data_1C9T
# 
_entry.id   1C9T 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1C9T         
RCSB  RCSB009470   
WWPDB D_1000009470 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1C9T 
_pdbx_database_status.recvd_initial_deposition_date   1999-08-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rester, U.'    1 
'Bode, W.'      2 
'Moser, M.'     3 
'Parry, M.A.'   4 
'Huber, R.'     5 
'Auerswald, E.' 6 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Structure of the complex of the antistasin-type inhibitor bdellastasin with trypsin and modelling of the bdellastasin-microplasmin system.
;
J.Mol.Biol.                293 93  106 1999 JMOBAK UK 0022-2836 0070 ? 10512718 10.1006/jmbi.1999.3162             
1       
;Bdellastasin, a serine protease inhibitor of the antistasin family from the medical leech (Hirudo medicinalis)-primary structure, expression in yeast, and characterisation of native and recombinant inhibitor
;
Eur.J.Biochem.             253 212 220 1998 EJBCAI IX 0014-2956 0262 ? ?        10.1046/j.1432-1327.1998.2530212.x 
2       'L-Isoaspartate 115 of porcine beta-trypsin promotes crystallization of its complex with bdellastasin' 
'Acta Crystallogr.,Sect.D' 56  581 588 2000 ABCRE6 DK 0907-4449 0766 ? ?        10.1107/S0907444900003048          
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rester, U.'     1  
primary 'Bode, W.'       2  
primary 'Moser, M.'      3  
primary 'Parry, M.A.'    4  
primary 'Huber, R.'      5  
primary 'Auerswald, E.'  6  
1       'Moser, M.'      7  
1       'Auerswald, E.'  8  
1       'Mentele, R.'    9  
1       'Eckerskorn, C.' 10 
1       'Fritz, E.'      11 
1       'Fink, H.'       12 
2       'Rester, U.'     13 
2       'Moser, M.'      14 
2       'Huber, R.'      15 
2       'Bode, W.'       16 
# 
_cell.entry_id           1C9T 
_cell.length_a           95.22 
_cell.length_b           108.78 
_cell.length_c           95.71 
_cell.angle_alpha        90 
_cell.angle_beta         93.7 
_cell.angle_gamma        90 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1C9T 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     monoclinic 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat TRYPSIN      23324.287 6   3.4.21.4 ? ? ? 
2 polymer man BDELLASTASIN 6351.208  6   ?        ? ? ? 
3 water   nat water        18.015    146 ?        ? ? ? 
# 
_entity_name_sys.entity_id   1 
_entity_name_sys.name        E.C.3.4.21.4 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT
LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM
FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
;
;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT
LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM
FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
;
A,B,C,D,E,F ? 
2 'polypeptide(L)' no no FDVNSHTTPCGPVTCSGAQMCEVDKCVCSDLHCKVKCEHGFKKDDNGCEYACICADAPQ 
FDVNSHTTPCGPVTCSGAQMCEVDKCVCSDLHCKVKCEHGFKKDDNGCEYACICADAPQ G,H,I,J,K,L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   VAL n 
1 3   GLY n 
1 4   GLY n 
1 5   TYR n 
1 6   THR n 
1 7   CYS n 
1 8   GLY n 
1 9   ALA n 
1 10  ASN n 
1 11  THR n 
1 12  VAL n 
1 13  PRO n 
1 14  TYR n 
1 15  GLN n 
1 16  VAL n 
1 17  SER n 
1 18  LEU n 
1 19  ASN n 
1 20  SER n 
1 21  GLY n 
1 22  TYR n 
1 23  HIS n 
1 24  PHE n 
1 25  CYS n 
1 26  GLY n 
1 27  GLY n 
1 28  SER n 
1 29  LEU n 
1 30  ILE n 
1 31  ASN n 
1 32  SER n 
1 33  GLN n 
1 34  TRP n 
1 35  VAL n 
1 36  VAL n 
1 37  SER n 
1 38  ALA n 
1 39  ALA n 
1 40  HIS n 
1 41  CYS n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  GLY n 
1 46  ILE n 
1 47  GLN n 
1 48  VAL n 
1 49  ARG n 
1 50  LEU n 
1 51  GLY n 
1 52  GLU n 
1 53  ASP n 
1 54  ASN n 
1 55  ILE n 
1 56  ASN n 
1 57  VAL n 
1 58  VAL n 
1 59  GLU n 
1 60  GLY n 
1 61  ASN n 
1 62  GLU n 
1 63  GLN n 
1 64  PHE n 
1 65  ILE n 
1 66  SER n 
1 67  ALA n 
1 68  SER n 
1 69  LYS n 
1 70  SER n 
1 71  ILE n 
1 72  VAL n 
1 73  HIS n 
1 74  PRO n 
1 75  SER n 
1 76  TYR n 
1 77  ASN n 
1 78  SER n 
1 79  ASN n 
1 80  THR n 
1 81  LEU n 
1 82  ASN n 
1 83  ASN n 
1 84  ASP n 
1 85  ILE n 
1 86  MET n 
1 87  LEU n 
1 88  ILE n 
1 89  LYS n 
1 90  LEU n 
1 91  LYS n 
1 92  SER n 
1 93  ALA n 
1 94  ALA n 
1 95  SER n 
1 96  LEU n 
1 97  ASN n 
1 98  SER n 
1 99  ARG n 
1 100 VAL n 
1 101 ALA n 
1 102 SER n 
1 103 ILE n 
1 104 SER n 
1 105 LEU n 
1 106 PRO n 
1 107 THR n 
1 108 SER n 
1 109 CYS n 
1 110 ALA n 
1 111 SER n 
1 112 ALA n 
1 113 GLY n 
1 114 THR n 
1 115 GLN n 
1 116 CYS n 
1 117 LEU n 
1 118 ILE n 
1 119 SER n 
1 120 GLY n 
1 121 TRP n 
1 122 GLY n 
1 123 ASN n 
1 124 THR n 
1 125 LYS n 
1 126 SER n 
1 127 SER n 
1 128 GLY n 
1 129 THR n 
1 130 SER n 
1 131 TYR n 
1 132 PRO n 
1 133 ASP n 
1 134 VAL n 
1 135 LEU n 
1 136 LYS n 
1 137 CYS n 
1 138 LEU n 
1 139 LYS n 
1 140 ALA n 
1 141 PRO n 
1 142 ILE n 
1 143 LEU n 
1 144 SER n 
1 145 ASP n 
1 146 SER n 
1 147 SER n 
1 148 CYS n 
1 149 LYS n 
1 150 SER n 
1 151 ALA n 
1 152 TYR n 
1 153 PRO n 
1 154 GLY n 
1 155 GLN n 
1 156 ILE n 
1 157 THR n 
1 158 SER n 
1 159 ASN n 
1 160 MET n 
1 161 PHE n 
1 162 CYS n 
1 163 ALA n 
1 164 GLY n 
1 165 TYR n 
1 166 LEU n 
1 167 GLU n 
1 168 GLY n 
1 169 GLY n 
1 170 LYS n 
1 171 ASP n 
1 172 SER n 
1 173 CYS n 
1 174 GLN n 
1 175 GLY n 
1 176 ASP n 
1 177 SER n 
1 178 GLY n 
1 179 GLY n 
1 180 PRO n 
1 181 VAL n 
1 182 VAL n 
1 183 CYS n 
1 184 SER n 
1 185 GLY n 
1 186 LYS n 
1 187 LEU n 
1 188 GLN n 
1 189 GLY n 
1 190 ILE n 
1 191 VAL n 
1 192 SER n 
1 193 TRP n 
1 194 GLY n 
1 195 SER n 
1 196 GLY n 
1 197 CYS n 
1 198 ALA n 
1 199 GLN n 
1 200 LYS n 
1 201 ASN n 
1 202 LYS n 
1 203 PRO n 
1 204 GLY n 
1 205 VAL n 
1 206 TYR n 
1 207 THR n 
1 208 LYS n 
1 209 VAL n 
1 210 CYS n 
1 211 ASN n 
1 212 TYR n 
1 213 VAL n 
1 214 SER n 
1 215 TRP n 
1 216 ILE n 
1 217 LYS n 
1 218 GLN n 
1 219 THR n 
1 220 ILE n 
1 221 ALA n 
1 222 SER n 
1 223 ASN n 
2 1   PHE n 
2 2   ASP n 
2 3   VAL n 
2 4   ASN n 
2 5   SER n 
2 6   HIS n 
2 7   THR n 
2 8   THR n 
2 9   PRO n 
2 10  CYS n 
2 11  GLY n 
2 12  PRO n 
2 13  VAL n 
2 14  THR n 
2 15  CYS n 
2 16  SER n 
2 17  GLY n 
2 18  ALA n 
2 19  GLN n 
2 20  MET n 
2 21  CYS n 
2 22  GLU n 
2 23  VAL n 
2 24  ASP n 
2 25  LYS n 
2 26  CYS n 
2 27  VAL n 
2 28  CYS n 
2 29  SER n 
2 30  ASP n 
2 31  LEU n 
2 32  HIS n 
2 33  CYS n 
2 34  LYS n 
2 35  VAL n 
2 36  LYS n 
2 37  CYS n 
2 38  GLU n 
2 39  HIS n 
2 40  GLY n 
2 41  PHE n 
2 42  LYS n 
2 43  LYS n 
2 44  ASP n 
2 45  ASP n 
2 46  ASN n 
2 47  GLY n 
2 48  CYS n 
2 49  GLU n 
2 50  TYR n 
2 51  ALA n 
2 52  CYS n 
2 53  ILE n 
2 54  CYS n 
2 55  ALA n 
2 56  ASP n 
2 57  ALA n 
2 58  PRO n 
2 59  GLN n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'medicinal leech' 
_entity_src_gen.gene_src_genus                     Hirudo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Hirudo medicinalis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     6421 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               
;baker's yeast
;
_entity_src_gen.pdbx_host_org_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4932 
_entity_src_gen.host_org_genus                     Saccharomyces 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                cattle 
_entity_src_nat.pdbx_organism_scientific   'Bos taurus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9913 
_entity_src_nat.genus                      Bos 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             SALIVA 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP    TRY1_BOVIN 1 P00760 ? ? ? 
2 TREMBL P82107     2 P82107 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1C9T A 1 ? 223 ? P00760 21 ? 243 ? 16 245 
2  1 1C9T B 1 ? 223 ? P00760 21 ? 243 ? 16 245 
3  1 1C9T C 1 ? 223 ? P00760 21 ? 243 ? 16 245 
4  1 1C9T D 1 ? 223 ? P00760 21 ? 243 ? 16 245 
5  1 1C9T E 1 ? 223 ? P00760 21 ? 243 ? 16 245 
6  1 1C9T F 1 ? 223 ? P00760 21 ? 243 ? 16 245 
7  2 1C9T G 1 ? 59  ? P82107 1  ? 59  ? 1  59  
8  2 1C9T H 1 ? 59  ? P82107 1  ? 59  ? 1  59  
9  2 1C9T I 1 ? 59  ? P82107 1  ? 59  ? 1  59  
10 2 1C9T J 1 ? 59  ? P82107 1  ? 59  ? 1  59  
11 2 1C9T K 1 ? 59  ? P82107 1  ? 59  ? 1  59  
12 2 1C9T L 1 ? 59  ? P82107 1  ? 59  ? 1  59  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1C9T 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
loop_
_exptl_crystal.id 
_exptl_crystal.density_meas 
_exptl_crystal.density_Matthews 
_exptl_crystal.density_percent_sol 
_exptl_crystal.description 
1 ? 2.78 55.71 ? 
2 ? ?    ?     ? 
# 
loop_
_exptl_crystal_grow.crystal_id 
_exptl_crystal_grow.method 
_exptl_crystal_grow.temp 
_exptl_crystal_grow.temp_details 
_exptl_crystal_grow.pH 
_exptl_crystal_grow.pdbx_details 
_exptl_crystal_grow.pdbx_pH_range 
1 'VAPOR DIFFUSION, SITTING DROP' 293 ? 5.6 
'50MM MES, 2.0M AMMONIUM SULFATE, 10MM MAGNESIM CHLORIDE, pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 293K' ? 
2 'VAPOR DIFFUSION, SITTING DROP' 293 ? 5.6 
'50MM MES, 2.2M AMMONIUM SULFATE, 10MM MAGNESIM CHLORIDE, pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 293K' ? 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 277 ? 1 
2 277 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 'IMAGE PLATE' MARRESEARCH 1997-04-17 ? 
2 'IMAGE PLATE' MARRESEARCH 1997-10-19 ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M ? 'SINGLE WAVELENGTH' x-ray 
2 2 M ? 'SINGLE WAVELENGTH' x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.5418 1.0 
2 .      1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 'ROTATING ANODE' 'RIGAKU RU200' ? ? 1.5418 ? 
2 'ROTATING ANODE' 'RIGAKU RU200' ? ? 1.5418 ? 
# 
_reflns.entry_id                     1C9T 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             47.0 
_reflns.d_resolution_high            3.3 
_reflns.number_obs                   52903 
_reflns.number_all                   52903 
_reflns.percent_possible_obs         81.2 
_reflns.pdbx_Rmerge_I_obs            0.11 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        4.3 
_reflns.B_iso_Wilson_estimate        55.5 
_reflns.pdbx_redundancy              2.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1,2 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.3 
_reflns_shell.d_res_low              3.42 
_reflns_shell.percent_possible_all   77.0 
_reflns_shell.Rmerge_I_obs           0.29 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        1.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1C9T 
_refine.ls_number_reflns_obs                     21951 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          2.0 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.0 
_refine.ls_d_res_high                            3.3 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.208 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.208 
_refine.ls_R_factor_R_free                       0.287 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.7 
_refine.ls_number_reflns_R_free                  2351 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        12078 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             146 
_refine_hist.number_atoms_total               12224 
_refine_hist.d_res_high                       3.3 
_refine_hist.d_res_low                        8.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1C9T 
_struct.title                     'COMPLEX OF BDELLASTASIN WITH BOVINE TRYPSIN' 
_struct.pdbx_descriptor           'TRYPSIN/BDELLASTASIN COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1C9T 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
_struct_keywords.text            
'COMPLEX (HYDROLASE-INHIBITOR), HYDROLASE, INHIBITOR, ANTISTASIN, PLASMIN, HYDROLASE-HYDROLASE INHIBITOR COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
M N N 3 ? 
N N N 3 ? 
O N N 3 ? 
P N N 3 ? 
Q N N 3 ? 
R N N 3 ? 
S N N 3 ? 
# 
loop_
_struct_biol.id 
1 
2 
3 
4 
5 
6 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 38  ? TYR A 42  ? ALA A 55  TYR A 59  5 ? 5  
HELX_P HELX_P2  2  SER A 144 ? TYR A 152 ? SER A 164 TYR A 172 1 ? 9  
HELX_P HELX_P3  3  TYR A 212 ? ASN A 223 ? TYR A 234 ASN A 245 1 ? 12 
HELX_P HELX_P4  4  ALA B 38  ? TYR B 42  ? ALA B 55  TYR B 59  5 ? 5  
HELX_P HELX_P5  5  SER B 144 ? TYR B 152 ? SER B 164 TYR B 172 1 ? 9  
HELX_P HELX_P6  6  TYR B 212 ? ASN B 223 ? TYR B 234 ASN B 245 1 ? 12 
HELX_P HELX_P7  7  ALA C 38  ? TYR C 42  ? ALA C 55  TYR C 59  5 ? 5  
HELX_P HELX_P8  8  SER C 144 ? TYR C 152 ? SER C 164 TYR C 172 1 ? 9  
HELX_P HELX_P9  9  TYR C 212 ? ASN C 223 ? TYR C 234 ASN C 245 1 ? 12 
HELX_P HELX_P10 10 ALA D 38  ? TYR D 42  ? ALA D 55  TYR D 59  5 ? 5  
HELX_P HELX_P11 11 SER D 144 ? TYR D 152 ? SER D 164 TYR D 172 1 ? 9  
HELX_P HELX_P12 12 TYR D 212 ? ASN D 223 ? TYR D 234 ASN D 245 1 ? 12 
HELX_P HELX_P13 13 ALA E 38  ? TYR E 42  ? ALA E 55  TYR E 59  5 ? 5  
HELX_P HELX_P14 14 SER E 144 ? TYR E 152 ? SER E 164 TYR E 172 1 ? 9  
HELX_P HELX_P15 15 VAL E 209 ? ASN E 223 ? VAL E 231 ASN E 245 1 ? 15 
HELX_P HELX_P16 16 ALA F 38  ? TYR F 42  ? ALA F 55  TYR F 59  5 ? 5  
HELX_P HELX_P17 17 SER F 144 ? TYR F 152 ? SER F 164 TYR F 172 1 ? 9  
HELX_P HELX_P18 18 VAL F 209 ? ASN F 223 ? VAL F 231 ASN F 245 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 7   SG ? ? ? 1_555 A CYS 137 SG ? ? A CYS 22  A CYS 157 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf2  disulf ? ? A CYS 25  SG ? ? ? 1_555 A CYS 41  SG ? ? A CYS 42  A CYS 58  1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf3  disulf ? ? A CYS 109 SG ? ? ? 1_555 A CYS 210 SG ? ? A CYS 128 A CYS 232 1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf4  disulf ? ? A CYS 116 SG ? ? ? 1_555 A CYS 183 SG ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 2.010 ? 
disulf5  disulf ? ? A CYS 148 SG ? ? ? 1_555 A CYS 162 SG ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 2.015 ? 
disulf6  disulf ? ? A CYS 173 SG ? ? ? 1_555 A CYS 197 SG ? ? A CYS 191 A CYS 220 1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf7  disulf ? ? B CYS 7   SG ? ? ? 1_555 B CYS 137 SG ? ? B CYS 22  B CYS 157 1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf8  disulf ? ? B CYS 25  SG ? ? ? 1_555 B CYS 41  SG ? ? B CYS 42  B CYS 58  1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf9  disulf ? ? B CYS 109 SG ? ? ? 1_555 B CYS 210 SG ? ? B CYS 128 B CYS 232 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf10 disulf ? ? B CYS 116 SG ? ? ? 1_555 B CYS 183 SG ? ? B CYS 136 B CYS 201 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf11 disulf ? ? B CYS 148 SG ? ? ? 1_555 B CYS 162 SG ? ? B CYS 168 B CYS 182 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf12 disulf ? ? B CYS 173 SG ? ? ? 1_555 B CYS 197 SG ? ? B CYS 191 B CYS 220 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf13 disulf ? ? C CYS 7   SG ? ? ? 1_555 C CYS 137 SG ? ? C CYS 22  C CYS 157 1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf14 disulf ? ? C CYS 25  SG ? ? ? 1_555 C CYS 41  SG ? ? C CYS 42  C CYS 58  1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf15 disulf ? ? C CYS 109 SG ? ? ? 1_555 C CYS 210 SG ? ? C CYS 128 C CYS 232 1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf16 disulf ? ? C CYS 116 SG ? ? ? 1_555 C CYS 183 SG ? ? C CYS 136 C CYS 201 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf17 disulf ? ? C CYS 148 SG ? ? ? 1_555 C CYS 162 SG ? ? C CYS 168 C CYS 182 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf18 disulf ? ? C CYS 173 SG ? ? ? 1_555 C CYS 197 SG ? ? C CYS 191 C CYS 220 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf19 disulf ? ? D CYS 7   SG ? ? ? 1_555 D CYS 137 SG ? ? D CYS 22  D CYS 157 1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf20 disulf ? ? D CYS 25  SG ? ? ? 1_555 D CYS 41  SG ? ? D CYS 42  D CYS 58  1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf21 disulf ? ? D CYS 109 SG ? ? ? 1_555 D CYS 210 SG ? ? D CYS 128 D CYS 232 1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf22 disulf ? ? D CYS 116 SG ? ? ? 1_555 D CYS 183 SG ? ? D CYS 136 D CYS 201 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf23 disulf ? ? D CYS 148 SG ? ? ? 1_555 D CYS 162 SG ? ? D CYS 168 D CYS 182 1_555 ? ? ? ? ? ? ? 2.026 ? 
disulf24 disulf ? ? D CYS 173 SG ? ? ? 1_555 D CYS 197 SG ? ? D CYS 191 D CYS 220 1_555 ? ? ? ? ? ? ? 2.016 ? 
disulf25 disulf ? ? E CYS 7   SG ? ? ? 1_555 E CYS 137 SG ? ? E CYS 22  E CYS 157 1_555 ? ? ? ? ? ? ? 2.011 ? 
disulf26 disulf ? ? E CYS 25  SG ? ? ? 1_555 E CYS 41  SG ? ? E CYS 42  E CYS 58  1_555 ? ? ? ? ? ? ? 2.017 ? 
disulf27 disulf ? ? E CYS 109 SG ? ? ? 1_555 E CYS 210 SG ? ? E CYS 128 E CYS 232 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf28 disulf ? ? E CYS 116 SG ? ? ? 1_555 E CYS 183 SG ? ? E CYS 136 E CYS 201 1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf29 disulf ? ? E CYS 148 SG ? ? ? 1_555 E CYS 162 SG ? ? E CYS 168 E CYS 182 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf30 disulf ? ? E CYS 173 SG ? ? ? 1_555 E CYS 197 SG ? ? E CYS 191 E CYS 220 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf31 disulf ? ? F CYS 7   SG ? ? ? 1_555 F CYS 137 SG ? ? F CYS 22  F CYS 157 1_555 ? ? ? ? ? ? ? 2.013 ? 
disulf32 disulf ? ? F CYS 25  SG ? ? ? 1_555 F CYS 41  SG ? ? F CYS 42  F CYS 58  1_555 ? ? ? ? ? ? ? 2.026 ? 
disulf33 disulf ? ? F CYS 109 SG ? ? ? 1_555 F CYS 210 SG ? ? F CYS 128 F CYS 232 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf34 disulf ? ? F CYS 116 SG ? ? ? 1_555 F CYS 183 SG ? ? F CYS 136 F CYS 201 1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf35 disulf ? ? F CYS 148 SG ? ? ? 1_555 F CYS 162 SG ? ? F CYS 168 F CYS 182 1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf36 disulf ? ? F CYS 173 SG ? ? ? 1_555 F CYS 197 SG ? ? F CYS 191 F CYS 220 1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf37 disulf ? ? G CYS 10  SG ? ? ? 1_555 G CYS 21  SG ? ? G CYS 10  G CYS 21  1_555 ? ? ? ? ? ? ? 2.009 ? 
disulf38 disulf ? ? G CYS 15  SG ? ? ? 1_555 G CYS 26  SG ? ? G CYS 15  G CYS 26  1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf39 disulf ? ? G CYS 28  SG ? ? ? 1_555 G CYS 48  SG ? ? G CYS 28  G CYS 48  1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf40 disulf ? ? G CYS 33  SG ? ? ? 1_555 G CYS 52  SG ? ? G CYS 33  G CYS 52  1_555 ? ? ? ? ? ? ? 2.019 ? 
disulf41 disulf ? ? G CYS 37  SG ? ? ? 1_555 G CYS 54  SG ? ? G CYS 37  G CYS 54  1_555 ? ? ? ? ? ? ? 2.014 ? 
disulf42 disulf ? ? H CYS 10  SG ? ? ? 1_555 H CYS 21  SG ? ? H CYS 10  H CYS 21  1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf43 disulf ? ? H CYS 15  SG ? ? ? 1_555 H CYS 26  SG ? ? H CYS 15  H CYS 26  1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf44 disulf ? ? H CYS 28  SG ? ? ? 1_555 H CYS 48  SG ? ? H CYS 28  H CYS 48  1_555 ? ? ? ? ? ? ? 2.018 ? 
disulf45 disulf ? ? H CYS 33  SG ? ? ? 1_555 H CYS 52  SG ? ? H CYS 33  H CYS 52  1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf46 disulf ? ? H CYS 37  SG ? ? ? 1_555 H CYS 54  SG ? ? H CYS 37  H CYS 54  1_555 ? ? ? ? ? ? ? 2.026 ? 
disulf47 disulf ? ? I CYS 10  SG ? ? ? 1_555 I CYS 21  SG ? ? I CYS 10  I CYS 21  1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf48 disulf ? ? I CYS 15  SG ? ? ? 1_555 I CYS 26  SG ? ? I CYS 15  I CYS 26  1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf49 disulf ? ? I CYS 28  SG ? ? ? 1_555 I CYS 48  SG ? ? I CYS 28  I CYS 48  1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf50 disulf ? ? I CYS 33  SG ? ? ? 1_555 I CYS 52  SG ? ? I CYS 33  I CYS 52  1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf51 disulf ? ? I CYS 37  SG ? ? ? 1_555 I CYS 54  SG ? ? I CYS 37  I CYS 54  1_555 ? ? ? ? ? ? ? 2.017 ? 
disulf52 disulf ? ? J CYS 10  SG ? ? ? 1_555 J CYS 21  SG ? ? J CYS 10  J CYS 21  1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf53 disulf ? ? J CYS 15  SG ? ? ? 1_555 J CYS 26  SG ? ? J CYS 15  J CYS 26  1_555 ? ? ? ? ? ? ? 2.015 ? 
disulf54 disulf ? ? J CYS 28  SG ? ? ? 1_555 J CYS 48  SG ? ? J CYS 28  J CYS 48  1_555 ? ? ? ? ? ? ? 2.018 ? 
disulf55 disulf ? ? J CYS 33  SG ? ? ? 1_555 J CYS 52  SG ? ? J CYS 33  J CYS 52  1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf56 disulf ? ? J CYS 37  SG ? ? ? 1_555 J CYS 54  SG ? ? J CYS 37  J CYS 54  1_555 ? ? ? ? ? ? ? 2.016 ? 
disulf57 disulf ? ? K CYS 10  SG ? ? ? 1_555 K CYS 21  SG ? ? K CYS 10  K CYS 21  1_555 ? ? ? ? ? ? ? 2.019 ? 
disulf58 disulf ? ? K CYS 15  SG ? ? ? 1_555 K CYS 26  SG ? ? K CYS 15  K CYS 26  1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf59 disulf ? ? K CYS 28  SG ? ? ? 1_555 K CYS 48  SG ? ? K CYS 28  K CYS 48  1_555 ? ? ? ? ? ? ? 2.010 ? 
disulf60 disulf ? ? K CYS 33  SG ? ? ? 1_555 K CYS 52  SG ? ? K CYS 33  K CYS 52  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf61 disulf ? ? K CYS 37  SG ? ? ? 1_555 K CYS 54  SG ? ? K CYS 37  K CYS 54  1_555 ? ? ? ? ? ? ? 2.017 ? 
disulf62 disulf ? ? L CYS 10  SG ? ? ? 1_555 L CYS 21  SG ? ? L CYS 10  L CYS 21  1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf63 disulf ? ? L CYS 15  SG ? ? ? 1_555 L CYS 26  SG ? ? L CYS 15  L CYS 26  1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf64 disulf ? ? L CYS 28  SG ? ? ? 1_555 L CYS 48  SG ? ? L CYS 28  L CYS 48  1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf65 disulf ? ? L CYS 33  SG ? ? ? 1_555 L CYS 52  SG ? ? L CYS 33  L CYS 52  1_555 ? ? ? ? ? ? ? 2.013 ? 
disulf66 disulf ? ? L CYS 37  SG ? ? ? 1_555 L CYS 54  SG ? ? L CYS 37  L CYS 54  1_555 ? ? ? ? ? ? ? 2.015 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 7 ? 
A1 ? 4 ? 
B  ? 7 ? 
C  ? 7 ? 
C1 ? 4 ? 
D  ? 7 ? 
E  ? 7 ? 
E1 ? 4 ? 
F  ? 7 ? 
G  ? 7 ? 
G1 ? 4 ? 
H  ? 7 ? 
I  ? 7 ? 
I1 ? 4 ? 
J  ? 7 ? 
K  ? 7 ? 
K1 ? 4 ? 
L  ? 7 ? 
M  ? 2 ? 
N  ? 2 ? 
O  ? 2 ? 
P  ? 2 ? 
Q  ? 2 ? 
R  ? 2 ? 
S  ? 2 ? 
T  ? 2 ? 
U  ? 2 ? 
V  ? 2 ? 
W  ? 2 ? 
X  ? 2 ? 
Y  ? 2 ? 
Z  ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
A  4 5 ? anti-parallel 
A  5 6 ? anti-parallel 
A  6 7 ? anti-parallel 
A1 1 2 ? anti-parallel 
A1 2 3 ? anti-parallel 
A1 3 4 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B  4 5 ? anti-parallel 
B  5 6 ? anti-parallel 
B  6 7 ? anti-parallel 
C  2 3 ? anti-parallel 
C  3 4 ? anti-parallel 
C  4 5 ? anti-parallel 
C  5 6 ? anti-parallel 
C  6 7 ? anti-parallel 
C1 1 2 ? anti-parallel 
C1 2 3 ? anti-parallel 
C1 3 4 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
D  4 5 ? anti-parallel 
D  5 6 ? anti-parallel 
D  6 7 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
E  4 5 ? anti-parallel 
E  5 6 ? anti-parallel 
E  6 7 ? anti-parallel 
E1 1 2 ? anti-parallel 
E1 2 3 ? anti-parallel 
E1 3 4 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
F  4 5 ? anti-parallel 
F  5 6 ? anti-parallel 
F  6 7 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
G  4 5 ? anti-parallel 
G  5 6 ? anti-parallel 
G  6 7 ? anti-parallel 
G1 1 2 ? anti-parallel 
G1 2 3 ? anti-parallel 
G1 3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
H  4 5 ? anti-parallel 
H  5 6 ? anti-parallel 
H  6 7 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
I  3 4 ? anti-parallel 
I  4 5 ? anti-parallel 
I  5 6 ? anti-parallel 
I  6 7 ? anti-parallel 
I1 1 2 ? anti-parallel 
I1 2 3 ? anti-parallel 
I1 3 4 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
J  3 4 ? anti-parallel 
J  4 5 ? anti-parallel 
J  5 6 ? anti-parallel 
J  6 7 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
K  4 5 ? anti-parallel 
K  5 6 ? anti-parallel 
K  6 7 ? anti-parallel 
K1 1 2 ? anti-parallel 
K1 2 3 ? anti-parallel 
K1 3 4 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
L  4 5 ? anti-parallel 
L  5 6 ? anti-parallel 
L  6 7 ? anti-parallel 
M  1 2 ? anti-parallel 
N  1 2 ? anti-parallel 
O  1 2 ? anti-parallel 
P  1 2 ? anti-parallel 
Q  1 2 ? anti-parallel 
R  1 2 ? anti-parallel 
S  1 2 ? anti-parallel 
T  1 2 ? anti-parallel 
U  1 2 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
X  1 2 ? anti-parallel 
Y  1 2 ? anti-parallel 
Z  1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 PHE K 41  ? LYS K 43  ? PHE K 41  LYS K 43  
A  2 GLU K 49  ? CYS K 54  ? GLU K 49  CYS K 54  
A  3 LYS A 186 ? SER A 195 ? LYS A 204 SER A 217 
A  4 PRO A 180 ? CYS A 183 ? PRO A 198 CYS A 201 
A  5 GLN A 115 ? GLY A 120 ? GLN A 135 GLY A 140 
A  6 LYS A 136 ? PRO A 141 ? LYS A 156 PRO A 161 
A  7 TYR A 5   ? THR A 6   ? TYR A 20  THR A 21  
A1 1 MET A 160 ? ALA A 163 ? MET A 180 ALA A 183 
A1 2 GLY A 204 ? LYS A 208 ? GLY A 226 LYS A 230 
A1 3 LYS A 186 ? SER A 195 ? LYS A 204 SER A 217 
A1 4 LEU G 31  ? CYS G 33  ? LEU G 31  CYS G 33  
B  1 THR L 8   ? CYS L 10  ? THR L 8   CYS L 10  
B  2 VAL L 13  ? CYS L 15  ? VAL L 13  CYS L 15  
B  3 GLN A 15  ? ASN A 19  ? GLN A 30  ASN A 34  
B  4 GLN A 47  ? LEU A 50  ? GLN A 64  LEU A 67  
B  5 GLN A 63  ? VAL A 72  ? GLN A 81  VAL A 90  
B  6 MET A 86  ? LEU A 90  ? MET A 104 LEU A 108 
B  7 TRP A 34  ? SER A 37  ? TRP A 51  SER A 54  
C  1 GLN L 19  ? GLU L 22  ? GLN L 19  GLU L 22  
C  2 LYS L 25  ? CYS L 28  ? LYS L 25  CYS L 28  
C  3 LYS B 186 ? SER B 195 ? LYS B 204 SER B 217 
C  4 PRO B 180 ? CYS B 183 ? PRO B 198 CYS B 201 
C  5 GLN B 115 ? GLY B 120 ? GLN B 135 GLY B 140 
C  6 LYS B 136 ? PRO B 141 ? LYS B 156 PRO B 161 
C  7 TYR B 5   ? THR B 6   ? TYR B 20  THR B 21  
C1 1 MET B 160 ? ALA B 163 ? MET B 180 ALA B 183 
C1 2 GLY B 204 ? LYS B 208 ? GLY B 226 LYS B 230 
C1 3 LYS B 186 ? SER B 195 ? LYS B 204 SER B 217 
C1 4 LEU H 31  ? CYS H 33  ? LEU H 31  CYS H 33  
D  1 PHE L 41  ? LYS L 43  ? PHE L 41  LYS L 43  
D  2 GLU L 49  ? CYS L 54  ? GLU L 49  CYS L 54  
D  3 GLN B 15  ? ASN B 19  ? GLN B 30  ASN B 34  
D  4 GLN B 47  ? LEU B 50  ? GLN B 64  LEU B 67  
D  5 GLN B 63  ? VAL B 72  ? GLN B 81  VAL B 90  
D  6 MET B 86  ? LEU B 90  ? MET B 104 LEU B 108 
D  7 TRP B 34  ? SER B 37  ? TRP B 51  SER B 54  
E  1 MET C 160 ? ALA C 163 ? MET C 180 ALA C 183 
E  2 GLY C 204 ? LYS C 208 ? GLY C 226 LYS C 230 
E  3 LYS C 186 ? SER C 195 ? LYS C 204 SER C 217 
E  4 PRO C 180 ? CYS C 183 ? PRO C 198 CYS C 201 
E  5 GLN C 115 ? GLY C 120 ? GLN C 135 GLY C 140 
E  6 LYS C 136 ? PRO C 141 ? LYS C 156 PRO C 161 
E  7 TYR C 5   ? THR C 6   ? TYR C 20  THR C 21  
E1 1 MET C 160 ? ALA C 163 ? MET C 180 ALA C 183 
E1 2 GLY C 204 ? LYS C 208 ? GLY C 226 LYS C 230 
E1 3 LYS C 186 ? SER C 195 ? LYS C 204 SER C 217 
E1 4 LEU I 31  ? CYS I 33  ? LEU I 31  CYS I 33  
F  1 GLN C 15  ? ASN C 19  ? GLN C 30  ASN C 34  
F  2 HIS C 23  ? ASN C 31  ? HIS C 40  ASN C 48  
F  3 GLN C 15  ? ASN C 19  ? GLN C 30  ASN C 34  
F  4 GLN C 47  ? LEU C 50  ? GLN C 64  LEU C 67  
F  5 GLN C 63  ? VAL C 72  ? GLN C 81  VAL C 90  
F  6 MET C 86  ? LEU C 90  ? MET C 104 LEU C 108 
F  7 TRP C 34  ? SER C 37  ? TRP C 51  SER C 54  
G  1 MET D 160 ? ALA D 163 ? MET D 180 ALA D 183 
G  2 GLY D 204 ? LYS D 208 ? GLY D 226 LYS D 230 
G  3 LYS D 186 ? SER D 195 ? LYS D 204 SER D 217 
G  4 PRO D 180 ? CYS D 183 ? PRO D 198 CYS D 201 
G  5 GLN D 115 ? GLY D 120 ? GLN D 135 GLY D 140 
G  6 LYS D 136 ? PRO D 141 ? LYS D 156 PRO D 161 
G  7 TYR D 5   ? THR D 6   ? TYR D 20  THR D 21  
G1 1 MET D 160 ? ALA D 163 ? MET D 180 ALA D 183 
G1 2 GLY D 204 ? LYS D 208 ? GLY D 226 LYS D 230 
G1 3 LYS D 186 ? SER D 195 ? LYS D 204 SER D 217 
G1 4 LEU J 31  ? CYS J 33  ? LEU J 31  CYS J 33  
H  1 GLN D 15  ? ASN D 19  ? GLN D 30  ASN D 34  
H  2 HIS D 23  ? ASN D 31  ? HIS D 40  ASN D 48  
H  3 GLN D 15  ? ASN D 19  ? GLN D 30  ASN D 34  
H  4 GLN D 47  ? LEU D 50  ? GLN D 64  LEU D 67  
H  5 GLN D 63  ? VAL D 72  ? GLN D 81  VAL D 90  
H  6 MET D 86  ? LEU D 90  ? MET D 104 LEU D 108 
H  7 TRP D 34  ? SER D 37  ? TRP D 51  SER D 54  
I  1 MET E 160 ? ALA E 163 ? MET E 180 ALA E 183 
I  2 GLY E 204 ? LYS E 208 ? GLY E 226 LYS E 230 
I  3 LYS E 186 ? SER E 195 ? LYS E 204 SER E 217 
I  4 PRO E 180 ? CYS E 183 ? PRO E 198 CYS E 201 
I  5 GLN E 115 ? GLY E 120 ? GLN E 135 GLY E 140 
I  6 LYS E 136 ? PRO E 141 ? LYS E 156 PRO E 161 
I  7 TYR E 5   ? THR E 6   ? TYR E 20  THR E 21  
I1 1 MET E 160 ? ALA E 163 ? MET E 180 ALA E 183 
I1 2 GLY E 204 ? LYS E 208 ? GLY E 226 LYS E 230 
I1 3 LYS E 186 ? SER E 195 ? LYS E 204 SER E 217 
I1 4 LEU K 31  ? CYS K 33  ? LEU K 31  CYS K 33  
J  1 GLN E 15  ? ASN E 19  ? GLN E 30  ASN E 34  
J  2 HIS E 23  ? ASN E 31  ? HIS E 40  ASN E 48  
J  3 GLN E 15  ? ASN E 19  ? GLN E 30  ASN E 34  
J  4 GLN E 47  ? LEU E 50  ? GLN E 64  LEU E 67  
J  5 GLN E 63  ? VAL E 72  ? GLN E 81  VAL E 90  
J  6 MET E 86  ? LEU E 90  ? MET E 104 LEU E 108 
J  7 TRP E 34  ? SER E 37  ? TRP E 51  SER E 54  
K  1 MET F 160 ? ALA F 163 ? MET F 180 ALA F 183 
K  2 GLY F 204 ? LYS F 208 ? GLY F 226 LYS F 230 
K  3 LYS F 186 ? SER F 195 ? LYS F 204 SER F 217 
K  4 PRO F 180 ? CYS F 183 ? PRO F 198 CYS F 201 
K  5 GLN F 115 ? GLY F 120 ? GLN F 135 GLY F 140 
K  6 LYS F 136 ? PRO F 141 ? LYS F 156 PRO F 161 
K  7 TYR F 5   ? THR F 6   ? TYR F 20  THR F 21  
K1 1 MET F 160 ? ALA F 163 ? MET F 180 ALA F 183 
K1 2 GLY F 204 ? LYS F 208 ? GLY F 226 LYS F 230 
K1 3 LYS F 186 ? SER F 195 ? LYS F 204 SER F 217 
K1 4 LEU L 31  ? CYS L 33  ? LEU L 31  CYS L 33  
L  1 GLN F 15  ? ASN F 19  ? GLN F 30  ASN F 34  
L  2 HIS F 23  ? ASN F 31  ? HIS F 40  ASN F 48  
L  3 GLN F 15  ? ASN F 19  ? GLN F 30  ASN F 34  
L  4 GLN F 47  ? LEU F 50  ? GLN F 64  LEU F 67  
L  5 GLN F 63  ? VAL F 72  ? GLN F 81  VAL F 90  
L  6 MET F 86  ? LEU F 90  ? MET F 104 LEU F 108 
L  7 TRP F 34  ? SER F 37  ? TRP F 51  SER F 54  
M  1 THR G 8   ? CYS G 10  ? THR G 8   CYS G 10  
M  2 VAL G 13  ? CYS G 15  ? VAL G 13  CYS G 15  
N  1 MET G 20  ? GLU G 22  ? MET G 20  GLU G 22  
N  2 LYS G 25  ? VAL G 27  ? LYS G 25  VAL G 27  
O  1 PHE G 41  ? LYS G 43  ? PHE G 41  LYS G 43  
O  2 GLU G 49  ? CYS G 54  ? GLU G 49  CYS G 54  
P  1 THR H 8   ? CYS H 10  ? THR H 8   CYS H 10  
P  2 VAL H 13  ? CYS H 15  ? VAL H 13  CYS H 15  
Q  1 MET H 20  ? GLU H 22  ? MET H 20  GLU H 22  
Q  2 LYS H 25  ? VAL H 27  ? LYS H 25  VAL H 27  
R  1 PHE H 41  ? LYS H 43  ? PHE H 41  LYS H 43  
R  2 GLU H 49  ? CYS H 54  ? GLU H 49  CYS H 54  
S  1 THR I 8   ? CYS I 10  ? THR I 8   CYS I 10  
S  2 VAL I 13  ? CYS I 15  ? VAL I 13  CYS I 15  
T  1 MET I 20  ? GLU I 22  ? MET I 20  GLU I 22  
T  2 LYS I 25  ? VAL I 27  ? LYS I 25  VAL I 27  
U  1 PHE I 41  ? LYS I 43  ? PHE I 41  LYS I 43  
U  2 GLU I 49  ? CYS I 54  ? GLU I 49  CYS I 54  
V  1 THR J 8   ? CYS J 10  ? THR J 8   CYS J 10  
V  2 VAL J 13  ? CYS J 15  ? VAL J 13  CYS J 15  
W  1 MET J 20  ? GLU J 22  ? MET J 20  GLU J 22  
W  2 LYS J 25  ? VAL J 27  ? LYS J 25  VAL J 27  
X  1 PHE J 41  ? LYS J 43  ? PHE J 41  LYS J 43  
X  2 GLU J 49  ? CYS J 54  ? GLU J 49  CYS J 54  
Y  1 THR K 8   ? CYS K 10  ? THR K 8   CYS K 10  
Y  2 VAL K 13  ? CYS K 15  ? VAL K 13  CYS K 15  
Z  1 GLN K 19  ? GLU K 22  ? GLN K 19  GLU K 22  
Z  2 LYS K 25  ? CYS K 28  ? LYS K 25  CYS K 28  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  2 3 N THR A 207 ? N THR A 229 O ILE A 190 ? O ILE A 212 
A  3 4 N GLN A 188 ? N GLN A 210 O VAL A 181 ? O VAL A 199 
A  4 5 O VAL A 182 ? O VAL A 200 N LEU A 117 ? N LEU A 137 
A  5 6 O GLY A 120 ? O GLY A 140 N LYS A 136 ? N LYS A 156 
A  6 7 N CYS A 137 ? N CYS A 157 O TYR A 5   ? O TYR A 20  
A1 1 2 N ALA A 163 ? N ALA A 183 O GLY A 204 ? O GLY A 226 
A1 2 3 N THR A 207 ? N THR A 229 O ILE A 190 ? O ILE A 212 
A1 3 4 O GLY A 194 ? O GLY A 216 N HIS G 32  ? N HIS G 32  
B  2 3 O GLY A 27  ? O GLY A 44  N VAL A 16  ? N VAL A 31  
B  3 4 N ASN A 19  ? N ASN A 34  O GLN A 47  ? O GLN A 64  
B  4 5 N LEU A 50  ? N LEU A 67  O GLN A 63  ? O GLN A 81  
B  5 6 O ILE A 71  ? O ILE A 89  N LEU A 87  ? N LEU A 105 
B  6 7 N ILE A 88  ? N ILE A 106 O VAL A 35  ? O VAL A 52  
C  2 3 N THR B 207 ? N THR B 229 O ILE B 190 ? O ILE B 212 
C  3 4 N GLN B 188 ? N GLN B 210 O VAL B 181 ? O VAL B 199 
C  4 5 O VAL B 182 ? O VAL B 200 N LEU B 117 ? N LEU B 137 
C  5 6 O GLY B 120 ? O GLY B 140 N LYS B 136 ? N LYS B 156 
C  6 7 N CYS B 137 ? N CYS B 157 O TYR B 5   ? O TYR B 20  
C1 1 2 N ALA B 163 ? N ALA B 183 O GLY B 204 ? O GLY B 226 
C1 2 3 N THR B 207 ? N THR B 229 O ILE B 190 ? O ILE B 212 
C1 3 4 O GLY B 194 ? O GLY B 216 N HIS H 32  ? N HIS H 32  
D  2 3 O GLY B 27  ? O GLY B 44  N VAL B 16  ? N VAL B 31  
D  3 4 N ASN B 19  ? N ASN B 34  O GLN B 47  ? O GLN B 64  
D  4 5 N LEU B 50  ? N LEU B 67  O GLN B 63  ? O GLN B 81  
D  5 6 N ILE B 71  ? N ILE B 89  O LEU B 87  ? O LEU B 105 
D  6 7 N ILE B 88  ? N ILE B 106 O VAL B 35  ? O VAL B 52  
E  1 2 N ALA C 163 ? N ALA C 183 O GLY C 204 ? O GLY C 226 
E  2 3 N THR C 207 ? N THR C 229 O ILE C 190 ? O ILE C 212 
E  3 4 N GLN C 188 ? N GLN C 210 O VAL C 181 ? O VAL C 199 
E  4 5 O VAL C 182 ? O VAL C 200 N LEU C 117 ? N LEU C 137 
E  5 6 O GLY C 120 ? O GLY C 140 N LYS C 136 ? N LYS C 156 
E  6 7 N CYS C 137 ? N CYS C 157 O TYR C 5   ? O TYR C 20  
E1 1 2 N ALA C 163 ? N ALA C 183 O GLY C 204 ? O GLY C 226 
E1 2 3 N THR C 207 ? N THR C 229 O ILE C 190 ? O ILE C 212 
E1 3 4 O GLY C 194 ? O GLY C 216 N HIS I 32  ? N HIS I 32  
F  1 2 O LEU C 18  ? O LEU C 33  N PHE C 24  ? N PHE C 41  
F  2 3 O GLY C 27  ? O GLY C 44  N VAL C 16  ? N VAL C 31  
F  3 4 N ASN C 19  ? N ASN C 34  O GLN C 47  ? O GLN C 64  
F  4 5 N LEU C 50  ? N LEU C 67  O GLN C 63  ? O GLN C 81  
F  5 6 O ILE C 71  ? O ILE C 89  N LEU C 87  ? N LEU C 105 
F  6 7 N ILE C 88  ? N ILE C 106 O VAL C 35  ? O VAL C 52  
G  1 2 N ALA D 163 ? N ALA D 183 O GLY D 204 ? O GLY D 226 
G  2 3 N THR D 207 ? N THR D 229 O ILE D 190 ? O ILE D 212 
G  3 4 N GLN D 188 ? N GLN D 210 O VAL D 181 ? O VAL D 199 
G  4 5 O VAL D 182 ? O VAL D 200 N LEU D 117 ? N LEU D 137 
G  5 6 O GLY D 120 ? O GLY D 140 N LYS D 136 ? N LYS D 156 
G  6 7 N CYS D 137 ? N CYS D 157 O TYR D 5   ? O TYR D 20  
G1 1 2 N ALA D 163 ? N ALA D 183 O GLY D 204 ? O GLY D 226 
G1 2 3 N THR D 207 ? N THR D 229 O ILE D 190 ? O ILE D 212 
G1 3 4 O GLY D 194 ? O GLY D 216 N HIS J 32  ? N HIS J 32  
H  1 2 O LEU D 18  ? O LEU D 33  N PHE D 24  ? N PHE D 41  
H  2 3 O GLY D 27  ? O GLY D 44  N VAL D 16  ? N VAL D 31  
H  3 4 N ASN D 19  ? N ASN D 34  O GLN D 47  ? O GLN D 64  
H  4 5 N LEU D 50  ? N LEU D 67  O GLN D 63  ? O GLN D 81  
H  5 6 O ILE D 71  ? O ILE D 89  N LEU D 87  ? N LEU D 105 
H  6 7 O ILE D 88  ? O ILE D 106 N VAL D 35  ? N VAL D 52  
I  1 2 N ALA E 163 ? N ALA E 183 O GLY E 204 ? O GLY E 226 
I  2 3 N THR E 207 ? N THR E 229 O ILE E 190 ? O ILE E 212 
I  3 4 N GLN E 188 ? N GLN E 210 O VAL E 181 ? O VAL E 199 
I  4 5 O VAL E 182 ? O VAL E 200 N LEU E 117 ? N LEU E 137 
I  5 6 O GLY E 120 ? O GLY E 140 N LYS E 136 ? N LYS E 156 
I  6 7 N CYS E 137 ? N CYS E 157 O TYR E 5   ? O TYR E 20  
I1 1 2 N ALA E 163 ? N ALA E 183 O GLY E 204 ? O GLY E 226 
I1 2 3 N THR E 207 ? N THR E 229 O ILE E 190 ? O ILE E 212 
I1 3 4 O GLY E 194 ? O GLY E 216 N HIS K 32  ? N HIS K 32  
J  1 2 O LEU E 18  ? O LEU E 33  N PHE E 24  ? N PHE E 41  
J  2 3 O GLY E 27  ? O GLY E 44  N VAL E 16  ? N VAL E 31  
J  3 4 N ASN E 19  ? N ASN E 34  O GLN E 47  ? O GLN E 64  
J  4 5 N LEU E 50  ? N LEU E 67  O GLN E 63  ? O GLN E 81  
J  5 6 O ILE E 71  ? O ILE E 89  N LEU E 87  ? N LEU E 105 
J  6 7 N ILE E 88  ? N ILE E 106 O VAL E 35  ? O VAL E 52  
K  1 2 N ALA F 163 ? N ALA F 183 O GLY F 204 ? O GLY F 226 
K  2 3 N THR F 207 ? N THR F 229 O ILE F 190 ? O ILE F 212 
K  3 4 N GLN F 188 ? N GLN F 210 O VAL F 181 ? O VAL F 199 
K  4 5 O VAL F 182 ? O VAL F 200 N LEU F 117 ? N LEU F 137 
K  5 6 O GLY F 120 ? O GLY F 140 N LYS F 136 ? N LYS F 156 
K  6 7 N CYS F 137 ? N CYS F 157 O TYR F 5   ? O TYR F 20  
K1 1 2 N ALA F 163 ? N ALA F 183 O GLY F 204 ? O GLY F 226 
K1 2 3 N THR F 207 ? N THR F 229 O ILE F 190 ? O ILE F 212 
K1 3 4 O GLY F 194 ? O GLY F 216 N HIS L 32  ? N HIS L 32  
L  1 2 O LEU F 18  ? O LEU F 33  N PHE F 24  ? N PHE F 41  
L  2 3 O GLY F 27  ? O GLY F 44  N VAL F 16  ? N VAL F 31  
L  3 4 N ASN F 19  ? N ASN F 34  O GLN F 47  ? O GLN F 64  
L  4 5 N LEU F 50  ? N LEU F 67  O GLN F 63  ? O GLN F 81  
L  5 6 O ILE F 71  ? O ILE F 89  N LEU F 87  ? N LEU F 105 
L  6 7 O ILE F 88  ? O ILE F 106 N VAL F 35  ? N VAL F 52  
M  1 2 N CYS G 10  ? N CYS G 10  O VAL G 13  ? O VAL G 13  
N  1 2 N GLU G 22  ? N GLU G 22  O LYS G 25  ? O LYS G 25  
O  1 2 O LYS G 42  ? O LYS G 42  N TYR G 50  ? N TYR G 50  
P  1 2 O CYS H 10  ? O CYS H 10  N VAL H 13  ? N VAL H 13  
Q  1 2 N GLU H 22  ? N GLU H 22  O LYS H 25  ? O LYS H 25  
R  1 2 O LYS H 42  ? O LYS H 42  N TYR H 50  ? N TYR H 50  
S  1 2 O CYS I 10  ? O CYS I 10  N VAL I 13  ? N VAL I 13  
T  1 2 N GLU I 22  ? N GLU I 22  O LYS I 25  ? O LYS I 25  
U  1 2 O LYS I 42  ? O LYS I 42  N TYR I 50  ? N TYR I 50  
V  1 2 N CYS J 10  ? N CYS J 10  O VAL J 13  ? O VAL J 13  
W  1 2 N GLU J 22  ? N GLU J 22  O LYS J 25  ? O LYS J 25  
X  1 2 O LYS J 42  ? O LYS J 42  N TYR J 50  ? N TYR J 50  
Y  1 2 O CYS K 10  ? O CYS K 10  N VAL K 13  ? N VAL K 13  
Z  1 2 N GLU K 22  ? N GLU K 22  O LYS K 25  ? O LYS K 25  
# 
_database_PDB_matrix.entry_id          1C9T 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1C9T 
_atom_sites.fract_transf_matrix[1][1]   0.010502 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000679 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009193 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010470 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ILE A 1 1   ? 34.560  -3.922  31.301  1.00 14.86 ? 16  ILE A N   1 
ATOM   2     C CA  . ILE A 1 1   ? 33.490  -4.062  30.289  1.00 17.44 ? 16  ILE A CA  1 
ATOM   3     C C   . ILE A 1 1   ? 32.227  -4.041  31.092  1.00 20.04 ? 16  ILE A C   1 
ATOM   4     O O   . ILE A 1 1   ? 31.963  -4.992  31.825  1.00 20.51 ? 16  ILE A O   1 
ATOM   5     C CB  . ILE A 1 1   ? 33.577  -5.422  29.526  1.00 17.27 ? 16  ILE A CB  1 
ATOM   6     C CG1 . ILE A 1 1   ? 34.736  -5.406  28.529  1.00 18.10 ? 16  ILE A CG1 1 
ATOM   7     C CG2 . ILE A 1 1   ? 32.294  -5.701  28.760  1.00 16.94 ? 16  ILE A CG2 1 
ATOM   8     C CD1 . ILE A 1 1   ? 34.548  -4.423  27.367  1.00 15.20 ? 16  ILE A CD1 1 
ATOM   9     N N   . VAL A 1 2   ? 31.484  -2.938  30.995  1.00 23.72 ? 17  VAL A N   1 
ATOM   10    C CA  . VAL A 1 2   ? 30.220  -2.786  31.710  1.00 26.10 ? 17  VAL A CA  1 
ATOM   11    C C   . VAL A 1 2   ? 29.151  -3.654  31.045  1.00 26.75 ? 17  VAL A C   1 
ATOM   12    O O   . VAL A 1 2   ? 28.904  -3.540  29.836  1.00 25.24 ? 17  VAL A O   1 
ATOM   13    C CB  . VAL A 1 2   ? 29.751  -1.322  31.759  0.00 27.77 ? 17  VAL A CB  1 
ATOM   14    C CG1 . VAL A 1 2   ? 28.427  -1.221  32.503  0.00 28.65 ? 17  VAL A CG1 1 
ATOM   15    C CG2 . VAL A 1 2   ? 30.794  -0.472  32.452  0.00 28.74 ? 17  VAL A CG2 1 
ATOM   16    N N   . GLY A 1 3   ? 28.599  -4.574  31.834  1.00 26.10 ? 18  GLY A N   1 
ATOM   17    C CA  . GLY A 1 3   ? 27.570  -5.470  31.357  1.00 26.05 ? 18  GLY A CA  1 
ATOM   18    C C   . GLY A 1 3   ? 28.050  -6.462  30.330  1.00 26.39 ? 18  GLY A C   1 
ATOM   19    O O   . GLY A 1 3   ? 27.541  -6.492  29.213  1.00 31.44 ? 18  GLY A O   1 
ATOM   20    N N   . GLY A 1 4   ? 29.003  -7.302  30.710  1.00 24.34 ? 19  GLY A N   1 
ATOM   21    C CA  . GLY A 1 4   ? 29.508  -8.287  29.773  1.00 21.52 ? 19  GLY A CA  1 
ATOM   22    C C   . GLY A 1 4   ? 29.516  -9.673  30.351  1.00 19.99 ? 19  GLY A C   1 
ATOM   23    O O   . GLY A 1 4   ? 29.029  -9.898  31.443  1.00 22.14 ? 19  GLY A O   1 
ATOM   24    N N   . TYR A 1 5   ? 30.100  -10.607 29.633  1.00 17.93 ? 20  TYR A N   1 
ATOM   25    C CA  . TYR A 1 5   ? 30.161  -11.972 30.109  1.00 20.01 ? 20  TYR A CA  1 
ATOM   26    C C   . TYR A 1 5   ? 31.611  -12.426 30.173  1.00 23.99 ? 20  TYR A C   1 
ATOM   27    O O   . TYR A 1 5   ? 32.424  -11.979 29.373  1.00 28.49 ? 20  TYR A O   1 
ATOM   28    C CB  . TYR A 1 5   ? 29.404  -12.872 29.149  1.00 17.26 ? 20  TYR A CB  1 
ATOM   29    C CG  . TYR A 1 5   ? 30.027  -12.994 27.783  1.00 13.10 ? 20  TYR A CG  1 
ATOM   30    C CD1 . TYR A 1 5   ? 30.890  -14.040 27.491  1.00 16.41 ? 20  TYR A CD1 1 
ATOM   31    C CD2 . TYR A 1 5   ? 29.715  -12.096 26.771  1.00 12.99 ? 20  TYR A CD2 1 
ATOM   32    C CE1 . TYR A 1 5   ? 31.430  -14.195 26.217  1.00 20.02 ? 20  TYR A CE1 1 
ATOM   33    C CE2 . TYR A 1 5   ? 30.242  -12.239 25.494  1.00 15.25 ? 20  TYR A CE2 1 
ATOM   34    C CZ  . TYR A 1 5   ? 31.100  -13.290 25.220  1.00 18.15 ? 20  TYR A CZ  1 
ATOM   35    O OH  . TYR A 1 5   ? 31.641  -13.435 23.962  1.00 17.23 ? 20  TYR A OH  1 
ATOM   36    N N   . THR A 1 6   ? 31.950  -13.312 31.105  1.00 23.11 ? 21  THR A N   1 
ATOM   37    C CA  . THR A 1 6   ? 33.324  -13.798 31.196  1.00 20.99 ? 21  THR A CA  1 
ATOM   38    C C   . THR A 1 6   ? 33.606  -14.523 29.891  1.00 20.15 ? 21  THR A C   1 
ATOM   39    O O   . THR A 1 6   ? 32.791  -15.306 29.437  1.00 22.00 ? 21  THR A O   1 
ATOM   40    C CB  . THR A 1 6   ? 33.511  -14.810 32.339  1.00 22.30 ? 21  THR A CB  1 
ATOM   41    O OG1 . THR A 1 6   ? 32.972  -14.290 33.554  1.00 27.85 ? 21  THR A OG1 1 
ATOM   42    C CG2 . THR A 1 6   ? 34.964  -15.074 32.553  1.00 25.29 ? 21  THR A CG2 1 
ATOM   43    N N   . CYS A 1 7   ? 34.741  -14.244 29.272  1.00 21.45 ? 22  CYS A N   1 
ATOM   44    C CA  . CYS A 1 7   ? 35.087  -14.900 28.020  1.00 22.42 ? 22  CYS A CA  1 
ATOM   45    C C   . CYS A 1 7   ? 35.422  -16.362 28.307  1.00 25.30 ? 22  CYS A C   1 
ATOM   46    O O   . CYS A 1 7   ? 35.052  -17.254 27.539  1.00 27.90 ? 22  CYS A O   1 
ATOM   47    C CB  . CYS A 1 7   ? 36.275  -14.199 27.368  1.00 20.93 ? 22  CYS A CB  1 
ATOM   48    S SG  . CYS A 1 7   ? 36.134  -12.380 27.246  1.00 19.59 ? 22  CYS A SG  1 
ATOM   49    N N   . GLY A 1 8   ? 36.085  -16.599 29.437  0.00 25.38 ? 23  GLY A N   1 
ATOM   50    C CA  . GLY A 1 8   ? 36.446  -17.949 29.837  0.00 28.79 ? 23  GLY A CA  1 
ATOM   51    C C   . GLY A 1 8   ? 37.410  -18.667 28.912  0.00 32.42 ? 23  GLY A C   1 
ATOM   52    O O   . GLY A 1 8   ? 37.607  -18.261 27.767  0.00 31.49 ? 23  GLY A O   1 
ATOM   53    N N   . ALA A 1 9   ? 38.008  -19.742 29.422  0.00 36.68 ? 24  ALA A N   1 
ATOM   54    C CA  . ALA A 1 9   ? 38.965  -20.553 28.670  0.00 42.29 ? 24  ALA A CA  1 
ATOM   55    C C   . ALA A 1 9   ? 39.967  -19.671 27.923  0.00 48.80 ? 24  ALA A C   1 
ATOM   56    O O   . ALA A 1 9   ? 40.861  -19.093 28.542  0.00 48.40 ? 24  ALA A O   1 
ATOM   57    C CB  . ALA A 1 9   ? 38.227  -21.486 27.706  0.00 41.46 ? 24  ALA A CB  1 
ATOM   58    N N   . ASN A 1 10  ? 39.805  -19.559 26.608  1.00 56.83 ? 25  ASN A N   1 
ATOM   59    C CA  . ASN A 1 10  ? 40.688  -18.726 25.775  1.00 61.22 ? 25  ASN A CA  1 
ATOM   60    C C   . ASN A 1 10  ? 40.161  -18.621 24.332  1.00 58.18 ? 25  ASN A C   1 
ATOM   61    O O   . ASN A 1 10  ? 40.440  -19.463 23.462  1.00 57.64 ? 25  ASN A O   1 
ATOM   62    C CB  . ASN A 1 10  ? 42.125  -19.246 25.787  1.00 64.52 ? 25  ASN A CB  1 
ATOM   63    C CG  . ASN A 1 10  ? 43.117  -18.175 25.418  1.00 72.68 ? 25  ASN A CG  1 
ATOM   64    O OD1 . ASN A 1 10  ? 42.741  -17.030 25.169  1.00 75.87 ? 25  ASN A OD1 1 
ATOM   65    N ND2 . ASN A 1 10  ? 44.393  -18.535 25.377  1.00 79.75 ? 25  ASN A ND2 1 
ATOM   66    N N   . THR A 1 11  ? 39.374  -17.579 24.105  1.00 52.51 ? 26  THR A N   1 
ATOM   67    C CA  . THR A 1 11  ? 38.754  -17.332 22.819  1.00 45.45 ? 26  THR A CA  1 
ATOM   68    C C   . THR A 1 11  ? 39.137  -15.947 22.336  1.00 35.78 ? 26  THR A C   1 
ATOM   69    O O   . THR A 1 11  ? 38.665  -15.485 21.294  1.00 34.55 ? 26  THR A O   1 
ATOM   70    C CB  . THR A 1 11  ? 37.217  -17.444 22.960  1.00 53.15 ? 26  THR A CB  1 
ATOM   71    O OG1 . THR A 1 11  ? 36.766  -16.593 24.030  1.00 55.23 ? 26  THR A OG1 1 
ATOM   72    C CG2 . THR A 1 11  ? 36.815  -18.907 23.278  1.00 54.29 ? 26  THR A CG2 1 
ATOM   73    N N   . VAL A 1 12  ? 39.953  -15.273 23.143  1.00 27.16 ? 27  VAL A N   1 
ATOM   74    C CA  . VAL A 1 12  ? 40.459  -13.944 22.836  1.00 18.83 ? 27  VAL A CA  1 
ATOM   75    C C   . VAL A 1 12  ? 41.965  -14.064 23.057  1.00 17.55 ? 27  VAL A C   1 
ATOM   76    O O   . VAL A 1 12  ? 42.526  -13.419 23.953  1.00 19.45 ? 27  VAL A O   1 
ATOM   77    C CB  . VAL A 1 12  ? 39.911  -12.858 23.786  1.00 14.17 ? 27  VAL A CB  1 
ATOM   78    C CG1 . VAL A 1 12  ? 39.878  -11.528 23.064  1.00 14.00 ? 27  VAL A CG1 1 
ATOM   79    C CG2 . VAL A 1 12  ? 38.534  -13.220 24.300  1.00 12.42 ? 27  VAL A CG2 1 
ATOM   80    N N   . PRO A 1 13  ? 42.645  -14.878 22.217  1.00 14.24 ? 28  PRO A N   1 
ATOM   81    C CA  . PRO A 1 13  ? 44.084  -15.148 22.242  1.00 11.32 ? 28  PRO A CA  1 
ATOM   82    C C   . PRO A 1 13  ? 44.916  -13.903 21.910  1.00 13.26 ? 28  PRO A C   1 
ATOM   83    O O   . PRO A 1 13  ? 46.032  -13.735 22.394  1.00 16.53 ? 28  PRO A O   1 
ATOM   84    C CB  . PRO A 1 13  ? 44.250  -16.180 21.127  1.00 10.16 ? 28  PRO A CB  1 
ATOM   85    C CG  . PRO A 1 13  ? 42.867  -16.688 20.849  1.00 7.97  ? 28  PRO A CG  1 
ATOM   86    C CD  . PRO A 1 13  ? 42.064  -15.462 20.995  1.00 11.88 ? 28  PRO A CD  1 
ATOM   87    N N   . TYR A 1 14  ? 44.374  -13.049 21.055  1.00 9.10  ? 29  TYR A N   1 
ATOM   88    C CA  . TYR A 1 14  ? 45.062  -11.848 20.653  1.00 5.34  ? 29  TYR A CA  1 
ATOM   89    C C   . TYR A 1 14  ? 44.985  -10.749 21.674  1.00 5.00  ? 29  TYR A C   1 
ATOM   90    O O   . TYR A 1 14  ? 45.462  -9.655  21.425  1.00 6.90  ? 29  TYR A O   1 
ATOM   91    C CB  . TYR A 1 14  ? 44.477  -11.347 19.345  1.00 10.43 ? 29  TYR A CB  1 
ATOM   92    C CG  . TYR A 1 14  ? 42.988  -11.165 19.407  1.00 12.77 ? 29  TYR A CG  1 
ATOM   93    C CD1 . TYR A 1 14  ? 42.435  -9.995  19.924  1.00 13.59 ? 29  TYR A CD1 1 
ATOM   94    C CD2 . TYR A 1 14  ? 42.123  -12.185 18.991  1.00 12.88 ? 29  TYR A CD2 1 
ATOM   95    C CE1 . TYR A 1 14  ? 41.053  -9.844  20.037  1.00 16.48 ? 29  TYR A CE1 1 
ATOM   96    C CE2 . TYR A 1 14  ? 40.743  -12.043 19.096  1.00 13.17 ? 29  TYR A CE2 1 
ATOM   97    C CZ  . TYR A 1 14  ? 40.214  -10.873 19.621  1.00 14.80 ? 29  TYR A CZ  1 
ATOM   98    O OH  . TYR A 1 14  ? 38.855  -10.729 19.746  1.00 13.76 ? 29  TYR A OH  1 
ATOM   99    N N   . GLN A 1 15  ? 44.354  -11.008 22.803  1.00 5.00  ? 30  GLN A N   1 
ATOM   100   C CA  . GLN A 1 15  ? 44.236  -9.974  23.822  1.00 8.67  ? 30  GLN A CA  1 
ATOM   101   C C   . GLN A 1 15  ? 45.529  -9.852  24.617  1.00 8.98  ? 30  GLN A C   1 
ATOM   102   O O   . GLN A 1 15  ? 46.219  -10.856 24.813  1.00 8.55  ? 30  GLN A O   1 
ATOM   103   C CB  . GLN A 1 15  ? 43.074  -10.303 24.785  1.00 9.47  ? 30  GLN A CB  1 
ATOM   104   C CG  . GLN A 1 15  ? 42.866  -9.312  25.964  1.00 8.05  ? 30  GLN A CG  1 
ATOM   105   C CD  . GLN A 1 15  ? 42.011  -8.084  25.601  1.00 7.82  ? 30  GLN A CD  1 
ATOM   106   O OE1 . GLN A 1 15  ? 42.164  -6.999  26.188  1.00 5.00  ? 30  GLN A OE1 1 
ATOM   107   N NE2 . GLN A 1 15  ? 41.101  -8.256  24.640  1.00 6.32  ? 30  GLN A NE2 1 
ATOM   108   N N   . VAL A 1 16  ? 45.894  -8.629  25.005  1.00 9.33  ? 31  VAL A N   1 
ATOM   109   C CA  . VAL A 1 16  ? 47.083  -8.408  25.839  1.00 12.20 ? 31  VAL A CA  1 
ATOM   110   C C   . VAL A 1 16  ? 46.810  -7.283  26.843  1.00 10.90 ? 31  VAL A C   1 
ATOM   111   O O   . VAL A 1 16  ? 46.013  -6.377  26.587  1.00 7.96  ? 31  VAL A O   1 
ATOM   112   C CB  . VAL A 1 16  ? 48.396  -8.083  25.049  1.00 11.97 ? 31  VAL A CB  1 
ATOM   113   C CG1 . VAL A 1 16  ? 48.580  -9.016  23.867  1.00 11.16 ? 31  VAL A CG1 1 
ATOM   114   C CG2 . VAL A 1 16  ? 48.429  -6.625  24.630  1.00 11.25 ? 31  VAL A CG2 1 
ATOM   115   N N   . SER A 1 17  ? 47.495  -7.359  27.976  1.00 9.72  ? 32  SER A N   1 
ATOM   116   C CA  . SER A 1 17  ? 47.343  -6.405  29.049  1.00 8.28  ? 32  SER A CA  1 
ATOM   117   C C   . SER A 1 17  ? 48.592  -5.549  29.140  1.00 8.17  ? 32  SER A C   1 
ATOM   118   O O   . SER A 1 17  ? 49.687  -6.083  29.185  1.00 9.90  ? 32  SER A O   1 
ATOM   119   C CB  . SER A 1 17  ? 47.143  -7.179  30.354  1.00 8.47  ? 32  SER A CB  1 
ATOM   120   O OG  . SER A 1 17  ? 47.346  -6.365  31.496  1.00 12.21 ? 32  SER A OG  1 
ATOM   121   N N   . LEU A 1 18  ? 48.428  -4.229  29.154  1.00 6.76  ? 33  LEU A N   1 
ATOM   122   C CA  . LEU A 1 18  ? 49.550  -3.308  29.267  1.00 5.00  ? 33  LEU A CA  1 
ATOM   123   C C   . LEU A 1 18  ? 49.676  -2.980  30.734  1.00 5.00  ? 33  LEU A C   1 
ATOM   124   O O   . LEU A 1 18  ? 48.748  -2.435  31.337  1.00 5.00  ? 33  LEU A O   1 
ATOM   125   C CB  . LEU A 1 18  ? 49.287  -2.024  28.488  1.00 5.74  ? 33  LEU A CB  1 
ATOM   126   C CG  . LEU A 1 18  ? 49.190  -2.166  26.977  1.00 5.00  ? 33  LEU A CG  1 
ATOM   127   C CD1 . LEU A 1 18  ? 49.284  -0.809  26.334  1.00 5.00  ? 33  LEU A CD1 1 
ATOM   128   C CD2 . LEU A 1 18  ? 50.316  -3.057  26.507  1.00 5.00  ? 33  LEU A CD2 1 
ATOM   129   N N   . ASN A 1 19  ? 50.813  -3.349  31.304  1.00 7.52  ? 34  ASN A N   1 
ATOM   130   C CA  . ASN A 1 19  ? 51.112  -3.138  32.714  1.00 10.58 ? 34  ASN A CA  1 
ATOM   131   C C   . ASN A 1 19  ? 52.191  -2.096  32.932  1.00 9.67  ? 34  ASN A C   1 
ATOM   132   O O   . ASN A 1 19  ? 53.131  -1.996  32.156  1.00 9.72  ? 34  ASN A O   1 
ATOM   133   C CB  . ASN A 1 19  ? 51.559  -4.464  33.350  1.00 14.71 ? 34  ASN A CB  1 
ATOM   134   C CG  . ASN A 1 19  ? 52.121  -4.288  34.765  1.00 18.04 ? 34  ASN A CG  1 
ATOM   135   O OD1 . ASN A 1 19  ? 53.175  -3.709  34.960  1.00 14.98 ? 34  ASN A OD1 1 
ATOM   136   N ND2 . ASN A 1 19  ? 51.419  -4.821  35.749  1.00 23.04 ? 34  ASN A ND2 1 
ATOM   137   N N   . SER A 1 20  ? 52.039  -1.320  33.996  1.00 10.27 ? 37  SER A N   1 
ATOM   138   C CA  . SER A 1 20  ? 53.013  -0.300  34.368  1.00 9.67  ? 37  SER A CA  1 
ATOM   139   C C   . SER A 1 20  ? 52.974  -0.294  35.883  1.00 6.20  ? 37  SER A C   1 
ATOM   140   O O   . SER A 1 20  ? 52.767  0.708   36.526  1.00 5.00  ? 37  SER A O   1 
ATOM   141   C CB  . SER A 1 20  ? 52.643  1.067   33.783  1.00 13.46 ? 37  SER A CB  1 
ATOM   142   O OG  . SER A 1 20  ? 51.314  1.446   34.128  1.00 18.11 ? 37  SER A OG  1 
ATOM   143   N N   . GLY A 1 21  ? 53.183  -1.465  36.446  1.00 7.63  ? 38  GLY A N   1 
ATOM   144   C CA  . GLY A 1 21  ? 53.149  -1.608  37.878  1.00 9.82  ? 38  GLY A CA  1 
ATOM   145   C C   . GLY A 1 21  ? 51.834  -2.282  38.156  1.00 11.90 ? 38  GLY A C   1 
ATOM   146   O O   . GLY A 1 21  ? 51.741  -3.116  39.035  1.00 12.70 ? 38  GLY A O   1 
ATOM   147   N N   . TYR A 1 22  ? 50.835  -1.967  37.335  1.00 12.79 ? 39  TYR A N   1 
ATOM   148   C CA  . TYR A 1 22  ? 49.478  -2.511  37.461  1.00 10.97 ? 39  TYR A CA  1 
ATOM   149   C C   . TYR A 1 22  ? 48.851  -2.421  36.075  1.00 9.82  ? 39  TYR A C   1 
ATOM   150   O O   . TYR A 1 22  ? 49.400  -1.742  35.191  1.00 9.71  ? 39  TYR A O   1 
ATOM   151   C CB  . TYR A 1 22  ? 48.662  -1.652  38.437  1.00 13.07 ? 39  TYR A CB  1 
ATOM   152   C CG  . TYR A 1 22  ? 48.589  -0.180  38.046  1.00 15.21 ? 39  TYR A CG  1 
ATOM   153   C CD1 . TYR A 1 22  ? 49.565  0.727   38.470  1.00 13.71 ? 39  TYR A CD1 1 
ATOM   154   C CD2 . TYR A 1 22  ? 47.584  0.287   37.198  1.00 15.31 ? 39  TYR A CD2 1 
ATOM   155   C CE1 . TYR A 1 22  ? 49.545  2.051   38.054  1.00 13.07 ? 39  TYR A CE1 1 
ATOM   156   C CE2 . TYR A 1 22  ? 47.557  1.603   36.778  1.00 18.00 ? 39  TYR A CE2 1 
ATOM   157   C CZ  . TYR A 1 22  ? 48.541  2.485   37.204  1.00 17.26 ? 39  TYR A CZ  1 
ATOM   158   O OH  . TYR A 1 22  ? 48.520  3.789   36.748  1.00 20.81 ? 39  TYR A OH  1 
ATOM   159   N N   . HIS A 1 23  ? 47.723  -3.097  35.880  1.00 6.35  ? 40  HIS A N   1 
ATOM   160   C CA  . HIS A 1 23  ? 47.046  -3.059  34.584  1.00 8.25  ? 40  HIS A CA  1 
ATOM   161   C C   . HIS A 1 23  ? 46.452  -1.682  34.370  1.00 6.84  ? 40  HIS A C   1 
ATOM   162   O O   . HIS A 1 23  ? 45.858  -1.125  35.275  1.00 6.57  ? 40  HIS A O   1 
ATOM   163   C CB  . HIS A 1 23  ? 45.930  -4.100  34.522  1.00 11.44 ? 40  HIS A CB  1 
ATOM   164   C CG  . HIS A 1 23  ? 45.031  -3.962  33.327  1.00 13.65 ? 40  HIS A CG  1 
ATOM   165   N ND1 . HIS A 1 23  ? 45.215  -4.686  32.170  1.00 14.72 ? 40  HIS A ND1 1 
ATOM   166   C CD2 . HIS A 1 23  ? 43.904  -3.237  33.136  1.00 14.55 ? 40  HIS A CD2 1 
ATOM   167   C CE1 . HIS A 1 23  ? 44.236  -4.425  31.322  1.00 14.66 ? 40  HIS A CE1 1 
ATOM   168   N NE2 . HIS A 1 23  ? 43.428  -3.546  31.883  1.00 13.94 ? 40  HIS A NE2 1 
ATOM   169   N N   . PHE A 1 24  ? 46.605  -1.136  33.174  1.00 6.78  ? 41  PHE A N   1 
ATOM   170   C CA  . PHE A 1 24  ? 46.048  0.175   32.902  1.00 5.68  ? 41  PHE A CA  1 
ATOM   171   C C   . PHE A 1 24  ? 45.466  0.271   31.504  1.00 5.00  ? 41  PHE A C   1 
ATOM   172   O O   . PHE A 1 24  ? 44.836  1.256   31.173  1.00 7.42  ? 41  PHE A O   1 
ATOM   173   C CB  . PHE A 1 24  ? 47.090  1.277   33.132  1.00 5.00  ? 41  PHE A CB  1 
ATOM   174   C CG  . PHE A 1 24  ? 48.196  1.278   32.132  1.00 6.88  ? 41  PHE A CG  1 
ATOM   175   C CD1 . PHE A 1 24  ? 48.200  2.195   31.104  1.00 10.08 ? 41  PHE A CD1 1 
ATOM   176   C CD2 . PHE A 1 24  ? 49.203  0.332   32.185  1.00 6.63  ? 41  PHE A CD2 1 
ATOM   177   C CE1 . PHE A 1 24  ? 49.185  2.170   30.139  1.00 11.08 ? 41  PHE A CE1 1 
ATOM   178   C CE2 . PHE A 1 24  ? 50.185  0.296   31.233  1.00 6.94  ? 41  PHE A CE2 1 
ATOM   179   C CZ  . PHE A 1 24  ? 50.177  1.218   30.204  1.00 10.17 ? 41  PHE A CZ  1 
ATOM   180   N N   . CYS A 1 25  ? 45.658  -0.745  30.684  1.00 5.00  ? 42  CYS A N   1 
ATOM   181   C CA  . CYS A 1 25  ? 45.120  -0.710  29.335  1.00 5.74  ? 42  CYS A CA  1 
ATOM   182   C C   . CYS A 1 25  ? 45.192  -2.102  28.754  1.00 8.11  ? 42  CYS A C   1 
ATOM   183   O O   . CYS A 1 25  ? 45.748  -3.018  29.379  1.00 9.10  ? 42  CYS A O   1 
ATOM   184   C CB  . CYS A 1 25  ? 45.945  0.227   28.438  1.00 8.01  ? 42  CYS A CB  1 
ATOM   185   S SG  . CYS A 1 25  ? 45.617  2.021   28.561  1.00 11.91 ? 42  CYS A SG  1 
ATOM   186   N N   . GLY A 1 26  ? 44.629  -2.252  27.561  1.00 5.84  ? 43  GLY A N   1 
ATOM   187   C CA  . GLY A 1 26  ? 44.657  -3.518  26.860  1.00 5.68  ? 43  GLY A CA  1 
ATOM   188   C C   . GLY A 1 26  ? 45.322  -3.245  25.530  1.00 5.00  ? 43  GLY A C   1 
ATOM   189   O O   . GLY A 1 26  ? 45.880  -2.169  25.329  1.00 5.00  ? 43  GLY A O   1 
ATOM   190   N N   . GLY A 1 27  ? 45.275  -4.207  24.622  1.00 5.42  ? 44  GLY A N   1 
ATOM   191   C CA  . GLY A 1 27  ? 45.877  -4.010  23.316  1.00 5.72  ? 44  GLY A CA  1 
ATOM   192   C C   . GLY A 1 27  ? 45.705  -5.270  22.514  1.00 5.00  ? 44  GLY A C   1 
ATOM   193   O O   . GLY A 1 27  ? 45.374  -6.304  23.096  1.00 5.00  ? 44  GLY A O   1 
ATOM   194   N N   . SER A 1 28  ? 45.930  -5.202  21.209  1.00 5.00  ? 45  SER A N   1 
ATOM   195   C CA  . SER A 1 28  ? 45.797  -6.387  20.380  1.00 5.97  ? 45  SER A CA  1 
ATOM   196   C C   . SER A 1 28  ? 47.123  -6.805  19.780  1.00 9.00  ? 45  SER A C   1 
ATOM   197   O O   . SER A 1 28  ? 47.927  -5.939  19.405  1.00 11.61 ? 45  SER A O   1 
ATOM   198   C CB  . SER A 1 28  ? 44.831  -6.123  19.254  1.00 5.00  ? 45  SER A CB  1 
ATOM   199   O OG  . SER A 1 28  ? 43.685  -5.502  19.760  1.00 5.00  ? 45  SER A OG  1 
ATOM   200   N N   . LEU A 1 29  ? 47.362  -8.115  19.703  1.00 7.25  ? 46  LEU A N   1 
ATOM   201   C CA  . LEU A 1 29  ? 48.590  -8.646  19.113  1.00 5.00  ? 46  LEU A CA  1 
ATOM   202   C C   . LEU A 1 29  ? 48.381  -8.770  17.606  1.00 6.38  ? 46  LEU A C   1 
ATOM   203   O O   . LEU A 1 29  ? 47.550  -9.561  17.151  1.00 5.00  ? 46  LEU A O   1 
ATOM   204   C CB  . LEU A 1 29  ? 48.924  -10.002 19.717  1.00 5.00  ? 46  LEU A CB  1 
ATOM   205   C CG  . LEU A 1 29  ? 50.281  -10.625 19.392  1.00 7.83  ? 46  LEU A CG  1 
ATOM   206   C CD1 . LEU A 1 29  ? 51.414  -9.687  19.709  1.00 5.00  ? 46  LEU A CD1 1 
ATOM   207   C CD2 . LEU A 1 29  ? 50.434  -11.877 20.209  1.00 13.03 ? 46  LEU A CD2 1 
ATOM   208   N N   . ILE A 1 30  ? 49.112  -7.954  16.844  1.00 8.40  ? 47  ILE A N   1 
ATOM   209   C CA  . ILE A 1 30  ? 49.019  -7.924  15.385  1.00 10.37 ? 47  ILE A CA  1 
ATOM   210   C C   . ILE A 1 30  ? 49.901  -9.001  14.759  1.00 9.84  ? 47  ILE A C   1 
ATOM   211   O O   . ILE A 1 30  ? 49.632  -9.481  13.652  1.00 9.98  ? 47  ILE A O   1 
ATOM   212   C CB  . ILE A 1 30  ? 49.371  -6.515  14.840  1.00 15.61 ? 47  ILE A CB  1 
ATOM   213   C CG1 . ILE A 1 30  ? 48.244  -5.549  15.160  1.00 19.53 ? 47  ILE A CG1 1 
ATOM   214   C CG2 . ILE A 1 30  ? 49.562  -6.512  13.326  1.00 16.95 ? 47  ILE A CG2 1 
ATOM   215   C CD1 . ILE A 1 30  ? 48.473  -4.195  14.560  1.00 24.87 ? 47  ILE A CD1 1 
ATOM   216   N N   . ASN A 1 31  ? 50.948  -9.390  15.476  1.00 10.34 ? 48  ASN A N   1 
ATOM   217   C CA  . ASN A 1 31  ? 51.851  -10.448 15.030  1.00 10.09 ? 48  ASN A CA  1 
ATOM   218   C C   . ASN A 1 31  ? 52.962  -10.550 16.051  1.00 6.30  ? 48  ASN A C   1 
ATOM   219   O O   . ASN A 1 31  ? 53.320  -9.559  16.655  1.00 5.00  ? 48  ASN A O   1 
ATOM   220   C CB  . ASN A 1 31  ? 52.437  -10.127 13.650  1.00 14.57 ? 48  ASN A CB  1 
ATOM   221   C CG  . ASN A 1 31  ? 53.463  -9.001  13.689  1.00 16.48 ? 48  ASN A CG  1 
ATOM   222   O OD1 . ASN A 1 31  ? 53.127  -7.815  13.654  1.00 13.68 ? 48  ASN A OD1 1 
ATOM   223   N ND2 . ASN A 1 31  ? 54.732  -9.378  13.758  1.00 22.76 ? 48  ASN A ND2 1 
ATOM   224   N N   . SER A 1 32  ? 53.538  -11.733 16.182  1.00 6.89  ? 49  SER A N   1 
ATOM   225   C CA  . SER A 1 32  ? 54.623  -12.022 17.125  1.00 7.42  ? 49  SER A CA  1 
ATOM   226   C C   . SER A 1 32  ? 55.309  -10.869 17.836  1.00 8.56  ? 49  SER A C   1 
ATOM   227   O O   . SER A 1 32  ? 55.423  -10.873 19.049  1.00 10.60 ? 49  SER A O   1 
ATOM   228   C CB  . SER A 1 32  ? 55.707  -12.864 16.447  1.00 6.87  ? 49  SER A CB  1 
ATOM   229   O OG  . SER A 1 32  ? 56.118  -12.248 15.240  1.00 11.34 ? 49  SER A OG  1 
ATOM   230   N N   . GLN A 1 33  ? 55.766  -9.872  17.093  1.00 10.33 ? 50  GLN A N   1 
ATOM   231   C CA  . GLN A 1 33  ? 56.483  -8.770  17.720  1.00 8.54  ? 50  GLN A CA  1 
ATOM   232   C C   . GLN A 1 33  ? 55.798  -7.447  17.931  1.00 6.88  ? 50  GLN A C   1 
ATOM   233   O O   . GLN A 1 33  ? 56.353  -6.612  18.646  1.00 7.70  ? 50  GLN A O   1 
ATOM   234   C CB  . GLN A 1 33  ? 57.787  -8.515  16.983  1.00 9.79  ? 50  GLN A CB  1 
ATOM   235   C CG  . GLN A 1 33  ? 59.018  -8.720  17.830  1.00 10.69 ? 50  GLN A CG  1 
ATOM   236   C CD  . GLN A 1 33  ? 60.271  -8.637  17.002  1.00 11.57 ? 50  GLN A CD  1 
ATOM   237   O OE1 . GLN A 1 33  ? 61.287  -8.150  17.465  1.00 15.38 ? 50  GLN A OE1 1 
ATOM   238   N NE2 . GLN A 1 33  ? 60.200  -9.101  15.757  1.00 9.44  ? 50  GLN A NE2 1 
ATOM   239   N N   . TRP A 1 34  ? 54.641  -7.226  17.306  1.00 6.34  ? 51  TRP A N   1 
ATOM   240   C CA  . TRP A 1 34  ? 53.937  -5.949  17.467  1.00 6.68  ? 51  TRP A CA  1 
ATOM   241   C C   . TRP A 1 34  ? 52.555  -6.009  18.125  1.00 5.00  ? 51  TRP A C   1 
ATOM   242   O O   . TRP A 1 34  ? 51.783  -6.931  17.905  1.00 5.51  ? 51  TRP A O   1 
ATOM   243   C CB  . TRP A 1 34  ? 53.842  -5.208  16.128  1.00 9.14  ? 51  TRP A CB  1 
ATOM   244   C CG  . TRP A 1 34  ? 55.156  -4.677  15.599  1.00 9.42  ? 51  TRP A CG  1 
ATOM   245   C CD1 . TRP A 1 34  ? 56.079  -5.363  14.872  1.00 9.33  ? 51  TRP A CD1 1 
ATOM   246   C CD2 . TRP A 1 34  ? 55.671  -3.338  15.743  1.00 9.05  ? 51  TRP A CD2 1 
ATOM   247   N NE1 . TRP A 1 34  ? 57.134  -4.539  14.551  1.00 9.28  ? 51  TRP A NE1 1 
ATOM   248   C CE2 . TRP A 1 34  ? 56.908  -3.292  15.067  1.00 7.57  ? 51  TRP A CE2 1 
ATOM   249   C CE3 . TRP A 1 34  ? 55.206  -2.177  16.371  1.00 9.29  ? 51  TRP A CE3 1 
ATOM   250   C CZ2 . TRP A 1 34  ? 57.683  -2.137  14.998  1.00 7.28  ? 51  TRP A CZ2 1 
ATOM   251   C CZ3 . TRP A 1 34  ? 55.990  -1.019  16.301  1.00 9.63  ? 51  TRP A CZ3 1 
ATOM   252   C CH2 . TRP A 1 34  ? 57.210  -1.012  15.618  1.00 6.88  ? 51  TRP A CH2 1 
ATOM   253   N N   . VAL A 1 35  ? 52.233  -4.967  18.878  1.00 5.57  ? 52  VAL A N   1 
ATOM   254   C CA  . VAL A 1 35  ? 50.969  -4.851  19.589  1.00 5.00  ? 52  VAL A CA  1 
ATOM   255   C C   . VAL A 1 35  ? 50.357  -3.491  19.273  1.00 5.00  ? 52  VAL A C   1 
ATOM   256   O O   . VAL A 1 35  ? 51.014  -2.472  19.448  1.00 5.00  ? 52  VAL A O   1 
ATOM   257   C CB  . VAL A 1 35  ? 51.215  -4.908  21.096  1.00 5.00  ? 52  VAL A CB  1 
ATOM   258   C CG1 . VAL A 1 35  ? 49.928  -4.754  21.827  1.00 6.49  ? 52  VAL A CG1 1 
ATOM   259   C CG2 . VAL A 1 35  ? 51.883  -6.204  21.471  1.00 5.00  ? 52  VAL A CG2 1 
ATOM   260   N N   . VAL A 1 36  ? 49.118  -3.459  18.797  1.00 5.82  ? 53  VAL A N   1 
ATOM   261   C CA  . VAL A 1 36  ? 48.458  -2.178  18.493  1.00 6.33  ? 53  VAL A CA  1 
ATOM   262   C C   . VAL A 1 36  ? 47.632  -1.766  19.706  1.00 6.23  ? 53  VAL A C   1 
ATOM   263   O O   . VAL A 1 36  ? 47.081  -2.637  20.399  1.00 8.03  ? 53  VAL A O   1 
ATOM   264   C CB  . VAL A 1 36  ? 47.542  -2.278  17.264  1.00 6.43  ? 53  VAL A CB  1 
ATOM   265   C CG1 . VAL A 1 36  ? 46.457  -3.289  17.506  1.00 8.46  ? 53  VAL A CG1 1 
ATOM   266   C CG2 . VAL A 1 36  ? 46.958  -0.923  16.907  1.00 5.00  ? 53  VAL A CG2 1 
ATOM   267   N N   . SER A 1 37  ? 47.550  -0.463  19.970  1.00 5.00  ? 54  SER A N   1 
ATOM   268   C CA  . SER A 1 37  ? 46.820  0.035   21.121  1.00 5.00  ? 54  SER A CA  1 
ATOM   269   C C   . SER A 1 37  ? 46.394  1.503   21.013  1.00 7.33  ? 54  SER A C   1 
ATOM   270   O O   . SER A 1 37  ? 46.591  2.163   19.985  1.00 7.90  ? 54  SER A O   1 
ATOM   271   C CB  . SER A 1 37  ? 47.658  -0.171  22.367  1.00 5.00  ? 54  SER A CB  1 
ATOM   272   O OG  . SER A 1 37  ? 46.907  0.088   23.518  1.00 5.00  ? 54  SER A OG  1 
ATOM   273   N N   . ALA A 1 38  ? 45.763  2.005   22.070  1.00 8.70  ? 55  ALA A N   1 
ATOM   274   C CA  . ALA A 1 38  ? 45.283  3.382   22.105  1.00 7.84  ? 55  ALA A CA  1 
ATOM   275   C C   . ALA A 1 38  ? 46.455  4.275   22.433  1.00 8.12  ? 55  ALA A C   1 
ATOM   276   O O   . ALA A 1 38  ? 47.124  4.060   23.448  1.00 10.61 ? 55  ALA A O   1 
ATOM   277   C CB  . ALA A 1 38  ? 44.192  3.535   23.154  0.00 8.10  ? 55  ALA A CB  1 
ATOM   278   N N   . ALA A 1 39  ? 46.709  5.274   21.589  1.00 6.86  ? 56  ALA A N   1 
ATOM   279   C CA  . ALA A 1 39  ? 47.829  6.184   21.806  1.00 5.35  ? 56  ALA A CA  1 
ATOM   280   C C   . ALA A 1 39  ? 47.811  6.826   23.178  1.00 6.77  ? 56  ALA A C   1 
ATOM   281   O O   . ALA A 1 39  ? 48.859  7.143   23.714  1.00 7.90  ? 56  ALA A O   1 
ATOM   282   C CB  . ALA A 1 39  ? 47.871  7.237   20.742  1.00 5.00  ? 56  ALA A CB  1 
ATOM   283   N N   . HIS A 1 40  ? 46.623  7.017   23.755  1.00 10.75 ? 57  HIS A N   1 
ATOM   284   C CA  . HIS A 1 40  ? 46.514  7.633   25.095  1.00 11.72 ? 57  HIS A CA  1 
ATOM   285   C C   . HIS A 1 40  ? 46.915  6.673   26.232  1.00 10.14 ? 57  HIS A C   1 
ATOM   286   O O   . HIS A 1 40  ? 46.962  7.061   27.400  1.00 7.51  ? 57  HIS A O   1 
ATOM   287   C CB  . HIS A 1 40  ? 45.125  8.276   25.333  1.00 12.20 ? 57  HIS A CB  1 
ATOM   288   C CG  . HIS A 1 40  ? 44.031  7.301   25.658  1.00 13.62 ? 57  HIS A CG  1 
ATOM   289   N ND1 . HIS A 1 40  ? 43.130  6.844   24.716  1.00 14.65 ? 57  HIS A ND1 1 
ATOM   290   C CD2 . HIS A 1 40  ? 43.667  6.730   26.833  1.00 11.15 ? 57  HIS A CD2 1 
ATOM   291   C CE1 . HIS A 1 40  ? 42.263  6.033   25.300  1.00 12.19 ? 57  HIS A CE1 1 
ATOM   292   N NE2 . HIS A 1 40  ? 42.567  5.948   26.583  1.00 9.10  ? 57  HIS A NE2 1 
ATOM   293   N N   . CYS A 1 41  ? 47.204  5.426   25.863  1.00 9.77  ? 58  CYS A N   1 
ATOM   294   C CA  . CYS A 1 41  ? 47.653  4.408   26.796  1.00 7.30  ? 58  CYS A CA  1 
ATOM   295   C C   . CYS A 1 41  ? 49.170  4.491   26.894  1.00 9.86  ? 58  CYS A C   1 
ATOM   296   O O   . CYS A 1 41  ? 49.779  3.775   27.689  1.00 12.45 ? 58  CYS A O   1 
ATOM   297   C CB  . CYS A 1 41  ? 47.264  3.028   26.295  1.00 6.49  ? 58  CYS A CB  1 
ATOM   298   S SG  . CYS A 1 41  ? 45.540  2.639   26.627  1.00 7.37  ? 58  CYS A SG  1 
ATOM   299   N N   . TYR A 1 42  ? 49.781  5.318   26.043  1.00 8.28  ? 59  TYR A N   1 
ATOM   300   C CA  . TYR A 1 42  ? 51.223  5.486   26.053  1.00 5.00  ? 59  TYR A CA  1 
ATOM   301   C C   . TYR A 1 42  ? 51.688  5.823   27.456  1.00 5.11  ? 59  TYR A C   1 
ATOM   302   O O   . TYR A 1 42  ? 51.072  6.611   28.150  1.00 5.00  ? 59  TYR A O   1 
ATOM   303   C CB  . TYR A 1 42  ? 51.661  6.600   25.098  1.00 6.16  ? 59  TYR A CB  1 
ATOM   304   C CG  . TYR A 1 42  ? 53.148  6.854   25.150  1.00 9.48  ? 59  TYR A CG  1 
ATOM   305   C CD1 . TYR A 1 42  ? 53.683  7.734   26.075  1.00 12.99 ? 59  TYR A CD1 1 
ATOM   306   C CD2 . TYR A 1 42  ? 54.028  6.143   24.351  1.00 12.20 ? 59  TYR A CD2 1 
ATOM   307   C CE1 . TYR A 1 42  ? 55.045  7.893   26.218  1.00 13.98 ? 59  TYR A CE1 1 
ATOM   308   C CE2 . TYR A 1 42  ? 55.397  6.300   24.488  1.00 15.18 ? 59  TYR A CE2 1 
ATOM   309   C CZ  . TYR A 1 42  ? 55.899  7.179   25.431  1.00 14.43 ? 59  TYR A CZ  1 
ATOM   310   O OH  . TYR A 1 42  ? 57.263  7.341   25.599  1.00 19.79 ? 59  TYR A OH  1 
ATOM   311   N N   . LYS A 1 43  ? 52.792  5.214   27.846  1.00 7.78  ? 60  LYS A N   1 
ATOM   312   C CA  . LYS A 1 43  ? 53.422  5.415   29.139  1.00 12.65 ? 60  LYS A CA  1 
ATOM   313   C C   . LYS A 1 43  ? 54.899  5.060   28.924  1.00 18.59 ? 60  LYS A C   1 
ATOM   314   O O   . LYS A 1 43  ? 55.238  4.299   27.995  1.00 19.40 ? 60  LYS A O   1 
ATOM   315   C CB  . LYS A 1 43  ? 52.834  4.464   30.191  1.00 10.74 ? 60  LYS A CB  1 
ATOM   316   C CG  . LYS A 1 43  ? 51.558  4.931   30.911  1.00 10.45 ? 60  LYS A CG  1 
ATOM   317   C CD  . LYS A 1 43  ? 51.245  4.011   32.104  1.00 7.75  ? 60  LYS A CD  1 
ATOM   318   C CE  . LYS A 1 43  ? 50.201  4.569   33.024  1.00 7.55  ? 60  LYS A CE  1 
ATOM   319   N NZ  . LYS A 1 43  ? 50.609  5.877   33.617  0.00 7.70  ? 60  LYS A NZ  1 
ATOM   320   N N   . SER A 1 44  ? 55.781  5.621   29.747  1.00 21.01 ? 61  SER A N   1 
ATOM   321   C CA  . SER A 1 44  ? 57.201  5.305   29.632  1.00 21.20 ? 61  SER A CA  1 
ATOM   322   C C   . SER A 1 44  ? 57.457  3.881   30.142  1.00 24.48 ? 61  SER A C   1 
ATOM   323   O O   . SER A 1 44  ? 57.048  3.540   31.255  1.00 29.16 ? 61  SER A O   1 
ATOM   324   C CB  . SER A 1 44  ? 58.023  6.303   30.436  1.00 17.60 ? 61  SER A CB  1 
ATOM   325   O OG  . SER A 1 44  ? 57.440  6.573   31.700  0.00 18.38 ? 61  SER A OG  1 
ATOM   326   N N   . GLY A 1 45  ? 58.044  3.030   29.303  1.00 24.17 ? 62  GLY A N   1 
ATOM   327   C CA  . GLY A 1 45  ? 58.344  1.667   29.717  1.00 25.39 ? 62  GLY A CA  1 
ATOM   328   C C   . GLY A 1 45  ? 57.162  0.792   30.118  1.00 25.58 ? 62  GLY A C   1 
ATOM   329   O O   . GLY A 1 45  ? 56.986  0.451   31.280  1.00 28.36 ? 62  GLY A O   1 
ATOM   330   N N   . ILE A 1 46  ? 56.366  0.410   29.131  1.00 23.87 ? 63  ILE A N   1 
ATOM   331   C CA  . ILE A 1 46  ? 55.198  -0.441  29.318  1.00 17.97 ? 63  ILE A CA  1 
ATOM   332   C C   . ILE A 1 46  ? 55.622  -1.904  29.245  1.00 14.58 ? 63  ILE A C   1 
ATOM   333   O O   . ILE A 1 46  ? 56.562  -2.251  28.554  1.00 14.68 ? 63  ILE A O   1 
ATOM   334   C CB  . ILE A 1 46  ? 54.195  -0.203  28.179  1.00 16.97 ? 63  ILE A CB  1 
ATOM   335   C CG1 . ILE A 1 46  ? 53.833  1.277   28.087  1.00 16.07 ? 63  ILE A CG1 1 
ATOM   336   C CG2 . ILE A 1 46  ? 52.982  -1.061  28.359  1.00 18.64 ? 63  ILE A CG2 1 
ATOM   337   C CD1 . ILE A 1 46  ? 52.820  1.571   27.000  1.00 15.32 ? 63  ILE A CD1 1 
ATOM   338   N N   . GLN A 1 47  ? 54.929  -2.767  29.957  1.00 13.52 ? 64  GLN A N   1 
ATOM   339   C CA  . GLN A 1 47  ? 55.248  -4.177  29.921  1.00 13.95 ? 64  GLN A CA  1 
ATOM   340   C C   . GLN A 1 47  ? 53.992  -4.872  29.470  1.00 12.42 ? 64  GLN A C   1 
ATOM   341   O O   . GLN A 1 47  ? 52.943  -4.704  30.068  1.00 14.26 ? 64  GLN A O   1 
ATOM   342   C CB  . GLN A 1 47  ? 55.657  -4.679  31.310  1.00 19.02 ? 64  GLN A CB  1 
ATOM   343   C CG  . GLN A 1 47  ? 56.864  -3.953  31.888  1.00 25.64 ? 64  GLN A CG  1 
ATOM   344   C CD  . GLN A 1 47  ? 57.357  -4.559  33.184  1.00 30.19 ? 64  GLN A CD  1 
ATOM   345   O OE1 . GLN A 1 47  ? 58.358  -5.284  33.203  1.00 30.67 ? 64  GLN A OE1 1 
ATOM   346   N NE2 . GLN A 1 47  ? 56.669  -4.254  34.281  1.00 32.74 ? 64  GLN A NE2 1 
ATOM   347   N N   . VAL A 1 48  ? 54.096  -5.661  28.419  1.00 10.85 ? 65  VAL A N   1 
ATOM   348   C CA  . VAL A 1 48  ? 52.951  -6.377  27.888  1.00 10.94 ? 65  VAL A CA  1 
ATOM   349   C C   . VAL A 1 48  ? 52.753  -7.782  28.492  1.00 13.36 ? 65  VAL A C   1 
ATOM   350   O O   . VAL A 1 48  ? 53.684  -8.563  28.564  1.00 16.54 ? 65  VAL A O   1 
ATOM   351   C CB  . VAL A 1 48  ? 53.094  -6.479  26.349  1.00 9.17  ? 65  VAL A CB  1 
ATOM   352   C CG1 . VAL A 1 48  ? 51.858  -7.060  25.704  1.00 7.66  ? 65  VAL A CG1 1 
ATOM   353   C CG2 . VAL A 1 48  ? 53.371  -5.125  25.784  1.00 9.62  ? 65  VAL A CG2 1 
ATOM   354   N N   . ARG A 1 49  ? 51.560  -8.076  28.995  1.00 18.10 ? 66  ARG A N   1 
ATOM   355   C CA  . ARG A 1 49  ? 51.254  -9.421  29.514  1.00 23.01 ? 66  ARG A CA  1 
ATOM   356   C C   . ARG A 1 49  ? 50.323  -10.059 28.486  1.00 23.83 ? 66  ARG A C   1 
ATOM   357   O O   . ARG A 1 49  ? 49.222  -9.549  28.240  1.00 21.66 ? 66  ARG A O   1 
ATOM   358   C CB  . ARG A 1 49  ? 50.551  -9.379  30.871  1.00 24.52 ? 66  ARG A CB  1 
ATOM   359   C CG  . ARG A 1 49  ? 51.435  -8.963  32.022  1.00 30.83 ? 66  ARG A CG  1 
ATOM   360   C CD  . ARG A 1 49  ? 50.612  -8.791  33.281  1.00 39.94 ? 66  ARG A CD  1 
ATOM   361   N NE  . ARG A 1 49  ? 50.050  -10.054 33.764  1.00 46.59 ? 66  ARG A NE  1 
ATOM   362   C CZ  . ARG A 1 49  ? 49.119  -10.158 34.715  1.00 50.41 ? 66  ARG A CZ  1 
ATOM   363   N NH1 . ARG A 1 49  ? 48.620  -9.067  35.293  1.00 53.71 ? 66  ARG A NH1 1 
ATOM   364   N NH2 . ARG A 1 49  ? 48.736  -11.357 35.147  1.00 49.96 ? 66  ARG A NH2 1 
ATOM   365   N N   . LEU A 1 50  ? 50.788  -11.117 27.831  1.00 24.04 ? 67  LEU A N   1 
ATOM   366   C CA  . LEU A 1 50  ? 49.977  -11.789 26.818  1.00 25.59 ? 67  LEU A CA  1 
ATOM   367   C C   . LEU A 1 50  ? 49.330  -13.037 27.381  1.00 27.14 ? 67  LEU A C   1 
ATOM   368   O O   . LEU A 1 50  ? 49.612  -13.405 28.508  1.00 30.84 ? 67  LEU A O   1 
ATOM   369   C CB  . LEU A 1 50  ? 50.832  -12.177 25.617  1.00 23.93 ? 67  LEU A CB  1 
ATOM   370   C CG  . LEU A 1 50  ? 51.630  -11.052 24.981  1.00 24.24 ? 67  LEU A CG  1 
ATOM   371   C CD1 . LEU A 1 50  ? 52.897  -10.787 25.796  1.00 22.14 ? 67  LEU A CD1 1 
ATOM   372   C CD2 . LEU A 1 50  ? 51.952  -11.450 23.552  1.00 25.29 ? 67  LEU A CD2 1 
ATOM   373   N N   . GLY A 1 51  ? 48.468  -13.681 26.598  1.00 27.64 ? 69  GLY A N   1 
ATOM   374   C CA  . GLY A 1 51  ? 47.816  -14.903 27.030  1.00 29.97 ? 69  GLY A CA  1 
ATOM   375   C C   . GLY A 1 51  ? 47.318  -14.916 28.460  1.00 35.36 ? 69  GLY A C   1 
ATOM   376   O O   . GLY A 1 51  ? 47.429  -15.925 29.148  1.00 36.11 ? 69  GLY A O   1 
ATOM   377   N N   . GLU A 1 52  ? 46.768  -13.797 28.910  1.00 37.00 ? 70  GLU A N   1 
ATOM   378   C CA  . GLU A 1 52  ? 46.240  -13.683 30.262  1.00 34.27 ? 70  GLU A CA  1 
ATOM   379   C C   . GLU A 1 52  ? 44.812  -14.193 30.337  1.00 32.11 ? 70  GLU A C   1 
ATOM   380   O O   . GLU A 1 52  ? 44.059  -14.145 29.367  1.00 31.12 ? 70  GLU A O   1 
ATOM   381   C CB  . GLU A 1 52  ? 46.227  -12.226 30.696  1.00 35.42 ? 70  GLU A CB  1 
ATOM   382   C CG  . GLU A 1 52  ? 47.574  -11.625 30.912  1.00 39.09 ? 70  GLU A CG  1 
ATOM   383   C CD  . GLU A 1 52  ? 48.230  -12.151 32.154  1.00 42.04 ? 70  GLU A CD  1 
ATOM   384   O OE1 . GLU A 1 52  ? 47.501  -12.541 33.092  1.00 40.34 ? 70  GLU A OE1 1 
ATOM   385   O OE2 . GLU A 1 52  ? 49.477  -12.164 32.194  1.00 46.03 ? 70  GLU A OE2 1 
ATOM   386   N N   . ASP A 1 53  ? 44.456  -14.705 31.499  1.00 30.84 ? 71  ASP A N   1 
ATOM   387   C CA  . ASP A 1 53  ? 43.113  -15.190 31.759  1.00 32.31 ? 71  ASP A CA  1 
ATOM   388   C C   . ASP A 1 53  ? 42.745  -14.336 32.958  1.00 33.43 ? 71  ASP A C   1 
ATOM   389   O O   . ASP A 1 53  ? 41.928  -13.420 32.860  1.00 33.93 ? 71  ASP A O   1 
ATOM   390   C CB  . ASP A 1 53  ? 43.145  -16.674 32.134  0.00 31.76 ? 71  ASP A CB  1 
ATOM   391   C CG  . ASP A 1 53  ? 41.762  -17.249 32.370  0.00 31.39 ? 71  ASP A CG  1 
ATOM   392   O OD1 . ASP A 1 53  ? 41.354  -17.356 33.546  0.00 30.08 ? 71  ASP A OD1 1 
ATOM   393   O OD2 . ASP A 1 53  ? 41.085  -17.596 31.380  0.00 30.13 ? 71  ASP A OD2 1 
ATOM   394   N N   . ASN A 1 54  ? 43.428  -14.595 34.066  1.00 34.19 ? 72  ASN A N   1 
ATOM   395   C CA  . ASN A 1 54  ? 43.232  -13.835 35.290  1.00 36.77 ? 72  ASN A CA  1 
ATOM   396   C C   . ASN A 1 54  ? 44.470  -12.946 35.370  1.00 38.90 ? 72  ASN A C   1 
ATOM   397   O O   . ASN A 1 54  ? 45.594  -13.441 35.239  1.00 39.44 ? 72  ASN A O   1 
ATOM   398   C CB  . ASN A 1 54  ? 43.159  -14.768 36.505  1.00 34.70 ? 72  ASN A CB  1 
ATOM   399   C CG  . ASN A 1 54  ? 43.004  -14.015 37.812  0.00 34.00 ? 72  ASN A CG  1 
ATOM   400   O OD1 . ASN A 1 54  ? 43.916  -13.320 38.249  0.00 34.18 ? 72  ASN A OD1 1 
ATOM   401   N ND2 . ASN A 1 54  ? 41.857  -14.175 38.455  0.00 34.41 ? 72  ASN A ND2 1 
ATOM   402   N N   . ILE A 1 55  ? 44.279  -11.636 35.501  1.00 39.45 ? 73  ILE A N   1 
ATOM   403   C CA  . ILE A 1 55  ? 45.417  -10.729 35.575  1.00 37.45 ? 73  ILE A CA  1 
ATOM   404   C C   . ILE A 1 55  ? 45.961  -10.573 36.988  1.00 38.52 ? 73  ILE A C   1 
ATOM   405   O O   . ILE A 1 55  ? 46.288  -9.471  37.409  1.00 43.72 ? 73  ILE A O   1 
ATOM   406   C CB  . ILE A 1 55  ? 45.124  -9.337  34.921  1.00 35.85 ? 73  ILE A CB  1 
ATOM   407   C CG1 . ILE A 1 55  ? 43.722  -8.839  35.251  1.00 37.09 ? 73  ILE A CG1 1 
ATOM   408   C CG2 . ILE A 1 55  ? 45.290  -9.417  33.432  1.00 33.17 ? 73  ILE A CG2 1 
ATOM   409   C CD1 . ILE A 1 55  ? 43.564  -8.271  36.655  1.00 41.29 ? 73  ILE A CD1 1 
ATOM   410   N N   . ASN A 1 56  ? 46.067  -11.680 37.715  1.00 38.89 ? 74  ASN A N   1 
ATOM   411   C CA  . ASN A 1 56  ? 46.588  -11.670 39.080  1.00 42.90 ? 74  ASN A CA  1 
ATOM   412   C C   . ASN A 1 56  ? 47.213  -13.029 39.400  1.00 47.01 ? 74  ASN A C   1 
ATOM   413   O O   . ASN A 1 56  ? 48.243  -13.110 40.066  1.00 47.02 ? 74  ASN A O   1 
ATOM   414   C CB  . ASN A 1 56  ? 45.487  -11.328 40.095  1.00 41.87 ? 74  ASN A CB  1 
ATOM   415   C CG  . ASN A 1 56  ? 44.972  -9.901  39.950  1.00 41.43 ? 74  ASN A CG  1 
ATOM   416   O OD1 . ASN A 1 56  ? 43.791  -9.674  39.676  1.00 38.00 ? 74  ASN A OD1 1 
ATOM   417   N ND2 . ASN A 1 56  ? 45.859  -8.934  40.132  1.00 41.38 ? 74  ASN A ND2 1 
ATOM   418   N N   . VAL A 1 57  ? 46.604  -14.097 38.899  1.00 50.00 ? 75  VAL A N   1 
ATOM   419   C CA  . VAL A 1 57  ? 47.114  -15.444 39.130  1.00 51.35 ? 75  VAL A CA  1 
ATOM   420   C C   . VAL A 1 57  ? 47.723  -15.998 37.840  1.00 53.51 ? 75  VAL A C   1 
ATOM   421   O O   . VAL A 1 57  ? 47.258  -15.655 36.746  1.00 55.38 ? 75  VAL A O   1 
ATOM   422   C CB  . VAL A 1 57  ? 45.983  -16.396 39.600  0.00 50.12 ? 75  VAL A CB  1 
ATOM   423   C CG1 . VAL A 1 57  ? 46.556  -17.750 39.997  0.00 48.24 ? 75  VAL A CG1 1 
ATOM   424   C CG2 . VAL A 1 57  ? 45.220  -15.779 40.763  0.00 48.36 ? 75  VAL A CG2 1 
ATOM   425   N N   . VAL A 1 58  ? 48.747  -16.851 37.958  1.00 54.63 ? 76  VAL A N   1 
ATOM   426   C CA  . VAL A 1 58  ? 49.399  -17.450 36.779  1.00 55.75 ? 76  VAL A CA  1 
ATOM   427   C C   . VAL A 1 58  ? 48.517  -18.542 36.163  1.00 47.81 ? 76  VAL A C   1 
ATOM   428   O O   . VAL A 1 58  ? 48.672  -19.724 36.458  1.00 47.27 ? 76  VAL A O   1 
ATOM   429   C CB  . VAL A 1 58  ? 50.826  -18.027 37.102  1.00 61.54 ? 76  VAL A CB  1 
ATOM   430   C CG1 . VAL A 1 58  ? 51.439  -18.657 35.856  1.00 66.24 ? 76  VAL A CG1 1 
ATOM   431   C CG2 . VAL A 1 58  ? 51.764  -16.924 37.622  1.00 65.89 ? 76  VAL A CG2 1 
ATOM   432   N N   . GLU A 1 59  ? 47.575  -18.130 35.321  0.00 41.14 ? 77  GLU A N   1 
ATOM   433   C CA  . GLU A 1 59  ? 46.666  -19.068 34.676  0.00 33.43 ? 77  GLU A CA  1 
ATOM   434   C C   . GLU A 1 59  ? 47.301  -19.741 33.464  0.00 29.57 ? 77  GLU A C   1 
ATOM   435   O O   . GLU A 1 59  ? 46.894  -19.513 32.322  0.00 28.40 ? 77  GLU A O   1 
ATOM   436   C CB  . GLU A 1 59  ? 45.364  -18.366 34.281  0.00 30.66 ? 77  GLU A CB  1 
ATOM   437   C CG  . GLU A 1 59  ? 44.543  -17.867 35.462  0.00 24.47 ? 77  GLU A CG  1 
ATOM   438   C CD  . GLU A 1 59  ? 44.071  -18.989 36.368  0.00 21.06 ? 77  GLU A CD  1 
ATOM   439   O OE1 . GLU A 1 59  ? 43.080  -19.663 36.017  0.00 19.74 ? 77  GLU A OE1 1 
ATOM   440   O OE2 . GLU A 1 59  ? 44.690  -19.196 37.434  0.00 19.74 ? 77  GLU A OE2 1 
ATOM   441   N N   . GLY A 1 60  ? 48.305  -20.573 33.726  0.00 25.92 ? 78  GLY A N   1 
ATOM   442   C CA  . GLY A 1 60  ? 48.990  -21.283 32.664  0.00 21.71 ? 78  GLY A CA  1 
ATOM   443   C C   . GLY A 1 60  ? 49.816  -20.375 31.775  0.00 19.26 ? 78  GLY A C   1 
ATOM   444   O O   . GLY A 1 60  ? 51.032  -20.278 31.934  0.00 18.64 ? 78  GLY A O   1 
ATOM   445   N N   . ASN A 1 61  ? 49.153  -19.709 30.838  0.00 17.86 ? 79  ASN A N   1 
ATOM   446   C CA  . ASN A 1 61  ? 49.826  -18.809 29.912  0.00 16.78 ? 79  ASN A CA  1 
ATOM   447   C C   . ASN A 1 61  ? 50.217  -17.527 30.635  0.00 16.33 ? 79  ASN A C   1 
ATOM   448   O O   . ASN A 1 61  ? 49.357  -16.777 31.099  0.00 16.18 ? 79  ASN A O   1 
ATOM   449   C CB  . ASN A 1 61  ? 48.916  -18.487 28.723  0.00 16.47 ? 79  ASN A CB  1 
ATOM   450   C CG  . ASN A 1 61  ? 48.453  -19.731 27.989  0.00 16.05 ? 79  ASN A CG  1 
ATOM   451   O OD1 . ASN A 1 61  ? 49.247  -20.415 27.348  0.00 16.03 ? 79  ASN A OD1 1 
ATOM   452   N ND2 . ASN A 1 61  ? 47.165  -20.025 28.070  0.00 16.12 ? 79  ASN A ND2 1 
ATOM   453   N N   . GLU A 1 62  ? 51.519  -17.303 30.765  0.00 15.98 ? 80  GLU A N   1 
ATOM   454   C CA  . GLU A 1 62  ? 52.028  -16.116 31.437  0.00 15.69 ? 80  GLU A CA  1 
ATOM   455   C C   . GLU A 1 62  ? 53.226  -15.591 30.660  0.00 15.32 ? 80  GLU A C   1 
ATOM   456   O O   . GLU A 1 62  ? 54.258  -16.257 30.574  0.00 15.37 ? 80  GLU A O   1 
ATOM   457   C CB  . GLU A 1 62  ? 52.440  -16.464 32.870  0.00 15.94 ? 80  GLU A CB  1 
ATOM   458   C CG  . GLU A 1 62  ? 51.971  -15.464 33.918  0.00 15.99 ? 80  GLU A CG  1 
ATOM   459   C CD  . GLU A 1 62  ? 50.456  -15.347 33.996  0.00 16.13 ? 80  GLU A CD  1 
ATOM   460   O OE1 . GLU A 1 62  ? 49.760  -16.372 33.828  0.00 16.19 ? 80  GLU A OE1 1 
ATOM   461   O OE2 . GLU A 1 62  ? 49.960  -14.227 34.235  0.00 16.18 ? 80  GLU A OE2 1 
ATOM   462   N N   . GLN A 1 63  ? 53.075  -14.412 30.066  0.00 14.71 ? 81  GLN A N   1 
ATOM   463   C CA  . GLN A 1 63  ? 54.150  -13.813 29.283  0.00 14.01 ? 81  GLN A CA  1 
ATOM   464   C C   . GLN A 1 63  ? 54.274  -12.311 29.507  0.00 13.33 ? 81  GLN A C   1 
ATOM   465   O O   . GLN A 1 63  ? 53.472  -11.538 28.986  0.00 12.98 ? 81  GLN A O   1 
ATOM   466   C CB  . GLN A 1 63  ? 53.931  -14.073 27.789  0.00 14.60 ? 81  GLN A CB  1 
ATOM   467   C CG  . GLN A 1 63  ? 53.992  -15.532 27.373  0.00 15.22 ? 81  GLN A CG  1 
ATOM   468   C CD  . GLN A 1 63  ? 53.740  -15.725 25.892  0.00 15.80 ? 81  GLN A CD  1 
ATOM   469   O OE1 . GLN A 1 63  ? 54.225  -14.959 25.059  0.00 15.74 ? 81  GLN A OE1 1 
ATOM   470   N NE2 . GLN A 1 63  ? 52.979  -16.755 25.553  0.00 15.87 ? 81  GLN A NE2 1 
ATOM   471   N N   . PHE A 1 64  ? 55.250  -11.907 30.312  1.00 12.10 ? 82  PHE A N   1 
ATOM   472   C CA  . PHE A 1 64  ? 55.495  -10.493 30.573  1.00 12.33 ? 82  PHE A CA  1 
ATOM   473   C C   . PHE A 1 64  ? 56.698  -10.116 29.685  1.00 13.05 ? 82  PHE A C   1 
ATOM   474   O O   . PHE A 1 64  ? 57.797  -10.634 29.870  1.00 18.06 ? 82  PHE A O   1 
ATOM   475   C CB  . PHE A 1 64  ? 55.857  -10.254 32.050  1.00 12.95 ? 82  PHE A CB  1 
ATOM   476   C CG  . PHE A 1 64  ? 54.790  -10.666 33.039  0.00 14.47 ? 82  PHE A CG  1 
ATOM   477   C CD1 . PHE A 1 64  ? 54.241  -11.946 33.019  0.00 15.15 ? 82  PHE A CD1 1 
ATOM   478   C CD2 . PHE A 1 64  ? 54.359  -9.773  34.016  0.00 14.95 ? 82  PHE A CD2 1 
ATOM   479   C CE1 . PHE A 1 64  ? 53.281  -12.326 33.956  0.00 15.65 ? 82  PHE A CE1 1 
ATOM   480   C CE2 . PHE A 1 64  ? 53.399  -10.145 34.957  0.00 15.83 ? 82  PHE A CE2 1 
ATOM   481   C CZ  . PHE A 1 64  ? 52.860  -11.425 34.926  0.00 16.10 ? 82  PHE A CZ  1 
ATOM   482   N N   . ILE A 1 65  ? 56.487  -9.264  28.692  1.00 8.58  ? 83  ILE A N   1 
ATOM   483   C CA  . ILE A 1 65  ? 57.558  -8.848  27.799  1.00 5.00  ? 83  ILE A CA  1 
ATOM   484   C C   . ILE A 1 65  ? 57.679  -7.331  27.823  1.00 5.64  ? 83  ILE A C   1 
ATOM   485   O O   . ILE A 1 65  ? 56.681  -6.614  27.754  1.00 8.51  ? 83  ILE A O   1 
ATOM   486   C CB  . ILE A 1 65  ? 57.262  -9.271  26.352  1.00 5.00  ? 83  ILE A CB  1 
ATOM   487   C CG1 . ILE A 1 65  ? 57.061  -10.774 26.260  1.00 5.00  ? 83  ILE A CG1 1 
ATOM   488   C CG2 . ILE A 1 65  ? 58.378  -8.849  25.430  1.00 5.00  ? 83  ILE A CG2 1 
ATOM   489   C CD1 . ILE A 1 65  ? 56.689  -11.246 24.870  1.00 5.00  ? 83  ILE A CD1 1 
ATOM   490   N N   . SER A 1 66  ? 58.899  -6.824  27.901  1.00 7.90  ? 84  SER A N   1 
ATOM   491   C CA  . SER A 1 66  ? 59.089  -5.376  27.908  1.00 6.37  ? 84  SER A CA  1 
ATOM   492   C C   . SER A 1 66  ? 58.884  -4.827  26.483  1.00 6.05  ? 84  SER A C   1 
ATOM   493   O O   . SER A 1 66  ? 59.040  -5.551  25.502  1.00 7.58  ? 84  SER A O   1 
ATOM   494   C CB  . SER A 1 66  ? 60.491  -5.058  28.413  1.00 5.00  ? 84  SER A CB  1 
ATOM   495   O OG  . SER A 1 66  ? 60.979  -6.114  29.223  0.00 6.36  ? 84  SER A OG  1 
ATOM   496   N N   . ALA A 1 67  ? 58.513  -3.564  26.358  1.00 5.00  ? 85  ALA A N   1 
ATOM   497   C CA  . ALA A 1 67  ? 58.319  -2.981  25.039  1.00 7.10  ? 85  ALA A CA  1 
ATOM   498   C C   . ALA A 1 67  ? 59.577  -2.248  24.556  1.00 13.81 ? 85  ALA A C   1 
ATOM   499   O O   . ALA A 1 67  ? 60.081  -1.368  25.273  1.00 17.86 ? 85  ALA A O   1 
ATOM   500   C CB  . ALA A 1 67  ? 57.188  -2.033  25.098  1.00 5.36  ? 85  ALA A CB  1 
ATOM   501   N N   . SER A 1 68  ? 60.101  -2.604  23.372  1.00 12.97 ? 86  SER A N   1 
ATOM   502   C CA  . SER A 1 68  ? 61.305  -1.941  22.831  1.00 9.51  ? 86  SER A CA  1 
ATOM   503   C C   . SER A 1 68  ? 60.933  -0.540  22.395  1.00 9.75  ? 86  SER A C   1 
ATOM   504   O O   . SER A 1 68  ? 61.317  0.418   23.041  1.00 12.48 ? 86  SER A O   1 
ATOM   505   C CB  . SER A 1 68  ? 61.882  -2.700  21.641  1.00 6.79  ? 86  SER A CB  1 
ATOM   506   O OG  . SER A 1 68  ? 63.189  -2.273  21.309  0.00 7.49  ? 86  SER A OG  1 
ATOM   507   N N   . LYS A 1 69  ? 60.160  -0.416  21.320  1.00 10.47 ? 87  LYS A N   1 
ATOM   508   C CA  . LYS A 1 69  ? 59.731  0.893   20.814  1.00 8.69  ? 87  LYS A CA  1 
ATOM   509   C C   . LYS A 1 69  ? 58.221  1.041   21.036  1.00 10.31 ? 87  LYS A C   1 
ATOM   510   O O   . LYS A 1 69  ? 57.475  0.088   20.807  1.00 12.34 ? 87  LYS A O   1 
ATOM   511   C CB  . LYS A 1 69  ? 60.017  1.030   19.306  1.00 5.00  ? 87  LYS A CB  1 
ATOM   512   C CG  . LYS A 1 69  ? 61.471  0.980   18.868  1.00 5.00  ? 87  LYS A CG  1 
ATOM   513   C CD  . LYS A 1 69  ? 62.012  -0.437  18.814  0.00 6.75  ? 87  LYS A CD  1 
ATOM   514   C CE  . LYS A 1 69  ? 63.419  -0.473  18.236  0.00 7.43  ? 87  LYS A CE  1 
ATOM   515   N NZ  . LYS A 1 69  ? 63.444  -0.083  16.797  0.00 7.71  ? 87  LYS A NZ  1 
ATOM   516   N N   . SER A 1 70  ? 57.784  2.185   21.560  1.00 10.94 ? 88  SER A N   1 
ATOM   517   C CA  . SER A 1 70  ? 56.357  2.476   21.776  1.00 8.85  ? 88  SER A CA  1 
ATOM   518   C C   . SER A 1 70  ? 56.063  3.684   20.865  1.00 9.02  ? 88  SER A C   1 
ATOM   519   O O   . SER A 1 70  ? 56.172  4.838   21.278  1.00 10.58 ? 88  SER A O   1 
ATOM   520   C CB  . SER A 1 70  ? 56.078  2.798   23.256  1.00 5.00  ? 88  SER A CB  1 
ATOM   521   O OG  . SER A 1 70  ? 56.473  1.718   24.092  0.00 5.92  ? 88  SER A OG  1 
ATOM   522   N N   . ILE A 1 71  ? 55.720  3.398   19.612  1.00 6.27  ? 89  ILE A N   1 
ATOM   523   C CA  . ILE A 1 71  ? 55.464  4.415   18.589  1.00 5.00  ? 89  ILE A CA  1 
ATOM   524   C C   . ILE A 1 71  ? 54.024  4.935   18.551  1.00 6.36  ? 89  ILE A C   1 
ATOM   525   O O   . ILE A 1 71  ? 53.113  4.245   18.095  1.00 5.00  ? 89  ILE A O   1 
ATOM   526   C CB  . ILE A 1 71  ? 55.840  3.836   17.192  1.00 5.74  ? 89  ILE A CB  1 
ATOM   527   C CG1 . ILE A 1 71  ? 57.290  3.346   17.189  1.00 5.00  ? 89  ILE A CG1 1 
ATOM   528   C CG2 . ILE A 1 71  ? 55.627  4.862   16.096  1.00 5.32  ? 89  ILE A CG2 1 
ATOM   529   C CD1 . ILE A 1 71  ? 57.630  2.460   16.031  1.00 5.00  ? 89  ILE A CD1 1 
ATOM   530   N N   . VAL A 1 72  ? 53.833  6.174   18.995  1.00 9.06  ? 90  VAL A N   1 
ATOM   531   C CA  . VAL A 1 72  ? 52.500  6.825   19.039  1.00 8.47  ? 90  VAL A CA  1 
ATOM   532   C C   . VAL A 1 72  ? 52.181  7.438   17.681  1.00 7.56  ? 90  VAL A C   1 
ATOM   533   O O   . VAL A 1 72  ? 53.092  7.862   17.008  1.00 14.44 ? 90  VAL A O   1 
ATOM   534   C CB  . VAL A 1 72  ? 52.496  7.944   20.139  1.00 5.00  ? 90  VAL A CB  1 
ATOM   535   C CG1 . VAL A 1 72  ? 51.353  8.881   19.970  1.00 5.00  ? 90  VAL A CG1 1 
ATOM   536   C CG2 . VAL A 1 72  ? 52.458  7.321   21.516  1.00 5.00  ? 90  VAL A CG2 1 
ATOM   537   N N   . HIS A 1 73  ? 50.929  7.473   17.246  1.00 5.00  ? 91  HIS A N   1 
ATOM   538   C CA  . HIS A 1 73  ? 50.637  8.085   15.951  1.00 5.00  ? 91  HIS A CA  1 
ATOM   539   C C   . HIS A 1 73  ? 50.991  9.574   15.955  1.00 5.00  ? 91  HIS A C   1 
ATOM   540   O O   . HIS A 1 73  ? 50.516  10.311  16.792  1.00 6.50  ? 91  HIS A O   1 
ATOM   541   C CB  . HIS A 1 73  ? 49.171  7.905   15.570  1.00 6.18  ? 91  HIS A CB  1 
ATOM   542   C CG  . HIS A 1 73  ? 48.856  8.306   14.156  1.00 6.92  ? 91  HIS A CG  1 
ATOM   543   N ND1 . HIS A 1 73  ? 48.724  9.625   13.768  1.00 5.00  ? 91  HIS A ND1 1 
ATOM   544   C CD2 . HIS A 1 73  ? 48.626  7.562   13.045  1.00 5.00  ? 91  HIS A CD2 1 
ATOM   545   C CE1 . HIS A 1 73  ? 48.420  9.674   12.482  1.00 5.00  ? 91  HIS A CE1 1 
ATOM   546   N NE2 . HIS A 1 73  ? 48.354  8.438   12.019  1.00 5.00  ? 91  HIS A NE2 1 
ATOM   547   N N   . PRO A 1 74  ? 51.731  10.046  14.935  1.00 7.85  ? 92  PRO A N   1 
ATOM   548   C CA  . PRO A 1 74  ? 52.215  11.414  14.704  1.00 11.17 ? 92  PRO A CA  1 
ATOM   549   C C   . PRO A 1 74  ? 51.210  12.545  14.596  1.00 16.35 ? 92  PRO A C   1 
ATOM   550   O O   . PRO A 1 74  ? 51.589  13.682  14.297  1.00 14.86 ? 92  PRO A O   1 
ATOM   551   C CB  . PRO A 1 74  ? 52.947  11.286  13.381  1.00 11.30 ? 92  PRO A CB  1 
ATOM   552   C CG  . PRO A 1 74  ? 52.158  10.244  12.676  1.00 9.91  ? 92  PRO A CG  1 
ATOM   553   C CD  . PRO A 1 74  ? 52.056  9.214   13.762  1.00 10.01 ? 92  PRO A CD  1 
ATOM   554   N N   . SER A 1 75  ? 49.933  12.238  14.788  1.00 20.33 ? 93  SER A N   1 
ATOM   555   C CA  . SER A 1 75  ? 48.906  13.264  14.696  1.00 19.23 ? 93  SER A CA  1 
ATOM   556   C C   . SER A 1 75  ? 47.905  13.089  15.800  1.00 16.07 ? 93  SER A C   1 
ATOM   557   O O   . SER A 1 75  ? 46.887  13.770  15.819  1.00 17.48 ? 93  SER A O   1 
ATOM   558   C CB  . SER A 1 75  ? 48.186  13.213  13.343  1.00 20.15 ? 93  SER A CB  1 
ATOM   559   O OG  . SER A 1 75  ? 49.103  13.321  12.270  1.00 22.83 ? 93  SER A OG  1 
ATOM   560   N N   . TYR A 1 76  ? 48.171  12.151  16.700  1.00 12.60 ? 94  TYR A N   1 
ATOM   561   C CA  . TYR A 1 76  ? 47.263  11.924  17.804  1.00 12.24 ? 94  TYR A CA  1 
ATOM   562   C C   . TYR A 1 76  ? 47.105  13.242  18.557  1.00 16.02 ? 94  TYR A C   1 
ATOM   563   O O   . TYR A 1 76  ? 48.096  13.898  18.869  1.00 18.06 ? 94  TYR A O   1 
ATOM   564   C CB  . TYR A 1 76  ? 47.808  10.843  18.725  1.00 7.32  ? 94  TYR A CB  1 
ATOM   565   C CG  . TYR A 1 76  ? 47.315  10.957  20.129  1.00 5.00  ? 94  TYR A CG  1 
ATOM   566   C CD1 . TYR A 1 76  ? 48.189  11.230  21.162  1.00 7.01  ? 94  TYR A CD1 1 
ATOM   567   C CD2 . TYR A 1 76  ? 45.982  10.848  20.425  1.00 5.00  ? 94  TYR A CD2 1 
ATOM   568   C CE1 . TYR A 1 76  ? 47.744  11.398  22.468  1.00 6.99  ? 94  TYR A CE1 1 
ATOM   569   C CE2 . TYR A 1 76  ? 45.526  11.019  21.730  1.00 6.36  ? 94  TYR A CE2 1 
ATOM   570   C CZ  . TYR A 1 76  ? 46.412  11.291  22.751  1.00 5.00  ? 94  TYR A CZ  1 
ATOM   571   O OH  . TYR A 1 76  ? 45.982  11.426  24.058  1.00 5.00  ? 94  TYR A OH  1 
ATOM   572   N N   . ASN A 1 77  ? 45.863  13.669  18.771  1.00 18.05 ? 95  ASN A N   1 
ATOM   573   C CA  . ASN A 1 77  ? 45.627  14.909  19.494  1.00 19.53 ? 95  ASN A CA  1 
ATOM   574   C C   . ASN A 1 77  ? 45.126  14.551  20.879  1.00 19.30 ? 95  ASN A C   1 
ATOM   575   O O   . ASN A 1 77  ? 44.028  14.044  21.033  1.00 16.71 ? 95  ASN A O   1 
ATOM   576   C CB  . ASN A 1 77  ? 44.621  15.804  18.758  1.00 19.07 ? 95  ASN A CB  1 
ATOM   577   C CG  . ASN A 1 77  ? 44.477  17.166  19.397  0.00 19.03 ? 95  ASN A CG  1 
ATOM   578   O OD1 . ASN A 1 77  ? 43.778  17.319  20.394  0.00 18.95 ? 95  ASN A OD1 1 
ATOM   579   N ND2 . ASN A 1 77  ? 45.131  18.165  18.823  0.00 19.06 ? 95  ASN A ND2 1 
ATOM   580   N N   . SER A 1 78  ? 45.959  14.782  21.884  1.00 21.10 ? 96  SER A N   1 
ATOM   581   C CA  . SER A 1 78  ? 45.608  14.482  23.264  1.00 20.42 ? 96  SER A CA  1 
ATOM   582   C C   . SER A 1 78  ? 44.320  15.138  23.727  1.00 20.17 ? 96  SER A C   1 
ATOM   583   O O   . SER A 1 78  ? 43.775  14.764  24.757  1.00 19.92 ? 96  SER A O   1 
ATOM   584   C CB  . SER A 1 78  ? 46.747  14.896  24.188  1.00 20.91 ? 96  SER A CB  1 
ATOM   585   O OG  . SER A 1 78  ? 47.219  16.191  23.851  1.00 23.96 ? 96  SER A OG  1 
ATOM   586   N N   . ASN A 1 79  ? 43.861  16.150  23.007  1.00 21.64 ? 97  ASN A N   1 
ATOM   587   C CA  . ASN A 1 79  ? 42.632  16.804  23.404  1.00 25.12 ? 97  ASN A CA  1 
ATOM   588   C C   . ASN A 1 79  ? 41.436  16.142  22.747  1.00 23.18 ? 97  ASN A C   1 
ATOM   589   O O   . ASN A 1 79  ? 40.612  15.540  23.425  1.00 28.19 ? 97  ASN A O   1 
ATOM   590   C CB  . ASN A 1 79  ? 42.660  18.300  23.092  1.00 33.22 ? 97  ASN A CB  1 
ATOM   591   C CG  . ASN A 1 79  ? 43.647  19.062  23.962  1.00 40.11 ? 97  ASN A CG  1 
ATOM   592   O OD1 . ASN A 1 79  ? 44.741  18.581  24.264  1.00 43.20 ? 97  ASN A OD1 1 
ATOM   593   N ND2 . ASN A 1 79  ? 43.264  20.263  24.364  1.00 44.83 ? 97  ASN A ND2 1 
ATOM   594   N N   . THR A 1 80  ? 41.369  16.186  21.426  1.00 17.45 ? 98  THR A N   1 
ATOM   595   C CA  . THR A 1 80  ? 40.243  15.600  20.716  1.00 14.76 ? 98  THR A CA  1 
ATOM   596   C C   . THR A 1 80  ? 40.232  14.076  20.711  1.00 13.25 ? 98  THR A C   1 
ATOM   597   O O   . THR A 1 80  ? 39.215  13.451  20.423  1.00 14.48 ? 98  THR A O   1 
ATOM   598   C CB  . THR A 1 80  ? 40.238  16.050  19.265  1.00 14.38 ? 98  THR A CB  1 
ATOM   599   O OG1 . THR A 1 80  ? 41.291  15.398  18.564  1.00 20.79 ? 98  THR A OG1 1 
ATOM   600   C CG2 . THR A 1 80  ? 40.481  17.513  19.174  1.00 15.78 ? 98  THR A CG2 1 
ATOM   601   N N   . LEU A 1 81  ? 41.367  13.487  21.047  1.00 10.96 ? 99  LEU A N   1 
ATOM   602   C CA  . LEU A 1 81  ? 41.550  12.047  21.019  1.00 8.10  ? 99  LEU A CA  1 
ATOM   603   C C   . LEU A 1 81  ? 41.377  11.564  19.584  1.00 7.28  ? 99  LEU A C   1 
ATOM   604   O O   . LEU A 1 81  ? 40.914  10.454  19.351  1.00 8.91  ? 99  LEU A O   1 
ATOM   605   C CB  . LEU A 1 81  ? 40.630  11.292  21.980  1.00 5.00  ? 99  LEU A CB  1 
ATOM   606   C CG  . LEU A 1 81  ? 40.816  11.575  23.475  1.00 6.82  ? 99  LEU A CG  1 
ATOM   607   C CD1 . LEU A 1 81  ? 39.967  10.649  24.306  1.00 6.65  ? 99  LEU A CD1 1 
ATOM   608   C CD2 . LEU A 1 81  ? 42.238  11.398  23.882  1.00 8.56  ? 99  LEU A CD2 1 
ATOM   609   N N   . ASN A 1 82  ? 41.737  12.408  18.620  1.00 5.00  ? 100 ASN A N   1 
ATOM   610   C CA  . ASN A 1 82  ? 41.648  12.023  17.225  1.00 5.00  ? 100 ASN A CA  1 
ATOM   611   C C   . ASN A 1 82  ? 42.940  11.307  16.956  1.00 6.10  ? 100 ASN A C   1 
ATOM   612   O O   . ASN A 1 82  ? 43.973  11.708  17.470  1.00 8.30  ? 100 ASN A O   1 
ATOM   613   C CB  . ASN A 1 82  ? 41.549  13.249  16.329  1.00 5.00  ? 100 ASN A CB  1 
ATOM   614   C CG  . ASN A 1 82  ? 41.221  12.898  14.894  1.00 5.00  ? 100 ASN A CG  1 
ATOM   615   O OD1 . ASN A 1 82  ? 40.770  11.803  14.594  1.00 5.00  ? 100 ASN A OD1 1 
ATOM   616   N ND2 . ASN A 1 82  ? 41.428  13.842  14.001  1.00 9.48  ? 100 ASN A ND2 1 
ATOM   617   N N   . ASN A 1 83  ? 42.886  10.248  16.165  1.00 7.15  ? 101 ASN A N   1 
ATOM   618   C CA  . ASN A 1 83  ? 44.071  9.476   15.846  1.00 6.76  ? 101 ASN A CA  1 
ATOM   619   C C   . ASN A 1 83  ? 44.604  8.803   17.100  1.00 11.40 ? 101 ASN A C   1 
ATOM   620   O O   . ASN A 1 83  ? 45.806  8.759   17.333  1.00 13.31 ? 101 ASN A O   1 
ATOM   621   C CB  . ASN A 1 83  ? 45.151  10.352  15.248  1.00 6.16  ? 101 ASN A CB  1 
ATOM   622   C CG  . ASN A 1 83  ? 44.787  10.882  13.896  1.00 8.59  ? 101 ASN A CG  1 
ATOM   623   O OD1 . ASN A 1 83  ? 44.620  10.130  12.936  1.00 9.13  ? 101 ASN A OD1 1 
ATOM   624   N ND2 . ASN A 1 83  ? 44.732  12.195  13.784  1.00 12.13 ? 101 ASN A ND2 1 
ATOM   625   N N   . ASP A 1 84  ? 43.702  8.312   17.937  1.00 13.52 ? 102 ASP A N   1 
ATOM   626   C CA  . ASP A 1 84  ? 44.093  7.599   19.147  1.00 13.16 ? 102 ASP A CA  1 
ATOM   627   C C   . ASP A 1 84  ? 44.556  6.190   18.740  1.00 13.09 ? 102 ASP A C   1 
ATOM   628   O O   . ASP A 1 84  ? 43.763  5.261   18.768  1.00 14.31 ? 102 ASP A O   1 
ATOM   629   C CB  . ASP A 1 84  ? 42.897  7.508   20.098  0.00 14.93 ? 102 ASP A CB  1 
ATOM   630   C CG  . ASP A 1 84  ? 43.213  6.740   21.362  0.00 16.66 ? 102 ASP A CG  1 
ATOM   631   O OD1 . ASP A 1 84  ? 44.233  7.051   22.010  0.00 17.89 ? 102 ASP A OD1 1 
ATOM   632   O OD2 . ASP A 1 84  ? 42.442  5.821   21.707  0.00 17.59 ? 102 ASP A OD2 1 
ATOM   633   N N   . ILE A 1 85  ? 45.800  6.059   18.270  1.00 12.41 ? 103 ILE A N   1 
ATOM   634   C CA  . ILE A 1 85  ? 46.376  4.757   17.868  1.00 10.70 ? 103 ILE A CA  1 
ATOM   635   C C   . ILE A 1 85  ? 47.902  4.761   18.101  1.00 12.23 ? 103 ILE A C   1 
ATOM   636   O O   . ILE A 1 85  ? 48.585  5.748   17.789  1.00 16.17 ? 103 ILE A O   1 
ATOM   637   C CB  . ILE A 1 85  ? 46.064  4.386   16.380  1.00 7.62  ? 103 ILE A CB  1 
ATOM   638   C CG1 . ILE A 1 85  ? 46.451  2.939   16.125  1.00 5.00  ? 103 ILE A CG1 1 
ATOM   639   C CG2 . ILE A 1 85  ? 46.862  5.243   15.405  1.00 6.35  ? 103 ILE A CG2 1 
ATOM   640   C CD1 . ILE A 1 85  ? 46.020  2.453   14.789  1.00 5.00  ? 103 ILE A CD1 1 
ATOM   641   N N   . MET A 1 86  ? 48.432  3.674   18.649  1.00 8.46  ? 104 MET A N   1 
ATOM   642   C CA  . MET A 1 86  ? 49.855  3.579   18.954  1.00 6.76  ? 104 MET A CA  1 
ATOM   643   C C   . MET A 1 86  ? 50.313  2.156   18.718  1.00 9.83  ? 104 MET A C   1 
ATOM   644   O O   . MET A 1 86  ? 49.540  1.225   18.914  1.00 13.50 ? 104 MET A O   1 
ATOM   645   C CB  . MET A 1 86  ? 50.071  3.965   20.413  1.00 5.00  ? 104 MET A CB  1 
ATOM   646   C CG  . MET A 1 86  ? 51.298  3.424   21.052  1.00 5.00  ? 104 MET A CG  1 
ATOM   647   S SD  . MET A 1 86  ? 51.267  3.671   22.820  1.00 5.00  ? 104 MET A SD  1 
ATOM   648   C CE  . MET A 1 86  ? 50.360  2.342   23.368  1.00 5.00  ? 104 MET A CE  1 
ATOM   649   N N   . LEU A 1 87  ? 51.544  1.982   18.245  1.00 9.63  ? 105 LEU A N   1 
ATOM   650   C CA  . LEU A 1 87  ? 52.094  0.656   17.993  1.00 5.69  ? 105 LEU A CA  1 
ATOM   651   C C   . LEU A 1 87  ? 53.196  0.368   18.979  1.00 5.57  ? 105 LEU A C   1 
ATOM   652   O O   . LEU A 1 87  ? 54.038  1.218   19.261  1.00 5.00  ? 105 LEU A O   1 
ATOM   653   C CB  . LEU A 1 87  ? 52.643  0.565   16.587  1.00 5.00  ? 105 LEU A CB  1 
ATOM   654   C CG  . LEU A 1 87  ? 51.593  0.475   15.494  1.00 6.79  ? 105 LEU A CG  1 
ATOM   655   C CD1 . LEU A 1 87  ? 52.269  0.514   14.141  1.00 9.37  ? 105 LEU A CD1 1 
ATOM   656   C CD2 . LEU A 1 87  ? 50.800  -0.828  15.648  1.00 6.52  ? 105 LEU A CD2 1 
ATOM   657   N N   . ILE A 1 88  ? 53.182  -0.839  19.509  1.00 5.44  ? 106 ILE A N   1 
ATOM   658   C CA  . ILE A 1 88  ? 54.166  -1.266  20.489  1.00 6.46  ? 106 ILE A CA  1 
ATOM   659   C C   . ILE A 1 88  ? 54.994  -2.407  19.894  1.00 5.29  ? 106 ILE A C   1 
ATOM   660   O O   . ILE A 1 88  ? 54.461  -3.274  19.204  1.00 5.00  ? 106 ILE A O   1 
ATOM   661   C CB  . ILE A 1 88  ? 53.443  -1.742  21.814  1.00 7.05  ? 106 ILE A CB  1 
ATOM   662   C CG1 . ILE A 1 88  ? 52.763  -0.553  22.504  1.00 8.43  ? 106 ILE A CG1 1 
ATOM   663   C CG2 . ILE A 1 88  ? 54.406  -2.411  22.785  1.00 5.00  ? 106 ILE A CG2 1 
ATOM   664   C CD1 . ILE A 1 88  ? 51.880  -0.947  23.683  1.00 8.06  ? 106 ILE A CD1 1 
ATOM   665   N N   . LYS A 1 89  ? 56.307  -2.337  20.068  1.00 5.00  ? 107 LYS A N   1 
ATOM   666   C CA  . LYS A 1 89  ? 57.171  -3.393  19.599  1.00 5.00  ? 107 LYS A CA  1 
ATOM   667   C C   . LYS A 1 89  ? 57.743  -4.073  20.834  1.00 5.00  ? 107 LYS A C   1 
ATOM   668   O O   . LYS A 1 89  ? 58.298  -3.431  21.719  1.00 5.00  ? 107 LYS A O   1 
ATOM   669   C CB  . LYS A 1 89  ? 58.277  -2.864  18.690  1.00 5.79  ? 107 LYS A CB  1 
ATOM   670   C CG  . LYS A 1 89  ? 59.160  -3.990  18.188  1.00 6.79  ? 107 LYS A CG  1 
ATOM   671   C CD  . LYS A 1 89  ? 60.182  -3.554  17.174  1.00 7.21  ? 107 LYS A CD  1 
ATOM   672   C CE  . LYS A 1 89  ? 60.966  -4.777  16.668  1.00 8.59  ? 107 LYS A CE  1 
ATOM   673   N NZ  . LYS A 1 89  ? 62.079  -4.465  15.716  1.00 8.73  ? 107 LYS A NZ  1 
ATOM   674   N N   . LEU A 1 90  ? 57.553  -5.375  20.901  1.00 5.00  ? 108 LEU A N   1 
ATOM   675   C CA  . LEU A 1 90  ? 57.998  -6.151  22.022  1.00 5.07  ? 108 LEU A CA  1 
ATOM   676   C C   . LEU A 1 90  ? 59.466  -6.406  21.915  1.00 8.54  ? 108 LEU A C   1 
ATOM   677   O O   . LEU A 1 90  ? 59.944  -6.814  20.852  1.00 9.01  ? 108 LEU A O   1 
ATOM   678   C CB  . LEU A 1 90  ? 57.291  -7.484  22.019  1.00 6.89  ? 108 LEU A CB  1 
ATOM   679   C CG  . LEU A 1 90  ? 55.781  -7.406  22.098  1.00 7.41  ? 108 LEU A CG  1 
ATOM   680   C CD1 . LEU A 1 90  ? 55.182  -8.811  21.909  1.00 5.00  ? 108 LEU A CD1 1 
ATOM   681   C CD2 . LEU A 1 90  ? 55.407  -6.754  23.441  1.00 5.00  ? 108 LEU A CD2 1 
ATOM   682   N N   . LYS A 1 91  ? 60.163  -6.217  23.039  1.00 9.59  ? 109 LYS A N   1 
ATOM   683   C CA  . LYS A 1 91  ? 61.604  -6.434  23.136  1.00 5.39  ? 109 LYS A CA  1 
ATOM   684   C C   . LYS A 1 91  ? 61.919  -7.775  22.530  1.00 5.59  ? 109 LYS A C   1 
ATOM   685   O O   . LYS A 1 91  ? 62.871  -7.891  21.797  1.00 8.66  ? 109 LYS A O   1 
ATOM   686   C CB  . LYS A 1 91  ? 62.063  -6.396  24.590  1.00 5.00  ? 109 LYS A CB  1 
ATOM   687   C CG  . LYS A 1 91  ? 63.456  -6.944  24.831  1.00 5.00  ? 109 LYS A CG  1 
ATOM   688   C CD  . LYS A 1 91  ? 63.894  -6.728  26.267  0.00 6.89  ? 109 LYS A CD  1 
ATOM   689   C CE  . LYS A 1 91  ? 64.033  -5.244  26.556  0.00 7.65  ? 109 LYS A CE  1 
ATOM   690   N NZ  . LYS A 1 91  ? 64.324  -4.966  27.986  0.00 7.58  ? 109 LYS A NZ  1 
ATOM   691   N N   . SER A 1 92  ? 61.086  -8.767  22.811  1.00 7.99  ? 110 SER A N   1 
ATOM   692   C CA  . SER A 1 92  ? 61.260  -10.118 22.279  1.00 14.21 ? 110 SER A CA  1 
ATOM   693   C C   . SER A 1 92  ? 59.968  -10.478 21.565  1.00 17.51 ? 110 SER A C   1 
ATOM   694   O O   . SER A 1 92  ? 58.918  -9.982  21.945  1.00 21.48 ? 110 SER A O   1 
ATOM   695   C CB  . SER A 1 92  ? 61.498  -11.112 23.422  1.00 14.91 ? 110 SER A CB  1 
ATOM   696   O OG  . SER A 1 92  ? 62.608  -10.719 24.214  0.00 12.02 ? 110 SER A OG  1 
ATOM   697   N N   . ALA A 1 93  ? 60.030  -11.337 20.551  1.00 19.47 ? 111 ALA A N   1 
ATOM   698   C CA  . ALA A 1 93  ? 58.822  -11.714 19.828  1.00 23.00 ? 111 ALA A CA  1 
ATOM   699   C C   . ALA A 1 93  ? 58.030  -12.652 20.695  1.00 28.81 ? 111 ALA A C   1 
ATOM   700   O O   . ALA A 1 93  ? 58.610  -13.489 21.378  1.00 28.51 ? 111 ALA A O   1 
ATOM   701   C CB  . ALA A 1 93  ? 59.151  -12.384 18.504  1.00 20.67 ? 111 ALA A CB  1 
ATOM   702   N N   . ALA A 1 94  ? 56.717  -12.431 20.733  1.00 34.90 ? 112 ALA A N   1 
ATOM   703   C CA  . ALA A 1 94  ? 55.775  -13.250 21.486  1.00 36.47 ? 112 ALA A CA  1 
ATOM   704   C C   . ALA A 1 94  ? 55.644  -14.604 20.785  1.00 40.72 ? 112 ALA A C   1 
ATOM   705   O O   . ALA A 1 94  ? 55.760  -14.723 19.549  1.00 40.03 ? 112 ALA A O   1 
ATOM   706   C CB  . ALA A 1 94  ? 54.423  -12.566 21.549  0.00 33.37 ? 112 ALA A CB  1 
ATOM   707   N N   . SER A 1 95  ? 55.373  -15.618 21.587  1.00 44.63 ? 113 SER A N   1 
ATOM   708   C CA  . SER A 1 95  ? 55.220  -16.988 21.116  1.00 46.74 ? 113 SER A CA  1 
ATOM   709   C C   . SER A 1 95  ? 53.836  -17.288 20.538  1.00 45.22 ? 113 SER A C   1 
ATOM   710   O O   . SER A 1 95  ? 52.913  -17.616 21.282  1.00 44.53 ? 113 SER A O   1 
ATOM   711   C CB  . SER A 1 95  ? 55.427  -17.884 22.304  1.00 51.18 ? 113 SER A CB  1 
ATOM   712   O OG  . SER A 1 95  ? 54.624  -17.376 23.364  1.00 56.79 ? 113 SER A OG  1 
ATOM   713   N N   . LEU A 1 96  ? 53.685  -17.184 19.225  1.00 44.37 ? 114 LEU A N   1 
ATOM   714   C CA  . LEU A 1 96  ? 52.397  -17.476 18.617  1.00 41.58 ? 114 LEU A CA  1 
ATOM   715   C C   . LEU A 1 96  ? 52.067  -18.956 18.769  1.00 38.25 ? 114 LEU A C   1 
ATOM   716   O O   . LEU A 1 96  ? 52.967  -19.784 18.947  1.00 41.50 ? 114 LEU A O   1 
ATOM   717   C CB  . LEU A 1 96  ? 52.391  -17.061 17.149  1.00 42.69 ? 114 LEU A CB  1 
ATOM   718   C CG  . LEU A 1 96  ? 52.596  -15.555 16.964  1.00 44.91 ? 114 LEU A CG  1 
ATOM   719   C CD1 . LEU A 1 96  ? 52.444  -15.191 15.502  1.00 47.25 ? 114 LEU A CD1 1 
ATOM   720   C CD2 . LEU A 1 96  ? 51.579  -14.779 17.790  1.00 47.31 ? 114 LEU A CD2 1 
ATOM   721   N N   . ASN A 1 97  ? 50.777  -19.261 18.818  0.00 33.49 ? 115 ASN A N   1 
ATOM   722   C CA  . ASN A 1 97  ? 50.290  -20.630 18.941  0.00 27.97 ? 115 ASN A CA  1 
ATOM   723   C C   . ASN A 1 97  ? 48.788  -20.618 19.185  0.00 25.52 ? 115 ASN A C   1 
ATOM   724   O O   . ASN A 1 97  ? 48.119  -19.614 18.934  0.00 24.99 ? 115 ASN A O   1 
ATOM   725   C CB  . ASN A 1 97  ? 51.012  -21.393 20.068  0.00 25.88 ? 115 ASN A CB  1 
ATOM   726   C CG  . ASN A 1 97  ? 50.709  -20.846 21.456  0.00 22.90 ? 115 ASN A CG  1 
ATOM   727   O OD1 . ASN A 1 97  ? 50.205  -19.738 21.614  0.00 21.28 ? 115 ASN A OD1 1 
ATOM   728   N ND2 . ASN A 1 97  ? 51.006  -21.641 22.473  0.00 21.37 ? 115 ASN A ND2 1 
ATOM   729   N N   . SER A 1 98  ? 48.258  -21.743 19.649  0.00 23.02 ? 116 SER A N   1 
ATOM   730   C CA  . SER A 1 98  ? 46.836  -21.868 19.932  0.00 20.60 ? 116 SER A CA  1 
ATOM   731   C C   . SER A 1 98  ? 46.415  -21.001 21.116  0.00 19.91 ? 116 SER A C   1 
ATOM   732   O O   . SER A 1 98  ? 45.238  -20.673 21.266  0.00 19.36 ? 116 SER A O   1 
ATOM   733   C CB  . SER A 1 98  ? 46.496  -23.333 20.207  0.00 19.28 ? 116 SER A CB  1 
ATOM   734   O OG  . SER A 1 98  ? 47.495  -23.936 21.014  0.00 18.24 ? 116 SER A OG  1 
ATOM   735   N N   . ARG A 1 99  ? 47.377  -20.651 21.963  0.00 19.77 ? 117 ARG A N   1 
ATOM   736   C CA  . ARG A 1 99  ? 47.105  -19.829 23.132  0.00 20.33 ? 117 ARG A CA  1 
ATOM   737   C C   . ARG A 1 99  ? 47.140  -18.358 22.750  0.00 22.00 ? 117 ARG A C   1 
ATOM   738   O O   . ARG A 1 99  ? 46.103  -17.708 22.682  0.00 21.65 ? 117 ARG A O   1 
ATOM   739   C CB  . ARG A 1 99  ? 48.120  -20.129 24.238  0.00 19.52 ? 117 ARG A CB  1 
ATOM   740   C CG  . ARG A 1 99  ? 48.164  -21.596 24.644  0.00 18.38 ? 117 ARG A CG  1 
ATOM   741   C CD  . ARG A 1 99  ? 46.806  -22.079 25.126  0.00 17.51 ? 117 ARG A CD  1 
ATOM   742   N NE  . ARG A 1 99  ? 46.815  -23.501 25.458  0.00 16.81 ? 117 ARG A NE  1 
ATOM   743   C CZ  . ARG A 1 99  ? 45.746  -24.186 25.855  0.00 16.77 ? 117 ARG A CZ  1 
ATOM   744   N NH1 . ARG A 1 99  ? 44.569  -23.586 25.972  0.00 16.52 ? 117 ARG A NH1 1 
ATOM   745   N NH2 . ARG A 1 99  ? 45.856  -25.477 26.137  0.00 16.32 ? 117 ARG A NH2 1 
ATOM   746   N N   . VAL A 1 100 ? 48.331  -17.840 22.484  1.00 23.95 ? 118 VAL A N   1 
ATOM   747   C CA  . VAL A 1 100 ? 48.493  -16.447 22.095  1.00 26.28 ? 118 VAL A CA  1 
ATOM   748   C C   . VAL A 1 100 ? 48.491  -16.492 20.578  1.00 25.97 ? 118 VAL A C   1 
ATOM   749   O O   . VAL A 1 100 ? 49.245  -17.248 19.978  1.00 29.24 ? 118 VAL A O   1 
ATOM   750   C CB  . VAL A 1 100 ? 49.851  -15.871 22.569  1.00 27.91 ? 118 VAL A CB  1 
ATOM   751   C CG1 . VAL A 1 100 ? 49.871  -14.369 22.424  1.00 26.91 ? 118 VAL A CG1 1 
ATOM   752   C CG2 . VAL A 1 100 ? 50.132  -16.280 24.007  1.00 30.42 ? 118 VAL A CG2 1 
ATOM   753   N N   . ALA A 1 101 ? 47.626  -15.713 19.956  1.00 24.50 ? 119 ALA A N   1 
ATOM   754   C CA  . ALA A 1 101 ? 47.551  -15.697 18.505  1.00 25.02 ? 119 ALA A CA  1 
ATOM   755   C C   . ALA A 1 101 ? 47.276  -14.278 18.063  1.00 24.99 ? 119 ALA A C   1 
ATOM   756   O O   . ALA A 1 101 ? 46.663  -13.510 18.792  1.00 25.30 ? 119 ALA A O   1 
ATOM   757   C CB  . ALA A 1 101 ? 46.451  -16.636 18.025  1.00 26.10 ? 119 ALA A CB  1 
ATOM   758   N N   . SER A 1 102 ? 47.737  -13.919 16.879  1.00 23.47 ? 120 SER A N   1 
ATOM   759   C CA  . SER A 1 102 ? 47.533  -12.570 16.389  1.00 22.41 ? 120 SER A CA  1 
ATOM   760   C C   . SER A 1 102 ? 46.148  -12.409 15.786  1.00 20.66 ? 120 SER A C   1 
ATOM   761   O O   . SER A 1 102 ? 45.540  -13.397 15.362  1.00 23.38 ? 120 SER A O   1 
ATOM   762   C CB  . SER A 1 102 ? 48.592  -12.253 15.334  1.00 25.58 ? 120 SER A CB  1 
ATOM   763   O OG  . SER A 1 102 ? 48.543  -13.191 14.272  1.00 27.70 ? 120 SER A OG  1 
ATOM   764   N N   . ILE A 1 103 ? 45.634  -11.179 15.799  1.00 16.58 ? 121 ILE A N   1 
ATOM   765   C CA  . ILE A 1 103 ? 44.334  -10.878 15.204  1.00 13.97 ? 121 ILE A CA  1 
ATOM   766   C C   . ILE A 1 103 ? 44.655  -10.228 13.866  1.00 17.47 ? 121 ILE A C   1 
ATOM   767   O O   . ILE A 1 103 ? 45.685  -9.582  13.755  1.00 24.70 ? 121 ILE A O   1 
ATOM   768   C CB  . ILE A 1 103 ? 43.541  -9.904  16.044  1.00 8.67  ? 121 ILE A CB  1 
ATOM   769   C CG1 . ILE A 1 103 ? 42.264  -9.553  15.314  1.00 9.73  ? 121 ILE A CG1 1 
ATOM   770   C CG2 . ILE A 1 103 ? 44.333  -8.657  16.309  1.00 10.71 ? 121 ILE A CG2 1 
ATOM   771   C CD1 . ILE A 1 103 ? 41.374  -10.733 15.087  1.00 8.55  ? 121 ILE A CD1 1 
ATOM   772   N N   . SER A 1 104 ? 43.799  -10.378 12.860  1.00 15.09 ? 122 SER A N   1 
ATOM   773   C CA  . SER A 1 104 ? 44.078  -9.798  11.552  1.00 12.95 ? 122 SER A CA  1 
ATOM   774   C C   . SER A 1 104 ? 43.673  -8.343  11.422  1.00 12.72 ? 122 SER A C   1 
ATOM   775   O O   . SER A 1 104 ? 42.770  -7.893  12.116  1.00 15.02 ? 122 SER A O   1 
ATOM   776   C CB  . SER A 1 104 ? 43.377  -10.602 10.474  1.00 16.35 ? 122 SER A CB  1 
ATOM   777   O OG  . SER A 1 104 ? 43.586  -11.986 10.675  1.00 21.89 ? 122 SER A OG  1 
ATOM   778   N N   . LEU A 1 105 ? 44.386  -7.594  10.582  1.00 12.96 ? 123 LEU A N   1 
ATOM   779   C CA  . LEU A 1 105 ? 44.063  -6.191  10.325  1.00 9.09  ? 123 LEU A CA  1 
ATOM   780   C C   . LEU A 1 105 ? 43.012  -6.235  9.238   1.00 11.27 ? 123 LEU A C   1 
ATOM   781   O O   . LEU A 1 105 ? 43.004  -7.144  8.410   1.00 13.48 ? 123 LEU A O   1 
ATOM   782   C CB  . LEU A 1 105 ? 45.277  -5.409  9.835   1.00 5.00  ? 123 LEU A CB  1 
ATOM   783   C CG  . LEU A 1 105 ? 46.343  -5.081  10.881  1.00 6.60  ? 123 LEU A CG  1 
ATOM   784   C CD1 . LEU A 1 105 ? 47.463  -4.271  10.220  1.00 5.00  ? 123 LEU A CD1 1 
ATOM   785   C CD2 . LEU A 1 105 ? 45.721  -4.293  12.050  1.00 8.94  ? 123 LEU A CD2 1 
ATOM   786   N N   . PRO A 1 106 ? 42.093  -5.274  9.235   1.00 12.94 ? 124 PRO A N   1 
ATOM   787   C CA  . PRO A 1 106 ? 41.023  -5.212  8.247   1.00 17.73 ? 124 PRO A CA  1 
ATOM   788   C C   . PRO A 1 106 ? 41.487  -4.714  6.891   1.00 26.10 ? 124 PRO A C   1 
ATOM   789   O O   . PRO A 1 106 ? 42.505  -4.032  6.790   1.00 27.10 ? 124 PRO A O   1 
ATOM   790   C CB  . PRO A 1 106 ? 40.089  -4.202  8.872   1.00 15.46 ? 124 PRO A CB  1 
ATOM   791   C CG  . PRO A 1 106 ? 41.040  -3.217  9.418   1.00 13.30 ? 124 PRO A CG  1 
ATOM   792   C CD  . PRO A 1 106 ? 42.029  -4.108  10.127  1.00 12.75 ? 124 PRO A CD  1 
ATOM   793   N N   . THR A 1 107 ? 40.723  -5.033  5.852   1.00 33.09 ? 125 THR A N   1 
ATOM   794   C CA  . THR A 1 107 ? 41.047  -4.563  4.509   1.00 38.76 ? 125 THR A CA  1 
ATOM   795   C C   . THR A 1 107 ? 40.027  -3.521  4.093   1.00 38.70 ? 125 THR A C   1 
ATOM   796   O O   . THR A 1 107 ? 40.269  -2.712  3.201   1.00 39.40 ? 125 THR A O   1 
ATOM   797   C CB  . THR A 1 107 ? 41.020  -5.692  3.494   1.00 41.64 ? 125 THR A CB  1 
ATOM   798   O OG1 . THR A 1 107 ? 39.710  -6.274  3.464   1.00 42.30 ? 125 THR A OG1 1 
ATOM   799   C CG2 . THR A 1 107 ? 42.041  -6.740  3.872   1.00 44.46 ? 125 THR A CG2 1 
ATOM   800   N N   . SER A 1 108 ? 38.863  -3.583  4.718   1.00 37.25 ? 127 SER A N   1 
ATOM   801   C CA  . SER A 1 108 ? 37.805  -2.641  4.436   1.00 39.05 ? 127 SER A CA  1 
ATOM   802   C C   . SER A 1 108 ? 37.065  -2.421  5.744   1.00 38.29 ? 127 SER A C   1 
ATOM   803   O O   . SER A 1 108 ? 36.945  -3.336  6.559   1.00 39.44 ? 127 SER A O   1 
ATOM   804   C CB  . SER A 1 108 ? 36.872  -3.224  3.388   1.00 44.13 ? 127 SER A CB  1 
ATOM   805   O OG  . SER A 1 108 ? 37.633  -3.793  2.341   1.00 49.35 ? 127 SER A OG  1 
ATOM   806   N N   . CYS A 1 109 ? 36.613  -1.195  5.958   1.00 36.04 ? 128 CYS A N   1 
ATOM   807   C CA  . CYS A 1 109 ? 35.883  -0.842  7.169   1.00 32.90 ? 128 CYS A CA  1 
ATOM   808   C C   . CYS A 1 109 ? 34.519  -1.544  7.328   1.00 32.40 ? 128 CYS A C   1 
ATOM   809   O O   . CYS A 1 109 ? 33.795  -1.809  6.350   1.00 31.17 ? 128 CYS A O   1 
ATOM   810   C CB  . CYS A 1 109 ? 35.691  0.663   7.181   1.00 31.70 ? 128 CYS A CB  1 
ATOM   811   S SG  . CYS A 1 109 ? 37.200  1.524   6.673   1.00 21.56 ? 128 CYS A SG  1 
ATOM   812   N N   . ALA A 1 110 ? 34.157  -1.805  8.580   1.00 31.72 ? 129 ALA A N   1 
ATOM   813   C CA  . ALA A 1 110 ? 32.894  -2.466  8.893   1.00 28.79 ? 129 ALA A CA  1 
ATOM   814   C C   . ALA A 1 110 ? 31.737  -1.509  8.663   1.00 26.77 ? 129 ALA A C   1 
ATOM   815   O O   . ALA A 1 110 ? 31.792  -0.347  9.067   1.00 23.30 ? 129 ALA A O   1 
ATOM   816   C CB  . ALA A 1 110 ? 32.892  -2.950  10.332  1.00 25.25 ? 129 ALA A CB  1 
ATOM   817   N N   . SER A 1 111 ? 30.724  -1.990  7.952   1.00 26.81 ? 130 SER A N   1 
ATOM   818   C CA  . SER A 1 111 ? 29.537  -1.200  7.671   1.00 26.77 ? 130 SER A CA  1 
ATOM   819   C C   . SER A 1 111 ? 28.739  -1.144  8.965   1.00 29.17 ? 130 SER A C   1 
ATOM   820   O O   . SER A 1 111 ? 28.834  -2.056  9.791   1.00 31.95 ? 130 SER A O   1 
ATOM   821   C CB  . SER A 1 111 ? 28.718  -1.860  6.564   0.00 26.83 ? 130 SER A CB  1 
ATOM   822   O OG  . SER A 1 111 ? 29.463  -1.918  5.359   0.00 27.18 ? 130 SER A OG  1 
ATOM   823   N N   . ALA A 1 112 ? 27.988  -0.067  9.174   1.00 29.85 ? 132 ALA A N   1 
ATOM   824   C CA  . ALA A 1 112 ? 27.204  0.069   10.396  1.00 29.14 ? 132 ALA A CA  1 
ATOM   825   C C   . ALA A 1 112 ? 26.274  -1.119  10.484  1.00 29.64 ? 132 ALA A C   1 
ATOM   826   O O   . ALA A 1 112 ? 25.779  -1.610  9.471   1.00 32.46 ? 132 ALA A O   1 
ATOM   827   C CB  . ALA A 1 112 ? 26.423  1.367   10.393  1.00 29.86 ? 132 ALA A CB  1 
ATOM   828   N N   . GLY A 1 113 ? 26.086  -1.623  11.687  1.00 28.99 ? 133 GLY A N   1 
ATOM   829   C CA  . GLY A 1 113 ? 25.232  -2.771  11.842  1.00 30.04 ? 133 GLY A CA  1 
ATOM   830   C C   . GLY A 1 113 ? 26.041  -4.009  12.138  1.00 29.86 ? 133 GLY A C   1 
ATOM   831   O O   . GLY A 1 113 ? 25.520  -4.946  12.747  1.00 31.59 ? 133 GLY A O   1 
ATOM   832   N N   . THR A 1 114 ? 27.308  -4.014  11.730  1.00 28.91 ? 134 THR A N   1 
ATOM   833   C CA  . THR A 1 114 ? 28.199  -5.158  11.972  1.00 28.39 ? 134 THR A CA  1 
ATOM   834   C C   . THR A 1 114 ? 28.330  -5.496  13.457  1.00 27.14 ? 134 THR A C   1 
ATOM   835   O O   . THR A 1 114 ? 28.534  -4.604  14.293  1.00 24.33 ? 134 THR A O   1 
ATOM   836   C CB  . THR A 1 114 ? 29.631  -4.916  11.449  1.00 26.36 ? 134 THR A CB  1 
ATOM   837   O OG1 . THR A 1 114 ? 29.604  -4.654  10.041  1.00 23.88 ? 134 THR A OG1 1 
ATOM   838   C CG2 . THR A 1 114 ? 30.497  -6.145  11.711  1.00 26.73 ? 134 THR A CG2 1 
ATOM   839   N N   . GLN A 1 115 ? 28.220  -6.785  13.774  1.00 26.34 ? 135 GLN A N   1 
ATOM   840   C CA  . GLN A 1 115 ? 28.325  -7.225  15.160  1.00 26.36 ? 135 GLN A CA  1 
ATOM   841   C C   . GLN A 1 115 ? 29.801  -7.516  15.453  1.00 23.54 ? 135 GLN A C   1 
ATOM   842   O O   . GLN A 1 115 ? 30.464  -8.216  14.682  1.00 21.93 ? 135 GLN A O   1 
ATOM   843   C CB  . GLN A 1 115 ? 27.439  -8.459  15.409  1.00 27.50 ? 135 GLN A CB  1 
ATOM   844   C CG  . GLN A 1 115 ? 27.031  -8.645  16.873  1.00 28.88 ? 135 GLN A CG  1 
ATOM   845   C CD  . GLN A 1 115 ? 26.390  -9.991  17.135  0.00 30.46 ? 135 GLN A CD  1 
ATOM   846   O OE1 . GLN A 1 115 ? 26.982  -10.855 17.778  0.00 31.40 ? 135 GLN A OE1 1 
ATOM   847   N NE2 . GLN A 1 115 ? 25.177  -10.179 16.639  0.00 31.36 ? 135 GLN A NE2 1 
ATOM   848   N N   . CYS A 1 116 ? 30.311  -6.948  16.547  1.00 22.17 ? 136 CYS A N   1 
ATOM   849   C CA  . CYS A 1 116 ? 31.713  -7.097  16.937  1.00 18.46 ? 136 CYS A CA  1 
ATOM   850   C C   . CYS A 1 116 ? 31.858  -7.592  18.367  1.00 16.39 ? 136 CYS A C   1 
ATOM   851   O O   . CYS A 1 116 ? 30.866  -7.671  19.099  1.00 18.86 ? 136 CYS A O   1 
ATOM   852   C CB  . CYS A 1 116 ? 32.438  -5.751  16.799  1.00 17.88 ? 136 CYS A CB  1 
ATOM   853   S SG  . CYS A 1 116 ? 32.163  -4.908  15.200  1.00 17.55 ? 136 CYS A SG  1 
ATOM   854   N N   . LEU A 1 117 ? 33.096  -7.943  18.739  1.00 14.50 ? 137 LEU A N   1 
ATOM   855   C CA  . LEU A 1 117 ? 33.435  -8.434  20.073  1.00 9.05  ? 137 LEU A CA  1 
ATOM   856   C C   . LEU A 1 117 ? 34.451  -7.503  20.694  1.00 6.08  ? 137 LEU A C   1 
ATOM   857   O O   . LEU A 1 117 ? 35.536  -7.332  20.153  1.00 5.00  ? 137 LEU A O   1 
ATOM   858   C CB  . LEU A 1 117 ? 34.011  -9.855  20.017  1.00 6.64  ? 137 LEU A CB  1 
ATOM   859   C CG  . LEU A 1 117 ? 34.397  -10.461 21.377  1.00 5.80  ? 137 LEU A CG  1 
ATOM   860   C CD1 . LEU A 1 117 ? 33.215  -10.448 22.384  1.00 5.00  ? 137 LEU A CD1 1 
ATOM   861   C CD2 . LEU A 1 117 ? 34.915  -11.871 21.151  1.00 5.00  ? 137 LEU A CD2 1 
ATOM   862   N N   . ILE A 1 118 ? 34.053  -6.850  21.780  1.00 5.53  ? 138 ILE A N   1 
ATOM   863   C CA  . ILE A 1 118 ? 34.902  -5.936  22.523  1.00 7.75  ? 138 ILE A CA  1 
ATOM   864   C C   . ILE A 1 118 ? 35.308  -6.734  23.748  1.00 9.21  ? 138 ILE A C   1 
ATOM   865   O O   . ILE A 1 118 ? 34.495  -7.499  24.256  1.00 12.60 ? 138 ILE A O   1 
ATOM   866   C CB  . ILE A 1 118 ? 34.113  -4.714  22.969  1.00 9.16  ? 138 ILE A CB  1 
ATOM   867   C CG1 . ILE A 1 118 ? 33.430  -4.068  21.763  1.00 11.76 ? 138 ILE A CG1 1 
ATOM   868   C CG2 . ILE A 1 118 ? 35.016  -3.717  23.634  1.00 9.33  ? 138 ILE A CG2 1 
ATOM   869   C CD1 . ILE A 1 118 ? 32.460  -2.948  22.141  1.00 15.12 ? 138 ILE A CD1 1 
ATOM   870   N N   . SER A 1 119 ? 36.551  -6.599  24.210  1.00 8.37  ? 139 SER A N   1 
ATOM   871   C CA  . SER A 1 119 ? 37.000  -7.370  25.371  1.00 5.70  ? 139 SER A CA  1 
ATOM   872   C C   . SER A 1 119 ? 38.011  -6.631  26.209  1.00 5.00  ? 139 SER A C   1 
ATOM   873   O O   . SER A 1 119 ? 38.726  -5.776  25.696  1.00 5.00  ? 139 SER A O   1 
ATOM   874   C CB  . SER A 1 119 ? 37.578  -8.701  24.918  1.00 5.00  ? 139 SER A CB  1 
ATOM   875   O OG  . SER A 1 119 ? 38.554  -8.494  23.913  1.00 6.83  ? 139 SER A OG  1 
ATOM   876   N N   . GLY A 1 120 ? 38.065  -6.963  27.496  1.00 5.00  ? 140 GLY A N   1 
ATOM   877   C CA  . GLY A 1 120 ? 38.984  -6.287  28.390  1.00 6.25  ? 140 GLY A CA  1 
ATOM   878   C C   . GLY A 1 120 ? 38.786  -6.641  29.846  1.00 7.62  ? 140 GLY A C   1 
ATOM   879   O O   . GLY A 1 120 ? 37.876  -7.395  30.186  1.00 10.30 ? 140 GLY A O   1 
ATOM   880   N N   . TRP A 1 121 ? 39.631  -6.086  30.707  1.00 7.69  ? 141 TRP A N   1 
ATOM   881   C CA  . TRP A 1 121 ? 39.590  -6.359  32.144  1.00 7.87  ? 141 TRP A CA  1 
ATOM   882   C C   . TRP A 1 121 ? 39.210  -5.125  32.905  1.00 7.70  ? 141 TRP A C   1 
ATOM   883   O O   . TRP A 1 121 ? 39.483  -5.028  34.105  1.00 6.56  ? 141 TRP A O   1 
ATOM   884   C CB  . TRP A 1 121 ? 40.965  -6.771  32.657  1.00 10.10 ? 141 TRP A CB  1 
ATOM   885   C CG  . TRP A 1 121 ? 41.398  -8.156  32.332  1.00 9.38  ? 141 TRP A CG  1 
ATOM   886   C CD1 . TRP A 1 121 ? 41.056  -9.285  33.003  1.00 8.45  ? 141 TRP A CD1 1 
ATOM   887   C CD2 . TRP A 1 121 ? 42.344  -8.548  31.329  1.00 8.50  ? 141 TRP A CD2 1 
ATOM   888   N NE1 . TRP A 1 121 ? 41.740  -10.357 32.496  1.00 10.25 ? 141 TRP A NE1 1 
ATOM   889   C CE2 . TRP A 1 121 ? 42.536  -9.935  31.464  1.00 10.09 ? 141 TRP A CE2 1 
ATOM   890   C CE3 . TRP A 1 121 ? 43.049  -7.858  30.330  1.00 9.48  ? 141 TRP A CE3 1 
ATOM   891   C CZ2 . TRP A 1 121 ? 43.408  -10.659 30.636  1.00 9.39  ? 141 TRP A CZ2 1 
ATOM   892   C CZ3 . TRP A 1 121 ? 43.917  -8.575  29.503  1.00 12.25 ? 141 TRP A CZ3 1 
ATOM   893   C CH2 . TRP A 1 121 ? 44.088  -9.966  29.665  1.00 10.28 ? 141 TRP A CH2 1 
ATOM   894   N N   . GLY A 1 122 ? 38.648  -4.161  32.183  1.00 10.90 ? 142 GLY A N   1 
ATOM   895   C CA  . GLY A 1 122 ? 38.254  -2.896  32.775  1.00 12.76 ? 142 GLY A CA  1 
ATOM   896   C C   . GLY A 1 122 ? 37.065  -3.031  33.683  1.00 14.03 ? 142 GLY A C   1 
ATOM   897   O O   . GLY A 1 122 ? 36.460  -4.105  33.771  1.00 11.52 ? 142 GLY A O   1 
ATOM   898   N N   . ASN A 1 123 ? 36.710  -1.921  34.320  1.00 16.01 ? 143 ASN A N   1 
ATOM   899   C CA  . ASN A 1 123 ? 35.588  -1.863  35.247  1.00 18.52 ? 143 ASN A CA  1 
ATOM   900   C C   . ASN A 1 123 ? 34.320  -2.495  34.677  1.00 23.06 ? 143 ASN A C   1 
ATOM   901   O O   . ASN A 1 123 ? 34.086  -2.444  33.455  1.00 23.24 ? 143 ASN A O   1 
ATOM   902   C CB  . ASN A 1 123 ? 35.306  -0.416  35.590  1.00 16.35 ? 143 ASN A CB  1 
ATOM   903   C CG  . ASN A 1 123 ? 34.290  -0.272  36.693  1.00 17.99 ? 143 ASN A CG  1 
ATOM   904   O OD1 . ASN A 1 123 ? 33.909  -1.252  37.342  1.00 14.73 ? 143 ASN A OD1 1 
ATOM   905   N ND2 . ASN A 1 123 ? 33.867  0.963   36.942  1.00 22.97 ? 143 ASN A ND2 1 
ATOM   906   N N   . THR A 1 124 ? 33.555  -3.165  35.544  1.00 27.01 ? 144 THR A N   1 
ATOM   907   C CA  . THR A 1 124 ? 32.294  -3.803  35.143  1.00 28.32 ? 144 THR A CA  1 
ATOM   908   C C   . THR A 1 124 ? 31.081  -2.962  35.562  1.00 33.11 ? 144 THR A C   1 
ATOM   909   O O   . THR A 1 124 ? 30.070  -2.903  34.845  1.00 34.55 ? 144 THR A O   1 
ATOM   910   C CB  . THR A 1 124 ? 32.153  -5.231  35.711  1.00 22.89 ? 144 THR A CB  1 
ATOM   911   O OG1 . THR A 1 124 ? 32.626  -5.262  37.057  1.00 23.05 ? 144 THR A OG1 1 
ATOM   912   C CG2 . THR A 1 124 ? 32.947  -6.211  34.893  1.00 24.71 ? 144 THR A CG2 1 
ATOM   913   N N   . LYS A 1 125 ? 31.205  -2.268  36.690  1.00 35.51 ? 145 LYS A N   1 
ATOM   914   C CA  . LYS A 1 125 ? 30.123  -1.445  37.195  1.00 38.66 ? 145 LYS A CA  1 
ATOM   915   C C   . LYS A 1 125 ? 29.975  -0.095  36.502  1.00 40.79 ? 145 LYS A C   1 
ATOM   916   O O   . LYS A 1 125 ? 30.951  0.548   36.135  1.00 38.12 ? 145 LYS A O   1 
ATOM   917   C CB  . LYS A 1 125 ? 30.266  -1.252  38.699  1.00 42.65 ? 145 LYS A CB  1 
ATOM   918   C CG  . LYS A 1 125 ? 29.847  -2.462  39.532  1.00 45.92 ? 145 LYS A CG  1 
ATOM   919   C CD  . LYS A 1 125 ? 29.769  -2.074  41.015  1.00 52.06 ? 145 LYS A CD  1 
ATOM   920   C CE  . LYS A 1 125 ? 29.208  -3.205  41.881  1.00 54.91 ? 145 LYS A CE  1 
ATOM   921   N NZ  . LYS A 1 125 ? 29.078  -2.812  43.320  1.00 57.43 ? 145 LYS A NZ  1 
ATOM   922   N N   . SER A 1 126 ? 28.725  0.310   36.309  1.00 45.97 ? 146 SER A N   1 
ATOM   923   C CA  . SER A 1 126 ? 28.399  1.586   35.675  1.00 49.24 ? 146 SER A CA  1 
ATOM   924   C C   . SER A 1 126 ? 28.691  2.691   36.672  1.00 50.91 ? 146 SER A C   1 
ATOM   925   O O   . SER A 1 126 ? 29.315  3.699   36.335  1.00 53.16 ? 146 SER A O   1 
ATOM   926   C CB  . SER A 1 126 ? 26.914  1.621   35.273  1.00 47.80 ? 146 SER A CB  1 
ATOM   927   O OG  . SER A 1 126 ? 26.088  1.117   36.311  0.00 50.14 ? 146 SER A OG  1 
ATOM   928   N N   . SER A 1 127 ? 28.198  2.493   37.893  1.00 52.15 ? 147 SER A N   1 
ATOM   929   C CA  . SER A 1 127 ? 28.389  3.425   38.996  1.00 54.16 ? 147 SER A CA  1 
ATOM   930   C C   . SER A 1 127 ? 29.208  2.671   40.046  1.00 54.86 ? 147 SER A C   1 
ATOM   931   O O   . SER A 1 127 ? 28.722  1.697   40.640  1.00 57.05 ? 147 SER A O   1 
ATOM   932   C CB  . SER A 1 127 ? 27.034  3.840   39.579  1.00 55.57 ? 147 SER A CB  1 
ATOM   933   O OG  . SER A 1 127 ? 26.172  4.332   38.564  0.00 57.13 ? 147 SER A OG  1 
ATOM   934   N N   . GLY A 1 128 ? 30.457  3.096   40.235  1.00 53.09 ? 148 GLY A N   1 
ATOM   935   C CA  . GLY A 1 128 ? 31.333  2.447   41.196  1.00 49.58 ? 148 GLY A CA  1 
ATOM   936   C C   . GLY A 1 128 ? 32.383  1.638   40.467  1.00 48.04 ? 148 GLY A C   1 
ATOM   937   O O   . GLY A 1 128 ? 32.202  1.281   39.303  1.00 48.65 ? 148 GLY A O   1 
ATOM   938   N N   . THR A 1 129 ? 33.490  1.355   41.139  1.00 45.64 ? 149 THR A N   1 
ATOM   939   C CA  . THR A 1 129 ? 34.575  0.598   40.529  1.00 41.29 ? 149 THR A CA  1 
ATOM   940   C C   . THR A 1 129 ? 34.610  -0.862  40.975  1.00 37.92 ? 149 THR A C   1 
ATOM   941   O O   . THR A 1 129 ? 34.673  -1.154  42.171  1.00 40.06 ? 149 THR A O   1 
ATOM   942   C CB  . THR A 1 129 ? 35.933  1.267   40.819  0.00 41.86 ? 149 THR A CB  1 
ATOM   943   O OG1 . THR A 1 129 ? 35.984  1.671   42.194  0.00 42.18 ? 149 THR A OG1 1 
ATOM   944   C CG2 . THR A 1 129 ? 36.125  2.488   39.931  0.00 42.10 ? 149 THR A CG2 1 
ATOM   945   N N   . SER A 1 130 ? 34.510  -1.773  40.009  1.00 32.80 ? 150 SER A N   1 
ATOM   946   C CA  . SER A 1 130 ? 34.563  -3.214  40.261  1.00 26.88 ? 150 SER A CA  1 
ATOM   947   C C   . SER A 1 130 ? 35.406  -3.776  39.116  1.00 22.41 ? 150 SER A C   1 
ATOM   948   O O   . SER A 1 130 ? 34.902  -4.114  38.045  1.00 19.91 ? 150 SER A O   1 
ATOM   949   C CB  . SER A 1 130 ? 33.156  -3.818  40.271  0.00 27.59 ? 150 SER A CB  1 
ATOM   950   O OG  . SER A 1 130 ? 33.179  -5.186  40.643  0.00 26.25 ? 150 SER A OG  1 
ATOM   951   N N   . TYR A 1 131 ? 36.713  -3.773  39.311  1.00 19.56 ? 151 TYR A N   1 
ATOM   952   C CA  . TYR A 1 131 ? 37.599  -4.261  38.285  1.00 19.68 ? 151 TYR A CA  1 
ATOM   953   C C   . TYR A 1 131 ? 37.754  -5.783  38.339  1.00 19.84 ? 151 TYR A C   1 
ATOM   954   O O   . TYR A 1 131 ? 38.280  -6.341  39.303  1.00 22.13 ? 151 TYR A O   1 
ATOM   955   C CB  . TYR A 1 131 ? 38.945  -3.541  38.384  1.00 21.35 ? 151 TYR A CB  1 
ATOM   956   C CG  . TYR A 1 131 ? 38.890  -2.082  37.965  1.00 19.54 ? 151 TYR A CG  1 
ATOM   957   C CD1 . TYR A 1 131 ? 38.931  -1.712  36.619  1.00 19.31 ? 151 TYR A CD1 1 
ATOM   958   C CD2 . TYR A 1 131 ? 38.784  -1.081  38.909  1.00 20.88 ? 151 TYR A CD2 1 
ATOM   959   C CE1 . TYR A 1 131 ? 38.863  -0.384  36.238  1.00 21.13 ? 151 TYR A CE1 1 
ATOM   960   C CE2 . TYR A 1 131 ? 38.716  0.257   38.535  1.00 23.41 ? 151 TYR A CE2 1 
ATOM   961   C CZ  . TYR A 1 131 ? 38.752  0.602   37.204  1.00 22.22 ? 151 TYR A CZ  1 
ATOM   962   O OH  . TYR A 1 131 ? 38.647  1.934   36.860  1.00 22.08 ? 151 TYR A OH  1 
ATOM   963   N N   . PRO A 1 132 ? 37.260  -6.480  37.312  1.00 20.43 ? 152 PRO A N   1 
ATOM   964   C CA  . PRO A 1 132 ? 37.325  -7.948  37.220  1.00 20.70 ? 152 PRO A CA  1 
ATOM   965   C C   . PRO A 1 132 ? 38.708  -8.543  37.117  1.00 27.01 ? 152 PRO A C   1 
ATOM   966   O O   . PRO A 1 132 ? 39.632  -7.903  36.612  1.00 30.85 ? 152 PRO A O   1 
ATOM   967   C CB  . PRO A 1 132 ? 36.512  -8.260  35.961  1.00 19.29 ? 152 PRO A CB  1 
ATOM   968   C CG  . PRO A 1 132 ? 36.631  -7.017  35.147  1.00 19.19 ? 152 PRO A CG  1 
ATOM   969   C CD  . PRO A 1 132 ? 36.538  -5.902  36.167  1.00 17.09 ? 152 PRO A CD  1 
ATOM   970   N N   . ASP A 1 133 ? 38.838  -9.784  37.581  1.00 32.67 ? 153 ASP A N   1 
ATOM   971   C CA  . ASP A 1 133 ? 40.107  -10.517 37.532  1.00 35.52 ? 153 ASP A CA  1 
ATOM   972   C C   . ASP A 1 133 ? 40.225  -11.245 36.218  1.00 30.08 ? 153 ASP A C   1 
ATOM   973   O O   . ASP A 1 133 ? 41.313  -11.424 35.693  1.00 28.59 ? 153 ASP A O   1 
ATOM   974   C CB  . ASP A 1 133 ? 40.181  -11.535 38.658  1.00 45.03 ? 153 ASP A CB  1 
ATOM   975   C CG  . ASP A 1 133 ? 40.882  -10.993 39.880  1.00 56.96 ? 153 ASP A CG  1 
ATOM   976   O OD1 . ASP A 1 133 ? 41.869  -11.629 40.309  1.00 63.07 ? 153 ASP A OD1 1 
ATOM   977   O OD2 . ASP A 1 133 ? 40.459  -9.933  40.406  1.00 62.13 ? 153 ASP A OD2 1 
ATOM   978   N N   . VAL A 1 134 ? 39.086  -11.684 35.707  1.00 25.49 ? 154 VAL A N   1 
ATOM   979   C CA  . VAL A 1 134 ? 39.039  -12.395 34.448  1.00 22.53 ? 154 VAL A CA  1 
ATOM   980   C C   . VAL A 1 134 ? 38.602  -11.505 33.290  1.00 20.96 ? 154 VAL A C   1 
ATOM   981   O O   . VAL A 1 134 ? 37.972  -10.454 33.472  1.00 18.18 ? 154 VAL A O   1 
ATOM   982   C CB  . VAL A 1 134 ? 38.110  -13.605 34.529  1.00 22.74 ? 154 VAL A CB  1 
ATOM   983   C CG1 . VAL A 1 134 ? 38.668  -14.622 35.520  1.00 21.11 ? 154 VAL A CG1 1 
ATOM   984   C CG2 . VAL A 1 134 ? 36.707  -13.160 34.940  1.00 24.20 ? 154 VAL A CG2 1 
ATOM   985   N N   . LEU A 1 135 ? 38.975  -11.939 32.095  1.00 20.06 ? 155 LEU A N   1 
ATOM   986   C CA  . LEU A 1 135 ? 38.659  -11.232 30.866  1.00 15.91 ? 155 LEU A CA  1 
ATOM   987   C C   . LEU A 1 135 ? 37.174  -11.300 30.619  1.00 13.13 ? 155 LEU A C   1 
ATOM   988   O O   . LEU A 1 135 ? 36.586  -12.379 30.684  1.00 14.29 ? 155 LEU A O   1 
ATOM   989   C CB  . LEU A 1 135 ? 39.377  -11.881 29.680  1.00 12.34 ? 155 LEU A CB  1 
ATOM   990   C CG  . LEU A 1 135 ? 39.216  -11.114 28.372  1.00 8.16  ? 155 LEU A CG  1 
ATOM   991   C CD1 . LEU A 1 135 ? 40.024  -9.811  28.461  1.00 6.69  ? 155 LEU A CD1 1 
ATOM   992   C CD2 . LEU A 1 135 ? 39.675  -11.970 27.210  1.00 8.11  ? 155 LEU A CD2 1 
ATOM   993   N N   . LYS A 1 136 ? 36.589  -10.151 30.311  1.00 10.38 ? 156 LYS A N   1 
ATOM   994   C CA  . LYS A 1 136 ? 35.179  -10.042 30.028  1.00 9.97  ? 156 LYS A CA  1 
ATOM   995   C C   . LYS A 1 136 ? 34.998  -9.750  28.562  1.00 12.20 ? 156 LYS A C   1 
ATOM   996   O O   . LYS A 1 136 ? 35.807  -9.054  27.964  1.00 17.74 ? 156 LYS A O   1 
ATOM   997   C CB  . LYS A 1 136 ? 34.614  -8.900  30.835  1.00 14.15 ? 156 LYS A CB  1 
ATOM   998   C CG  . LYS A 1 136 ? 34.725  -9.108  32.333  1.00 18.37 ? 156 LYS A CG  1 
ATOM   999   C CD  . LYS A 1 136 ? 33.900  -10.312 32.779  1.00 21.07 ? 156 LYS A CD  1 
ATOM   1000  C CE  . LYS A 1 136 ? 34.144  -10.596 34.248  1.00 24.83 ? 156 LYS A CE  1 
ATOM   1001  N NZ  . LYS A 1 136 ? 33.319  -11.698 34.824  1.00 25.87 ? 156 LYS A NZ  1 
ATOM   1002  N N   . CYS A 1 137 ? 33.936  -10.274 27.981  1.00 12.97 ? 157 CYS A N   1 
ATOM   1003  C CA  . CYS A 1 137 ? 33.636  -10.068 26.572  1.00 15.16 ? 157 CYS A CA  1 
ATOM   1004  C C   . CYS A 1 137 ? 32.289  -9.373  26.425  1.00 15.42 ? 157 CYS A C   1 
ATOM   1005  O O   . CYS A 1 137 ? 31.442  -9.456  27.314  1.00 16.37 ? 157 CYS A O   1 
ATOM   1006  C CB  . CYS A 1 137 ? 33.600  -11.409 25.840  1.00 13.92 ? 157 CYS A CB  1 
ATOM   1007  S SG  . CYS A 1 137 ? 35.234  -12.090 25.447  1.00 18.16 ? 157 CYS A SG  1 
ATOM   1008  N N   . LEU A 1 138 ? 32.096  -8.685  25.305  1.00 16.52 ? 158 LEU A N   1 
ATOM   1009  C CA  . LEU A 1 138 ? 30.849  -7.991  25.021  1.00 15.59 ? 158 LEU A CA  1 
ATOM   1010  C C   . LEU A 1 138 ? 30.565  -7.940  23.518  1.00 17.67 ? 158 LEU A C   1 
ATOM   1011  O O   . LEU A 1 138 ? 31.375  -7.434  22.755  1.00 17.93 ? 158 LEU A O   1 
ATOM   1012  C CB  . LEU A 1 138 ? 30.886  -6.569  25.589  1.00 12.37 ? 158 LEU A CB  1 
ATOM   1013  C CG  . LEU A 1 138 ? 29.648  -5.701  25.340  1.00 12.36 ? 158 LEU A CG  1 
ATOM   1014  C CD1 . LEU A 1 138 ? 28.408  -6.402  25.861  1.00 13.05 ? 158 LEU A CD1 1 
ATOM   1015  C CD2 . LEU A 1 138 ? 29.793  -4.353  26.004  1.00 9.98  ? 158 LEU A CD2 1 
ATOM   1016  N N   . LYS A 1 139 ? 29.468  -8.562  23.095  1.00 19.84 ? 159 LYS A N   1 
ATOM   1017  C CA  . LYS A 1 139 ? 29.048  -8.535  21.700  1.00 19.30 ? 159 LYS A CA  1 
ATOM   1018  C C   . LYS A 1 139 ? 28.378  -7.153  21.582  1.00 20.58 ? 159 LYS A C   1 
ATOM   1019  O O   . LYS A 1 139 ? 27.684  -6.719  22.498  1.00 23.25 ? 159 LYS A O   1 
ATOM   1020  C CB  . LYS A 1 139 ? 28.022  -9.640  21.437  0.00 20.41 ? 159 LYS A CB  1 
ATOM   1021  C CG  . LYS A 1 139 ? 28.537  -11.034 21.736  0.00 21.98 ? 159 LYS A CG  1 
ATOM   1022  C CD  . LYS A 1 139 ? 29.659  -11.418 20.786  0.00 24.08 ? 159 LYS A CD  1 
ATOM   1023  C CE  . LYS A 1 139 ? 30.355  -12.687 21.241  0.00 25.09 ? 159 LYS A CE  1 
ATOM   1024  N NZ  . LYS A 1 139 ? 29.394  -13.796 21.496  0.00 25.46 ? 159 LYS A NZ  1 
ATOM   1025  N N   . ALA A 1 140 ? 28.633  -6.427  20.506  1.00 18.43 ? 160 ALA A N   1 
ATOM   1026  C CA  . ALA A 1 140 ? 28.030  -5.116  20.330  1.00 15.46 ? 160 ALA A CA  1 
ATOM   1027  C C   . ALA A 1 140 ? 28.103  -4.755  18.852  1.00 16.71 ? 160 ALA A C   1 
ATOM   1028  O O   . ALA A 1 140 ? 29.030  -5.158  18.154  1.00 16.65 ? 160 ALA A O   1 
ATOM   1029  C CB  . ALA A 1 140 ? 28.762  -4.088  21.171  1.00 13.80 ? 160 ALA A CB  1 
ATOM   1030  N N   . PRO A 1 141 ? 27.073  -4.069  18.328  1.00 18.31 ? 161 PRO A N   1 
ATOM   1031  C CA  . PRO A 1 141 ? 27.084  -3.692  16.914  1.00 14.00 ? 161 PRO A CA  1 
ATOM   1032  C C   . PRO A 1 141 ? 27.695  -2.333  16.735  1.00 11.96 ? 161 PRO A C   1 
ATOM   1033  O O   . PRO A 1 141 ? 27.848  -1.561  17.683  1.00 8.85  ? 161 PRO A O   1 
ATOM   1034  C CB  . PRO A 1 141 ? 25.611  -3.630  16.575  1.00 13.95 ? 161 PRO A CB  1 
ATOM   1035  C CG  . PRO A 1 141 ? 25.066  -2.982  17.810  1.00 16.07 ? 161 PRO A CG  1 
ATOM   1036  C CD  . PRO A 1 141 ? 25.770  -3.740  18.937  1.00 18.45 ? 161 PRO A CD  1 
ATOM   1037  N N   . ILE A 1 142 ? 28.028  -2.050  15.493  1.00 13.75 ? 162 ILE A N   1 
ATOM   1038  C CA  . ILE A 1 142 ? 28.629  -0.790  15.127  1.00 14.83 ? 162 ILE A CA  1 
ATOM   1039  C C   . ILE A 1 142 ? 27.466  0.134   14.826  1.00 16.29 ? 162 ILE A C   1 
ATOM   1040  O O   . ILE A 1 142 ? 26.661  -0.181  13.951  1.00 20.79 ? 162 ILE A O   1 
ATOM   1041  C CB  . ILE A 1 142 ? 29.543  -0.993  13.889  1.00 14.54 ? 162 ILE A CB  1 
ATOM   1042  C CG1 . ILE A 1 142 ? 30.863  -1.644  14.324  1.00 12.82 ? 162 ILE A CG1 1 
ATOM   1043  C CG2 . ILE A 1 142 ? 29.780  0.317   13.171  1.00 16.76 ? 162 ILE A CG2 1 
ATOM   1044  C CD1 . ILE A 1 142 ? 31.765  -2.032  13.180  1.00 14.33 ? 162 ILE A CD1 1 
ATOM   1045  N N   . LEU A 1 143 ? 27.339  1.234   15.571  1.00 15.65 ? 163 LEU A N   1 
ATOM   1046  C CA  . LEU A 1 143 ? 26.231  2.167   15.348  1.00 14.73 ? 163 LEU A CA  1 
ATOM   1047  C C   . LEU A 1 143 ? 26.475  2.987   14.107  1.00 16.19 ? 163 LEU A C   1 
ATOM   1048  O O   . LEU A 1 143 ? 27.571  2.992   13.565  1.00 16.83 ? 163 LEU A O   1 
ATOM   1049  C CB  . LEU A 1 143 ? 26.013  3.093   16.541  1.00 13.64 ? 163 LEU A CB  1 
ATOM   1050  C CG  . LEU A 1 143 ? 26.059  2.477   17.945  1.00 13.84 ? 163 LEU A CG  1 
ATOM   1051  C CD1 . LEU A 1 143 ? 25.619  3.522   18.930  1.00 17.22 ? 163 LEU A CD1 1 
ATOM   1052  C CD2 . LEU A 1 143 ? 25.184  1.263   18.082  1.00 6.60  ? 163 LEU A CD2 1 
ATOM   1053  N N   . SER A 1 144 ? 25.439  3.669   13.651  1.00 19.80 ? 164 SER A N   1 
ATOM   1054  C CA  . SER A 1 144 ? 25.531  4.491   12.456  1.00 24.73 ? 164 SER A CA  1 
ATOM   1055  C C   . SER A 1 144 ? 26.233  5.827   12.723  1.00 26.06 ? 164 SER A C   1 
ATOM   1056  O O   . SER A 1 144 ? 25.918  6.516   13.694  1.00 26.11 ? 164 SER A O   1 
ATOM   1057  C CB  . SER A 1 144 ? 24.132  4.720   11.909  1.00 25.28 ? 164 SER A CB  1 
ATOM   1058  O OG  . SER A 1 144 ? 23.227  4.921   12.980  1.00 27.63 ? 164 SER A OG  1 
ATOM   1059  N N   . ASP A 1 145 ? 27.199  6.176   11.874  0.00 26.18 ? 165 ASP A N   1 
ATOM   1060  C CA  . ASP A 1 145 ? 27.953  7.427   12.009  0.00 26.79 ? 165 ASP A CA  1 
ATOM   1061  C C   . ASP A 1 145 ? 27.037  8.580   12.437  0.00 29.23 ? 165 ASP A C   1 
ATOM   1062  O O   . ASP A 1 145 ? 27.447  9.472   13.177  0.00 28.51 ? 165 ASP A O   1 
ATOM   1063  C CB  . ASP A 1 145 ? 28.654  7.760   10.685  0.00 24.48 ? 165 ASP A CB  1 
ATOM   1064  C CG  . ASP A 1 145 ? 29.492  9.027   10.761  0.00 21.91 ? 165 ASP A CG  1 
ATOM   1065  O OD1 . ASP A 1 145 ? 30.416  9.091   11.600  0.00 20.61 ? 165 ASP A OD1 1 
ATOM   1066  O OD2 . ASP A 1 145 ? 29.228  9.956   9.970   0.00 20.50 ? 165 ASP A OD2 1 
ATOM   1067  N N   . SER A 1 146 ? 25.774  8.491   12.030  1.00 31.71 ? 166 SER A N   1 
ATOM   1068  C CA  . SER A 1 146 ? 24.734  9.488   12.342  1.00 32.60 ? 166 SER A CA  1 
ATOM   1069  C C   . SER A 1 146 ? 24.317  9.493   13.823  1.00 30.27 ? 166 SER A C   1 
ATOM   1070  O O   . SER A 1 146 ? 24.253  10.551  14.454  1.00 29.33 ? 166 SER A O   1 
ATOM   1071  C CB  . SER A 1 146 ? 23.514  9.236   11.458  1.00 30.98 ? 166 SER A CB  1 
ATOM   1072  O OG  . SER A 1 146 ? 23.300  7.839   11.351  0.00 33.04 ? 166 SER A OG  1 
ATOM   1073  N N   . SER A 1 147 ? 23.995  8.322   14.365  1.00 27.71 ? 167 SER A N   1 
ATOM   1074  C CA  . SER A 1 147 ? 23.627  8.226   15.772  1.00 28.30 ? 167 SER A CA  1 
ATOM   1075  C C   . SER A 1 147 ? 24.862  8.574   16.610  1.00 25.46 ? 167 SER A C   1 
ATOM   1076  O O   . SER A 1 147 ? 24.765  9.134   17.701  1.00 26.10 ? 167 SER A O   1 
ATOM   1077  C CB  . SER A 1 147 ? 23.142  6.813   16.107  1.00 31.83 ? 167 SER A CB  1 
ATOM   1078  O OG  . SER A 1 147 ? 22.071  6.440   15.263  1.00 35.00 ? 167 SER A OG  1 
ATOM   1079  N N   . CYS A 1 148 ? 26.030  8.283   16.057  1.00 22.07 ? 168 CYS A N   1 
ATOM   1080  C CA  . CYS A 1 148 ? 27.295  8.554   16.725  1.00 17.48 ? 168 CYS A CA  1 
ATOM   1081  C C   . CYS A 1 148 ? 27.486  10.066  16.860  1.00 13.17 ? 168 CYS A C   1 
ATOM   1082  O O   . CYS A 1 148 ? 27.541  10.626  17.964  1.00 5.00  ? 168 CYS A O   1 
ATOM   1083  C CB  . CYS A 1 148 ? 28.421  7.934   15.895  1.00 16.25 ? 168 CYS A CB  1 
ATOM   1084  S SG  . CYS A 1 148 ? 30.014  7.786   16.732  1.00 10.37 ? 168 CYS A SG  1 
ATOM   1085  N N   . LYS A 1 149 ? 27.531  10.726  15.714  1.00 11.30 ? 169 LYS A N   1 
ATOM   1086  C CA  . LYS A 1 149 ? 27.708  12.153  15.686  1.00 11.40 ? 169 LYS A CA  1 
ATOM   1087  C C   . LYS A 1 149 ? 26.655  12.852  16.498  1.00 14.45 ? 169 LYS A C   1 
ATOM   1088  O O   . LYS A 1 149 ? 26.965  13.809  17.168  1.00 18.09 ? 169 LYS A O   1 
ATOM   1089  C CB  . LYS A 1 149 ? 27.710  12.657  14.246  1.00 13.73 ? 169 LYS A CB  1 
ATOM   1090  C CG  . LYS A 1 149 ? 29.047  12.428  13.529  1.00 17.99 ? 169 LYS A CG  1 
ATOM   1091  C CD  . LYS A 1 149 ? 29.009  12.843  12.060  1.00 18.73 ? 169 LYS A CD  1 
ATOM   1092  C CE  . LYS A 1 149 ? 30.372  12.738  11.404  0.00 18.08 ? 169 LYS A CE  1 
ATOM   1093  N NZ  . LYS A 1 149 ? 31.357  13.703  11.962  0.00 17.30 ? 169 LYS A NZ  1 
ATOM   1094  N N   . SER A 1 150 ? 25.416  12.367  16.455  1.00 16.13 ? 170 SER A N   1 
ATOM   1095  C CA  . SER A 1 150 ? 24.328  12.979  17.201  1.00 13.08 ? 170 SER A CA  1 
ATOM   1096  C C   . SER A 1 150 ? 24.556  12.896  18.712  1.00 15.11 ? 170 SER A C   1 
ATOM   1097  O O   . SER A 1 150 ? 24.266  13.843  19.449  1.00 14.22 ? 170 SER A O   1 
ATOM   1098  C CB  . SER A 1 150 ? 22.998  12.349  16.795  1.00 8.48  ? 170 SER A CB  1 
ATOM   1099  O OG  . SER A 1 150 ? 22.996  10.948  16.936  0.00 11.98 ? 170 SER A OG  1 
ATOM   1100  N N   . ALA A 1 151 ? 25.132  11.782  19.157  1.00 18.05 ? 171 ALA A N   1 
ATOM   1101  C CA  . ALA A 1 151 ? 25.416  11.559  20.571  1.00 18.84 ? 171 ALA A CA  1 
ATOM   1102  C C   . ALA A 1 151 ? 26.539  12.446  21.058  1.00 19.91 ? 171 ALA A C   1 
ATOM   1103  O O   . ALA A 1 151 ? 26.511  12.948  22.173  1.00 20.47 ? 171 ALA A O   1 
ATOM   1104  C CB  . ALA A 1 151 ? 25.773  10.119  20.803  1.00 19.15 ? 171 ALA A CB  1 
ATOM   1105  N N   . TYR A 1 152 ? 27.564  12.597  20.233  1.00 21.21 ? 172 TYR A N   1 
ATOM   1106  C CA  . TYR A 1 152 ? 28.704  13.430  20.580  1.00 17.88 ? 172 TYR A CA  1 
ATOM   1107  C C   . TYR A 1 152 ? 28.896  14.396  19.433  1.00 21.80 ? 172 TYR A C   1 
ATOM   1108  O O   . TYR A 1 152 ? 29.774  14.221  18.603  1.00 26.14 ? 172 TYR A O   1 
ATOM   1109  C CB  . TYR A 1 152 ? 29.936  12.554  20.748  1.00 11.97 ? 172 TYR A CB  1 
ATOM   1110  C CG  . TYR A 1 152 ? 29.753  11.448  21.759  1.00 7.50  ? 172 TYR A CG  1 
ATOM   1111  C CD1 . TYR A 1 152 ? 29.378  10.162  21.370  1.00 6.01  ? 172 TYR A CD1 1 
ATOM   1112  C CD2 . TYR A 1 152 ? 29.988  11.680  23.097  1.00 5.00  ? 172 TYR A CD2 1 
ATOM   1113  C CE1 . TYR A 1 152 ? 29.255  9.155   22.295  1.00 5.00  ? 172 TYR A CE1 1 
ATOM   1114  C CE2 . TYR A 1 152 ? 29.870  10.690  24.016  1.00 5.00  ? 172 TYR A CE2 1 
ATOM   1115  C CZ  . TYR A 1 152 ? 29.509  9.433   23.622  1.00 5.00  ? 172 TYR A CZ  1 
ATOM   1116  O OH  . TYR A 1 152 ? 29.428  8.462   24.594  1.00 7.78  ? 172 TYR A OH  1 
ATOM   1117  N N   . PRO A 1 153 ? 28.100  15.463  19.398  1.00 22.10 ? 173 PRO A N   1 
ATOM   1118  C CA  . PRO A 1 153 ? 28.086  16.525  18.386  1.00 22.02 ? 173 PRO A CA  1 
ATOM   1119  C C   . PRO A 1 153 ? 29.432  17.030  17.928  1.00 20.84 ? 173 PRO A C   1 
ATOM   1120  O O   . PRO A 1 153 ? 30.171  17.584  18.723  1.00 18.37 ? 173 PRO A O   1 
ATOM   1121  C CB  . PRO A 1 153 ? 27.290  17.626  19.069  1.00 24.35 ? 173 PRO A CB  1 
ATOM   1122  C CG  . PRO A 1 153 ? 27.522  17.349  20.532  1.00 27.91 ? 173 PRO A CG  1 
ATOM   1123  C CD  . PRO A 1 153 ? 27.325  15.873  20.570  1.00 23.98 ? 173 PRO A CD  1 
ATOM   1124  N N   . GLY A 1 154 ? 29.737  16.832  16.647  0.00 23.12 ? 174 GLY A N   1 
ATOM   1125  C CA  . GLY A 1 154 ? 30.993  17.295  16.075  0.00 24.57 ? 174 GLY A CA  1 
ATOM   1126  C C   . GLY A 1 154 ? 32.256  16.587  16.535  0.00 25.37 ? 174 GLY A C   1 
ATOM   1127  O O   . GLY A 1 154 ? 33.191  16.419  15.755  0.00 24.92 ? 174 GLY A O   1 
ATOM   1128  N N   . GLN A 1 155 ? 32.291  16.193  17.804  1.00 26.29 ? 175 GLN A N   1 
ATOM   1129  C CA  . GLN A 1 155 ? 33.438  15.503  18.393  1.00 27.55 ? 175 GLN A CA  1 
ATOM   1130  C C   . GLN A 1 155 ? 33.805  14.228  17.652  1.00 26.04 ? 175 GLN A C   1 
ATOM   1131  O O   . GLN A 1 155 ? 34.962  13.829  17.641  1.00 31.75 ? 175 GLN A O   1 
ATOM   1132  C CB  . GLN A 1 155 ? 33.167  15.154  19.856  1.00 29.79 ? 175 GLN A CB  1 
ATOM   1133  C CG  . GLN A 1 155 ? 32.849  16.345  20.733  1.00 36.27 ? 175 GLN A CG  1 
ATOM   1134  C CD  . GLN A 1 155 ? 32.664  15.965  22.188  1.00 39.94 ? 175 GLN A CD  1 
ATOM   1135  O OE1 . GLN A 1 155 ? 33.567  16.137  22.997  1.00 41.66 ? 175 GLN A OE1 1 
ATOM   1136  N NE2 . GLN A 1 155 ? 31.490  15.454  22.528  1.00 43.49 ? 175 GLN A NE2 1 
ATOM   1137  N N   . ILE A 1 156 ? 32.811  13.551  17.099  1.00 19.81 ? 176 ILE A N   1 
ATOM   1138  C CA  . ILE A 1 156 ? 33.051  12.335  16.356  1.00 15.87 ? 176 ILE A CA  1 
ATOM   1139  C C   . ILE A 1 156 ? 33.742  12.650  15.030  1.00 17.58 ? 176 ILE A C   1 
ATOM   1140  O O   . ILE A 1 156 ? 33.161  13.295  14.152  1.00 19.40 ? 176 ILE A O   1 
ATOM   1141  C CB  . ILE A 1 156 ? 31.735  11.602  16.096  1.00 13.12 ? 176 ILE A CB  1 
ATOM   1142  C CG1 . ILE A 1 156 ? 31.110  11.207  17.431  1.00 16.83 ? 176 ILE A CG1 1 
ATOM   1143  C CG2 . ILE A 1 156 ? 31.942  10.379  15.235  1.00 8.30  ? 176 ILE A CG2 1 
ATOM   1144  C CD1 . ILE A 1 156 ? 32.065  10.509  18.378  1.00 17.84 ? 176 ILE A CD1 1 
ATOM   1145  N N   . THR A 1 157 ? 34.991  12.208  14.902  1.00 16.16 ? 177 THR A N   1 
ATOM   1146  C CA  . THR A 1 157 ? 35.764  12.414  13.686  1.00 12.57 ? 177 THR A CA  1 
ATOM   1147  C C   . THR A 1 157 ? 35.585  11.232  12.737  1.00 10.53 ? 177 THR A C   1 
ATOM   1148  O O   . THR A 1 157 ? 34.872  10.266  13.049  1.00 5.58  ? 177 THR A O   1 
ATOM   1149  C CB  . THR A 1 157 ? 37.266  12.554  13.982  1.00 11.03 ? 177 THR A CB  1 
ATOM   1150  O OG1 . THR A 1 157 ? 37.761  11.339  14.559  1.00 7.07  ? 177 THR A OG1 1 
ATOM   1151  C CG2 . THR A 1 157 ? 37.517  13.708  14.919  1.00 13.41 ? 177 THR A CG2 1 
ATOM   1152  N N   . SER A 1 158 ? 36.273  11.310  11.595  1.00 11.25 ? 178 SER A N   1 
ATOM   1153  C CA  . SER A 1 158 ? 36.232  10.274  10.576  1.00 10.01 ? 178 SER A CA  1 
ATOM   1154  C C   . SER A 1 158 ? 37.084  9.109   11.007  1.00 9.88  ? 178 SER A C   1 
ATOM   1155  O O   . SER A 1 158 ? 37.040  8.032   10.413  1.00 9.96  ? 178 SER A O   1 
ATOM   1156  C CB  . SER A 1 158 ? 36.739  10.816  9.252   1.00 9.42  ? 178 SER A CB  1 
ATOM   1157  O OG  . SER A 1 158 ? 37.876  11.642  9.435   0.00 10.56 ? 178 SER A OG  1 
ATOM   1158  N N   . ASN A 1 159 ? 37.829  9.315   12.081  1.00 9.61  ? 179 ASN A N   1 
ATOM   1159  C CA  . ASN A 1 159 ? 38.685  8.273   12.600  1.00 10.80 ? 179 ASN A CA  1 
ATOM   1160  C C   . ASN A 1 159 ? 38.079  7.630   13.837  1.00 11.59 ? 179 ASN A C   1 
ATOM   1161  O O   . ASN A 1 159 ? 38.743  6.877   14.557  1.00 11.65 ? 179 ASN A O   1 
ATOM   1162  C CB  . ASN A 1 159 ? 40.046  8.869   12.908  1.00 12.83 ? 179 ASN A CB  1 
ATOM   1163  C CG  . ASN A 1 159 ? 40.758  9.356   11.655  1.00 13.71 ? 179 ASN A CG  1 
ATOM   1164  O OD1 . ASN A 1 159 ? 40.551  8.829   10.559  1.00 11.60 ? 179 ASN A OD1 1 
ATOM   1165  N ND2 . ASN A 1 159 ? 41.589  10.367  11.810  1.00 14.92 ? 179 ASN A ND2 1 
ATOM   1166  N N   . MET A 1 160 ? 36.799  7.912   14.062  1.00 12.17 ? 180 MET A N   1 
ATOM   1167  C CA  . MET A 1 160 ? 36.076  7.393   15.207  1.00 7.78  ? 180 MET A CA  1 
ATOM   1168  C C   . MET A 1 160 ? 34.758  6.733   14.773  1.00 6.48  ? 180 MET A C   1 
ATOM   1169  O O   . MET A 1 160 ? 34.205  7.035   13.709  1.00 5.00  ? 180 MET A O   1 
ATOM   1170  C CB  . MET A 1 160 ? 35.806  8.545   16.185  1.00 5.00  ? 180 MET A CB  1 
ATOM   1171  C CG  . MET A 1 160 ? 37.046  9.314   16.626  1.00 5.00  ? 180 MET A CG  1 
ATOM   1172  S SD  . MET A 1 160 ? 36.729  10.524  17.929  1.00 5.00  ? 180 MET A SD  1 
ATOM   1173  C CE  . MET A 1 160 ? 37.939  11.700  17.674  1.00 5.00  ? 180 MET A CE  1 
ATOM   1174  N N   . PHE A 1 161 ? 34.302  5.775   15.569  1.00 7.71  ? 181 PHE A N   1 
ATOM   1175  C CA  . PHE A 1 161 ? 33.036  5.118   15.304  1.00 9.71  ? 181 PHE A CA  1 
ATOM   1176  C C   . PHE A 1 161 ? 32.427  4.714   16.634  1.00 10.26 ? 181 PHE A C   1 
ATOM   1177  O O   . PHE A 1 161 ? 33.166  4.453   17.580  1.00 11.43 ? 181 PHE A O   1 
ATOM   1178  C CB  . PHE A 1 161 ? 33.190  3.928   14.317  1.00 13.42 ? 181 PHE A CB  1 
ATOM   1179  C CG  . PHE A 1 161 ? 33.796  2.647   14.906  1.00 12.17 ? 181 PHE A CG  1 
ATOM   1180  C CD1 . PHE A 1 161 ? 33.031  1.763   15.642  1.00 10.78 ? 181 PHE A CD1 1 
ATOM   1181  C CD2 . PHE A 1 161 ? 35.110  2.288   14.627  1.00 10.42 ? 181 PHE A CD2 1 
ATOM   1182  C CE1 . PHE A 1 161 ? 33.577  0.562   16.072  1.00 10.41 ? 181 PHE A CE1 1 
ATOM   1183  C CE2 . PHE A 1 161 ? 35.650  1.077   15.064  1.00 5.00  ? 181 PHE A CE2 1 
ATOM   1184  C CZ  . PHE A 1 161 ? 34.898  0.228   15.773  1.00 5.00  ? 181 PHE A CZ  1 
ATOM   1185  N N   . CYS A 1 162 ? 31.099  4.785   16.733  1.00 10.46 ? 182 CYS A N   1 
ATOM   1186  C CA  . CYS A 1 162 ? 30.380  4.403   17.952  1.00 8.33  ? 182 CYS A CA  1 
ATOM   1187  C C   . CYS A 1 162 ? 29.940  2.938   17.901  1.00 8.26  ? 182 CYS A C   1 
ATOM   1188  O O   . CYS A 1 162 ? 29.596  2.407   16.850  1.00 5.71  ? 182 CYS A O   1 
ATOM   1189  C CB  . CYS A 1 162 ? 29.152  5.275   18.135  1.00 7.49  ? 182 CYS A CB  1 
ATOM   1190  S SG  . CYS A 1 162 ? 29.513  7.006   18.521  1.00 7.70  ? 182 CYS A SG  1 
ATOM   1191  N N   . ALA A 1 163 ? 29.958  2.280   19.043  1.00 10.25 ? 183 ALA A N   1 
ATOM   1192  C CA  . ALA A 1 163 ? 29.557  0.884   19.117  1.00 14.85 ? 183 ALA A CA  1 
ATOM   1193  C C   . ALA A 1 163 ? 28.961  0.670   20.497  1.00 17.43 ? 183 ALA A C   1 
ATOM   1194  O O   . ALA A 1 163 ? 29.409  1.275   21.486  1.00 14.26 ? 183 ALA A O   1 
ATOM   1195  C CB  . ALA A 1 163 ? 30.756  -0.049  18.892  1.00 15.17 ? 183 ALA A CB  1 
ATOM   1196  N N   . GLY A 1 164 A 27.943  -0.183  20.553  1.00 19.58 ? 184 GLY A N   1 
ATOM   1197  C CA  . GLY A 1 164 A 27.261  -0.450  21.803  1.00 18.88 ? 184 GLY A CA  1 
ATOM   1198  C C   . GLY A 1 164 A 25.747  -0.431  21.646  1.00 17.39 ? 184 GLY A C   1 
ATOM   1199  O O   . GLY A 1 164 A 25.212  -0.805  20.599  1.00 17.44 ? 184 GLY A O   1 
ATOM   1200  N N   . TYR A 1 165 ? 25.053  0.027   22.682  1.00 16.40 ? 184 TYR A N   1 
ATOM   1201  C CA  . TYR A 1 165 ? 23.603  0.067   22.680  1.00 15.34 ? 184 TYR A CA  1 
ATOM   1202  C C   . TYR A 1 165 ? 23.141  1.419   23.120  1.00 17.21 ? 184 TYR A C   1 
ATOM   1203  O O   . TYR A 1 165 ? 23.434  1.844   24.236  1.00 17.54 ? 184 TYR A O   1 
ATOM   1204  C CB  . TYR A 1 165 ? 23.080  -0.978  23.636  1.00 16.18 ? 184 TYR A CB  1 
ATOM   1205  C CG  . TYR A 1 165 ? 23.572  -2.340  23.280  1.00 17.49 ? 184 TYR A CG  1 
ATOM   1206  C CD1 . TYR A 1 165 ? 24.497  -2.999  24.078  1.00 17.85 ? 184 TYR A CD1 1 
ATOM   1207  C CD2 . TYR A 1 165 ? 23.147  -2.952  22.111  1.00 19.70 ? 184 TYR A CD2 1 
ATOM   1208  C CE1 . TYR A 1 165 ? 24.991  -4.231  23.715  1.00 20.95 ? 184 TYR A CE1 1 
ATOM   1209  C CE2 . TYR A 1 165 ? 23.625  -4.184  21.739  1.00 22.98 ? 184 TYR A CE2 1 
ATOM   1210  C CZ  . TYR A 1 165 ? 24.549  -4.822  22.537  1.00 24.69 ? 184 TYR A CZ  1 
ATOM   1211  O OH  . TYR A 1 165 ? 25.028  -6.051  22.128  1.00 29.56 ? 184 TYR A OH  1 
ATOM   1212  N N   . LEU A 1 166 ? 22.389  2.085   22.256  1.00 19.42 ? 185 LEU A N   1 
ATOM   1213  C CA  . LEU A 1 166 ? 21.903  3.415   22.574  1.00 21.71 ? 185 LEU A CA  1 
ATOM   1214  C C   . LEU A 1 166 ? 21.073  3.414   23.873  1.00 23.39 ? 185 LEU A C   1 
ATOM   1215  O O   . LEU A 1 166 ? 21.003  4.433   24.578  1.00 22.64 ? 185 LEU A O   1 
ATOM   1216  C CB  . LEU A 1 166 ? 21.136  4.010   21.376  1.00 16.82 ? 185 LEU A CB  1 
ATOM   1217  C CG  . LEU A 1 166 ? 21.913  4.594   20.193  1.00 6.91  ? 185 LEU A CG  1 
ATOM   1218  C CD1 . LEU A 1 166 ? 20.947  5.004   19.103  0.00 10.26 ? 185 LEU A CD1 1 
ATOM   1219  C CD2 . LEU A 1 166 ? 22.743  5.787   20.654  0.00 10.23 ? 185 LEU A CD2 1 
ATOM   1220  N N   . GLU A 1 167 ? 20.503  2.253   24.207  1.00 24.23 ? 186 GLU A N   1 
ATOM   1221  C CA  . GLU A 1 167 ? 19.707  2.110   25.426  1.00 26.27 ? 186 GLU A CA  1 
ATOM   1222  C C   . GLU A 1 167 ? 20.613  2.155   26.655  1.00 28.00 ? 186 GLU A C   1 
ATOM   1223  O O   . GLU A 1 167 ? 20.260  2.729   27.681  1.00 27.20 ? 186 GLU A O   1 
ATOM   1224  C CB  . GLU A 1 167 ? 18.923  0.796   25.422  0.00 25.93 ? 186 GLU A CB  1 
ATOM   1225  C CG  . GLU A 1 167 ? 18.072  0.614   26.673  0.00 25.33 ? 186 GLU A CG  1 
ATOM   1226  C CD  . GLU A 1 167 ? 17.534  -0.789  26.839  0.00 24.25 ? 186 GLU A CD  1 
ATOM   1227  O OE1 . GLU A 1 167 ? 16.313  -0.928  27.056  0.00 23.34 ? 186 GLU A OE1 1 
ATOM   1228  O OE2 . GLU A 1 167 ? 18.329  -1.750  26.775  0.00 23.26 ? 186 GLU A OE2 1 
ATOM   1229  N N   . GLY A 1 168 ? 21.799  1.572   26.526  1.00 29.42 ? 187 GLY A N   1 
ATOM   1230  C CA  . GLY A 1 168 ? 22.736  1.540   27.631  1.00 29.45 ? 187 GLY A CA  1 
ATOM   1231  C C   . GLY A 1 168 ? 22.760  0.172   28.299  1.00 27.96 ? 187 GLY A C   1 
ATOM   1232  O O   . GLY A 1 168 ? 22.100  -0.766  27.841  1.00 28.07 ? 187 GLY A O   1 
ATOM   1233  N N   . GLY A 1 169 A 23.532  0.046   29.374  1.00 24.74 ? 188 GLY A N   1 
ATOM   1234  C CA  . GLY A 1 169 A 23.605  -1.220  30.075  1.00 21.41 ? 188 GLY A CA  1 
ATOM   1235  C C   . GLY A 1 169 A 24.787  -2.077  29.705  1.00 18.98 ? 188 GLY A C   1 
ATOM   1236  O O   . GLY A 1 169 A 25.264  -2.835  30.536  1.00 19.61 ? 188 GLY A O   1 
ATOM   1237  N N   . LYS A 1 170 ? 25.267  -1.943  28.473  1.00 17.65 ? 188 LYS A N   1 
ATOM   1238  C CA  . LYS A 1 170 ? 26.407  -2.716  27.982  1.00 16.31 ? 188 LYS A CA  1 
ATOM   1239  C C   . LYS A 1 170 ? 27.320  -1.755  27.234  1.00 16.07 ? 188 LYS A C   1 
ATOM   1240  O O   . LYS A 1 170 ? 26.861  -1.070  26.316  1.00 14.03 ? 188 LYS A O   1 
ATOM   1241  C CB  . LYS A 1 170 ? 25.919  -3.828  27.056  1.00 15.20 ? 188 LYS A CB  1 
ATOM   1242  C CG  . LYS A 1 170 ? 24.915  -4.789  27.718  1.00 12.03 ? 188 LYS A CG  1 
ATOM   1243  C CD  . LYS A 1 170 ? 24.472  -5.873  26.763  1.00 11.35 ? 188 LYS A CD  1 
ATOM   1244  C CE  . LYS A 1 170 ? 23.406  -6.760  27.367  0.00 11.62 ? 188 LYS A CE  1 
ATOM   1245  N NZ  . LYS A 1 170 ? 22.939  -7.777  26.385  0.00 11.63 ? 188 LYS A NZ  1 
ATOM   1246  N N   . ASP A 1 171 ? 28.600  -1.701  27.634  1.00 14.88 ? 189 ASP A N   1 
ATOM   1247  C CA  . ASP A 1 171 ? 29.588  -0.773  27.053  1.00 9.64  ? 189 ASP A CA  1 
ATOM   1248  C C   . ASP A 1 171 ? 30.937  -1.059  27.689  1.00 8.48  ? 189 ASP A C   1 
ATOM   1249  O O   . ASP A 1 171 ? 30.997  -1.736  28.716  1.00 6.08  ? 189 ASP A O   1 
ATOM   1250  C CB  . ASP A 1 171 ? 29.168  0.662   27.404  1.00 9.11  ? 189 ASP A CB  1 
ATOM   1251  C CG  . ASP A 1 171 ? 29.997  1.726   26.722  1.00 7.56  ? 189 ASP A CG  1 
ATOM   1252  O OD1 . ASP A 1 171 ? 29.853  2.889   27.122  1.00 8.61  ? 189 ASP A OD1 1 
ATOM   1253  O OD2 . ASP A 1 171 ? 30.750  1.439   25.782  1.00 8.35  ? 189 ASP A OD2 1 
ATOM   1254  N N   . SER A 1 172 ? 32.011  -0.573  27.055  1.00 11.47 ? 190 SER A N   1 
ATOM   1255  C CA  . SER A 1 172 ? 33.397  -0.724  27.539  1.00 8.54  ? 190 SER A CA  1 
ATOM   1256  C C   . SER A 1 172 ? 33.616  0.328   28.613  1.00 6.05  ? 190 SER A C   1 
ATOM   1257  O O   . SER A 1 172 ? 32.911  1.321   28.664  1.00 5.00  ? 190 SER A O   1 
ATOM   1258  C CB  . SER A 1 172 ? 34.416  -0.558  26.399  1.00 6.50  ? 190 SER A CB  1 
ATOM   1259  O OG  . SER A 1 172 ? 34.213  0.645   25.683  1.00 5.00  ? 190 SER A OG  1 
ATOM   1260  N N   . CYS A 1 173 ? 34.604  0.138   29.461  1.00 7.04  ? 191 CYS A N   1 
ATOM   1261  C CA  . CYS A 1 173 ? 34.806  1.082   30.543  1.00 8.70  ? 191 CYS A CA  1 
ATOM   1262  C C   . CYS A 1 173 ? 36.268  1.212   30.973  1.00 10.92 ? 191 CYS A C   1 
ATOM   1263  O O   . CYS A 1 173 ? 37.113  0.382   30.595  1.00 12.28 ? 191 CYS A O   1 
ATOM   1264  C CB  . CYS A 1 173 ? 33.954  0.654   31.734  1.00 6.48  ? 191 CYS A CB  1 
ATOM   1265  S SG  . CYS A 1 173 ? 33.585  1.989   32.906  1.00 5.00  ? 191 CYS A SG  1 
ATOM   1266  N N   . GLN A 1 174 ? 36.534  2.247   31.780  1.00 11.11 ? 192 GLN A N   1 
ATOM   1267  C CA  . GLN A 1 174 ? 37.860  2.572   32.305  1.00 7.66  ? 192 GLN A CA  1 
ATOM   1268  C C   . GLN A 1 174 ? 38.614  1.319   32.679  1.00 7.84  ? 192 GLN A C   1 
ATOM   1269  O O   . GLN A 1 174 ? 38.144  0.527   33.491  1.00 7.00  ? 192 GLN A O   1 
ATOM   1270  C CB  . GLN A 1 174 ? 37.757  3.567   33.464  1.00 6.82  ? 192 GLN A CB  1 
ATOM   1271  C CG  . GLN A 1 174 ? 37.444  5.032   33.017  1.00 5.00  ? 192 GLN A CG  1 
ATOM   1272  C CD  . GLN A 1 174 ? 36.079  5.200   32.364  1.00 5.00  ? 192 GLN A CD  1 
ATOM   1273  O OE1 . GLN A 1 174 ? 35.882  4.846   31.207  0.00 5.00  ? 192 GLN A OE1 1 
ATOM   1274  N NE2 . GLN A 1 174 ? 35.125  5.723   33.122  0.00 5.00  ? 192 GLN A NE2 1 
ATOM   1275  N N   . GLY A 1 175 ? 39.721  1.105   31.960  1.00 10.13 ? 193 GLY A N   1 
ATOM   1276  C CA  . GLY A 1 175 ? 40.555  -0.069  32.115  1.00 7.08  ? 193 GLY A CA  1 
ATOM   1277  C C   . GLY A 1 175 ? 40.489  -0.858  30.821  1.00 5.00  ? 193 GLY A C   1 
ATOM   1278  O O   . GLY A 1 175 ? 41.261  -1.777  30.617  1.00 5.00  ? 193 GLY A O   1 
ATOM   1279  N N   . ASP A 1 176 ? 39.561  -0.501  29.948  1.00 5.00  ? 194 ASP A N   1 
ATOM   1280  C CA  . ASP A 1 176 ? 39.401  -1.184  28.681  1.00 5.00  ? 194 ASP A CA  1 
ATOM   1281  C C   . ASP A 1 176 ? 40.100  -0.509  27.518  1.00 8.29  ? 194 ASP A C   1 
ATOM   1282  O O   . ASP A 1 176 ? 40.146  -1.078  26.418  1.00 10.46 ? 194 ASP A O   1 
ATOM   1283  C CB  . ASP A 1 176 ? 37.924  -1.353  28.325  1.00 5.00  ? 194 ASP A CB  1 
ATOM   1284  C CG  . ASP A 1 176 ? 37.245  -2.436  29.132  1.00 5.91  ? 194 ASP A CG  1 
ATOM   1285  O OD1 . ASP A 1 176 ? 36.048  -2.289  29.428  1.00 5.00  ? 194 ASP A OD1 1 
ATOM   1286  O OD2 . ASP A 1 176 ? 37.894  -3.452  29.458  1.00 9.04  ? 194 ASP A OD2 1 
ATOM   1287  N N   . SER A 1 177 ? 40.614  0.706   27.736  1.00 7.84  ? 195 SER A N   1 
ATOM   1288  C CA  . SER A 1 177 ? 41.313  1.460   26.690  1.00 5.22  ? 195 SER A CA  1 
ATOM   1289  C C   . SER A 1 177 ? 42.328  0.613   25.945  1.00 6.25  ? 195 SER A C   1 
ATOM   1290  O O   . SER A 1 177 ? 42.971  -0.267  26.515  1.00 5.91  ? 195 SER A O   1 
ATOM   1291  C CB  . SER A 1 177 ? 42.050  2.655   27.284  1.00 5.00  ? 195 SER A CB  1 
ATOM   1292  O OG  . SER A 1 177 ? 41.280  3.824   27.226  1.00 5.00  ? 195 SER A OG  1 
ATOM   1293  N N   . GLY A 1 178 ? 42.451  0.872   24.654  1.00 8.46  ? 196 GLY A N   1 
ATOM   1294  C CA  . GLY A 1 178 ? 43.410  0.149   23.851  1.00 7.36  ? 196 GLY A CA  1 
ATOM   1295  C C   . GLY A 1 178 ? 42.998  -1.247  23.494  1.00 5.00  ? 196 GLY A C   1 
ATOM   1296  O O   . GLY A 1 178 ? 43.607  -1.832  22.625  1.00 6.60  ? 196 GLY A O   1 
ATOM   1297  N N   . GLY A 1 179 ? 41.969  -1.773  24.147  1.00 5.00  ? 197 GLY A N   1 
ATOM   1298  C CA  . GLY A 1 179 ? 41.514  -3.113  23.843  1.00 5.00  ? 197 GLY A CA  1 
ATOM   1299  C C   . GLY A 1 179 ? 40.990  -3.261  22.423  1.00 5.00  ? 197 GLY A C   1 
ATOM   1300  O O   . GLY A 1 179 ? 40.744  -2.261  21.732  1.00 5.00  ? 197 GLY A O   1 
ATOM   1301  N N   . PRO A 1 180 ? 40.808  -4.506  21.960  1.00 5.00  ? 198 PRO A N   1 
ATOM   1302  C CA  . PRO A 1 180 ? 40.314  -4.817  20.620  1.00 5.00  ? 198 PRO A CA  1 
ATOM   1303  C C   . PRO A 1 180 ? 38.812  -4.755  20.401  1.00 5.00  ? 198 PRO A C   1 
ATOM   1304  O O   . PRO A 1 180 ? 38.034  -4.950  21.324  1.00 5.00  ? 198 PRO A O   1 
ATOM   1305  C CB  . PRO A 1 180 ? 40.813  -6.243  20.412  1.00 5.00  ? 198 PRO A CB  1 
ATOM   1306  C CG  . PRO A 1 180 ? 40.727  -6.834  21.775  1.00 5.00  ? 198 PRO A CG  1 
ATOM   1307  C CD  . PRO A 1 180 ? 41.268  -5.730  22.645  1.00 5.00  ? 198 PRO A CD  1 
ATOM   1308  N N   . VAL A 1 181 ? 38.417  -4.452  19.172  1.00 5.94  ? 199 VAL A N   1 
ATOM   1309  C CA  . VAL A 1 181 ? 37.011  -4.453  18.762  1.00 7.68  ? 199 VAL A CA  1 
ATOM   1310  C C   . VAL A 1 181 ? 37.109  -5.262  17.487  1.00 8.85  ? 199 VAL A C   1 
ATOM   1311  O O   . VAL A 1 181 ? 37.496  -4.732  16.453  1.00 10.29 ? 199 VAL A O   1 
ATOM   1312  C CB  . VAL A 1 181 ? 36.439  -3.043  18.429  1.00 7.35  ? 199 VAL A CB  1 
ATOM   1313  C CG1 . VAL A 1 181 ? 35.161  -3.176  17.604  1.00 7.66  ? 199 VAL A CG1 1 
ATOM   1314  C CG2 . VAL A 1 181 ? 36.130  -2.279  19.705  1.00 5.00  ? 199 VAL A CG2 1 
ATOM   1315  N N   . VAL A 1 182 ? 36.871  -6.561  17.594  1.00 10.43 ? 200 VAL A N   1 
ATOM   1316  C CA  . VAL A 1 182 ? 36.979  -7.441  16.447  1.00 10.42 ? 200 VAL A CA  1 
ATOM   1317  C C   . VAL A 1 182 ? 35.625  -7.689  15.821  1.00 11.81 ? 200 VAL A C   1 
ATOM   1318  O O   . VAL A 1 182 ? 34.659  -7.936  16.520  1.00 11.78 ? 200 VAL A O   1 
ATOM   1319  C CB  . VAL A 1 182 ? 37.610  -8.783  16.839  1.00 8.94  ? 200 VAL A CB  1 
ATOM   1320  C CG1 . VAL A 1 182 ? 37.837  -9.615  15.614  1.00 10.46 ? 200 VAL A CG1 1 
ATOM   1321  C CG2 . VAL A 1 182 ? 38.901  -8.563  17.562  1.00 5.00  ? 200 VAL A CG2 1 
ATOM   1322  N N   . CYS A 1 183 ? 35.557  -7.568  14.502  1.00 15.49 ? 201 CYS A N   1 
ATOM   1323  C CA  . CYS A 1 183 ? 34.322  -7.814  13.761  1.00 18.44 ? 201 CYS A CA  1 
ATOM   1324  C C   . CYS A 1 183 ? 34.710  -8.750  12.628  1.00 20.95 ? 201 CYS A C   1 
ATOM   1325  O O   . CYS A 1 183 ? 35.590  -8.435  11.824  1.00 18.94 ? 201 CYS A O   1 
ATOM   1326  C CB  . CYS A 1 183 ? 33.734  -6.532  13.171  1.00 14.21 ? 201 CYS A CB  1 
ATOM   1327  S SG  . CYS A 1 183 ? 33.916  -5.080  14.232  1.00 11.69 ? 201 CYS A SG  1 
ATOM   1328  N N   . SER A 1 184 ? 34.111  -9.934  12.625  1.00 23.38 ? 202 SER A N   1 
ATOM   1329  C CA  . SER A 1 184 ? 34.378  -10.921 11.594  1.00 25.19 ? 202 SER A CA  1 
ATOM   1330  C C   . SER A 1 184 ? 35.869  -11.278 11.479  1.00 24.05 ? 202 SER A C   1 
ATOM   1331  O O   . SER A 1 184 ? 36.420  -11.345 10.373  1.00 24.36 ? 202 SER A O   1 
ATOM   1332  C CB  . SER A 1 184 ? 33.836  -10.417 10.252  1.00 26.45 ? 202 SER A CB  1 
ATOM   1333  O OG  . SER A 1 184 ? 32.534  -9.864  10.409  1.00 29.66 ? 202 SER A OG  1 
ATOM   1334  N N   . GLY A 1 185 ? 36.513  -11.492 12.628  1.00 20.67 ? 203 GLY A N   1 
ATOM   1335  C CA  . GLY A 1 185 ? 37.918  -11.868 12.645  1.00 17.97 ? 203 GLY A CA  1 
ATOM   1336  C C   . GLY A 1 185 ? 38.939  -10.785 12.316  1.00 15.57 ? 203 GLY A C   1 
ATOM   1337  O O   . GLY A 1 185 ? 40.126  -11.068 12.203  1.00 16.44 ? 203 GLY A O   1 
ATOM   1338  N N   . LYS A 1 186 ? 38.500  -9.548  12.151  1.00 13.57 ? 204 LYS A N   1 
ATOM   1339  C CA  . LYS A 1 186 ? 39.421  -8.465  11.856  1.00 8.10  ? 204 LYS A CA  1 
ATOM   1340  C C   . LYS A 1 186 ? 39.422  -7.484  13.006  1.00 5.00  ? 204 LYS A C   1 
ATOM   1341  O O   . LYS A 1 186 ? 38.477  -7.437  13.782  1.00 5.00  ? 204 LYS A O   1 
ATOM   1342  C CB  . LYS A 1 186 ? 38.996  -7.752  10.585  1.00 9.56  ? 204 LYS A CB  1 
ATOM   1343  C CG  . LYS A 1 186 ? 38.927  -8.653  9.382   1.00 13.12 ? 204 LYS A CG  1 
ATOM   1344  C CD  . LYS A 1 186 ? 40.273  -9.254  9.096   1.00 17.19 ? 204 LYS A CD  1 
ATOM   1345  C CE  . LYS A 1 186 ? 40.330  -9.934  7.732   1.00 17.35 ? 204 LYS A CE  1 
ATOM   1346  N NZ  . LYS A 1 186 ? 41.737  -10.345 7.446   0.00 17.51 ? 204 LYS A NZ  1 
ATOM   1347  N N   . LEU A 1 187 ? 40.502  -6.735  13.141  1.00 5.00  ? 209 LEU A N   1 
ATOM   1348  C CA  . LEU A 1 187 ? 40.607  -5.746  14.193  1.00 6.47  ? 209 LEU A CA  1 
ATOM   1349  C C   . LEU A 1 187 ? 40.012  -4.470  13.626  1.00 9.42  ? 209 LEU A C   1 
ATOM   1350  O O   . LEU A 1 187 ? 40.664  -3.818  12.836  1.00 13.30 ? 209 LEU A O   1 
ATOM   1351  C CB  . LEU A 1 187 ? 42.071  -5.513  14.560  1.00 5.00  ? 209 LEU A CB  1 
ATOM   1352  C CG  . LEU A 1 187 ? 42.283  -4.485  15.671  1.00 5.00  ? 209 LEU A CG  1 
ATOM   1353  C CD1 . LEU A 1 187 ? 41.814  -5.039  16.997  1.00 5.00  ? 209 LEU A CD1 1 
ATOM   1354  C CD2 . LEU A 1 187 ? 43.727  -4.136  15.741  1.00 5.00  ? 209 LEU A CD2 1 
ATOM   1355  N N   . GLN A 1 188 ? 38.794  -4.106  14.024  1.00 9.48  ? 210 GLN A N   1 
ATOM   1356  C CA  . GLN A 1 188 ? 38.140  -2.915  13.499  1.00 6.64  ? 210 GLN A CA  1 
ATOM   1357  C C   . GLN A 1 188 ? 38.307  -1.663  14.294  1.00 5.00  ? 210 GLN A C   1 
ATOM   1358  O O   . GLN A 1 188 ? 38.318  -0.582  13.726  1.00 5.00  ? 210 GLN A O   1 
ATOM   1359  C CB  . GLN A 1 188 ? 36.656  -3.150  13.311  1.00 9.28  ? 210 GLN A CB  1 
ATOM   1360  C CG  . GLN A 1 188 ? 36.324  -4.010  12.121  1.00 12.42 ? 210 GLN A CG  1 
ATOM   1361  C CD  . GLN A 1 188 ? 36.726  -3.375  10.807  1.00 13.92 ? 210 GLN A CD  1 
ATOM   1362  O OE1 . GLN A 1 188 ? 36.910  -4.085  9.814   1.00 14.31 ? 210 GLN A OE1 1 
ATOM   1363  N NE2 . GLN A 1 188 ? 36.839  -2.037  10.778  1.00 10.43 ? 210 GLN A NE2 1 
ATOM   1364  N N   . GLY A 1 189 ? 38.409  -1.786  15.604  1.00 5.00  ? 211 GLY A N   1 
ATOM   1365  C CA  . GLY A 1 189 ? 38.545  -0.589  16.413  1.00 5.70  ? 211 GLY A CA  1 
ATOM   1366  C C   . GLY A 1 189 ? 39.211  -0.768  17.758  1.00 5.00  ? 211 GLY A C   1 
ATOM   1367  O O   . GLY A 1 189 ? 39.305  -1.866  18.298  1.00 5.78  ? 211 GLY A O   1 
ATOM   1368  N N   . ILE A 1 190 ? 39.664  0.331   18.319  1.00 5.00  ? 212 ILE A N   1 
ATOM   1369  C CA  . ILE A 1 190 ? 40.332  0.279   19.605  1.00 7.56  ? 212 ILE A CA  1 
ATOM   1370  C C   . ILE A 1 190 ? 39.461  1.028   20.611  1.00 9.18  ? 212 ILE A C   1 
ATOM   1371  O O   . ILE A 1 190 ? 38.952  2.124   20.308  1.00 9.91  ? 212 ILE A O   1 
ATOM   1372  C CB  . ILE A 1 190 ? 41.744  0.954   19.521  1.00 8.47  ? 212 ILE A CB  1 
ATOM   1373  C CG1 . ILE A 1 190 ? 42.513  0.368   18.334  1.00 11.00 ? 212 ILE A CG1 1 
ATOM   1374  C CG2 . ILE A 1 190 ? 42.526  0.762   20.824  1.00 5.00  ? 212 ILE A CG2 1 
ATOM   1375  C CD1 . ILE A 1 190 ? 43.781  1.067   18.018  1.00 11.28 ? 212 ILE A CD1 1 
ATOM   1376  N N   . VAL A 1 191 ? 39.229  0.412   21.768  1.00 6.27  ? 213 VAL A N   1 
ATOM   1377  C CA  . VAL A 1 191 ? 38.454  1.042   22.824  1.00 5.76  ? 213 VAL A CA  1 
ATOM   1378  C C   . VAL A 1 191 ? 39.129  2.392   23.133  1.00 9.48  ? 213 VAL A C   1 
ATOM   1379  O O   . VAL A 1 191 ? 40.277  2.421   23.590  1.00 13.00 ? 213 VAL A O   1 
ATOM   1380  C CB  . VAL A 1 191 ? 38.481  0.195   24.078  1.00 5.00  ? 213 VAL A CB  1 
ATOM   1381  C CG1 . VAL A 1 191 ? 37.689  0.850   25.157  1.00 7.26  ? 213 VAL A CG1 1 
ATOM   1382  C CG2 . VAL A 1 191 ? 37.947  -1.157  23.798  1.00 5.00  ? 213 VAL A CG2 1 
ATOM   1383  N N   . SER A 1 192 ? 38.415  3.496   22.906  1.00 10.12 ? 214 SER A N   1 
ATOM   1384  C CA  . SER A 1 192 ? 38.956  4.826   23.113  1.00 7.42  ? 214 SER A CA  1 
ATOM   1385  C C   . SER A 1 192 ? 38.281  5.630   24.219  1.00 8.59  ? 214 SER A C   1 
ATOM   1386  O O   . SER A 1 192 ? 38.734  5.625   25.358  1.00 11.20 ? 214 SER A O   1 
ATOM   1387  C CB  . SER A 1 192 ? 38.909  5.583   21.796  1.00 5.00  ? 214 SER A CB  1 
ATOM   1388  O OG  . SER A 1 192 ? 39.644  6.780   21.882  1.00 11.55 ? 214 SER A OG  1 
ATOM   1389  N N   . TRP A 1 193 ? 37.193  6.318   23.901  1.00 10.62 ? 215 TRP A N   1 
ATOM   1390  C CA  . TRP A 1 193 ? 36.502  7.131   24.908  1.00 14.19 ? 215 TRP A CA  1 
ATOM   1391  C C   . TRP A 1 193 ? 34.954  7.102   24.832  1.00 16.18 ? 215 TRP A C   1 
ATOM   1392  O O   . TRP A 1 193 ? 34.357  6.377   24.016  1.00 13.38 ? 215 TRP A O   1 
ATOM   1393  C CB  . TRP A 1 193 ? 36.995  8.572   24.806  1.00 12.32 ? 215 TRP A CB  1 
ATOM   1394  C CG  . TRP A 1 193 ? 36.735  9.152   23.469  1.00 12.65 ? 215 TRP A CG  1 
ATOM   1395  C CD1 . TRP A 1 193 ? 37.431  8.903   22.321  1.00 14.96 ? 215 TRP A CD1 1 
ATOM   1396  C CD2 . TRP A 1 193 ? 35.685  10.058  23.115  1.00 12.27 ? 215 TRP A CD2 1 
ATOM   1397  N NE1 . TRP A 1 193 ? 36.879  9.598   21.271  1.00 15.15 ? 215 TRP A NE1 1 
ATOM   1398  C CE2 . TRP A 1 193 ? 35.805  10.313  21.731  1.00 14.58 ? 215 TRP A CE2 1 
ATOM   1399  C CE3 . TRP A 1 193 ? 34.654  10.675  23.831  1.00 9.61  ? 215 TRP A CE3 1 
ATOM   1400  C CZ2 . TRP A 1 193 ? 34.935  11.156  21.054  1.00 16.09 ? 215 TRP A CZ2 1 
ATOM   1401  C CZ3 . TRP A 1 193 ? 33.795  11.508  23.161  1.00 9.67  ? 215 TRP A CZ3 1 
ATOM   1402  C CH2 . TRP A 1 193 ? 33.934  11.744  21.788  1.00 13.83 ? 215 TRP A CH2 1 
ATOM   1403  N N   . GLY A 1 194 ? 34.323  7.863   25.725  1.00 16.83 ? 216 GLY A N   1 
ATOM   1404  C CA  . GLY A 1 194 ? 32.872  7.960   25.761  1.00 17.30 ? 216 GLY A CA  1 
ATOM   1405  C C   . GLY A 1 194 ? 32.473  8.721   27.006  1.00 16.39 ? 216 GLY A C   1 
ATOM   1406  O O   . GLY A 1 194 ? 33.354  9.258   27.686  1.00 18.04 ? 216 GLY A O   1 
ATOM   1407  N N   . SER A 1 195 ? 31.176  8.841   27.278  1.00 14.30 ? 217 SER A N   1 
ATOM   1408  C CA  . SER A 1 195 ? 30.746  9.527   28.494  1.00 18.20 ? 217 SER A CA  1 
ATOM   1409  C C   . SER A 1 195 ? 30.408  8.447   29.494  1.00 17.91 ? 217 SER A C   1 
ATOM   1410  O O   . SER A 1 195 ? 29.573  7.588   29.217  1.00 15.87 ? 217 SER A O   1 
ATOM   1411  C CB  . SER A 1 195 ? 29.517  10.384  28.245  1.00 23.72 ? 217 SER A CB  1 
ATOM   1412  O OG  . SER A 1 195 ? 29.688  11.168  27.088  1.00 31.01 ? 217 SER A OG  1 
ATOM   1413  N N   . GLY A 1 196 ? 31.063  8.477   30.649  1.00 19.90 ? 219 GLY A N   1 
ATOM   1414  C CA  . GLY A 1 196 ? 30.820  7.461   31.661  1.00 22.17 ? 219 GLY A CA  1 
ATOM   1415  C C   . GLY A 1 196 ? 30.858  6.077   31.041  1.00 20.31 ? 219 GLY A C   1 
ATOM   1416  O O   . GLY A 1 196 ? 31.610  5.846   30.101  1.00 18.67 ? 219 GLY A O   1 
ATOM   1417  N N   . CYS A 1 197 ? 30.023  5.169   31.529  1.00 19.64 ? 220 CYS A N   1 
ATOM   1418  C CA  . CYS A 1 197 ? 29.992  3.822   30.979  1.00 19.83 ? 220 CYS A CA  1 
ATOM   1419  C C   . CYS A 1 197 ? 28.588  3.258   30.939  1.00 23.01 ? 220 CYS A C   1 
ATOM   1420  O O   . CYS A 1 197 ? 27.857  3.332   31.931  1.00 23.61 ? 220 CYS A O   1 
ATOM   1421  C CB  . CYS A 1 197 ? 30.903  2.898   31.783  1.00 18.45 ? 220 CYS A CB  1 
ATOM   1422  S SG  . CYS A 1 197 ? 32.679  3.325   31.692  1.00 16.30 ? 220 CYS A SG  1 
ATOM   1423  N N   . ALA A 1 198 A 28.207  2.740   29.772  1.00 24.96 ? 221 ALA A N   1 
ATOM   1424  C CA  . ALA A 1 198 A 26.884  2.147   29.552  1.00 26.49 ? 221 ALA A CA  1 
ATOM   1425  C C   . ALA A 1 198 A 25.745  3.151   29.723  1.00 27.82 ? 221 ALA A C   1 
ATOM   1426  O O   . ALA A 1 198 A 24.584  2.752   29.865  1.00 29.58 ? 221 ALA A O   1 
ATOM   1427  C CB  . ALA A 1 198 A 26.672  0.946   30.478  1.00 23.59 ? 221 ALA A CB  1 
ATOM   1428  N N   . GLN A 1 199 ? 26.088  4.439   29.702  1.00 25.96 ? 221 GLN A N   1 
ATOM   1429  C CA  . GLN A 1 199 ? 25.127  5.515   29.861  1.00 24.59 ? 221 GLN A CA  1 
ATOM   1430  C C   . GLN A 1 199 ? 24.255  5.586   28.627  1.00 23.78 ? 221 GLN A C   1 
ATOM   1431  O O   . GLN A 1 199 ? 24.738  5.422   27.515  1.00 26.58 ? 221 GLN A O   1 
ATOM   1432  C CB  . GLN A 1 199 ? 25.850  6.839   30.087  1.00 24.81 ? 221 GLN A CB  1 
ATOM   1433  C CG  . GLN A 1 199 ? 25.613  7.465   31.456  1.00 22.39 ? 221 GLN A CG  1 
ATOM   1434  C CD  . GLN A 1 199 ? 25.984  6.551   32.602  1.00 20.40 ? 221 GLN A CD  1 
ATOM   1435  O OE1 . GLN A 1 199 ? 25.132  6.169   33.402  0.00 21.26 ? 221 GLN A OE1 1 
ATOM   1436  N NE2 . GLN A 1 199 ? 27.260  6.211   32.703  0.00 21.26 ? 221 GLN A NE2 1 
ATOM   1437  N N   . LYS A 1 200 ? 22.960  5.771   28.843  1.00 22.13 ? 222 LYS A N   1 
ATOM   1438  C CA  . LYS A 1 200 ? 21.986  5.839   27.771  1.00 19.77 ? 222 LYS A CA  1 
ATOM   1439  C C   . LYS A 1 200 ? 22.354  6.956   26.836  1.00 17.40 ? 222 LYS A C   1 
ATOM   1440  O O   . LYS A 1 200 ? 22.796  7.998   27.287  1.00 11.81 ? 222 LYS A O   1 
ATOM   1441  C CB  . LYS A 1 200 ? 20.603  6.105   28.354  1.00 22.26 ? 222 LYS A CB  1 
ATOM   1442  C CG  . LYS A 1 200 ? 19.490  6.245   27.322  1.00 23.73 ? 222 LYS A CG  1 
ATOM   1443  C CD  . LYS A 1 200 ? 18.188  6.692   27.974  0.00 21.34 ? 222 LYS A CD  1 
ATOM   1444  C CE  . LYS A 1 200 ? 17.114  6.977   26.936  0.00 19.68 ? 222 LYS A CE  1 
ATOM   1445  N NZ  . LYS A 1 200 ? 15.839  7.418   27.568  0.00 18.71 ? 222 LYS A NZ  1 
ATOM   1446  N N   . ASN A 1 201 ? 22.175  6.720   25.539  1.00 18.75 ? 223 ASN A N   1 
ATOM   1447  C CA  . ASN A 1 201 ? 22.473  7.701   24.498  1.00 21.33 ? 223 ASN A CA  1 
ATOM   1448  C C   . ASN A 1 201 ? 23.939  8.208   24.476  1.00 22.34 ? 223 ASN A C   1 
ATOM   1449  O O   . ASN A 1 201 ? 24.245  9.248   23.885  1.00 21.35 ? 223 ASN A O   1 
ATOM   1450  C CB  . ASN A 1 201 ? 21.486  8.882   24.587  1.00 20.79 ? 223 ASN A CB  1 
ATOM   1451  C CG  . ASN A 1 201 ? 20.060  8.483   24.267  1.00 16.84 ? 223 ASN A CG  1 
ATOM   1452  O OD1 . ASN A 1 201 ? 19.810  7.451   23.645  0.00 19.14 ? 223 ASN A OD1 1 
ATOM   1453  N ND2 . ASN A 1 201 ? 19.112  9.307   24.690  0.00 19.12 ? 223 ASN A ND2 1 
ATOM   1454  N N   . LYS A 1 202 ? 24.832  7.489   25.149  1.00 22.12 ? 224 LYS A N   1 
ATOM   1455  C CA  . LYS A 1 202 ? 26.255  7.826   25.181  1.00 19.52 ? 224 LYS A CA  1 
ATOM   1456  C C   . LYS A 1 202 ? 26.971  6.508   24.932  1.00 18.43 ? 224 LYS A C   1 
ATOM   1457  O O   . LYS A 1 202 ? 27.434  5.851   25.860  1.00 21.37 ? 224 LYS A O   1 
ATOM   1458  C CB  . LYS A 1 202 ? 26.654  8.417   26.532  1.00 19.25 ? 224 LYS A CB  1 
ATOM   1459  C CG  . LYS A 1 202 ? 26.005  9.760   26.818  1.00 20.63 ? 224 LYS A CG  1 
ATOM   1460  C CD  . LYS A 1 202 ? 26.352  10.776  25.764  1.00 22.35 ? 224 LYS A CD  1 
ATOM   1461  C CE  . LYS A 1 202 ? 25.519  12.033  25.871  1.00 25.50 ? 224 LYS A CE  1 
ATOM   1462  N NZ  . LYS A 1 202 ? 26.034  13.108  24.964  1.00 27.63 ? 224 LYS A NZ  1 
ATOM   1463  N N   . PRO A 1 203 ? 27.032  6.086   23.663  1.00 15.95 ? 225 PRO A N   1 
ATOM   1464  C CA  . PRO A 1 203 ? 27.670  4.840   23.262  1.00 18.05 ? 225 PRO A CA  1 
ATOM   1465  C C   . PRO A 1 203 ? 29.174  4.952   23.366  1.00 20.49 ? 225 PRO A C   1 
ATOM   1466  O O   . PRO A 1 203 ? 29.711  6.061   23.344  1.00 22.58 ? 225 PRO A O   1 
ATOM   1467  C CB  . PRO A 1 203 ? 27.264  4.706   21.784  1.00 14.57 ? 225 PRO A CB  1 
ATOM   1468  C CG  . PRO A 1 203 ? 26.241  5.770   21.554  1.00 12.56 ? 225 PRO A CG  1 
ATOM   1469  C CD  . PRO A 1 203 ? 26.647  6.849   22.471  1.00 14.25 ? 225 PRO A CD  1 
ATOM   1470  N N   . GLY A 1 204 ? 29.851  3.811   23.472  1.00 20.16 ? 226 GLY A N   1 
ATOM   1471  C CA  . GLY A 1 204 ? 31.295  3.842   23.517  1.00 19.21 ? 226 GLY A CA  1 
ATOM   1472  C C   . GLY A 1 204 ? 31.833  4.294   22.162  1.00 17.25 ? 226 GLY A C   1 
ATOM   1473  O O   . GLY A 1 204 ? 31.251  3.943   21.114  1.00 15.25 ? 226 GLY A O   1 
ATOM   1474  N N   . VAL A 1 205 ? 32.890  5.116   22.178  1.00 15.09 ? 227 VAL A N   1 
ATOM   1475  C CA  . VAL A 1 205 ? 33.530  5.593   20.947  1.00 14.00 ? 227 VAL A CA  1 
ATOM   1476  C C   . VAL A 1 205 ? 34.810  4.793   20.737  1.00 10.41 ? 227 VAL A C   1 
ATOM   1477  O O   . VAL A 1 205 ? 35.497  4.486   21.701  1.00 9.98  ? 227 VAL A O   1 
ATOM   1478  C CB  . VAL A 1 205 ? 33.858  7.101   21.007  1.00 14.14 ? 227 VAL A CB  1 
ATOM   1479  C CG1 . VAL A 1 205 ? 34.509  7.544   19.691  1.00 11.81 ? 227 VAL A CG1 1 
ATOM   1480  C CG2 . VAL A 1 205 ? 32.587  7.901   21.276  1.00 12.83 ? 227 VAL A CG2 1 
ATOM   1481  N N   . TYR A 1 206 ? 35.108  4.441   19.493  1.00 8.86  ? 228 TYR A N   1 
ATOM   1482  C CA  . TYR A 1 206 ? 36.285  3.639   19.188  1.00 10.48 ? 228 TYR A CA  1 
ATOM   1483  C C   . TYR A 1 206 ? 37.065  4.177   17.998  1.00 10.92 ? 228 TYR A C   1 
ATOM   1484  O O   . TYR A 1 206 ? 36.500  4.862   17.142  1.00 12.28 ? 228 TYR A O   1 
ATOM   1485  C CB  . TYR A 1 206 ? 35.850  2.201   18.895  1.00 10.30 ? 228 TYR A CB  1 
ATOM   1486  C CG  . TYR A 1 206 ? 35.099  1.554   20.031  1.00 6.98  ? 228 TYR A CG  1 
ATOM   1487  C CD1 . TYR A 1 206 ? 35.760  0.730   20.929  1.00 9.12  ? 228 TYR A CD1 1 
ATOM   1488  C CD2 . TYR A 1 206 ? 33.744  1.779   20.216  1.00 5.00  ? 228 TYR A CD2 1 
ATOM   1489  C CE1 . TYR A 1 206 ? 35.101  0.141   21.990  1.00 12.63 ? 228 TYR A CE1 1 
ATOM   1490  C CE2 . TYR A 1 206 ? 33.062  1.200   21.280  1.00 10.49 ? 228 TYR A CE2 1 
ATOM   1491  C CZ  . TYR A 1 206 ? 33.756  0.370   22.173  1.00 13.97 ? 228 TYR A CZ  1 
ATOM   1492  O OH  . TYR A 1 206 ? 33.147  -0.264  23.244  1.00 13.33 ? 228 TYR A OH  1 
ATOM   1493  N N   . THR A 1 207 ? 38.354  3.851   17.943  1.00 9.71  ? 229 THR A N   1 
ATOM   1494  C CA  . THR A 1 207 ? 39.231  4.283   16.848  1.00 9.30  ? 229 THR A CA  1 
ATOM   1495  C C   . THR A 1 207 ? 39.027  3.420   15.607  1.00 6.02  ? 229 THR A C   1 
ATOM   1496  O O   . THR A 1 207 ? 39.091  2.198   15.680  1.00 5.94  ? 229 THR A O   1 
ATOM   1497  C CB  . THR A 1 207 ? 40.722  4.178   17.253  1.00 12.06 ? 229 THR A CB  1 
ATOM   1498  O OG1 . THR A 1 207 ? 40.924  4.813   18.522  1.00 13.77 ? 229 THR A OG1 1 
ATOM   1499  C CG2 . THR A 1 207 ? 41.613  4.861   16.212  1.00 13.48 ? 229 THR A CG2 1 
ATOM   1500  N N   . LYS A 1 208 ? 38.815  4.059   14.470  1.00 5.00  ? 230 LYS A N   1 
ATOM   1501  C CA  . LYS A 1 208 ? 38.596  3.344   13.227  1.00 5.92  ? 230 LYS A CA  1 
ATOM   1502  C C   . LYS A 1 208 ? 39.949  2.789   12.740  1.00 8.38  ? 230 LYS A C   1 
ATOM   1503  O O   . LYS A 1 208 ? 40.703  3.460   12.010  1.00 7.52  ? 230 LYS A O   1 
ATOM   1504  C CB  . LYS A 1 208 ? 37.990  4.318   12.213  1.00 8.04  ? 230 LYS A CB  1 
ATOM   1505  C CG  . LYS A 1 208 ? 36.955  3.724   11.277  1.00 7.24  ? 230 LYS A CG  1 
ATOM   1506  C CD  . LYS A 1 208 ? 36.377  4.814   10.361  1.00 7.91  ? 230 LYS A CD  1 
ATOM   1507  C CE  . LYS A 1 208 ? 35.254  4.263   9.462   1.00 10.09 ? 230 LYS A CE  1 
ATOM   1508  N NZ  . LYS A 1 208 ? 34.657  5.310   8.597   0.00 9.68  ? 230 LYS A NZ  1 
ATOM   1509  N N   . VAL A 1 209 ? 40.260  1.556   13.127  1.00 9.96  ? 231 VAL A N   1 
ATOM   1510  C CA  . VAL A 1 209 ? 41.544  0.957   12.743  1.00 11.60 ? 231 VAL A CA  1 
ATOM   1511  C C   . VAL A 1 209 ? 41.726  0.830   11.233  1.00 13.87 ? 231 VAL A C   1 
ATOM   1512  O O   . VAL A 1 209 ? 42.855  0.914   10.734  1.00 15.86 ? 231 VAL A O   1 
ATOM   1513  C CB  . VAL A 1 209 ? 41.777  -0.431  13.425  1.00 8.83  ? 231 VAL A CB  1 
ATOM   1514  C CG1 . VAL A 1 209 ? 42.938  -1.179  12.759  1.00 7.74  ? 231 VAL A CG1 1 
ATOM   1515  C CG2 . VAL A 1 209 ? 42.066  -0.259  14.917  1.00 5.00  ? 231 VAL A CG2 1 
ATOM   1516  N N   . CYS A 1 210 ? 40.624  0.692   10.501  1.00 14.15 ? 232 CYS A N   1 
ATOM   1517  C CA  . CYS A 1 210 ? 40.704  0.535   9.057   1.00 16.86 ? 232 CYS A CA  1 
ATOM   1518  C C   . CYS A 1 210 ? 41.375  1.722   8.374   1.00 16.85 ? 232 CYS A C   1 
ATOM   1519  O O   . CYS A 1 210 ? 42.063  1.555   7.364   1.00 19.14 ? 232 CYS A O   1 
ATOM   1520  C CB  . CYS A 1 210 ? 39.324  0.266   8.461   1.00 19.73 ? 232 CYS A CB  1 
ATOM   1521  S SG  . CYS A 1 210 ? 38.200  1.700   8.441   1.00 25.62 ? 232 CYS A SG  1 
ATOM   1522  N N   . ASN A 1 211 ? 41.220  2.906   8.947   1.00 15.43 ? 233 ASN A N   1 
ATOM   1523  C CA  . ASN A 1 211 ? 41.834  4.105   8.384   1.00 18.07 ? 233 ASN A CA  1 
ATOM   1524  C C   . ASN A 1 211 ? 43.356  4.145   8.625   1.00 19.05 ? 233 ASN A C   1 
ATOM   1525  O O   . ASN A 1 211 ? 44.077  4.955   8.027   1.00 20.02 ? 233 ASN A O   1 
ATOM   1526  C CB  . ASN A 1 211 ? 41.233  5.358   9.036   1.00 21.00 ? 233 ASN A CB  1 
ATOM   1527  C CG  . ASN A 1 211 ? 39.823  5.633   8.605   1.00 21.20 ? 233 ASN A CG  1 
ATOM   1528  O OD1 . ASN A 1 211 ? 39.239  4.893   7.812   1.00 22.23 ? 233 ASN A OD1 1 
ATOM   1529  N ND2 . ASN A 1 211 ? 39.269  6.722   9.110   1.00 21.05 ? 233 ASN A ND2 1 
ATOM   1530  N N   . TYR A 1 212 ? 43.842  3.300   9.528   1.00 18.85 ? 234 TYR A N   1 
ATOM   1531  C CA  . TYR A 1 212 ? 45.260  3.299   9.869   1.00 15.88 ? 234 TYR A CA  1 
ATOM   1532  C C   . TYR A 1 212 ? 46.059  2.096   9.405   1.00 14.78 ? 234 TYR A C   1 
ATOM   1533  O O   . TYR A 1 212 ? 47.251  2.019   9.674   1.00 13.90 ? 234 TYR A O   1 
ATOM   1534  C CB  . TYR A 1 212 ? 45.424  3.478   11.382  1.00 12.98 ? 234 TYR A CB  1 
ATOM   1535  C CG  . TYR A 1 212 ? 44.762  4.732   11.917  1.00 8.62  ? 234 TYR A CG  1 
ATOM   1536  C CD1 . TYR A 1 212 ? 45.400  5.958   11.838  1.00 8.75  ? 234 TYR A CD1 1 
ATOM   1537  C CD2 . TYR A 1 212 ? 43.503  4.693   12.492  1.00 6.11  ? 234 TYR A CD2 1 
ATOM   1538  C CE1 . TYR A 1 212 ? 44.816  7.115   12.315  1.00 5.00  ? 234 TYR A CE1 1 
ATOM   1539  C CE2 . TYR A 1 212 ? 42.918  5.845   12.969  1.00 6.60  ? 234 TYR A CE2 1 
ATOM   1540  C CZ  . TYR A 1 212 ? 43.591  7.057   12.876  1.00 5.00  ? 234 TYR A CZ  1 
ATOM   1541  O OH  . TYR A 1 212 ? 43.073  8.216   13.380  1.00 5.00  ? 234 TYR A OH  1 
ATOM   1542  N N   . VAL A 1 213 ? 45.419  1.176   8.692   1.00 15.25 ? 235 VAL A N   1 
ATOM   1543  C CA  . VAL A 1 213 ? 46.093  -0.024  8.203   1.00 14.99 ? 235 VAL A CA  1 
ATOM   1544  C C   . VAL A 1 213 ? 47.408  0.297   7.483   1.00 17.75 ? 235 VAL A C   1 
ATOM   1545  O O   . VAL A 1 213 ? 48.447  -0.296  7.782   1.00 18.60 ? 235 VAL A O   1 
ATOM   1546  C CB  . VAL A 1 213 ? 45.186  -0.832  7.264   1.00 11.55 ? 235 VAL A CB  1 
ATOM   1547  C CG1 . VAL A 1 213 ? 45.899  -2.094  6.785   1.00 8.42  ? 235 VAL A CG1 1 
ATOM   1548  C CG2 . VAL A 1 213 ? 43.904  -1.187  7.976   1.00 11.81 ? 235 VAL A CG2 1 
ATOM   1549  N N   . SER A 1 214 ? 47.387  1.256   6.562   1.00 19.78 ? 236 SER A N   1 
ATOM   1550  C CA  . SER A 1 214 ? 48.611  1.619   5.826   1.00 18.59 ? 236 SER A CA  1 
ATOM   1551  C C   . SER A 1 214 ? 49.713  2.005   6.811   1.00 14.64 ? 236 SER A C   1 
ATOM   1552  O O   . SER A 1 214 ? 50.736  1.337   6.889   1.00 14.26 ? 236 SER A O   1 
ATOM   1553  C CB  . SER A 1 214 ? 48.326  2.766   4.852   1.00 19.72 ? 236 SER A CB  1 
ATOM   1554  O OG  . SER A 1 214 ? 47.182  2.464   4.068   0.00 19.76 ? 236 SER A OG  1 
ATOM   1555  N N   . TRP A 1 215 ? 49.440  3.019   7.628   1.00 10.87 ? 237 TRP A N   1 
ATOM   1556  C CA  . TRP A 1 215 ? 50.384  3.479   8.626   1.00 7.61  ? 237 TRP A CA  1 
ATOM   1557  C C   . TRP A 1 215 ? 50.933  2.322   9.418   1.00 8.56  ? 237 TRP A C   1 
ATOM   1558  O O   . TRP A 1 215 ? 52.139  2.234   9.618   1.00 10.77 ? 237 TRP A O   1 
ATOM   1559  C CB  . TRP A 1 215 ? 49.728  4.425   9.613   1.00 7.74  ? 237 TRP A CB  1 
ATOM   1560  C CG  . TRP A 1 215 ? 50.682  4.865   10.655  1.00 6.98  ? 237 TRP A CG  1 
ATOM   1561  C CD1 . TRP A 1 215 ? 51.724  5.705   10.476  1.00 6.59  ? 237 TRP A CD1 1 
ATOM   1562  C CD2 . TRP A 1 215 ? 50.666  4.529   12.052  1.00 5.81  ? 237 TRP A CD2 1 
ATOM   1563  N NE1 . TRP A 1 215 ? 52.353  5.930   11.667  1.00 8.88  ? 237 TRP A NE1 1 
ATOM   1564  C CE2 . TRP A 1 215 ? 51.723  5.223   12.653  1.00 6.16  ? 237 TRP A CE2 1 
ATOM   1565  C CE3 . TRP A 1 215 ? 49.864  3.712   12.844  1.00 5.00  ? 237 TRP A CE3 1 
ATOM   1566  C CZ2 . TRP A 1 215 ? 52.001  5.134   14.014  1.00 5.00  ? 237 TRP A CZ2 1 
ATOM   1567  C CZ3 . TRP A 1 215 ? 50.148  3.621   14.201  1.00 5.96  ? 237 TRP A CZ3 1 
ATOM   1568  C CH2 . TRP A 1 215 ? 51.206  4.329   14.769  1.00 5.93  ? 237 TRP A CH2 1 
ATOM   1569  N N   . ILE A 1 216 ? 50.045  1.467   9.917   1.00 8.20  ? 238 ILE A N   1 
ATOM   1570  C CA  . ILE A 1 216 ? 50.476  0.324   10.703  1.00 7.56  ? 238 ILE A CA  1 
ATOM   1571  C C   . ILE A 1 216 ? 51.474  -0.465  9.878   1.00 7.79  ? 238 ILE A C   1 
ATOM   1572  O O   . ILE A 1 216 ? 52.610  -0.665  10.289  1.00 11.72 ? 238 ILE A O   1 
ATOM   1573  C CB  . ILE A 1 216 ? 49.322  -0.615  11.087  1.00 5.00  ? 238 ILE A CB  1 
ATOM   1574  C CG1 . ILE A 1 216 ? 48.220  0.148   11.803  1.00 5.16  ? 238 ILE A CG1 1 
ATOM   1575  C CG2 . ILE A 1 216 ? 49.837  -1.699  11.995  1.00 5.00  ? 238 ILE A CG2 1 
ATOM   1576  C CD1 . ILE A 1 216 ? 46.997  -0.692  12.097  1.00 7.44  ? 238 ILE A CD1 1 
ATOM   1577  N N   . LYS A 1 217 ? 51.086  -0.825  8.671   1.00 5.00  ? 239 LYS A N   1 
ATOM   1578  C CA  . LYS A 1 217 ? 51.964  -1.608  7.843   1.00 6.50  ? 239 LYS A CA  1 
ATOM   1579  C C   . LYS A 1 217 ? 53.327  -0.933  7.597   1.00 7.94  ? 239 LYS A C   1 
ATOM   1580  O O   . LYS A 1 217 ? 54.376  -1.562  7.739   1.00 7.93  ? 239 LYS A O   1 
ATOM   1581  C CB  . LYS A 1 217 ? 51.255  -1.984  6.539   1.00 8.13  ? 239 LYS A CB  1 
ATOM   1582  C CG  . LYS A 1 217 ? 50.260  -3.159  6.636   1.00 5.00  ? 239 LYS A CG  1 
ATOM   1583  C CD  . LYS A 1 217 ? 49.566  -3.363  5.298   0.00 7.83  ? 239 LYS A CD  1 
ATOM   1584  C CE  . LYS A 1 217 ? 48.542  -4.480  5.364   0.00 8.21  ? 239 LYS A CE  1 
ATOM   1585  N NZ  . LYS A 1 217 ? 47.864  -4.681  4.054   0.00 8.40  ? 239 LYS A NZ  1 
ATOM   1586  N N   . GLN A 1 218 ? 53.338  0.354   7.286   1.00 7.91  ? 240 GLN A N   1 
ATOM   1587  C CA  . GLN A 1 218 ? 54.610  1.025   7.043   1.00 8.52  ? 240 GLN A CA  1 
ATOM   1588  C C   . GLN A 1 218 ? 55.484  1.040   8.301   1.00 9.94  ? 240 GLN A C   1 
ATOM   1589  O O   . GLN A 1 218 ? 56.659  0.664   8.244   1.00 13.09 ? 240 GLN A O   1 
ATOM   1590  C CB  . GLN A 1 218 ? 54.407  2.450   6.509   1.00 6.60  ? 240 GLN A CB  1 
ATOM   1591  C CG  . GLN A 1 218 ? 55.687  3.160   6.086   0.00 10.35 ? 240 GLN A CG  1 
ATOM   1592  C CD  . GLN A 1 218 ? 56.379  2.486   4.913   0.00 11.73 ? 240 GLN A CD  1 
ATOM   1593  O OE1 . GLN A 1 218 ? 55.851  2.453   3.802   0.00 12.28 ? 240 GLN A OE1 1 
ATOM   1594  N NE2 . GLN A 1 218 ? 57.570  1.956   5.152   0.00 12.48 ? 240 GLN A NE2 1 
ATOM   1595  N N   . THR A 1 219 ? 54.900  1.403   9.440   1.00 7.70  ? 241 THR A N   1 
ATOM   1596  C CA  . THR A 1 219 ? 55.632  1.490   10.703  1.00 6.16  ? 241 THR A CA  1 
ATOM   1597  C C   . THR A 1 219 ? 56.341  0.192   11.077  1.00 10.19 ? 241 THR A C   1 
ATOM   1598  O O   . THR A 1 219 ? 57.483  0.182   11.535  1.00 11.55 ? 241 THR A O   1 
ATOM   1599  C CB  . THR A 1 219 ? 54.693  1.894   11.835  1.00 5.00  ? 241 THR A CB  1 
ATOM   1600  O OG1 . THR A 1 219 ? 54.027  3.109   11.482  1.00 5.00  ? 241 THR A OG1 1 
ATOM   1601  C CG2 . THR A 1 219 ? 55.454  2.109   13.121  1.00 6.11  ? 241 THR A CG2 1 
ATOM   1602  N N   . ILE A 1 220 ? 55.656  -0.914  10.871  1.00 11.84 ? 242 ILE A N   1 
ATOM   1603  C CA  . ILE A 1 220 ? 56.199  -2.227  11.169  1.00 8.55  ? 242 ILE A CA  1 
ATOM   1604  C C   . ILE A 1 220 ? 57.359  -2.562  10.247  1.00 8.70  ? 242 ILE A C   1 
ATOM   1605  O O   . ILE A 1 220 ? 58.385  -3.036  10.712  1.00 12.22 ? 242 ILE A O   1 
ATOM   1606  C CB  . ILE A 1 220 ? 55.089  -3.284  11.036  1.00 8.01  ? 242 ILE A CB  1 
ATOM   1607  C CG1 . ILE A 1 220 ? 54.078  -3.102  12.163  1.00 5.00  ? 242 ILE A CG1 1 
ATOM   1608  C CG2 . ILE A 1 220 ? 55.662  -4.693  11.022  1.00 11.19 ? 242 ILE A CG2 1 
ATOM   1609  C CD1 . ILE A 1 220 ? 52.745  -3.707  11.871  1.00 5.00  ? 242 ILE A CD1 1 
ATOM   1610  N N   . ALA A 1 221 ? 57.210  -2.284  8.952   1.00 9.25  ? 243 ALA A N   1 
ATOM   1611  C CA  . ALA A 1 221 ? 58.258  -2.576  7.960   1.00 10.15 ? 243 ALA A CA  1 
ATOM   1612  C C   . ALA A 1 221 ? 59.558  -1.797  8.114   1.00 10.26 ? 243 ALA A C   1 
ATOM   1613  O O   . ALA A 1 221 ? 60.607  -2.235  7.627   1.00 11.46 ? 243 ALA A O   1 
ATOM   1614  C CB  . ALA A 1 221 ? 57.728  -2.372  6.552   1.00 9.24  ? 243 ALA A CB  1 
ATOM   1615  N N   . SER A 1 222 ? 59.479  -0.633  8.747   1.00 9.23  ? 244 SER A N   1 
ATOM   1616  C CA  . SER A 1 222 ? 60.642  0.217   8.934   1.00 9.07  ? 244 SER A CA  1 
ATOM   1617  C C   . SER A 1 222 ? 61.259  0.150   10.320  1.00 10.88 ? 244 SER A C   1 
ATOM   1618  O O   . SER A 1 222 ? 62.400  0.572   10.495  1.00 14.43 ? 244 SER A O   1 
ATOM   1619  C CB  . SER A 1 222 ? 60.265  1.659   8.639   1.00 8.34  ? 244 SER A CB  1 
ATOM   1620  O OG  . SER A 1 222 ? 59.290  1.710   7.611   1.00 10.60 ? 244 SER A OG  1 
ATOM   1621  N N   . ASN A 1 223 ? 60.516  -0.353  11.303  1.00 9.82  ? 245 ASN A N   1 
ATOM   1622  C CA  . ASN A 1 223 ? 61.030  -0.426  12.665  1.00 9.99  ? 245 ASN A CA  1 
ATOM   1623  C C   . ASN A 1 223 ? 61.315  -1.846  13.142  1.00 11.25 ? 245 ASN A C   1 
ATOM   1624  O O   . ASN A 1 223 ? 61.255  -2.093  14.361  1.00 10.20 ? 245 ASN A O   1 
ATOM   1625  C CB  . ASN A 1 223 ? 60.077  0.288   13.606  1.00 9.12  ? 245 ASN A CB  1 
ATOM   1626  C CG  . ASN A 1 223 ? 59.974  1.742   13.292  1.00 11.60 ? 245 ASN A CG  1 
ATOM   1627  O OD1 . ASN A 1 223 ? 60.879  2.517   13.591  1.00 18.21 ? 245 ASN A OD1 1 
ATOM   1628  N ND2 . ASN A 1 223 ? 58.896  2.133   12.643  1.00 13.09 ? 245 ASN A ND2 1 
ATOM   1629  O OXT . ASN A 1 223 ? 61.654  -2.698  12.293  1.00 13.37 ? 245 ASN A OXT 1 
ATOM   1630  N N   . ILE B 1 1   ? 25.164  11.899  78.190  1.00 21.26 ? 16  ILE B N   1 
ATOM   1631  C CA  . ILE B 1 1   ? 25.539  10.945  77.121  1.00 22.08 ? 16  ILE B CA  1 
ATOM   1632  C C   . ILE B 1 1   ? 25.870  9.669   77.854  1.00 26.43 ? 16  ILE B C   1 
ATOM   1633  O O   . ILE B 1 1   ? 26.876  9.606   78.554  1.00 29.40 ? 16  ILE B O   1 
ATOM   1634  C CB  . ILE B 1 1   ? 26.790  11.435  76.345  1.00 19.06 ? 16  ILE B CB  1 
ATOM   1635  C CG1 . ILE B 1 1   ? 26.436  12.646  75.483  1.00 19.35 ? 16  ILE B CG1 1 
ATOM   1636  C CG2 . ILE B 1 1   ? 27.332  10.335  75.461  1.00 18.81 ? 16  ILE B CG2 1 
ATOM   1637  C CD1 . ILE B 1 1   ? 25.455  12.351  74.336  1.00 18.17 ? 16  ILE B CD1 1 
ATOM   1638  N N   . VAL B 1 2   ? 24.975  8.694   77.783  1.00 30.13 ? 17  VAL B N   1 
ATOM   1639  C CA  . VAL B 1 2   ? 25.192  7.418   78.448  1.00 33.71 ? 17  VAL B CA  1 
ATOM   1640  C C   . VAL B 1 2   ? 26.233  6.643   77.652  1.00 36.12 ? 17  VAL B C   1 
ATOM   1641  O O   . VAL B 1 2   ? 26.077  6.449   76.437  1.00 33.60 ? 17  VAL B O   1 
ATOM   1642  C CB  . VAL B 1 2   ? 23.895  6.585   78.549  0.00 33.12 ? 17  VAL B CB  1 
ATOM   1643  C CG1 . VAL B 1 2   ? 24.182  5.234   79.195  0.00 34.00 ? 17  VAL B CG1 1 
ATOM   1644  C CG2 . VAL B 1 2   ? 22.862  7.334   79.362  0.00 33.97 ? 17  VAL B CG2 1 
ATOM   1645  N N   . GLY B 1 3   ? 27.320  6.285   78.338  1.00 36.80 ? 18  GLY B N   1 
ATOM   1646  C CA  . GLY B 1 3   ? 28.389  5.517   77.730  1.00 36.26 ? 18  GLY B CA  1 
ATOM   1647  C C   . GLY B 1 3   ? 29.196  6.274   76.704  1.00 34.89 ? 18  GLY B C   1 
ATOM   1648  O O   . GLY B 1 3   ? 29.338  5.836   75.552  1.00 37.23 ? 18  GLY B O   1 
ATOM   1649  N N   . GLY B 1 4   ? 29.758  7.397   77.120  1.00 32.43 ? 19  GLY B N   1 
ATOM   1650  C CA  . GLY B 1 4   ? 30.543  8.172   76.184  1.00 33.91 ? 19  GLY B CA  1 
ATOM   1651  C C   . GLY B 1 4   ? 31.957  8.442   76.660  1.00 31.50 ? 19  GLY B C   1 
ATOM   1652  O O   . GLY B 1 4   ? 32.419  7.854   77.655  1.00 33.55 ? 19  GLY B O   1 
ATOM   1653  N N   . TYR B 1 5   ? 32.644  9.330   75.940  1.00 26.07 ? 20  TYR B N   1 
ATOM   1654  C CA  . TYR B 1 5   ? 33.997  9.706   76.280  1.00 19.76 ? 20  TYR B CA  1 
ATOM   1655  C C   . TYR B 1 5   ? 34.039  11.202  76.397  1.00 20.07 ? 20  TYR B C   1 
ATOM   1656  O O   . TYR B 1 5   ? 33.289  11.886  75.726  1.00 19.50 ? 20  TYR B O   1 
ATOM   1657  C CB  . TYR B 1 5   ? 34.970  9.256   75.199  1.00 18.23 ? 20  TYR B CB  1 
ATOM   1658  C CG  . TYR B 1 5   ? 34.863  9.961   73.858  1.00 14.71 ? 20  TYR B CG  1 
ATOM   1659  C CD1 . TYR B 1 5   ? 35.593  11.109  73.592  1.00 11.37 ? 20  TYR B CD1 1 
ATOM   1660  C CD2 . TYR B 1 5   ? 34.075  9.443   72.835  1.00 15.53 ? 20  TYR B CD2 1 
ATOM   1661  C CE1 . TYR B 1 5   ? 35.540  11.730  72.341  1.00 9.52  ? 20  TYR B CE1 1 
ATOM   1662  C CE2 . TYR B 1 5   ? 34.019  10.051  71.577  1.00 11.19 ? 20  TYR B CE2 1 
ATOM   1663  C CZ  . TYR B 1 5   ? 34.750  11.197  71.339  1.00 9.42  ? 20  TYR B CZ  1 
ATOM   1664  O OH  . TYR B 1 5   ? 34.656  11.833  70.118  1.00 5.41  ? 20  TYR B OH  1 
ATOM   1665  N N   . THR B 1 6   ? 34.892  11.707  77.276  1.00 21.62 ? 21  THR B N   1 
ATOM   1666  C CA  . THR B 1 6   ? 35.049  13.142  77.450  1.00 19.77 ? 21  THR B CA  1 
ATOM   1667  C C   . THR B 1 6   ? 35.601  13.661  76.141  1.00 19.66 ? 21  THR B C   1 
ATOM   1668  O O   . THR B 1 6   ? 36.561  13.115  75.623  1.00 22.59 ? 21  THR B O   1 
ATOM   1669  C CB  . THR B 1 6   ? 36.082  13.465  78.531  1.00 20.01 ? 21  THR B CB  1 
ATOM   1670  O OG1 . THR B 1 6   ? 35.754  12.750  79.725  1.00 22.92 ? 21  THR B OG1 1 
ATOM   1671  C CG2 . THR B 1 6   ? 36.102  14.961  78.828  1.00 19.88 ? 21  THR B CG2 1 
ATOM   1672  N N   . CYS B 1 7   ? 34.998  14.701  75.596  1.00 18.21 ? 22  CYS B N   1 
ATOM   1673  C CA  . CYS B 1 7   ? 35.476  15.245  74.343  1.00 19.24 ? 22  CYS B CA  1 
ATOM   1674  C C   . CYS B 1 7   ? 36.828  15.916  74.572  1.00 23.44 ? 22  CYS B C   1 
ATOM   1675  O O   . CYS B 1 7   ? 37.735  15.813  73.738  1.00 25.15 ? 22  CYS B O   1 
ATOM   1676  C CB  . CYS B 1 7   ? 34.460  16.232  73.811  1.00 18.32 ? 22  CYS B CB  1 
ATOM   1677  S SG  . CYS B 1 7   ? 32.774  15.560  73.854  1.00 14.31 ? 22  CYS B SG  1 
ATOM   1678  N N   . GLY B 1 8   ? 36.961  16.577  75.721  0.00 24.45 ? 23  GLY B N   1 
ATOM   1679  C CA  . GLY B 1 8   ? 38.204  17.243  76.073  0.00 27.61 ? 23  GLY B CA  1 
ATOM   1680  C C   . GLY B 1 8   ? 38.592  18.401  75.175  0.00 30.22 ? 23  GLY B C   1 
ATOM   1681  O O   . GLY B 1 8   ? 38.061  18.551  74.073  0.00 28.67 ? 23  GLY B O   1 
ATOM   1682  N N   . ALA B 1 9   ? 39.528  19.218  75.656  0.00 33.85 ? 24  ALA B N   1 
ATOM   1683  C CA  . ALA B 1 9   ? 40.022  20.385  74.925  0.00 39.34 ? 24  ALA B CA  1 
ATOM   1684  C C   . ALA B 1 9   ? 38.865  21.168  74.306  0.00 46.23 ? 24  ALA B C   1 
ATOM   1685  O O   . ALA B 1 9   ? 38.136  21.861  75.015  0.00 45.49 ? 24  ALA B O   1 
ATOM   1686  C CB  . ALA B 1 9   ? 41.030  19.955  73.856  0.00 39.90 ? 24  ALA B CB  1 
ATOM   1687  N N   . ASN B 1 10  ? 38.701  21.053  72.991  1.00 53.96 ? 25  ASN B N   1 
ATOM   1688  C CA  . ASN B 1 10  ? 37.613  21.727  72.281  1.00 57.32 ? 25  ASN B CA  1 
ATOM   1689  C C   . ASN B 1 10  ? 37.538  21.207  70.836  1.00 52.12 ? 25  ASN B C   1 
ATOM   1690  O O   . ASN B 1 10  ? 38.317  21.613  69.963  1.00 53.28 ? 25  ASN B O   1 
ATOM   1691  C CB  . ASN B 1 10  ? 37.787  23.255  72.308  1.00 64.12 ? 25  ASN B CB  1 
ATOM   1692  C CG  . ASN B 1 10  ? 36.470  23.994  72.096  1.00 72.62 ? 25  ASN B CG  1 
ATOM   1693  O OD1 . ASN B 1 10  ? 35.417  23.368  71.931  1.00 76.67 ? 25  ASN B OD1 1 
ATOM   1694  N ND2 . ASN B 1 10  ? 36.523  25.328  72.096  1.00 77.61 ? 25  ASN B ND2 1 
ATOM   1695  N N   . THR B 1 11  ? 36.652  20.241  70.621  1.00 44.23 ? 26  THR B N   1 
ATOM   1696  C CA  . THR B 1 11  ? 36.455  19.640  69.311  1.00 39.01 ? 26  THR B CA  1 
ATOM   1697  C C   . THR B 1 11  ? 34.976  19.682  68.953  1.00 34.71 ? 26  THR B C   1 
ATOM   1698  O O   . THR B 1 11  ? 34.550  19.126  67.943  1.00 35.63 ? 26  THR B O   1 
ATOM   1699  C CB  . THR B 1 11  ? 36.960  18.196  69.289  1.00 41.40 ? 26  THR B CB  1 
ATOM   1700  O OG1 . THR B 1 11  ? 36.341  17.443  70.341  1.00 40.55 ? 26  THR B OG1 1 
ATOM   1701  C CG2 . THR B 1 11  ? 38.464  18.181  69.487  1.00 45.80 ? 26  THR B CG2 1 
ATOM   1702  N N   . VAL B 1 12  ? 34.197  20.339  69.807  1.00 28.24 ? 27  VAL B N   1 
ATOM   1703  C CA  . VAL B 1 12  ? 32.764  20.516  69.601  1.00 18.01 ? 27  VAL B CA  1 
ATOM   1704  C C   . VAL B 1 12  ? 32.525  22.008  69.902  1.00 15.07 ? 27  VAL B C   1 
ATOM   1705  O O   . VAL B 1 12  ? 31.776  22.372  70.812  1.00 12.22 ? 27  VAL B O   1 
ATOM   1706  C CB  . VAL B 1 12  ? 31.925  19.675  70.587  1.00 12.99 ? 27  VAL B CB  1 
ATOM   1707  C CG1 . VAL B 1 12  ? 30.581  19.372  69.974  1.00 12.48 ? 27  VAL B CG1 1 
ATOM   1708  C CG2 . VAL B 1 12  ? 32.630  18.406  70.972  1.00 7.43  ? 27  VAL B CG2 1 
ATOM   1709  N N   . PRO B 1 13  ? 33.137  22.892  69.107  1.00 12.13 ? 28  PRO B N   1 
ATOM   1710  C CA  . PRO B 1 13  ? 33.047  24.345  69.236  1.00 10.83 ? 28  PRO B CA  1 
ATOM   1711  C C   . PRO B 1 13  ? 31.631  24.890  69.059  1.00 13.97 ? 28  PRO B C   1 
ATOM   1712  O O   . PRO B 1 13  ? 31.284  25.937  69.606  1.00 14.72 ? 28  PRO B O   1 
ATOM   1713  C CB  . PRO B 1 13  ? 33.913  24.835  68.083  1.00 9.70  ? 28  PRO B CB  1 
ATOM   1714  C CG  . PRO B 1 13  ? 34.680  23.633  67.639  1.00 7.98  ? 28  PRO B CG  1 
ATOM   1715  C CD  . PRO B 1 13  ? 33.717  22.547  67.805  1.00 7.97  ? 28  PRO B CD  1 
ATOM   1716  N N   . TYR B 1 14  ? 30.847  24.210  68.222  1.00 14.42 ? 29  TYR B N   1 
ATOM   1717  C CA  . TYR B 1 14  ? 29.478  24.606  67.919  1.00 12.47 ? 29  TYR B CA  1 
ATOM   1718  C C   . TYR B 1 14  ? 28.471  24.247  69.045  1.00 15.63 ? 29  TYR B C   1 
ATOM   1719  O O   . TYR B 1 14  ? 27.301  24.671  69.011  1.00 17.66 ? 29  TYR B O   1 
ATOM   1720  C CB  . TYR B 1 14  ? 29.074  23.982  66.579  1.00 7.18  ? 29  TYR B CB  1 
ATOM   1721  C CG  . TYR B 1 14  ? 29.279  22.492  66.553  1.00 10.26 ? 29  TYR B CG  1 
ATOM   1722  C CD1 . TYR B 1 14  ? 28.367  21.634  67.156  1.00 14.65 ? 29  TYR B CD1 1 
ATOM   1723  C CD2 . TYR B 1 14  ? 30.410  21.930  65.978  1.00 13.49 ? 29  TYR B CD2 1 
ATOM   1724  C CE1 . TYR B 1 14  ? 28.577  20.243  67.194  1.00 14.50 ? 29  TYR B CE1 1 
ATOM   1725  C CE2 . TYR B 1 14  ? 30.629  20.530  66.011  1.00 13.05 ? 29  TYR B CE2 1 
ATOM   1726  C CZ  . TYR B 1 14  ? 29.707  19.701  66.623  1.00 10.34 ? 29  TYR B CZ  1 
ATOM   1727  O OH  . TYR B 1 14  ? 29.911  18.346  66.700  1.00 5.00  ? 29  TYR B OH  1 
ATOM   1728  N N   . GLN B 1 15  ? 28.921  23.485  70.045  1.00 11.81 ? 30  GLN B N   1 
ATOM   1729  C CA  . GLN B 1 15  ? 28.052  23.076  71.153  1.00 6.96  ? 30  GLN B CA  1 
ATOM   1730  C C   . GLN B 1 15  ? 27.726  24.253  72.014  1.00 8.08  ? 30  GLN B C   1 
ATOM   1731  O O   . GLN B 1 15  ? 28.585  25.098  72.199  1.00 11.80 ? 30  GLN B O   1 
ATOM   1732  C CB  . GLN B 1 15  ? 28.777  22.100  72.050  1.00 5.61  ? 30  GLN B CB  1 
ATOM   1733  C CG  . GLN B 1 15  ? 27.977  21.647  73.226  1.00 5.00  ? 30  GLN B CG  1 
ATOM   1734  C CD  . GLN B 1 15  ? 27.052  20.465  72.898  1.00 13.91 ? 30  GLN B CD  1 
ATOM   1735  O OE1 . GLN B 1 15  ? 25.928  20.356  73.442  1.00 17.18 ? 30  GLN B OE1 1 
ATOM   1736  N NE2 . GLN B 1 15  ? 27.534  19.548  72.041  1.00 12.86 ? 30  GLN B NE2 1 
ATOM   1737  N N   . VAL B 1 16  ? 26.499  24.339  72.520  1.00 9.66  ? 31  VAL B N   1 
ATOM   1738  C CA  . VAL B 1 16  ? 26.129  25.426  73.447  1.00 9.14  ? 31  VAL B CA  1 
ATOM   1739  C C   . VAL B 1 16  ? 25.222  24.857  74.516  1.00 6.52  ? 31  VAL B C   1 
ATOM   1740  O O   . VAL B 1 16  ? 24.588  23.821  74.298  1.00 6.36  ? 31  VAL B O   1 
ATOM   1741  C CB  . VAL B 1 16  ? 25.415  26.646  72.772  1.00 10.92 ? 31  VAL B CB  1 
ATOM   1742  C CG1 . VAL B 1 16  ? 26.128  27.061  71.521  1.00 14.43 ? 31  VAL B CG1 1 
ATOM   1743  C CG2 . VAL B 1 16  ? 23.957  26.356  72.479  1.00 13.29 ? 31  VAL B CG2 1 
ATOM   1744  N N   . SER B 1 17  ? 25.212  25.497  75.681  1.00 5.57  ? 32  SER B N   1 
ATOM   1745  C CA  . SER B 1 17  ? 24.358  25.082  76.799  1.00 7.81  ? 32  SER B CA  1 
ATOM   1746  C C   . SER B 1 17  ? 23.171  26.046  77.000  1.00 6.81  ? 32  SER B C   1 
ATOM   1747  O O   . SER B 1 17  ? 23.342  27.261  76.974  1.00 5.00  ? 32  SER B O   1 
ATOM   1748  C CB  . SER B 1 17  ? 25.173  24.985  78.094  1.00 7.48  ? 32  SER B CB  1 
ATOM   1749  O OG  . SER B 1 17  ? 24.344  24.690  79.206  1.00 5.00  ? 32  SER B OG  1 
ATOM   1750  N N   . LEU B 1 18  ? 21.965  25.504  77.141  1.00 6.35  ? 33  LEU B N   1 
ATOM   1751  C CA  . LEU B 1 18  ? 20.807  26.343  77.366  1.00 6.12  ? 33  LEU B CA  1 
ATOM   1752  C C   . LEU B 1 18  ? 20.644  26.294  78.850  1.00 8.20  ? 33  LEU B C   1 
ATOM   1753  O O   . LEU B 1 18  ? 20.595  25.205  79.434  1.00 9.15  ? 33  LEU B O   1 
ATOM   1754  C CB  . LEU B 1 18  ? 19.556  25.789  76.693  1.00 5.00  ? 33  LEU B CB  1 
ATOM   1755  C CG  . LEU B 1 18  ? 19.589  25.797  75.175  1.00 8.50  ? 33  LEU B CG  1 
ATOM   1756  C CD1 . LEU B 1 18  ? 18.206  25.629  74.626  1.00 6.61  ? 33  LEU B CD1 1 
ATOM   1757  C CD2 . LEU B 1 18  ? 20.177  27.117  74.713  1.00 13.26 ? 33  LEU B CD2 1 
ATOM   1758  N N   . ASN B 1 19  ? 20.674  27.468  79.463  1.00 10.91 ? 34  ASN B N   1 
ATOM   1759  C CA  . ASN B 1 19  ? 20.532  27.595  80.895  1.00 13.91 ? 34  ASN B CA  1 
ATOM   1760  C C   . ASN B 1 19  ? 19.287  28.392  81.229  1.00 16.85 ? 34  ASN B C   1 
ATOM   1761  O O   . ASN B 1 19  ? 18.923  29.335  80.514  1.00 17.66 ? 34  ASN B O   1 
ATOM   1762  C CB  . ASN B 1 19  ? 21.745  28.309  81.491  1.00 15.01 ? 34  ASN B CB  1 
ATOM   1763  C CG  . ASN B 1 19  ? 21.538  28.699  82.956  1.00 17.47 ? 34  ASN B CG  1 
ATOM   1764  O OD1 . ASN B 1 19  ? 20.797  29.623  83.271  1.00 14.44 ? 34  ASN B OD1 1 
ATOM   1765  N ND2 . ASN B 1 19  ? 22.206  27.998  83.850  1.00 20.02 ? 34  ASN B ND2 1 
ATOM   1766  N N   . SER B 1 20  ? 18.630  27.978  82.310  1.00 17.57 ? 37  SER B N   1 
ATOM   1767  C CA  . SER B 1 20  ? 17.443  28.645  82.832  1.00 15.88 ? 37  SER B CA  1 
ATOM   1768  C C   . SER B 1 20  ? 17.617  28.506  84.331  1.00 13.27 ? 37  SER B C   1 
ATOM   1769  O O   . SER B 1 20  ? 16.805  27.893  85.020  1.00 11.87 ? 37  SER B O   1 
ATOM   1770  C CB  . SER B 1 20  ? 16.181  27.934  82.379  1.00 15.25 ? 37  SER B CB  1 
ATOM   1771  O OG  . SER B 1 20  ? 16.234  26.580  82.788  1.00 17.36 ? 37  SER B OG  1 
ATOM   1772  N N   . GLY B 1 21  ? 18.733  29.035  84.816  1.00 13.32 ? 38  GLY B N   1 
ATOM   1773  C CA  . GLY B 1 21  ? 19.053  28.961  86.226  1.00 12.51 ? 38  GLY B CA  1 
ATOM   1774  C C   . GLY B 1 21  ? 19.969  27.783  86.404  1.00 10.32 ? 38  GLY B C   1 
ATOM   1775  O O   . GLY B 1 21  ? 20.770  27.744  87.320  1.00 10.98 ? 38  GLY B O   1 
ATOM   1776  N N   . TYR B 1 22  ? 19.858  26.831  85.493  1.00 9.67  ? 39  TYR B N   1 
ATOM   1777  C CA  . TYR B 1 22  ? 20.679  25.631  85.512  1.00 13.11 ? 39  TYR B CA  1 
ATOM   1778  C C   . TYR B 1 22  ? 20.677  25.086  84.096  1.00 12.85 ? 39  TYR B C   1 
ATOM   1779  O O   . TYR B 1 22  ? 19.901  25.556  83.252  1.00 14.13 ? 39  TYR B O   1 
ATOM   1780  C CB  . TYR B 1 22  ? 20.105  24.582  86.471  1.00 16.72 ? 39  TYR B CB  1 
ATOM   1781  C CG  . TYR B 1 22  ? 18.681  24.200  86.146  1.00 22.25 ? 39  TYR B CG  1 
ATOM   1782  C CD1 . TYR B 1 22  ? 17.611  24.928  86.669  1.00 26.22 ? 39  TYR B CD1 1 
ATOM   1783  C CD2 . TYR B 1 22  ? 18.403  23.158  85.269  1.00 23.04 ? 39  TYR B CD2 1 
ATOM   1784  C CE1 . TYR B 1 22  ? 16.305  24.629  86.318  1.00 27.50 ? 39  TYR B CE1 1 
ATOM   1785  C CE2 . TYR B 1 22  ? 17.105  22.853  84.912  1.00 25.91 ? 39  TYR B CE2 1 
ATOM   1786  C CZ  . TYR B 1 22  ? 16.057  23.590  85.435  1.00 28.65 ? 39  TYR B CZ  1 
ATOM   1787  O OH  . TYR B 1 22  ? 14.757  23.296  85.066  1.00 32.93 ? 39  TYR B OH  1 
ATOM   1788  N N   . HIS B 1 23  ? 21.549  24.119  83.829  1.00 9.86  ? 40  HIS B N   1 
ATOM   1789  C CA  . HIS B 1 23  ? 21.617  23.532  82.504  1.00 10.16 ? 40  HIS B CA  1 
ATOM   1790  C C   . HIS B 1 23  ? 20.392  22.651  82.341  1.00 10.26 ? 40  HIS B C   1 
ATOM   1791  O O   . HIS B 1 23  ? 20.059  21.890  83.241  1.00 11.53 ? 40  HIS B O   1 
ATOM   1792  C CB  . HIS B 1 23  ? 22.898  22.690  82.339  1.00 11.42 ? 40  HIS B CB  1 
ATOM   1793  C CG  . HIS B 1 23  ? 22.930  21.857  81.085  1.00 12.28 ? 40  HIS B CG  1 
ATOM   1794  N ND1 . HIS B 1 23  ? 23.483  22.306  79.901  1.00 9.48  ? 40  HIS B ND1 1 
ATOM   1795  C CD2 . HIS B 1 23  ? 22.457  20.610  80.830  1.00 11.03 ? 40  HIS B CD2 1 
ATOM   1796  C CE1 . HIS B 1 23  ? 23.341  21.376  78.973  1.00 12.69 ? 40  HIS B CE1 1 
ATOM   1797  N NE2 . HIS B 1 23  ? 22.721  20.338  79.510  1.00 13.16 ? 40  HIS B NE2 1 
ATOM   1798  N N   . PHE B 1 24  ? 19.712  22.769  81.206  1.00 9.18  ? 41  PHE B N   1 
ATOM   1799  C CA  . PHE B 1 24  ? 18.565  21.931  80.955  1.00 7.54  ? 41  PHE B CA  1 
ATOM   1800  C C   . PHE B 1 24  ? 18.525  21.412  79.511  1.00 8.17  ? 41  PHE B C   1 
ATOM   1801  O O   . PHE B 1 24  ? 17.775  20.495  79.205  1.00 12.14 ? 41  PHE B O   1 
ATOM   1802  C CB  . PHE B 1 24  ? 17.300  22.678  81.307  1.00 5.53  ? 41  PHE B CB  1 
ATOM   1803  C CG  . PHE B 1 24  ? 16.968  23.757  80.358  1.00 5.00  ? 41  PHE B CG  1 
ATOM   1804  C CD1 . PHE B 1 24  ? 16.070  23.531  79.326  1.00 5.00  ? 41  PHE B CD1 1 
ATOM   1805  C CD2 . PHE B 1 24  ? 17.529  25.003  80.500  1.00 5.00  ? 41  PHE B CD2 1 
ATOM   1806  C CE1 . PHE B 1 24  ? 15.730  24.521  78.456  1.00 5.00  ? 41  PHE B CE1 1 
ATOM   1807  C CE2 . PHE B 1 24  ? 17.197  26.016  79.628  1.00 7.61  ? 41  PHE B CE2 1 
ATOM   1808  C CZ  . PHE B 1 24  ? 16.288  25.771  78.597  1.00 7.32  ? 41  PHE B CZ  1 
ATOM   1809  N N   . CYS B 1 25  ? 19.337  21.971  78.628  1.00 5.00  ? 42  CYS B N   1 
ATOM   1810  C CA  . CYS B 1 25  ? 19.362  21.511  77.249  1.00 5.52  ? 42  CYS B CA  1 
ATOM   1811  C C   . CYS B 1 25  ? 20.640  21.972  76.578  1.00 8.07  ? 42  CYS B C   1 
ATOM   1812  O O   . CYS B 1 25  ? 21.381  22.776  77.141  1.00 9.09  ? 42  CYS B O   1 
ATOM   1813  C CB  . CYS B 1 25  ? 18.174  22.064  76.455  1.00 5.00  ? 42  CYS B CB  1 
ATOM   1814  S SG  . CYS B 1 25  ? 16.596  21.193  76.669  1.00 5.38  ? 42  CYS B SG  1 
ATOM   1815  N N   . GLY B 1 26  ? 20.897  21.433  75.391  1.00 7.62  ? 43  GLY B N   1 
ATOM   1816  C CA  . GLY B 1 26  ? 22.053  21.806  74.616  1.00 7.11  ? 43  GLY B CA  1 
ATOM   1817  C C   . GLY B 1 26  ? 21.495  22.512  73.408  1.00 8.67  ? 43  GLY B C   1 
ATOM   1818  O O   . GLY B 1 26  ? 20.324  22.883  73.415  1.00 9.26  ? 43  GLY B O   1 
ATOM   1819  N N   . GLY B 1 27  ? 22.307  22.673  72.366  1.00 8.74  ? 44  GLY B N   1 
ATOM   1820  C CA  . GLY B 1 27  ? 21.862  23.346  71.156  1.00 7.30  ? 44  GLY B CA  1 
ATOM   1821  C C   . GLY B 1 27  ? 23.085  23.570  70.307  1.00 8.25  ? 44  GLY B C   1 
ATOM   1822  O O   . GLY B 1 27  ? 24.199  23.539  70.837  1.00 10.41 ? 44  GLY B O   1 
ATOM   1823  N N   . SER B 1 28  ? 22.905  23.803  69.012  1.00 9.53  ? 45  SER B N   1 
ATOM   1824  C CA  . SER B 1 28  ? 24.044  23.998  68.117  1.00 6.02  ? 45  SER B CA  1 
ATOM   1825  C C   . SER B 1 28  ? 24.045  25.379  67.507  1.00 6.47  ? 45  SER B C   1 
ATOM   1826  O O   . SER B 1 28  ? 22.997  25.896  67.126  1.00 6.41  ? 45  SER B O   1 
ATOM   1827  C CB  . SER B 1 28  ? 24.008  22.963  67.011  1.00 5.00  ? 45  SER B CB  1 
ATOM   1828  O OG  . SER B 1 28  ? 23.819  21.677  67.557  1.00 5.00  ? 45  SER B OG  1 
ATOM   1829  N N   . LEU B 1 29  ? 25.225  25.982  67.442  1.00 6.69  ? 46  LEU B N   1 
ATOM   1830  C CA  . LEU B 1 29  ? 25.399  27.313  66.866  1.00 6.45  ? 46  LEU B CA  1 
ATOM   1831  C C   . LEU B 1 29  ? 25.413  27.194  65.346  1.00 7.33  ? 46  LEU B C   1 
ATOM   1832  O O   . LEU B 1 29  ? 26.265  26.534  64.777  1.00 7.49  ? 46  LEU B O   1 
ATOM   1833  C CB  . LEU B 1 29  ? 26.701  27.898  67.368  1.00 5.00  ? 46  LEU B CB  1 
ATOM   1834  C CG  . LEU B 1 29  ? 26.991  29.353  67.093  1.00 6.33  ? 46  LEU B CG  1 
ATOM   1835  C CD1 . LEU B 1 29  ? 25.824  30.213  67.445  1.00 6.60  ? 46  LEU B CD1 1 
ATOM   1836  C CD2 . LEU B 1 29  ? 28.186  29.725  67.949  1.00 9.47  ? 46  LEU B CD2 1 
ATOM   1837  N N   . ILE B 1 30  ? 24.428  27.791  64.695  1.00 10.24 ? 47  ILE B N   1 
ATOM   1838  C CA  . ILE B 1 30  ? 24.322  27.717  63.249  1.00 10.89 ? 47  ILE B CA  1 
ATOM   1839  C C   . ILE B 1 30  ? 25.065  28.860  62.589  1.00 8.93  ? 47  ILE B C   1 
ATOM   1840  O O   . ILE B 1 30  ? 25.403  28.774  61.409  1.00 10.95 ? 47  ILE B O   1 
ATOM   1841  C CB  . ILE B 1 30  ? 22.840  27.681  62.805  1.00 15.80 ? 47  ILE B CB  1 
ATOM   1842  C CG1 . ILE B 1 30  ? 22.281  26.274  62.987  1.00 18.32 ? 47  ILE B CG1 1 
ATOM   1843  C CG2 . ILE B 1 30  ? 22.688  28.048  61.343  1.00 19.99 ? 47  ILE B CG2 1 
ATOM   1844  C CD1 . ILE B 1 30  ? 20.871  26.123  62.456  1.00 21.24 ? 47  ILE B CD1 1 
ATOM   1845  N N   . ASN B 1 31  ? 25.348  29.904  63.367  1.00 6.61  ? 48  ASN B N   1 
ATOM   1846  C CA  . ASN B 1 31  ? 26.071  31.093  62.901  1.00 5.64  ? 48  ASN B CA  1 
ATOM   1847  C C   . ASN B 1 31  ? 26.010  32.163  63.966  1.00 5.00  ? 48  ASN B C   1 
ATOM   1848  O O   . ASN B 1 31  ? 25.045  32.244  64.673  1.00 9.82  ? 48  ASN B O   1 
ATOM   1849  C CB  . ASN B 1 31  ? 25.469  31.634  61.608  1.00 9.11  ? 48  ASN B CB  1 
ATOM   1850  C CG  . ASN B 1 31  ? 24.120  32.283  61.804  1.00 8.41  ? 48  ASN B CG  1 
ATOM   1851  O OD1 . ASN B 1 31  ? 23.081  31.634  61.687  1.00 5.00  ? 48  ASN B OD1 1 
ATOM   1852  N ND2 . ASN B 1 31  ? 24.128  33.587  62.056  1.00 11.44 ? 48  ASN B ND2 1 
ATOM   1853  N N   . SER B 1 32  ? 26.988  33.038  64.008  1.00 5.00  ? 49  SER B N   1 
ATOM   1854  C CA  . SER B 1 32  ? 27.077  34.090  65.003  1.00 6.33  ? 49  SER B CA  1 
ATOM   1855  C C   . SER B 1 32  ? 25.870  34.396  65.889  1.00 11.17 ? 49  SER B C   1 
ATOM   1856  O O   . SER B 1 32  ? 25.983  34.382  67.115  1.00 14.92 ? 49  SER B O   1 
ATOM   1857  C CB  . SER B 1 32  ? 27.532  35.361  64.330  1.00 5.27  ? 49  SER B CB  1 
ATOM   1858  O OG  . SER B 1 32  ? 26.743  35.569  63.183  1.00 8.81  ? 49  SER B OG  1 
ATOM   1859  N N   . GLN B 1 33  ? 24.715  34.675  65.284  1.00 13.54 ? 50  GLN B N   1 
ATOM   1860  C CA  . GLN B 1 33  ? 23.499  35.008  66.048  1.00 9.31  ? 50  GLN B CA  1 
ATOM   1861  C C   . GLN B 1 33  ? 22.430  33.946  66.270  1.00 8.68  ? 50  GLN B C   1 
ATOM   1862  O O   . GLN B 1 33  ? 21.610  34.123  67.151  1.00 14.14 ? 50  GLN B O   1 
ATOM   1863  C CB  . GLN B 1 33  ? 22.821  36.242  65.473  1.00 5.00  ? 50  GLN B CB  1 
ATOM   1864  C CG  . GLN B 1 33  ? 22.896  37.416  66.356  1.00 5.00  ? 50  GLN B CG  1 
ATOM   1865  C CD  . GLN B 1 33  ? 22.395  38.656  65.686  1.00 5.00  ? 50  GLN B CD  1 
ATOM   1866  O OE1 . GLN B 1 33  ? 21.731  39.456  66.310  1.00 7.94  ? 50  GLN B OE1 1 
ATOM   1867  N NE2 . GLN B 1 33  ? 22.726  38.844  64.415  1.00 5.00  ? 50  GLN B NE2 1 
ATOM   1868  N N   . TRP B 1 34  ? 22.414  32.850  65.526  1.00 5.00  ? 51  TRP B N   1 
ATOM   1869  C CA  . TRP B 1 34  ? 21.362  31.876  65.749  1.00 5.00  ? 51  TRP B CA  1 
ATOM   1870  C C   . TRP B 1 34  ? 21.800  30.535  66.316  1.00 5.60  ? 51  TRP B C   1 
ATOM   1871  O O   . TRP B 1 34  ? 22.849  30.013  65.953  1.00 5.93  ? 51  TRP B O   1 
ATOM   1872  C CB  . TRP B 1 34  ? 20.560  31.656  64.471  1.00 5.95  ? 51  TRP B CB  1 
ATOM   1873  C CG  . TRP B 1 34  ? 19.706  32.808  64.072  1.00 6.83  ? 51  TRP B CG  1 
ATOM   1874  C CD1 . TRP B 1 34  ? 20.091  33.889  63.353  1.00 10.44 ? 51  TRP B CD1 1 
ATOM   1875  C CD2 . TRP B 1 34  ? 18.320  32.987  64.345  1.00 5.70  ? 51  TRP B CD2 1 
ATOM   1876  N NE1 . TRP B 1 34  ? 19.029  34.734  63.148  1.00 8.44  ? 51  TRP B NE1 1 
ATOM   1877  C CE2 . TRP B 1 34  ? 17.928  34.205  63.748  1.00 5.00  ? 51  TRP B CE2 1 
ATOM   1878  C CE3 . TRP B 1 34  ? 17.373  32.243  65.037  1.00 10.75 ? 51  TRP B CE3 1 
ATOM   1879  C CZ2 . TRP B 1 34  ? 16.638  34.698  63.820  1.00 5.55  ? 51  TRP B CZ2 1 
ATOM   1880  C CZ3 . TRP B 1 34  ? 16.075  32.729  65.116  1.00 13.13 ? 51  TRP B CZ3 1 
ATOM   1881  C CH2 . TRP B 1 34  ? 15.720  33.953  64.504  1.00 12.03 ? 51  TRP B CH2 1 
ATOM   1882  N N   . VAL B 1 35  ? 20.937  29.936  67.133  1.00 5.00  ? 52  VAL B N   1 
ATOM   1883  C CA  . VAL B 1 35  ? 21.190  28.641  67.763  1.00 5.00  ? 52  VAL B CA  1 
ATOM   1884  C C   . VAL B 1 35  ? 19.995  27.757  67.456  1.00 7.45  ? 52  VAL B C   1 
ATOM   1885  O O   . VAL B 1 35  ? 18.876  28.183  67.644  1.00 9.82  ? 52  VAL B O   1 
ATOM   1886  C CB  . VAL B 1 35  ? 21.262  28.779  69.293  1.00 5.00  ? 52  VAL B CB  1 
ATOM   1887  C CG1 . VAL B 1 35  ? 21.499  27.441  69.935  1.00 5.00  ? 52  VAL B CG1 1 
ATOM   1888  C CG2 . VAL B 1 35  ? 22.341  29.766  69.689  1.00 5.94  ? 52  VAL B CG2 1 
ATOM   1889  N N   . VAL B 1 36  ? 20.220  26.539  66.971  1.00 10.08 ? 53  VAL B N   1 
ATOM   1890  C CA  . VAL B 1 36  ? 19.124  25.610  66.662  1.00 5.35  ? 53  VAL B CA  1 
ATOM   1891  C C   . VAL B 1 36  ? 19.049  24.634  67.820  1.00 5.60  ? 53  VAL B C   1 
ATOM   1892  O O   . VAL B 1 36  ? 20.079  24.247  68.379  1.00 6.50  ? 53  VAL B O   1 
ATOM   1893  C CB  . VAL B 1 36  ? 19.388  24.819  65.369  1.00 5.00  ? 53  VAL B CB  1 
ATOM   1894  C CG1 . VAL B 1 36  ? 20.588  23.913  65.551  1.00 5.00  ? 53  VAL B CG1 1 
ATOM   1895  C CG2 . VAL B 1 36  ? 18.185  24.013  64.982  1.00 5.00  ? 53  VAL B CG2 1 
ATOM   1896  N N   . SER B 1 37  ? 17.838  24.237  68.188  1.00 8.02  ? 54  SER B N   1 
ATOM   1897  C CA  . SER B 1 37  ? 17.659  23.305  69.298  1.00 8.27  ? 54  SER B CA  1 
ATOM   1898  C C   . SER B 1 37  ? 16.326  22.529  69.234  1.00 8.26  ? 54  SER B C   1 
ATOM   1899  O O   . SER B 1 37  ? 15.565  22.635  68.267  1.00 7.88  ? 54  SER B O   1 
ATOM   1900  C CB  . SER B 1 37  ? 17.768  24.090  70.612  1.00 5.00  ? 54  SER B CB  1 
ATOM   1901  O OG  . SER B 1 37  ? 17.987  23.244  71.714  1.00 5.24  ? 54  SER B OG  1 
ATOM   1902  N N   . ALA B 1 38  ? 16.088  21.700  70.242  1.00 8.40  ? 55  ALA B N   1 
ATOM   1903  C CA  . ALA B 1 38  ? 14.859  20.944  70.344  1.00 8.77  ? 55  ALA B CA  1 
ATOM   1904  C C   . ALA B 1 38  ? 13.770  21.920  70.833  1.00 11.86 ? 55  ALA B C   1 
ATOM   1905  O O   . ALA B 1 38  ? 13.960  22.631  71.833  1.00 8.14  ? 55  ALA B O   1 
ATOM   1906  C CB  . ALA B 1 38  ? 15.025  19.798  71.328  0.00 9.79  ? 55  ALA B CB  1 
ATOM   1907  N N   . ALA B 1 39  ? 12.646  21.968  70.109  1.00 13.63 ? 56  ALA B N   1 
ATOM   1908  C CA  . ALA B 1 39  ? 11.507  22.823  70.460  1.00 9.21  ? 56  ALA B CA  1 
ATOM   1909  C C   . ALA B 1 39  ? 10.981  22.500  71.861  1.00 8.30  ? 56  ALA B C   1 
ATOM   1910  O O   . ALA B 1 39  ? 10.440  23.365  72.524  1.00 11.81 ? 56  ALA B O   1 
ATOM   1911  C CB  . ALA B 1 39  ? 10.393  22.674  69.439  1.00 7.96  ? 56  ALA B CB  1 
ATOM   1912  N N   . HIS B 1 40  ? 11.102  21.257  72.312  1.00 7.03  ? 57  HIS B N   1 
ATOM   1913  C CA  . HIS B 1 40  ? 10.652  20.949  73.658  1.00 8.72  ? 57  HIS B CA  1 
ATOM   1914  C C   . HIS B 1 40  ? 11.612  21.544  74.699  1.00 10.24 ? 57  HIS B C   1 
ATOM   1915  O O   . HIS B 1 40  ? 11.370  21.464  75.892  1.00 13.02 ? 57  HIS B O   1 
ATOM   1916  C CB  . HIS B 1 40  ? 10.411  19.437  73.856  1.00 11.18 ? 57  HIS B CB  1 
ATOM   1917  C CG  . HIS B 1 40  ? 11.653  18.608  73.981  1.00 10.97 ? 57  HIS B CG  1 
ATOM   1918  N ND1 . HIS B 1 40  ? 12.158  17.849  72.939  1.00 9.64  ? 57  HIS B ND1 1 
ATOM   1919  C CD2 . HIS B 1 40  ? 12.464  18.383  75.043  1.00 9.34  ? 57  HIS B CD2 1 
ATOM   1920  C CE1 . HIS B 1 40  ? 13.226  17.194  73.359  1.00 7.75  ? 57  HIS B CE1 1 
ATOM   1921  N NE2 . HIS B 1 40  ? 13.431  17.501  74.629  1.00 9.35  ? 57  HIS B NE2 1 
ATOM   1922  N N   . CYS B 1 41  ? 12.707  22.141  74.236  1.00 11.44 ? 58  CYS B N   1 
ATOM   1923  C CA  . CYS B 1 41  ? 13.676  22.785  75.116  1.00 10.29 ? 58  CYS B CA  1 
ATOM   1924  C C   . CYS B 1 41  ? 13.294  24.247  75.274  1.00 12.53 ? 58  CYS B C   1 
ATOM   1925  O O   . CYS B 1 41  ? 14.065  25.039  75.826  1.00 12.98 ? 58  CYS B O   1 
ATOM   1926  C CB  . CYS B 1 41  ? 15.080  22.692  74.541  1.00 5.00  ? 58  CYS B CB  1 
ATOM   1927  S SG  . CYS B 1 41  ? 15.795  21.053  74.803  1.00 7.97  ? 58  CYS B SG  1 
ATOM   1928  N N   . TYR B 1 42  ? 12.132  24.620  74.730  1.00 13.63 ? 59  TYR B N   1 
ATOM   1929  C CA  . TYR B 1 42  ? 11.651  25.994  74.833  1.00 12.51 ? 59  TYR B CA  1 
ATOM   1930  C C   . TYR B 1 42  ? 11.289  26.312  76.296  1.00 13.91 ? 59  TYR B C   1 
ATOM   1931  O O   . TYR B 1 42  ? 10.644  25.508  76.987  1.00 15.91 ? 59  TYR B O   1 
ATOM   1932  C CB  . TYR B 1 42  ? 10.423  26.238  73.938  1.00 9.25  ? 59  TYR B CB  1 
ATOM   1933  C CG  . TYR B 1 42  ? 9.842   27.631  74.146  1.00 12.56 ? 59  TYR B CG  1 
ATOM   1934  C CD1 . TYR B 1 42  ? 9.004   27.912  75.231  1.00 11.50 ? 59  TYR B CD1 1 
ATOM   1935  C CD2 . TYR B 1 42  ? 10.206  28.695  73.317  1.00 13.14 ? 59  TYR B CD2 1 
ATOM   1936  C CE1 . TYR B 1 42  ? 8.566   29.199  75.481  1.00 7.97  ? 59  TYR B CE1 1 
ATOM   1937  C CE2 . TYR B 1 42  ? 9.764   29.998  73.569  1.00 8.42  ? 59  TYR B CE2 1 
ATOM   1938  C CZ  . TYR B 1 42  ? 8.951   30.235  74.646  1.00 8.50  ? 59  TYR B CZ  1 
ATOM   1939  O OH  . TYR B 1 42  ? 8.513   31.518  74.872  1.00 11.11 ? 59  TYR B OH  1 
ATOM   1940  N N   . LYS B 1 43  ? 11.701  27.490  76.744  1.00 10.56 ? 60  LYS B N   1 
ATOM   1941  C CA  . LYS B 1 43  ? 11.439  27.963  78.082  1.00 11.53 ? 60  LYS B CA  1 
ATOM   1942  C C   . LYS B 1 43  ? 11.420  29.456  77.932  1.00 17.26 ? 60  LYS B C   1 
ATOM   1943  O O   . LYS B 1 43  ? 11.943  29.986  76.955  1.00 20.49 ? 60  LYS B O   1 
ATOM   1944  C CB  . LYS B 1 43  ? 12.565  27.587  79.032  1.00 8.99  ? 60  LYS B CB  1 
ATOM   1945  C CG  . LYS B 1 43  ? 12.444  26.219  79.670  1.00 7.93  ? 60  LYS B CG  1 
ATOM   1946  C CD  . LYS B 1 43  ? 13.476  26.079  80.780  1.00 7.55  ? 60  LYS B CD  1 
ATOM   1947  C CE  . LYS B 1 43  ? 13.266  24.826  81.624  1.00 8.22  ? 60  LYS B CE  1 
ATOM   1948  N NZ  . LYS B 1 43  ? 11.978  24.862  82.361  0.00 8.84  ? 60  LYS B NZ  1 
ATOM   1949  N N   . SER B 1 44  ? 10.802  30.147  78.876  1.00 21.19 ? 61  SER B N   1 
ATOM   1950  C CA  . SER B 1 44  ? 10.747  31.597  78.804  1.00 23.25 ? 61  SER B CA  1 
ATOM   1951  C C   . SER B 1 44  ? 12.093  32.134  79.249  1.00 25.29 ? 61  SER B C   1 
ATOM   1952  O O   . SER B 1 44  ? 12.639  31.665  80.246  1.00 27.22 ? 61  SER B O   1 
ATOM   1953  C CB  . SER B 1 44  ? 9.629   32.123  79.699  1.00 24.72 ? 61  SER B CB  1 
ATOM   1954  O OG  . SER B 1 44  ? 9.569   31.430  80.936  0.00 22.70 ? 61  SER B OG  1 
ATOM   1955  N N   . GLY B 1 45  ? 12.661  33.055  78.475  1.00 26.96 ? 62  GLY B N   1 
ATOM   1956  C CA  . GLY B 1 45  ? 13.956  33.634  78.823  1.00 27.16 ? 62  GLY B CA  1 
ATOM   1957  C C   . GLY B 1 45  ? 15.086  32.633  79.056  1.00 27.94 ? 62  GLY B C   1 
ATOM   1958  O O   . GLY B 1 45  ? 15.490  32.382  80.201  1.00 28.06 ? 62  GLY B O   1 
ATOM   1959  N N   . ILE B 1 46  ? 15.570  32.032  77.971  1.00 26.43 ? 63  ILE B N   1 
ATOM   1960  C CA  . ILE B 1 46  ? 16.659  31.061  78.029  1.00 21.79 ? 63  ILE B CA  1 
ATOM   1961  C C   . ILE B 1 46  ? 17.955  31.857  77.868  1.00 22.88 ? 63  ILE B C   1 
ATOM   1962  O O   . ILE B 1 46  ? 17.949  32.917  77.227  1.00 25.80 ? 63  ILE B O   1 
ATOM   1963  C CB  . ILE B 1 46  ? 16.569  30.090  76.857  1.00 18.46 ? 63  ILE B CB  1 
ATOM   1964  C CG1 . ILE B 1 46  ? 15.242  29.356  76.883  1.00 17.81 ? 63  ILE B CG1 1 
ATOM   1965  C CG2 . ILE B 1 46  ? 17.696  29.107  76.899  1.00 18.78 ? 63  ILE B CG2 1 
ATOM   1966  C CD1 . ILE B 1 46  ? 15.068  28.361  75.739  1.00 18.70 ? 63  ILE B CD1 1 
ATOM   1967  N N   . GLN B 1 47  ? 19.041  31.389  78.486  1.00 21.02 ? 64  GLN B N   1 
ATOM   1968  C CA  . GLN B 1 47  ? 20.342  32.051  78.379  1.00 18.48 ? 64  GLN B CA  1 
ATOM   1969  C C   . GLN B 1 47  ? 21.264  31.020  77.781  1.00 17.64 ? 64  GLN B C   1 
ATOM   1970  O O   . GLN B 1 47  ? 21.334  29.891  78.275  1.00 17.92 ? 64  GLN B O   1 
ATOM   1971  C CB  . GLN B 1 47  ? 20.867  32.488  79.751  1.00 20.28 ? 64  GLN B CB  1 
ATOM   1972  C CG  . GLN B 1 47  ? 19.968  33.475  80.456  1.00 24.34 ? 64  GLN B CG  1 
ATOM   1973  C CD  . GLN B 1 47  ? 20.539  33.970  81.772  1.00 27.43 ? 64  GLN B CD  1 
ATOM   1974  O OE1 . GLN B 1 47  ? 20.956  35.119  81.880  1.00 30.68 ? 64  GLN B OE1 1 
ATOM   1975  N NE2 . GLN B 1 47  ? 20.537  33.117  82.783  1.00 27.84 ? 64  GLN B NE2 1 
ATOM   1976  N N   . VAL B 1 48  ? 21.947  31.400  76.706  1.00 17.95 ? 65  VAL B N   1 
ATOM   1977  C CA  . VAL B 1 48  ? 22.864  30.498  76.002  1.00 15.27 ? 65  VAL B CA  1 
ATOM   1978  C C   . VAL B 1 48  ? 24.324  30.596  76.475  1.00 17.09 ? 65  VAL B C   1 
ATOM   1979  O O   . VAL B 1 48  ? 24.876  31.689  76.565  1.00 15.18 ? 65  VAL B O   1 
ATOM   1980  C CB  . VAL B 1 48  ? 22.800  30.740  74.473  1.00 9.84  ? 65  VAL B CB  1 
ATOM   1981  C CG1 . VAL B 1 48  ? 23.541  29.631  73.751  1.00 10.21 ? 65  VAL B CG1 1 
ATOM   1982  C CG2 . VAL B 1 48  ? 21.344  30.814  73.994  1.00 5.00  ? 65  VAL B CG2 1 
ATOM   1983  N N   . ARG B 1 49  ? 24.912  29.458  76.843  1.00 20.40 ? 66  ARG B N   1 
ATOM   1984  C CA  . ARG B 1 49  ? 26.309  29.397  77.281  1.00 24.62 ? 66  ARG B CA  1 
ATOM   1985  C C   . ARG B 1 49  ? 27.084  28.700  76.183  1.00 23.69 ? 66  ARG B C   1 
ATOM   1986  O O   . ARG B 1 49  ? 26.925  27.498  75.981  1.00 19.00 ? 66  ARG B O   1 
ATOM   1987  C CB  . ARG B 1 49  ? 26.472  28.600  78.582  1.00 30.39 ? 66  ARG B CB  1 
ATOM   1988  C CG  . ARG B 1 49  ? 25.971  29.317  79.849  1.00 43.08 ? 66  ARG B CG  1 
ATOM   1989  C CD  . ARG B 1 49  ? 26.098  28.427  81.106  1.00 52.77 ? 66  ARG B CD  1 
ATOM   1990  N NE  . ARG B 1 49  ? 27.492  28.208  81.519  1.00 61.31 ? 66  ARG B NE  1 
ATOM   1991  C CZ  . ARG B 1 49  ? 27.890  27.266  82.377  1.00 61.60 ? 66  ARG B CZ  1 
ATOM   1992  N NH1 . ARG B 1 49  ? 26.992  26.445  82.910  1.00 59.95 ? 66  ARG B NH1 1 
ATOM   1993  N NH2 . ARG B 1 49  ? 29.178  27.158  82.716  1.00 60.10 ? 66  ARG B NH2 1 
ATOM   1994  N N   . LEU B 1 50  ? 27.885  29.464  75.447  1.00 26.62 ? 67  LEU B N   1 
ATOM   1995  C CA  . LEU B 1 50  ? 28.688  28.910  74.359  1.00 27.99 ? 67  LEU B CA  1 
ATOM   1996  C C   . LEU B 1 50  ? 30.116  28.612  74.828  1.00 32.63 ? 67  LEU B C   1 
ATOM   1997  O O   . LEU B 1 50  ? 30.492  28.947  75.956  1.00 37.16 ? 67  LEU B O   1 
ATOM   1998  C CB  . LEU B 1 50  ? 28.736  29.884  73.189  1.00 24.87 ? 67  LEU B CB  1 
ATOM   1999  C CG  . LEU B 1 50  ? 27.411  30.495  72.747  1.00 22.37 ? 67  LEU B CG  1 
ATOM   2000  C CD1 . LEU B 1 50  ? 27.075  31.676  73.634  1.00 19.18 ? 67  LEU B CD1 1 
ATOM   2001  C CD2 . LEU B 1 50  ? 27.537  30.959  71.318  1.00 22.60 ? 67  LEU B CD2 1 
ATOM   2002  N N   . GLY B 1 51  ? 30.892  27.956  73.973  1.00 34.36 ? 69  GLY B N   1 
ATOM   2003  C CA  . GLY B 1 51  ? 32.274  27.631  74.283  1.00 37.63 ? 69  GLY B CA  1 
ATOM   2004  C C   . GLY B 1 51  ? 32.525  27.093  75.679  1.00 39.05 ? 69  GLY B C   1 
ATOM   2005  O O   . GLY B 1 51  ? 33.500  27.455  76.345  1.00 41.28 ? 69  GLY B O   1 
ATOM   2006  N N   . GLU B 1 52  ? 31.590  26.290  76.154  1.00 38.25 ? 70  GLU B N   1 
ATOM   2007  C CA  . GLU B 1 52  ? 31.692  25.673  77.458  1.00 39.50 ? 70  GLU B CA  1 
ATOM   2008  C C   . GLU B 1 52  ? 32.571  24.424  77.419  1.00 40.17 ? 70  GLU B C   1 
ATOM   2009  O O   . GLU B 1 52  ? 32.684  23.762  76.386  1.00 37.93 ? 70  GLU B O   1 
ATOM   2010  C CB  . GLU B 1 52  ? 30.299  25.281  77.936  1.00 39.08 ? 70  GLU B CB  1 
ATOM   2011  C CG  . GLU B 1 52  ? 29.424  26.434  78.286  1.00 37.93 ? 70  GLU B CG  1 
ATOM   2012  C CD  . GLU B 1 52  ? 29.926  27.157  79.496  1.00 37.85 ? 70  GLU B CD  1 
ATOM   2013  O OE1 . GLU B 1 52  ? 30.467  26.503  80.413  1.00 37.54 ? 70  GLU B OE1 1 
ATOM   2014  O OE2 . GLU B 1 52  ? 29.780  28.387  79.531  1.00 39.60 ? 70  GLU B OE2 1 
ATOM   2015  N N   . ASP B 1 53  ? 33.235  24.149  78.534  1.00 40.68 ? 71  ASP B N   1 
ATOM   2016  C CA  . ASP B 1 53  ? 34.054  22.952  78.668  1.00 41.87 ? 71  ASP B CA  1 
ATOM   2017  C C   . ASP B 1 53  ? 33.413  22.292  79.880  1.00 41.53 ? 71  ASP B C   1 
ATOM   2018  O O   . ASP B 1 53  ? 32.719  21.270  79.775  1.00 41.19 ? 71  ASP B O   1 
ATOM   2019  C CB  . ASP B 1 53  ? 35.519  23.305  78.949  0.00 38.43 ? 71  ASP B CB  1 
ATOM   2020  C CG  . ASP B 1 53  ? 36.417  22.082  79.023  0.00 37.69 ? 71  ASP B CG  1 
ATOM   2021  O OD1 . ASP B 1 53  ? 36.722  21.638  80.151  0.00 38.28 ? 71  ASP B OD1 1 
ATOM   2022  O OD2 . ASP B 1 53  ? 36.831  21.576  77.958  0.00 38.35 ? 71  ASP B OD2 1 
ATOM   2023  N N   . ASN B 1 54  ? 33.589  22.932  81.025  1.00 40.00 ? 72  ASN B N   1 
ATOM   2024  C CA  . ASN B 1 54  ? 33.001  22.444  82.251  1.00 40.91 ? 72  ASN B CA  1 
ATOM   2025  C C   . ASN B 1 54  ? 31.853  23.429  82.461  1.00 43.20 ? 72  ASN B C   1 
ATOM   2026  O O   . ASN B 1 54  ? 32.039  24.643  82.301  1.00 44.51 ? 72  ASN B O   1 
ATOM   2027  C CB  . ASN B 1 54  ? 34.026  22.504  83.386  1.00 38.50 ? 72  ASN B CB  1 
ATOM   2028  C CG  . ASN B 1 54  ? 33.431  22.157  84.731  0.00 38.69 ? 72  ASN B CG  1 
ATOM   2029  O OD1 . ASN B 1 54  ? 32.579  22.874  85.251  0.00 38.07 ? 72  ASN B OD1 1 
ATOM   2030  N ND2 . ASN B 1 54  ? 33.899  21.067  85.316  0.00 37.84 ? 72  ASN B ND2 1 
ATOM   2031  N N   . ILE B 1 55  ? 30.651  22.915  82.695  1.00 43.30 ? 73  ILE B N   1 
ATOM   2032  C CA  . ILE B 1 55  ? 29.512  23.794  82.905  1.00 42.77 ? 73  ILE B CA  1 
ATOM   2033  C C   . ILE B 1 55  ? 29.329  24.181  84.370  1.00 44.84 ? 73  ILE B C   1 
ATOM   2034  O O   . ILE B 1 55  ? 28.211  24.134  84.897  1.00 49.01 ? 73  ILE B O   1 
ATOM   2035  C CB  . ILE B 1 55  ? 28.193  23.208  82.323  1.00 41.41 ? 73  ILE B CB  1 
ATOM   2036  C CG1 . ILE B 1 55  ? 28.073  21.710  82.600  1.00 40.15 ? 73  ILE B CG1 1 
ATOM   2037  C CG2 . ILE B 1 55  ? 28.101  23.501  80.857  1.00 39.24 ? 73  ILE B CG2 1 
ATOM   2038  C CD1 . ILE B 1 55  ? 27.652  21.369  84.030  1.00 41.50 ? 73  ILE B CD1 1 
ATOM   2039  N N   . ASN B 1 56  ? 30.424  24.565  85.026  1.00 44.32 ? 74  ASN B N   1 
ATOM   2040  C CA  . ASN B 1 56  ? 30.397  24.981  86.431  1.00 46.74 ? 74  ASN B CA  1 
ATOM   2041  C C   . ASN B 1 56  ? 31.591  25.898  86.721  1.00 49.57 ? 74  ASN B C   1 
ATOM   2042  O O   . ASN B 1 56  ? 31.508  26.835  87.523  1.00 48.05 ? 74  ASN B O   1 
ATOM   2043  C CB  . ASN B 1 56  ? 30.395  23.761  87.374  1.00 47.41 ? 74  ASN B CB  1 
ATOM   2044  C CG  . ASN B 1 56  ? 29.104  22.919  87.269  1.00 47.66 ? 74  ASN B CG  1 
ATOM   2045  O OD1 . ASN B 1 56  ? 29.148  21.741  86.917  1.00 47.07 ? 74  ASN B OD1 1 
ATOM   2046  N ND2 . ASN B 1 56  ? 27.961  23.527  87.573  1.00 45.12 ? 74  ASN B ND2 1 
ATOM   2047  N N   . VAL B 1 57  ? 32.704  25.637  86.044  1.00 53.53 ? 75  VAL B N   1 
ATOM   2048  C CA  . VAL B 1 57  ? 33.908  26.453  86.208  1.00 54.70 ? 75  VAL B CA  1 
ATOM   2049  C C   . VAL B 1 57  ? 34.199  27.250  84.924  1.00 54.77 ? 75  VAL B C   1 
ATOM   2050  O O   . VAL B 1 57  ? 33.899  26.793  83.817  1.00 53.03 ? 75  VAL B O   1 
ATOM   2051  C CB  . VAL B 1 57  ? 35.143  25.569  86.550  0.00 52.77 ? 75  VAL B CB  1 
ATOM   2052  C CG1 . VAL B 1 57  ? 36.344  26.437  86.904  0.00 51.81 ? 75  VAL B CG1 1 
ATOM   2053  C CG2 . VAL B 1 57  ? 34.821  24.619  87.696  0.00 51.85 ? 75  VAL B CG2 1 
ATOM   2054  N N   . VAL B 1 58  ? 34.765  28.444  85.078  1.00 56.66 ? 76  VAL B N   1 
ATOM   2055  C CA  . VAL B 1 58  ? 35.120  29.286  83.932  1.00 58.84 ? 76  VAL B CA  1 
ATOM   2056  C C   . VAL B 1 58  ? 36.354  28.696  83.211  1.00 50.81 ? 76  VAL B C   1 
ATOM   2057  O O   . VAL B 1 58  ? 37.504  29.054  83.497  1.00 51.39 ? 76  VAL B O   1 
ATOM   2058  C CB  . VAL B 1 58  ? 35.395  30.787  84.362  1.00 65.98 ? 76  VAL B CB  1 
ATOM   2059  C CG1 . VAL B 1 58  ? 35.795  31.642  83.147  1.00 71.21 ? 76  VAL B CG1 1 
ATOM   2060  C CG2 . VAL B 1 58  ? 34.158  31.400  85.036  1.00 68.95 ? 76  VAL B CG2 1 
ATOM   2061  N N   . GLU B 1 59  ? 36.107  27.767  82.295  0.00 42.72 ? 77  GLU B N   1 
ATOM   2062  C CA  . GLU B 1 59  ? 37.189  27.141  81.547  0.00 35.05 ? 77  GLU B CA  1 
ATOM   2063  C C   . GLU B 1 59  ? 37.590  27.986  80.342  0.00 31.41 ? 77  GLU B C   1 
ATOM   2064  O O   . GLU B 1 59  ? 37.366  27.600  79.191  0.00 31.38 ? 77  GLU B O   1 
ATOM   2065  C CB  . GLU B 1 59  ? 36.794  25.729  81.108  0.00 32.93 ? 77  GLU B CB  1 
ATOM   2066  C CG  . GLU B 1 59  ? 36.601  24.751  82.257  0.00 26.36 ? 77  GLU B CG  1 
ATOM   2067  C CD  . GLU B 1 59  ? 37.873  24.522  83.053  0.00 21.85 ? 77  GLU B CD  1 
ATOM   2068  O OE1 . GLU B 1 59  ? 38.736  23.748  82.588  0.00 19.96 ? 77  GLU B OE1 1 
ATOM   2069  O OE2 . GLU B 1 59  ? 38.007  25.114  84.145  0.00 19.98 ? 77  GLU B OE2 1 
ATOM   2070  N N   . GLY B 1 60  ? 38.173  29.148  80.621  0.00 27.88 ? 78  GLY B N   1 
ATOM   2071  C CA  . GLY B 1 60  ? 38.609  30.043  79.566  0.00 22.90 ? 78  GLY B CA  1 
ATOM   2072  C C   . GLY B 1 60  ? 37.462  30.668  78.799  0.00 19.80 ? 78  GLY B C   1 
ATOM   2073  O O   . GLY B 1 60  ? 37.086  31.812  79.053  0.00 18.85 ? 78  GLY B O   1 
ATOM   2074  N N   . ASN B 1 61  ? 36.901  29.914  77.860  0.00 18.04 ? 79  ASN B N   1 
ATOM   2075  C CA  . ASN B 1 61  ? 35.794  30.398  77.045  0.00 16.78 ? 79  ASN B CA  1 
ATOM   2076  C C   . ASN B 1 61  ? 34.520  30.423  77.879  0.00 16.28 ? 79  ASN B C   1 
ATOM   2077  O O   . ASN B 1 61  ? 34.045  29.381  78.333  0.00 16.03 ? 79  ASN B O   1 
ATOM   2078  C CB  . ASN B 1 61  ? 35.595  29.500  75.822  0.00 16.42 ? 79  ASN B CB  1 
ATOM   2079  C CG  . ASN B 1 61  ? 36.851  29.362  74.989  0.00 16.13 ? 79  ASN B CG  1 
ATOM   2080  O OD1 . ASN B 1 61  ? 37.295  30.314  74.350  0.00 16.19 ? 79  ASN B OD1 1 
ATOM   2081  N ND2 . ASN B 1 61  ? 37.429  28.169  74.986  0.00 16.18 ? 79  ASN B ND2 1 
ATOM   2082  N N   . GLU B 1 62  ? 33.994  31.619  78.108  0.00 15.95 ? 80  GLU B N   1 
ATOM   2083  C CA  . GLU B 1 62  ? 32.778  31.783  78.891  0.00 15.73 ? 80  GLU B CA  1 
ATOM   2084  C C   . GLU B 1 62  ? 31.920  32.857  78.237  0.00 15.66 ? 80  GLU B C   1 
ATOM   2085  O O   . GLU B 1 62  ? 32.311  34.023  78.183  0.00 15.55 ? 80  GLU B O   1 
ATOM   2086  C CB  . GLU B 1 62  ? 33.131  32.188  80.324  0.00 15.86 ? 80  GLU B CB  1 
ATOM   2087  C CG  . GLU B 1 62  ? 32.362  31.431  81.399  0.00 16.08 ? 80  GLU B CG  1 
ATOM   2088  C CD  . GLU B 1 62  ? 32.620  29.931  81.375  0.00 16.01 ? 80  GLU B CD  1 
ATOM   2089  O OE1 . GLU B 1 62  ? 33.765  29.518  81.090  0.00 16.19 ? 80  GLU B OE1 1 
ATOM   2090  O OE2 . GLU B 1 62  ? 31.675  29.163  81.650  0.00 16.22 ? 80  GLU B OE2 1 
ATOM   2091  N N   . GLN B 1 63  ? 30.766  32.456  77.712  0.00 15.46 ? 81  GLN B N   1 
ATOM   2092  C CA  . GLN B 1 63  ? 29.864  33.393  77.049  0.00 14.93 ? 81  GLN B CA  1 
ATOM   2093  C C   . GLN B 1 63  ? 28.398  33.131  77.385  0.00 14.55 ? 81  GLN B C   1 
ATOM   2094  O O   . GLN B 1 63  ? 27.800  32.191  76.862  0.00 14.96 ? 81  GLN B O   1 
ATOM   2095  C CB  . GLN B 1 63  ? 30.049  33.322  75.528  0.00 15.29 ? 81  GLN B CB  1 
ATOM   2096  C CG  . GLN B 1 63  ? 31.417  33.754  75.026  0.00 15.43 ? 81  GLN B CG  1 
ATOM   2097  C CD  . GLN B 1 63  ? 31.549  33.640  73.520  0.00 15.82 ? 81  GLN B CD  1 
ATOM   2098  O OE1 . GLN B 1 63  ? 30.625  33.965  72.774  0.00 15.90 ? 81  GLN B OE1 1 
ATOM   2099  N NE2 . GLN B 1 63  ? 32.705  33.181  73.065  0.00 15.76 ? 81  GLN B NE2 1 
ATOM   2100  N N   . PHE B 1 64  ? 27.837  33.941  78.280  1.00 15.08 ? 82  PHE B N   1 
ATOM   2101  C CA  . PHE B 1 64  ? 26.432  33.818  78.669  1.00 10.88 ? 82  PHE B CA  1 
ATOM   2102  C C   . PHE B 1 64  ? 25.672  34.899  77.904  1.00 8.78  ? 82  PHE B C   1 
ATOM   2103  O O   . PHE B 1 64  ? 25.822  36.085  78.181  1.00 12.16 ? 82  PHE B O   1 
ATOM   2104  C CB  . PHE B 1 64  ? 26.249  34.035  80.183  1.00 10.73 ? 82  PHE B CB  1 
ATOM   2105  C CG  . PHE B 1 64  ? 26.974  33.037  81.050  0.00 12.97 ? 82  PHE B CG  1 
ATOM   2106  C CD1 . PHE B 1 64  ? 28.342  32.817  80.906  0.00 13.40 ? 82  PHE B CD1 1 
ATOM   2107  C CD2 . PHE B 1 64  ? 26.288  32.337  82.038  0.00 13.53 ? 82  PHE B CD2 1 
ATOM   2108  C CE1 . PHE B 1 64  ? 29.012  31.919  81.733  0.00 14.01 ? 82  PHE B CE1 1 
ATOM   2109  C CE2 . PHE B 1 64  ? 26.950  31.437  82.870  0.00 13.86 ? 82  PHE B CE2 1 
ATOM   2110  C CZ  . PHE B 1 64  ? 28.315  31.228  82.716  0.00 14.15 ? 82  PHE B CZ  1 
ATOM   2111  N N   . ILE B 1 65  ? 24.881  34.498  76.923  1.00 5.27  ? 83  ILE B N   1 
ATOM   2112  C CA  . ILE B 1 65  ? 24.114  35.452  76.139  1.00 6.06  ? 83  ILE B CA  1 
ATOM   2113  C C   . ILE B 1 65  ? 22.603  35.252  76.254  1.00 5.87  ? 83  ILE B C   1 
ATOM   2114  O O   . ILE B 1 65  ? 22.096  34.131  76.168  1.00 5.51  ? 83  ILE B O   1 
ATOM   2115  C CB  . ILE B 1 65  ? 24.477  35.353  74.656  1.00 8.51  ? 83  ILE B CB  1 
ATOM   2116  C CG1 . ILE B 1 65  ? 25.974  35.548  74.467  1.00 6.54  ? 83  ILE B CG1 1 
ATOM   2117  C CG2 . ILE B 1 65  ? 23.694  36.394  73.838  1.00 11.91 ? 83  ILE B CG2 1 
ATOM   2118  C CD1 . ILE B 1 65  ? 26.382  35.418  73.037  1.00 9.41  ? 83  ILE B CD1 1 
ATOM   2119  N N   . SER B 1 66  ? 21.875  36.344  76.420  1.00 5.00  ? 84  SER B N   1 
ATOM   2120  C CA  . SER B 1 66  ? 20.435  36.246  76.506  1.00 7.06  ? 84  SER B CA  1 
ATOM   2121  C C   . SER B 1 66  ? 19.901  35.929  75.100  1.00 8.40  ? 84  SER B C   1 
ATOM   2122  O O   . SER B 1 66  ? 20.562  36.215  74.106  1.00 9.57  ? 84  SER B O   1 
ATOM   2123  C CB  . SER B 1 66  ? 19.882  37.570  77.005  1.00 5.94  ? 84  SER B CB  1 
ATOM   2124  O OG  . SER B 1 66  ? 20.751  38.131  77.970  0.00 6.86  ? 84  SER B OG  1 
ATOM   2125  N N   . ALA B 1 67  ? 18.734  35.306  75.011  1.00 8.40  ? 85  ALA B N   1 
ATOM   2126  C CA  . ALA B 1 67  ? 18.140  34.979  73.721  1.00 8.32  ? 85  ALA B CA  1 
ATOM   2127  C C   . ALA B 1 67  ? 17.082  36.014  73.372  1.00 9.98  ? 85  ALA B C   1 
ATOM   2128  O O   . ALA B 1 67  ? 16.134  36.169  74.125  1.00 17.03 ? 85  ALA B O   1 
ATOM   2129  C CB  . ALA B 1 67  ? 17.496  33.632  73.802  1.00 9.03  ? 85  ALA B CB  1 
ATOM   2130  N N   . SER B 1 68  ? 17.221  36.703  72.242  1.00 8.34  ? 86  SER B N   1 
ATOM   2131  C CA  . SER B 1 68  ? 16.241  37.711  71.830  1.00 8.48  ? 86  SER B CA  1 
ATOM   2132  C C   . SER B 1 68  ? 14.907  37.073  71.398  1.00 10.50 ? 86  SER B C   1 
ATOM   2133  O O   . SER B 1 68  ? 13.874  37.316  72.018  1.00 16.37 ? 86  SER B O   1 
ATOM   2134  C CB  . SER B 1 68  ? 16.809  38.597  70.715  1.00 7.65  ? 86  SER B CB  1 
ATOM   2135  O OG  . SER B 1 68  ? 15.968  39.707  70.448  0.00 8.62  ? 86  SER B OG  1 
ATOM   2136  N N   . LYS B 1 69  ? 14.908  36.279  70.335  1.00 7.88  ? 87  LYS B N   1 
ATOM   2137  C CA  . LYS B 1 69  ? 13.674  35.638  69.895  1.00 6.89  ? 87  LYS B CA  1 
ATOM   2138  C C   . LYS B 1 69  ? 13.892  34.150  70.038  1.00 6.98  ? 87  LYS B C   1 
ATOM   2139  O O   . LYS B 1 69  ? 14.961  33.691  69.702  1.00 10.26 ? 87  LYS B O   1 
ATOM   2140  C CB  . LYS B 1 69  ? 13.372  35.937  68.418  1.00 5.00  ? 87  LYS B CB  1 
ATOM   2141  C CG  . LYS B 1 69  ? 12.992  37.360  68.077  1.00 5.00  ? 87  LYS B CG  1 
ATOM   2142  C CD  . LYS B 1 69  ? 14.209  38.269  68.024  0.00 6.65  ? 87  LYS B CD  1 
ATOM   2143  C CE  . LYS B 1 69  ? 13.843  39.665  67.548  0.00 7.35  ? 87  LYS B CE  1 
ATOM   2144  N NZ  . LYS B 1 69  ? 13.364  39.670  66.137  0.00 7.79  ? 87  LYS B NZ  1 
ATOM   2145  N N   . SER B 1 70  ? 12.954  33.419  70.628  1.00 6.42  ? 88  SER B N   1 
ATOM   2146  C CA  . SER B 1 70  ? 13.069  31.961  70.734  1.00 6.66  ? 88  SER B CA  1 
ATOM   2147  C C   . SER B 1 70  ? 11.887  31.458  69.901  1.00 10.48 ? 88  SER B C   1 
ATOM   2148  O O   . SER B 1 70  ? 10.733  31.408  70.374  1.00 13.19 ? 88  SER B O   1 
ATOM   2149  C CB  . SER B 1 70  ? 12.987  31.471  72.188  1.00 5.00  ? 88  SER B CB  1 
ATOM   2150  O OG  . SER B 1 70  ? 13.958  32.105  73.006  0.00 5.53  ? 88  SER B OG  1 
ATOM   2151  N N   . ILE B 1 71  ? 12.166  31.170  68.630  1.00 9.08  ? 89  ILE B N   1 
ATOM   2152  C CA  . ILE B 1 71  ? 11.152  30.719  67.680  1.00 7.76  ? 89  ILE B CA  1 
ATOM   2153  C C   . ILE B 1 71  ? 10.941  29.193  67.539  1.00 8.65  ? 89  ILE B C   1 
ATOM   2154  O O   . ILE B 1 71  ? 11.721  28.507  66.898  1.00 8.60  ? 89  ILE B O   1 
ATOM   2155  C CB  . ILE B 1 71  ? 11.444  31.324  66.310  1.00 5.00  ? 89  ILE B CB  1 
ATOM   2156  C CG1 . ILE B 1 71  ? 11.489  32.847  66.421  1.00 5.00  ? 89  ILE B CG1 1 
ATOM   2157  C CG2 . ILE B 1 71  ? 10.427  30.852  65.295  1.00 5.00  ? 89  ILE B CG2 1 
ATOM   2158  C CD1 . ILE B 1 71  ? 12.032  33.542  65.196  1.00 5.00  ? 89  ILE B CD1 1 
ATOM   2159  N N   . VAL B 1 72  ? 9.850   28.687  68.111  1.00 10.51 ? 90  VAL B N   1 
ATOM   2160  C CA  . VAL B 1 72  ? 9.478   27.260  68.051  1.00 9.54  ? 90  VAL B CA  1 
ATOM   2161  C C   . VAL B 1 72  ? 8.840   26.902  66.680  1.00 9.90  ? 90  VAL B C   1 
ATOM   2162  O O   . VAL B 1 72  ? 8.162   27.735  66.059  1.00 11.76 ? 90  VAL B O   1 
ATOM   2163  C CB  . VAL B 1 72  ? 8.456   26.917  69.190  1.00 5.74  ? 90  VAL B CB  1 
ATOM   2164  C CG1 . VAL B 1 72  ? 7.931   25.528  69.019  1.00 5.00  ? 90  VAL B CG1 1 
ATOM   2165  C CG2 . VAL B 1 72  ? 9.101   27.059  70.568  1.00 5.00  ? 90  VAL B CG2 1 
ATOM   2166  N N   . HIS B 1 73  ? 9.062   25.685  66.191  1.00 8.64  ? 91  HIS B N   1 
ATOM   2167  C CA  . HIS B 1 73  ? 8.477   25.294  64.914  1.00 9.15  ? 91  HIS B CA  1 
ATOM   2168  C C   . HIS B 1 73  ? 6.962   25.272  65.029  1.00 12.05 ? 91  HIS B C   1 
ATOM   2169  O O   . HIS B 1 73  ? 6.417   24.530  65.842  1.00 14.19 ? 91  HIS B O   1 
ATOM   2170  C CB  . HIS B 1 73  ? 8.963   23.929  64.478  1.00 9.93  ? 91  HIS B CB  1 
ATOM   2171  C CG  . HIS B 1 73  ? 8.538   23.565  63.098  1.00 11.73 ? 91  HIS B CG  1 
ATOM   2172  N ND1 . HIS B 1 73  ? 7.307   23.016  62.818  1.00 14.01 ? 91  HIS B ND1 1 
ATOM   2173  C CD2 . HIS B 1 73  ? 9.174   23.685  61.910  1.00 16.30 ? 91  HIS B CD2 1 
ATOM   2174  C CE1 . HIS B 1 73  ? 7.199   22.812  61.516  1.00 16.59 ? 91  HIS B CE1 1 
ATOM   2175  N NE2 . HIS B 1 73  ? 8.320   23.209  60.941  1.00 18.52 ? 91  HIS B NE2 1 
ATOM   2176  N N   . PRO B 1 74  ? 6.258   25.960  64.111  1.00 14.85 ? 92  PRO B N   1 
ATOM   2177  C CA  . PRO B 1 74  ? 4.793   26.101  64.023  1.00 14.83 ? 92  PRO B CA  1 
ATOM   2178  C C   . PRO B 1 74  ? 3.927   24.833  63.938  1.00 16.92 ? 92  PRO B C   1 
ATOM   2179  O O   . PRO B 1 74  ? 2.714   24.915  63.823  1.00 20.38 ? 92  PRO B O   1 
ATOM   2180  C CB  . PRO B 1 74  ? 4.620   26.965  62.773  1.00 12.42 ? 92  PRO B CB  1 
ATOM   2181  C CG  . PRO B 1 74  ? 5.727   26.482  61.910  1.00 13.55 ? 92  PRO B CG  1 
ATOM   2182  C CD  . PRO B 1 74  ? 6.883   26.506  62.894  1.00 15.61 ? 92  PRO B CD  1 
ATOM   2183  N N   . SER B 1 75  ? 4.525   23.664  64.012  1.00 18.19 ? 93  SER B N   1 
ATOM   2184  C CA  . SER B 1 75  ? 3.743   22.444  63.912  1.00 19.09 ? 93  SER B CA  1 
ATOM   2185  C C   . SER B 1 75  ? 4.301   21.437  64.898  1.00 19.51 ? 93  SER B C   1 
ATOM   2186  O O   . SER B 1 75  ? 3.992   20.246  64.829  1.00 22.74 ? 93  SER B O   1 
ATOM   2187  C CB  . SER B 1 75  ? 3.823   21.881  62.484  1.00 19.18 ? 93  SER B CB  1 
ATOM   2188  O OG  . SER B 1 75  ? 3.486   22.870  61.522  1.00 20.24 ? 93  SER B OG  1 
ATOM   2189  N N   . TYR B 1 76  ? 5.165   21.910  65.790  1.00 15.45 ? 94  TYR B N   1 
ATOM   2190  C CA  . TYR B 1 76  ? 5.758   21.031  66.769  1.00 11.83 ? 94  TYR B CA  1 
ATOM   2191  C C   . TYR B 1 76  ? 4.594   20.506  67.570  1.00 15.16 ? 94  TYR B C   1 
ATOM   2192  O O   . TYR B 1 76  ? 3.733   21.288  67.962  1.00 20.03 ? 94  TYR B O   1 
ATOM   2193  C CB  . TYR B 1 76  ? 6.720   21.816  67.648  1.00 5.00  ? 94  TYR B CB  1 
ATOM   2194  C CG  . TYR B 1 76  ? 6.877   21.233  69.012  1.00 5.00  ? 94  TYR B CG  1 
ATOM   2195  C CD1 . TYR B 1 76  ? 6.528   21.958  70.130  1.00 5.00  ? 94  TYR B CD1 1 
ATOM   2196  C CD2 . TYR B 1 76  ? 7.302   19.931  69.185  1.00 6.11  ? 94  TYR B CD2 1 
ATOM   2197  C CE1 . TYR B 1 76  ? 6.591   21.404  71.394  1.00 5.00  ? 94  TYR B CE1 1 
ATOM   2198  C CE2 . TYR B 1 76  ? 7.360   19.361  70.453  1.00 6.18  ? 94  TYR B CE2 1 
ATOM   2199  C CZ  . TYR B 1 76  ? 7.002   20.105  71.551  1.00 5.00  ? 94  TYR B CZ  1 
ATOM   2200  O OH  . TYR B 1 76  ? 7.044   19.539  72.805  1.00 5.00  ? 94  TYR B OH  1 
ATOM   2201  N N   . ASN B 1 77  ? 4.493   19.190  67.718  1.00 15.69 ? 95  ASN B N   1 
ATOM   2202  C CA  . ASN B 1 77  ? 3.396   18.612  68.498  1.00 18.30 ? 95  ASN B CA  1 
ATOM   2203  C C   . ASN B 1 77  ? 3.921   18.131  69.844  1.00 18.04 ? 95  ASN B C   1 
ATOM   2204  O O   . ASN B 1 77  ? 4.646   17.144  69.915  1.00 18.48 ? 95  ASN B O   1 
ATOM   2205  C CB  . ASN B 1 77  ? 2.717   17.463  67.735  1.00 20.02 ? 95  ASN B CB  1 
ATOM   2206  C CG  . ASN B 1 77  ? 1.488   16.933  68.448  0.00 19.05 ? 95  ASN B CG  1 
ATOM   2207  O OD1 . ASN B 1 77  ? 1.594   16.160  69.397  0.00 18.76 ? 95  ASN B OD1 1 
ATOM   2208  N ND2 . ASN B 1 77  ? 0.314   17.344  67.991  0.00 18.87 ? 95  ASN B ND2 1 
ATOM   2209  N N   . SER B 1 78  ? 3.545   18.822  70.913  1.00 19.14 ? 96  SER B N   1 
ATOM   2210  C CA  . SER B 1 78  ? 4.010   18.471  72.252  1.00 21.60 ? 96  SER B CA  1 
ATOM   2211  C C   . SER B 1 78  ? 3.754   17.050  72.678  1.00 22.89 ? 96  SER B C   1 
ATOM   2212  O O   . SER B 1 78  ? 4.338   16.590  73.656  1.00 22.71 ? 96  SER B O   1 
ATOM   2213  C CB  . SER B 1 78  ? 3.433   19.413  73.305  1.00 19.78 ? 96  SER B CB  1 
ATOM   2214  O OG  . SER B 1 78  ? 2.057   19.626  73.101  1.00 22.05 ? 96  SER B OG  1 
ATOM   2215  N N   . ASN B 1 79  ? 2.878   16.362  71.958  1.00 26.28 ? 97  ASN B N   1 
ATOM   2216  C CA  . ASN B 1 79  ? 2.553   14.982  72.298  1.00 31.40 ? 97  ASN B CA  1 
ATOM   2217  C C   . ASN B 1 79  ? 3.408   13.988  71.546  1.00 28.12 ? 97  ASN B C   1 
ATOM   2218  O O   . ASN B 1 79  ? 4.135   13.216  72.158  1.00 25.79 ? 97  ASN B O   1 
ATOM   2219  C CB  . ASN B 1 79  ? 1.063   14.687  72.068  1.00 38.09 ? 97  ASN B CB  1 
ATOM   2220  C CG  . ASN B 1 79  ? 0.152   15.442  73.044  1.00 44.13 ? 97  ASN B CG  1 
ATOM   2221  O OD1 . ASN B 1 79  ? 0.425   16.588  73.423  1.00 45.44 ? 97  ASN B OD1 1 
ATOM   2222  N ND2 . ASN B 1 79  ? -0.941  14.804  73.440  1.00 46.66 ? 97  ASN B ND2 1 
ATOM   2223  N N   . THR B 1 80  ? 3.326   14.019  70.219  1.00 27.50 ? 98  THR B N   1 
ATOM   2224  C CA  . THR B 1 80  ? 4.102   13.106  69.369  1.00 26.01 ? 98  THR B CA  1 
ATOM   2225  C C   . THR B 1 80  ? 5.600   13.451  69.341  1.00 23.03 ? 98  THR B C   1 
ATOM   2226  O O   . THR B 1 80  ? 6.457   12.558  69.174  1.00 22.69 ? 98  THR B O   1 
ATOM   2227  C CB  . THR B 1 80  ? 3.586   13.101  67.887  1.00 24.82 ? 98  THR B CB  1 
ATOM   2228  O OG1 . THR B 1 80  ? 3.857   14.362  67.255  1.00 23.61 ? 98  THR B OG1 1 
ATOM   2229  C CG2 . THR B 1 80  ? 2.110   12.876  67.851  1.00 25.67 ? 98  THR B CG2 1 
ATOM   2230  N N   . LEU B 1 81  ? 5.888   14.741  69.554  1.00 18.83 ? 99  LEU B N   1 
ATOM   2231  C CA  . LEU B 1 81  ? 7.237   15.299  69.511  1.00 13.99 ? 99  LEU B CA  1 
ATOM   2232  C C   . LEU B 1 81  ? 7.634   15.309  68.046  1.00 12.36 ? 99  LEU B C   1 
ATOM   2233  O O   . LEU B 1 81  ? 8.781   15.046  67.701  1.00 13.87 ? 99  LEU B O   1 
ATOM   2234  C CB  . LEU B 1 81  ? 8.248   14.496  70.356  1.00 12.15 ? 99  LEU B CB  1 
ATOM   2235  C CG  . LEU B 1 81  ? 8.038   14.520  71.875  1.00 10.22 ? 99  LEU B CG  1 
ATOM   2236  C CD1 . LEU B 1 81  ? 9.137   13.715  72.549  1.00 5.00  ? 99  LEU B CD1 1 
ATOM   2237  C CD2 . LEU B 1 81  ? 7.971   15.975  72.410  1.00 5.89  ? 99  LEU B CD2 1 
ATOM   2238  N N   . ASN B 1 82  ? 6.646   15.481  67.176  1.00 11.25 ? 100 ASN B N   1 
ATOM   2239  C CA  . ASN B 1 82  ? 6.934   15.552  65.756  1.00 13.41 ? 100 ASN B CA  1 
ATOM   2240  C C   . ASN B 1 82  ? 7.300   17.014  65.510  1.00 14.87 ? 100 ASN B C   1 
ATOM   2241  O O   . ASN B 1 82  ? 6.661   17.908  66.084  1.00 17.88 ? 100 ASN B O   1 
ATOM   2242  C CB  . ASN B 1 82  ? 5.716   15.170  64.918  1.00 14.31 ? 100 ASN B CB  1 
ATOM   2243  C CG  . ASN B 1 82  ? 6.037   15.093  63.420  1.00 17.08 ? 100 ASN B CG  1 
ATOM   2244  O OD1 . ASN B 1 82  ? 7.144   14.716  63.034  1.00 20.76 ? 100 ASN B OD1 1 
ATOM   2245  N ND2 . ASN B 1 82  ? 5.071   15.435  62.578  1.00 17.04 ? 100 ASN B ND2 1 
ATOM   2246  N N   . ASN B 1 83  ? 8.312   17.251  64.673  1.00 11.66 ? 101 ASN B N   1 
ATOM   2247  C CA  . ASN B 1 83  ? 8.782   18.592  64.370  1.00 10.73 ? 101 ASN B CA  1 
ATOM   2248  C C   . ASN B 1 83  ? 9.386   19.200  65.630  1.00 12.73 ? 101 ASN B C   1 
ATOM   2249  O O   . ASN B 1 83  ? 9.121   20.361  65.952  1.00 15.20 ? 101 ASN B O   1 
ATOM   2250  C CB  . ASN B 1 83  ? 7.650   19.503  63.868  1.00 13.34 ? 101 ASN B CB  1 
ATOM   2251  C CG  . ASN B 1 83  ? 6.970   18.979  62.623  1.00 12.80 ? 101 ASN B CG  1 
ATOM   2252  O OD1 . ASN B 1 83  ? 7.491   19.100  61.506  1.00 15.50 ? 101 ASN B OD1 1 
ATOM   2253  N ND2 . ASN B 1 83  ? 5.779   18.439  62.797  1.00 7.85  ? 101 ASN B ND2 1 
ATOM   2254  N N   . ASP B 1 84  ? 10.139  18.403  66.383  1.00 13.35 ? 102 ASP B N   1 
ATOM   2255  C CA  . ASP B 1 84  ? 10.801  18.900  67.587  1.00 12.96 ? 102 ASP B CA  1 
ATOM   2256  C C   . ASP B 1 84  ? 12.000  19.751  67.115  1.00 13.29 ? 102 ASP B C   1 
ATOM   2257  O O   . ASP B 1 84  ? 13.100  19.234  66.991  1.00 16.14 ? 102 ASP B O   1 
ATOM   2258  C CB  . ASP B 1 84  ? 11.279  17.722  68.436  0.00 15.13 ? 102 ASP B CB  1 
ATOM   2259  C CG  . ASP B 1 84  ? 12.030  18.162  69.670  0.00 16.87 ? 102 ASP B CG  1 
ATOM   2260  O OD1 . ASP B 1 84  ? 11.524  19.040  70.397  0.00 18.29 ? 102 ASP B OD1 1 
ATOM   2261  O OD2 . ASP B 1 84  ? 13.133  17.630  69.911  0.00 18.15 ? 102 ASP B OD2 1 
ATOM   2262  N N   . ILE B 1 85  ? 11.766  21.015  66.754  1.00 10.79 ? 103 ILE B N   1 
ATOM   2263  C CA  . ILE B 1 85  ? 12.828  21.914  66.287  1.00 8.53  ? 103 ILE B CA  1 
ATOM   2264  C C   . ILE B 1 85  ? 12.476  23.368  66.609  1.00 10.29 ? 103 ILE B C   1 
ATOM   2265  O O   . ILE B 1 85  ? 11.361  23.830  66.352  1.00 9.67  ? 103 ILE B O   1 
ATOM   2266  C CB  . ILE B 1 85  ? 13.118  21.767  64.755  1.00 9.79  ? 103 ILE B CB  1 
ATOM   2267  C CG1 . ILE B 1 85  ? 14.514  22.318  64.428  1.00 9.32  ? 103 ILE B CG1 1 
ATOM   2268  C CG2 . ILE B 1 85  ? 12.087  22.548  63.922  1.00 9.13  ? 103 ILE B CG2 1 
ATOM   2269  C CD1 . ILE B 1 85  ? 14.942  22.121  62.988  1.00 5.00  ? 103 ILE B CD1 1 
ATOM   2270  N N   . MET B 1 86  ? 13.453  24.090  67.146  1.00 11.07 ? 104 MET B N   1 
ATOM   2271  C CA  . MET B 1 86  ? 13.285  25.475  67.561  1.00 8.20  ? 104 MET B CA  1 
ATOM   2272  C C   . MET B 1 86  ? 14.553  26.255  67.206  1.00 5.00  ? 104 MET B C   1 
ATOM   2273  O O   . MET B 1 86  ? 15.636  25.698  67.193  1.00 6.99  ? 104 MET B O   1 
ATOM   2274  C CB  . MET B 1 86  ? 13.034  25.487  69.088  1.00 6.21  ? 104 MET B CB  1 
ATOM   2275  C CG  . MET B 1 86  ? 13.118  26.838  69.772  1.00 6.03  ? 104 MET B CG  1 
ATOM   2276  S SD  . MET B 1 86  ? 13.103  26.686  71.577  1.00 5.46  ? 104 MET B SD  1 
ATOM   2277  C CE  . MET B 1 86  ? 14.570  25.907  71.873  1.00 5.00  ? 104 MET B CE  1 
ATOM   2278  N N   . LEU B 1 87  ? 14.401  27.530  66.884  1.00 5.00  ? 105 LEU B N   1 
ATOM   2279  C CA  . LEU B 1 87  ? 15.514  28.408  66.560  1.00 5.00  ? 105 LEU B CA  1 
ATOM   2280  C C   . LEU B 1 87  ? 15.567  29.534  67.577  1.00 5.00  ? 105 LEU B C   1 
ATOM   2281  O O   . LEU B 1 87  ? 14.574  30.196  67.836  1.00 5.00  ? 105 LEU B O   1 
ATOM   2282  C CB  . LEU B 1 87  ? 15.355  29.013  65.166  1.00 5.00  ? 105 LEU B CB  1 
ATOM   2283  C CG  . LEU B 1 87  ? 15.557  28.074  63.983  1.00 5.00  ? 105 LEU B CG  1 
ATOM   2284  C CD1 . LEU B 1 87  ? 15.372  28.838  62.677  1.00 5.00  ? 105 LEU B CD1 1 
ATOM   2285  C CD2 . LEU B 1 87  ? 16.927  27.471  64.059  1.00 5.00  ? 105 LEU B CD2 1 
ATOM   2286  N N   . ILE B 1 88  ? 16.747  29.749  68.130  1.00 5.46  ? 106 ILE B N   1 
ATOM   2287  C CA  . ILE B 1 88  ? 17.001  30.785  69.114  1.00 5.00  ? 106 ILE B CA  1 
ATOM   2288  C C   . ILE B 1 88  ? 17.881  31.870  68.497  1.00 5.78  ? 106 ILE B C   1 
ATOM   2289  O O   . ILE B 1 88  ? 18.812  31.569  67.746  1.00 9.48  ? 106 ILE B O   1 
ATOM   2290  C CB  . ILE B 1 88  ? 17.738  30.186  70.327  1.00 5.00  ? 106 ILE B CB  1 
ATOM   2291  C CG1 . ILE B 1 88  ? 16.873  29.098  70.967  1.00 6.29  ? 106 ILE B CG1 1 
ATOM   2292  C CG2 . ILE B 1 88  ? 18.136  31.271  71.308  1.00 5.00  ? 106 ILE B CG2 1 
ATOM   2293  C CD1 . ILE B 1 88  ? 17.522  28.377  72.118  1.00 5.00  ? 106 ILE B CD1 1 
ATOM   2294  N N   . LYS B 1 89  ? 17.540  33.127  68.736  1.00 5.22  ? 107 LYS B N   1 
ATOM   2295  C CA  . LYS B 1 89  ? 18.344  34.237  68.246  1.00 5.00  ? 107 LYS B CA  1 
ATOM   2296  C C   . LYS B 1 89  ? 18.989  34.885  69.470  1.00 5.00  ? 107 LYS B C   1 
ATOM   2297  O O   . LYS B 1 89  ? 18.314  35.215  70.440  1.00 6.17  ? 107 LYS B O   1 
ATOM   2298  C CB  . LYS B 1 89  ? 17.497  35.256  67.492  1.00 5.00  ? 107 LYS B CB  1 
ATOM   2299  C CG  . LYS B 1 89  ? 18.296  36.482  67.077  1.00 5.00  ? 107 LYS B CG  1 
ATOM   2300  C CD  . LYS B 1 89  ? 17.551  37.367  66.093  1.00 5.00  ? 107 LYS B CD  1 
ATOM   2301  C CE  . LYS B 1 89  ? 18.420  38.519  65.601  1.00 5.00  ? 107 LYS B CE  1 
ATOM   2302  N NZ  . LYS B 1 89  ? 17.821  39.411  64.577  1.00 5.00  ? 107 LYS B NZ  1 
ATOM   2303  N N   . LEU B 1 90  ? 20.301  35.019  69.446  1.00 5.00  ? 108 LEU B N   1 
ATOM   2304  C CA  . LEU B 1 90  ? 21.023  35.606  70.558  1.00 5.00  ? 108 LEU B CA  1 
ATOM   2305  C C   . LEU B 1 90  ? 20.878  37.119  70.562  1.00 5.64  ? 108 LEU B C   1 
ATOM   2306  O O   . LEU B 1 90  ? 20.978  37.767  69.511  1.00 5.00  ? 108 LEU B O   1 
ATOM   2307  C CB  . LEU B 1 90  ? 22.500  35.238  70.463  1.00 5.00  ? 108 LEU B CB  1 
ATOM   2308  C CG  . LEU B 1 90  ? 22.807  33.751  70.384  1.00 5.00  ? 108 LEU B CG  1 
ATOM   2309  C CD1 . LEU B 1 90  ? 24.237  33.556  70.085  1.00 5.77  ? 108 LEU B CD1 1 
ATOM   2310  C CD2 . LEU B 1 90  ? 22.481  33.108  71.690  1.00 7.37  ? 108 LEU B CD2 1 
ATOM   2311  N N   . LYS B 1 91  ? 20.654  37.673  71.752  1.00 5.00  ? 109 LYS B N   1 
ATOM   2312  C CA  . LYS B 1 91  ? 20.516  39.103  71.928  1.00 5.00  ? 109 LYS B CA  1 
ATOM   2313  C C   . LYS B 1 91  ? 21.652  39.741  71.189  1.00 9.00  ? 109 LYS B C   1 
ATOM   2314  O O   . LYS B 1 91  ? 21.433  40.631  70.391  1.00 13.32 ? 109 LYS B O   1 
ATOM   2315  C CB  . LYS B 1 91  ? 20.634  39.463  73.401  1.00 5.00  ? 109 LYS B CB  1 
ATOM   2316  C CG  . LYS B 1 91  ? 20.797  40.966  73.710  1.00 5.00  ? 109 LYS B CG  1 
ATOM   2317  C CD  . LYS B 1 91  ? 20.492  41.254  75.182  0.00 6.91  ? 109 LYS B CD  1 
ATOM   2318  C CE  . LYS B 1 91  ? 19.028  40.979  75.527  0.00 7.55  ? 109 LYS B CE  1 
ATOM   2319  N NZ  . LYS B 1 91  ? 18.755  41.115  76.986  0.00 7.62  ? 109 LYS B NZ  1 
ATOM   2320  N N   . SER B 1 92  ? 22.862  39.234  71.431  1.00 10.80 ? 110 SER B N   1 
ATOM   2321  C CA  . SER B 1 92  ? 24.092  39.735  70.820  1.00 8.79  ? 110 SER B CA  1 
ATOM   2322  C C   . SER B 1 92  ? 24.714  38.614  70.030  1.00 11.21 ? 110 SER B C   1 
ATOM   2323  O O   . SER B 1 92  ? 24.632  37.462  70.452  1.00 13.60 ? 110 SER B O   1 
ATOM   2324  C CB  . SER B 1 92  ? 25.058  40.146  71.924  1.00 5.00  ? 110 SER B CB  1 
ATOM   2325  O OG  . SER B 1 92  ? 24.451  41.083  72.801  0.00 7.36  ? 110 SER B OG  1 
ATOM   2326  N N   . ALA B 1 93  ? 25.355  38.928  68.905  1.00 13.65 ? 111 ALA B N   1 
ATOM   2327  C CA  . ALA B 1 93  ? 25.988  37.883  68.086  1.00 17.42 ? 111 ALA B CA  1 
ATOM   2328  C C   . ALA B 1 93  ? 27.182  37.277  68.787  1.00 19.82 ? 111 ALA B C   1 
ATOM   2329  O O   . ALA B 1 93  ? 28.016  37.994  69.346  1.00 21.56 ? 111 ALA B O   1 
ATOM   2330  C CB  . ALA B 1 93  ? 26.412  38.418  66.743  1.00 14.89 ? 111 ALA B CB  1 
ATOM   2331  N N   . ALA B 1 94  ? 27.228  35.952  68.789  1.00 24.15 ? 112 ALA B N   1 
ATOM   2332  C CA  . ALA B 1 94  ? 28.305  35.199  69.415  1.00 30.23 ? 112 ALA B CA  1 
ATOM   2333  C C   . ALA B 1 94  ? 29.580  35.448  68.650  1.00 36.35 ? 112 ALA B C   1 
ATOM   2334  O O   . ALA B 1 94  ? 29.571  35.662  67.435  1.00 36.97 ? 112 ALA B O   1 
ATOM   2335  C CB  . ALA B 1 94  ? 27.981  33.722  69.421  0.00 31.54 ? 112 ALA B CB  1 
ATOM   2336  N N   . SER B 1 95  ? 30.684  35.374  69.367  1.00 41.20 ? 113 SER B N   1 
ATOM   2337  C CA  . SER B 1 95  ? 32.002  35.613  68.799  1.00 44.93 ? 113 SER B CA  1 
ATOM   2338  C C   . SER B 1 95  ? 32.590  34.401  68.097  1.00 43.54 ? 113 SER B C   1 
ATOM   2339  O O   . SER B 1 95  ? 33.219  33.553  68.736  1.00 42.38 ? 113 SER B O   1 
ATOM   2340  C CB  . SER B 1 95  ? 32.918  35.999  69.932  1.00 48.09 ? 113 SER B CB  1 
ATOM   2341  O OG  . SER B 1 95  ? 32.781  35.023  70.956  1.00 54.05 ? 113 SER B OG  1 
ATOM   2342  N N   . LEU B 1 96  ? 32.409  34.316  66.790  1.00 42.98 ? 114 LEU B N   1 
ATOM   2343  C CA  . LEU B 1 96  ? 32.966  33.179  66.074  1.00 42.81 ? 114 LEU B CA  1 
ATOM   2344  C C   . LEU B 1 96  ? 34.487  33.239  66.129  1.00 40.20 ? 114 LEU B C   1 
ATOM   2345  O O   . LEU B 1 96  ? 35.063  34.319  66.335  1.00 43.19 ? 114 LEU B O   1 
ATOM   2346  C CB  . LEU B 1 96  ? 32.477  33.152  64.625  1.00 44.13 ? 114 LEU B CB  1 
ATOM   2347  C CG  . LEU B 1 96  ? 30.977  32.896  64.500  1.00 45.99 ? 114 LEU B CG  1 
ATOM   2348  C CD1 . LEU B 1 96  ? 30.601  32.822  63.032  1.00 45.58 ? 114 LEU B CD1 1 
ATOM   2349  C CD2 . LEU B 1 96  ? 30.591  31.600  65.246  1.00 44.97 ? 114 LEU B CD2 1 
ATOM   2350  N N   . ASN B 1 97  ? 35.113  32.065  66.045  0.00 34.31 ? 115 ASN B N   1 
ATOM   2351  C CA  . ASN B 1 97  ? 36.569  31.913  66.052  0.00 28.85 ? 115 ASN B CA  1 
ATOM   2352  C C   . ASN B 1 97  ? 36.942  30.437  66.184  0.00 26.51 ? 115 ASN B C   1 
ATOM   2353  O O   . ASN B 1 97  ? 36.114  29.556  65.946  0.00 26.33 ? 115 ASN B O   1 
ATOM   2354  C CB  . ASN B 1 97  ? 37.223  32.734  67.176  0.00 27.10 ? 115 ASN B CB  1 
ATOM   2355  C CG  . ASN B 1 97  ? 36.890  32.218  68.568  0.00 23.66 ? 115 ASN B CG  1 
ATOM   2356  O OD1 . ASN B 1 97  ? 35.956  31.444  68.760  0.00 21.81 ? 115 ASN B OD1 1 
ATOM   2357  N ND2 . ASN B 1 97  ? 37.674  32.639  69.549  0.00 21.73 ? 115 ASN B ND2 1 
ATOM   2358  N N   . SER B 1 98  ? 38.195  30.172  66.541  0.00 23.97 ? 116 SER B N   1 
ATOM   2359  C CA  . SER B 1 98  ? 38.681  28.809  66.710  0.00 21.16 ? 116 SER B CA  1 
ATOM   2360  C C   . SER B 1 98  ? 38.041  28.116  67.913  0.00 20.19 ? 116 SER B C   1 
ATOM   2361  O O   . SER B 1 98  ? 38.032  26.889  68.000  0.00 19.32 ? 116 SER B O   1 
ATOM   2362  C CB  . SER B 1 98  ? 40.204  28.820  66.859  0.00 19.48 ? 116 SER B CB  1 
ATOM   2363  O OG  . SER B 1 98  ? 40.619  29.883  67.702  0.00 18.51 ? 116 SER B OG  1 
ATOM   2364  N N   . ARG B 1 99  ? 37.523  28.912  68.844  0.00 19.91 ? 117 ARG B N   1 
ATOM   2365  C CA  . ARG B 1 99  ? 36.887  28.385  70.045  0.00 20.35 ? 117 ARG B CA  1 
ATOM   2366  C C   . ARG B 1 99  ? 35.414  28.085  69.782  0.00 21.69 ? 117 ARG B C   1 
ATOM   2367  O O   . ARG B 1 99  ? 35.013  26.927  69.742  0.00 21.58 ? 117 ARG B O   1 
ATOM   2368  C CB  . ARG B 1 99  ? 37.038  29.376  71.200  0.00 19.49 ? 117 ARG B CB  1 
ATOM   2369  C CG  . ARG B 1 99  ? 38.482  29.755  71.500  0.00 18.53 ? 117 ARG B CG  1 
ATOM   2370  C CD  . ARG B 1 99  ? 39.315  28.534  71.858  0.00 17.53 ? 117 ARG B CD  1 
ATOM   2371  N NE  . ARG B 1 99  ? 40.715  28.876  72.098  0.00 17.00 ? 117 ARG B NE  1 
ATOM   2372  C CZ  . ARG B 1 99  ? 41.667  27.990  72.373  0.00 16.52 ? 117 ARG B CZ  1 
ATOM   2373  N NH1 . ARG B 1 99  ? 41.381  26.696  72.446  0.00 16.44 ? 117 ARG B NH1 1 
ATOM   2374  N NH2 . ARG B 1 99  ? 42.911  28.400  72.580  0.00 16.56 ? 117 ARG B NH2 1 
ATOM   2375  N N   . VAL B 1 100 ? 34.611  29.132  69.636  1.00 23.19 ? 118 VAL B N   1 
ATOM   2376  C CA  . VAL B 1 100 ? 33.188  28.984  69.352  1.00 24.34 ? 118 VAL B CA  1 
ATOM   2377  C C   . VAL B 1 100 ? 33.067  29.039  67.836  1.00 24.27 ? 118 VAL B C   1 
ATOM   2378  O O   . VAL B 1 100 ? 33.461  30.035  67.211  1.00 26.13 ? 118 VAL B O   1 
ATOM   2379  C CB  . VAL B 1 100 ? 32.358  30.180  69.908  1.00 26.60 ? 118 VAL B CB  1 
ATOM   2380  C CG1 . VAL B 1 100 ? 30.872  29.869  69.843  1.00 26.69 ? 118 VAL B CG1 1 
ATOM   2381  C CG2 . VAL B 1 100 ? 32.783  30.535  71.325  1.00 27.83 ? 118 VAL B CG2 1 
ATOM   2382  N N   . ALA B 1 101 ? 32.531  27.992  67.233  1.00 21.67 ? 119 ALA B N   1 
ATOM   2383  C CA  . ALA B 1 101 ? 32.380  28.004  65.788  1.00 22.70 ? 119 ALA B CA  1 
ATOM   2384  C C   . ALA B 1 101 ? 31.036  27.420  65.411  1.00 22.16 ? 119 ALA B C   1 
ATOM   2385  O O   . ALA B 1 101 ? 30.481  26.611  66.151  1.00 23.85 ? 119 ALA B O   1 
ATOM   2386  C CB  . ALA B 1 101 ? 33.506  27.238  65.127  1.00 25.21 ? 119 ALA B CB  1 
ATOM   2387  N N   . SER B 1 102 ? 30.502  27.852  64.277  1.00 19.31 ? 120 SER B N   1 
ATOM   2388  C CA  . SER B 1 102 ? 29.217  27.379  63.808  1.00 17.64 ? 120 SER B CA  1 
ATOM   2389  C C   . SER B 1 102 ? 29.359  26.061  63.089  1.00 18.28 ? 120 SER B C   1 
ATOM   2390  O O   . SER B 1 102 ? 30.396  25.813  62.489  1.00 20.29 ? 120 SER B O   1 
ATOM   2391  C CB  . SER B 1 102 ? 28.628  28.388  62.840  1.00 21.08 ? 120 SER B CB  1 
ATOM   2392  O OG  . SER B 1 102 ? 29.440  28.513  61.683  1.00 22.43 ? 120 SER B OG  1 
ATOM   2393  N N   . ILE B 1 103 ? 28.318  25.224  63.165  1.00 19.34 ? 121 ILE B N   1 
ATOM   2394  C CA  . ILE B 1 103 ? 28.263  23.917  62.493  1.00 15.20 ? 121 ILE B CA  1 
ATOM   2395  C C   . ILE B 1 103 ? 27.461  24.159  61.219  1.00 13.57 ? 121 ILE B C   1 
ATOM   2396  O O   . ILE B 1 103 ? 26.645  25.059  61.175  1.00 15.47 ? 121 ILE B O   1 
ATOM   2397  C CB  . ILE B 1 103 ? 27.587  22.834  63.379  1.00 12.13 ? 121 ILE B CB  1 
ATOM   2398  C CG1 . ILE B 1 103 ? 27.477  21.526  62.614  1.00 14.44 ? 121 ILE B CG1 1 
ATOM   2399  C CG2 . ILE B 1 103 ? 26.216  23.257  63.801  1.00 9.79  ? 121 ILE B CG2 1 
ATOM   2400  C CD1 . ILE B 1 103 ? 28.791  20.963  62.165  1.00 13.81 ? 121 ILE B CD1 1 
ATOM   2401  N N   . SER B 1 104 ? 27.702  23.397  60.171  1.00 13.34 ? 122 SER B N   1 
ATOM   2402  C CA  . SER B 1 104 ? 26.987  23.637  58.926  1.00 14.21 ? 122 SER B CA  1 
ATOM   2403  C C   . SER B 1 104 ? 25.698  22.861  58.843  1.00 13.98 ? 122 SER B C   1 
ATOM   2404  O O   . SER B 1 104 ? 25.565  21.785  59.443  1.00 12.98 ? 122 SER B O   1 
ATOM   2405  C CB  . SER B 1 104 ? 27.858  23.260  57.730  1.00 17.64 ? 122 SER B CB  1 
ATOM   2406  O OG  . SER B 1 104 ? 29.127  23.881  57.816  1.00 24.91 ? 122 SER B OG  1 
ATOM   2407  N N   . LEU B 1 105 ? 24.734  23.430  58.125  1.00 13.43 ? 123 LEU B N   1 
ATOM   2408  C CA  . LEU B 1 105 ? 23.455  22.761  57.914  1.00 13.89 ? 123 LEU B CA  1 
ATOM   2409  C C   . LEU B 1 105 ? 23.680  21.787  56.774  1.00 15.43 ? 123 LEU B C   1 
ATOM   2410  O O   . LEU B 1 105 ? 24.594  21.956  55.970  1.00 13.86 ? 123 LEU B O   1 
ATOM   2411  C CB  . LEU B 1 105 ? 22.347  23.747  57.536  1.00 11.05 ? 123 LEU B CB  1 
ATOM   2412  C CG  . LEU B 1 105 ? 21.831  24.650  58.661  1.00 15.42 ? 123 LEU B CG  1 
ATOM   2413  C CD1 . LEU B 1 105 ? 20.736  25.538  58.082  1.00 18.81 ? 123 LEU B CD1 1 
ATOM   2414  C CD2 . LEU B 1 105 ? 21.303  23.844  59.865  1.00 13.58 ? 123 LEU B CD2 1 
ATOM   2415  N N   . PRO B 1 106 ? 22.902  20.712  56.736  1.00 14.85 ? 124 PRO B N   1 
ATOM   2416  C CA  . PRO B 1 106 ? 23.019  19.704  55.688  1.00 22.87 ? 124 PRO B CA  1 
ATOM   2417  C C   . PRO B 1 106 ? 22.300  20.124  54.399  1.00 30.01 ? 124 PRO B C   1 
ATOM   2418  O O   . PRO B 1 106 ? 21.438  21.015  54.403  1.00 30.85 ? 124 PRO B O   1 
ATOM   2419  C CB  . PRO B 1 106 ? 22.331  18.517  56.318  1.00 19.42 ? 124 PRO B CB  1 
ATOM   2420  C CG  . PRO B 1 106 ? 21.210  19.187  57.022  1.00 18.92 ? 124 PRO B CG  1 
ATOM   2421  C CD  . PRO B 1 106 ? 21.892  20.320  57.724  1.00 15.12 ? 124 PRO B CD  1 
ATOM   2422  N N   . THR B 1 107 ? 22.682  19.495  53.290  1.00 36.85 ? 125 THR B N   1 
ATOM   2423  C CA  . THR B 1 107 ? 22.063  19.775  51.996  1.00 41.88 ? 125 THR B CA  1 
ATOM   2424  C C   . THR B 1 107 ? 21.276  18.539  51.572  1.00 41.99 ? 125 THR B C   1 
ATOM   2425  O O   . THR B 1 107 ? 20.323  18.629  50.792  1.00 41.74 ? 125 THR B O   1 
ATOM   2426  C CB  . THR B 1 107 ? 23.112  20.109  50.921  1.00 42.59 ? 125 THR B CB  1 
ATOM   2427  O OG1 . THR B 1 107 ? 24.056  19.031  50.803  1.00 44.69 ? 125 THR B OG1 1 
ATOM   2428  C CG2 . THR B 1 107 ? 23.847  21.377  51.292  1.00 45.28 ? 125 THR B CG2 1 
ATOM   2429  N N   . SER B 1 108 ? 21.689  17.385  52.098  1.00 41.57 ? 127 SER B N   1 
ATOM   2430  C CA  . SER B 1 108 ? 21.043  16.103  51.816  1.00 40.27 ? 127 SER B CA  1 
ATOM   2431  C C   . SER B 1 108 ? 21.076  15.296  53.109  1.00 36.58 ? 127 SER B C   1 
ATOM   2432  O O   . SER B 1 108 ? 22.013  15.437  53.895  1.00 38.97 ? 127 SER B O   1 
ATOM   2433  C CB  . SER B 1 108 ? 21.801  15.358  50.719  1.00 43.81 ? 127 SER B CB  1 
ATOM   2434  O OG  . SER B 1 108 ? 22.067  16.224  49.626  1.00 50.48 ? 127 SER B OG  1 
ATOM   2435  N N   . CYS B 1 109 ? 20.046  14.485  53.338  1.00 32.32 ? 128 CYS B N   1 
ATOM   2436  C CA  . CYS B 1 109 ? 19.942  13.663  54.544  1.00 28.94 ? 128 CYS B CA  1 
ATOM   2437  C C   . CYS B 1 109 ? 20.931  12.522  54.588  1.00 25.53 ? 128 CYS B C   1 
ATOM   2438  O O   . CYS B 1 109 ? 21.183  11.874  53.577  1.00 25.95 ? 128 CYS B O   1 
ATOM   2439  C CB  . CYS B 1 109 ? 18.540  13.082  54.669  1.00 32.52 ? 128 CYS B CB  1 
ATOM   2440  S SG  . CYS B 1 109 ? 17.211  14.327  54.607  1.00 35.51 ? 128 CYS B SG  1 
ATOM   2441  N N   . ALA B 1 110 ? 21.429  12.229  55.781  1.00 24.63 ? 129 ALA B N   1 
ATOM   2442  C CA  . ALA B 1 110 ? 22.403  11.161  55.956  1.00 28.29 ? 129 ALA B CA  1 
ATOM   2443  C C   . ALA B 1 110 ? 21.773  9.793   55.732  1.00 30.09 ? 129 ALA B C   1 
ATOM   2444  O O   . ALA B 1 110 ? 20.718  9.489   56.287  1.00 28.07 ? 129 ALA B O   1 
ATOM   2445  C CB  . ALA B 1 110 ? 23.024  11.240  57.333  1.00 29.62 ? 129 ALA B CB  1 
ATOM   2446  N N   . SER B 1 111 ? 22.413  8.982   54.897  1.00 32.30 ? 130 SER B N   1 
ATOM   2447  C CA  . SER B 1 111 ? 21.921  7.641   54.591  1.00 31.42 ? 130 SER B CA  1 
ATOM   2448  C C   . SER B 1 111 ? 22.179  6.757   55.797  1.00 31.89 ? 130 SER B C   1 
ATOM   2449  O O   . SER B 1 111 ? 23.183  6.942   56.490  1.00 34.60 ? 130 SER B O   1 
ATOM   2450  C CB  . SER B 1 111 ? 22.657  7.077   53.374  0.00 28.94 ? 130 SER B CB  1 
ATOM   2451  O OG  . SER B 1 111 ? 22.436  7.877   52.224  0.00 28.75 ? 130 SER B OG  1 
ATOM   2452  N N   . ALA B 1 112 ? 21.278  5.815   56.064  1.00 31.19 ? 132 ALA B N   1 
ATOM   2453  C CA  . ALA B 1 112 ? 21.450  4.922   57.203  1.00 32.42 ? 132 ALA B CA  1 
ATOM   2454  C C   . ALA B 1 112 ? 22.838  4.303   57.107  1.00 34.80 ? 132 ALA B C   1 
ATOM   2455  O O   . ALA B 1 112 ? 23.326  4.013   56.013  1.00 36.91 ? 132 ALA B O   1 
ATOM   2456  C CB  . ALA B 1 112 ? 20.386  3.847   57.205  1.00 36.84 ? 132 ALA B CB  1 
ATOM   2457  N N   . GLY B 1 113 ? 23.491  4.142   58.247  1.00 35.39 ? 133 GLY B N   1 
ATOM   2458  C CA  . GLY B 1 113 ? 24.824  3.590   58.240  1.00 32.49 ? 133 GLY B CA  1 
ATOM   2459  C C   . GLY B 1 113 ? 25.840  4.672   58.512  1.00 28.32 ? 133 GLY B C   1 
ATOM   2460  O O   . GLY B 1 113 ? 26.925  4.358   58.999  1.00 31.47 ? 133 GLY B O   1 
ATOM   2461  N N   . THR B 1 114 ? 25.506  5.931   58.219  1.00 23.27 ? 134 THR B N   1 
ATOM   2462  C CA  . THR B 1 114 ? 26.434  7.036   58.467  1.00 23.93 ? 134 THR B CA  1 
ATOM   2463  C C   . THR B 1 114 ? 26.833  7.134   59.945  1.00 25.38 ? 134 THR B C   1 
ATOM   2464  O O   . THR B 1 114 ? 25.978  7.001   60.840  1.00 28.44 ? 134 THR B O   1 
ATOM   2465  C CB  . THR B 1 114 ? 25.850  8.409   58.072  1.00 24.62 ? 134 THR B CB  1 
ATOM   2466  O OG1 . THR B 1 114 ? 25.410  8.402   56.706  1.00 22.60 ? 134 THR B OG1 1 
ATOM   2467  C CG2 . THR B 1 114 ? 26.924  9.494   58.255  1.00 25.33 ? 134 THR B CG2 1 
ATOM   2468  N N   . GLN B 1 115 ? 28.123  7.368   60.193  1.00 23.07 ? 135 GLN B N   1 
ATOM   2469  C CA  . GLN B 1 115 ? 28.627  7.496   61.554  1.00 21.56 ? 135 GLN B CA  1 
ATOM   2470  C C   . GLN B 1 115 ? 28.586  8.983   61.946  1.00 18.15 ? 135 GLN B C   1 
ATOM   2471  O O   . GLN B 1 115 ? 28.998  9.833   61.164  1.00 20.85 ? 135 GLN B O   1 
ATOM   2472  C CB  . GLN B 1 115 ? 30.051  6.935   61.637  1.00 23.45 ? 135 GLN B CB  1 
ATOM   2473  C CG  . GLN B 1 115 ? 30.486  6.608   63.056  1.00 26.38 ? 135 GLN B CG  1 
ATOM   2474  C CD  . GLN B 1 115 ? 31.950  6.257   63.176  0.00 26.12 ? 135 GLN B CD  1 
ATOM   2475  O OE1 . GLN B 1 115 ? 32.716  6.982   63.805  0.00 26.51 ? 135 GLN B OE1 1 
ATOM   2476  N NE2 . GLN B 1 115 ? 32.346  5.133   62.595  0.00 26.67 ? 135 GLN B NE2 1 
ATOM   2477  N N   . CYS B 1 116 ? 28.056  9.294   63.125  1.00 13.08 ? 136 CYS B N   1 
ATOM   2478  C CA  . CYS B 1 116 ? 27.932  10.672  63.595  1.00 9.10  ? 136 CYS B CA  1 
ATOM   2479  C C   . CYS B 1 116 ? 28.440  10.868  65.014  1.00 9.64  ? 136 CYS B C   1 
ATOM   2480  O O   . CYS B 1 116 ? 28.727  9.914   65.733  1.00 12.12 ? 136 CYS B O   1 
ATOM   2481  C CB  . CYS B 1 116 ? 26.474  11.089  63.554  1.00 8.67  ? 136 CYS B CB  1 
ATOM   2482  S SG  . CYS B 1 116 ? 25.674  10.610  62.001  1.00 12.89 ? 136 CYS B SG  1 
ATOM   2483  N N   . LEU B 1 117 ? 28.542  12.122  65.421  1.00 9.03  ? 137 LEU B N   1 
ATOM   2484  C CA  . LEU B 1 117 ? 28.998  12.463  66.758  1.00 9.18  ? 137 LEU B CA  1 
ATOM   2485  C C   . LEU B 1 117 ? 27.869  13.201  67.496  1.00 13.02 ? 137 LEU B C   1 
ATOM   2486  O O   . LEU B 1 117 ? 27.360  14.240  67.025  1.00 12.29 ? 137 LEU B O   1 
ATOM   2487  C CB  . LEU B 1 117 ? 30.243  13.339  66.684  1.00 5.00  ? 137 LEU B CB  1 
ATOM   2488  C CG  . LEU B 1 117 ? 30.834  13.771  68.024  1.00 5.67  ? 137 LEU B CG  1 
ATOM   2489  C CD1 . LEU B 1 117 ? 31.242  12.569  68.811  1.00 5.00  ? 137 LEU B CD1 1 
ATOM   2490  C CD2 . LEU B 1 117 ? 32.026  14.681  67.831  1.00 7.41  ? 137 LEU B CD2 1 
ATOM   2491  N N   . ILE B 1 118 ? 27.419  12.591  68.595  1.00 13.25 ? 138 ILE B N   1 
ATOM   2492  C CA  . ILE B 1 118 ? 26.363  13.128  69.457  1.00 12.55 ? 138 ILE B CA  1 
ATOM   2493  C C   . ILE B 1 118 ? 27.111  13.650  70.689  1.00 13.20 ? 138 ILE B C   1 
ATOM   2494  O O   . ILE B 1 118 ? 28.067  13.001  71.148  1.00 15.32 ? 138 ILE B O   1 
ATOM   2495  C CB  . ILE B 1 118 ? 25.421  12.006  69.899  1.00 10.12 ? 138 ILE B CB  1 
ATOM   2496  C CG1 . ILE B 1 118 ? 24.903  11.268  68.675  1.00 9.51  ? 138 ILE B CG1 1 
ATOM   2497  C CG2 . ILE B 1 118 ? 24.263  12.565  70.704  1.00 11.21 ? 138 ILE B CG2 1 
ATOM   2498  C CD1 . ILE B 1 118 ? 24.190  10.009  69.004  1.00 11.46 ? 138 ILE B CD1 1 
ATOM   2499  N N   . SER B 1 119 ? 26.695  14.790  71.235  1.00 9.59  ? 139 SER B N   1 
ATOM   2500  C CA  . SER B 1 119 ? 27.412  15.336  72.375  1.00 9.80  ? 139 SER B CA  1 
ATOM   2501  C C   . SER B 1 119 ? 26.514  16.070  73.347  1.00 12.69 ? 139 SER B C   1 
ATOM   2502  O O   . SER B 1 119 ? 25.474  16.604  72.956  1.00 18.20 ? 139 SER B O   1 
ATOM   2503  C CB  . SER B 1 119 ? 28.524  16.285  71.880  1.00 11.87 ? 139 SER B CB  1 
ATOM   2504  O OG  . SER B 1 119 ? 28.038  17.368  71.086  1.00 7.19  ? 139 SER B OG  1 
ATOM   2505  N N   . GLY B 1 120 ? 26.936  16.170  74.601  1.00 11.32 ? 140 GLY B N   1 
ATOM   2506  C CA  . GLY B 1 120 ? 26.123  16.876  75.574  1.00 12.11 ? 140 GLY B CA  1 
ATOM   2507  C C   . GLY B 1 120 ? 26.651  16.770  76.988  1.00 13.02 ? 140 GLY B C   1 
ATOM   2508  O O   . GLY B 1 120 ? 27.686  16.144  77.212  1.00 15.49 ? 140 GLY B O   1 
ATOM   2509  N N   . TRP B 1 121 ? 25.966  17.409  77.935  1.00 10.64 ? 141 TRP B N   1 
ATOM   2510  C CA  . TRP B 1 121 ? 26.367  17.374  79.337  1.00 8.32  ? 141 TRP B CA  1 
ATOM   2511  C C   . TRP B 1 121 ? 25.341  16.600  80.132  1.00 8.99  ? 141 TRP B C   1 
ATOM   2512  O O   . TRP B 1 121 ? 25.285  16.693  81.356  1.00 8.52  ? 141 TRP B O   1 
ATOM   2513  C CB  . TRP B 1 121 ? 26.444  18.783  79.904  1.00 8.21  ? 141 TRP B CB  1 
ATOM   2514  C CG  . TRP B 1 121 ? 27.658  19.540  79.559  1.00 9.50  ? 141 TRP B CG  1 
ATOM   2515  C CD1 . TRP B 1 121 ? 28.861  19.483  80.193  1.00 13.05 ? 141 TRP B CD1 1 
ATOM   2516  C CD2 . TRP B 1 121 ? 27.776  20.557  78.564  1.00 10.94 ? 141 TRP B CD2 1 
ATOM   2517  N NE1 . TRP B 1 121 ? 29.720  20.418  79.667  1.00 15.20 ? 141 TRP B NE1 1 
ATOM   2518  C CE2 . TRP B 1 121 ? 29.075  21.094  78.665  1.00 11.20 ? 141 TRP B CE2 1 
ATOM   2519  C CE3 . TRP B 1 121 ? 26.907  21.075  77.600  1.00 10.26 ? 141 TRP B CE3 1 
ATOM   2520  C CZ2 . TRP B 1 121 ? 29.521  22.120  77.848  1.00 7.40  ? 141 TRP B CZ2 1 
ATOM   2521  C CZ3 . TRP B 1 121 ? 27.361  22.103  76.785  1.00 9.08  ? 141 TRP B CZ3 1 
ATOM   2522  C CH2 . TRP B 1 121 ? 28.651  22.611  76.918  1.00 5.00  ? 141 TRP B CH2 1 
ATOM   2523  N N   . GLY B 1 122 ? 24.496  15.871  79.419  1.00 11.22 ? 142 GLY B N   1 
ATOM   2524  C CA  . GLY B 1 122 ? 23.455  15.101  80.063  1.00 14.10 ? 142 GLY B CA  1 
ATOM   2525  C C   . GLY B 1 122 ? 23.961  13.958  80.907  1.00 15.35 ? 142 GLY B C   1 
ATOM   2526  O O   . GLY B 1 122 ? 25.144  13.626  80.897  1.00 18.05 ? 142 GLY B O   1 
ATOM   2527  N N   . ASN B 1 123 ? 23.032  13.337  81.616  1.00 16.54 ? 143 ASN B N   1 
ATOM   2528  C CA  . ASN B 1 123 ? 23.305  12.209  82.485  1.00 18.91 ? 143 ASN B CA  1 
ATOM   2529  C C   . ASN B 1 123 ? 24.151  11.189  81.748  1.00 23.78 ? 143 ASN B C   1 
ATOM   2530  O O   . ASN B 1 123 ? 24.067  11.060  80.517  1.00 23.49 ? 143 ASN B O   1 
ATOM   2531  C CB  . ASN B 1 123 ? 21.976  11.565  82.887  1.00 18.75 ? 143 ASN B CB  1 
ATOM   2532  C CG  . ASN B 1 123 ? 22.129  10.503  83.953  1.00 18.61 ? 143 ASN B CG  1 
ATOM   2533  O OD1 . ASN B 1 123 ? 23.200  10.349  84.545  1.00 16.71 ? 143 ASN B OD1 1 
ATOM   2534  N ND2 . ASN B 1 123 ? 21.040  9.790   84.239  1.00 18.28 ? 143 ASN B ND2 1 
ATOM   2535  N N   . THR B 1 124 ? 25.012  10.515  82.495  1.00 29.21 ? 144 THR B N   1 
ATOM   2536  C CA  . THR B 1 124 ? 25.868  9.484   81.936  1.00 31.22 ? 144 THR B CA  1 
ATOM   2537  C C   . THR B 1 124 ? 25.365  8.075   82.290  1.00 32.74 ? 144 THR B C   1 
ATOM   2538  O O   . THR B 1 124 ? 25.393  7.172   81.446  1.00 32.51 ? 144 THR B O   1 
ATOM   2539  C CB  . THR B 1 124 ? 27.338  9.672   82.395  1.00 32.32 ? 144 THR B CB  1 
ATOM   2540  O OG1 . THR B 1 124 ? 27.380  9.969   83.800  1.00 32.80 ? 144 THR B OG1 1 
ATOM   2541  C CG2 . THR B 1 124 ? 28.001  10.803  81.617  1.00 30.98 ? 144 THR B CG2 1 
ATOM   2542  N N   . LYS B 1 125 ? 24.873  7.900   83.517  1.00 34.21 ? 145 LYS B N   1 
ATOM   2543  C CA  . LYS B 1 125 ? 24.379  6.602   83.976  1.00 37.12 ? 145 LYS B CA  1 
ATOM   2544  C C   . LYS B 1 125 ? 23.056  6.184   83.381  1.00 39.39 ? 145 LYS B C   1 
ATOM   2545  O O   . LYS B 1 125 ? 22.161  6.992   83.192  1.00 39.36 ? 145 LYS B O   1 
ATOM   2546  C CB  . LYS B 1 125 ? 24.257  6.566   85.493  1.00 42.63 ? 145 LYS B CB  1 
ATOM   2547  C CG  . LYS B 1 125 ? 25.573  6.463   86.231  1.00 48.06 ? 145 LYS B CG  1 
ATOM   2548  C CD  . LYS B 1 125 ? 25.313  6.244   87.713  1.00 52.38 ? 145 LYS B CD  1 
ATOM   2549  C CE  . LYS B 1 125 ? 26.593  5.975   88.486  1.00 56.16 ? 145 LYS B CE  1 
ATOM   2550  N NZ  . LYS B 1 125 ? 26.313  5.726   89.940  1.00 58.79 ? 145 LYS B NZ  1 
ATOM   2551  N N   . SER B 1 126 ? 22.944  4.897   83.098  1.00 45.73 ? 146 SER B N   1 
ATOM   2552  C CA  . SER B 1 126 ? 21.726  4.325   82.534  1.00 51.36 ? 146 SER B CA  1 
ATOM   2553  C C   . SER B 1 126 ? 20.639  4.282   83.630  1.00 55.18 ? 146 SER B C   1 
ATOM   2554  O O   . SER B 1 126 ? 19.474  4.669   83.410  1.00 53.94 ? 146 SER B O   1 
ATOM   2555  C CB  . SER B 1 126 ? 22.027  2.914   82.013  1.00 49.88 ? 146 SER B CB  1 
ATOM   2556  O OG  . SER B 1 126 ? 22.775  2.166   82.960  0.00 51.74 ? 146 SER B OG  1 
ATOM   2557  N N   . SER B 1 127 ? 21.037  3.781   84.801  1.00 57.24 ? 147 SER B N   1 
ATOM   2558  C CA  . SER B 1 127 ? 20.164  3.683   85.972  1.00 56.31 ? 147 SER B CA  1 
ATOM   2559  C C   . SER B 1 127 ? 20.785  4.589   87.037  1.00 53.82 ? 147 SER B C   1 
ATOM   2560  O O   . SER B 1 127 ? 21.848  4.292   87.580  1.00 54.72 ? 147 SER B O   1 
ATOM   2561  C CB  . SER B 1 127 ? 20.104  2.236   86.478  1.00 57.30 ? 147 SER B CB  1 
ATOM   2562  O OG  . SER B 1 127 ? 19.808  1.337   85.421  0.00 58.79 ? 147 SER B OG  1 
ATOM   2563  N N   . GLY B 1 128 ? 20.141  5.715   87.297  1.00 51.26 ? 148 GLY B N   1 
ATOM   2564  C CA  . GLY B 1 128 ? 20.669  6.651   88.272  1.00 49.08 ? 148 GLY B CA  1 
ATOM   2565  C C   . GLY B 1 128 ? 21.096  7.931   87.571  1.00 46.87 ? 148 GLY B C   1 
ATOM   2566  O O   . GLY B 1 128 ? 21.329  7.945   86.366  1.00 48.30 ? 148 GLY B O   1 
ATOM   2567  N N   . THR B 1 129 ? 21.154  9.025   88.310  1.00 43.40 ? 149 THR B N   1 
ATOM   2568  C CA  . THR B 1 129 ? 21.545  10.281  87.722  1.00 41.03 ? 149 THR B CA  1 
ATOM   2569  C C   . THR B 1 129 ? 22.977  10.635  88.119  1.00 40.03 ? 149 THR B C   1 
ATOM   2570  O O   . THR B 1 129 ? 23.294  10.701  89.318  1.00 41.43 ? 149 THR B O   1 
ATOM   2571  C CB  . THR B 1 129 ? 20.597  11.412  88.163  0.00 40.64 ? 149 THR B CB  1 
ATOM   2572  O OG1 . THR B 1 129 ? 20.324  11.293  89.566  0.00 41.14 ? 149 THR B OG1 1 
ATOM   2573  C CG2 . THR B 1 129 ? 19.291  11.343  87.387  0.00 41.11 ? 149 THR B CG2 1 
ATOM   2574  N N   . SER B 1 130 ? 23.840  10.817  87.115  1.00 34.77 ? 150 SER B N   1 
ATOM   2575  C CA  . SER B 1 130 ? 25.229  11.207  87.311  1.00 27.58 ? 150 SER B CA  1 
ATOM   2576  C C   . SER B 1 130 ? 25.452  12.223  86.211  1.00 25.42 ? 150 SER B C   1 
ATOM   2577  O O   . SER B 1 130 ? 25.786  11.857  85.092  1.00 26.35 ? 150 SER B O   1 
ATOM   2578  C CB  . SER B 1 130 ? 26.158  10.003  87.142  0.00 27.76 ? 150 SER B CB  1 
ATOM   2579  O OG  . SER B 1 130 ? 27.507  10.349  87.408  0.00 26.27 ? 150 SER B OG  1 
ATOM   2580  N N   . TYR B 1 131 ? 25.142  13.487  86.485  1.00 23.13 ? 151 TYR B N   1 
ATOM   2581  C CA  . TYR B 1 131 ? 25.328  14.533  85.477  1.00 22.95 ? 151 TYR B CA  1 
ATOM   2582  C C   . TYR B 1 131 ? 26.772  15.060  85.441  1.00 22.64 ? 151 TYR B C   1 
ATOM   2583  O O   . TYR B 1 131 ? 27.270  15.646  86.420  1.00 18.35 ? 151 TYR B O   1 
ATOM   2584  C CB  . TYR B 1 131 ? 24.324  15.672  85.671  1.00 23.98 ? 151 TYR B CB  1 
ATOM   2585  C CG  . TYR B 1 131 ? 22.900  15.284  85.330  1.00 28.21 ? 151 TYR B CG  1 
ATOM   2586  C CD1 . TYR B 1 131 ? 22.444  15.292  84.005  1.00 28.40 ? 151 TYR B CD1 1 
ATOM   2587  C CD2 . TYR B 1 131 ? 22.011  14.883  86.335  1.00 30.76 ? 151 TYR B CD2 1 
ATOM   2588  C CE1 . TYR B 1 131 ? 21.133  14.906  83.696  1.00 30.09 ? 151 TYR B CE1 1 
ATOM   2589  C CE2 . TYR B 1 131 ? 20.704  14.497  86.037  1.00 30.19 ? 151 TYR B CE2 1 
ATOM   2590  C CZ  . TYR B 1 131 ? 20.270  14.507  84.719  1.00 30.11 ? 151 TYR B CZ  1 
ATOM   2591  O OH  . TYR B 1 131 ? 18.982  14.099  84.436  1.00 29.10 ? 151 TYR B OH  1 
ATOM   2592  N N   . PRO B 1 132 ? 27.477  14.804  84.320  1.00 21.44 ? 152 PRO B N   1 
ATOM   2593  C CA  . PRO B 1 132 ? 28.868  15.226  84.117  1.00 24.07 ? 152 PRO B CA  1 
ATOM   2594  C C   . PRO B 1 132 ? 29.095  16.719  84.069  1.00 26.13 ? 152 PRO B C   1 
ATOM   2595  O O   . PRO B 1 132 ? 28.200  17.480  83.726  1.00 25.72 ? 152 PRO B O   1 
ATOM   2596  C CB  . PRO B 1 132 ? 29.232  14.567  82.790  1.00 23.64 ? 152 PRO B CB  1 
ATOM   2597  C CG  . PRO B 1 132 ? 27.911  14.489  82.080  1.00 21.96 ? 152 PRO B CG  1 
ATOM   2598  C CD  . PRO B 1 132 ? 26.992  14.027  83.163  1.00 18.74 ? 152 PRO B CD  1 
ATOM   2599  N N   . ASP B 1 133 ? 30.305  17.123  84.433  1.00 30.80 ? 153 ASP B N   1 
ATOM   2600  C CA  . ASP B 1 133 ? 30.687  18.526  84.427  1.00 36.24 ? 153 ASP B CA  1 
ATOM   2601  C C   . ASP B 1 133 ? 31.249  18.878  83.070  1.00 32.72 ? 153 ASP B C   1 
ATOM   2602  O O   . ASP B 1 133 ? 31.105  20.009  82.598  1.00 32.02 ? 153 ASP B O   1 
ATOM   2603  C CB  . ASP B 1 133 ? 31.759  18.798  85.485  1.00 44.57 ? 153 ASP B CB  1 
ATOM   2604  C CG  . ASP B 1 133 ? 31.182  19.310  86.781  1.00 55.19 ? 153 ASP B CG  1 
ATOM   2605  O OD1 . ASP B 1 133 ? 31.625  20.384  87.241  1.00 61.10 ? 153 ASP B OD1 1 
ATOM   2606  O OD2 . ASP B 1 133 ? 30.288  18.643  87.343  1.00 62.12 ? 153 ASP B OD2 1 
ATOM   2607  N N   . VAL B 1 134 ? 31.918  17.900  82.464  1.00 28.10 ? 154 VAL B N   1 
ATOM   2608  C CA  . VAL B 1 134 ? 32.556  18.087  81.167  1.00 23.97 ? 154 VAL B CA  1 
ATOM   2609  C C   . VAL B 1 134 ? 31.736  17.549  80.018  1.00 22.97 ? 154 VAL B C   1 
ATOM   2610  O O   . VAL B 1 134 ? 30.938  16.620  80.191  1.00 24.73 ? 154 VAL B O   1 
ATOM   2611  C CB  . VAL B 1 134 ? 33.946  17.434  81.125  1.00 18.77 ? 154 VAL B CB  1 
ATOM   2612  C CG1 . VAL B 1 134 ? 34.878  18.181  82.043  1.00 17.59 ? 154 VAL B CG1 1 
ATOM   2613  C CG2 . VAL B 1 134 ? 33.859  15.984  81.541  1.00 12.26 ? 154 VAL B CG2 1 
ATOM   2614  N N   . LEU B 1 135 ? 31.947  18.136  78.847  1.00 18.71 ? 155 LEU B N   1 
ATOM   2615  C CA  . LEU B 1 135 ? 31.242  17.730  77.652  1.00 14.61 ? 155 LEU B CA  1 
ATOM   2616  C C   . LEU B 1 135 ? 31.681  16.340  77.281  1.00 14.57 ? 155 LEU B C   1 
ATOM   2617  O O   . LEU B 1 135 ? 32.883  16.086  77.221  1.00 15.12 ? 155 LEU B O   1 
ATOM   2618  C CB  . LEU B 1 135 ? 31.593  18.647  76.495  1.00 11.70 ? 155 LEU B CB  1 
ATOM   2619  C CG  . LEU B 1 135 ? 30.768  18.352  75.246  1.00 9.28  ? 155 LEU B CG  1 
ATOM   2620  C CD1 . LEU B 1 135 ? 29.318  18.799  75.472  1.00 7.58  ? 155 LEU B CD1 1 
ATOM   2621  C CD2 . LEU B 1 135 ? 31.377  19.064  74.059  1.00 8.05  ? 155 LEU B CD2 1 
ATOM   2622  N N   . LYS B 1 136 ? 30.706  15.466  77.024  1.00 14.92 ? 156 LYS B N   1 
ATOM   2623  C CA  . LYS B 1 136 ? 30.932  14.075  76.623  1.00 13.32 ? 156 LYS B CA  1 
ATOM   2624  C C   . LYS B 1 136 ? 30.572  13.914  75.140  1.00 14.22 ? 156 LYS B C   1 
ATOM   2625  O O   . LYS B 1 136 ? 29.682  14.607  74.625  1.00 17.13 ? 156 LYS B O   1 
ATOM   2626  C CB  . LYS B 1 136 ? 30.057  13.144  77.456  1.00 11.17 ? 156 LYS B CB  1 
ATOM   2627  C CG  . LYS B 1 136 ? 30.314  13.285  78.926  1.00 13.10 ? 156 LYS B CG  1 
ATOM   2628  C CD  . LYS B 1 136 ? 31.690  12.782  79.262  1.00 15.54 ? 156 LYS B CD  1 
ATOM   2629  C CE  . LYS B 1 136 ? 31.985  12.969  80.728  1.00 18.16 ? 156 LYS B CE  1 
ATOM   2630  N NZ  . LYS B 1 136 ? 33.258  12.333  81.155  1.00 17.72 ? 156 LYS B NZ  1 
ATOM   2631  N N   . CYS B 1 137 ? 31.271  13.019  74.457  1.00 10.65 ? 157 CYS B N   1 
ATOM   2632  C CA  . CYS B 1 137 ? 31.024  12.756  73.058  1.00 7.52  ? 157 CYS B CA  1 
ATOM   2633  C C   . CYS B 1 137 ? 30.694  11.293  72.870  1.00 9.61  ? 157 CYS B C   1 
ATOM   2634  O O   . CYS B 1 137 ? 31.055  10.455  73.694  1.00 7.90  ? 157 CYS B O   1 
ATOM   2635  C CB  . CYS B 1 137 ? 32.252  13.092  72.249  1.00 8.32  ? 157 CYS B CB  1 
ATOM   2636  S SG  . CYS B 1 137 ? 32.474  14.859  71.981  1.00 9.94  ? 157 CYS B SG  1 
ATOM   2637  N N   . LEU B 1 138 ? 29.979  10.988  71.799  1.00 11.05 ? 158 LEU B N   1 
ATOM   2638  C CA  . LEU B 1 138 ? 29.613  9.617   71.503  1.00 14.42 ? 158 LEU B CA  1 
ATOM   2639  C C   . LEU B 1 138 ? 29.524  9.435   70.001  1.00 18.17 ? 158 LEU B C   1 
ATOM   2640  O O   . LEU B 1 138 ? 28.855  10.223  69.315  1.00 19.13 ? 158 LEU B O   1 
ATOM   2641  C CB  . LEU B 1 138 ? 28.264  9.264   72.138  1.00 15.40 ? 158 LEU B CB  1 
ATOM   2642  C CG  . LEU B 1 138 ? 27.723  7.859   71.837  1.00 14.66 ? 158 LEU B CG  1 
ATOM   2643  C CD1 . LEU B 1 138 ? 28.744  6.817   72.281  1.00 16.04 ? 158 LEU B CD1 1 
ATOM   2644  C CD2 . LEU B 1 138 ? 26.396  7.622   72.527  1.00 12.45 ? 158 LEU B CD2 1 
ATOM   2645  N N   . LYS B 1 139 ? 30.270  8.455   69.490  1.00 19.60 ? 159 LYS B N   1 
ATOM   2646  C CA  . LYS B 1 139 ? 30.263  8.139   68.067  1.00 20.14 ? 159 LYS B CA  1 
ATOM   2647  C C   . LYS B 1 139 ? 29.130  7.138   67.972  1.00 20.78 ? 159 LYS B C   1 
ATOM   2648  O O   . LYS B 1 139 ? 29.031  6.258   68.836  1.00 20.81 ? 159 LYS B O   1 
ATOM   2649  C CB  . LYS B 1 139 ? 31.571  7.467   67.656  0.00 21.27 ? 159 LYS B CB  1 
ATOM   2650  C CG  . LYS B 1 139 ? 32.792  8.319   67.891  0.00 22.57 ? 159 LYS B CG  1 
ATOM   2651  C CD  . LYS B 1 139 ? 32.785  9.537   66.991  0.00 23.84 ? 159 LYS B CD  1 
ATOM   2652  C CE  . LYS B 1 139 ? 33.854  10.513  67.412  0.00 24.32 ? 159 LYS B CE  1 
ATOM   2653  N NZ  . LYS B 1 139 ? 35.144  9.823   67.628  0.00 24.39 ? 159 LYS B NZ  1 
ATOM   2654  N N   . ALA B 1 140 ? 28.263  7.293   66.969  1.00 19.27 ? 160 ALA B N   1 
ATOM   2655  C CA  . ALA B 1 140 ? 27.112  6.402   66.771  1.00 16.35 ? 160 ALA B CA  1 
ATOM   2656  C C   . ALA B 1 140 ? 26.623  6.456   65.334  1.00 10.50 ? 160 ALA B C   1 
ATOM   2657  O O   . ALA B 1 140 ? 26.700  7.477   64.681  1.00 12.52 ? 160 ALA B O   1 
ATOM   2658  C CB  . ALA B 1 140 ? 25.960  6.785   67.732  1.00 18.21 ? 160 ALA B CB  1 
ATOM   2659  N N   . PRO B 1 141 ? 26.136  5.342   64.810  1.00 6.94  ? 161 PRO B N   1 
ATOM   2660  C CA  . PRO B 1 141 ? 25.659  5.364   63.435  1.00 7.08  ? 161 PRO B CA  1 
ATOM   2661  C C   . PRO B 1 141 ? 24.199  5.678   63.352  1.00 10.28 ? 161 PRO B C   1 
ATOM   2662  O O   . PRO B 1 141 ? 23.471  5.591   64.345  1.00 13.54 ? 161 PRO B O   1 
ATOM   2663  C CB  . PRO B 1 141 ? 25.871  3.935   62.997  1.00 8.36  ? 161 PRO B CB  1 
ATOM   2664  C CG  . PRO B 1 141 ? 25.500  3.177   64.222  1.00 8.04  ? 161 PRO B CG  1 
ATOM   2665  C CD  . PRO B 1 141 ? 26.187  3.967   65.324  1.00 8.43  ? 161 PRO B CD  1 
ATOM   2666  N N   . ILE B 1 142 ? 23.765  6.014   62.150  1.00 12.47 ? 162 ILE B N   1 
ATOM   2667  C CA  . ILE B 1 142 ? 22.360  6.284   61.892  1.00 15.09 ? 162 ILE B CA  1 
ATOM   2668  C C   . ILE B 1 142 ? 21.694  4.930   61.582  1.00 19.96 ? 162 ILE B C   1 
ATOM   2669  O O   . ILE B 1 142 ? 22.118  4.225   60.657  1.00 23.33 ? 162 ILE B O   1 
ATOM   2670  C CB  . ILE B 1 142 ? 22.231  7.241   60.714  1.00 10.29 ? 162 ILE B CB  1 
ATOM   2671  C CG1 . ILE B 1 142 ? 22.561  8.659   61.199  1.00 9.77  ? 162 ILE B CG1 1 
ATOM   2672  C CG2 . ILE B 1 142 ? 20.874  7.087   60.043  1.00 8.20  ? 162 ILE B CG2 1 
ATOM   2673  C CD1 . ILE B 1 142 ? 22.622  9.709   60.125  1.00 5.63  ? 162 ILE B CD1 1 
ATOM   2674  N N   . LEU B 1 143 ? 20.715  4.525   62.391  1.00 20.93 ? 163 LEU B N   1 
ATOM   2675  C CA  . LEU B 1 143 ? 20.042  3.244   62.162  1.00 22.33 ? 163 LEU B CA  1 
ATOM   2676  C C   . LEU B 1 143 ? 19.087  3.347   60.975  1.00 24.90 ? 163 LEU B C   1 
ATOM   2677  O O   . LEU B 1 143 ? 18.743  4.443   60.510  1.00 23.97 ? 163 LEU B O   1 
ATOM   2678  C CB  . LEU B 1 143 ? 19.262  2.770   63.400  1.00 19.33 ? 163 LEU B CB  1 
ATOM   2679  C CG  . LEU B 1 143 ? 19.901  2.829   64.791  1.00 19.50 ? 163 LEU B CG  1 
ATOM   2680  C CD1 . LEU B 1 143 ? 19.056  1.970   65.723  1.00 17.02 ? 163 LEU B CD1 1 
ATOM   2681  C CD2 . LEU B 1 143 ? 21.353  2.340   64.792  1.00 18.50 ? 163 LEU B CD2 1 
ATOM   2682  N N   . SER B 1 144 ? 18.656  2.191   60.495  1.00 28.77 ? 164 SER B N   1 
ATOM   2683  C CA  . SER B 1 144 ? 17.737  2.120   59.372  1.00 31.60 ? 164 SER B CA  1 
ATOM   2684  C C   . SER B 1 144 ? 16.321  2.472   59.806  1.00 30.85 ? 164 SER B C   1 
ATOM   2685  O O   . SER B 1 144 ? 15.822  1.953   60.817  1.00 31.55 ? 164 SER B O   1 
ATOM   2686  C CB  . SER B 1 144 ? 17.766  0.708   58.785  1.00 35.25 ? 164 SER B CB  1 
ATOM   2687  O OG  . SER B 1 144 ? 17.800  -0.287  59.810  1.00 35.43 ? 164 SER B OG  1 
ATOM   2688  N N   . ASP B 1 145 ? 15.675  3.342   59.036  0.00 30.38 ? 165 ASP B N   1 
ATOM   2689  C CA  . ASP B 1 145 ? 14.305  3.771   59.313  0.00 32.74 ? 165 ASP B CA  1 
ATOM   2690  C C   . ASP B 1 145 ? 13.457  2.576   59.749  0.00 37.02 ? 165 ASP B C   1 
ATOM   2691  O O   . ASP B 1 145 ? 12.551  2.707   60.570  0.00 36.55 ? 165 ASP B O   1 
ATOM   2692  C CB  . ASP B 1 145 ? 13.704  4.421   58.062  0.00 29.21 ? 165 ASP B CB  1 
ATOM   2693  C CG  . ASP B 1 145 ? 12.283  4.906   58.276  0.00 25.85 ? 165 ASP B CG  1 
ATOM   2694  O OD1 . ASP B 1 145 ? 12.060  5.735   59.183  0.00 22.68 ? 165 ASP B OD1 1 
ATOM   2695  O OD2 . ASP B 1 145 ? 11.388  4.457   57.529  0.00 22.75 ? 165 ASP B OD2 1 
ATOM   2696  N N   . SER B 1 146 ? 13.826  1.401   59.251  1.00 40.63 ? 166 SER B N   1 
ATOM   2697  C CA  . SER B 1 146 ? 13.136  0.148   59.563  1.00 40.15 ? 166 SER B CA  1 
ATOM   2698  C C   . SER B 1 146 ? 13.334  -0.259  61.026  1.00 39.03 ? 166 SER B C   1 
ATOM   2699  O O   . SER B 1 146 ? 12.348  -0.412  61.775  1.00 38.31 ? 166 SER B O   1 
ATOM   2700  C CB  . SER B 1 146 ? 13.603  -0.972  58.618  1.00 36.13 ? 166 SER B CB  1 
ATOM   2701  O OG  . SER B 1 146 ? 15.005  -0.897  58.408  0.00 37.98 ? 166 SER B OG  1 
ATOM   2702  N N   . SER B 1 147 ? 14.594  -0.425  61.436  1.00 36.39 ? 167 SER B N   1 
ATOM   2703  C CA  . SER B 1 147 ? 14.893  -0.809  62.814  1.00 34.92 ? 167 SER B CA  1 
ATOM   2704  C C   . SER B 1 147 ? 14.285  0.256   63.733  1.00 33.42 ? 167 SER B C   1 
ATOM   2705  O O   . SER B 1 147 ? 13.739  -0.033  64.809  1.00 36.73 ? 167 SER B O   1 
ATOM   2706  C CB  . SER B 1 147 ? 16.404  -0.901  63.025  1.00 37.61 ? 167 SER B CB  1 
ATOM   2707  O OG  . SER B 1 147 ? 17.013  -1.660  61.996  1.00 40.89 ? 167 SER B OG  1 
ATOM   2708  N N   . CYS B 1 148 ? 14.308  1.490   63.257  1.00 30.32 ? 168 CYS B N   1 
ATOM   2709  C CA  . CYS B 1 148 ? 13.768  2.591   64.030  1.00 26.85 ? 168 CYS B CA  1 
ATOM   2710  C C   . CYS B 1 148 ? 12.299  2.331   64.293  1.00 23.84 ? 168 CYS B C   1 
ATOM   2711  O O   . CYS B 1 148 ? 11.900  2.058   65.429  1.00 20.88 ? 168 CYS B O   1 
ATOM   2712  C CB  . CYS B 1 148 ? 13.940  3.888   63.251  1.00 26.27 ? 168 CYS B CB  1 
ATOM   2713  S SG  . CYS B 1 148 ? 13.804  5.373   64.275  1.00 20.45 ? 168 CYS B SG  1 
ATOM   2714  N N   . LYS B 1 149 ? 11.528  2.321   63.209  1.00 22.71 ? 169 LYS B N   1 
ATOM   2715  C CA  . LYS B 1 149 ? 10.090  2.093   63.265  1.00 24.07 ? 169 LYS B CA  1 
ATOM   2716  C C   . LYS B 1 149 ? 9.712   0.823   64.041  1.00 25.69 ? 169 LYS B C   1 
ATOM   2717  O O   . LYS B 1 149 ? 8.724   0.810   64.809  1.00 22.37 ? 169 LYS B O   1 
ATOM   2718  C CB  . LYS B 1 149 ? 9.499   2.064   61.851  1.00 21.28 ? 169 LYS B CB  1 
ATOM   2719  C CG  . LYS B 1 149 ? 9.312   3.453   61.245  1.00 22.09 ? 169 LYS B CG  1 
ATOM   2720  C CD  . LYS B 1 149 ? 8.829   3.394   59.797  1.00 23.43 ? 169 LYS B CD  1 
ATOM   2721  C CE  . LYS B 1 149 ? 8.547   4.778   59.227  0.00 22.54 ? 169 LYS B CE  1 
ATOM   2722  N NZ  . LYS B 1 149 ? 7.415   5.468   59.902  0.00 22.91 ? 169 LYS B NZ  1 
ATOM   2723  N N   . SER B 1 150 ? 10.492  -0.238  63.849  1.00 26.34 ? 170 SER B N   1 
ATOM   2724  C CA  . SER B 1 150 ? 10.213  -1.473  64.555  1.00 27.02 ? 170 SER B CA  1 
ATOM   2725  C C   . SER B 1 150 ? 10.368  -1.252  66.064  1.00 28.82 ? 170 SER B C   1 
ATOM   2726  O O   . SER B 1 150 ? 9.520   -1.685  66.849  1.00 31.45 ? 170 SER B O   1 
ATOM   2727  C CB  . SER B 1 150 ? 11.111  -2.608  64.056  1.00 23.51 ? 170 SER B CB  1 
ATOM   2728  O OG  . SER B 1 150 ? 12.471  -2.230  64.046  0.00 24.62 ? 170 SER B OG  1 
ATOM   2729  N N   . ALA B 1 151 ? 11.404  -0.518  66.458  1.00 28.55 ? 171 ALA B N   1 
ATOM   2730  C CA  . ALA B 1 151 ? 11.643  -0.257  67.870  1.00 30.81 ? 171 ALA B CA  1 
ATOM   2731  C C   . ALA B 1 151 ? 10.534  0.609   68.477  1.00 32.48 ? 171 ALA B C   1 
ATOM   2732  O O   . ALA B 1 151 ? 10.078  0.359   69.605  1.00 33.83 ? 171 ALA B O   1 
ATOM   2733  C CB  . ALA B 1 151 ? 12.990  0.404   68.047  1.00 31.69 ? 171 ALA B CB  1 
ATOM   2734  N N   . TYR B 1 152 ? 10.117  1.630   67.727  1.00 30.93 ? 172 TYR B N   1 
ATOM   2735  C CA  . TYR B 1 152 ? 9.059   2.550   68.158  1.00 29.23 ? 172 TYR B CA  1 
ATOM   2736  C C   . TYR B 1 152 ? 7.925   2.558   67.122  1.00 30.55 ? 172 TYR B C   1 
ATOM   2737  O O   . TYR B 1 152 ? 7.723   3.536   66.380  1.00 27.61 ? 172 TYR B O   1 
ATOM   2738  C CB  . TYR B 1 152 ? 9.614   3.973   68.355  1.00 24.05 ? 172 TYR B CB  1 
ATOM   2739  C CG  . TYR B 1 152 ? 10.778  4.048   69.301  1.00 16.70 ? 172 TYR B CG  1 
ATOM   2740  C CD1 . TYR B 1 152 ? 12.072  4.115   68.822  1.00 12.29 ? 172 TYR B CD1 1 
ATOM   2741  C CD2 . TYR B 1 152 ? 10.576  4.006   70.686  1.00 17.09 ? 172 TYR B CD2 1 
ATOM   2742  C CE1 . TYR B 1 152 ? 13.154  4.125   69.693  1.00 15.99 ? 172 TYR B CE1 1 
ATOM   2743  C CE2 . TYR B 1 152 ? 11.640  4.023   71.573  1.00 17.61 ? 172 TYR B CE2 1 
ATOM   2744  C CZ  . TYR B 1 152 ? 12.938  4.075   71.077  1.00 18.14 ? 172 TYR B CZ  1 
ATOM   2745  O OH  . TYR B 1 152 ? 14.001  4.030   71.970  1.00 15.62 ? 172 TYR B OH  1 
ATOM   2746  N N   . PRO B 1 153 ? 7.110   1.499   67.133  1.00 33.43 ? 173 PRO B N   1 
ATOM   2747  C CA  . PRO B 1 153 ? 5.967   1.284   66.238  1.00 34.54 ? 173 PRO B CA  1 
ATOM   2748  C C   . PRO B 1 153 ? 5.096   2.503   65.904  1.00 33.66 ? 173 PRO B C   1 
ATOM   2749  O O   . PRO B 1 153 ? 4.409   3.060   66.773  1.00 29.55 ? 173 PRO B O   1 
ATOM   2750  C CB  . PRO B 1 153 ? 5.164   0.210   66.978  1.00 34.91 ? 173 PRO B CB  1 
ATOM   2751  C CG  . PRO B 1 153 ? 5.553   0.431   68.439  1.00 32.94 ? 173 PRO B CG  1 
ATOM   2752  C CD  . PRO B 1 153 ? 7.034   0.581   68.281  1.00 32.50 ? 173 PRO B CD  1 
ATOM   2753  N N   . GLY B 1 154 ? 5.135   2.896   64.633  0.00 34.31 ? 174 GLY B N   1 
ATOM   2754  C CA  . GLY B 1 154 ? 4.347   4.019   64.155  0.00 35.46 ? 174 GLY B CA  1 
ATOM   2755  C C   . GLY B 1 154 ? 4.753   5.383   64.678  0.00 39.66 ? 174 GLY B C   1 
ATOM   2756  O O   . GLY B 1 154 ? 4.625   6.383   63.976  0.00 39.69 ? 174 GLY B O   1 
ATOM   2757  N N   . GLN B 1 155 ? 5.244   5.421   65.911  1.00 39.84 ? 175 GLN B N   1 
ATOM   2758  C CA  . GLN B 1 155 ? 5.666   6.663   66.550  1.00 37.40 ? 175 GLN B CA  1 
ATOM   2759  C C   . GLN B 1 155 ? 6.756   7.382   65.771  1.00 32.49 ? 175 GLN B C   1 
ATOM   2760  O O   . GLN B 1 155 ? 6.857   8.613   65.832  1.00 32.57 ? 175 GLN B O   1 
ATOM   2761  C CB  . GLN B 1 155 ? 6.180   6.393   67.962  1.00 39.65 ? 175 GLN B CB  1 
ATOM   2762  C CG  . GLN B 1 155 ? 5.162   5.769   68.891  1.00 45.86 ? 175 GLN B CG  1 
ATOM   2763  C CD  . GLN B 1 155 ? 5.711   5.614   70.295  1.00 52.87 ? 175 GLN B CD  1 
ATOM   2764  O OE1 . GLN B 1 155 ? 5.503   6.481   71.136  1.00 57.70 ? 175 GLN B OE1 1 
ATOM   2765  N NE2 . GLN B 1 155 ? 6.428   4.516   70.554  1.00 55.15 ? 175 GLN B NE2 1 
ATOM   2766  N N   . ILE B 1 156 ? 7.613   6.618   65.102  1.00 26.03 ? 176 ILE B N   1 
ATOM   2767  C CA  . ILE B 1 156 ? 8.684   7.215   64.320  1.00 22.57 ? 176 ILE B CA  1 
ATOM   2768  C C   . ILE B 1 156 ? 8.119   7.879   63.062  1.00 21.91 ? 176 ILE B C   1 
ATOM   2769  O O   . ILE B 1 156 ? 7.637   7.179   62.162  1.00 25.19 ? 176 ILE B O   1 
ATOM   2770  C CB  . ILE B 1 156 ? 9.736   6.157   63.904  1.00 22.82 ? 176 ILE B CB  1 
ATOM   2771  C CG1 . ILE B 1 156 ? 10.367  5.515   65.150  1.00 21.21 ? 176 ILE B CG1 1 
ATOM   2772  C CG2 . ILE B 1 156 ? 10.801  6.788   62.968  1.00 23.96 ? 176 ILE B CG2 1 
ATOM   2773  C CD1 . ILE B 1 156 ? 10.888  6.514   66.172  1.00 18.73 ? 176 ILE B CD1 1 
ATOM   2774  N N   . THR B 1 157 ? 8.158   9.216   63.018  1.00 19.15 ? 177 THR B N   1 
ATOM   2775  C CA  . THR B 1 157 ? 7.676   9.971   61.861  1.00 15.43 ? 177 THR B CA  1 
ATOM   2776  C C   . THR B 1 157 ? 8.787   10.140  60.808  1.00 18.21 ? 177 THR B C   1 
ATOM   2777  O O   . THR B 1 157 ? 9.925   9.684   60.998  1.00 20.01 ? 177 THR B O   1 
ATOM   2778  C CB  . THR B 1 157 ? 7.185   11.347  62.273  1.00 8.30  ? 177 THR B CB  1 
ATOM   2779  O OG1 . THR B 1 157 ? 8.252   12.071  62.878  1.00 6.12  ? 177 THR B OG1 1 
ATOM   2780  C CG2 . THR B 1 157 ? 6.094   11.220  63.260  1.00 10.26 ? 177 THR B CG2 1 
ATOM   2781  N N   . SER B 1 158 ? 8.460   10.787  59.694  1.00 17.63 ? 178 SER B N   1 
ATOM   2782  C CA  . SER B 1 158 ? 9.445   11.031  58.641  1.00 17.28 ? 178 SER B CA  1 
ATOM   2783  C C   . SER B 1 158 ? 10.451  12.090  59.098  1.00 18.51 ? 178 SER B C   1 
ATOM   2784  O O   . SER B 1 158 ? 11.489  12.275  58.467  1.00 21.11 ? 178 SER B O   1 
ATOM   2785  C CB  . SER B 1 158 ? 8.750   11.505  57.361  1.00 14.89 ? 178 SER B CB  1 
ATOM   2786  O OG  . SER B 1 158 ? 7.683   12.394  57.668  0.00 15.05 ? 178 SER B OG  1 
ATOM   2787  N N   . ASN B 1 159 ? 10.132  12.782  60.192  1.00 19.20 ? 179 ASN B N   1 
ATOM   2788  C CA  . ASN B 1 159 ? 10.986  13.834  60.744  1.00 17.70 ? 179 ASN B CA  1 
ATOM   2789  C C   . ASN B 1 159 ? 11.828  13.337  61.897  1.00 16.92 ? 179 ASN B C   1 
ATOM   2790  O O   . ASN B 1 159 ? 12.395  14.131  62.647  1.00 18.63 ? 179 ASN B O   1 
ATOM   2791  C CB  . ASN B 1 159 ? 10.137  15.001  61.219  1.00 15.11 ? 179 ASN B CB  1 
ATOM   2792  C CG  . ASN B 1 159 ? 9.388   15.634  60.102  1.00 16.29 ? 179 ASN B CG  1 
ATOM   2793  O OD1 . ASN B 1 159 ? 9.785   15.530  58.933  1.00 15.29 ? 179 ASN B OD1 1 
ATOM   2794  N ND2 . ASN B 1 159 ? 8.285   16.287  60.432  1.00 19.42 ? 179 ASN B ND2 1 
ATOM   2795  N N   . MET B 1 160 ? 11.912  12.023  62.039  1.00 15.25 ? 180 MET B N   1 
ATOM   2796  C CA  . MET B 1 160 ? 12.687  11.427  63.111  1.00 14.99 ? 180 MET B CA  1 
ATOM   2797  C C   . MET B 1 160 ? 13.616  10.353  62.527  1.00 18.67 ? 180 MET B C   1 
ATOM   2798  O O   . MET B 1 160 ? 13.373  9.839   61.413  1.00 22.14 ? 180 MET B O   1 
ATOM   2799  C CB  . MET B 1 160 ? 11.739  10.787  64.121  1.00 9.92  ? 180 MET B CB  1 
ATOM   2800  C CG  . MET B 1 160 ? 10.720  11.734  64.659  1.00 8.47  ? 180 MET B CG  1 
ATOM   2801  S SD  . MET B 1 160 ? 9.733   10.979  65.929  1.00 9.35  ? 180 MET B SD  1 
ATOM   2802  C CE  . MET B 1 160 ? 8.361   12.127  65.962  1.00 5.52  ? 180 MET B CE  1 
ATOM   2803  N N   . PHE B 1 161 ? 14.712  10.067  63.235  1.00 16.34 ? 181 PHE B N   1 
ATOM   2804  C CA  . PHE B 1 161 ? 15.648  9.022   62.807  1.00 14.44 ? 181 PHE B CA  1 
ATOM   2805  C C   . PHE B 1 161 ? 16.343  8.468   64.035  1.00 12.94 ? 181 PHE B C   1 
ATOM   2806  O O   . PHE B 1 161 ? 16.688  9.226   64.953  1.00 10.02 ? 181 PHE B O   1 
ATOM   2807  C CB  . PHE B 1 161 ? 16.661  9.522   61.742  1.00 15.42 ? 181 PHE B CB  1 
ATOM   2808  C CG  . PHE B 1 161 ? 17.765  10.419  62.277  1.00 13.91 ? 181 PHE B CG  1 
ATOM   2809  C CD1 . PHE B 1 161 ? 18.865  9.871   62.942  1.00 11.32 ? 181 PHE B CD1 1 
ATOM   2810  C CD2 . PHE B 1 161 ? 17.718  11.814  62.076  1.00 11.07 ? 181 PHE B CD2 1 
ATOM   2811  C CE1 . PHE B 1 161 ? 19.891  10.682  63.394  1.00 11.09 ? 181 PHE B CE1 1 
ATOM   2812  C CE2 . PHE B 1 161 ? 18.745  12.643  62.526  1.00 5.76  ? 181 PHE B CE2 1 
ATOM   2813  C CZ  . PHE B 1 161 ? 19.831  12.078  63.185  1.00 10.46 ? 181 PHE B CZ  1 
ATOM   2814  N N   . CYS B 1 162 ? 16.488  7.146   64.073  1.00 12.73 ? 182 CYS B N   1 
ATOM   2815  C CA  . CYS B 1 162 ? 17.115  6.483   65.207  1.00 12.99 ? 182 CYS B CA  1 
ATOM   2816  C C   . CYS B 1 162 ? 18.589  6.444   65.003  1.00 12.29 ? 182 CYS B C   1 
ATOM   2817  O O   . CYS B 1 162 ? 19.028  6.271   63.878  1.00 15.82 ? 182 CYS B O   1 
ATOM   2818  C CB  . CYS B 1 162 ? 16.609  5.047   65.355  1.00 16.13 ? 182 CYS B CB  1 
ATOM   2819  S SG  . CYS B 1 162 ? 14.881  4.855   65.924  1.00 20.30 ? 182 CYS B SG  1 
ATOM   2820  N N   . ALA B 1 163 ? 19.348  6.588   66.088  1.00 12.76 ? 183 ALA B N   1 
ATOM   2821  C CA  . ALA B 1 163 ? 20.815  6.547   66.046  1.00 14.27 ? 183 ALA B CA  1 
ATOM   2822  C C   . ALA B 1 163 ? 21.324  5.947   67.340  1.00 15.60 ? 183 ALA B C   1 
ATOM   2823  O O   . ALA B 1 163 ? 20.790  6.232   68.411  1.00 15.25 ? 183 ALA B O   1 
ATOM   2824  C CB  . ALA B 1 163 ? 21.390  7.937   65.856  1.00 12.63 ? 183 ALA B CB  1 
ATOM   2825  N N   . GLY B 1 164 A 22.340  5.101   67.240  1.00 17.82 ? 184 GLY B N   1 
ATOM   2826  C CA  . GLY B 1 164 A 22.887  4.474   68.427  1.00 20.47 ? 184 GLY B CA  1 
ATOM   2827  C C   . GLY B 1 164 A 23.178  3.006   68.218  1.00 22.07 ? 184 GLY B C   1 
ATOM   2828  O O   . GLY B 1 164 A 23.524  2.597   67.116  1.00 22.23 ? 184 GLY B O   1 
ATOM   2829  N N   . TYR B 1 165 ? 22.980  2.197   69.256  1.00 24.16 ? 184 TYR B N   1 
ATOM   2830  C CA  . TYR B 1 165 ? 23.269  0.755   69.194  1.00 23.31 ? 184 TYR B CA  1 
ATOM   2831  C C   . TYR B 1 165 ? 22.113  -0.079  69.709  1.00 21.49 ? 184 TYR B C   1 
ATOM   2832  O O   . TYR B 1 165 ? 21.796  -0.034  70.889  1.00 20.94 ? 184 TYR B O   1 
ATOM   2833  C CB  . TYR B 1 165 ? 24.530  0.444   70.015  1.00 23.12 ? 184 TYR B CB  1 
ATOM   2834  C CG  . TYR B 1 165 ? 25.690  1.313   69.606  1.00 23.57 ? 184 TYR B CG  1 
ATOM   2835  C CD1 . TYR B 1 165 ? 26.123  2.363   70.408  1.00 23.01 ? 184 TYR B CD1 1 
ATOM   2836  C CD2 . TYR B 1 165 ? 26.319  1.120   68.381  1.00 25.05 ? 184 TYR B CD2 1 
ATOM   2837  C CE1 . TYR B 1 165 ? 27.155  3.198   69.993  1.00 25.00 ? 184 TYR B CE1 1 
ATOM   2838  C CE2 . TYR B 1 165 ? 27.353  1.945   67.963  1.00 26.47 ? 184 TYR B CE2 1 
ATOM   2839  C CZ  . TYR B 1 165 ? 27.770  2.980   68.772  1.00 25.38 ? 184 TYR B CZ  1 
ATOM   2840  O OH  . TYR B 1 165 ? 28.829  3.757   68.365  1.00 24.64 ? 184 TYR B OH  1 
ATOM   2841  N N   . LEU B 1 166 ? 21.507  -0.870  68.833  1.00 21.38 ? 185 LEU B N   1 
ATOM   2842  C CA  . LEU B 1 166 ? 20.386  -1.699  69.235  1.00 23.14 ? 185 LEU B CA  1 
ATOM   2843  C C   . LEU B 1 166 ? 20.762  -2.589  70.415  1.00 28.38 ? 185 LEU B C   1 
ATOM   2844  O O   . LEU B 1 166 ? 19.889  -3.012  71.165  1.00 31.05 ? 185 LEU B O   1 
ATOM   2845  C CB  . LEU B 1 166 ? 19.869  -2.537  68.069  1.00 21.65 ? 185 LEU B CB  1 
ATOM   2846  C CG  . LEU B 1 166 ? 19.099  -1.836  66.947  1.00 19.29 ? 185 LEU B CG  1 
ATOM   2847  C CD1 . LEU B 1 166 ? 18.914  -2.791  65.773  0.00 17.96 ? 185 LEU B CD1 1 
ATOM   2848  C CD2 . LEU B 1 166 ? 17.760  -1.360  67.466  0.00 17.84 ? 185 LEU B CD2 1 
ATOM   2849  N N   . GLU B 1 167 ? 22.055  -2.868  70.588  1.00 30.66 ? 186 GLU B N   1 
ATOM   2850  C CA  . GLU B 1 167 ? 22.492  -3.681  71.721  1.00 30.96 ? 186 GLU B CA  1 
ATOM   2851  C C   . GLU B 1 167 ? 22.311  -2.858  73.005  1.00 32.65 ? 186 GLU B C   1 
ATOM   2852  O O   . GLU B 1 167 ? 21.844  -3.366  74.024  1.00 33.27 ? 186 GLU B O   1 
ATOM   2853  C CB  . GLU B 1 167 ? 23.962  -4.088  71.584  0.00 29.94 ? 186 GLU B CB  1 
ATOM   2854  C CG  . GLU B 1 167 ? 24.460  -4.936  72.754  0.00 29.34 ? 186 GLU B CG  1 
ATOM   2855  C CD  . GLU B 1 167 ? 25.964  -5.128  72.761  0.00 29.28 ? 186 GLU B CD  1 
ATOM   2856  O OE1 . GLU B 1 167 ? 26.413  -6.290  72.844  0.00 29.45 ? 186 GLU B OE1 1 
ATOM   2857  O OE2 . GLU B 1 167 ? 26.699  -4.118  72.701  0.00 29.56 ? 186 GLU B OE2 1 
ATOM   2858  N N   . GLY B 1 168 ? 22.637  -1.571  72.926  1.00 32.59 ? 187 GLY B N   1 
ATOM   2859  C CA  . GLY B 1 168 ? 22.532  -0.696  74.080  1.00 32.61 ? 187 GLY B CA  1 
ATOM   2860  C C   . GLY B 1 168 ? 23.906  -0.411  74.674  1.00 30.41 ? 187 GLY B C   1 
ATOM   2861  O O   . GLY B 1 168 ? 24.921  -0.864  74.145  1.00 33.43 ? 187 GLY B O   1 
ATOM   2862  N N   . GLY B 1 169 A 23.944  0.353   75.760  1.00 27.09 ? 188 GLY B N   1 
ATOM   2863  C CA  . GLY B 1 169 A 25.206  0.672   76.406  1.00 24.05 ? 188 GLY B CA  1 
ATOM   2864  C C   . GLY B 1 169 A 25.710  2.063   76.090  1.00 22.85 ? 188 GLY B C   1 
ATOM   2865  O O   . GLY B 1 169 A 26.421  2.673   76.896  1.00 19.23 ? 188 GLY B O   1 
ATOM   2866  N N   . LYS B 1 170 ? 25.333  2.562   74.917  1.00 22.25 ? 188 LYS B N   1 
ATOM   2867  C CA  . LYS B 1 170 ? 25.746  3.896   74.465  1.00 22.17 ? 188 LYS B CA  1 
ATOM   2868  C C   . LYS B 1 170 ? 24.544  4.608   73.848  1.00 20.77 ? 188 LYS B C   1 
ATOM   2869  O O   . LYS B 1 170 ? 23.949  4.109   72.884  1.00 20.07 ? 188 LYS B O   1 
ATOM   2870  C CB  . LYS B 1 170 ? 26.881  3.786   73.438  1.00 19.12 ? 188 LYS B CB  1 
ATOM   2871  C CG  . LYS B 1 170 ? 28.119  3.053   73.954  1.00 17.83 ? 188 LYS B CG  1 
ATOM   2872  C CD  . LYS B 1 170 ? 29.171  2.887   72.880  1.00 18.33 ? 188 LYS B CD  1 
ATOM   2873  C CE  . LYS B 1 170 ? 30.326  2.027   73.362  0.00 19.22 ? 188 LYS B CE  1 
ATOM   2874  N NZ  . LYS B 1 170 ? 31.351  1.851   72.298  0.00 19.36 ? 188 LYS B NZ  1 
ATOM   2875  N N   . ASP B 1 171 ? 24.189  5.766   74.400  1.00 16.64 ? 189 ASP B N   1 
ATOM   2876  C CA  . ASP B 1 171 ? 23.026  6.507   73.931  1.00 15.80 ? 189 ASP B CA  1 
ATOM   2877  C C   . ASP B 1 171 ? 23.015  7.872   74.614  1.00 17.02 ? 189 ASP B C   1 
ATOM   2878  O O   . ASP B 1 171 ? 23.739  8.064   75.595  1.00 19.16 ? 189 ASP B O   1 
ATOM   2879  C CB  . ASP B 1 171 ? 21.764  5.729   74.329  1.00 15.01 ? 189 ASP B CB  1 
ATOM   2880  C CG  . ASP B 1 171 ? 20.478  6.331   73.767  1.00 17.14 ? 189 ASP B CG  1 
ATOM   2881  O OD1 . ASP B 1 171 ? 19.408  5.946   74.284  1.00 16.95 ? 189 ASP B OD1 1 
ATOM   2882  O OD2 . ASP B 1 171 ? 20.520  7.150   72.813  1.00 15.41 ? 189 ASP B OD2 1 
ATOM   2883  N N   . SER B 1 172 ? 22.273  8.835   74.049  1.00 15.25 ? 190 SER B N   1 
ATOM   2884  C CA  . SER B 1 172 ? 22.151  10.168  74.639  1.00 12.04 ? 190 SER B CA  1 
ATOM   2885  C C   . SER B 1 172 ? 21.190  10.022  75.836  1.00 13.06 ? 190 SER B C   1 
ATOM   2886  O O   . SER B 1 172 ? 20.592  8.954   76.045  1.00 14.08 ? 190 SER B O   1 
ATOM   2887  C CB  . SER B 1 172 ? 21.623  11.176  73.613  1.00 8.76  ? 190 SER B CB  1 
ATOM   2888  O OG  . SER B 1 172 ? 20.472  10.671  72.963  1.00 7.37  ? 190 SER B OG  1 
ATOM   2889  N N   . CYS B 1 173 ? 21.021  11.078  76.617  1.00 11.20 ? 191 CYS B N   1 
ATOM   2890  C CA  . CYS B 1 173 ? 20.170  10.959  77.781  1.00 9.06  ? 191 CYS B CA  1 
ATOM   2891  C C   . CYS B 1 173 ? 19.704  12.315  78.315  1.00 8.71  ? 191 CYS B C   1 
ATOM   2892  O O   . CYS B 1 173 ? 20.167  13.365  77.877  1.00 8.70  ? 191 CYS B O   1 
ATOM   2893  C CB  . CYS B 1 173 ? 20.919  10.172  78.849  1.00 9.17  ? 191 CYS B CB  1 
ATOM   2894  S SG  . CYS B 1 173 ? 19.834  9.361   80.046  1.00 15.15 ? 191 CYS B SG  1 
ATOM   2895  N N   . GLN B 1 174 ? 18.759  12.277  79.244  1.00 8.92  ? 192 GLN B N   1 
ATOM   2896  C CA  . GLN B 1 174 ? 18.176  13.470  79.848  1.00 7.65  ? 192 GLN B CA  1 
ATOM   2897  C C   . GLN B 1 174 ? 19.250  14.505  80.166  1.00 6.58  ? 192 GLN B C   1 
ATOM   2898  O O   . GLN B 1 174 ? 20.207  14.230  80.876  1.00 8.48  ? 192 GLN B O   1 
ATOM   2899  C CB  . GLN B 1 174 ? 17.345  13.077  81.079  1.00 8.97  ? 192 GLN B CB  1 
ATOM   2900  C CG  . GLN B 1 174 ? 15.988  12.406  80.752  1.00 5.23  ? 192 GLN B CG  1 
ATOM   2901  C CD  . GLN B 1 174 ? 16.112  11.064  80.046  1.00 5.00  ? 192 GLN B CD  1 
ATOM   2902  O OE1 . GLN B 1 174 ? 16.406  11.002  78.854  0.00 5.04  ? 192 GLN B OE1 1 
ATOM   2903  N NE2 . GLN B 1 174 ? 15.886  9.983   80.780  0.00 5.04  ? 192 GLN B NE2 1 
ATOM   2904  N N   . GLY B 1 175 ? 19.079  15.697  79.620  1.00 5.30  ? 193 GLY B N   1 
ATOM   2905  C CA  . GLY B 1 175 ? 20.060  16.750  79.769  1.00 5.37  ? 193 GLY B CA  1 
ATOM   2906  C C   . GLY B 1 175 ? 20.779  16.925  78.429  1.00 7.82  ? 193 GLY B C   1 
ATOM   2907  O O   . GLY B 1 175 ? 21.542  17.884  78.229  1.00 8.44  ? 193 GLY B O   1 
ATOM   2908  N N   . ASP B 1 176 ? 20.542  16.001  77.500  1.00 5.65  ? 194 ASP B N   1 
ATOM   2909  C CA  . ASP B 1 176 ? 21.166  16.058  76.189  1.00 7.36  ? 194 ASP B CA  1 
ATOM   2910  C C   . ASP B 1 176 ? 20.237  16.567  75.107  1.00 8.37  ? 194 ASP B C   1 
ATOM   2911  O O   . ASP B 1 176 ? 20.655  16.700  73.956  1.00 11.54 ? 194 ASP B O   1 
ATOM   2912  C CB  . ASP B 1 176 ? 21.691  14.683  75.773  1.00 11.09 ? 194 ASP B CB  1 
ATOM   2913  C CG  . ASP B 1 176 ? 22.954  14.283  76.525  1.00 15.38 ? 194 ASP B CG  1 
ATOM   2914  O OD1 . ASP B 1 176 ? 23.136  13.068  76.801  1.00 15.33 ? 194 ASP B OD1 1 
ATOM   2915  O OD2 . ASP B 1 176 ? 23.768  15.190  76.830  1.00 16.53 ? 194 ASP B OD2 1 
ATOM   2916  N N   . SER B 1 177 ? 18.973  16.795  75.451  1.00 8.27  ? 195 SER B N   1 
ATOM   2917  C CA  . SER B 1 177 ? 17.990  17.308  74.498  1.00 10.00 ? 195 SER B CA  1 
ATOM   2918  C C   . SER B 1 177 ? 18.493  18.575  73.797  1.00 11.07 ? 195 SER B C   1 
ATOM   2919  O O   . SER B 1 177 ? 19.196  19.394  74.391  1.00 13.82 ? 195 SER B O   1 
ATOM   2920  C CB  . SER B 1 177 ? 16.667  17.640  75.218  1.00 13.21 ? 195 SER B CB  1 
ATOM   2921  O OG  . SER B 1 177 ? 15.784  16.514  75.307  1.00 13.98 ? 195 SER B OG  1 
ATOM   2922  N N   . GLY B 1 178 ? 18.168  18.730  72.523  1.00 11.01 ? 196 GLY B N   1 
ATOM   2923  C CA  . GLY B 1 178 ? 18.612  19.923  71.819  1.00 10.99 ? 196 GLY B CA  1 
ATOM   2924  C C   . GLY B 1 178 ? 20.049  19.879  71.342  1.00 10.87 ? 196 GLY B C   1 
ATOM   2925  O O   . GLY B 1 178 ? 20.456  20.710  70.530  1.00 9.44  ? 196 GLY B O   1 
ATOM   2926  N N   . GLY B 1 179 ? 20.802  18.898  71.836  1.00 12.70 ? 197 GLY B N   1 
ATOM   2927  C CA  . GLY B 1 179 ? 22.194  18.719  71.457  1.00 11.29 ? 197 GLY B CA  1 
ATOM   2928  C C   . GLY B 1 179 ? 22.311  18.327  69.997  1.00 10.41 ? 197 GLY B C   1 
ATOM   2929  O O   . GLY B 1 179 ? 21.309  17.905  69.394  1.00 9.23  ? 197 GLY B O   1 
ATOM   2930  N N   . PRO B 1 180 ? 23.508  18.500  69.391  1.00 8.30  ? 198 PRO B N   1 
ATOM   2931  C CA  . PRO B 1 180 ? 23.811  18.184  67.989  1.00 9.03  ? 198 PRO B CA  1 
ATOM   2932  C C   . PRO B 1 180 ? 24.123  16.724  67.663  1.00 10.13 ? 198 PRO B C   1 
ATOM   2933  O O   . PRO B 1 180 ? 24.569  15.936  68.515  1.00 11.66 ? 198 PRO B O   1 
ATOM   2934  C CB  . PRO B 1 180 ? 25.041  19.038  67.713  1.00 5.12  ? 198 PRO B CB  1 
ATOM   2935  C CG  . PRO B 1 180 ? 25.764  19.007  69.006  1.00 5.74  ? 198 PRO B CG  1 
ATOM   2936  C CD  . PRO B 1 180 ? 24.651  19.196  70.022  1.00 7.23  ? 198 PRO B CD  1 
ATOM   2937  N N   . VAL B 1 181 ? 23.854  16.372  66.415  1.00 10.71 ? 199 VAL B N   1 
ATOM   2938  C CA  . VAL B 1 181 ? 24.166  15.052  65.866  1.00 10.61 ? 199 VAL B CA  1 
ATOM   2939  C C   . VAL B 1 181 ? 24.857  15.433  64.554  1.00 13.30 ? 199 VAL B C   1 
ATOM   2940  O O   . VAL B 1 181 ? 24.201  15.704  63.534  1.00 11.28 ? 199 VAL B O   1 
ATOM   2941  C CB  . VAL B 1 181 ? 22.913  14.202  65.544  1.00 7.67  ? 199 VAL B CB  1 
ATOM   2942  C CG1 . VAL B 1 181 ? 23.321  12.963  64.772  1.00 5.00  ? 199 VAL B CG1 1 
ATOM   2943  C CG2 . VAL B 1 181 ? 22.206  13.811  66.808  1.00 5.00  ? 199 VAL B CG2 1 
ATOM   2944  N N   . VAL B 1 182 ? 26.173  15.572  64.607  1.00 13.24 ? 200 VAL B N   1 
ATOM   2945  C CA  . VAL B 1 182 ? 26.903  15.955  63.417  1.00 14.03 ? 200 VAL B CA  1 
ATOM   2946  C C   . VAL B 1 182 ? 27.415  14.729  62.692  1.00 16.62 ? 200 VAL B C   1 
ATOM   2947  O O   . VAL B 1 182 ? 27.958  13.816  63.313  1.00 17.97 ? 200 VAL B O   1 
ATOM   2948  C CB  . VAL B 1 182 ? 28.077  16.871  63.752  1.00 15.66 ? 200 VAL B CB  1 
ATOM   2949  C CG1 . VAL B 1 182 ? 28.805  17.267  62.505  1.00 14.77 ? 200 VAL B CG1 1 
ATOM   2950  C CG2 . VAL B 1 182 ? 27.575  18.111  64.435  1.00 18.84 ? 200 VAL B CG2 1 
ATOM   2951  N N   . CYS B 1 183 ? 27.185  14.689  61.387  1.00 17.41 ? 201 CYS B N   1 
ATOM   2952  C CA  . CYS B 1 183 ? 27.641  13.579  60.567  1.00 18.99 ? 201 CYS B CA  1 
ATOM   2953  C C   . CYS B 1 183 ? 28.394  14.241  59.435  1.00 22.35 ? 201 CYS B C   1 
ATOM   2954  O O   . CYS B 1 183 ? 27.840  15.106  58.757  1.00 25.86 ? 201 CYS B O   1 
ATOM   2955  C CB  . CYS B 1 183 ? 26.467  12.773  59.983  1.00 17.69 ? 201 CYS B CB  1 
ATOM   2956  S SG  . CYS B 1 183 ? 25.119  12.360  61.135  1.00 17.44 ? 201 CYS B SG  1 
ATOM   2957  N N   . SER B 1 184 ? 29.673  13.906  59.291  1.00 23.05 ? 202 SER B N   1 
ATOM   2958  C CA  . SER B 1 184 ? 30.498  14.451  58.221  1.00 21.72 ? 202 SER B CA  1 
ATOM   2959  C C   . SER B 1 184 ? 30.485  15.969  58.162  1.00 17.83 ? 202 SER B C   1 
ATOM   2960  O O   . SER B 1 184 ? 30.362  16.548  57.089  1.00 17.95 ? 202 SER B O   1 
ATOM   2961  C CB  . SER B 1 184 ? 30.044  13.867  56.885  1.00 25.06 ? 202 SER B CB  1 
ATOM   2962  O OG  . SER B 1 184 ? 29.905  12.455  56.992  1.00 30.78 ? 202 SER B OG  1 
ATOM   2963  N N   . GLY B 1 185 ? 30.561  16.599  59.326  1.00 15.23 ? 203 GLY B N   1 
ATOM   2964  C CA  . GLY B 1 185 ? 30.591  18.052  59.395  1.00 15.87 ? 203 GLY B CA  1 
ATOM   2965  C C   . GLY B 1 185 ? 29.273  18.799  59.260  1.00 15.00 ? 203 GLY B C   1 
ATOM   2966  O O   . GLY B 1 185 ? 29.241  20.041  59.276  1.00 13.39 ? 203 GLY B O   1 
ATOM   2967  N N   . LYS B 1 186 ? 28.178  18.062  59.146  1.00 13.56 ? 204 LYS B N   1 
ATOM   2968  C CA  . LYS B 1 186 ? 26.885  18.698  59.013  1.00 12.95 ? 204 LYS B CA  1 
ATOM   2969  C C   . LYS B 1 186 ? 26.019  18.399  60.211  1.00 13.93 ? 204 LYS B C   1 
ATOM   2970  O O   . LYS B 1 186 ? 26.224  17.394  60.905  1.00 14.85 ? 204 LYS B O   1 
ATOM   2971  C CB  . LYS B 1 186 ? 26.197  18.211  57.750  1.00 12.62 ? 204 LYS B CB  1 
ATOM   2972  C CG  . LYS B 1 186 ? 26.977  18.516  56.483  1.00 15.00 ? 204 LYS B CG  1 
ATOM   2973  C CD  . LYS B 1 186 ? 27.125  20.004  56.282  1.00 17.62 ? 204 LYS B CD  1 
ATOM   2974  C CE  . LYS B 1 186 ? 27.748  20.294  54.935  1.00 22.28 ? 204 LYS B CE  1 
ATOM   2975  N NZ  . LYS B 1 186 ? 27.787  21.755  54.668  0.00 21.30 ? 204 LYS B NZ  1 
ATOM   2976  N N   . LEU B 1 187 ? 25.077  19.297  60.481  1.00 12.56 ? 209 LEU B N   1 
ATOM   2977  C CA  . LEU B 1 187 ? 24.149  19.121  61.592  1.00 13.04 ? 209 LEU B CA  1 
ATOM   2978  C C   . LEU B 1 187 ? 22.984  18.259  61.103  1.00 15.15 ? 209 LEU B C   1 
ATOM   2979  O O   . LEU B 1 187 ? 22.029  18.781  60.524  1.00 15.93 ? 209 LEU B O   1 
ATOM   2980  C CB  . LEU B 1 187 ? 23.634  20.478  62.059  1.00 9.00  ? 209 LEU B CB  1 
ATOM   2981  C CG  . LEU B 1 187 ? 22.643  20.426  63.216  1.00 7.55  ? 209 LEU B CG  1 
ATOM   2982  C CD1 . LEU B 1 187 ? 23.304  19.948  64.489  1.00 7.10  ? 209 LEU B CD1 1 
ATOM   2983  C CD2 . LEU B 1 187 ? 22.091  21.788  63.413  1.00 5.87  ? 209 LEU B CD2 1 
ATOM   2984  N N   . GLN B 1 188 ? 23.059  16.952  61.343  1.00 15.37 ? 210 GLN B N   1 
ATOM   2985  C CA  . GLN B 1 188 ? 22.023  16.042  60.876  1.00 15.76 ? 210 GLN B CA  1 
ATOM   2986  C C   . GLN B 1 188 ? 20.765  15.908  61.733  1.00 15.45 ? 210 GLN B C   1 
ATOM   2987  O O   . GLN B 1 188 ? 19.652  15.741  61.212  1.00 15.33 ? 210 GLN B O   1 
ATOM   2988  C CB  . GLN B 1 188 ? 22.624  14.664  60.609  1.00 15.82 ? 210 GLN B CB  1 
ATOM   2989  C CG  . GLN B 1 188 ? 23.394  14.585  59.308  1.00 17.11 ? 210 GLN B CG  1 
ATOM   2990  C CD  . GLN B 1 188 ? 22.557  14.978  58.094  1.00 19.53 ? 210 GLN B CD  1 
ATOM   2991  O OE1 . GLN B 1 188 ? 23.092  15.504  57.117  1.00 20.02 ? 210 GLN B OE1 1 
ATOM   2992  N NE2 . GLN B 1 188 ? 21.244  14.723  58.147  1.00 19.17 ? 210 GLN B NE2 1 
ATOM   2993  N N   . GLY B 1 189 ? 20.935  15.963  63.045  1.00 14.64 ? 211 GLY B N   1 
ATOM   2994  C CA  . GLY B 1 189 ? 19.785  15.821  63.915  1.00 12.53 ? 211 GLY B CA  1 
ATOM   2995  C C   . GLY B 1 189 ? 19.938  16.452  65.282  1.00 10.12 ? 211 GLY B C   1 
ATOM   2996  O O   . GLY B 1 189 ? 21.033  16.830  65.702  1.00 13.89 ? 211 GLY B O   1 
ATOM   2997  N N   . ILE B 1 190 ? 18.828  16.574  65.981  1.00 6.11  ? 212 ILE B N   1 
ATOM   2998  C CA  . ILE B 1 190 ? 18.851  17.142  67.294  1.00 5.00  ? 212 ILE B CA  1 
ATOM   2999  C C   . ILE B 1 190 ? 18.390  16.049  68.248  1.00 7.33  ? 212 ILE B C   1 
ATOM   3000  O O   . ILE B 1 190 ? 17.492  15.263  67.918  1.00 7.01  ? 212 ILE B O   1 
ATOM   3001  C CB  . ILE B 1 190 ? 17.922  18.325  67.347  1.00 6.88  ? 212 ILE B CB  1 
ATOM   3002  C CG1 . ILE B 1 190 ? 18.194  19.226  66.150  1.00 8.83  ? 212 ILE B CG1 1 
ATOM   3003  C CG2 . ILE B 1 190 ? 18.140  19.090  68.617  1.00 9.00  ? 212 ILE B CG2 1 
ATOM   3004  C CD1 . ILE B 1 190 ? 17.223  20.363  66.008  1.00 10.78 ? 212 ILE B CD1 1 
ATOM   3005  N N   . VAL B 1 191 ? 19.072  15.950  69.387  1.00 8.93  ? 213 VAL B N   1 
ATOM   3006  C CA  . VAL B 1 191 ? 18.761  14.962  70.426  1.00 8.95  ? 213 VAL B CA  1 
ATOM   3007  C C   . VAL B 1 191 ? 17.343  15.234  70.865  1.00 8.70  ? 213 VAL B C   1 
ATOM   3008  O O   . VAL B 1 191 ? 17.080  16.315  71.394  1.00 5.00  ? 213 VAL B O   1 
ATOM   3009  C CB  . VAL B 1 191 ? 19.670  15.143  71.656  1.00 9.11  ? 213 VAL B CB  1 
ATOM   3010  C CG1 . VAL B 1 191 ? 19.287  14.148  72.739  1.00 9.29  ? 213 VAL B CG1 1 
ATOM   3011  C CG2 . VAL B 1 191 ? 21.143  15.001  71.258  1.00 7.55  ? 213 VAL B CG2 1 
ATOM   3012  N N   . SER B 1 192 ? 16.464  14.240  70.710  1.00 9.91  ? 214 SER B N   1 
ATOM   3013  C CA  . SER B 1 192 ? 15.053  14.397  71.037  1.00 9.39  ? 214 SER B CA  1 
ATOM   3014  C C   . SER B 1 192 ? 14.522  13.535  72.177  1.00 8.49  ? 214 SER B C   1 
ATOM   3015  O O   . SER B 1 192 ? 14.504  13.966  73.335  1.00 5.41  ? 214 SER B O   1 
ATOM   3016  C CB  . SER B 1 192 ? 14.206  14.185  69.774  1.00 8.46  ? 214 SER B CB  1 
ATOM   3017  O OG  . SER B 1 192 ? 12.911  14.736  69.930  1.00 12.45 ? 214 SER B OG  1 
ATOM   3018  N N   . TRP B 1 193 ? 14.103  12.319  71.854  1.00 11.13 ? 215 TRP B N   1 
ATOM   3019  C CA  . TRP B 1 193 ? 13.529  11.420  72.853  1.00 13.55 ? 215 TRP B CA  1 
ATOM   3020  C C   . TRP B 1 193 ? 13.925  9.960   72.659  1.00 16.84 ? 215 TRP B C   1 
ATOM   3021  O O   . TRP B 1 193 ? 14.698  9.614   71.748  1.00 18.40 ? 215 TRP B O   1 
ATOM   3022  C CB  . TRP B 1 193 ? 12.016  11.506  72.799  1.00 11.42 ? 215 TRP B CB  1 
ATOM   3023  C CG  . TRP B 1 193 ? 11.476  11.175  71.451  1.00 11.15 ? 215 TRP B CG  1 
ATOM   3024  C CD1 . TRP B 1 193 ? 11.451  11.990  70.356  1.00 12.70 ? 215 TRP B CD1 1 
ATOM   3025  C CD2 . TRP B 1 193 ? 10.863  9.953   71.053  1.00 10.07 ? 215 TRP B CD2 1 
ATOM   3026  N NE1 . TRP B 1 193 ? 10.857  11.351  69.301  1.00 11.83 ? 215 TRP B NE1 1 
ATOM   3027  C CE2 . TRP B 1 193 ? 10.483  10.095  69.701  1.00 11.97 ? 215 TRP B CE2 1 
ATOM   3028  C CE3 . TRP B 1 193 ? 10.585  8.755   71.708  1.00 12.13 ? 215 TRP B CE3 1 
ATOM   3029  C CZ2 . TRP B 1 193 ? 9.834   9.080   68.990  1.00 14.47 ? 215 TRP B CZ2 1 
ATOM   3030  C CZ3 . TRP B 1 193 ? 9.935   7.742   71.000  1.00 16.31 ? 215 TRP B CZ3 1 
ATOM   3031  C CH2 . TRP B 1 193 ? 9.566   7.914   69.655  1.00 15.62 ? 215 TRP B CH2 1 
ATOM   3032  N N   . GLY B 1 194 ? 13.382  9.111   73.524  1.00 16.36 ? 216 GLY B N   1 
ATOM   3033  C CA  . GLY B 1 194 ? 13.671  7.693   73.454  1.00 17.60 ? 216 GLY B CA  1 
ATOM   3034  C C   . GLY B 1 194 ? 13.219  7.075   74.747  1.00 17.62 ? 216 GLY B C   1 
ATOM   3035  O O   . GLY B 1 194 ? 12.747  7.793   75.628  1.00 19.31 ? 216 GLY B O   1 
ATOM   3036  N N   . SER B 1 195 ? 13.352  5.765   74.871  1.00 16.81 ? 217 SER B N   1 
ATOM   3037  C CA  . SER B 1 195 ? 12.928  5.100   76.081  1.00 18.87 ? 217 SER B CA  1 
ATOM   3038  C C   . SER B 1 195 ? 14.096  4.894   77.020  1.00 17.87 ? 217 SER B C   1 
ATOM   3039  O O   . SER B 1 195 ? 15.018  4.152   76.721  1.00 20.64 ? 217 SER B O   1 
ATOM   3040  C CB  . SER B 1 195 ? 12.297  3.771   75.725  1.00 26.02 ? 217 SER B CB  1 
ATOM   3041  O OG  . SER B 1 195 ? 11.408  3.952   74.636  1.00 32.44 ? 217 SER B OG  1 
ATOM   3042  N N   . GLY B 1 196 ? 14.056  5.558   78.164  1.00 19.45 ? 219 GLY B N   1 
ATOM   3043  C CA  . GLY B 1 196 ? 15.126  5.421   79.132  1.00 20.12 ? 219 GLY B CA  1 
ATOM   3044  C C   . GLY B 1 196 ? 16.399  5.825   78.454  1.00 20.13 ? 219 GLY B C   1 
ATOM   3045  O O   . GLY B 1 196 ? 16.376  6.678   77.584  1.00 22.40 ? 219 GLY B O   1 
ATOM   3046  N N   . CYS B 1 197 ? 17.493  5.169   78.789  1.00 21.29 ? 220 CYS B N   1 
ATOM   3047  C CA  . CYS B 1 197 ? 18.772  5.484   78.163  1.00 23.67 ? 220 CYS B CA  1 
ATOM   3048  C C   . CYS B 1 197 ? 19.687  4.264   77.953  1.00 25.83 ? 220 CYS B C   1 
ATOM   3049  O O   . CYS B 1 197 ? 19.952  3.475   78.877  1.00 18.92 ? 220 CYS B O   1 
ATOM   3050  C CB  . CYS B 1 197 ? 19.493  6.565   78.966  1.00 20.15 ? 220 CYS B CB  1 
ATOM   3051  S SG  . CYS B 1 197 ? 18.680  8.173   78.881  1.00 11.30 ? 220 CYS B SG  1 
ATOM   3052  N N   . ALA B 1 198 A 20.160  4.115   76.720  1.00 29.67 ? 221 ALA B N   1 
ATOM   3053  C CA  . ALA B 1 198 A 21.039  3.010   76.357  1.00 31.38 ? 221 ALA B CA  1 
ATOM   3054  C C   . ALA B 1 198 A 20.342  1.664   76.587  1.00 31.16 ? 221 ALA B C   1 
ATOM   3055  O O   . ALA B 1 198 A 20.983  0.627   76.737  1.00 32.87 ? 221 ALA B O   1 
ATOM   3056  C CB  . ALA B 1 198 A 22.334  3.092   77.137  1.00 29.30 ? 221 ALA B CB  1 
ATOM   3057  N N   . GLN B 1 199 ? 19.020  1.687   76.599  1.00 29.91 ? 221 GLN B N   1 
ATOM   3058  C CA  . GLN B 1 199 ? 18.250  0.484   76.778  1.00 30.08 ? 221 GLN B CA  1 
ATOM   3059  C C   . GLN B 1 199 ? 18.299  -0.285  75.468  1.00 30.78 ? 221 GLN B C   1 
ATOM   3060  O O   . GLN B 1 199 ? 18.183  0.301   74.386  1.00 30.22 ? 221 GLN B O   1 
ATOM   3061  C CB  . GLN B 1 199 ? 16.803  0.834   77.123  1.00 32.88 ? 221 GLN B CB  1 
ATOM   3062  C CG  . GLN B 1 199 ? 16.352  0.356   78.515  1.00 33.22 ? 221 GLN B CG  1 
ATOM   3063  C CD  . GLN B 1 199 ? 17.233  0.891   79.641  1.00 31.40 ? 221 GLN B CD  1 
ATOM   3064  O OE1 . GLN B 1 199 ? 17.880  0.127   80.352  0.00 29.40 ? 221 GLN B OE1 1 
ATOM   3065  N NE2 . GLN B 1 199 ? 17.260  2.208   79.799  0.00 29.44 ? 221 GLN B NE2 1 
ATOM   3066  N N   . LYS B 1 200 ? 18.518  -1.591  75.584  1.00 30.66 ? 222 LYS B N   1 
ATOM   3067  C CA  . LYS B 1 200 ? 18.576  -2.499  74.443  1.00 27.86 ? 222 LYS B CA  1 
ATOM   3068  C C   . LYS B 1 200 ? 17.328  -2.348  73.589  1.00 24.87 ? 222 LYS B C   1 
ATOM   3069  O O   . LYS B 1 200 ? 16.235  -2.182  74.117  1.00 26.13 ? 222 LYS B O   1 
ATOM   3070  C CB  . LYS B 1 200 ? 18.648  -3.941  74.957  1.00 29.89 ? 222 LYS B CB  1 
ATOM   3071  C CG  . LYS B 1 200 ? 18.650  -5.015  73.871  1.00 29.69 ? 222 LYS B CG  1 
ATOM   3072  C CD  . LYS B 1 200 ? 18.626  -6.409  74.467  0.00 27.94 ? 222 LYS B CD  1 
ATOM   3073  C CE  . LYS B 1 200 ? 18.498  -7.460  73.381  0.00 27.54 ? 222 LYS B CE  1 
ATOM   3074  N NZ  . LYS B 1 200 ? 18.470  -8.836  73.938  0.00 27.37 ? 222 LYS B NZ  1 
ATOM   3075  N N   . ASN B 1 201 ? 17.489  -2.407  72.275  1.00 22.84 ? 223 ASN B N   1 
ATOM   3076  C CA  . ASN B 1 201 ? 16.367  -2.296  71.349  1.00 26.81 ? 223 ASN B CA  1 
ATOM   3077  C C   . ASN B 1 201 ? 15.515  -1.019  71.501  1.00 29.12 ? 223 ASN B C   1 
ATOM   3078  O O   . ASN B 1 201 ? 14.357  -0.963  71.044  1.00 29.16 ? 223 ASN B O   1 
ATOM   3079  C CB  . ASN B 1 201 ? 15.469  -3.540  71.458  1.00 28.35 ? 223 ASN B CB  1 
ATOM   3080  C CG  . ASN B 1 201 ? 16.159  -4.810  70.985  1.00 27.79 ? 223 ASN B CG  1 
ATOM   3081  O OD1 . ASN B 1 201 ? 17.150  -4.766  70.262  0.00 26.55 ? 223 ASN B OD1 1 
ATOM   3082  N ND2 . ASN B 1 201 ? 15.633  -5.955  71.405  0.00 26.65 ? 223 ASN B ND2 1 
ATOM   3083  N N   . LYS B 1 202 ? 16.081  -0.007  72.157  1.00 28.68 ? 224 LYS B N   1 
ATOM   3084  C CA  . LYS B 1 202 ? 15.413  1.280   72.355  1.00 26.67 ? 224 LYS B CA  1 
ATOM   3085  C C   . LYS B 1 202 ? 16.496  2.299   72.093  1.00 24.75 ? 224 LYS B C   1 
ATOM   3086  O O   . LYS B 1 202 ? 17.134  2.797   73.020  1.00 23.27 ? 224 LYS B O   1 
ATOM   3087  C CB  . LYS B 1 202 ? 14.880  1.419   73.787  1.00 28.21 ? 224 LYS B CB  1 
ATOM   3088  C CG  . LYS B 1 202 ? 13.739  0.461   74.105  1.00 33.14 ? 224 LYS B CG  1 
ATOM   3089  C CD  . LYS B 1 202 ? 12.570  0.648   73.127  1.00 41.17 ? 224 LYS B CD  1 
ATOM   3090  C CE  . LYS B 1 202 ? 11.610  -0.558  73.125  1.00 46.45 ? 224 LYS B CE  1 
ATOM   3091  N NZ  . LYS B 1 202 ? 10.363  -0.354  72.301  1.00 48.04 ? 224 LYS B NZ  1 
ATOM   3092  N N   . PRO B 1 203 ? 16.770  2.570   70.813  1.00 21.41 ? 225 PRO B N   1 
ATOM   3093  C CA  . PRO B 1 203 ? 17.791  3.520   70.364  1.00 23.57 ? 225 PRO B CA  1 
ATOM   3094  C C   . PRO B 1 203 ? 17.312  4.944   70.540  1.00 19.92 ? 225 PRO B C   1 
ATOM   3095  O O   . PRO B 1 203 ? 16.114  5.187   70.510  1.00 21.94 ? 225 PRO B O   1 
ATOM   3096  C CB  . PRO B 1 203 ? 17.929  3.206   68.861  1.00 23.25 ? 225 PRO B CB  1 
ATOM   3097  C CG  . PRO B 1 203 ? 17.148  1.930   68.644  1.00 24.40 ? 225 PRO B CG  1 
ATOM   3098  C CD  . PRO B 1 203 ? 16.047  2.024   69.661  1.00 23.32 ? 225 PRO B CD  1 
ATOM   3099  N N   . GLY B 1 204 ? 18.239  5.878   70.707  1.00 16.45 ? 226 GLY B N   1 
ATOM   3100  C CA  . GLY B 1 204 ? 17.843  7.266   70.846  1.00 16.72 ? 226 GLY B CA  1 
ATOM   3101  C C   . GLY B 1 204 ? 17.198  7.745   69.560  1.00 16.55 ? 226 GLY B C   1 
ATOM   3102  O O   . GLY B 1 204 ? 17.604  7.316   68.481  1.00 18.58 ? 226 GLY B O   1 
ATOM   3103  N N   . VAL B 1 205 ? 16.180  8.592   69.661  1.00 15.11 ? 227 VAL B N   1 
ATOM   3104  C CA  . VAL B 1 205 ? 15.493  9.116   68.481  1.00 15.09 ? 227 VAL B CA  1 
ATOM   3105  C C   . VAL B 1 205 ? 15.866  10.573  68.322  1.00 15.78 ? 227 VAL B C   1 
ATOM   3106  O O   . VAL B 1 205 ? 15.901  11.314  69.316  1.00 16.48 ? 227 VAL B O   1 
ATOM   3107  C CB  . VAL B 1 205 ? 13.973  8.997   68.600  1.00 13.78 ? 227 VAL B CB  1 
ATOM   3108  C CG1 . VAL B 1 205 ? 13.286  9.654   67.404  1.00 9.87  ? 227 VAL B CG1 1 
ATOM   3109  C CG2 . VAL B 1 205 ? 13.582  7.523   68.706  1.00 15.28 ? 227 VAL B CG2 1 
ATOM   3110  N N   . TYR B 1 206 ? 16.141  10.977  67.077  1.00 14.79 ? 228 TYR B N   1 
ATOM   3111  C CA  . TYR B 1 206 ? 16.561  12.348  66.763  1.00 11.66 ? 228 TYR B CA  1 
ATOM   3112  C C   . TYR B 1 206 ? 15.764  13.035  65.653  1.00 8.62  ? 228 TYR B C   1 
ATOM   3113  O O   . TYR B 1 206 ? 15.175  12.370  64.787  1.00 7.06  ? 228 TYR B O   1 
ATOM   3114  C CB  . TYR B 1 206 ? 18.036  12.322  66.393  1.00 11.52 ? 228 TYR B CB  1 
ATOM   3115  C CG  . TYR B 1 206 ? 18.886  11.650  67.441  1.00 9.75  ? 228 TYR B CG  1 
ATOM   3116  C CD1 . TYR B 1 206 ? 19.599  12.411  68.363  1.00 11.45 ? 228 TYR B CD1 1 
ATOM   3117  C CD2 . TYR B 1 206 ? 18.978  10.269  67.515  1.00 5.00  ? 228 TYR B CD2 1 
ATOM   3118  C CE1 . TYR B 1 206 ? 20.384  11.820  69.323  1.00 9.49  ? 228 TYR B CE1 1 
ATOM   3119  C CE2 . TYR B 1 206 ? 19.751  9.676   68.475  1.00 5.99  ? 228 TYR B CE2 1 
ATOM   3120  C CZ  . TYR B 1 206 ? 20.454  10.456  69.374  1.00 8.16  ? 228 TYR B CZ  1 
ATOM   3121  O OH  . TYR B 1 206 ? 21.243  9.873   70.331  1.00 13.89 ? 228 TYR B OH  1 
ATOM   3122  N N   . THR B 1 207 ? 15.749  14.362  65.686  1.00 5.00  ? 229 THR B N   1 
ATOM   3123  C CA  . THR B 1 207 ? 15.023  15.125  64.693  1.00 5.00  ? 229 THR B CA  1 
ATOM   3124  C C   . THR B 1 207 ? 15.818  15.209  63.413  1.00 8.88  ? 229 THR B C   1 
ATOM   3125  O O   . THR B 1 207 ? 16.984  15.597  63.424  1.00 12.78 ? 229 THR B O   1 
ATOM   3126  C CB  . THR B 1 207 ? 14.784  16.547  65.159  1.00 10.74 ? 229 THR B CB  1 
ATOM   3127  O OG1 . THR B 1 207 ? 14.311  16.524  66.505  1.00 17.88 ? 229 THR B OG1 1 
ATOM   3128  C CG2 . THR B 1 207 ? 13.745  17.250  64.269  1.00 12.85 ? 229 THR B CG2 1 
ATOM   3129  N N   . LYS B 1 208 ? 15.173  14.900  62.296  1.00 10.38 ? 230 LYS B N   1 
ATOM   3130  C CA  . LYS B 1 208 ? 15.819  14.954  60.989  1.00 9.11  ? 230 LYS B CA  1 
ATOM   3131  C C   . LYS B 1 208 ? 16.029  16.423  60.528  1.00 7.95  ? 230 LYS B C   1 
ATOM   3132  O O   . LYS B 1 208 ? 15.237  16.965  59.753  1.00 5.00  ? 230 LYS B O   1 
ATOM   3133  C CB  . LYS B 1 208 ? 14.948  14.198  59.997  1.00 8.79  ? 230 LYS B CB  1 
ATOM   3134  C CG  . LYS B 1 208 ? 15.714  13.477  58.919  1.00 13.24 ? 230 LYS B CG  1 
ATOM   3135  C CD  . LYS B 1 208 ? 14.766  12.629  58.055  1.00 17.09 ? 230 LYS B CD  1 
ATOM   3136  C CE  . LYS B 1 208 ? 15.502  11.798  57.005  1.00 14.00 ? 230 LYS B CE  1 
ATOM   3137  N NZ  . LYS B 1 208 ? 14.542  10.934  56.258  0.00 12.61 ? 230 LYS B NZ  1 
ATOM   3138  N N   . VAL B 1 209 ? 17.113  17.051  60.980  1.00 8.19  ? 231 VAL B N   1 
ATOM   3139  C CA  . VAL B 1 209 ? 17.413  18.440  60.618  1.00 10.32 ? 231 VAL B CA  1 
ATOM   3140  C C   . VAL B 1 209 ? 17.366  18.731  59.122  1.00 14.00 ? 231 VAL B C   1 
ATOM   3141  O O   . VAL B 1 209 ? 17.039  19.843  58.706  1.00 14.96 ? 231 VAL B O   1 
ATOM   3142  C CB  . VAL B 1 209 ? 18.785  18.892  61.171  1.00 9.66  ? 231 VAL B CB  1 
ATOM   3143  C CG1 . VAL B 1 209 ? 19.164  20.279  60.636  1.00 5.00  ? 231 VAL B CG1 1 
ATOM   3144  C CG2 . VAL B 1 209 ? 18.734  18.920  62.689  1.00 11.27 ? 231 VAL B CG2 1 
ATOM   3145  N N   . CYS B 1 210 ? 17.669  17.732  58.308  1.00 17.43 ? 232 CYS B N   1 
ATOM   3146  C CA  . CYS B 1 210 ? 17.647  17.924  56.865  1.00 19.97 ? 232 CYS B CA  1 
ATOM   3147  C C   . CYS B 1 210 ? 16.274  18.328  56.310  1.00 19.09 ? 232 CYS B C   1 
ATOM   3148  O O   . CYS B 1 210 ? 16.201  19.087  55.351  1.00 21.02 ? 232 CYS B O   1 
ATOM   3149  C CB  . CYS B 1 210 ? 18.182  16.680  56.160  1.00 22.95 ? 232 CYS B CB  1 
ATOM   3150  S SG  . CYS B 1 210 ? 17.219  15.168  56.456  1.00 27.44 ? 232 CYS B SG  1 
ATOM   3151  N N   . ASN B 1 211 ? 15.193  17.896  56.953  1.00 17.87 ? 233 ASN B N   1 
ATOM   3152  C CA  . ASN B 1 211 ? 13.847  18.229  56.478  1.00 17.95 ? 233 ASN B CA  1 
ATOM   3153  C C   . ASN B 1 211 ? 13.495  19.680  56.782  1.00 17.48 ? 233 ASN B C   1 
ATOM   3154  O O   . ASN B 1 211 ? 12.650  20.278  56.124  1.00 17.49 ? 233 ASN B O   1 
ATOM   3155  C CB  . ASN B 1 211 ? 12.787  17.318  57.122  1.00 21.17 ? 233 ASN B CB  1 
ATOM   3156  C CG  . ASN B 1 211 ? 12.889  15.843  56.678  1.00 25.44 ? 233 ASN B CG  1 
ATOM   3157  O OD1 . ASN B 1 211 ? 13.673  15.481  55.795  1.00 28.59 ? 233 ASN B OD1 1 
ATOM   3158  N ND2 . ASN B 1 211 ? 12.070  14.993  57.289  1.00 24.66 ? 233 ASN B ND2 1 
ATOM   3159  N N   . TYR B 1 212 ? 14.172  20.266  57.760  1.00 18.17 ? 234 TYR B N   1 
ATOM   3160  C CA  . TYR B 1 212 ? 13.888  21.649  58.165  1.00 16.62 ? 234 TYR B CA  1 
ATOM   3161  C C   . TYR B 1 212 ? 14.868  22.721  57.686  1.00 17.65 ? 234 TYR B C   1 
ATOM   3162  O O   . TYR B 1 212 ? 14.726  23.889  58.082  1.00 16.74 ? 234 TYR B O   1 
ATOM   3163  C CB  . TYR B 1 212 ? 13.771  21.738  59.698  1.00 12.71 ? 234 TYR B CB  1 
ATOM   3164  C CG  . TYR B 1 212 ? 12.794  20.752  60.271  1.00 8.47  ? 234 TYR B CG  1 
ATOM   3165  C CD1 . TYR B 1 212 ? 11.445  21.053  60.342  1.00 7.97  ? 234 TYR B CD1 1 
ATOM   3166  C CD2 . TYR B 1 212 ? 13.211  19.485  60.663  1.00 10.20 ? 234 TYR B CD2 1 
ATOM   3167  C CE1 . TYR B 1 212 ? 10.527  20.113  60.780  1.00 12.19 ? 234 TYR B CE1 1 
ATOM   3168  C CE2 . TYR B 1 212 ? 12.310  18.529  61.104  1.00 12.63 ? 234 TYR B CE2 1 
ATOM   3169  C CZ  . TYR B 1 212 ? 10.969  18.840  61.160  1.00 14.06 ? 234 TYR B CZ  1 
ATOM   3170  O OH  . TYR B 1 212 ? 10.082  17.875  61.603  1.00 15.19 ? 234 TYR B OH  1 
ATOM   3171  N N   . VAL B 1 213 ? 15.845  22.348  56.849  1.00 16.85 ? 235 VAL B N   1 
ATOM   3172  C CA  . VAL B 1 213 ? 16.837  23.309  56.351  1.00 14.66 ? 235 VAL B CA  1 
ATOM   3173  C C   . VAL B 1 213 ? 16.193  24.564  55.775  1.00 15.65 ? 235 VAL B C   1 
ATOM   3174  O O   . VAL B 1 213 ? 16.590  25.673  56.125  1.00 15.82 ? 235 VAL B O   1 
ATOM   3175  C CB  . VAL B 1 213 ? 17.762  22.700  55.293  1.00 13.16 ? 235 VAL B CB  1 
ATOM   3176  C CG1 . VAL B 1 213 ? 18.800  23.727  54.851  1.00 12.83 ? 235 VAL B CG1 1 
ATOM   3177  C CG2 . VAL B 1 213 ? 18.454  21.481  55.863  1.00 15.78 ? 235 VAL B CG2 1 
ATOM   3178  N N   . SER B 1 214 ? 15.172  24.380  54.935  1.00 17.56 ? 236 SER B N   1 
ATOM   3179  C CA  . SER B 1 214 ? 14.449  25.490  54.309  1.00 16.76 ? 236 SER B CA  1 
ATOM   3180  C C   . SER B 1 214 ? 13.837  26.435  55.369  1.00 16.40 ? 236 SER B C   1 
ATOM   3181  O O   . SER B 1 214 ? 14.117  27.651  55.395  1.00 13.09 ? 236 SER B O   1 
ATOM   3182  C CB  . SER B 1 214 ? 13.361  24.929  53.383  1.00 15.69 ? 236 SER B CB  1 
ATOM   3183  O OG  . SER B 1 214 ? 13.903  23.976  52.484  0.00 18.00 ? 236 SER B OG  1 
ATOM   3184  N N   . TRP B 1 215 ? 13.039  25.850  56.266  1.00 14.92 ? 237 TRP B N   1 
ATOM   3185  C CA  . TRP B 1 215 ? 12.386  26.589  57.340  1.00 8.92  ? 237 TRP B CA  1 
ATOM   3186  C C   . TRP B 1 215 ? 13.443  27.387  58.055  1.00 7.33  ? 237 TRP B C   1 
ATOM   3187  O O   . TRP B 1 215 ? 13.316  28.602  58.185  1.00 5.00  ? 237 TRP B O   1 
ATOM   3188  C CB  . TRP B 1 215 ? 11.708  25.641  58.336  1.00 9.08  ? 237 TRP B CB  1 
ATOM   3189  C CG  . TRP B 1 215 ? 11.067  26.371  59.476  1.00 10.94 ? 237 TRP B CG  1 
ATOM   3190  C CD1 . TRP B 1 215 ? 10.035  27.268  59.391  1.00 14.32 ? 237 TRP B CD1 1 
ATOM   3191  C CD2 . TRP B 1 215 ? 11.506  26.403  60.838  1.00 10.11 ? 237 TRP B CD2 1 
ATOM   3192  N NE1 . TRP B 1 215 ? 9.829   27.875  60.606  1.00 12.19 ? 237 TRP B NE1 1 
ATOM   3193  C CE2 . TRP B 1 215 ? 10.720  27.366  61.511  1.00 11.15 ? 237 TRP B CE2 1 
ATOM   3194  C CE3 . TRP B 1 215 ? 12.491  25.720  61.553  1.00 12.22 ? 237 TRP B CE3 1 
ATOM   3195  C CZ2 . TRP B 1 215 ? 10.896  27.668  62.864  1.00 12.15 ? 237 TRP B CZ2 1 
ATOM   3196  C CZ3 . TRP B 1 215 ? 12.663  26.012  62.902  1.00 14.22 ? 237 TRP B CZ3 1 
ATOM   3197  C CH2 . TRP B 1 215 ? 11.867  26.983  63.541  1.00 15.01 ? 237 TRP B CH2 1 
ATOM   3198  N N   . ILE B 1 216 ? 14.495  26.694  58.487  1.00 7.49  ? 238 ILE B N   1 
ATOM   3199  C CA  . ILE B 1 216 ? 15.599  27.344  59.186  1.00 10.62 ? 238 ILE B CA  1 
ATOM   3200  C C   . ILE B 1 216 ? 16.033  28.591  58.390  1.00 13.87 ? 238 ILE B C   1 
ATOM   3201  O O   . ILE B 1 216 ? 15.923  29.739  58.874  1.00 14.27 ? 238 ILE B O   1 
ATOM   3202  C CB  . ILE B 1 216 ? 16.828  26.398  59.360  1.00 6.79  ? 238 ILE B CB  1 
ATOM   3203  C CG1 . ILE B 1 216 ? 16.421  25.106  60.069  1.00 5.97  ? 238 ILE B CG1 1 
ATOM   3204  C CG2 . ILE B 1 216 ? 17.918  27.104  60.160  1.00 6.84  ? 238 ILE B CG2 1 
ATOM   3205  C CD1 . ILE B 1 216 ? 17.572  24.160  60.331  1.00 5.00  ? 238 ILE B CD1 1 
ATOM   3206  N N   . LYS B 1 217 ? 16.428  28.365  57.139  1.00 12.63 ? 239 LYS B N   1 
ATOM   3207  C CA  . LYS B 1 217 ? 16.886  29.445  56.282  1.00 12.50 ? 239 LYS B CA  1 
ATOM   3208  C C   . LYS B 1 217 ? 15.879  30.583  56.169  1.00 14.21 ? 239 LYS B C   1 
ATOM   3209  O O   . LYS B 1 217 ? 16.235  31.761  56.362  1.00 14.51 ? 239 LYS B O   1 
ATOM   3210  C CB  . LYS B 1 217 ? 17.304  28.930  54.891  1.00 12.96 ? 239 LYS B CB  1 
ATOM   3211  C CG  . LYS B 1 217 ? 18.691  28.232  54.830  1.00 10.97 ? 239 LYS B CG  1 
ATOM   3212  C CD  . LYS B 1 217 ? 18.967  27.669  53.451  0.00 12.19 ? 239 LYS B CD  1 
ATOM   3213  C CE  . LYS B 1 217 ? 20.306  26.953  53.405  0.00 12.63 ? 239 LYS B CE  1 
ATOM   3214  N NZ  . LYS B 1 217 ? 20.585  26.404  52.050  0.00 12.40 ? 239 LYS B NZ  1 
ATOM   3215  N N   . GLN B 1 218 ? 14.615  30.263  55.926  1.00 13.74 ? 240 GLN B N   1 
ATOM   3216  C CA  . GLN B 1 218 ? 13.645  31.340  55.807  1.00 13.51 ? 240 GLN B CA  1 
ATOM   3217  C C   . GLN B 1 218 ? 13.504  32.124  57.125  1.00 16.45 ? 240 GLN B C   1 
ATOM   3218  O O   . GLN B 1 218 ? 13.564  33.360  57.112  1.00 20.16 ? 240 GLN B O   1 
ATOM   3219  C CB  . GLN B 1 218 ? 12.294  30.820  55.333  1.00 11.13 ? 240 GLN B CB  1 
ATOM   3220  C CG  . GLN B 1 218 ? 11.261  31.914  55.094  0.00 13.78 ? 240 GLN B CG  1 
ATOM   3221  C CD  . GLN B 1 218 ? 11.648  32.838  53.953  0.00 15.12 ? 240 GLN B CD  1 
ATOM   3222  O OE1 . GLN B 1 218 ? 11.728  32.415  52.801  0.00 16.23 ? 240 GLN B OE1 1 
ATOM   3223  N NE2 . GLN B 1 218 ? 11.886  34.105  54.267  0.00 16.31 ? 240 GLN B NE2 1 
ATOM   3224  N N   . THR B 1 219 ? 13.403  31.419  58.258  1.00 14.62 ? 241 THR B N   1 
ATOM   3225  C CA  . THR B 1 219 ? 13.242  32.064  59.571  1.00 12.06 ? 241 THR B CA  1 
ATOM   3226  C C   . THR B 1 219 ? 14.347  33.079  59.906  1.00 12.23 ? 241 THR B C   1 
ATOM   3227  O O   . THR B 1 219 ? 14.082  34.217  60.347  1.00 8.06  ? 241 THR B O   1 
ATOM   3228  C CB  . THR B 1 219 ? 13.139  31.015  60.689  1.00 11.58 ? 241 THR B CB  1 
ATOM   3229  O OG1 . THR B 1 219 ? 12.073  30.105  60.387  1.00 13.19 ? 241 THR B OG1 1 
ATOM   3230  C CG2 . THR B 1 219 ? 12.844  31.683  62.015  1.00 12.79 ? 241 THR B CG2 1 
ATOM   3231  N N   . ILE B 1 220 ? 15.583  32.674  59.644  1.00 13.90 ? 242 ILE B N   1 
ATOM   3232  C CA  . ILE B 1 220 ? 16.758  33.517  59.887  1.00 12.25 ? 242 ILE B CA  1 
ATOM   3233  C C   . ILE B 1 220 ? 16.793  34.801  59.009  1.00 12.36 ? 242 ILE B C   1 
ATOM   3234  O O   . ILE B 1 220 ? 17.204  35.886  59.458  1.00 8.94  ? 242 ILE B O   1 
ATOM   3235  C CB  . ILE B 1 220 ? 18.022  32.687  59.663  1.00 10.67 ? 242 ILE B CB  1 
ATOM   3236  C CG1 . ILE B 1 220 ? 18.119  31.611  60.734  1.00 10.00 ? 242 ILE B CG1 1 
ATOM   3237  C CG2 . ILE B 1 220 ? 19.227  33.555  59.709  1.00 11.42 ? 242 ILE B CG2 1 
ATOM   3238  C CD1 . ILE B 1 220 ? 19.023  30.484  60.354  1.00 15.31 ? 242 ILE B CD1 1 
ATOM   3239  N N   . ALA B 1 221 ? 16.387  34.666  57.749  1.00 10.03 ? 243 ALA B N   1 
ATOM   3240  C CA  . ALA B 1 221 ? 16.377  35.803  56.840  1.00 8.27  ? 243 ALA B CA  1 
ATOM   3241  C C   . ALA B 1 221 ? 15.284  36.813  57.160  1.00 8.47  ? 243 ALA B C   1 
ATOM   3242  O O   . ALA B 1 221 ? 15.362  37.966  56.751  1.00 8.17  ? 243 ALA B O   1 
ATOM   3243  C CB  . ALA B 1 221 ? 16.219  35.320  55.418  1.00 8.73  ? 243 ALA B CB  1 
ATOM   3244  N N   . SER B 1 222 ? 14.271  36.383  57.900  1.00 8.32  ? 244 SER B N   1 
ATOM   3245  C CA  . SER B 1 222 ? 13.160  37.254  58.199  1.00 7.19  ? 244 SER B CA  1 
ATOM   3246  C C   . SER B 1 222 ? 13.170  37.792  59.581  1.00 7.76  ? 244 SER B C   1 
ATOM   3247  O O   . SER B 1 222 ? 12.503  38.783  59.849  1.00 11.46 ? 244 SER B O   1 
ATOM   3248  C CB  . SER B 1 222 ? 11.856  36.522  57.982  1.00 7.61  ? 244 SER B CB  1 
ATOM   3249  O OG  . SER B 1 222 ? 11.929  35.759  56.791  1.00 13.45 ? 244 SER B OG  1 
ATOM   3250  N N   . ASN B 1 223 ? 13.885  37.136  60.476  1.00 5.00  ? 245 ASN B N   1 
ATOM   3251  C CA  . ASN B 1 223 ? 13.903  37.616  61.838  1.00 5.80  ? 245 ASN B CA  1 
ATOM   3252  C C   . ASN B 1 223 ? 15.238  38.224  62.183  1.00 5.00  ? 245 ASN B C   1 
ATOM   3253  O O   . ASN B 1 223 ? 15.747  37.984  63.283  1.00 9.97  ? 245 ASN B O   1 
ATOM   3254  C CB  . ASN B 1 223 ? 13.509  36.491  62.804  1.00 7.36  ? 245 ASN B CB  1 
ATOM   3255  C CG  . ASN B 1 223 ? 12.082  35.998  62.576  1.00 5.00  ? 245 ASN B CG  1 
ATOM   3256  O OD1 . ASN B 1 223 ? 11.119  36.666  62.902  1.00 5.00  ? 245 ASN B OD1 1 
ATOM   3257  N ND2 . ASN B 1 223 ? 11.956  34.822  62.016  1.00 8.36  ? 245 ASN B ND2 1 
ATOM   3258  O OXT . ASN B 1 223 ? 15.757  38.960  61.344  1.00 5.00  ? 245 ASN B OXT 1 
ATOM   3259  N N   . ILE C 1 1   ? 25.345  81.379  78.230  1.00 20.83 ? 16  ILE C N   1 
ATOM   3260  C CA  . ILE C 1 1   ? 24.272  82.369  78.511  1.00 22.84 ? 16  ILE C CA  1 
ATOM   3261  C C   . ILE C 1 1   ? 24.979  83.657  78.894  1.00 24.71 ? 16  ILE C C   1 
ATOM   3262  O O   . ILE C 1 1   ? 25.577  83.744  79.967  1.00 21.62 ? 16  ILE C O   1 
ATOM   3263  C CB  . ILE C 1 1   ? 23.355  81.910  79.697  1.00 20.23 ? 16  ILE C CB  1 
ATOM   3264  C CG1 . ILE C 1 1   ? 22.506  80.699  79.301  1.00 20.00 ? 16  ILE C CG1 1 
ATOM   3265  C CG2 . ILE C 1 1   ? 22.411  83.027  80.088  1.00 19.29 ? 16  ILE C CG2 1 
ATOM   3266  C CD1 . ILE C 1 1   ? 21.466  80.996  78.204  1.00 21.28 ? 16  ILE C CD1 1 
ATOM   3267  N N   . VAL C 1 2   ? 24.957  84.627  77.990  1.00 29.47 ? 17  VAL C N   1 
ATOM   3268  C CA  . VAL C 1 2   ? 25.610  85.914  78.230  1.00 33.88 ? 17  VAL C CA  1 
ATOM   3269  C C   . VAL C 1 2   ? 24.766  86.711  79.214  1.00 35.69 ? 17  VAL C C   1 
ATOM   3270  O O   . VAL C 1 2   ? 23.565  86.936  78.987  1.00 35.39 ? 17  VAL C O   1 
ATOM   3271  C CB  . VAL C 1 2   ? 25.791  86.729  76.921  0.00 33.13 ? 17  VAL C CB  1 
ATOM   3272  C CG1 . VAL C 1 2   ? 26.420  88.083  77.224  0.00 32.72 ? 17  VAL C CG1 1 
ATOM   3273  C CG2 . VAL C 1 2   ? 26.667  85.966  75.946  0.00 32.66 ? 17  VAL C CG2 1 
ATOM   3274  N N   . GLY C 1 3   ? 25.392  87.089  80.324  1.00 35.09 ? 18  GLY C N   1 
ATOM   3275  C CA  . GLY C 1 3   ? 24.696  87.850  81.342  1.00 35.05 ? 18  GLY C CA  1 
ATOM   3276  C C   . GLY C 1 3   ? 23.575  87.070  82.010  1.00 35.44 ? 18  GLY C C   1 
ATOM   3277  O O   . GLY C 1 3   ? 22.397  87.443  81.933  1.00 36.17 ? 18  GLY C O   1 
ATOM   3278  N N   . GLY C 1 4   ? 23.942  85.993  82.688  1.00 34.33 ? 19  GLY C N   1 
ATOM   3279  C CA  . GLY C 1 4   ? 22.942  85.194  83.372  1.00 33.08 ? 19  GLY C CA  1 
ATOM   3280  C C   . GLY C 1 4   ? 23.298  84.916  84.823  1.00 28.74 ? 19  GLY C C   1 
ATOM   3281  O O   . GLY C 1 4   ? 24.214  85.542  85.379  1.00 29.45 ? 19  GLY C O   1 
ATOM   3282  N N   . TYR C 1 5   ? 22.561  84.002  85.449  1.00 23.07 ? 20  TYR C N   1 
ATOM   3283  C CA  . TYR C 1 5   ? 22.824  83.643  86.831  1.00 20.21 ? 20  TYR C CA  1 
ATOM   3284  C C   . TYR C 1 5   ? 22.957  82.144  86.891  1.00 21.55 ? 20  TYR C C   1 
ATOM   3285  O O   . TYR C 1 5   ? 22.361  81.451  86.078  1.00 24.52 ? 20  TYR C O   1 
ATOM   3286  C CB  . TYR C 1 5   ? 21.691  84.091  87.737  1.00 17.42 ? 20  TYR C CB  1 
ATOM   3287  C CG  . TYR C 1 5   ? 20.375  83.389  87.503  1.00 14.35 ? 20  TYR C CG  1 
ATOM   3288  C CD1 . TYR C 1 5   ? 20.050  82.238  88.201  1.00 11.16 ? 20  TYR C CD1 1 
ATOM   3289  C CD2 . TYR C 1 5   ? 19.441  83.893  86.597  1.00 14.89 ? 20  TYR C CD2 1 
ATOM   3290  C CE1 . TYR C 1 5   ? 18.830  81.595  88.004  1.00 11.58 ? 20  TYR C CE1 1 
ATOM   3291  C CE2 . TYR C 1 5   ? 18.212  83.264  86.395  1.00 12.45 ? 20  TYR C CE2 1 
ATOM   3292  C CZ  . TYR C 1 5   ? 17.917  82.116  87.097  1.00 12.28 ? 20  TYR C CZ  1 
ATOM   3293  O OH  . TYR C 1 5   ? 16.722  81.476  86.876  1.00 14.00 ? 20  TYR C OH  1 
ATOM   3294  N N   . THR C 1 6   ? 23.754  81.644  87.827  1.00 20.82 ? 21  THR C N   1 
ATOM   3295  C CA  . THR C 1 6   ? 23.934  80.216  87.958  1.00 21.43 ? 21  THR C CA  1 
ATOM   3296  C C   . THR C 1 6   ? 22.605  79.677  88.410  1.00 23.98 ? 21  THR C C   1 
ATOM   3297  O O   . THR C 1 6   ? 22.043  80.202  89.359  1.00 26.83 ? 21  THR C O   1 
ATOM   3298  C CB  . THR C 1 6   ? 24.932  79.891  89.045  1.00 22.44 ? 21  THR C CB  1 
ATOM   3299  O OG1 . THR C 1 6   ? 26.144  80.602  88.796  1.00 24.49 ? 21  THR C OG1 1 
ATOM   3300  C CG2 . THR C 1 6   ? 25.230  78.396  89.060  1.00 26.25 ? 21  THR C CG2 1 
ATOM   3301  N N   . CYS C 1 7   ? 22.098  78.641  87.744  1.00 24.52 ? 22  CYS C N   1 
ATOM   3302  C CA  . CYS C 1 7   ? 20.816  78.053  88.127  1.00 22.62 ? 22  CYS C CA  1 
ATOM   3303  C C   . CYS C 1 7   ? 20.983  77.394  89.498  1.00 23.91 ? 22  CYS C C   1 
ATOM   3304  O O   . CYS C 1 7   ? 20.138  77.555  90.375  1.00 26.99 ? 22  CYS C O   1 
ATOM   3305  C CB  . CYS C 1 7   ? 20.346  77.036  87.080  1.00 20.25 ? 22  CYS C CB  1 
ATOM   3306  S SG  . CYS C 1 7   ? 20.456  77.624  85.351  1.00 17.18 ? 22  CYS C SG  1 
ATOM   3307  N N   . GLY C 1 8   ? 22.103  76.708  89.698  0.00 24.60 ? 23  GLY C N   1 
ATOM   3308  C CA  . GLY C 1 8   ? 22.362  76.061  90.973  0.00 27.25 ? 23  GLY C CA  1 
ATOM   3309  C C   . GLY C 1 8   ? 21.427  74.914  91.306  0.00 30.12 ? 23  GLY C C   1 
ATOM   3310  O O   . GLY C 1 8   ? 20.364  74.768  90.699  0.00 28.76 ? 23  GLY C O   1 
ATOM   3311  N N   . ALA C 1 9   ? 21.838  74.097  92.275  0.00 33.87 ? 24  ALA C N   1 
ATOM   3312  C CA  . ALA C 1 9   ? 21.066  72.937  92.720  0.00 39.14 ? 24  ALA C CA  1 
ATOM   3313  C C   . ALA C 1 9   ? 20.525  72.160  91.521  0.00 45.93 ? 24  ALA C C   1 
ATOM   3314  O O   . ALA C 1 9   ? 21.281  71.472  90.832  0.00 45.19 ? 24  ALA C O   1 
ATOM   3315  C CB  . ALA C 1 9   ? 19.932  73.377  93.649  0.00 39.36 ? 24  ALA C CB  1 
ATOM   3316  N N   . ASN C 1 10  ? 19.231  72.304  91.252  1.00 53.74 ? 25  ASN C N   1 
ATOM   3317  C CA  . ASN C 1 10  ? 18.598  71.630  90.122  1.00 56.50 ? 25  ASN C CA  1 
ATOM   3318  C C   . ASN C 1 10  ? 17.156  72.113  89.963  1.00 51.31 ? 25  ASN C C   1 
ATOM   3319  O O   . ASN C 1 10  ? 16.239  71.663  90.665  1.00 51.62 ? 25  ASN C O   1 
ATOM   3320  C CB  . ASN C 1 10  ? 18.657  70.105  90.283  1.00 64.14 ? 25  ASN C CB  1 
ATOM   3321  C CG  . ASN C 1 10  ? 18.469  69.372  88.962  1.00 72.49 ? 25  ASN C CG  1 
ATOM   3322  O OD1 . ASN C 1 10  ? 18.395  69.987  87.883  1.00 75.45 ? 25  ASN C OD1 1 
ATOM   3323  N ND2 . ASN C 1 10  ? 18.393  68.054  89.037  1.00 78.09 ? 25  ASN C ND2 1 
ATOM   3324  N N   . THR C 1 11  ? 16.987  73.092  89.082  1.00 44.57 ? 26  THR C N   1 
ATOM   3325  C CA  . THR C 1 11  ? 15.686  73.684  88.800  1.00 39.37 ? 26  THR C CA  1 
ATOM   3326  C C   . THR C 1 11  ? 15.400  73.640  87.307  1.00 32.21 ? 26  THR C C   1 
ATOM   3327  O O   . THR C 1 11  ? 14.403  74.171  86.830  1.00 28.72 ? 26  THR C O   1 
ATOM   3328  C CB  . THR C 1 11  ? 15.660  75.123  89.280  1.00 44.04 ? 26  THR C CB  1 
ATOM   3329  O OG1 . THR C 1 11  ? 16.816  75.802  88.777  1.00 45.62 ? 26  THR C OG1 1 
ATOM   3330  C CG2 . THR C 1 11  ? 15.687  75.162  90.804  1.00 47.96 ? 26  THR C CG2 1 
ATOM   3331  N N   . VAL C 1 12  ? 16.319  73.015  86.578  1.00 26.79 ? 27  VAL C N   1 
ATOM   3332  C CA  . VAL C 1 12  ? 16.214  72.836  85.141  1.00 16.66 ? 27  VAL C CA  1 
ATOM   3333  C C   . VAL C 1 12  ? 16.593  71.368  84.962  1.00 14.22 ? 27  VAL C C   1 
ATOM   3334  O O   . VAL C 1 12  ? 17.650  71.058  84.413  1.00 11.01 ? 27  VAL C O   1 
ATOM   3335  C CB  . VAL C 1 12  ? 17.223  73.703  84.360  1.00 12.16 ? 27  VAL C CB  1 
ATOM   3336  C CG1 . VAL C 1 12  ? 16.681  74.022  82.993  1.00 7.40  ? 27  VAL C CG1 1 
ATOM   3337  C CG2 . VAL C 1 12  ? 17.543  74.982  85.107  1.00 10.77 ? 27  VAL C CG2 1 
ATOM   3338  N N   . PRO C 1 13  ? 15.723  70.450  85.434  1.00 8.20  ? 28  PRO C N   1 
ATOM   3339  C CA  . PRO C 1 13  ? 15.851  68.997  85.392  1.00 7.52  ? 28  PRO C CA  1 
ATOM   3340  C C   . PRO C 1 13  ? 15.730  68.471  83.984  1.00 5.46  ? 28  PRO C C   1 
ATOM   3341  O O   . PRO C 1 13  ? 16.285  67.432  83.667  1.00 5.33  ? 28  PRO C O   1 
ATOM   3342  C CB  . PRO C 1 13  ? 14.650  68.531  86.194  1.00 7.11  ? 28  PRO C CB  1 
ATOM   3343  C CG  . PRO C 1 13  ? 14.255  69.724  86.987  1.00 5.49  ? 28  PRO C CG  1 
ATOM   3344  C CD  . PRO C 1 13  ? 14.415  70.795  86.004  1.00 5.00  ? 28  PRO C CD  1 
ATOM   3345  N N   . TYR C 1 14  ? 14.970  69.177  83.158  1.00 5.00  ? 29  TYR C N   1 
ATOM   3346  C CA  . TYR C 1 14  ? 14.766  68.767  81.785  1.00 11.02 ? 29  TYR C CA  1 
ATOM   3347  C C   . TYR C 1 14  ? 15.927  69.097  80.843  1.00 17.03 ? 29  TYR C C   1 
ATOM   3348  O O   . TYR C 1 14  ? 15.903  68.709  79.657  1.00 22.20 ? 29  TYR C O   1 
ATOM   3349  C CB  . TYR C 1 14  ? 13.473  69.374  81.260  1.00 8.62  ? 29  TYR C CB  1 
ATOM   3350  C CG  . TYR C 1 14  ? 13.422  70.860  81.431  1.00 8.74  ? 29  TYR C CG  1 
ATOM   3351  C CD1 . TYR C 1 14  ? 14.061  71.703  80.530  1.00 9.41  ? 29  TYR C CD1 1 
ATOM   3352  C CD2 . TYR C 1 14  ? 12.788  71.431  82.528  1.00 10.25 ? 29  TYR C CD2 1 
ATOM   3353  C CE1 . TYR C 1 14  ? 14.080  73.081  80.724  1.00 8.99  ? 29  TYR C CE1 1 
ATOM   3354  C CE2 . TYR C 1 14  ? 12.804  72.815  82.730  1.00 7.36  ? 29  TYR C CE2 1 
ATOM   3355  C CZ  . TYR C 1 14  ? 13.458  73.625  81.826  1.00 6.66  ? 29  TYR C CZ  1 
ATOM   3356  O OH  . TYR C 1 14  ? 13.555  74.972  82.037  1.00 8.53  ? 29  TYR C OH  1 
ATOM   3357  N N   . GLN C 1 15  ? 16.933  69.816  81.350  1.00 16.83 ? 30  GLN C N   1 
ATOM   3358  C CA  . GLN C 1 15  ? 18.098  70.215  80.539  1.00 12.83 ? 30  GLN C CA  1 
ATOM   3359  C C   . GLN C 1 15  ? 18.988  69.022  80.279  1.00 12.96 ? 30  GLN C C   1 
ATOM   3360  O O   . GLN C 1 15  ? 19.046  68.123  81.114  1.00 12.14 ? 30  GLN C O   1 
ATOM   3361  C CB  . GLN C 1 15  ? 18.915  71.243  81.299  1.00 9.34  ? 30  GLN C CB  1 
ATOM   3362  C CG  . GLN C 1 15  ? 20.130  71.733  80.564  1.00 9.58  ? 30  GLN C CG  1 
ATOM   3363  C CD  . GLN C 1 15  ? 19.850  72.900  79.620  1.00 10.80 ? 30  GLN C CD  1 
ATOM   3364  O OE1 . GLN C 1 15  ? 20.449  72.994  78.544  1.00 14.37 ? 30  GLN C OE1 1 
ATOM   3365  N NE2 . GLN C 1 15  ? 18.969  73.806  80.026  1.00 5.00  ? 30  GLN C NE2 1 
ATOM   3366  N N   . VAL C 1 16  ? 19.607  68.961  79.101  1.00 13.96 ? 31  VAL C N   1 
ATOM   3367  C CA  . VAL C 1 16  ? 20.555  67.868  78.783  1.00 12.03 ? 31  VAL C CA  1 
ATOM   3368  C C   . VAL C 1 16  ? 21.674  68.439  77.935  1.00 13.70 ? 31  VAL C C   1 
ATOM   3369  O O   . VAL C 1 16  ? 21.482  69.462  77.252  1.00 17.29 ? 31  VAL C O   1 
ATOM   3370  C CB  . VAL C 1 16  ? 19.926  66.637  78.017  1.00 9.37  ? 31  VAL C CB  1 
ATOM   3371  C CG1 . VAL C 1 16  ? 18.671  66.164  78.703  1.00 9.92  ? 31  VAL C CG1 1 
ATOM   3372  C CG2 . VAL C 1 16  ? 19.681  66.944  76.544  1.00 5.21  ? 31  VAL C CG2 1 
ATOM   3373  N N   . SER C 1 17  ? 22.847  67.820  78.016  1.00 11.16 ? 32  SER C N   1 
ATOM   3374  C CA  . SER C 1 17  ? 24.006  68.249  77.223  1.00 11.97 ? 32  SER C CA  1 
ATOM   3375  C C   . SER C 1 17  ? 24.253  67.300  76.052  1.00 10.79 ? 32  SER C C   1 
ATOM   3376  O O   . SER C 1 17  ? 24.176  66.075  76.212  1.00 10.45 ? 32  SER C O   1 
ATOM   3377  C CB  . SER C 1 17  ? 25.276  68.336  78.089  1.00 11.60 ? 32  SER C CB  1 
ATOM   3378  O OG  . SER C 1 17  ? 26.445  68.561  77.301  1.00 5.00  ? 32  SER C OG  1 
ATOM   3379  N N   . LEU C 1 18  ? 24.508  67.863  74.876  1.00 8.56  ? 33  LEU C N   1 
ATOM   3380  C CA  . LEU C 1 18  ? 24.786  67.040  73.723  1.00 9.02  ? 33  LEU C CA  1 
ATOM   3381  C C   . LEU C 1 18  ? 26.282  67.043  73.634  1.00 10.32 ? 33  LEU C C   1 
ATOM   3382  O O   . LEU C 1 18  ? 26.879  68.114  73.518  1.00 12.05 ? 33  LEU C O   1 
ATOM   3383  C CB  . LEU C 1 18  ? 24.180  67.625  72.452  1.00 8.26  ? 33  LEU C CB  1 
ATOM   3384  C CG  . LEU C 1 18  ? 22.665  67.502  72.317  1.00 7.84  ? 33  LEU C CG  1 
ATOM   3385  C CD1 . LEU C 1 18  ? 22.280  67.623  70.864  1.00 5.00  ? 33  LEU C CD1 1 
ATOM   3386  C CD2 . LEU C 1 18  ? 22.206  66.160  72.843  1.00 9.44  ? 33  LEU C CD2 1 
ATOM   3387  N N   . ASN C 1 19  ? 26.881  65.858  73.744  1.00 11.32 ? 34  ASN C N   1 
ATOM   3388  C CA  . ASN C 1 19  ? 28.326  65.687  73.695  1.00 12.75 ? 34  ASN C CA  1 
ATOM   3389  C C   . ASN C 1 19  ? 28.788  64.876  72.474  1.00 12.55 ? 34  ASN C C   1 
ATOM   3390  O O   . ASN C 1 19  ? 28.146  63.914  72.068  1.00 12.48 ? 34  ASN C O   1 
ATOM   3391  C CB  . ASN C 1 19  ? 28.797  65.009  74.986  1.00 15.05 ? 34  ASN C CB  1 
ATOM   3392  C CG  . ASN C 1 19  ? 30.244  64.575  74.924  1.00 21.73 ? 34  ASN C CG  1 
ATOM   3393  O OD1 . ASN C 1 19  ? 30.602  63.644  74.191  1.00 24.91 ? 34  ASN C OD1 1 
ATOM   3394  N ND2 . ASN C 1 19  ? 31.089  65.237  75.701  1.00 24.14 ? 34  ASN C ND2 1 
ATOM   3395  N N   . SER C 1 20  ? 29.896  65.301  71.883  1.00 13.10 ? 37  SER C N   1 
ATOM   3396  C CA  . SER C 1 20  ? 30.499  64.628  70.733  1.00 12.16 ? 37  SER C CA  1 
ATOM   3397  C C   . SER C 1 20  ? 31.988  64.788  70.999  1.00 9.81  ? 37  SER C C   1 
ATOM   3398  O O   . SER C 1 20  ? 32.717  65.415  70.232  1.00 8.88  ? 37  SER C O   1 
ATOM   3399  C CB  . SER C 1 20  ? 30.129  65.332  69.423  1.00 13.22 ? 37  SER C CB  1 
ATOM   3400  O OG  . SER C 1 20  ? 30.641  66.666  69.394  1.00 14.67 ? 37  SER C OG  1 
ATOM   3401  N N   . GLY C 1 21  ? 32.415  64.249  72.129  1.00 8.78  ? 38  GLY C N   1 
ATOM   3402  C CA  . GLY C 1 21  ? 33.793  64.354  72.529  1.00 7.47  ? 38  GLY C CA  1 
ATOM   3403  C C   . GLY C 1 21  ? 33.828  65.497  73.511  1.00 8.35  ? 38  GLY C C   1 
ATOM   3404  O O   . GLY C 1 21  ? 34.528  65.451  74.507  1.00 11.05 ? 38  GLY C O   1 
ATOM   3405  N N   . TYR C 1 22  ? 33.010  66.507  73.255  1.00 8.84  ? 39  TYR C N   1 
ATOM   3406  C CA  . TYR C 1 22  ? 32.926  67.684  74.113  1.00 9.60  ? 39  TYR C CA  1 
ATOM   3407  C C   . TYR C 1 22  ? 31.498  68.224  73.998  1.00 9.51  ? 39  TYR C C   1 
ATOM   3408  O O   . TYR C 1 22  ? 30.712  67.775  73.151  1.00 7.24  ? 39  TYR C O   1 
ATOM   3409  C CB  . TYR C 1 22  ? 33.927  68.744  73.656  1.00 10.02 ? 39  TYR C CB  1 
ATOM   3410  C CG  . TYR C 1 22  ? 33.752  69.122  72.206  1.00 13.84 ? 39  TYR C CG  1 
ATOM   3411  C CD1 . TYR C 1 22  ? 34.383  68.399  71.184  1.00 17.02 ? 39  TYR C CD1 1 
ATOM   3412  C CD2 . TYR C 1 22  ? 32.881  70.132  71.847  1.00 15.54 ? 39  TYR C CD2 1 
ATOM   3413  C CE1 . TYR C 1 22  ? 34.126  68.677  69.848  1.00 18.86 ? 39  TYR C CE1 1 
ATOM   3414  C CE2 . TYR C 1 22  ? 32.620  70.416  70.526  1.00 20.01 ? 39  TYR C CE2 1 
ATOM   3415  C CZ  . TYR C 1 22  ? 33.234  69.689  69.530  1.00 21.78 ? 39  TYR C CZ  1 
ATOM   3416  O OH  . TYR C 1 22  ? 32.912  69.972  68.221  1.00 26.09 ? 39  TYR C OH  1 
ATOM   3417  N N   . HIS C 1 23  ? 31.151  69.157  74.875  1.00 8.84  ? 40  HIS C N   1 
ATOM   3418  C CA  . HIS C 1 23  ? 29.824  69.739  74.855  1.00 6.66  ? 40  HIS C CA  1 
ATOM   3419  C C   . HIS C 1 23  ? 29.723  70.662  73.671  1.00 6.24  ? 40  HIS C C   1 
ATOM   3420  O O   . HIS C 1 23  ? 30.553  71.546  73.516  1.00 7.30  ? 40  HIS C O   1 
ATOM   3421  C CB  . HIS C 1 23  ? 29.568  70.541  76.130  1.00 7.23  ? 40  HIS C CB  1 
ATOM   3422  C CG  . HIS C 1 23  ? 28.338  71.391  76.064  1.00 8.90  ? 40  HIS C CG  1 
ATOM   3423  N ND1 . HIS C 1 23  ? 27.132  70.993  76.596  1.00 10.52 ? 40  HIS C ND1 1 
ATOM   3424  C CD2 . HIS C 1 23  ? 28.116  72.598  75.487  1.00 9.89  ? 40  HIS C CD2 1 
ATOM   3425  C CE1 . HIS C 1 23  ? 26.217  71.911  76.344  1.00 14.43 ? 40  HIS C CE1 1 
ATOM   3426  N NE2 . HIS C 1 23  ? 26.788  72.895  75.671  1.00 14.02 ? 40  HIS C NE2 1 
ATOM   3427  N N   . PHE C 1 24  ? 28.701  70.486  72.851  1.00 5.00  ? 41  PHE C N   1 
ATOM   3428  C CA  . PHE C 1 24  ? 28.527  71.365  71.706  1.00 8.28  ? 41  PHE C CA  1 
ATOM   3429  C C   . PHE C 1 24  ? 27.102  71.933  71.556  1.00 11.19 ? 41  PHE C C   1 
ATOM   3430  O O   . PHE C 1 24  ? 26.861  72.828  70.734  1.00 12.84 ? 41  PHE C O   1 
ATOM   3431  C CB  . PHE C 1 24  ? 28.939  70.653  70.440  1.00 6.72  ? 41  PHE C CB  1 
ATOM   3432  C CG  . PHE C 1 24  ? 28.028  69.556  70.055  1.00 5.00  ? 41  PHE C CG  1 
ATOM   3433  C CD1 . PHE C 1 24  ? 27.097  69.746  69.050  1.00 5.00  ? 41  PHE C CD1 1 
ATOM   3434  C CD2 . PHE C 1 24  ? 28.103  68.327  70.676  1.00 5.00  ? 41  PHE C CD2 1 
ATOM   3435  C CE1 . PHE C 1 24  ? 26.252  68.720  68.661  1.00 5.00  ? 41  PHE C CE1 1 
ATOM   3436  C CE2 . PHE C 1 24  ? 27.258  67.283  70.291  1.00 5.00  ? 41  PHE C CE2 1 
ATOM   3437  C CZ  . PHE C 1 24  ? 26.330  67.481  69.282  1.00 5.00  ? 41  PHE C CZ  1 
ATOM   3438  N N   . CYS C 1 25  ? 26.164  71.422  72.349  1.00 9.92  ? 42  CYS C N   1 
ATOM   3439  C CA  . CYS C 1 25  ? 24.787  71.887  72.300  1.00 8.93  ? 42  CYS C CA  1 
ATOM   3440  C C   . CYS C 1 25  ? 24.031  71.416  73.533  1.00 12.52 ? 42  CYS C C   1 
ATOM   3441  O O   . CYS C 1 25  ? 24.552  70.609  74.331  1.00 13.39 ? 42  CYS C O   1 
ATOM   3442  C CB  . CYS C 1 25  ? 24.073  71.335  71.065  1.00 5.00  ? 42  CYS C CB  1 
ATOM   3443  S SG  . CYS C 1 25  ? 24.518  72.123  69.498  1.00 5.53  ? 42  CYS C SG  1 
ATOM   3444  N N   . GLY C 1 26  ? 22.814  71.940  73.687  1.00 10.29 ? 43  GLY C N   1 
ATOM   3445  C CA  . GLY C 1 26  ? 21.957  71.546  74.778  1.00 8.95  ? 43  GLY C CA  1 
ATOM   3446  C C   . GLY C 1 26  ? 20.787  70.818  74.148  1.00 8.31  ? 43  GLY C C   1 
ATOM   3447  O O   . GLY C 1 26  ? 20.794  70.518  72.949  1.00 6.98  ? 43  GLY C O   1 
ATOM   3448  N N   . GLY C 1 27  ? 19.776  70.532  74.956  1.00 8.46  ? 44  GLY C N   1 
ATOM   3449  C CA  . GLY C 1 27  ? 18.588  69.863  74.466  1.00 6.40  ? 44  GLY C CA  1 
ATOM   3450  C C   . GLY C 1 27  ? 17.615  69.725  75.615  1.00 6.54  ? 44  GLY C C   1 
ATOM   3451  O O   . GLY C 1 27  ? 18.006  69.844  76.788  1.00 6.58  ? 44  GLY C O   1 
ATOM   3452  N N   . SER C 1 28  ? 16.349  69.483  75.299  1.00 6.71  ? 45  SER C N   1 
ATOM   3453  C CA  . SER C 1 28  ? 15.344  69.331  76.329  1.00 5.00  ? 45  SER C CA  1 
ATOM   3454  C C   . SER C 1 28  ? 14.754  67.939  76.318  1.00 5.00  ? 45  SER C C   1 
ATOM   3455  O O   . SER C 1 28  ? 14.523  67.353  75.260  1.00 5.00  ? 45  SER C O   1 
ATOM   3456  C CB  . SER C 1 28  ? 14.266  70.374  76.117  1.00 7.19  ? 45  SER C CB  1 
ATOM   3457  O OG  . SER C 1 28  ? 14.871  71.651  75.978  1.00 8.03  ? 45  SER C OG  1 
ATOM   3458  N N   . LEU C 1 29  ? 14.562  67.389  77.506  1.00 5.00  ? 46  LEU C N   1 
ATOM   3459  C CA  . LEU C 1 29  ? 13.987  66.055  77.643  1.00 9.15  ? 46  LEU C CA  1 
ATOM   3460  C C   . LEU C 1 29  ? 12.468  66.170  77.550  1.00 10.82 ? 46  LEU C C   1 
ATOM   3461  O O   . LEU C 1 29  ? 11.835  66.823  78.375  1.00 11.86 ? 46  LEU C O   1 
ATOM   3462  C CB  . LEU C 1 29  ? 14.402  65.443  78.977  1.00 7.33  ? 46  LEU C CB  1 
ATOM   3463  C CG  . LEU C 1 29  ? 14.127  63.961  79.182  1.00 5.00  ? 46  LEU C CG  1 
ATOM   3464  C CD1 . LEU C 1 29  ? 14.585  63.118  78.029  1.00 5.00  ? 46  LEU C CD1 1 
ATOM   3465  C CD2 . LEU C 1 29  ? 14.846  63.564  80.440  1.00 6.97  ? 46  LEU C CD2 1 
ATOM   3466  N N   . ILE C 1 30  ? 11.896  65.573  76.516  1.00 11.68 ? 47  ILE C N   1 
ATOM   3467  C CA  . ILE C 1 30  ? 10.464  65.634  76.306  1.00 12.19 ? 47  ILE C CA  1 
ATOM   3468  C C   . ILE C 1 30  ? 9.766   64.473  76.998  1.00 9.93  ? 47  ILE C C   1 
ATOM   3469  O O   . ILE C 1 30  ? 8.557   64.547  77.260  1.00 11.77 ? 47  ILE C O   1 
ATOM   3470  C CB  . ILE C 1 30  ? 10.136  65.683  74.792  1.00 16.63 ? 47  ILE C CB  1 
ATOM   3471  C CG1 . ILE C 1 30  ? 10.381  67.093  74.267  1.00 18.89 ? 47  ILE C CG1 1 
ATOM   3472  C CG2 . ILE C 1 30  ? 8.693   65.288  74.509  1.00 18.45 ? 47  ILE C CG2 1 
ATOM   3473  C CD1 . ILE C 1 30  ? 10.011  67.235  72.806  1.00 25.99 ? 47  ILE C CD1 1 
ATOM   3474  N N   . ASN C 1 31  ? 10.522  63.416  77.294  1.00 5.49  ? 48  ASN C N   1 
ATOM   3475  C CA  . ASN C 1 31  ? 10.003  62.237  77.988  1.00 5.00  ? 48  ASN C CA  1 
ATOM   3476  C C   . ASN C 1 31  ? 11.044  61.166  77.987  1.00 5.00  ? 48  ASN C C   1 
ATOM   3477  O O   . ASN C 1 31  ? 11.785  61.071  77.045  1.00 9.86  ? 48  ASN C O   1 
ATOM   3478  C CB  . ASN C 1 31  ? 8.749   61.700  77.321  1.00 7.89  ? 48  ASN C CB  1 
ATOM   3479  C CG  . ASN C 1 31  ? 9.026   60.996  76.034  1.00 5.50  ? 48  ASN C CG  1 
ATOM   3480  O OD1 . ASN C 1 31  ? 9.073   61.622  74.973  1.00 5.00  ? 48  ASN C OD1 1 
ATOM   3481  N ND2 . ASN C 1 31  ? 9.179   59.674  76.109  1.00 5.00  ? 48  ASN C ND2 1 
ATOM   3482  N N   . SER C 1 32  ? 11.046  60.314  78.993  1.00 5.00  ? 49  SER C N   1 
ATOM   3483  C CA  . SER C 1 32  ? 12.027  59.230  79.135  1.00 8.55  ? 49  SER C CA  1 
ATOM   3484  C C   . SER C 1 32  ? 13.010  58.905  77.999  1.00 11.01 ? 49  SER C C   1 
ATOM   3485  O O   . SER C 1 32  ? 14.224  58.869  78.214  1.00 12.71 ? 49  SER C O   1 
ATOM   3486  C CB  . SER C 1 32  ? 11.326  57.941  79.563  1.00 8.84  ? 49  SER C CB  1 
ATOM   3487  O OG  . SER C 1 32  ? 10.256  57.641  78.686  1.00 10.82 ? 49  SER C OG  1 
ATOM   3488  N N   . GLN C 1 33  ? 12.495  58.669  76.796  1.00 11.46 ? 50  GLN C N   1 
ATOM   3489  C CA  . GLN C 1 33  ? 13.343  58.320  75.657  1.00 8.49  ? 50  GLN C CA  1 
ATOM   3490  C C   . GLN C 1 33  ? 13.614  59.367  74.582  1.00 7.74  ? 50  GLN C C   1 
ATOM   3491  O O   . GLN C 1 33  ? 14.488  59.137  73.764  1.00 12.91 ? 50  GLN C O   1 
ATOM   3492  C CB  . GLN C 1 33  ? 12.817  57.059  74.975  1.00 5.00  ? 50  GLN C CB  1 
ATOM   3493  C CG  . GLN C 1 33  ? 13.670  55.866  75.152  1.00 5.00  ? 50  GLN C CG  1 
ATOM   3494  C CD  . GLN C 1 33  ? 13.030  54.646  74.585  1.00 5.00  ? 50  GLN C CD  1 
ATOM   3495  O OE1 . GLN C 1 33  ? 13.678  53.851  73.938  1.00 5.00  ? 50  GLN C OE1 1 
ATOM   3496  N NE2 . GLN C 1 33  ? 11.746  54.479  74.831  1.00 5.00  ? 50  GLN C NE2 1 
ATOM   3497  N N   . TRP C 1 34  ? 12.899  60.483  74.539  1.00 5.00  ? 51  TRP C N   1 
ATOM   3498  C CA  . TRP C 1 34  ? 13.153  61.455  73.480  1.00 5.00  ? 51  TRP C CA  1 
ATOM   3499  C C   . TRP C 1 34  ? 13.692  62.794  73.957  1.00 7.83  ? 51  TRP C C   1 
ATOM   3500  O O   . TRP C 1 34  ? 13.315  63.278  75.035  1.00 10.45 ? 51  TRP C O   1 
ATOM   3501  C CB  . TRP C 1 34  ? 11.903  61.678  72.630  1.00 5.01  ? 51  TRP C CB  1 
ATOM   3502  C CG  . TRP C 1 34  ? 11.559  60.535  71.742  1.00 5.00  ? 51  TRP C CG  1 
ATOM   3503  C CD1 . TRP C 1 34  ? 10.840  59.435  72.082  1.00 5.00  ? 51  TRP C CD1 1 
ATOM   3504  C CD2 . TRP C 1 34  ? 11.926  60.370  70.361  1.00 5.00  ? 51  TRP C CD2 1 
ATOM   3505  N NE1 . TRP C 1 34  ? 10.730  58.596  71.008  1.00 5.72  ? 51  TRP C NE1 1 
ATOM   3506  C CE2 . TRP C 1 34  ? 11.390  59.144  69.937  1.00 5.75  ? 51  TRP C CE2 1 
ATOM   3507  C CE3 . TRP C 1 34  ? 12.659  61.137  69.447  1.00 5.00  ? 51  TRP C CE3 1 
ATOM   3508  C CZ2 . TRP C 1 34  ? 11.563  58.659  68.631  1.00 5.00  ? 51  TRP C CZ2 1 
ATOM   3509  C CZ3 . TRP C 1 34  ? 12.830  60.659  68.157  1.00 5.00  ? 51  TRP C CZ3 1 
ATOM   3510  C CH2 . TRP C 1 34  ? 12.285  59.432  67.763  1.00 5.00  ? 51  TRP C CH2 1 
ATOM   3511  N N   . VAL C 1 35  ? 14.528  63.425  73.131  1.00 5.92  ? 52  VAL C N   1 
ATOM   3512  C CA  . VAL C 1 35  ? 15.139  64.712  73.460  1.00 5.00  ? 52  VAL C CA  1 
ATOM   3513  C C   . VAL C 1 35  ? 14.929  65.591  72.255  1.00 6.53  ? 52  VAL C C   1 
ATOM   3514  O O   . VAL C 1 35  ? 15.199  65.164  71.147  1.00 10.85 ? 52  VAL C O   1 
ATOM   3515  C CB  . VAL C 1 35  ? 16.662  64.555  73.658  1.00 5.18  ? 52  VAL C CB  1 
ATOM   3516  C CG1 . VAL C 1 35  ? 17.304  65.879  73.914  1.00 5.04  ? 52  VAL C CG1 1 
ATOM   3517  C CG2 . VAL C 1 35  ? 16.961  63.595  74.790  1.00 5.00  ? 52  VAL C CG2 1 
ATOM   3518  N N   . VAL C 1 36  ? 14.432  66.803  72.444  1.00 6.33  ? 53  VAL C N   1 
ATOM   3519  C CA  . VAL C 1 36  ? 14.219  67.710  71.314  1.00 6.10  ? 53  VAL C CA  1 
ATOM   3520  C C   . VAL C 1 36  ? 15.362  68.713  71.315  1.00 7.73  ? 53  VAL C C   1 
ATOM   3521  O O   . VAL C 1 36  ? 15.770  69.163  72.394  1.00 9.39  ? 53  VAL C O   1 
ATOM   3522  C CB  . VAL C 1 36  ? 12.902  68.474  71.459  1.00 5.00  ? 53  VAL C CB  1 
ATOM   3523  C CG1 . VAL C 1 36  ? 12.948  69.339  72.706  1.00 5.00  ? 53  VAL C CG1 1 
ATOM   3524  C CG2 . VAL C 1 36  ? 12.626  69.312  70.224  1.00 5.00  ? 53  VAL C CG2 1 
ATOM   3525  N N   . SER C 1 37  ? 15.890  69.057  70.139  1.00 7.62  ? 54  SER C N   1 
ATOM   3526  C CA  . SER C 1 37  ? 16.986  70.030  70.057  1.00 6.88  ? 54  SER C CA  1 
ATOM   3527  C C   . SER C 1 37  ? 17.065  70.746  68.710  1.00 8.12  ? 54  SER C C   1 
ATOM   3528  O O   . SER C 1 37  ? 16.241  70.486  67.827  1.00 11.18 ? 54  SER C O   1 
ATOM   3529  C CB  . SER C 1 37  ? 18.306  69.347  70.356  1.00 5.00  ? 54  SER C CB  1 
ATOM   3530  O OG  . SER C 1 37  ? 19.265  70.314  70.684  1.00 5.00  ? 54  SER C OG  1 
ATOM   3531  N N   . ALA C 1 38  ? 18.034  71.655  68.562  1.00 5.55  ? 55  ALA C N   1 
ATOM   3532  C CA  . ALA C 1 38  ? 18.231  72.392  67.313  1.00 5.35  ? 55  ALA C CA  1 
ATOM   3533  C C   . ALA C 1 38  ? 18.771  71.439  66.234  1.00 7.17  ? 55  ALA C C   1 
ATOM   3534  O O   . ALA C 1 38  ? 19.729  70.725  66.458  1.00 5.26  ? 55  ALA C O   1 
ATOM   3535  C CB  . ALA C 1 38  ? 19.196  73.541  67.529  0.00 7.40  ? 55  ALA C CB  1 
ATOM   3536  N N   . ALA C 1 39  ? 18.138  71.403  65.069  1.00 10.60 ? 56  ALA C N   1 
ATOM   3537  C CA  . ALA C 1 39  ? 18.588  70.536  63.963  1.00 11.05 ? 56  ALA C CA  1 
ATOM   3538  C C   . ALA C 1 39  ? 20.026  70.830  63.547  1.00 11.35 ? 56  ALA C C   1 
ATOM   3539  O O   . ALA C 1 39  ? 20.716  69.950  63.058  1.00 16.45 ? 56  ALA C O   1 
ATOM   3540  C CB  . ALA C 1 39  ? 17.676  70.678  62.747  1.00 11.14 ? 56  ALA C CB  1 
ATOM   3541  N N   . HIS C 1 40  ? 20.474  72.072  63.681  1.00 10.21 ? 57  HIS C N   1 
ATOM   3542  C CA  . HIS C 1 40  ? 21.861  72.373  63.355  1.00 8.09  ? 57  HIS C CA  1 
ATOM   3543  C C   . HIS C 1 40  ? 22.822  71.797  64.415  1.00 7.33  ? 57  HIS C C   1 
ATOM   3544  O O   . HIS C 1 40  ? 24.010  71.963  64.322  1.00 10.59 ? 57  HIS C O   1 
ATOM   3545  C CB  . HIS C 1 40  ? 22.085  73.874  63.116  1.00 7.82  ? 57  HIS C CB  1 
ATOM   3546  C CG  . HIS C 1 40  ? 22.109  74.702  64.358  1.00 5.10  ? 57  HIS C CG  1 
ATOM   3547  N ND1 . HIS C 1 40  ? 21.026  75.441  64.788  1.00 6.21  ? 57  HIS C ND1 1 
ATOM   3548  C CD2 . HIS C 1 40  ? 23.115  74.973  65.219  1.00 7.15  ? 57  HIS C CD2 1 
ATOM   3549  C CE1 . HIS C 1 40  ? 21.371  76.138  65.855  1.00 6.12  ? 57  HIS C CE1 1 
ATOM   3550  N NE2 . HIS C 1 40  ? 22.633  75.872  66.136  1.00 5.00  ? 57  HIS C NE2 1 
ATOM   3551  N N   . CYS C 1 41  ? 22.300  71.154  65.447  1.00 7.70  ? 58  CYS C N   1 
ATOM   3552  C CA  . CYS C 1 41  ? 23.147  70.517  66.445  1.00 6.62  ? 58  CYS C CA  1 
ATOM   3553  C C   . CYS C 1 41  ? 23.294  69.048  66.066  1.00 8.55  ? 58  CYS C C   1 
ATOM   3554  O O   . CYS C 1 41  ? 23.785  68.222  66.860  1.00 7.01  ? 58  CYS C O   1 
ATOM   3555  C CB  . CYS C 1 41  ? 22.534  70.614  67.823  1.00 5.00  ? 58  CYS C CB  1 
ATOM   3556  S SG  . CYS C 1 41  ? 22.767  72.263  68.497  1.00 6.04  ? 58  CYS C SG  1 
ATOM   3557  N N   . TYR C 1 42  ? 22.804  68.705  64.874  1.00 8.79  ? 59  TYR C N   1 
ATOM   3558  C CA  . TYR C 1 42  ? 22.916  67.340  64.399  1.00 10.45 ? 59  TYR C CA  1 
ATOM   3559  C C   . TYR C 1 42  ? 24.386  67.028  64.139  1.00 13.14 ? 59  TYR C C   1 
ATOM   3560  O O   . TYR C 1 42  ? 25.112  67.856  63.557  1.00 16.04 ? 59  TYR C O   1 
ATOM   3561  C CB  . TYR C 1 42  ? 22.145  67.126  63.099  1.00 9.81  ? 59  TYR C CB  1 
ATOM   3562  C CG  . TYR C 1 42  ? 22.373  65.727  62.523  1.00 12.65 ? 59  TYR C CG  1 
ATOM   3563  C CD1 . TYR C 1 42  ? 23.452  65.463  61.679  1.00 8.26  ? 59  TYR C CD1 1 
ATOM   3564  C CD2 . TYR C 1 42  ? 21.532  64.656  62.860  1.00 12.89 ? 59  TYR C CD2 1 
ATOM   3565  C CE1 . TYR C 1 42  ? 23.677  64.200  61.203  1.00 5.74  ? 59  TYR C CE1 1 
ATOM   3566  C CE2 . TYR C 1 42  ? 21.768  63.382  62.378  1.00 8.72  ? 59  TYR C CE2 1 
ATOM   3567  C CZ  . TYR C 1 42  ? 22.836  63.171  61.559  1.00 7.75  ? 59  TYR C CZ  1 
ATOM   3568  O OH  . TYR C 1 42  ? 23.087  61.907  61.116  1.00 15.00 ? 59  TYR C OH  1 
ATOM   3569  N N   . LYS C 1 43  ? 24.806  65.839  64.563  1.00 10.01 ? 60  LYS C N   1 
ATOM   3570  C CA  . LYS C 1 43  ? 26.161  65.355  64.382  1.00 7.79  ? 60  LYS C CA  1 
ATOM   3571  C C   . LYS C 1 43  ? 25.981  63.869  64.366  1.00 13.47 ? 60  LYS C C   1 
ATOM   3572  O O   . LYS C 1 43  ? 24.954  63.371  64.817  1.00 17.77 ? 60  LYS C O   1 
ATOM   3573  C CB  . LYS C 1 43  ? 27.058  65.716  65.555  1.00 5.74  ? 60  LYS C CB  1 
ATOM   3574  C CG  . LYS C 1 43  ? 27.729  67.053  65.457  1.00 5.00  ? 60  LYS C CG  1 
ATOM   3575  C CD  . LYS C 1 43  ? 28.701  67.211  66.610  1.00 8.61  ? 60  LYS C CD  1 
ATOM   3576  C CE  . LYS C 1 43  ? 29.546  68.477  66.496  1.00 12.42 ? 60  LYS C CE  1 
ATOM   3577  N NZ  . LYS C 1 43  ? 30.394  68.458  65.275  0.00 12.09 ? 60  LYS C NZ  1 
ATOM   3578  N N   . SER C 1 44  ? 26.949  63.157  63.806  1.00 17.14 ? 61  SER C N   1 
ATOM   3579  C CA  . SER C 1 44  ? 26.887  61.706  63.744  1.00 17.93 ? 61  SER C CA  1 
ATOM   3580  C C   . SER C 1 44  ? 27.215  61.168  65.141  1.00 19.38 ? 61  SER C C   1 
ATOM   3581  O O   . SER C 1 44  ? 28.114  61.674  65.808  1.00 21.20 ? 61  SER C O   1 
ATOM   3582  C CB  . SER C 1 44  ? 27.868  61.192  62.681  1.00 18.30 ? 61  SER C CB  1 
ATOM   3583  O OG  . SER C 1 44  ? 29.115  61.866  62.740  0.00 18.63 ? 61  SER C OG  1 
ATOM   3584  N N   . GLY C 1 45  ? 26.430  60.209  65.615  1.00 19.51 ? 62  GLY C N   1 
ATOM   3585  C CA  . GLY C 1 45  ? 26.658  59.641  66.933  1.00 21.75 ? 62  GLY C CA  1 
ATOM   3586  C C   . GLY C 1 45  ? 26.826  60.630  68.082  1.00 22.22 ? 62  GLY C C   1 
ATOM   3587  O O   . GLY C 1 45  ? 27.946  60.831  68.562  1.00 26.59 ? 62  GLY C O   1 
ATOM   3588  N N   . ILE C 1 46  ? 25.728  61.243  68.523  1.00 18.34 ? 63  ILE C N   1 
ATOM   3589  C CA  . ILE C 1 46  ? 25.749  62.195  69.634  1.00 14.21 ? 63  ILE C CA  1 
ATOM   3590  C C   . ILE C 1 46  ? 25.511  61.429  70.939  1.00 12.54 ? 63  ILE C C   1 
ATOM   3591  O O   . ILE C 1 46  ? 24.894  60.362  70.937  1.00 14.77 ? 63  ILE C O   1 
ATOM   3592  C CB  . ILE C 1 46  ? 24.624  63.209  69.477  1.00 14.41 ? 63  ILE C CB  1 
ATOM   3593  C CG1 . ILE C 1 46  ? 24.766  63.938  68.148  1.00 14.64 ? 63  ILE C CG1 1 
ATOM   3594  C CG2 . ILE C 1 46  ? 24.576  64.160  70.665  1.00 15.00 ? 63  ILE C CG2 1 
ATOM   3595  C CD1 . ILE C 1 46  ? 23.686  64.982  67.912  1.00 15.88 ? 63  ILE C CD1 1 
ATOM   3596  N N   . GLN C 1 47  ? 26.030  61.939  72.045  1.00 11.27 ? 64  GLN C N   1 
ATOM   3597  C CA  . GLN C 1 47  ? 25.831  61.293  73.340  1.00 14.16 ? 64  GLN C CA  1 
ATOM   3598  C C   . GLN C 1 47  ? 25.184  62.336  74.244  1.00 14.16 ? 64  GLN C C   1 
ATOM   3599  O O   . GLN C 1 47  ? 25.681  63.468  74.373  1.00 12.42 ? 64  GLN C O   1 
ATOM   3600  C CB  . GLN C 1 47  ? 27.158  60.812  73.945  1.00 17.78 ? 64  GLN C CB  1 
ATOM   3601  C CG  . GLN C 1 47  ? 27.922  59.830  73.073  1.00 21.27 ? 64  GLN C CG  1 
ATOM   3602  C CD  . GLN C 1 47  ? 29.213  59.362  73.701  1.00 21.92 ? 64  GLN C CD  1 
ATOM   3603  O OE1 . GLN C 1 47  ? 29.315  58.224  74.145  1.00 23.26 ? 64  GLN C OE1 1 
ATOM   3604  N NE2 . GLN C 1 47  ? 30.205  60.235  73.745  1.00 22.38 ? 64  GLN C NE2 1 
ATOM   3605  N N   . VAL C 1 48  ? 24.066  61.950  74.860  1.00 13.97 ? 65  VAL C N   1 
ATOM   3606  C CA  . VAL C 1 48  ? 23.300  62.844  75.724  1.00 10.89 ? 65  VAL C CA  1 
ATOM   3607  C C   . VAL C 1 48  ? 23.700  62.722  77.191  1.00 12.12 ? 65  VAL C C   1 
ATOM   3608  O O   . VAL C 1 48  ? 23.803  61.615  77.716  1.00 10.51 ? 65  VAL C O   1 
ATOM   3609  C CB  . VAL C 1 48  ? 21.775  62.573  75.582  1.00 5.00  ? 65  VAL C CB  1 
ATOM   3610  C CG1 . VAL C 1 48  ? 20.998  63.605  76.330  1.00 5.40  ? 65  VAL C CG1 1 
ATOM   3611  C CG2 . VAL C 1 48  ? 21.348  62.559  74.123  1.00 5.00  ? 65  VAL C CG2 1 
ATOM   3612  N N   . ARG C 1 49  ? 24.014  63.852  77.814  1.00 16.20 ? 66  ARG C N   1 
ATOM   3613  C CA  . ARG C 1 49  ? 24.361  63.891  79.234  1.00 22.22 ? 66  ARG C CA  1 
ATOM   3614  C C   . ARG C 1 49  ? 23.204  64.579  79.913  1.00 23.99 ? 66  ARG C C   1 
ATOM   3615  O O   . ARG C 1 49  ? 22.990  65.772  79.703  1.00 22.38 ? 66  ARG C O   1 
ATOM   3616  C CB  . ARG C 1 49  ? 25.613  64.723  79.493  1.00 28.51 ? 66  ARG C CB  1 
ATOM   3617  C CG  . ARG C 1 49  ? 26.914  64.057  79.064  1.00 42.93 ? 66  ARG C CG  1 
ATOM   3618  C CD  . ARG C 1 49  ? 28.138  64.969  79.303  1.00 52.35 ? 66  ARG C CD  1 
ATOM   3619  N NE  . ARG C 1 49  ? 28.470  65.151  80.726  1.00 58.46 ? 66  ARG C NE  1 
ATOM   3620  C CZ  . ARG C 1 49  ? 29.336  66.053  81.192  1.00 56.91 ? 66  ARG C CZ  1 
ATOM   3621  N NH1 . ARG C 1 49  ? 29.958  66.865  80.347  1.00 56.91 ? 66  ARG C NH1 1 
ATOM   3622  N NH2 . ARG C 1 49  ? 29.601  66.126  82.497  1.00 53.99 ? 66  ARG C NH2 1 
ATOM   3623  N N   . LEU C 1 50  ? 22.428  63.823  80.684  1.00 27.49 ? 67  LEU C N   1 
ATOM   3624  C CA  . LEU C 1 50  ? 21.267  64.372  81.399  1.00 27.44 ? 67  LEU C CA  1 
ATOM   3625  C C   . LEU C 1 50  ? 21.611  64.663  82.865  1.00 30.11 ? 67  LEU C C   1 
ATOM   3626  O O   . LEU C 1 50  ? 22.682  64.279  83.347  1.00 35.02 ? 67  LEU C O   1 
ATOM   3627  C CB  . LEU C 1 50  ? 20.093  63.395  81.344  1.00 23.66 ? 67  LEU C CB  1 
ATOM   3628  C CG  . LEU C 1 50  ? 19.731  62.771  79.999  1.00 20.92 ? 67  LEU C CG  1 
ATOM   3629  C CD1 . LEU C 1 50  ? 20.584  61.569  79.729  1.00 20.03 ? 67  LEU C CD1 1 
ATOM   3630  C CD2 . LEU C 1 50  ? 18.323  62.319  80.055  1.00 23.45 ? 67  LEU C CD2 1 
ATOM   3631  N N   . GLY C 1 51  ? 20.707  65.338  83.564  1.00 30.08 ? 69  GLY C N   1 
ATOM   3632  C CA  . GLY C 1 51  ? 20.918  65.661  84.963  1.00 35.32 ? 69  GLY C CA  1 
ATOM   3633  C C   . GLY C 1 51  ? 22.281  66.239  85.308  1.00 39.71 ? 69  GLY C C   1 
ATOM   3634  O O   . GLY C 1 51  ? 22.836  65.953  86.372  1.00 41.75 ? 69  GLY C O   1 
ATOM   3635  N N   . GLU C 1 52  ? 22.825  67.050  84.409  1.00 40.80 ? 70  GLU C N   1 
ATOM   3636  C CA  . GLU C 1 52  ? 24.125  67.677  84.611  1.00 41.02 ? 70  GLU C CA  1 
ATOM   3637  C C   . GLU C 1 52  ? 24.019  68.932  85.479  1.00 42.99 ? 70  GLU C C   1 
ATOM   3638  O O   . GLU C 1 52  ? 22.980  69.616  85.512  1.00 40.48 ? 70  GLU C O   1 
ATOM   3639  C CB  . GLU C 1 52  ? 24.739  68.064  83.265  1.00 37.23 ? 70  GLU C CB  1 
ATOM   3640  C CG  . GLU C 1 52  ? 25.130  66.916  82.394  1.00 34.28 ? 70  GLU C CG  1 
ATOM   3641  C CD  . GLU C 1 52  ? 26.295  66.181  82.952  1.00 34.56 ? 70  GLU C CD  1 
ATOM   3642  O OE1 . GLU C 1 52  ? 27.150  66.817  83.607  1.00 34.00 ? 70  GLU C OE1 1 
ATOM   3643  O OE2 . GLU C 1 52  ? 26.354  64.961  82.734  1.00 35.34 ? 70  GLU C OE2 1 
ATOM   3644  N N   . ASP C 1 53  ? 25.083  69.191  86.227  1.00 43.92 ? 71  ASP C N   1 
ATOM   3645  C CA  . ASP C 1 53  ? 25.169  70.379  87.061  1.00 43.21 ? 71  ASP C CA  1 
ATOM   3646  C C   . ASP C 1 53  ? 26.421  71.036  86.517  1.00 43.16 ? 71  ASP C C   1 
ATOM   3647  O O   . ASP C 1 53  ? 26.365  72.088  85.870  1.00 42.42 ? 71  ASP C O   1 
ATOM   3648  C CB  . ASP C 1 53  ? 25.349  70.009  88.532  0.00 39.98 ? 71  ASP C CB  1 
ATOM   3649  C CG  . ASP C 1 53  ? 25.385  71.224  89.438  0.00 39.29 ? 71  ASP C CG  1 
ATOM   3650  O OD1 . ASP C 1 53  ? 26.497  71.660  89.806  0.00 39.96 ? 71  ASP C OD1 1 
ATOM   3651  O OD2 . ASP C 1 53  ? 24.302  71.744  89.779  0.00 40.07 ? 71  ASP C OD2 1 
ATOM   3652  N N   . ASN C 1 54  ? 27.542  70.356  86.711  1.00 42.54 ? 72  ASN C N   1 
ATOM   3653  C CA  . ASN C 1 54  ? 28.817  70.838  86.204  1.00 45.16 ? 72  ASN C CA  1 
ATOM   3654  C C   . ASN C 1 54  ? 29.123  69.869  85.065  1.00 46.00 ? 72  ASN C C   1 
ATOM   3655  O O   . ASN C 1 54  ? 28.956  68.649  85.226  1.00 46.18 ? 72  ASN C O   1 
ATOM   3656  C CB  . ASN C 1 54  ? 29.887  70.769  87.302  1.00 46.22 ? 72  ASN C CB  1 
ATOM   3657  C CG  . ASN C 1 54  ? 31.269  71.142  86.806  0.00 44.31 ? 72  ASN C CG  1 
ATOM   3658  O OD1 . ASN C 1 54  ? 31.860  70.436  85.992  0.00 43.73 ? 72  ASN C OD1 1 
ATOM   3659  N ND2 . ASN C 1 54  ? 31.807  72.236  87.324  0.00 43.99 ? 72  ASN C ND2 1 
ATOM   3660  N N   . ILE C 1 55  ? 29.465  70.396  83.893  1.00 46.67 ? 73  ILE C N   1 
ATOM   3661  C CA  . ILE C 1 55  ? 29.758  69.518  82.761  1.00 46.20 ? 73  ILE C CA  1 
ATOM   3662  C C   . ILE C 1 55  ? 31.225  69.107  82.698  1.00 48.99 ? 73  ILE C C   1 
ATOM   3663  O O   . ILE C 1 55  ? 31.837  69.107  81.618  1.00 52.51 ? 73  ILE C O   1 
ATOM   3664  C CB  . ILE C 1 55  ? 29.297  70.108  81.394  1.00 43.18 ? 73  ILE C CB  1 
ATOM   3665  C CG1 . ILE C 1 55  ? 29.527  71.616  81.347  1.00 42.43 ? 73  ILE C CG1 1 
ATOM   3666  C CG2 . ILE C 1 55  ? 27.862  69.754  81.125  1.00 40.69 ? 73  ILE C CG2 1 
ATOM   3667  C CD1 . ILE C 1 55  ? 30.983  72.021  81.189  1.00 42.82 ? 73  ILE C CD1 1 
ATOM   3668  N N   . ASN C 1 56  ? 31.784  68.748  83.853  1.00 49.05 ? 74  ASN C N   1 
ATOM   3669  C CA  . ASN C 1 56  ? 33.174  68.316  83.936  1.00 50.68 ? 74  ASN C CA  1 
ATOM   3670  C C   . ASN C 1 56  ? 33.362  67.394  85.143  1.00 52.95 ? 74  ASN C C   1 
ATOM   3671  O O   . ASN C 1 56  ? 34.127  66.423  85.098  1.00 51.41 ? 74  ASN C O   1 
ATOM   3672  C CB  . ASN C 1 56  ? 34.112  69.533  84.016  1.00 51.20 ? 74  ASN C CB  1 
ATOM   3673  C CG  . ASN C 1 56  ? 34.107  70.371  82.731  1.00 51.71 ? 74  ASN C CG  1 
ATOM   3674  O OD1 . ASN C 1 56  ? 33.827  71.574  82.756  1.00 49.88 ? 74  ASN C OD1 1 
ATOM   3675  N ND2 . ASN C 1 56  ? 34.396  69.729  81.601  1.00 50.78 ? 74  ASN C ND2 1 
ATOM   3676  N N   . VAL C 1 57  ? 32.635  67.679  86.218  1.00 55.71 ? 75  VAL C N   1 
ATOM   3677  C CA  . VAL C 1 57  ? 32.727  66.866  87.435  1.00 57.45 ? 75  VAL C CA  1 
ATOM   3678  C C   . VAL C 1 57  ? 31.449  66.059  87.655  1.00 60.02 ? 75  VAL C C   1 
ATOM   3679  O O   . VAL C 1 57  ? 30.365  66.517  87.291  1.00 60.21 ? 75  VAL C O   1 
ATOM   3680  C CB  . VAL C 1 57  ? 32.990  67.751  88.679  0.00 55.93 ? 75  VAL C CB  1 
ATOM   3681  C CG1 . VAL C 1 57  ? 33.267  66.883  89.899  0.00 55.44 ? 75  VAL C CG1 1 
ATOM   3682  C CG2 . VAL C 1 57  ? 34.157  68.695  88.423  0.00 55.38 ? 75  VAL C CG2 1 
ATOM   3683  N N   . VAL C 1 58  ? 31.569  64.864  88.240  1.00 61.76 ? 76  VAL C N   1 
ATOM   3684  C CA  . VAL C 1 58  ? 30.393  64.016  88.500  1.00 62.45 ? 76  VAL C CA  1 
ATOM   3685  C C   . VAL C 1 58  ? 29.534  64.585  89.653  1.00 56.09 ? 76  VAL C C   1 
ATOM   3686  O O   . VAL C 1 58  ? 29.647  64.166  90.816  1.00 58.17 ? 76  VAL C O   1 
ATOM   3687  C CB  . VAL C 1 58  ? 30.785  62.509  88.800  1.00 69.58 ? 76  VAL C CB  1 
ATOM   3688  C CG1 . VAL C 1 58  ? 29.527  61.670  89.111  1.00 72.46 ? 76  VAL C CG1 1 
ATOM   3689  C CG2 . VAL C 1 58  ? 31.536  61.886  87.606  1.00 72.92 ? 76  VAL C CG2 1 
ATOM   3690  N N   . GLU C 1 59  ? 28.691  65.559  89.333  0.00 45.62 ? 77  GLU C N   1 
ATOM   3691  C CA  . GLU C 1 59  ? 27.842  66.173  90.346  0.00 37.24 ? 77  GLU C CA  1 
ATOM   3692  C C   . GLU C 1 59  ? 26.614  65.325  90.661  0.00 33.72 ? 77  GLU C C   1 
ATOM   3693  O O   . GLU C 1 59  ? 25.480  65.710  90.360  0.00 34.29 ? 77  GLU C O   1 
ATOM   3694  C CB  . GLU C 1 59  ? 27.434  67.584  89.920  0.00 35.89 ? 77  GLU C CB  1 
ATOM   3695  C CG  . GLU C 1 59  ? 28.598  68.561  89.811  0.00 28.44 ? 77  GLU C CG  1 
ATOM   3696  C CD  . GLU C 1 59  ? 29.307  68.786  91.135  0.00 22.79 ? 77  GLU C CD  1 
ATOM   3697  O OE1 . GLU C 1 59  ? 28.788  69.560  91.966  0.00 20.41 ? 77  GLU C OE1 1 
ATOM   3698  O OE2 . GLU C 1 59  ? 30.386  68.191  91.342  0.00 20.37 ? 77  GLU C OE2 1 
ATOM   3699  N N   . GLY C 1 60  ? 26.854  64.167  91.269  0.00 30.04 ? 78  GLY C N   1 
ATOM   3700  C CA  . GLY C 1 60  ? 25.774  63.269  91.633  0.00 24.17 ? 78  GLY C CA  1 
ATOM   3701  C C   . GLY C 1 60  ? 25.088  62.645  90.434  0.00 20.36 ? 78  GLY C C   1 
ATOM   3702  O O   . GLY C 1 60  ? 25.368  61.502  90.076  0.00 19.00 ? 78  GLY C O   1 
ATOM   3703  N N   . ASN C 1 61  ? 24.189  63.399  89.813  0.00 18.16 ? 79  ASN C N   1 
ATOM   3704  C CA  . ASN C 1 61  ? 23.453  62.918  88.651  0.00 16.87 ? 79  ASN C CA  1 
ATOM   3705  C C   . ASN C 1 61  ? 24.370  62.894  87.438  0.00 16.34 ? 79  ASN C C   1 
ATOM   3706  O O   . ASN C 1 61  ? 24.851  63.936  86.990  0.00 16.17 ? 79  ASN C O   1 
ATOM   3707  C CB  . ASN C 1 61  ? 22.246  63.817  88.371  0.00 16.40 ? 79  ASN C CB  1 
ATOM   3708  C CG  . ASN C 1 61  ? 21.330  63.954  89.567  0.00 16.18 ? 79  ASN C CG  1 
ATOM   3709  O OD1 . ASN C 1 61  ? 20.668  62.999  89.970  0.00 16.03 ? 79  ASN C OD1 1 
ATOM   3710  N ND2 . ASN C 1 61  ? 21.282  65.148  90.139  0.00 16.07 ? 79  ASN C ND2 1 
ATOM   3711  N N   . GLU C 1 62  ? 24.640  61.696  86.933  0.00 15.99 ? 80  GLU C N   1 
ATOM   3712  C CA  . GLU C 1 62  ? 25.504  61.534  85.773  0.00 15.79 ? 80  GLU C CA  1 
ATOM   3713  C C   . GLU C 1 62  ? 24.909  60.463  84.871  0.00 15.57 ? 80  GLU C C   1 
ATOM   3714  O O   . GLU C 1 62  ? 24.827  59.295  85.253  0.00 15.55 ? 80  GLU C O   1 
ATOM   3715  C CB  . GLU C 1 62  ? 26.909  61.125  86.222  0.00 15.90 ? 80  GLU C CB  1 
ATOM   3716  C CG  . GLU C 1 62  ? 28.034  61.881  85.527  0.00 16.09 ? 80  GLU C CG  1 
ATOM   3717  C CD  . GLU C 1 62  ? 27.992  63.381  85.780  0.00 16.05 ? 80  GLU C CD  1 
ATOM   3718  O OE1 . GLU C 1 62  ? 27.635  63.797  86.904  0.00 16.12 ? 80  GLU C OE1 1 
ATOM   3719  O OE2 . GLU C 1 62  ? 28.326  64.147  84.853  0.00 16.16 ? 80  GLU C OE2 1 
ATOM   3720  N N   . GLN C 1 63  ? 24.462  60.870  83.688  0.00 15.29 ? 81  GLN C N   1 
ATOM   3721  C CA  . GLN C 1 63  ? 23.861  59.937  82.744  0.00 14.73 ? 81  GLN C CA  1 
ATOM   3722  C C   . GLN C 1 63  ? 24.291  60.185  81.304  0.00 13.94 ? 81  GLN C C   1 
ATOM   3723  O O   . GLN C 1 63  ? 23.795  61.109  80.658  0.00 14.22 ? 81  GLN C O   1 
ATOM   3724  C CB  . GLN C 1 63  ? 22.331  60.006  82.824  0.00 15.11 ? 81  GLN C CB  1 
ATOM   3725  C CG  . GLN C 1 63  ? 21.736  59.566  84.150  0.00 15.24 ? 81  GLN C CG  1 
ATOM   3726  C CD  . GLN C 1 63  ? 20.224  59.677  84.177  0.00 15.91 ? 81  GLN C CD  1 
ATOM   3727  O OE1 . GLN C 1 63  ? 19.545  59.350  83.204  0.00 15.88 ? 81  GLN C OE1 1 
ATOM   3728  N NE2 . GLN C 1 63  ? 19.689  60.138  85.297  0.00 15.87 ? 81  GLN C NE2 1 
ATOM   3729  N N   . PHE C 1 64  ? 25.260  59.407  80.830  1.00 13.57 ? 82  PHE C N   1 
ATOM   3730  C CA  . PHE C 1 64  ? 25.723  59.509  79.441  1.00 12.26 ? 82  PHE C CA  1 
ATOM   3731  C C   . PHE C 1 64  ? 25.010  58.414  78.626  1.00 10.71 ? 82  PHE C C   1 
ATOM   3732  O O   . PHE C 1 64  ? 25.285  57.218  78.810  1.00 11.22 ? 82  PHE C O   1 
ATOM   3733  C CB  . PHE C 1 64  ? 27.241  59.295  79.339  1.00 11.82 ? 82  PHE C CB  1 
ATOM   3734  C CG  . PHE C 1 64  ? 28.060  60.283  80.125  0.00 13.66 ? 82  PHE C CG  1 
ATOM   3735  C CD1 . PHE C 1 64  ? 27.823  60.498  81.480  0.00 14.07 ? 82  PHE C CD1 1 
ATOM   3736  C CD2 . PHE C 1 64  ? 29.091  60.982  79.509  0.00 14.29 ? 82  PHE C CD2 1 
ATOM   3737  C CE1 . PHE C 1 64  ? 28.600  61.393  82.206  0.00 14.70 ? 82  PHE C CE1 1 
ATOM   3738  C CE2 . PHE C 1 64  ? 29.875  61.880  80.228  0.00 14.56 ? 82  PHE C CE2 1 
ATOM   3739  C CZ  . PHE C 1 64  ? 29.629  62.086  81.579  0.00 14.87 ? 82  PHE C CZ  1 
ATOM   3740  N N   . ILE C 1 65  ? 24.082  58.811  77.758  1.00 6.95  ? 83  ILE C N   1 
ATOM   3741  C CA  . ILE C 1 65  ? 23.349  57.855  76.934  1.00 6.95  ? 83  ILE C CA  1 
ATOM   3742  C C   . ILE C 1 65  ? 23.566  58.064  75.440  1.00 5.07  ? 83  ILE C C   1 
ATOM   3743  O O   . ILE C 1 65  ? 23.504  59.190  74.939  1.00 5.00  ? 83  ILE C O   1 
ATOM   3744  C CB  . ILE C 1 65  ? 21.851  57.958  77.185  1.00 9.59  ? 83  ILE C CB  1 
ATOM   3745  C CG1 . ILE C 1 65  ? 21.553  57.778  78.670  1.00 13.37 ? 83  ILE C CG1 1 
ATOM   3746  C CG2 . ILE C 1 65  ? 21.095  56.925  76.343  1.00 10.03 ? 83  ILE C CG2 1 
ATOM   3747  C CD1 . ILE C 1 65  ? 20.079  57.927  78.996  1.00 18.54 ? 83  ILE C CD1 1 
ATOM   3748  N N   . SER C 1 66  ? 23.801  56.982  74.718  1.00 5.00  ? 84  SER C N   1 
ATOM   3749  C CA  . SER C 1 66  ? 23.996  57.098  73.288  1.00 5.72  ? 84  SER C CA  1 
ATOM   3750  C C   . SER C 1 66  ? 22.644  57.390  72.631  1.00 7.42  ? 84  SER C C   1 
ATOM   3751  O O   . SER C 1 66  ? 21.599  57.036  73.184  1.00 8.57  ? 84  SER C O   1 
ATOM   3752  C CB  . SER C 1 66  ? 24.550  55.792  72.754  1.00 5.72  ? 84  SER C CB  1 
ATOM   3753  O OG  . SER C 1 66  ? 25.440  55.201  73.686  0.00 6.37  ? 84  SER C OG  1 
ATOM   3754  N N   . ALA C 1 67  ? 22.659  58.031  71.465  1.00 8.19  ? 85  ALA C N   1 
ATOM   3755  C CA  . ALA C 1 67  ? 21.424  58.348  70.745  1.00 10.04 ? 85  ALA C CA  1 
ATOM   3756  C C   . ALA C 1 67  ? 21.127  57.323  69.671  1.00 10.79 ? 85  ALA C C   1 
ATOM   3757  O O   . ALA C 1 67  ? 21.922  57.163  68.771  1.00 13.01 ? 85  ALA C O   1 
ATOM   3758  C CB  . ALA C 1 67  ? 21.531  59.713  70.113  1.00 8.60  ? 85  ALA C CB  1 
ATOM   3759  N N   . SER C 1 68  ? 19.988  56.641  69.753  1.00 14.03 ? 86  SER C N   1 
ATOM   3760  C CA  . SER C 1 68  ? 19.611  55.630  68.748  1.00 13.59 ? 86  SER C CA  1 
ATOM   3761  C C   . SER C 1 68  ? 19.293  56.280  67.377  1.00 11.80 ? 86  SER C C   1 
ATOM   3762  O O   . SER C 1 68  ? 20.035  56.104  66.413  1.00 12.97 ? 86  SER C O   1 
ATOM   3763  C CB  . SER C 1 68  ? 18.440  54.762  69.257  1.00 10.67 ? 86  SER C CB  1 
ATOM   3764  O OG  . SER C 1 68  ? 18.209  53.645  68.414  0.00 10.91 ? 86  SER C OG  1 
ATOM   3765  N N   . LYS C 1 69  ? 18.217  57.053  67.297  1.00 9.65  ? 87  LYS C N   1 
ATOM   3766  C CA  . LYS C 1 69  ? 17.850  57.714  66.051  1.00 8.55  ? 87  LYS C CA  1 
ATOM   3767  C C   . LYS C 1 69  ? 18.002  59.201  66.290  1.00 9.41  ? 87  LYS C C   1 
ATOM   3768  O O   . LYS C 1 69  ? 17.627  59.673  67.348  1.00 15.73 ? 87  LYS C O   1 
ATOM   3769  C CB  . LYS C 1 69  ? 16.369  57.452  65.690  1.00 7.54  ? 87  LYS C CB  1 
ATOM   3770  C CG  . LYS C 1 69  ? 15.984  56.024  65.281  1.00 7.46  ? 87  LYS C CG  1 
ATOM   3771  C CD  . LYS C 1 69  ? 15.921  55.087  66.484  0.00 7.56  ? 87  LYS C CD  1 
ATOM   3772  C CE  . LYS C 1 69  ? 15.473  53.681  66.099  0.00 7.66  ? 87  LYS C CE  1 
ATOM   3773  N NZ  . LYS C 1 69  ? 14.099  53.652  65.524  0.00 7.82  ? 87  LYS C NZ  1 
ATOM   3774  N N   . SER C 1 70  ? 18.603  59.934  65.364  1.00 8.79  ? 88  SER C N   1 
ATOM   3775  C CA  . SER C 1 70  ? 18.703  61.395  65.496  1.00 7.33  ? 88  SER C CA  1 
ATOM   3776  C C   . SER C 1 70  ? 17.956  61.897  64.255  1.00 7.09  ? 88  SER C C   1 
ATOM   3777  O O   . SER C 1 70  ? 18.484  61.924  63.135  1.00 5.00  ? 88  SER C O   1 
ATOM   3778  C CB  . SER C 1 70  ? 20.155  61.877  65.522  1.00 8.01  ? 88  SER C CB  1 
ATOM   3779  O OG  . SER C 1 70  ? 20.896  61.232  66.549  0.00 6.10  ? 88  SER C OG  1 
ATOM   3780  N N   . ILE C 1 71  ? 16.672  62.177  64.457  1.00 9.33  ? 89  ILE C N   1 
ATOM   3781  C CA  . ILE C 1 71  ? 15.768  62.615  63.389  1.00 9.87  ? 89  ILE C CA  1 
ATOM   3782  C C   . ILE C 1 71  ? 15.652  64.143  63.196  1.00 8.91  ? 89  ILE C C   1 
ATOM   3783  O O   . ILE C 1 71  ? 15.007  64.842  63.971  1.00 8.21  ? 89  ILE C O   1 
ATOM   3784  C CB  . ILE C 1 71  ? 14.351  61.994  63.593  1.00 8.71  ? 89  ILE C CB  1 
ATOM   3785  C CG1 . ILE C 1 71  ? 14.436  60.464  63.633  1.00 5.00  ? 89  ILE C CG1 1 
ATOM   3786  C CG2 . ILE C 1 71  ? 13.446  62.414  62.463  1.00 10.30 ? 89  ILE C CG2 1 
ATOM   3787  C CD1 . ILE C 1 71  ? 13.223  59.762  64.152  1.00 5.00  ? 89  ILE C CD1 1 
ATOM   3788  N N   . VAL C 1 72  ? 16.277  64.642  62.144  1.00 8.65  ? 90  VAL C N   1 
ATOM   3789  C CA  . VAL C 1 72  ? 16.265  66.056  61.814  1.00 9.83  ? 90  VAL C CA  1 
ATOM   3790  C C   . VAL C 1 72  ? 14.941  66.396  61.086  1.00 10.06 ? 90  VAL C C   1 
ATOM   3791  O O   . VAL C 1 72  ? 14.347  65.536  60.437  1.00 10.63 ? 90  VAL C O   1 
ATOM   3792  C CB  . VAL C 1 72  ? 17.525  66.394  60.923  1.00 9.08  ? 90  VAL C CB  1 
ATOM   3793  C CG1 . VAL C 1 72  ? 17.391  67.754  60.275  1.00 12.18 ? 90  VAL C CG1 1 
ATOM   3794  C CG2 . VAL C 1 72  ? 18.805  66.350  61.764  1.00 5.00  ? 90  VAL C CG2 1 
ATOM   3795  N N   . HIS C 1 73  ? 14.440  67.619  61.246  1.00 9.63  ? 91  HIS C N   1 
ATOM   3796  C CA  . HIS C 1 73  ? 13.211  68.002  60.575  1.00 11.47 ? 91  HIS C CA  1 
ATOM   3797  C C   . HIS C 1 73  ? 13.424  68.017  59.061  1.00 13.90 ? 91  HIS C C   1 
ATOM   3798  O O   . HIS C 1 73  ? 14.275  68.738  58.560  1.00 15.60 ? 91  HIS C O   1 
ATOM   3799  C CB  . HIS C 1 73  ? 12.737  69.377  61.040  1.00 13.25 ? 91  HIS C CB  1 
ATOM   3800  C CG  . HIS C 1 73  ? 11.402  69.758  60.481  1.00 16.78 ? 91  HIS C CG  1 
ATOM   3801  N ND1 . HIS C 1 73  ? 11.235  70.240  59.196  1.00 16.42 ? 91  HIS C ND1 1 
ATOM   3802  C CD2 . HIS C 1 73  ? 10.158  69.651  61.005  1.00 19.96 ? 91  HIS C CD2 1 
ATOM   3803  C CE1 . HIS C 1 73  ? 9.946   70.409  58.953  1.00 16.90 ? 91  HIS C CE1 1 
ATOM   3804  N NE2 . HIS C 1 73  ? 9.271   70.059  60.034  1.00 20.53 ? 91  HIS C NE2 1 
ATOM   3805  N N   . PRO C 1 74  ? 12.541  67.351  58.304  1.00 17.34 ? 92  PRO C N   1 
ATOM   3806  C CA  . PRO C 1 74  ? 12.551  67.220  56.829  1.00 16.55 ? 92  PRO C CA  1 
ATOM   3807  C C   . PRO C 1 74  ? 12.550  68.479  55.958  1.00 15.58 ? 92  PRO C C   1 
ATOM   3808  O O   . PRO C 1 74  ? 12.513  68.381  54.732  1.00 16.86 ? 92  PRO C O   1 
ATOM   3809  C CB  . PRO C 1 74  ? 11.305  66.368  56.550  1.00 13.57 ? 92  PRO C CB  1 
ATOM   3810  C CG  . PRO C 1 74  ? 10.384  66.799  57.642  1.00 17.22 ? 92  PRO C CG  1 
ATOM   3811  C CD  . PRO C 1 74  ? 11.309  66.758  58.855  1.00 19.08 ? 92  PRO C CD  1 
ATOM   3812  N N   . SER C 1 75  ? 12.593  69.653  56.566  1.00 14.89 ? 93  SER C N   1 
ATOM   3813  C CA  . SER C 1 75  ? 12.585  70.870  55.772  1.00 18.14 ? 93  SER C CA  1 
ATOM   3814  C C   . SER C 1 75  ? 13.532  71.870  56.390  1.00 17.17 ? 93  SER C C   1 
ATOM   3815  O O   . SER C 1 75  ? 13.509  73.058  56.058  1.00 21.71 ? 93  SER C O   1 
ATOM   3816  C CB  . SER C 1 75  ? 11.174  71.466  55.706  1.00 20.99 ? 93  SER C CB  1 
ATOM   3817  O OG  . SER C 1 75  ? 10.230  70.493  55.297  1.00 27.30 ? 93  SER C OG  1 
ATOM   3818  N N   . TYR C 1 76  ? 14.331  71.399  57.333  1.00 11.74 ? 94  TYR C N   1 
ATOM   3819  C CA  . TYR C 1 76  ? 15.267  72.273  57.982  1.00 11.20 ? 94  TYR C CA  1 
ATOM   3820  C C   . TYR C 1 76  ? 16.141  72.790  56.874  1.00 15.51 ? 94  TYR C C   1 
ATOM   3821  O O   . TYR C 1 76  ? 16.619  72.001  56.078  1.00 18.05 ? 94  TYR C O   1 
ATOM   3822  C CB  . TYR C 1 76  ? 16.095  71.484  58.985  1.00 6.86  ? 94  TYR C CB  1 
ATOM   3823  C CG  . TYR C 1 76  ? 17.440  72.079  59.243  1.00 5.03  ? 94  TYR C CG  1 
ATOM   3824  C CD1 . TYR C 1 76  ? 18.586  71.349  58.997  1.00 7.99  ? 94  TYR C CD1 1 
ATOM   3825  C CD2 . TYR C 1 76  ? 17.575  73.411  59.633  1.00 6.92  ? 94  TYR C CD2 1 
ATOM   3826  C CE1 . TYR C 1 76  ? 19.845  71.923  59.115  1.00 8.62  ? 94  TYR C CE1 1 
ATOM   3827  C CE2 . TYR C 1 76  ? 18.822  73.998  59.751  1.00 7.81  ? 94  TYR C CE2 1 
ATOM   3828  C CZ  . TYR C 1 76  ? 19.953  73.248  59.487  1.00 8.33  ? 94  TYR C CZ  1 
ATOM   3829  O OH  . TYR C 1 76  ? 21.195  73.829  59.558  1.00 8.15  ? 94  TYR C OH  1 
ATOM   3830  N N   . ASN C 1 77  ? 16.272  74.108  56.753  1.00 19.76 ? 95  ASN C N   1 
ATOM   3831  C CA  . ASN C 1 77  ? 17.131  74.686  55.711  1.00 22.61 ? 95  ASN C CA  1 
ATOM   3832  C C   . ASN C 1 77  ? 18.431  75.176  56.357  1.00 23.87 ? 95  ASN C C   1 
ATOM   3833  O O   . ASN C 1 77  ? 18.421  76.134  57.152  1.00 22.81 ? 95  ASN C O   1 
ATOM   3834  C CB  . ASN C 1 77  ? 16.426  75.831  54.978  1.00 21.66 ? 95  ASN C CB  1 
ATOM   3835  C CG  . ASN C 1 77  ? 17.236  76.374  53.821  0.00 21.69 ? 95  ASN C CG  1 
ATOM   3836  O OD1 . ASN C 1 77  ? 18.160  77.159  54.013  0.00 22.98 ? 95  ASN C OD1 1 
ATOM   3837  N ND2 . ASN C 1 77  ? 16.881  75.977  52.610  0.00 22.99 ? 95  ASN C ND2 1 
ATOM   3838  N N   . SER C 1 78  ? 19.539  74.511  56.022  1.00 23.25 ? 96  SER C N   1 
ATOM   3839  C CA  . SER C 1 78  ? 20.840  74.855  56.588  1.00 24.21 ? 96  SER C CA  1 
ATOM   3840  C C   . SER C 1 78  ? 21.259  76.290  56.346  1.00 24.72 ? 96  SER C C   1 
ATOM   3841  O O   . SER C 1 78  ? 22.176  76.799  57.001  1.00 24.38 ? 96  SER C O   1 
ATOM   3842  C CB  . SER C 1 78  ? 21.918  73.918  56.062  1.00 22.74 ? 96  SER C CB  1 
ATOM   3843  O OG  . SER C 1 78  ? 21.806  73.801  54.666  1.00 22.05 ? 96  SER C OG  1 
ATOM   3844  N N   . ASN C 1 79  ? 20.591  76.945  55.411  1.00 26.20 ? 97  ASN C N   1 
ATOM   3845  C CA  . ASN C 1 79  ? 20.949  78.314  55.113  1.00 32.04 ? 97  ASN C CA  1 
ATOM   3846  C C   . ASN C 1 79  ? 20.168  79.308  55.921  1.00 30.29 ? 97  ASN C C   1 
ATOM   3847  O O   . ASN C 1 79  ? 20.748  80.107  56.657  1.00 31.84 ? 97  ASN C O   1 
ATOM   3848  C CB  . ASN C 1 79  ? 20.802  78.610  53.616  1.00 39.96 ? 97  ASN C CB  1 
ATOM   3849  C CG  . ASN C 1 79  ? 21.860  77.896  52.767  1.00 47.50 ? 97  ASN C CG  1 
ATOM   3850  O OD1 . ASN C 1 79  ? 22.248  76.749  53.049  1.00 52.56 ? 97  ASN C OD1 1 
ATOM   3851  N ND2 . ASN C 1 79  ? 22.328  78.570  51.724  1.00 49.63 ? 97  ASN C ND2 1 
ATOM   3852  N N   . THR C 1 80  ? 18.849  79.261  55.786  1.00 27.29 ? 98  THR C N   1 
ATOM   3853  C CA  . THR C 1 80  ? 17.979  80.192  56.505  1.00 23.96 ? 98  THR C CA  1 
ATOM   3854  C C   . THR C 1 80  ? 17.838  79.843  57.974  1.00 19.35 ? 98  THR C C   1 
ATOM   3855  O O   . THR C 1 80  ? 17.564  80.721  58.802  1.00 20.89 ? 98  THR C O   1 
ATOM   3856  C CB  . THR C 1 80  ? 16.556  80.245  55.883  1.00 26.02 ? 98  THR C CB  1 
ATOM   3857  O OG1 . THR C 1 80  ? 15.848  79.021  56.144  1.00 28.06 ? 98  THR C OG1 1 
ATOM   3858  C CG2 . THR C 1 80  ? 16.663  80.416  54.380  1.00 27.56 ? 98  THR C CG2 1 
ATOM   3859  N N   . LEU C 1 81  ? 18.069  78.567  58.282  1.00 14.16 ? 99  LEU C N   1 
ATOM   3860  C CA  . LEU C 1 81  ? 17.914  78.045  59.624  1.00 11.26 ? 99  LEU C CA  1 
ATOM   3861  C C   . LEU C 1 81  ? 16.405  78.030  59.947  1.00 11.48 ? 99  LEU C C   1 
ATOM   3862  O O   . LEU C 1 81  ? 15.989  78.263  61.091  1.00 10.68 ? 99  LEU C O   1 
ATOM   3863  C CB  . LEU C 1 81  ? 18.698  78.879  60.644  1.00 10.36 ? 99  LEU C CB  1 
ATOM   3864  C CG  . LEU C 1 81  ? 20.218  78.796  60.537  1.00 8.20  ? 99  LEU C CG  1 
ATOM   3865  C CD1 . LEU C 1 81  ? 20.884  79.613  61.655  1.00 5.01  ? 99  LEU C CD1 1 
ATOM   3866  C CD2 . LEU C 1 81  ? 20.643  77.318  60.586  1.00 5.00  ? 99  LEU C CD2 1 
ATOM   3867  N N   . ASN C 1 82  ? 15.584  77.824  58.919  1.00 11.41 ? 100 ASN C N   1 
ATOM   3868  C CA  . ASN C 1 82  ? 14.136  77.749  59.109  1.00 13.42 ? 100 ASN C CA  1 
ATOM   3869  C C   . ASN C 1 82  ? 13.843  76.293  59.436  1.00 13.87 ? 100 ASN C C   1 
ATOM   3870  O O   . ASN C 1 82  ? 14.402  75.402  58.791  1.00 18.01 ? 100 ASN C O   1 
ATOM   3871  C CB  . ASN C 1 82  ? 13.381  78.139  57.834  1.00 15.15 ? 100 ASN C CB  1 
ATOM   3872  C CG  . ASN C 1 82  ? 11.861  78.279  58.064  1.00 15.94 ? 100 ASN C CG  1 
ATOM   3873  O OD1 . ASN C 1 82  ? 11.411  78.662  59.142  1.00 13.75 ? 100 ASN C OD1 1 
ATOM   3874  N ND2 . ASN C 1 82  ? 11.077  77.991  57.037  1.00 17.27 ? 100 ASN C ND2 1 
ATOM   3875  N N   . ASN C 1 83  ? 12.974  76.045  60.412  1.00 10.17 ? 101 ASN C N   1 
ATOM   3876  C CA  . ASN C 1 83  ? 12.651  74.687  60.826  1.00 11.10 ? 101 ASN C CA  1 
ATOM   3877  C C   . ASN C 1 83  ? 13.822  74.058  61.561  1.00 13.79 ? 101 ASN C C   1 
ATOM   3878  O O   . ASN C 1 83  ? 14.060  72.849  61.428  1.00 14.12 ? 101 ASN C O   1 
ATOM   3879  C CB  . ASN C 1 83  ? 12.321  73.788  59.634  1.00 11.55 ? 101 ASN C CB  1 
ATOM   3880  C CG  . ASN C 1 83  ? 11.102  74.234  58.889  1.00 12.86 ? 101 ASN C CG  1 
ATOM   3881  O OD1 . ASN C 1 83  ? 9.959   74.046  59.361  1.00 11.81 ? 101 ASN C OD1 1 
ATOM   3882  N ND2 . ASN C 1 83  ? 11.317  74.790  57.691  1.00 7.58  ? 101 ASN C ND2 1 
ATOM   3883  N N   . ASP C 1 84  ? 14.563  74.872  62.312  1.00 14.91 ? 102 ASP C N   1 
ATOM   3884  C CA  . ASP C 1 84  ? 15.714  74.389  63.074  1.00 13.70 ? 102 ASP C CA  1 
ATOM   3885  C C   . ASP C 1 84  ? 15.202  73.517  64.233  1.00 12.53 ? 102 ASP C C   1 
ATOM   3886  O O   . ASP C 1 84  ? 15.129  73.977  65.376  1.00 15.32 ? 102 ASP C O   1 
ATOM   3887  C CB  . ASP C 1 84  ? 16.523  75.578  63.606  0.00 15.29 ? 102 ASP C CB  1 
ATOM   3888  C CG  . ASP C 1 84  ? 17.719  75.151  64.430  0.00 17.03 ? 102 ASP C CG  1 
ATOM   3889  O OD1 . ASP C 1 84  ? 18.486  74.281  63.969  0.00 18.33 ? 102 ASP C OD1 1 
ATOM   3890  O OD2 . ASP C 1 84  ? 17.890  75.685  65.545  0.00 18.38 ? 102 ASP C OD2 1 
ATOM   3891  N N   . ILE C 1 85  ? 14.787  72.286  63.927  1.00 8.50  ? 103 ILE C N   1 
ATOM   3892  C CA  . ILE C 1 85  ? 14.283  71.371  64.953  1.00 9.20  ? 103 ILE C CA  1 
ATOM   3893  C C   . ILE C 1 85  ? 14.649  69.927  64.630  1.00 8.99  ? 103 ILE C C   1 
ATOM   3894  O O   . ILE C 1 85  ? 14.526  69.471  63.484  1.00 8.06  ? 103 ILE C O   1 
ATOM   3895  C CB  . ILE C 1 85  ? 12.741  71.496  65.175  1.00 9.85  ? 103 ILE C CB  1 
ATOM   3896  C CG1 . ILE C 1 85  ? 12.364  70.923  66.543  1.00 7.62  ? 103 ILE C CG1 1 
ATOM   3897  C CG2 . ILE C 1 85  ? 11.970  70.750  64.079  1.00 8.34  ? 103 ILE C CG2 1 
ATOM   3898  C CD1 . ILE C 1 85  ? 11.031  71.346  66.999  1.00 5.00  ? 103 ILE C CD1 1 
ATOM   3899  N N   . MET C 1 86  ? 15.088  69.219  65.662  1.00 8.45  ? 104 MET C N   1 
ATOM   3900  C CA  . MET C 1 86  ? 15.530  67.850  65.541  1.00 7.74  ? 104 MET C CA  1 
ATOM   3901  C C   . MET C 1 86  ? 15.128  67.083  66.798  1.00 7.14  ? 104 MET C C   1 
ATOM   3902  O O   . MET C 1 86  ? 15.102  67.632  67.896  1.00 7.07  ? 104 MET C O   1 
ATOM   3903  C CB  . MET C 1 86  ? 17.064  67.851  65.362  1.00 9.45  ? 104 MET C CB  1 
ATOM   3904  C CG  . MET C 1 86  ? 17.746  66.490  65.458  1.00 10.17 ? 104 MET C CG  1 
ATOM   3905  S SD  . MET C 1 86  ? 19.530  66.605  65.577  1.00 5.21  ? 104 MET C SD  1 
ATOM   3906  C CE  . MET C 1 86  ? 19.749  67.182  67.201  1.00 5.00  ? 104 MET C CE  1 
ATOM   3907  N N   . LEU C 1 87  ? 14.806  65.813  66.620  1.00 5.54  ? 105 LEU C N   1 
ATOM   3908  C CA  . LEU C 1 87  ? 14.420  64.944  67.713  1.00 5.00  ? 105 LEU C CA  1 
ATOM   3909  C C   . LEU C 1 87  ? 15.445  63.833  67.831  1.00 5.00  ? 105 LEU C C   1 
ATOM   3910  O O   . LEU C 1 87  ? 15.828  63.209  66.845  1.00 5.00  ? 105 LEU C O   1 
ATOM   3911  C CB  . LEU C 1 87  ? 13.046  64.337  67.442  1.00 7.70  ? 105 LEU C CB  1 
ATOM   3912  C CG  . LEU C 1 87  ? 11.858  65.286  67.495  1.00 6.27  ? 105 LEU C CG  1 
ATOM   3913  C CD1 . LEU C 1 87  ? 10.601  64.545  67.127  1.00 8.96  ? 105 LEU C CD1 1 
ATOM   3914  C CD2 . LEU C 1 87  ? 11.754  65.836  68.886  1.00 9.15  ? 105 LEU C CD2 1 
ATOM   3915  N N   . ILE C 1 88  ? 15.856  63.574  69.056  1.00 5.00  ? 106 ILE C N   1 
ATOM   3916  C CA  . ILE C 1 88  ? 16.835  62.555  69.363  1.00 5.00  ? 106 ILE C CA  1 
ATOM   3917  C C   . ILE C 1 88  ? 16.181  61.480  70.208  1.00 5.00  ? 106 ILE C C   1 
ATOM   3918  O O   . ILE C 1 88  ? 15.409  61.792  71.121  1.00 7.09  ? 106 ILE C O   1 
ATOM   3919  C CB  . ILE C 1 88  ? 17.958  63.163  70.190  1.00 5.00  ? 106 ILE C CB  1 
ATOM   3920  C CG1 . ILE C 1 88  ? 18.681  64.233  69.380  1.00 9.27  ? 106 ILE C CG1 1 
ATOM   3921  C CG2 . ILE C 1 88  ? 18.901  62.094  70.660  1.00 7.31  ? 106 ILE C CG2 1 
ATOM   3922  C CD1 . ILE C 1 88  ? 19.721  65.009  70.159  1.00 11.74 ? 106 ILE C CD1 1 
ATOM   3923  N N   . LYS C 1 89  ? 16.437  60.221  69.872  1.00 5.92  ? 107 LYS C N   1 
ATOM   3924  C CA  . LYS C 1 89  ? 15.910  59.102  70.640  1.00 5.24  ? 107 LYS C CA  1 
ATOM   3925  C C   . LYS C 1 89  ? 17.086  58.448  71.339  1.00 5.00  ? 107 LYS C C   1 
ATOM   3926  O O   . LYS C 1 89  ? 18.065  58.087  70.716  1.00 5.00  ? 107 LYS C O   1 
ATOM   3927  C CB  . LYS C 1 89  ? 15.189  58.080  69.763  1.00 5.00  ? 107 LYS C CB  1 
ATOM   3928  C CG  . LYS C 1 89  ? 14.591  56.945  70.582  1.00 5.00  ? 107 LYS C CG  1 
ATOM   3929  C CD  . LYS C 1 89  ? 13.753  56.013  69.740  1.00 5.00  ? 107 LYS C CD  1 
ATOM   3930  C CE  . LYS C 1 89  ? 13.227  54.858  70.567  1.00 5.00  ? 107 LYS C CE  1 
ATOM   3931  N NZ  . LYS C 1 89  ? 12.283  53.981  69.816  1.00 5.00  ? 107 LYS C NZ  1 
ATOM   3932  N N   . LEU C 1 90  ? 16.994  58.324  72.645  1.00 5.00  ? 108 LEU C N   1 
ATOM   3933  C CA  . LEU C 1 90  ? 18.050  57.724  73.424  1.00 5.00  ? 108 LEU C CA  1 
ATOM   3934  C C   . LEU C 1 90  ? 18.066  56.209  73.250  1.00 7.40  ? 108 LEU C C   1 
ATOM   3935  O O   . LEU C 1 90  ? 17.023  55.563  73.227  1.00 9.05  ? 108 LEU C O   1 
ATOM   3936  C CB  . LEU C 1 90  ? 17.837  58.061  74.902  1.00 7.32  ? 108 LEU C CB  1 
ATOM   3937  C CG  . LEU C 1 90  ? 17.742  59.554  75.227  1.00 8.45  ? 108 LEU C CG  1 
ATOM   3938  C CD1 . LEU C 1 90  ? 17.422  59.768  76.691  1.00 5.61  ? 108 LEU C CD1 1 
ATOM   3939  C CD2 . LEU C 1 90  ? 19.044  60.230  74.856  1.00 9.39  ? 108 LEU C CD2 1 
ATOM   3940  N N   . LYS C 1 91  ? 19.258  55.645  73.115  1.00 6.44  ? 109 LYS C N   1 
ATOM   3941  C CA  . LYS C 1 91  ? 19.402  54.206  73.001  1.00 6.55  ? 109 LYS C CA  1 
ATOM   3942  C C   . LYS C 1 91  ? 18.574  53.577  74.102  1.00 11.16 ? 109 LYS C C   1 
ATOM   3943  O O   . LYS C 1 91  ? 17.787  52.685  73.835  1.00 14.63 ? 109 LYS C O   1 
ATOM   3944  C CB  . LYS C 1 91  ? 20.856  53.812  73.215  1.00 6.68  ? 109 LYS C CB  1 
ATOM   3945  C CG  . LYS C 1 91  ? 21.133  52.311  73.391  1.00 5.00  ? 109 LYS C CG  1 
ATOM   3946  C CD  . LYS C 1 91  ? 22.623  52.032  73.227  0.00 7.00  ? 109 LYS C CD  1 
ATOM   3947  C CE  . LYS C 1 91  ? 23.088  52.332  71.804  0.00 7.56  ? 109 LYS C CE  1 
ATOM   3948  N NZ  . LYS C 1 91  ? 24.561  52.200  71.643  0.00 7.61  ? 109 LYS C NZ  1 
ATOM   3949  N N   . SER C 1 92  ? 18.752  54.074  75.327  1.00 11.22 ? 110 SER C N   1 
ATOM   3950  C CA  . SER C 1 92  ? 18.041  53.597  76.507  1.00 9.98  ? 110 SER C CA  1 
ATOM   3951  C C   . SER C 1 92  ? 17.194  54.755  77.037  1.00 16.01 ? 110 SER C C   1 
ATOM   3952  O O   . SER C 1 92  ? 17.585  55.917  76.881  1.00 17.58 ? 110 SER C O   1 
ATOM   3953  C CB  . SER C 1 92  ? 19.054  53.177  77.575  1.00 5.00  ? 110 SER C CB  1 
ATOM   3954  O OG  . SER C 1 92  ? 19.983  52.241  77.052  0.00 6.84  ? 110 SER C OG  1 
ATOM   3955  N N   . ALA C 1 93  ? 16.043  54.454  77.650  1.00 18.85 ? 111 ALA C N   1 
ATOM   3956  C CA  . ALA C 1 93  ? 15.170  55.494  78.215  1.00 17.68 ? 111 ALA C CA  1 
ATOM   3957  C C   . ALA C 1 93  ? 15.776  56.063  79.464  1.00 18.80 ? 111 ALA C C   1 
ATOM   3958  O O   . ALA C 1 93  ? 16.274  55.327  80.310  1.00 17.78 ? 111 ALA C O   1 
ATOM   3959  C CB  . ALA C 1 93  ? 13.837  54.947  78.537  1.00 17.57 ? 111 ALA C CB  1 
ATOM   3960  N N   . ALA C 1 94  ? 15.778  57.387  79.533  1.00 24.35 ? 112 ALA C N   1 
ATOM   3961  C CA  . ALA C 1 94  ? 16.324  58.131  80.654  1.00 32.31 ? 112 ALA C CA  1 
ATOM   3962  C C   . ALA C 1 94  ? 15.467  57.899  81.867  1.00 40.46 ? 112 ALA C C   1 
ATOM   3963  O O   . ALA C 1 94  ? 14.254  57.724  81.762  1.00 39.72 ? 112 ALA C O   1 
ATOM   3964  C CB  . ALA C 1 94  ? 16.376  59.605  80.330  0.00 33.67 ? 112 ALA C CB  1 
ATOM   3965  N N   . SER C 1 95  ? 16.110  57.946  83.025  1.00 47.48 ? 113 SER C N   1 
ATOM   3966  C CA  . SER C 1 95  ? 15.470  57.718  84.321  1.00 49.31 ? 113 SER C CA  1 
ATOM   3967  C C   . SER C 1 95  ? 14.731  58.928  84.867  1.00 45.65 ? 113 SER C C   1 
ATOM   3968  O O   . SER C 1 95  ? 15.318  59.754  85.574  1.00 43.75 ? 113 SER C O   1 
ATOM   3969  C CB  . SER C 1 95  ? 16.551  57.336  85.317  1.00 52.49 ? 113 SER C CB  1 
ATOM   3970  O OG  . SER C 1 95  ? 17.560  58.341  85.310  1.00 57.38 ? 113 SER C OG  1 
ATOM   3971  N N   . LEU C 1 96  ? 13.451  59.035  84.554  1.00 44.05 ? 114 LEU C N   1 
ATOM   3972  C CA  . LEU C 1 96  ? 12.683  60.163  85.051  1.00 44.77 ? 114 LEU C CA  1 
ATOM   3973  C C   . LEU C 1 96  ? 12.626  60.094  86.574  1.00 43.66 ? 114 LEU C C   1 
ATOM   3974  O O   . LEU C 1 96  ? 12.776  59.001  87.149  1.00 49.32 ? 114 LEU C O   1 
ATOM   3975  C CB  . LEU C 1 96  ? 11.273  60.156  84.456  1.00 46.62 ? 114 LEU C CB  1 
ATOM   3976  C CG  . LEU C 1 96  ? 11.270  60.367  82.943  1.00 47.58 ? 114 LEU C CG  1 
ATOM   3977  C CD1 . LEU C 1 96  ? 9.856   60.451  82.422  1.00 46.84 ? 114 LEU C CD1 1 
ATOM   3978  C CD2 . LEU C 1 96  ? 12.038  61.650  82.622  1.00 48.88 ? 114 LEU C CD2 1 
ATOM   3979  N N   . ASN C 1 97  ? 12.521  61.263  87.207  0.00 37.20 ? 115 ASN C N   1 
ATOM   3980  C CA  . ASN C 1 97  ? 12.428  61.409  88.663  0.00 30.95 ? 115 ASN C CA  1 
ATOM   3981  C C   . ASN C 1 97  ? 12.538  62.886  89.050  0.00 28.31 ? 115 ASN C C   1 
ATOM   3982  O O   . ASN C 1 97  ? 12.361  63.769  88.210  0.00 28.29 ? 115 ASN C O   1 
ATOM   3983  C CB  . ASN C 1 97  ? 13.502  60.581  89.391  0.00 28.91 ? 115 ASN C CB  1 
ATOM   3984  C CG  . ASN C 1 97  ? 14.915  61.098  89.164  0.00 24.86 ? 115 ASN C CG  1 
ATOM   3985  O OD1 . ASN C 1 97  ? 15.174  61.869  88.245  0.00 22.35 ? 115 ASN C OD1 1 
ATOM   3986  N ND2 . ASN C 1 97  ? 15.834  60.683  90.023  0.00 22.43 ? 115 ASN C ND2 1 
ATOM   3987  N N   . SER C 1 98  ? 12.805  63.149  90.326  0.00 25.48 ? 116 SER C N   1 
ATOM   3988  C CA  . SER C 1 98  ? 12.942  64.513  90.825  0.00 22.21 ? 116 SER C CA  1 
ATOM   3989  C C   . SER C 1 98  ? 14.187  65.202  90.268  0.00 21.15 ? 116 SER C C   1 
ATOM   3990  O O   . SER C 1 98  ? 14.277  66.430  90.259  0.00 20.21 ? 116 SER C O   1 
ATOM   3991  C CB  . SER C 1 98  ? 12.990  64.501  92.354  0.00 19.91 ? 116 SER C CB  1 
ATOM   3992  O OG  . SER C 1 98  ? 13.807  63.441  92.825  0.00 18.49 ? 116 SER C OG  1 
ATOM   3993  N N   . ARG C 1 99  ? 15.150  64.400  89.822  0.00 20.94 ? 117 ARG C N   1 
ATOM   3994  C CA  . ARG C 1 99  ? 16.393  64.917  89.268  0.00 22.11 ? 117 ARG C CA  1 
ATOM   3995  C C   . ARG C 1 99  ? 16.232  65.193  87.779  0.00 24.52 ? 117 ARG C C   1 
ATOM   3996  O O   . ARG C 1 99  ? 16.240  66.348  87.354  0.00 23.87 ? 117 ARG C O   1 
ATOM   3997  C CB  . ARG C 1 99  ? 17.530  63.922  89.506  0.00 20.74 ? 117 ARG C CB  1 
ATOM   3998  C CG  . ARG C 1 99  ? 17.734  63.557  90.967  0.00 19.41 ? 117 ARG C CG  1 
ATOM   3999  C CD  . ARG C 1 99  ? 18.040  64.782  91.812  0.00 18.17 ? 117 ARG C CD  1 
ATOM   4000  N NE  . ARG C 1 99  ? 18.184  64.444  93.225  0.00 16.99 ? 117 ARG C NE  1 
ATOM   4001  C CZ  . ARG C 1 99  ? 18.395  65.332  94.193  0.00 16.39 ? 117 ARG C CZ  1 
ATOM   4002  N NH1 . ARG C 1 99  ? 18.487  66.625  93.909  0.00 16.56 ? 117 ARG C NH1 1 
ATOM   4003  N NH2 . ARG C 1 99  ? 18.516  64.924  95.448  0.00 16.63 ? 117 ARG C NH2 1 
ATOM   4004  N N   . VAL C 1 100 ? 16.125  64.131  86.985  1.00 26.74 ? 118 VAL C N   1 
ATOM   4005  C CA  . VAL C 1 100 ? 15.944  64.281  85.545  1.00 27.90 ? 118 VAL C CA  1 
ATOM   4006  C C   . VAL C 1 100 ? 14.441  64.217  85.330  1.00 28.52 ? 118 VAL C C   1 
ATOM   4007  O O   . VAL C 1 100 ? 13.807  63.216  85.695  1.00 30.12 ? 118 VAL C O   1 
ATOM   4008  C CB  . VAL C 1 100 ? 16.577  63.110  84.735  1.00 29.33 ? 118 VAL C CB  1 
ATOM   4009  C CG1 . VAL C 1 100 ? 16.598  63.450  83.257  1.00 25.70 ? 118 VAL C CG1 1 
ATOM   4010  C CG2 . VAL C 1 100 ? 17.975  62.779  85.241  1.00 30.12 ? 118 VAL C CG2 1 
ATOM   4011  N N   . ALA C 1 101 ? 13.869  65.269  84.756  1.00 25.97 ? 119 ALA C N   1 
ATOM   4012  C CA  . ALA C 1 101 ? 12.437  65.289  84.502  1.00 25.35 ? 119 ALA C CA  1 
ATOM   4013  C C   . ALA C 1 101 ? 12.160  65.849  83.107  1.00 22.92 ? 119 ALA C C   1 
ATOM   4014  O O   . ALA C 1 101 ? 12.970  66.584  82.565  1.00 26.46 ? 119 ALA C O   1 
ATOM   4015  C CB  . ALA C 1 101 ? 11.734  66.111  85.575  1.00 27.72 ? 119 ALA C CB  1 
ATOM   4016  N N   . SER C 1 102 ? 11.042  65.470  82.508  1.00 19.07 ? 120 SER C N   1 
ATOM   4017  C CA  . SER C 1 102 ? 10.705  65.956  81.190  1.00 18.81 ? 120 SER C CA  1 
ATOM   4018  C C   . SER C 1 102 ? 9.978   67.271  81.286  1.00 21.82 ? 120 SER C C   1 
ATOM   4019  O O   . SER C 1 102 ? 9.327   67.531  82.290  1.00 24.20 ? 120 SER C O   1 
ATOM   4020  C CB  . SER C 1 102 ? 9.804   64.960  80.504  1.00 21.45 ? 120 SER C CB  1 
ATOM   4021  O OG  . SER C 1 102 ? 8.698   64.645  81.321  1.00 23.73 ? 120 SER C OG  1 
ATOM   4022  N N   . ILE C 1 103 ? 10.125  68.112  80.262  1.00 23.02 ? 121 ILE C N   1 
ATOM   4023  C CA  . ILE C 1 103 ? 9.453   69.415  80.183  1.00 19.76 ? 121 ILE C CA  1 
ATOM   4024  C C   . ILE C 1 103 ? 8.232   69.162  79.301  1.00 18.54 ? 121 ILE C C   1 
ATOM   4025  O O   . ILE C 1 103 ? 8.247   68.262  78.472  1.00 18.68 ? 121 ILE C O   1 
ATOM   4026  C CB  . ILE C 1 103 ? 10.379  70.488  79.541  1.00 19.15 ? 121 ILE C CB  1 
ATOM   4027  C CG1 . ILE C 1 103 ? 9.626   71.804  79.326  1.00 21.21 ? 121 ILE C CG1 1 
ATOM   4028  C CG2 . ILE C 1 103 ? 10.938  70.004  78.222  1.00 17.48 ? 121 ILE C CG2 1 
ATOM   4029  C CD1 . ILE C 1 103 ? 9.147   72.448  80.603  1.00 22.83 ? 121 ILE C CD1 1 
ATOM   4030  N N   . SER C 1 104 ? 7.170   69.929  79.465  1.00 17.45 ? 122 SER C N   1 
ATOM   4031  C CA  . SER C 1 104 ? 5.979   69.684  78.658  1.00 18.97 ? 122 SER C CA  1 
ATOM   4032  C C   . SER C 1 104 ? 5.967   70.445  77.356  1.00 16.14 ? 122 SER C C   1 
ATOM   4033  O O   . SER C 1 104 ? 6.534   71.532  77.275  1.00 17.39 ? 122 SER C O   1 
ATOM   4034  C CB  . SER C 1 104 ? 4.726   70.051  79.447  1.00 25.58 ? 122 SER C CB  1 
ATOM   4035  O OG  . SER C 1 104 ? 4.745   69.444  80.732  1.00 33.54 ? 122 SER C OG  1 
ATOM   4036  N N   . LEU C 1 105 ? 5.349   69.859  76.330  1.00 13.89 ? 123 LEU C N   1 
ATOM   4037  C CA  . LEU C 1 105 ? 5.236   70.538  75.037  1.00 13.41 ? 123 LEU C CA  1 
ATOM   4038  C C   . LEU C 1 105 ? 4.065   71.525  75.161  1.00 16.60 ? 123 LEU C C   1 
ATOM   4039  O O   . LEU C 1 105 ? 3.167   71.340  75.983  1.00 19.13 ? 123 LEU C O   1 
ATOM   4040  C CB  . LEU C 1 105 ? 4.998   69.545  73.888  1.00 9.79  ? 123 LEU C CB  1 
ATOM   4041  C CG  . LEU C 1 105 ? 6.147   68.619  73.467  1.00 5.00  ? 123 LEU C CG  1 
ATOM   4042  C CD1 . LEU C 1 105 ? 5.751   67.728  72.318  1.00 5.00  ? 123 LEU C CD1 1 
ATOM   4043  C CD2 . LEU C 1 105 ? 7.324   69.449  73.074  1.00 6.93  ? 123 LEU C CD2 1 
ATOM   4044  N N   . PRO C 1 106 ? 4.100   72.619  74.410  1.00 15.58 ? 124 PRO C N   1 
ATOM   4045  C CA  . PRO C 1 106 ? 3.037   73.614  74.462  1.00 18.65 ? 124 PRO C CA  1 
ATOM   4046  C C   . PRO C 1 106 ? 1.816   73.177  73.673  1.00 28.14 ? 124 PRO C C   1 
ATOM   4047  O O   . PRO C 1 106 ? 1.884   72.244  72.856  1.00 26.03 ? 124 PRO C O   1 
ATOM   4048  C CB  . PRO C 1 106 ? 3.677   74.804  73.785  1.00 17.89 ? 124 PRO C CB  1 
ATOM   4049  C CG  . PRO C 1 106 ? 4.432   74.142  72.686  1.00 16.64 ? 124 PRO C CG  1 
ATOM   4050  C CD  . PRO C 1 106 ? 5.125   73.009  73.433  1.00 16.24 ? 124 PRO C CD  1 
ATOM   4051  N N   . THR C 1 107 ? 0.699   73.857  73.927  1.00 34.50 ? 125 THR C N   1 
ATOM   4052  C CA  . THR C 1 107 ? -0.549  73.575  73.226  1.00 37.86 ? 125 THR C CA  1 
ATOM   4053  C C   . THR C 1 107 ? -0.891  74.810  72.415  1.00 39.36 ? 125 THR C C   1 
ATOM   4054  O O   . THR C 1 107 ? -1.551  74.732  71.374  1.00 40.18 ? 125 THR C O   1 
ATOM   4055  C CB  . THR C 1 107 ? -1.712  73.262  74.201  1.00 38.05 ? 125 THR C CB  1 
ATOM   4056  O OG1 . THR C 1 107 ? -1.928  74.369  75.084  1.00 34.28 ? 125 THR C OG1 1 
ATOM   4057  C CG2 . THR C 1 107 ? -1.395  72.024  75.018  1.00 42.05 ? 125 THR C CG2 1 
ATOM   4058  N N   . SER C 1 108 ? -0.417  75.952  72.904  1.00 38.62 ? 127 SER C N   1 
ATOM   4059  C CA  . SER C 1 108 ? -0.654  77.232  72.258  1.00 39.80 ? 127 SER C CA  1 
ATOM   4060  C C   . SER C 1 108 ? 0.610   78.061  72.427  1.00 36.91 ? 127 SER C C   1 
ATOM   4061  O O   . SER C 1 108 ? 1.251   78.008  73.477  1.00 33.48 ? 127 SER C O   1 
ATOM   4062  C CB  . SER C 1 108 ? -1.836  77.955  72.918  1.00 43.94 ? 127 SER C CB  1 
ATOM   4063  O OG  . SER C 1 108 ? -2.944  77.087  73.100  1.00 48.10 ? 127 SER C OG  1 
ATOM   4064  N N   . CYS C 1 109 ? 0.962   78.799  71.377  1.00 34.61 ? 128 CYS C N   1 
ATOM   4065  C CA  . CYS C 1 109 ? 2.150   79.647  71.358  1.00 31.22 ? 128 CYS C CA  1 
ATOM   4066  C C   . CYS C 1 109 ? 2.093   80.791  72.361  1.00 30.00 ? 128 CYS C C   1 
ATOM   4067  O O   . CYS C 1 109 ? 1.038   81.413  72.563  1.00 29.61 ? 128 CYS C O   1 
ATOM   4068  C CB  . CYS C 1 109 ? 2.354   80.236  69.964  1.00 30.63 ? 128 CYS C CB  1 
ATOM   4069  S SG  . CYS C 1 109 ? 2.246   79.023  68.616  1.00 31.92 ? 128 CYS C SG  1 
ATOM   4070  N N   . ALA C 1 110 ? 3.256   81.106  72.929  1.00 29.23 ? 129 ALA C N   1 
ATOM   4071  C CA  . ALA C 1 110 ? 3.386   82.176  73.916  1.00 29.54 ? 129 ALA C CA  1 
ATOM   4072  C C   . ALA C 1 110 ? 3.190   83.539  73.274  1.00 30.31 ? 129 ALA C C   1 
ATOM   4073  O O   . ALA C 1 110 ? 3.823   83.845  72.266  1.00 31.04 ? 129 ALA C O   1 
ATOM   4074  C CB  . ALA C 1 110 ? 4.734   82.104  74.574  1.00 28.44 ? 129 ALA C CB  1 
ATOM   4075  N N   . SER C 1 111 ? 2.306   84.347  73.852  1.00 31.36 ? 130 SER C N   1 
ATOM   4076  C CA  . SER C 1 111 ? 2.032   85.676  73.319  1.00 31.29 ? 130 SER C CA  1 
ATOM   4077  C C   . SER C 1 111 ? 3.213   86.558  73.643  1.00 31.33 ? 130 SER C C   1 
ATOM   4078  O O   . SER C 1 111 ? 3.839   86.387  74.689  1.00 30.30 ? 130 SER C O   1 
ATOM   4079  C CB  . SER C 1 111 ? 0.762   86.252  73.951  0.00 30.26 ? 130 SER C CB  1 
ATOM   4080  O OG  . SER C 1 111 ? -0.371  85.462  73.633  0.00 30.43 ? 130 SER C OG  1 
ATOM   4081  N N   . ALA C 1 112 ? 3.547   87.472  72.741  1.00 31.62 ? 132 ALA C N   1 
ATOM   4082  C CA  . ALA C 1 112 ? 4.666   88.376  72.982  1.00 33.27 ? 132 ALA C CA  1 
ATOM   4083  C C   . ALA C 1 112 ? 4.491   89.011  74.360  1.00 33.52 ? 132 ALA C C   1 
ATOM   4084  O O   . ALA C 1 112 ? 3.372   89.335  74.761  1.00 37.44 ? 132 ALA C O   1 
ATOM   4085  C CB  . ALA C 1 112 ? 4.718   89.443  71.911  1.00 33.86 ? 132 ALA C CB  1 
ATOM   4086  N N   . GLY C 1 113 ? 5.590   89.155  75.089  1.00 32.16 ? 133 GLY C N   1 
ATOM   4087  C CA  . GLY C 1 113 ? 5.523   89.723  76.421  1.00 31.28 ? 133 GLY C CA  1 
ATOM   4088  C C   . GLY C 1 113 ? 5.723   88.660  77.478  1.00 30.57 ? 133 GLY C C   1 
ATOM   4089  O O   . GLY C 1 113 ? 6.117   88.984  78.607  1.00 30.05 ? 133 GLY C O   1 
ATOM   4090  N N   . THR C 1 114 ? 5.467   87.399  77.113  1.00 28.69 ? 134 THR C N   1 
ATOM   4091  C CA  . THR C 1 114 ? 5.634   86.272  78.036  1.00 25.58 ? 134 THR C CA  1 
ATOM   4092  C C   . THR C 1 114 ? 7.073   86.158  78.524  1.00 24.92 ? 134 THR C C   1 
ATOM   4093  O O   . THR C 1 114 ? 8.010   86.199  77.716  1.00 27.32 ? 134 THR C O   1 
ATOM   4094  C CB  . THR C 1 114 ? 5.307   84.913  77.389  1.00 24.36 ? 134 THR C CB  1 
ATOM   4095  O OG1 . THR C 1 114 ? 3.967   84.909  76.877  1.00 24.26 ? 134 THR C OG1 1 
ATOM   4096  C CG2 . THR C 1 114 ? 5.450   83.809  78.432  1.00 21.70 ? 134 THR C CG2 1 
ATOM   4097  N N   . GLN C 1 115 ? 7.239   85.991  79.834  1.00 21.72 ? 135 GLN C N   1 
ATOM   4098  C CA  . GLN C 1 115 ? 8.560   85.845  80.431  1.00 20.35 ? 135 GLN C CA  1 
ATOM   4099  C C   . GLN C 1 115 ? 8.920   84.351  80.413  1.00 18.75 ? 135 GLN C C   1 
ATOM   4100  O O   . GLN C 1 115 ? 8.105   83.511  80.764  1.00 21.48 ? 135 GLN C O   1 
ATOM   4101  C CB  . GLN C 1 115 ? 8.550   86.389  81.857  1.00 22.06 ? 135 GLN C CB  1 
ATOM   4102  C CG  . GLN C 1 115 ? 9.908   86.826  82.359  1.00 24.75 ? 135 GLN C CG  1 
ATOM   4103  C CD  . GLN C 1 115 ? 9.923   87.104  83.847  0.00 24.81 ? 135 GLN C CD  1 
ATOM   4104  O OE1 . GLN C 1 115 ? 10.490  86.339  84.626  0.00 24.62 ? 135 GLN C OE1 1 
ATOM   4105  N NE2 . GLN C 1 115 ? 9.309   88.206  84.250  0.00 24.64 ? 135 GLN C NE2 1 
ATOM   4106  N N   . CYS C 1 116 ? 10.128  84.026  79.978  1.00 14.80 ? 136 CYS C N   1 
ATOM   4107  C CA  . CYS C 1 116 ? 10.569  82.646  79.878  1.00 12.51 ? 136 CYS C CA  1 
ATOM   4108  C C   . CYS C 1 116 ? 11.937  82.465  80.502  1.00 12.67 ? 136 CYS C C   1 
ATOM   4109  O O   . CYS C 1 116 ? 12.603  83.433  80.829  1.00 16.76 ? 136 CYS C O   1 
ATOM   4110  C CB  . CYS C 1 116 ? 10.665  82.265  78.413  1.00 11.06 ? 136 CYS C CB  1 
ATOM   4111  S SG  . CYS C 1 116 ? 9.204   82.729  77.460  1.00 11.89 ? 136 CYS C SG  1 
ATOM   4112  N N   . LEU C 1 117 ? 12.372  81.220  80.625  1.00 9.87  ? 137 LEU C N   1 
ATOM   4113  C CA  . LEU C 1 117 ? 13.664  80.902  81.190  1.00 7.76  ? 137 LEU C CA  1 
ATOM   4114  C C   . LEU C 1 117 ? 14.477  80.142  80.149  1.00 12.62 ? 137 LEU C C   1 
ATOM   4115  O O   . LEU C 1 117 ? 14.065  79.070  79.685  1.00 14.13 ? 137 LEU C O   1 
ATOM   4116  C CB  . LEU C 1 117 ? 13.494  80.058  82.448  1.00 5.00  ? 137 LEU C CB  1 
ATOM   4117  C CG  . LEU C 1 117 ? 14.764  79.551  83.129  1.00 6.01  ? 137 LEU C CG  1 
ATOM   4118  C CD1 . LEU C 1 117 ? 15.590  80.722  83.564  1.00 8.41  ? 137 LEU C CD1 1 
ATOM   4119  C CD2 . LEU C 1 117 ? 14.464  78.676  84.321  1.00 5.00  ? 137 LEU C CD2 1 
ATOM   4120  N N   . ILE C 1 118 ? 15.589  80.745  79.731  1.00 15.08 ? 138 ILE C N   1 
ATOM   4121  C CA  . ILE C 1 118 ? 16.517  80.163  78.758  1.00 12.94 ? 138 ILE C CA  1 
ATOM   4122  C C   . ILE C 1 118 ? 17.696  79.676  79.594  1.00 12.68 ? 138 ILE C C   1 
ATOM   4123  O O   . ILE C 1 118 ? 18.090  80.345  80.554  1.00 11.30 ? 138 ILE C O   1 
ATOM   4124  C CB  . ILE C 1 118 ? 17.036  81.231  77.807  1.00 15.15 ? 138 ILE C CB  1 
ATOM   4125  C CG1 . ILE C 1 118 ? 15.862  82.009  77.204  1.00 17.49 ? 138 ILE C CG1 1 
ATOM   4126  C CG2 . ILE C 1 118 ? 17.863  80.590  76.707  1.00 14.85 ? 138 ILE C CG2 1 
ATOM   4127  C CD1 . ILE C 1 118 ? 16.272  83.294  76.477  1.00 19.13 ? 138 ILE C CD1 1 
ATOM   4128  N N   . SER C 1 119 ? 18.261  78.529  79.240  1.00 11.12 ? 139 SER C N   1 
ATOM   4129  C CA  . SER C 1 119 ? 19.373  77.981  80.003  1.00 12.04 ? 139 SER C CA  1 
ATOM   4130  C C   . SER C 1 119 ? 20.401  77.265  79.129  1.00 15.42 ? 139 SER C C   1 
ATOM   4131  O O   . SER C 1 119 ? 20.086  76.780  78.036  1.00 15.97 ? 139 SER C O   1 
ATOM   4132  C CB  . SER C 1 119 ? 18.845  77.006  81.070  1.00 12.41 ? 139 SER C CB  1 
ATOM   4133  O OG  . SER C 1 119 ? 18.102  75.929  80.488  1.00 12.59 ? 139 SER C OG  1 
ATOM   4134  N N   . GLY C 1 120 ? 21.627  77.164  79.626  1.00 16.94 ? 140 GLY C N   1 
ATOM   4135  C CA  . GLY C 1 120 ? 22.668  76.487  78.874  1.00 15.38 ? 140 GLY C CA  1 
ATOM   4136  C C   . GLY C 1 120 ? 24.035  76.559  79.531  1.00 14.00 ? 140 GLY C C   1 
ATOM   4137  O O   . GLY C 1 120 ? 24.197  77.126  80.625  1.00 13.77 ? 140 GLY C O   1 
ATOM   4138  N N   . TRP C 1 121 ? 25.011  75.929  78.889  1.00 12.29 ? 141 TRP C N   1 
ATOM   4139  C CA  . TRP C 1 121 ? 26.371  75.928  79.387  1.00 10.38 ? 141 TRP C CA  1 
ATOM   4140  C C   . TRP C 1 121 ? 27.234  76.763  78.448  1.00 11.15 ? 141 TRP C C   1 
ATOM   4141  O O   . TRP C 1 121 ? 28.450  76.852  78.608  1.00 15.39 ? 141 TRP C O   1 
ATOM   4142  C CB  . TRP C 1 121 ? 26.895  74.495  79.454  1.00 7.74  ? 141 TRP C CB  1 
ATOM   4143  C CG  . TRP C 1 121 ? 26.479  73.762  80.645  1.00 6.41  ? 141 TRP C CG  1 
ATOM   4144  C CD1 . TRP C 1 121 ? 27.007  73.866  81.900  1.00 11.62 ? 141 TRP C CD1 1 
ATOM   4145  C CD2 . TRP C 1 121 ? 25.503  72.738  80.704  1.00 5.00  ? 141 TRP C CD2 1 
ATOM   4146  N NE1 . TRP C 1 121 ? 26.423  72.944  82.742  1.00 12.05 ? 141 TRP C NE1 1 
ATOM   4147  C CE2 . TRP C 1 121 ? 25.495  72.237  82.031  1.00 7.10  ? 141 TRP C CE2 1 
ATOM   4148  C CE3 . TRP C 1 121 ? 24.639  72.182  79.768  1.00 5.00  ? 141 TRP C CE3 1 
ATOM   4149  C CZ2 . TRP C 1 121 ? 24.661  71.210  82.434  1.00 5.00  ? 141 TRP C CZ2 1 
ATOM   4150  C CZ3 . TRP C 1 121 ? 23.806  71.151  80.174  1.00 5.00  ? 141 TRP C CZ3 1 
ATOM   4151  C CH2 . TRP C 1 121 ? 23.827  70.678  81.494  1.00 5.00  ? 141 TRP C CH2 1 
ATOM   4152  N N   . GLY C 1 122 ? 26.594  77.394  77.478  1.00 10.38 ? 142 GLY C N   1 
ATOM   4153  C CA  . GLY C 1 122 ? 27.329  78.184  76.516  1.00 13.94 ? 142 GLY C CA  1 
ATOM   4154  C C   . GLY C 1 122 ? 28.153  79.305  77.096  1.00 15.80 ? 142 GLY C C   1 
ATOM   4155  O O   . GLY C 1 122 ? 28.096  79.591  78.286  1.00 16.26 ? 142 GLY C O   1 
ATOM   4156  N N   . ASN C 1 123 ? 28.888  79.964  76.216  1.00 17.26 ? 143 ASN C N   1 
ATOM   4157  C CA  . ASN C 1 123 ? 29.742  81.090  76.554  1.00 18.08 ? 143 ASN C CA  1 
ATOM   4158  C C   . ASN C 1 123 ? 28.971  82.137  77.360  1.00 19.67 ? 143 ASN C C   1 
ATOM   4159  O O   . ASN C 1 123 ? 27.757  82.298  77.184  1.00 17.75 ? 143 ASN C O   1 
ATOM   4160  C CB  . ASN C 1 123 ? 30.254  81.715  75.256  1.00 17.73 ? 143 ASN C CB  1 
ATOM   4161  C CG  . ASN C 1 123 ? 31.256  82.813  75.492  1.00 20.21 ? 143 ASN C CG  1 
ATOM   4162  O OD1 . ASN C 1 123 ? 31.765  82.988  76.611  1.00 15.73 ? 143 ASN C OD1 1 
ATOM   4163  N ND2 . ASN C 1 123 ? 31.582  83.548  74.426  1.00 24.23 ? 143 ASN C ND2 1 
ATOM   4164  N N   . THR C 1 124 ? 29.666  82.792  78.284  1.00 23.32 ? 144 THR C N   1 
ATOM   4165  C CA  . THR C 1 124 ? 29.077  83.831  79.117  1.00 27.11 ? 144 THR C CA  1 
ATOM   4166  C C   . THR C 1 124 ? 29.487  85.249  78.680  1.00 31.08 ? 144 THR C C   1 
ATOM   4167  O O   . THR C 1 124 ? 28.687  86.193  78.786  1.00 34.90 ? 144 THR C O   1 
ATOM   4168  C CB  . THR C 1 124 ? 29.409  83.618  80.615  1.00 25.18 ? 144 THR C CB  1 
ATOM   4169  O OG1 . THR C 1 124 ? 30.798  83.341  80.774  1.00 23.21 ? 144 THR C OG1 1 
ATOM   4170  C CG2 . THR C 1 124 ? 28.619  82.453  81.172  1.00 27.15 ? 144 THR C CG2 1 
ATOM   4171  N N   . LYS C 1 125 ? 30.705  85.391  78.156  1.00 32.36 ? 145 LYS C N   1 
ATOM   4172  C CA  . LYS C 1 125 ? 31.201  86.693  77.708  1.00 34.99 ? 145 LYS C CA  1 
ATOM   4173  C C   . LYS C 1 125 ? 30.696  87.127  76.347  1.00 35.53 ? 145 LYS C C   1 
ATOM   4174  O O   . LYS C 1 125 ? 30.570  86.327  75.436  1.00 32.78 ? 145 LYS C O   1 
ATOM   4175  C CB  . LYS C 1 125 ? 32.722  86.717  77.699  1.00 41.17 ? 145 LYS C CB  1 
ATOM   4176  C CG  . LYS C 1 125 ? 33.358  86.769  79.076  1.00 45.61 ? 145 LYS C CG  1 
ATOM   4177  C CD  . LYS C 1 125 ? 34.859  86.961  78.942  1.00 50.68 ? 145 LYS C CD  1 
ATOM   4178  C CE  . LYS C 1 125 ? 35.514  87.269  80.284  1.00 54.57 ? 145 LYS C CE  1 
ATOM   4179  N NZ  . LYS C 1 125 ? 36.989  87.540  80.140  1.00 58.18 ? 145 LYS C NZ  1 
ATOM   4180  N N   . SER C 1 126 ? 30.424  88.419  76.224  1.00 42.14 ? 146 SER C N   1 
ATOM   4181  C CA  . SER C 1 126 ? 29.927  89.014  74.982  1.00 46.76 ? 146 SER C CA  1 
ATOM   4182  C C   . SER C 1 126 ? 31.063  89.085  73.989  1.00 50.68 ? 146 SER C C   1 
ATOM   4183  O O   . SER C 1 126 ? 30.886  88.782  72.806  1.00 52.75 ? 146 SER C O   1 
ATOM   4184  C CB  . SER C 1 126 ? 29.383  90.420  75.235  1.00 44.13 ? 146 SER C CB  1 
ATOM   4185  O OG  . SER C 1 126 ? 30.263  91.161  76.067  0.00 47.22 ? 146 SER C OG  1 
ATOM   4186  N N   . SER C 1 127 ? 32.216  89.536  74.477  1.00 52.64 ? 147 SER C N   1 
ATOM   4187  C CA  . SER C 1 127 ? 33.431  89.638  73.678  1.00 52.72 ? 147 SER C CA  1 
ATOM   4188  C C   . SER C 1 127 ? 34.422  88.708  74.360  1.00 51.27 ? 147 SER C C   1 
ATOM   4189  O O   . SER C 1 127 ? 34.876  88.975  75.475  1.00 52.91 ? 147 SER C O   1 
ATOM   4190  C CB  . SER C 1 127 ? 33.962  91.073  73.689  1.00 54.47 ? 147 SER C CB  1 
ATOM   4191  O OG  . SER C 1 127 ? 32.954  91.985  73.286  0.00 55.95 ? 147 SER C OG  1 
ATOM   4192  N N   . GLY C 1 128 ? 34.702  87.583  73.720  1.00 48.97 ? 148 GLY C N   1 
ATOM   4193  C CA  . GLY C 1 128 ? 35.625  86.629  74.303  1.00 48.47 ? 148 GLY C CA  1 
ATOM   4194  C C   . GLY C 1 128 ? 34.900  85.357  74.699  1.00 45.92 ? 148 GLY C C   1 
ATOM   4195  O O   . GLY C 1 128 ? 33.685  85.348  74.848  1.00 45.30 ? 148 GLY C O   1 
ATOM   4196  N N   . THR C 1 129 ? 35.649  84.273  74.836  1.00 43.28 ? 149 THR C N   1 
ATOM   4197  C CA  . THR C 1 129 ? 35.078  82.994  75.190  1.00 39.34 ? 149 THR C CA  1 
ATOM   4198  C C   . THR C 1 129 ? 35.380  82.625  76.641  1.00 37.79 ? 149 THR C C   1 
ATOM   4199  O O   . THR C 1 129 ? 36.539  82.534  77.051  1.00 36.74 ? 149 THR C O   1 
ATOM   4200  C CB  . THR C 1 129 ? 35.599  81.882  74.257  0.00 39.75 ? 149 THR C CB  1 
ATOM   4201  O OG1 . THR C 1 129 ? 37.016  82.021  74.084  0.00 40.73 ? 149 THR C OG1 1 
ATOM   4202  C CG2 . THR C 1 129 ? 34.915  81.961  72.901  0.00 40.74 ? 149 THR C CG2 1 
ATOM   4203  N N   . SER C 1 130 ? 34.325  82.462  77.426  1.00 32.83 ? 150 SER C N   1 
ATOM   4204  C CA  . SER C 1 130 ? 34.449  82.073  78.812  1.00 26.45 ? 150 SER C CA  1 
ATOM   4205  C C   . SER C 1 130 ? 33.333  81.065  78.972  1.00 24.06 ? 150 SER C C   1 
ATOM   4206  O O   . SER C 1 130 ? 32.233  81.444  79.317  1.00 29.50 ? 150 SER C O   1 
ATOM   4207  C CB  . SER C 1 130 ? 34.227  83.283  79.726  0.00 26.35 ? 150 SER C CB  1 
ATOM   4208  O OG  . SER C 1 130 ? 34.386  82.942  81.093  0.00 25.59 ? 150 SER C OG  1 
ATOM   4209  N N   . TYR C 1 131 ? 33.573  79.808  78.609  1.00 19.27 ? 151 TYR C N   1 
ATOM   4210  C CA  . TYR C 1 131 ? 32.546  78.776  78.738  1.00 19.59 ? 151 TYR C CA  1 
ATOM   4211  C C   . TYR C 1 131 ? 32.446  78.254  80.176  1.00 22.21 ? 151 TYR C C   1 
ATOM   4212  O O   . TYR C 1 131 ? 33.399  77.664  80.696  1.00 22.24 ? 151 TYR C O   1 
ATOM   4213  C CB  . TYR C 1 131 ? 32.817  77.624  77.774  1.00 22.71 ? 151 TYR C CB  1 
ATOM   4214  C CG  . TYR C 1 131 ? 32.601  77.988  76.327  1.00 26.16 ? 151 TYR C CG  1 
ATOM   4215  C CD1 . TYR C 1 131 ? 31.323  78.008  75.778  1.00 27.57 ? 151 TYR C CD1 1 
ATOM   4216  C CD2 . TYR C 1 131 ? 33.674  78.348  75.511  1.00 28.42 ? 151 TYR C CD2 1 
ATOM   4217  C CE1 . TYR C 1 131 ? 31.120  78.386  74.453  1.00 29.33 ? 151 TYR C CE1 1 
ATOM   4218  C CE2 . TYR C 1 131 ? 33.483  78.727  74.185  1.00 27.40 ? 151 TYR C CE2 1 
ATOM   4219  C CZ  . TYR C 1 131 ? 32.206  78.750  73.661  1.00 28.25 ? 151 TYR C CZ  1 
ATOM   4220  O OH  . TYR C 1 131 ? 32.013  79.164  72.361  1.00 27.27 ? 151 TYR C OH  1 
ATOM   4221  N N   . PRO C 1 132 ? 31.286  78.473  80.835  1.00 19.77 ? 152 PRO C N   1 
ATOM   4222  C CA  . PRO C 1 132 ? 31.006  78.059  82.215  1.00 21.54 ? 152 PRO C CA  1 
ATOM   4223  C C   . PRO C 1 132 ? 30.891  76.569  82.448  1.00 23.50 ? 152 PRO C C   1 
ATOM   4224  O O   . PRO C 1 132 ? 30.522  75.800  81.556  1.00 19.54 ? 152 PRO C O   1 
ATOM   4225  C CB  . PRO C 1 132 ? 29.702  78.771  82.516  1.00 21.63 ? 152 PRO C CB  1 
ATOM   4226  C CG  . PRO C 1 132 ? 29.033  78.809  81.186  1.00 21.71 ? 152 PRO C CG  1 
ATOM   4227  C CD  . PRO C 1 132 ? 30.139  79.205  80.272  1.00 19.91 ? 152 PRO C CD  1 
ATOM   4228  N N   . ASP C 1 133 ? 31.225  76.175  83.667  1.00 28.23 ? 153 ASP C N   1 
ATOM   4229  C CA  . ASP C 1 133 ? 31.180  74.777  84.063  1.00 35.08 ? 153 ASP C CA  1 
ATOM   4230  C C   . ASP C 1 133 ? 29.784  74.397  84.525  1.00 31.32 ? 153 ASP C C   1 
ATOM   4231  O O   . ASP C 1 133 ? 29.340  73.253  84.350  1.00 29.99 ? 153 ASP C O   1 
ATOM   4232  C CB  . ASP C 1 133 ? 32.167  74.529  85.207  1.00 45.70 ? 153 ASP C CB  1 
ATOM   4233  C CG  . ASP C 1 133 ? 33.503  74.013  84.722  1.00 57.63 ? 153 ASP C CG  1 
ATOM   4234  O OD1 . ASP C 1 133 ? 33.897  72.914  85.169  1.00 65.15 ? 153 ASP C OD1 1 
ATOM   4235  O OD2 . ASP C 1 133 ? 34.154  74.693  83.895  1.00 63.96 ? 153 ASP C OD2 1 
ATOM   4236  N N   . VAL C 1 134 ? 29.121  75.362  85.158  1.00 25.56 ? 154 VAL C N   1 
ATOM   4237  C CA  . VAL C 1 134 ? 27.788  75.167  85.692  1.00 21.14 ? 154 VAL C CA  1 
ATOM   4238  C C   . VAL C 1 134 ? 26.717  75.749  84.789  1.00 21.33 ? 154 VAL C C   1 
ATOM   4239  O O   . VAL C 1 134 ? 26.961  76.686  84.023  1.00 21.99 ? 154 VAL C O   1 
ATOM   4240  C CB  . VAL C 1 134 ? 27.636  75.797  87.080  1.00 18.42 ? 154 VAL C CB  1 
ATOM   4241  C CG1 . VAL C 1 134 ? 28.464  75.033  88.097  1.00 13.46 ? 154 VAL C CG1 1 
ATOM   4242  C CG2 . VAL C 1 134 ? 28.009  77.277  87.020  1.00 18.21 ? 154 VAL C CG2 1 
ATOM   4243  N N   . LEU C 1 135 ? 25.524  75.178  84.900  1.00 18.48 ? 155 LEU C N   1 
ATOM   4244  C CA  . LEU C 1 135 ? 24.398  75.608  84.121  1.00 13.87 ? 155 LEU C CA  1 
ATOM   4245  C C   . LEU C 1 135 ? 24.026  77.009  84.536  1.00 14.63 ? 155 LEU C C   1 
ATOM   4246  O O   . LEU C 1 135 ? 23.969  77.316  85.741  1.00 8.62  ? 155 LEU C O   1 
ATOM   4247  C CB  . LEU C 1 135 ? 23.220  74.694  84.388  1.00 12.18 ? 155 LEU C CB  1 
ATOM   4248  C CG  . LEU C 1 135 ? 21.986  74.910  83.498  1.00 12.12 ? 155 LEU C CG  1 
ATOM   4249  C CD1 . LEU C 1 135 ? 22.229  74.426  82.046  1.00 8.52  ? 155 LEU C CD1 1 
ATOM   4250  C CD2 . LEU C 1 135 ? 20.819  74.168  84.127  1.00 10.49 ? 155 LEU C CD2 1 
ATOM   4251  N N   . LYS C 1 136 ? 23.806  77.852  83.527  1.00 16.22 ? 156 LYS C N   1 
ATOM   4252  C CA  . LYS C 1 136 ? 23.388  79.243  83.714  1.00 16.91 ? 156 LYS C CA  1 
ATOM   4253  C C   . LYS C 1 136 ? 21.915  79.377  83.292  1.00 17.15 ? 156 LYS C C   1 
ATOM   4254  O O   . LYS C 1 136 ? 21.431  78.637  82.419  1.00 17.52 ? 156 LYS C O   1 
ATOM   4255  C CB  . LYS C 1 136 ? 24.252  80.197  82.877  1.00 15.68 ? 156 LYS C CB  1 
ATOM   4256  C CG  . LYS C 1 136 ? 25.716  80.141  83.223  1.00 17.84 ? 156 LYS C CG  1 
ATOM   4257  C CD  . LYS C 1 136 ? 25.947  80.623  84.632  1.00 23.00 ? 156 LYS C CD  1 
ATOM   4258  C CE  . LYS C 1 136 ? 27.364  80.317  85.051  1.00 27.36 ? 156 LYS C CE  1 
ATOM   4259  N NZ  . LYS C 1 136 ? 27.717  80.860  86.383  1.00 32.42 ? 156 LYS C NZ  1 
ATOM   4260  N N   . CYS C 1 137 ? 21.208  80.301  83.935  1.00 15.46 ? 157 CYS C N   1 
ATOM   4261  C CA  . CYS C 1 137 ? 19.810  80.564  83.649  1.00 12.47 ? 157 CYS C CA  1 
ATOM   4262  C C   . CYS C 1 137 ? 19.646  82.028  83.326  1.00 10.97 ? 157 CYS C C   1 
ATOM   4263  O O   . CYS C 1 137 ? 20.448  82.854  83.767  1.00 5.00  ? 157 CYS C O   1 
ATOM   4264  C CB  . CYS C 1 137 ? 18.962  80.211  84.847  1.00 14.07 ? 157 CYS C CB  1 
ATOM   4265  S SG  . CYS C 1 137 ? 18.645  78.438  84.980  1.00 19.37 ? 157 CYS C SG  1 
ATOM   4266  N N   . LEU C 1 138 ? 18.639  82.332  82.514  1.00 12.66 ? 158 LEU C N   1 
ATOM   4267  C CA  . LEU C 1 138 ? 18.355  83.700  82.118  1.00 16.25 ? 158 LEU C CA  1 
ATOM   4268  C C   . LEU C 1 138 ? 16.867  83.873  81.893  1.00 19.44 ? 158 LEU C C   1 
ATOM   4269  O O   . LEU C 1 138 ? 16.278  83.130  81.106  1.00 20.61 ? 158 LEU C O   1 
ATOM   4270  C CB  . LEU C 1 138 ? 19.091  84.065  80.827  1.00 16.94 ? 158 LEU C CB  1 
ATOM   4271  C CG  . LEU C 1 138 ? 18.786  85.469  80.275  1.00 16.78 ? 158 LEU C CG  1 
ATOM   4272  C CD1 . LEU C 1 138 ? 19.047  86.503  81.356  1.00 16.49 ? 158 LEU C CD1 1 
ATOM   4273  C CD2 . LEU C 1 138 ? 19.611  85.781  79.026  1.00 16.51 ? 158 LEU C CD2 1 
ATOM   4274  N N   . LYS C 1 139 ? 16.275  84.830  82.617  1.00 20.85 ? 159 LYS C N   1 
ATOM   4275  C CA  . LYS C 1 139 ? 14.855  85.172  82.522  1.00 17.94 ? 159 LYS C CA  1 
ATOM   4276  C C   . LYS C 1 139 ? 14.861  86.181  81.403  1.00 17.72 ? 159 LYS C C   1 
ATOM   4277  O O   . LYS C 1 139 ? 15.736  87.038  81.368  1.00 20.36 ? 159 LYS C O   1 
ATOM   4278  C CB  . LYS C 1 139 ? 14.379  85.849  83.805  0.00 20.59 ? 159 LYS C CB  1 
ATOM   4279  C CG  . LYS C 1 139 ? 14.547  85.000  85.039  0.00 22.52 ? 159 LYS C CG  1 
ATOM   4280  C CD  . LYS C 1 139 ? 13.659  83.776  84.979  0.00 23.17 ? 159 LYS C CD  1 
ATOM   4281  C CE  . LYS C 1 139 ? 14.016  82.808  86.081  0.00 23.59 ? 159 LYS C CE  1 
ATOM   4282  N NZ  . LYS C 1 139 ? 14.087  83.495  87.391  0.00 23.57 ? 159 LYS C NZ  1 
ATOM   4283  N N   . ALA C 1 140 ? 13.945  86.044  80.458  1.00 16.13 ? 160 ALA C N   1 
ATOM   4284  C CA  . ALA C 1 140 ? 13.868  86.953  79.315  1.00 15.50 ? 160 ALA C CA  1 
ATOM   4285  C C   . ALA C 1 140 ? 12.471  86.874  78.715  1.00 15.69 ? 160 ALA C C   1 
ATOM   4286  O O   . ALA C 1 140 ? 11.839  85.822  78.718  1.00 18.80 ? 160 ALA C O   1 
ATOM   4287  C CB  . ALA C 1 140 ? 14.915  86.571  78.254  1.00 14.30 ? 160 ALA C CB  1 
ATOM   4288  N N   . PRO C 1 141 ? 11.956  87.993  78.216  1.00 10.95 ? 161 PRO C N   1 
ATOM   4289  C CA  . PRO C 1 141 ? 10.624  87.971  77.629  1.00 10.34 ? 161 PRO C CA  1 
ATOM   4290  C C   . PRO C 1 141 ? 10.651  87.659  76.147  1.00 11.61 ? 161 PRO C C   1 
ATOM   4291  O O   . PRO C 1 141 ? 11.702  87.723  75.497  1.00 15.31 ? 161 PRO C O   1 
ATOM   4292  C CB  . PRO C 1 141 ? 10.173  89.400  77.837  1.00 11.95 ? 161 PRO C CB  1 
ATOM   4293  C CG  . PRO C 1 141 ? 11.422  90.150  77.538  1.00 12.11 ? 161 PRO C CG  1 
ATOM   4294  C CD  . PRO C 1 141 ? 12.478  89.365  78.286  1.00 11.16 ? 161 PRO C CD  1 
ATOM   4295  N N   . ILE C 1 142 ? 9.488   87.314  75.619  1.00 11.40 ? 162 ILE C N   1 
ATOM   4296  C CA  . ILE C 1 142 ? 9.333   87.054  74.200  1.00 11.62 ? 162 ILE C CA  1 
ATOM   4297  C C   . ILE C 1 142 ? 9.066   88.409  73.543  1.00 14.99 ? 162 ILE C C   1 
ATOM   4298  O O   . ILE C 1 142 ? 8.162   89.130  73.950  1.00 19.01 ? 162 ILE C O   1 
ATOM   4299  C CB  . ILE C 1 142 ? 8.167   86.090  73.975  1.00 8.21  ? 162 ILE C CB  1 
ATOM   4300  C CG1 . ILE C 1 142 ? 8.615   84.682  74.375  1.00 7.45  ? 162 ILE C CG1 1 
ATOM   4301  C CG2 . ILE C 1 142 ? 7.622   86.205  72.562  1.00 5.00  ? 162 ILE C CG2 1 
ATOM   4302  C CD1 . ILE C 1 142 ? 7.548   83.644  74.355  1.00 7.39  ? 162 ILE C CD1 1 
ATOM   4303  N N   . LEU C 1 143 ? 9.904   88.800  72.593  1.00 16.88 ? 163 LEU C N   1 
ATOM   4304  C CA  . LEU C 1 143 ? 9.720   90.075  71.910  1.00 18.66 ? 163 LEU C CA  1 
ATOM   4305  C C   . LEU C 1 143 ? 8.623   89.965  70.850  1.00 21.89 ? 163 LEU C C   1 
ATOM   4306  O O   . LEU C 1 143 ? 8.241   88.875  70.409  1.00 18.77 ? 163 LEU C O   1 
ATOM   4307  C CB  . LEU C 1 143 ? 11.019  90.546  71.249  1.00 15.73 ? 163 LEU C CB  1 
ATOM   4308  C CG  . LEU C 1 143 ? 12.326  90.514  72.052  1.00 15.86 ? 163 LEU C CG  1 
ATOM   4309  C CD1 . LEU C 1 143 ? 13.313  91.400  71.331  1.00 18.43 ? 163 LEU C CD1 1 
ATOM   4310  C CD2 . LEU C 1 143 ? 12.170  91.023  73.477  1.00 12.77 ? 163 LEU C CD2 1 
ATOM   4311  N N   . SER C 1 144 ? 8.107   91.115  70.452  1.00 26.98 ? 164 SER C N   1 
ATOM   4312  C CA  . SER C 1 144 ? 7.060   91.177  69.451  1.00 28.57 ? 164 SER C CA  1 
ATOM   4313  C C   . SER C 1 144 ? 7.619   90.839  68.064  1.00 28.40 ? 164 SER C C   1 
ATOM   4314  O O   . SER C 1 144 ? 8.681   91.349  67.650  1.00 27.65 ? 164 SER C O   1 
ATOM   4315  C CB  . SER C 1 144 ? 6.430   92.578  69.475  1.00 30.64 ? 164 SER C CB  1 
ATOM   4316  O OG  . SER C 1 144 ? 7.414   93.593  69.680  1.00 33.78 ? 164 SER C OG  1 
ATOM   4317  N N   . ASP C 1 145 ? 6.895   89.981  67.350  0.00 27.73 ? 165 ASP C N   1 
ATOM   4318  C CA  . ASP C 1 145 ? 7.269   89.553  66.003  0.00 28.92 ? 165 ASP C CA  1 
ATOM   4319  C C   . ASP C 1 145 ? 7.772   90.741  65.184  0.00 31.88 ? 165 ASP C C   1 
ATOM   4320  O O   . ASP C 1 145 ? 8.646   90.601  64.330  0.00 32.53 ? 165 ASP C O   1 
ATOM   4321  C CB  . ASP C 1 145 ? 6.059   88.910  65.315  0.00 26.74 ? 165 ASP C CB  1 
ATOM   4322  C CG  . ASP C 1 145 ? 6.368   88.428  63.911  0.00 23.72 ? 165 ASP C CG  1 
ATOM   4323  O OD1 . ASP C 1 145 ? 7.286   87.596  63.748  0.00 21.44 ? 165 ASP C OD1 1 
ATOM   4324  O OD2 . ASP C 1 145 ? 5.684   88.879  62.968  0.00 21.54 ? 165 ASP C OD2 1 
ATOM   4325  N N   . SER C 1 146 ? 7.266   91.919  65.522  1.00 33.93 ? 166 SER C N   1 
ATOM   4326  C CA  . SER C 1 146 ? 7.624   93.156  64.857  1.00 35.13 ? 166 SER C CA  1 
ATOM   4327  C C   . SER C 1 146 ? 9.063   93.548  65.159  1.00 36.56 ? 166 SER C C   1 
ATOM   4328  O O   . SER C 1 146 ? 9.894   93.658  64.235  1.00 36.89 ? 166 SER C O   1 
ATOM   4329  C CB  . SER C 1 146 ? 6.660   94.277  65.271  1.00 33.55 ? 166 SER C CB  1 
ATOM   4330  O OG  . SER C 1 146 ? 6.342   94.196  66.651  0.00 34.87 ? 166 SER C OG  1 
ATOM   4331  N N   . SER C 1 147 ? 9.371   93.745  66.443  1.00 34.95 ? 167 SER C N   1 
ATOM   4332  C CA  . SER C 1 147 ? 10.726  94.143  66.837  1.00 33.45 ? 167 SER C CA  1 
ATOM   4333  C C   . SER C 1 147 ? 11.709  93.102  66.275  1.00 31.32 ? 167 SER C C   1 
ATOM   4334  O O   . SER C 1 147 ? 12.815  93.411  65.797  1.00 29.14 ? 167 SER C O   1 
ATOM   4335  C CB  . SER C 1 147 ? 10.823  94.216  68.361  1.00 34.18 ? 167 SER C CB  1 
ATOM   4336  O OG  . SER C 1 147 ? 9.725   94.928  68.901  1.00 36.20 ? 167 SER C OG  1 
ATOM   4337  N N   . CYS C 1 148 ? 11.245  91.863  66.276  1.00 28.37 ? 168 CYS C N   1 
ATOM   4338  C CA  . CYS C 1 148 ? 12.038  90.770  65.781  1.00 24.83 ? 168 CYS C CA  1 
ATOM   4339  C C   . CYS C 1 148 ? 12.360  91.048  64.319  1.00 22.59 ? 168 CYS C C   1 
ATOM   4340  O O   . CYS C 1 148 ? 13.503  91.328  63.979  1.00 21.90 ? 168 CYS C O   1 
ATOM   4341  C CB  . CYS C 1 148 ? 11.245  89.468  65.928  1.00 23.96 ? 168 CYS C CB  1 
ATOM   4342  S SG  . CYS C 1 148 ? 12.225  87.939  65.872  1.00 17.04 ? 168 CYS C SG  1 
ATOM   4343  N N   . LYS C 1 149 ? 11.331  91.066  63.476  1.00 21.87 ? 169 LYS C N   1 
ATOM   4344  C CA  . LYS C 1 149 ? 11.513  91.283  62.042  1.00 23.08 ? 169 LYS C CA  1 
ATOM   4345  C C   . LYS C 1 149 ? 12.301  92.537  61.725  1.00 23.56 ? 169 LYS C C   1 
ATOM   4346  O O   . LYS C 1 149 ? 13.125  92.554  60.805  1.00 21.80 ? 169 LYS C O   1 
ATOM   4347  C CB  . LYS C 1 149 ? 10.166  91.287  61.302  1.00 22.28 ? 169 LYS C CB  1 
ATOM   4348  C CG  . LYS C 1 149 ? 9.544   89.894  61.108  1.00 22.07 ? 169 LYS C CG  1 
ATOM   4349  C CD  . LYS C 1 149 ? 8.167   89.961  60.458  1.00 21.48 ? 169 LYS C CD  1 
ATOM   4350  C CE  . LYS C 1 149 ? 7.578   88.579  60.222  0.00 20.99 ? 169 LYS C CE  1 
ATOM   4351  N NZ  . LYS C 1 149 ? 8.310   87.831  59.168  0.00 21.04 ? 169 LYS C NZ  1 
ATOM   4352  N N   . SER C 1 150 ? 12.068  93.592  62.490  1.00 25.88 ? 170 SER C N   1 
ATOM   4353  C CA  . SER C 1 150 ? 12.812  94.820  62.241  1.00 29.96 ? 170 SER C CA  1 
ATOM   4354  C C   . SER C 1 150 ? 14.308  94.566  62.455  1.00 33.10 ? 170 SER C C   1 
ATOM   4355  O O   . SER C 1 150 ? 15.133  94.903  61.600  1.00 31.15 ? 170 SER C O   1 
ATOM   4356  C CB  . SER C 1 150 ? 12.312  95.968  63.128  1.00 28.04 ? 170 SER C CB  1 
ATOM   4357  O OG  . SER C 1 150 ? 12.131  95.556  64.469  0.00 28.77 ? 170 SER C OG  1 
ATOM   4358  N N   . ALA C 1 151 ? 14.636  93.911  63.569  1.00 35.60 ? 171 ALA C N   1 
ATOM   4359  C CA  . ALA C 1 151 ? 16.024  93.593  63.905  1.00 34.40 ? 171 ALA C CA  1 
ATOM   4360  C C   . ALA C 1 151 ? 16.675  92.702  62.838  1.00 32.01 ? 171 ALA C C   1 
ATOM   4361  O O   . ALA C 1 151 ? 17.832  92.917  62.460  1.00 34.58 ? 171 ALA C O   1 
ATOM   4362  C CB  . ALA C 1 151 ? 16.090  92.913  65.277  1.00 31.77 ? 171 ALA C CB  1 
ATOM   4363  N N   . TYR C 1 152 ? 15.939  91.690  62.383  1.00 29.10 ? 172 TYR C N   1 
ATOM   4364  C CA  . TYR C 1 152 ? 16.441  90.780  61.367  1.00 29.48 ? 172 TYR C CA  1 
ATOM   4365  C C   . TYR C 1 152 ? 15.490  90.763  60.173  1.00 32.90 ? 172 TYR C C   1 
ATOM   4366  O O   . TYR C 1 152 ? 14.771  89.775  59.925  1.00 33.24 ? 172 TYR C O   1 
ATOM   4367  C CB  . TYR C 1 152 ? 16.609  89.379  61.933  1.00 25.47 ? 172 TYR C CB  1 
ATOM   4368  C CG  . TYR C 1 152 ? 17.478  89.322  63.149  1.00 19.74 ? 172 TYR C CG  1 
ATOM   4369  C CD1 . TYR C 1 152 ? 16.913  89.334  64.424  1.00 17.08 ? 172 TYR C CD1 1 
ATOM   4370  C CD2 . TYR C 1 152 ? 18.862  89.229  63.035  1.00 15.97 ? 172 TYR C CD2 1 
ATOM   4371  C CE1 . TYR C 1 152 ? 17.707  89.257  65.567  1.00 14.76 ? 172 TYR C CE1 1 
ATOM   4372  C CE2 . TYR C 1 152 ? 19.662  89.141  64.165  1.00 14.49 ? 172 TYR C CE2 1 
ATOM   4373  C CZ  . TYR C 1 152 ? 19.081  89.159  65.430  1.00 13.51 ? 172 TYR C CZ  1 
ATOM   4374  O OH  . TYR C 1 152 ? 19.891  89.102  66.537  1.00 9.96  ? 172 TYR C OH  1 
ATOM   4375  N N   . PRO C 1 153 ? 15.539  91.838  59.364  1.00 38.25 ? 173 PRO C N   1 
ATOM   4376  C CA  . PRO C 1 153 ? 14.719  92.045  58.164  1.00 34.33 ? 173 PRO C CA  1 
ATOM   4377  C C   . PRO C 1 153 ? 14.429  90.816  57.293  1.00 34.10 ? 173 PRO C C   1 
ATOM   4378  O O   . PRO C 1 153 ? 15.332  90.239  56.689  1.00 32.36 ? 173 PRO C O   1 
ATOM   4379  C CB  . PRO C 1 153 ? 15.514  93.115  57.391  1.00 33.97 ? 173 PRO C CB  1 
ATOM   4380  C CG  . PRO C 1 153 ? 16.937  92.981  57.932  1.00 31.18 ? 173 PRO C CG  1 
ATOM   4381  C CD  . PRO C 1 153 ? 16.637  92.823  59.397  1.00 34.83 ? 173 PRO C CD  1 
ATOM   4382  N N   . GLY C 1 154 ? 13.159  90.433  57.236  0.00 34.19 ? 174 GLY C N   1 
ATOM   4383  C CA  . GLY C 1 154 ? 12.751  89.300  56.424  0.00 35.24 ? 174 GLY C CA  1 
ATOM   4384  C C   . GLY C 1 154 ? 13.269  87.939  56.849  0.00 39.53 ? 174 GLY C C   1 
ATOM   4385  O O   . GLY C 1 154 ? 12.585  86.935  56.660  0.00 40.74 ? 174 GLY C O   1 
ATOM   4386  N N   . GLN C 1 155 ? 14.465  87.901  57.430  1.00 40.63 ? 175 GLN C N   1 
ATOM   4387  C CA  . GLN C 1 155 ? 15.077  86.647  57.872  1.00 37.74 ? 175 GLN C CA  1 
ATOM   4388  C C   . GLN C 1 155 ? 14.222  85.914  58.897  1.00 33.16 ? 175 GLN C C   1 
ATOM   4389  O O   . GLN C 1 155 ? 14.285  84.687  58.995  1.00 32.11 ? 175 GLN C O   1 
ATOM   4390  C CB  . GLN C 1 155 ? 16.451  86.909  58.478  1.00 39.06 ? 175 GLN C CB  1 
ATOM   4391  C CG  . GLN C 1 155 ? 17.438  87.560  57.532  1.00 44.85 ? 175 GLN C CG  1 
ATOM   4392  C CD  . GLN C 1 155 ? 18.804  87.726  58.164  1.00 50.13 ? 175 GLN C CD  1 
ATOM   4393  O OE1 . GLN C 1 155 ? 19.682  86.879  57.994  1.00 52.29 ? 175 GLN C OE1 1 
ATOM   4394  N NE2 . GLN C 1 155 ? 18.990  88.818  58.908  1.00 52.99 ? 175 GLN C NE2 1 
ATOM   4395  N N   . ILE C 1 156 ? 13.472  86.678  59.689  1.00 28.49 ? 176 ILE C N   1 
ATOM   4396  C CA  . ILE C 1 156 ? 12.606  86.110  60.710  1.00 24.52 ? 176 ILE C CA  1 
ATOM   4397  C C   . ILE C 1 156 ? 11.391  85.459  60.067  1.00 23.89 ? 176 ILE C C   1 
ATOM   4398  O O   . ILE C 1 156 ? 10.533  86.158  59.530  1.00 24.19 ? 176 ILE C O   1 
ATOM   4399  C CB  . ILE C 1 156 ? 12.144  87.193  61.711  1.00 21.91 ? 176 ILE C CB  1 
ATOM   4400  C CG1 . ILE C 1 156 ? 13.367  87.804  62.410  1.00 23.07 ? 176 ILE C CG1 1 
ATOM   4401  C CG2 . ILE C 1 156 ? 11.146  86.614  62.732  1.00 21.70 ? 176 ILE C CG2 1 
ATOM   4402  C CD1 . ILE C 1 156 ? 14.351  86.784  63.002  1.00 19.32 ? 176 ILE C CD1 1 
ATOM   4403  N N   . THR C 1 157 ? 11.341  84.125  60.103  1.00 23.62 ? 177 THR C N   1 
ATOM   4404  C CA  . THR C 1 157 ? 10.216  83.376  59.537  1.00 21.98 ? 177 THR C CA  1 
ATOM   4405  C C   . THR C 1 157 ? 9.126   83.178  60.583  1.00 20.85 ? 177 THR C C   1 
ATOM   4406  O O   . THR C 1 157 ? 9.264   83.598  61.737  1.00 17.67 ? 177 THR C O   1 
ATOM   4407  C CB  . THR C 1 157 ? 10.637  81.988  59.013  1.00 18.73 ? 177 THR C CB  1 
ATOM   4408  O OG1 . THR C 1 157 ? 11.039  81.152  60.105  1.00 15.91 ? 177 THR C OG1 1 
ATOM   4409  C CG2 . THR C 1 157 ? 11.781  82.136  58.039  1.00 20.47 ? 177 THR C CG2 1 
ATOM   4410  N N   . SER C 1 158 ? 8.050   82.517  60.174  1.00 20.29 ? 178 SER C N   1 
ATOM   4411  C CA  . SER C 1 158 ? 6.936   82.248  61.073  1.00 20.30 ? 178 SER C CA  1 
ATOM   4412  C C   . SER C 1 158 ? 7.306   81.190  62.097  1.00 20.31 ? 178 SER C C   1 
ATOM   4413  O O   . SER C 1 158 ? 6.560   80.964  63.053  1.00 23.13 ? 178 SER C O   1 
ATOM   4414  C CB  . SER C 1 158 ? 5.722   81.770  60.275  1.00 22.93 ? 178 SER C CB  1 
ATOM   4415  O OG  . SER C 1 158 ? 6.109   80.897  59.228  0.00 21.14 ? 178 SER C OG  1 
ATOM   4416  N N   . ASN C 1 159 ? 8.448   80.538  61.879  1.00 19.51 ? 179 ASN C N   1 
ATOM   4417  C CA  . ASN C 1 159 ? 8.937   79.488  62.764  1.00 17.71 ? 179 ASN C CA  1 
ATOM   4418  C C   . ASN C 1 159 ? 10.058  79.987  63.670  1.00 16.24 ? 179 ASN C C   1 
ATOM   4419  O O   . ASN C 1 159 ? 10.801  79.203  64.264  1.00 16.52 ? 179 ASN C O   1 
ATOM   4420  C CB  . ASN C 1 159 ? 9.429   78.312  61.934  1.00 19.00 ? 179 ASN C CB  1 
ATOM   4421  C CG  . ASN C 1 159 ? 8.337   77.718  61.085  1.00 20.72 ? 179 ASN C CG  1 
ATOM   4422  O OD1 . ASN C 1 159 ? 7.153   77.773  61.441  1.00 21.22 ? 179 ASN C OD1 1 
ATOM   4423  N ND2 . ASN C 1 159 ? 8.718   77.152  59.951  1.00 20.05 ? 179 ASN C ND2 1 
ATOM   4424  N N   . MET C 1 160 ? 10.173  81.301  63.780  1.00 15.34 ? 180 MET C N   1 
ATOM   4425  C CA  . MET C 1 160 ? 11.193  81.917  64.610  1.00 15.14 ? 180 MET C CA  1 
ATOM   4426  C C   . MET C 1 160 ? 10.574  82.996  65.518  1.00 17.84 ? 180 MET C C   1 
ATOM   4427  O O   . MET C 1 160 ? 9.498   83.547  65.221  1.00 23.31 ? 180 MET C O   1 
ATOM   4428  C CB  . MET C 1 160 ? 12.241  82.561  63.712  1.00 12.65 ? 180 MET C CB  1 
ATOM   4429  C CG  . MET C 1 160 ? 12.873  81.601  62.741  1.00 11.47 ? 180 MET C CG  1 
ATOM   4430  S SD  . MET C 1 160 ? 14.230  82.349  61.806  1.00 12.53 ? 180 MET C SD  1 
ATOM   4431  C CE  . MET C 1 160 ? 14.301  81.194  60.444  1.00 8.14  ? 180 MET C CE  1 
ATOM   4432  N N   . PHE C 1 161 ? 11.218  83.272  66.645  1.00 13.79 ? 181 PHE C N   1 
ATOM   4433  C CA  . PHE C 1 161 ? 10.711  84.303  67.528  1.00 14.02 ? 181 PHE C CA  1 
ATOM   4434  C C   . PHE C 1 161 ? 11.873  84.847  68.289  1.00 16.18 ? 181 PHE C C   1 
ATOM   4435  O O   . PHE C 1 161 ? 12.774  84.097  68.623  1.00 20.51 ? 181 PHE C O   1 
ATOM   4436  C CB  . PHE C 1 161 ? 9.599   83.782  68.463  1.00 14.04 ? 181 PHE C CB  1 
ATOM   4437  C CG  . PHE C 1 161 ? 10.071  82.930  69.613  1.00 10.66 ? 181 PHE C CG  1 
ATOM   4438  C CD1 . PHE C 1 161 ? 10.637  83.511  70.751  1.00 6.48  ? 181 PHE C CD1 1 
ATOM   4439  C CD2 . PHE C 1 161 ? 9.854   81.547  69.594  1.00 10.76 ? 181 PHE C CD2 1 
ATOM   4440  C CE1 . PHE C 1 161 ? 10.974  82.727  71.855  1.00 8.94  ? 181 PHE C CE1 1 
ATOM   4441  C CE2 . PHE C 1 161 ? 10.185  80.744  70.695  1.00 9.31  ? 181 PHE C CE2 1 
ATOM   4442  C CZ  . PHE C 1 161 ? 10.746  81.332  71.831  1.00 10.47 ? 181 PHE C CZ  1 
ATOM   4443  N N   . CYS C 1 162 ? 11.901  86.156  68.486  1.00 15.58 ? 182 CYS C N   1 
ATOM   4444  C CA  . CYS C 1 162 ? 12.992  86.786  69.205  1.00 14.89 ? 182 CYS C CA  1 
ATOM   4445  C C   . CYS C 1 162 ? 12.667  86.769  70.669  1.00 15.06 ? 182 CYS C C   1 
ATOM   4446  O O   . CYS C 1 162 ? 11.502  86.693  71.035  1.00 16.16 ? 182 CYS C O   1 
ATOM   4447  C CB  . CYS C 1 162 ? 13.163  88.233  68.748  1.00 16.66 ? 182 CYS C CB  1 
ATOM   4448  S SG  . CYS C 1 162 ? 13.802  88.442  67.051  1.00 19.31 ? 182 CYS C SG  1 
ATOM   4449  N N   . ALA C 1 163 ? 13.694  86.771  71.503  1.00 15.41 ? 183 ALA C N   1 
ATOM   4450  C CA  . ALA C 1 163 ? 13.497  86.818  72.951  1.00 18.09 ? 183 ALA C CA  1 
ATOM   4451  C C   . ALA C 1 163 ? 14.747  87.439  73.532  1.00 19.12 ? 183 ALA C C   1 
ATOM   4452  O O   . ALA C 1 163 ? 15.834  87.271  72.971  1.00 20.35 ? 183 ALA C O   1 
ATOM   4453  C CB  . ALA C 1 163 ? 13.266  85.430  73.530  1.00 15.64 ? 183 ALA C CB  1 
ATOM   4454  N N   . GLY C 1 164 A 14.599  88.179  74.625  1.00 18.84 ? 184 GLY C N   1 
ATOM   4455  C CA  . GLY C 1 164 A 15.756  88.808  75.229  1.00 19.43 ? 184 GLY C CA  1 
ATOM   4456  C C   . GLY C 1 164 A 15.547  90.272  75.526  1.00 21.35 ? 184 GLY C C   1 
ATOM   4457  O O   . GLY C 1 164 A 14.447  90.657  75.927  1.00 21.51 ? 184 GLY C O   1 
ATOM   4458  N N   . TYR C 1 165 ? 16.575  91.090  75.298  1.00 21.43 ? 184 TYR C N   1 
ATOM   4459  C CA  . TYR C 1 165 ? 16.505  92.522  75.592  1.00 22.38 ? 184 TYR C CA  1 
ATOM   4460  C C   . TYR C 1 165 ? 17.081  93.356  74.477  1.00 21.42 ? 184 TYR C C   1 
ATOM   4461  O O   . TYR C 1 165 ? 18.272  93.285  74.222  1.00 25.60 ? 184 TYR C O   1 
ATOM   4462  C CB  . TYR C 1 165 ? 17.262  92.826  76.897  1.00 23.03 ? 184 TYR C CB  1 
ATOM   4463  C CG  . TYR C 1 165 ? 16.768  91.986  78.057  1.00 25.66 ? 184 TYR C CG  1 
ATOM   4464  C CD1 . TYR C 1 165 ? 17.532  90.932  78.559  1.00 25.15 ? 184 TYR C CD1 1 
ATOM   4465  C CD2 . TYR C 1 165 ? 15.500  92.208  78.612  1.00 28.25 ? 184 TYR C CD2 1 
ATOM   4466  C CE1 . TYR C 1 165 ? 17.044  90.118  79.582  1.00 25.80 ? 184 TYR C CE1 1 
ATOM   4467  C CE2 . TYR C 1 165 ? 15.008  91.403  79.629  1.00 28.39 ? 184 TYR C CE2 1 
ATOM   4468  C CZ  . TYR C 1 165 ? 15.782  90.361  80.109  1.00 26.97 ? 184 TYR C CZ  1 
ATOM   4469  O OH  . TYR C 1 165 ? 15.286  89.579  81.122  1.00 27.09 ? 184 TYR C OH  1 
ATOM   4470  N N   . LEU C 1 166 ? 16.258  94.184  73.844  1.00 20.59 ? 185 LEU C N   1 
ATOM   4471  C CA  . LEU C 1 166 ? 16.739  95.025  72.751  1.00 22.22 ? 185 LEU C CA  1 
ATOM   4472  C C   . LEU C 1 166 ? 17.918  95.884  73.194  1.00 27.67 ? 185 LEU C C   1 
ATOM   4473  O O   . LEU C 1 166 ? 18.773  96.230  72.381  1.00 28.47 ? 185 LEU C O   1 
ATOM   4474  C CB  . LEU C 1 166 ? 15.620  95.898  72.178  1.00 18.17 ? 185 LEU C CB  1 
ATOM   4475  C CG  . LEU C 1 166 ? 14.553  95.200  71.332  1.00 16.61 ? 185 LEU C CG  1 
ATOM   4476  C CD1 . LEU C 1 166 ? 13.398  96.150  71.051  0.00 15.53 ? 185 LEU C CD1 1 
ATOM   4477  C CD2 . LEU C 1 166 ? 15.166  94.702  70.034  0.00 15.53 ? 185 LEU C CD2 1 
ATOM   4478  N N   . GLU C 1 167 ? 17.985  96.191  74.491  1.00 31.43 ? 186 GLU C N   1 
ATOM   4479  C CA  . GLU C 1 167 ? 19.081  97.001  75.019  1.00 31.14 ? 186 GLU C CA  1 
ATOM   4480  C C   . GLU C 1 167 ? 20.371  96.209  74.946  1.00 32.41 ? 186 GLU C C   1 
ATOM   4481  O O   . GLU C 1 167 ? 21.415  96.762  74.623  1.00 33.50 ? 186 GLU C O   1 
ATOM   4482  C CB  . GLU C 1 167 ? 18.832  97.415  76.472  0.00 29.33 ? 186 GLU C CB  1 
ATOM   4483  C CG  . GLU C 1 167 ? 19.971  98.258  77.051  0.00 28.41 ? 186 GLU C CG  1 
ATOM   4484  C CD  . GLU C 1 167 ? 19.883  98.447  78.553  0.00 29.21 ? 186 GLU C CD  1 
ATOM   4485  O OE1 . GLU C 1 167 ? 19.940  99.609  79.008  0.00 29.65 ? 186 GLU C OE1 1 
ATOM   4486  O OE2 . GLU C 1 167 ? 19.776  97.437  79.280  0.00 29.69 ? 186 GLU C OE2 1 
ATOM   4487  N N   . GLY C 1 168 ? 20.276  94.907  75.217  1.00 32.92 ? 187 GLY C N   1 
ATOM   4488  C CA  . GLY C 1 168 ? 21.439  94.032  75.212  1.00 32.92 ? 187 GLY C CA  1 
ATOM   4489  C C   . GLY C 1 168 ? 21.926  93.733  76.628  1.00 32.08 ? 187 GLY C C   1 
ATOM   4490  O O   . GLY C 1 168 ? 21.328  94.180  77.611  1.00 34.26 ? 187 GLY C O   1 
ATOM   4491  N N   . GLY C 1 169 A 23.007  92.969  76.740  1.00 30.47 ? 188 GLY C N   1 
ATOM   4492  C CA  . GLY C 1 169 A 23.550  92.635  78.049  1.00 27.93 ? 188 GLY C CA  1 
ATOM   4493  C C   . GLY C 1 169 A 23.205  91.243  78.551  1.00 25.27 ? 188 GLY C C   1 
ATOM   4494  O O   . GLY C 1 169 A 23.959  90.663  79.346  1.00 23.73 ? 188 GLY C O   1 
ATOM   4495  N N   . LYS C 1 170 ? 22.071  90.716  78.089  1.00 23.34 ? 188 LYS C N   1 
ATOM   4496  C CA  . LYS C 1 170 ? 21.592  89.378  78.467  1.00 20.86 ? 188 LYS C CA  1 
ATOM   4497  C C   . LYS C 1 170 ? 21.051  88.670  77.219  1.00 18.04 ? 188 LYS C C   1 
ATOM   4498  O O   . LYS C 1 170 ? 20.116  89.153  76.573  1.00 19.31 ? 188 LYS C O   1 
ATOM   4499  C CB  . LYS C 1 170 ? 20.487  89.485  79.522  1.00 19.18 ? 188 LYS C CB  1 
ATOM   4500  C CG  . LYS C 1 170 ? 20.890  90.298  80.746  1.00 19.33 ? 188 LYS C CG  1 
ATOM   4501  C CD  . LYS C 1 170 ? 19.743  90.462  81.738  1.00 19.99 ? 188 LYS C CD  1 
ATOM   4502  C CE  . LYS C 1 170 ? 20.168  91.297  82.934  0.00 19.22 ? 188 LYS C CE  1 
ATOM   4503  N NZ  . LYS C 1 170 ? 19.048  91.470  83.898  0.00 18.97 ? 188 LYS C NZ  1 
ATOM   4504  N N   . ASP C 1 171 ? 21.636  87.528  76.886  1.00 13.11 ? 189 ASP C N   1 
ATOM   4505  C CA  . ASP C 1 171 ? 21.243  86.793  75.699  1.00 11.69 ? 189 ASP C CA  1 
ATOM   4506  C C   . ASP C 1 171 ? 21.928  85.437  75.716  1.00 13.33 ? 189 ASP C C   1 
ATOM   4507  O O   . ASP C 1 171 ? 22.867  85.229  76.485  1.00 13.27 ? 189 ASP C O   1 
ATOM   4508  C CB  . ASP C 1 171 ? 21.704  87.572  74.475  1.00 13.34 ? 189 ASP C CB  1 
ATOM   4509  C CG  . ASP C 1 171 ? 21.322  86.909  73.162  1.00 16.56 ? 189 ASP C CG  1 
ATOM   4510  O OD1 . ASP C 1 171 ? 21.954  87.254  72.139  1.00 17.30 ? 189 ASP C OD1 1 
ATOM   4511  O OD2 . ASP C 1 171 ? 20.394  86.072  73.131  1.00 15.64 ? 189 ASP C OD2 1 
ATOM   4512  N N   . SER C 1 172 ? 21.393  84.479  74.956  1.00 14.29 ? 190 SER C N   1 
ATOM   4513  C CA  . SER C 1 172 ? 21.998  83.147  74.869  1.00 12.26 ? 190 SER C CA  1 
ATOM   4514  C C   . SER C 1 172 ? 23.264  83.296  73.987  1.00 11.62 ? 190 SER C C   1 
ATOM   4515  O O   . SER C 1 172 ? 23.464  84.334  73.332  1.00 8.40  ? 190 SER C O   1 
ATOM   4516  C CB  . SER C 1 172 ? 21.002  82.127  74.289  1.00 8.33  ? 190 SER C CB  1 
ATOM   4517  O OG  . SER C 1 172 ? 20.393  82.618  73.104  1.00 5.66  ? 190 SER C OG  1 
ATOM   4518  N N   . CYS C 1 173 ? 24.109  82.274  73.957  1.00 10.62 ? 191 CYS C N   1 
ATOM   4519  C CA  . CYS C 1 173 ? 25.333  82.375  73.186  1.00 10.44 ? 191 CYS C CA  1 
ATOM   4520  C C   . CYS C 1 173 ? 25.892  81.007  72.784  1.00 12.34 ? 191 CYS C C   1 
ATOM   4521  O O   . CYS C 1 173 ? 25.475  79.970  73.309  1.00 14.04 ? 191 CYS C O   1 
ATOM   4522  C CB  . CYS C 1 173 ? 26.368  83.162  73.978  1.00 9.91  ? 191 CYS C CB  1 
ATOM   4523  S SG  . CYS C 1 173 ? 27.639  83.968  72.957  1.00 14.93 ? 191 CYS C SG  1 
ATOM   4524  N N   . GLN C 1 174 ? 26.827  81.029  71.833  1.00 12.94 ? 192 GLN C N   1 
ATOM   4525  C CA  . GLN C 1 174 ? 27.475  79.840  71.282  1.00 8.94  ? 192 GLN C CA  1 
ATOM   4526  C C   . GLN C 1 174 ? 27.706  78.810  72.367  1.00 6.99  ? 192 GLN C C   1 
ATOM   4527  O O   . GLN C 1 174 ? 28.275  79.104  73.415  1.00 5.00  ? 192 GLN C O   1 
ATOM   4528  C CB  . GLN C 1 174 ? 28.765  80.223  70.525  1.00 7.66  ? 192 GLN C CB  1 
ATOM   4529  C CG  . GLN C 1 174 ? 28.522  80.908  69.145  1.00 5.00  ? 192 GLN C CG  1 
ATOM   4530  C CD  . GLN C 1 174 ? 27.807  82.256  69.225  1.00 5.00  ? 192 GLN C CD  1 
ATOM   4531  O OE1 . GLN C 1 174 ? 26.599  82.316  69.441  0.00 5.00  ? 192 GLN C OE1 1 
ATOM   4532  N NE2 . GLN C 1 174 ? 28.552  83.337  69.046  0.00 5.00  ? 192 GLN C NE2 1 
ATOM   4533  N N   . GLY C 1 175 ? 27.145  77.631  72.135  1.00 7.43  ? 193 GLY C N   1 
ATOM   4534  C CA  . GLY C 1 175 ? 27.215  76.541  73.087  1.00 8.47  ? 193 GLY C CA  1 
ATOM   4535  C C   . GLY C 1 175 ? 25.841  76.377  73.735  1.00 8.41  ? 193 GLY C C   1 
ATOM   4536  O O   . GLY C 1 175 ? 25.605  75.432  74.507  1.00 9.87  ? 193 GLY C O   1 
ATOM   4537  N N   . ASP C 1 176 ? 24.942  77.318  73.451  1.00 5.95  ? 194 ASP C N   1 
ATOM   4538  C CA  . ASP C 1 176 ? 23.596  77.290  73.994  1.00 5.00  ? 194 ASP C CA  1 
ATOM   4539  C C   . ASP C 1 176 ? 22.587  76.762  72.994  1.00 6.28  ? 194 ASP C C   1 
ATOM   4540  O O   . ASP C 1 176 ? 21.411  76.599  73.328  1.00 8.08  ? 194 ASP C O   1 
ATOM   4541  C CB  . ASP C 1 176 ? 23.166  78.680  74.458  1.00 6.29  ? 194 ASP C CB  1 
ATOM   4542  C CG  . ASP C 1 176 ? 23.852  79.103  75.739  1.00 8.63  ? 194 ASP C CG  1 
ATOM   4543  O OD1 . ASP C 1 176 ? 24.085  80.319  75.911  1.00 5.79  ? 194 ASP C OD1 1 
ATOM   4544  O OD2 . ASP C 1 176 ? 24.143  78.220  76.581  1.00 12.37 ? 194 ASP C OD2 1 
ATOM   4545  N N   . SER C 1 177 ? 23.028  76.521  71.761  1.00 6.83  ? 195 SER C N   1 
ATOM   4546  C CA  . SER C 1 177 ? 22.145  75.982  70.729  1.00 8.95  ? 195 SER C CA  1 
ATOM   4547  C C   . SER C 1 177 ? 21.383  74.721  71.202  1.00 12.22 ? 195 SER C C   1 
ATOM   4548  O O   . SER C 1 177 ? 21.872  73.934  72.046  1.00 11.17 ? 195 SER C O   1 
ATOM   4549  C CB  . SER C 1 177 ? 22.932  75.657  69.453  1.00 7.02  ? 195 SER C CB  1 
ATOM   4550  O OG  . SER C 1 177 ? 23.025  76.781  68.581  1.00 5.17  ? 195 SER C OG  1 
ATOM   4551  N N   . GLY C 1 178 ? 20.158  74.562  70.703  1.00 12.46 ? 196 GLY C N   1 
ATOM   4552  C CA  . GLY C 1 178 ? 19.362  73.413  71.085  1.00 12.01 ? 196 GLY C CA  1 
ATOM   4553  C C   . GLY C 1 178 ? 18.812  73.485  72.498  1.00 9.96  ? 196 GLY C C   1 
ATOM   4554  O O   . GLY C 1 178 ? 17.931  72.700  72.856  1.00 10.01 ? 196 GLY C O   1 
ATOM   4555  N N   . GLY C 1 179 ? 19.309  74.422  73.298  1.00 8.21  ? 197 GLY C N   1 
ATOM   4556  C CA  . GLY C 1 179 ? 18.828  74.538  74.658  1.00 9.23  ? 197 GLY C CA  1 
ATOM   4557  C C   . GLY C 1 179 ? 17.367  74.946  74.665  1.00 11.37 ? 197 GLY C C   1 
ATOM   4558  O O   . GLY C 1 179 ? 16.854  75.406  73.616  1.00 11.85 ? 197 GLY C O   1 
ATOM   4559  N N   . PRO C 1 180 ? 16.672  74.781  75.818  1.00 6.81  ? 198 PRO C N   1 
ATOM   4560  C CA  . PRO C 1 180 ? 15.267  75.112  76.031  1.00 5.35  ? 198 PRO C CA  1 
ATOM   4561  C C   . PRO C 1 180 ? 14.946  76.588  76.342  1.00 7.42  ? 198 PRO C C   1 
ATOM   4562  O O   . PRO C 1 180 ? 15.774  77.357  76.865  1.00 5.00  ? 198 PRO C O   1 
ATOM   4563  C CB  . PRO C 1 180 ? 14.914  74.236  77.215  1.00 5.00  ? 198 PRO C CB  1 
ATOM   4564  C CG  . PRO C 1 180 ? 16.147  74.295  78.026  1.00 5.00  ? 198 PRO C CG  1 
ATOM   4565  C CD  . PRO C 1 180 ? 17.213  74.081  76.998  1.00 5.74  ? 198 PRO C CD  1 
ATOM   4566  N N   . VAL C 1 181 ? 13.724  76.968  75.984  1.00 10.26 ? 199 VAL C N   1 
ATOM   4567  C CA  . VAL C 1 181 ? 13.161  78.286  76.272  1.00 9.97  ? 199 VAL C CA  1 
ATOM   4568  C C   . VAL C 1 181 ? 11.819  77.867  76.877  1.00 9.37  ? 199 VAL C C   1 
ATOM   4569  O O   . VAL C 1 181 ? 10.904  77.417  76.158  1.00 8.03  ? 199 VAL C O   1 
ATOM   4570  C CB  . VAL C 1 181 ? 12.917  79.130  75.003  1.00 8.93  ? 199 VAL C CB  1 
ATOM   4571  C CG1 . VAL C 1 181 ? 12.170  80.428  75.352  1.00 6.94  ? 199 VAL C CG1 1 
ATOM   4572  C CG2 . VAL C 1 181 ? 14.219  79.453  74.356  1.00 8.41  ? 199 VAL C CG2 1 
ATOM   4573  N N   . VAL C 1 182 ? 11.756  77.865  78.204  1.00 10.36 ? 200 VAL C N   1 
ATOM   4574  C CA  . VAL C 1 182 ? 10.536  77.459  78.870  1.00 15.06 ? 200 VAL C CA  1 
ATOM   4575  C C   . VAL C 1 182 ? 9.748   78.665  79.286  1.00 16.53 ? 200 VAL C C   1 
ATOM   4576  O O   . VAL C 1 182 ? 10.318  79.624  79.790  1.00 16.21 ? 200 VAL C O   1 
ATOM   4577  C CB  . VAL C 1 182 ? 10.802  76.567  80.099  1.00 12.42 ? 200 VAL C CB  1 
ATOM   4578  C CG1 . VAL C 1 182 ? 9.497   76.109  80.687  1.00 11.84 ? 200 VAL C CG1 1 
ATOM   4579  C CG2 . VAL C 1 182 ? 11.572  75.336  79.681  1.00 18.38 ? 200 VAL C CG2 1 
ATOM   4580  N N   . CYS C 1 183 ? 8.453   78.647  78.992  1.00 18.81 ? 201 CYS C N   1 
ATOM   4581  C CA  . CYS C 1 183 ? 7.571   79.737  79.390  1.00 20.09 ? 201 CYS C CA  1 
ATOM   4582  C C   . CYS C 1 183 ? 6.371   79.066  80.048  1.00 20.37 ? 201 CYS C C   1 
ATOM   4583  O O   . CYS C 1 183 ? 5.730   78.197  79.441  1.00 20.38 ? 201 CYS C O   1 
ATOM   4584  C CB  . CYS C 1 183 ? 7.115   80.577  78.190  1.00 19.11 ? 201 CYS C CB  1 
ATOM   4585  S SG  . CYS C 1 183 ? 8.411   80.927  76.962  1.00 21.80 ? 201 CYS C SG  1 
ATOM   4586  N N   . SER C 1 184 ? 6.151   79.389  81.321  1.00 20.86 ? 202 SER C N   1 
ATOM   4587  C CA  . SER C 1 184 ? 5.037   78.844  82.090  1.00 22.43 ? 202 SER C CA  1 
ATOM   4588  C C   . SER C 1 184 ? 5.003   77.321  82.072  1.00 19.57 ? 202 SER C C   1 
ATOM   4589  O O   . SER C 1 184 ? 3.966   76.715  81.833  1.00 20.76 ? 202 SER C O   1 
ATOM   4590  C CB  . SER C 1 184 ? 3.720   79.424  81.568  1.00 29.34 ? 202 SER C CB  1 
ATOM   4591  O OG  . SER C 1 184 ? 3.807   80.841  81.463  1.00 35.88 ? 202 SER C OG  1 
ATOM   4592  N N   . GLY C 1 185 ? 6.150   76.710  82.324  1.00 17.02 ? 203 GLY C N   1 
ATOM   4593  C CA  . GLY C 1 185 ? 6.221   75.262  82.335  1.00 16.21 ? 203 GLY C CA  1 
ATOM   4594  C C   . GLY C 1 185 ? 6.151   74.557  80.984  1.00 16.20 ? 203 GLY C C   1 
ATOM   4595  O O   . GLY C 1 185 ? 6.145   73.324  80.931  1.00 15.53 ? 203 GLY C O   1 
ATOM   4596  N N   . LYS C 1 186 ? 6.115   75.311  79.891  1.00 14.11 ? 204 LYS C N   1 
ATOM   4597  C CA  . LYS C 1 186 ? 6.061   74.696  78.579  1.00 12.12 ? 204 LYS C CA  1 
ATOM   4598  C C   . LYS C 1 186 ? 7.320   75.006  77.791  1.00 12.39 ? 204 LYS C C   1 
ATOM   4599  O O   . LYS C 1 186 ? 7.975   76.017  78.057  1.00 10.86 ? 204 LYS C O   1 
ATOM   4600  C CB  . LYS C 1 186 ? 4.845   75.209  77.825  1.00 12.26 ? 204 LYS C CB  1 
ATOM   4601  C CG  . LYS C 1 186 ? 3.547   74.890  78.515  1.00 13.81 ? 204 LYS C CG  1 
ATOM   4602  C CD  . LYS C 1 186 ? 3.361   73.394  78.638  1.00 18.81 ? 204 LYS C CD  1 
ATOM   4603  C CE  . LYS C 1 186 ? 1.972   73.065  79.165  1.00 23.44 ? 204 LYS C CE  1 
ATOM   4604  N NZ  . LYS C 1 186 ? 1.707   71.600  79.130  0.00 22.73 ? 204 LYS C NZ  1 
ATOM   4605  N N   . LEU C 1 187 ? 7.661   74.121  76.847  1.00 11.39 ? 209 LEU C N   1 
ATOM   4606  C CA  . LEU C 1 187 ? 8.822   74.295  75.978  1.00 9.92  ? 209 LEU C CA  1 
ATOM   4607  C C   . LEU C 1 187 ? 8.392   75.146  74.792  1.00 8.71  ? 209 LEU C C   1 
ATOM   4608  O O   . LEU C 1 187 ? 7.854   74.625  73.814  1.00 5.00  ? 209 LEU C O   1 
ATOM   4609  C CB  . LEU C 1 187 ? 9.338   72.940  75.474  1.00 9.08  ? 209 LEU C CB  1 
ATOM   4610  C CG  . LEU C 1 187 ? 10.585  72.994  74.571  1.00 8.02  ? 209 LEU C CG  1 
ATOM   4611  C CD1 . LEU C 1 187 ? 11.789  73.478  75.361  1.00 6.70  ? 209 LEU C CD1 1 
ATOM   4612  C CD2 . LEU C 1 187 ? 10.864  71.641  73.973  1.00 5.00  ? 209 LEU C CD2 1 
ATOM   4613  N N   . GLN C 1 188 ? 8.646   76.448  74.875  1.00 9.74  ? 210 GLN C N   1 
ATOM   4614  C CA  . GLN C 1 188 ? 8.256   77.365  73.804  1.00 14.58 ? 210 GLN C CA  1 
ATOM   4615  C C   . GLN C 1 188 ? 9.219   77.487  72.620  1.00 15.36 ? 210 GLN C C   1 
ATOM   4616  O O   . GLN C 1 188 ? 8.789   77.619  71.464  1.00 14.81 ? 210 GLN C O   1 
ATOM   4617  C CB  . GLN C 1 188 ? 7.959   78.762  74.359  1.00 14.72 ? 210 GLN C CB  1 
ATOM   4618  C CG  . GLN C 1 188 ? 6.621   78.882  75.076  1.00 16.90 ? 210 GLN C CG  1 
ATOM   4619  C CD  . GLN C 1 188 ? 5.433   78.498  74.198  1.00 17.98 ? 210 GLN C CD  1 
ATOM   4620  O OE1 . GLN C 1 188 ? 4.471   77.887  74.673  1.00 15.11 ? 210 GLN C OE1 1 
ATOM   4621  N NE2 . GLN C 1 188 ? 5.487   78.875  72.918  1.00 18.11 ? 210 GLN C NE2 1 
ATOM   4622  N N   . GLY C 1 189 ? 10.515  77.459  72.893  1.00 15.13 ? 211 GLY C N   1 
ATOM   4623  C CA  . GLY C 1 189 ? 11.462  77.576  71.808  1.00 12.71 ? 211 GLY C CA  1 
ATOM   4624  C C   . GLY C 1 189 ? 12.792  76.919  72.061  1.00 10.94 ? 211 GLY C C   1 
ATOM   4625  O O   . GLY C 1 189 ? 13.116  76.553  73.190  1.00 10.89 ? 211 GLY C O   1 
ATOM   4626  N N   . ILE C 1 190 ? 13.562  76.769  70.993  1.00 10.47 ? 212 ILE C N   1 
ATOM   4627  C CA  . ILE C 1 190 ? 14.877  76.179  71.086  1.00 9.81  ? 212 ILE C CA  1 
ATOM   4628  C C   . ILE C 1 190 ? 15.899  77.234  70.656  1.00 11.01 ? 212 ILE C C   1 
ATOM   4629  O O   . ILE C 1 190 ? 15.705  77.919  69.635  1.00 11.11 ? 212 ILE C O   1 
ATOM   4630  C CB  . ILE C 1 190 ? 14.991  74.995  70.173  1.00 9.33  ? 212 ILE C CB  1 
ATOM   4631  C CG1 . ILE C 1 190 ? 13.806  74.070  70.373  1.00 12.04 ? 212 ILE C CG1 1 
ATOM   4632  C CG2 . ILE C 1 190 ? 16.212  74.244  70.517  1.00 11.91 ? 212 ILE C CG2 1 
ATOM   4633  C CD1 . ILE C 1 190 ? 13.669  72.997  69.293  1.00 12.18 ? 212 ILE C CD1 1 
ATOM   4634  N N   . VAL C 1 191 ? 16.955  77.391  71.457  1.00 9.90  ? 213 VAL C N   1 
ATOM   4635  C CA  . VAL C 1 191 ? 18.000  78.367  71.162  1.00 9.55  ? 213 VAL C CA  1 
ATOM   4636  C C   . VAL C 1 191 ? 18.495  78.080  69.756  1.00 9.06  ? 213 VAL C C   1 
ATOM   4637  O O   . VAL C 1 191 ? 18.878  76.953  69.454  1.00 7.09  ? 213 VAL C O   1 
ATOM   4638  C CB  . VAL C 1 191 ? 19.181  78.247  72.153  1.00 9.63  ? 213 VAL C CB  1 
ATOM   4639  C CG1 . VAL C 1 191 ? 20.254  79.297  71.827  1.00 8.47  ? 213 VAL C CG1 1 
ATOM   4640  C CG2 . VAL C 1 191 ? 18.685  78.380  73.598  1.00 8.34  ? 213 VAL C CG2 1 
ATOM   4641  N N   . SER C 1 192 ? 18.469  79.083  68.892  1.00 11.05 ? 214 SER C N   1 
ATOM   4642  C CA  . SER C 1 192 ? 18.911  78.874  67.519  1.00 12.05 ? 214 SER C CA  1 
ATOM   4643  C C   . SER C 1 192 ? 20.045  79.776  67.033  1.00 10.84 ? 214 SER C C   1 
ATOM   4644  O O   . SER C 1 192 ? 21.196  79.348  67.003  1.00 10.91 ? 214 SER C O   1 
ATOM   4645  C CB  . SER C 1 192 ? 17.731  78.958  66.548  1.00 12.88 ? 214 SER C CB  1 
ATOM   4646  O OG  . SER C 1 192 ? 18.137  78.535  65.252  1.00 15.29 ? 214 SER C OG  1 
ATOM   4647  N N   . TRP C 1 193 ? 19.742  81.020  66.690  1.00 10.35 ? 215 TRP C N   1 
ATOM   4648  C CA  . TRP C 1 193 ? 20.770  81.901  66.176  1.00 13.29 ? 215 TRP C CA  1 
ATOM   4649  C C   . TRP C 1 193 ? 20.600  83.355  66.549  1.00 14.73 ? 215 TRP C C   1 
ATOM   4650  O O   . TRP C 1 193 ? 19.681  83.708  67.283  1.00 17.39 ? 215 TRP C O   1 
ATOM   4651  C CB  . TRP C 1 193 ? 20.804  81.784  64.667  1.00 16.57 ? 215 TRP C CB  1 
ATOM   4652  C CG  . TRP C 1 193 ? 19.512  82.124  64.017  1.00 17.04 ? 215 TRP C CG  1 
ATOM   4653  C CD1 . TRP C 1 193 ? 18.432  81.305  63.867  1.00 16.93 ? 215 TRP C CD1 1 
ATOM   4654  C CD2 . TRP C 1 193 ? 19.172  83.359  63.384  1.00 16.89 ? 215 TRP C CD2 1 
ATOM   4655  N NE1 . TRP C 1 193 ? 17.437  81.950  63.175  1.00 16.15 ? 215 TRP C NE1 1 
ATOM   4656  C CE2 . TRP C 1 193 ? 17.862  83.215  62.867  1.00 18.18 ? 215 TRP C CE2 1 
ATOM   4657  C CE3 . TRP C 1 193 ? 19.851  84.570  63.195  1.00 15.74 ? 215 TRP C CE3 1 
ATOM   4658  C CZ2 . TRP C 1 193 ? 17.211  84.240  62.170  1.00 20.45 ? 215 TRP C CZ2 1 
ATOM   4659  C CZ3 . TRP C 1 193 ? 19.205  85.594  62.499  1.00 18.33 ? 215 TRP C CZ3 1 
ATOM   4660  C CH2 . TRP C 1 193 ? 17.896  85.421  61.996  1.00 20.73 ? 215 TRP C CH2 1 
ATOM   4661  N N   . GLY C 1 194 ? 21.510  84.190  66.066  1.00 13.45 ? 216 GLY C N   1 
ATOM   4662  C CA  . GLY C 1 194 ? 21.430  85.606  66.356  1.00 17.88 ? 216 GLY C CA  1 
ATOM   4663  C C   . GLY C 1 194 ? 22.736  86.259  65.987  1.00 20.10 ? 216 GLY C C   1 
ATOM   4664  O O   . GLY C 1 194 ? 23.651  85.568  65.549  1.00 24.81 ? 216 GLY C O   1 
ATOM   4665  N N   . SER C 1 195 ? 22.831  87.573  66.123  1.00 18.97 ? 217 SER C N   1 
ATOM   4666  C CA  . SER C 1 195 ? 24.064  88.250  65.793  1.00 19.12 ? 217 SER C CA  1 
ATOM   4667  C C   . SER C 1 195 ? 24.909  88.407  67.030  1.00 17.13 ? 217 SER C C   1 
ATOM   4668  O O   . SER C 1 195 ? 24.565  89.151  67.938  1.00 15.91 ? 217 SER C O   1 
ATOM   4669  C CB  . SER C 1 195 ? 23.768  89.613  65.200  1.00 27.41 ? 217 SER C CB  1 
ATOM   4670  O OG  . SER C 1 195 ? 22.797  89.483  64.178  1.00 36.55 ? 217 SER C OG  1 
ATOM   4671  N N   . GLY C 1 196 ? 26.019  87.690  67.063  1.00 18.71 ? 219 GLY C N   1 
ATOM   4672  C CA  . GLY C 1 196 ? 26.923  87.771  68.190  1.00 19.42 ? 219 GLY C CA  1 
ATOM   4673  C C   . GLY C 1 196 ? 26.133  87.391  69.402  1.00 18.47 ? 219 GLY C C   1 
ATOM   4674  O O   . GLY C 1 196 ? 25.253  86.554  69.302  1.00 18.74 ? 219 GLY C O   1 
ATOM   4675  N N   . CYS C 1 197 ? 26.392  88.056  70.519  1.00 19.22 ? 220 CYS C N   1 
ATOM   4676  C CA  . CYS C 1 197 ? 25.680  87.784  71.759  1.00 17.71 ? 220 CYS C CA  1 
ATOM   4677  C C   . CYS C 1 197 ? 25.436  89.032  72.628  1.00 18.34 ? 220 CYS C C   1 
ATOM   4678  O O   . CYS C 1 197 ? 26.340  89.829  72.898  1.00 12.60 ? 220 CYS C O   1 
ATOM   4679  C CB  . CYS C 1 197 ? 26.430  86.718  72.554  1.00 14.99 ? 220 CYS C CB  1 
ATOM   4680  S SG  . CYS C 1 197 ? 26.566  85.136  71.686  1.00 10.83 ? 220 CYS C SG  1 
ATOM   4681  N N   . ALA C 1 198 A 24.184  89.214  73.022  1.00 23.18 ? 221 ALA C N   1 
ATOM   4682  C CA  . ALA C 1 198 A 23.792  90.333  73.873  1.00 27.29 ? 221 ALA C CA  1 
ATOM   4683  C C   . ALA C 1 198 A 24.053  91.682  73.209  1.00 28.51 ? 221 ALA C C   1 
ATOM   4684  O O   . ALA C 1 198 A 24.140  92.735  73.869  1.00 27.88 ? 221 ALA C O   1 
ATOM   4685  C CB  . ALA C 1 198 A 24.506  90.244  75.210  1.00 27.84 ? 221 ALA C CB  1 
ATOM   4686  N N   . GLN C 1 199 ? 24.168  91.637  71.891  1.00 28.70 ? 221 GLN C N   1 
ATOM   4687  C CA  . GLN C 1 199 ? 24.398  92.829  71.110  1.00 29.65 ? 221 GLN C CA  1 
ATOM   4688  C C   . GLN C 1 199 ? 23.095  93.599  71.092  1.00 29.67 ? 221 GLN C C   1 
ATOM   4689  O O   . GLN C 1 199 ? 22.020  93.003  70.963  1.00 28.20 ? 221 GLN C O   1 
ATOM   4690  C CB  . GLN C 1 199 ? 24.826  92.462  69.677  1.00 28.23 ? 221 GLN C CB  1 
ATOM   4691  C CG  . GLN C 1 199 ? 26.243  92.911  69.294  1.00 24.23 ? 221 GLN C CG  1 
ATOM   4692  C CD  . GLN C 1 199 ? 27.311  92.394  70.251  1.00 23.40 ? 221 GLN C CD  1 
ATOM   4693  O OE1 . GLN C 1 199 ? 27.965  93.173  70.947  0.00 22.92 ? 221 GLN C OE1 1 
ATOM   4694  N NE2 . GLN C 1 199 ? 27.476  91.080  70.307  0.00 22.79 ? 221 GLN C NE2 1 
ATOM   4695  N N   . LYS C 1 200 ? 23.202  94.911  71.300  1.00 30.59 ? 222 LYS C N   1 
ATOM   4696  C CA  . LYS C 1 200 ? 22.054  95.826  71.280  1.00 29.57 ? 222 LYS C CA  1 
ATOM   4697  C C   . LYS C 1 200 ? 21.299  95.709  69.957  1.00 27.24 ? 222 LYS C C   1 
ATOM   4698  O O   . LYS C 1 200 ? 21.907  95.577  68.892  1.00 24.18 ? 222 LYS C O   1 
ATOM   4699  C CB  . LYS C 1 200 ? 22.531  97.272  71.441  1.00 29.16 ? 222 LYS C CB  1 
ATOM   4700  C CG  . LYS C 1 200 ? 21.433  98.326  71.369  1.00 26.13 ? 222 LYS C CG  1 
ATOM   4701  C CD  . LYS C 1 200 ? 22.050  99.716  71.362  0.00 26.57 ? 222 LYS C CD  1 
ATOM   4702  C CE  . LYS C 1 200 ? 20.996  100.782 71.148  0.00 26.59 ? 222 LYS C CE  1 
ATOM   4703  N NZ  . LYS C 1 200 ? 21.578  102.148 71.152  0.00 26.80 ? 222 LYS C NZ  1 
ATOM   4704  N N   . ASN C 1 201 ? 19.975  95.749  70.040  1.00 26.90 ? 223 ASN C N   1 
ATOM   4705  C CA  . ASN C 1 201 ? 19.103  95.646  68.876  1.00 28.29 ? 223 ASN C CA  1 
ATOM   4706  C C   . ASN C 1 201 ? 19.275  94.357  68.062  1.00 28.24 ? 223 ASN C C   1 
ATOM   4707  O O   . ASN C 1 201 ? 18.803  94.270  66.926  1.00 29.70 ? 223 ASN C O   1 
ATOM   4708  C CB  . ASN C 1 201 ? 19.280  96.876  67.974  1.00 31.00 ? 223 ASN C CB  1 
ATOM   4709  C CG  . ASN C 1 201 ? 18.792  98.156  68.631  1.00 30.48 ? 223 ASN C CG  1 
ATOM   4710  O OD1 . ASN C 1 201 ? 18.009  98.124  69.579  0.00 29.82 ? 223 ASN C OD1 1 
ATOM   4711  N ND2 . ASN C 1 201 ? 19.261  99.291  68.133  0.00 29.74 ? 223 ASN C ND2 1 
ATOM   4712  N N   . LYS C 1 202 ? 19.977  93.377  68.631  1.00 27.87 ? 224 LYS C N   1 
ATOM   4713  C CA  . LYS C 1 202 ? 20.202  92.077  67.993  1.00 27.57 ? 224 LYS C CA  1 
ATOM   4714  C C   . LYS C 1 202 ? 19.854  91.048  69.060  1.00 28.12 ? 224 LYS C C   1 
ATOM   4715  O O   . LYS C 1 202 ? 20.734  90.545  69.770  1.00 29.62 ? 224 LYS C O   1 
ATOM   4716  C CB  . LYS C 1 202 ? 21.665  91.921  67.564  1.00 28.08 ? 224 LYS C CB  1 
ATOM   4717  C CG  . LYS C 1 202 ? 22.061  92.841  66.435  1.00 32.54 ? 224 LYS C CG  1 
ATOM   4718  C CD  . LYS C 1 202 ? 21.165  92.633  65.216  1.00 36.54 ? 224 LYS C CD  1 
ATOM   4719  C CE  . LYS C 1 202 ? 21.253  93.808  64.245  1.00 41.30 ? 224 LYS C CE  1 
ATOM   4720  N NZ  . LYS C 1 202 ? 20.450  93.573  63.005  1.00 43.40 ? 224 LYS C NZ  1 
ATOM   4721  N N   . PRO C 1 203 ? 18.557  90.762  69.227  1.00 22.90 ? 225 PRO C N   1 
ATOM   4722  C CA  . PRO C 1 203 ? 18.061  89.807  70.215  1.00 23.84 ? 225 PRO C CA  1 
ATOM   4723  C C   . PRO C 1 203 ? 18.279  88.384  69.744  1.00 20.88 ? 225 PRO C C   1 
ATOM   4724  O O   . PRO C 1 203 ? 18.379  88.140  68.544  1.00 22.57 ? 225 PRO C O   1 
ATOM   4725  C CB  . PRO C 1 203 ? 16.558  90.114  70.261  1.00 24.38 ? 225 PRO C CB  1 
ATOM   4726  C CG  . PRO C 1 203 ? 16.375  91.376  69.424  1.00 24.98 ? 225 PRO C CG  1 
ATOM   4727  C CD  . PRO C 1 203 ? 17.449  91.252  68.402  1.00 24.68 ? 225 PRO C CD  1 
ATOM   4728  N N   . GLY C 1 204 ? 18.352  87.446  70.679  1.00 17.00 ? 226 GLY C N   1 
ATOM   4729  C CA  . GLY C 1 204 ? 18.512  86.059  70.282  1.00 15.60 ? 226 GLY C CA  1 
ATOM   4730  C C   . GLY C 1 204 ? 17.260  85.559  69.574  1.00 14.41 ? 226 GLY C C   1 
ATOM   4731  O O   . GLY C 1 204 ? 16.129  85.921  69.940  1.00 17.34 ? 226 GLY C O   1 
ATOM   4732  N N   . VAL C 1 205 ? 17.448  84.746  68.550  1.00 11.45 ? 227 VAL C N   1 
ATOM   4733  C CA  . VAL C 1 205 ? 16.327  84.189  67.801  1.00 11.55 ? 227 VAL C CA  1 
ATOM   4734  C C   . VAL C 1 205 ? 16.124  82.731  68.212  1.00 10.89 ? 227 VAL C C   1 
ATOM   4735  O O   . VAL C 1 205 ? 17.092  81.996  68.413  1.00 11.17 ? 227 VAL C O   1 
ATOM   4736  C CB  . VAL C 1 205 ? 16.570  84.288  66.289  1.00 13.08 ? 227 VAL C CB  1 
ATOM   4737  C CG1 . VAL C 1 205 ? 15.429  83.622  65.509  1.00 10.07 ? 227 VAL C CG1 1 
ATOM   4738  C CG2 . VAL C 1 205 ? 16.735  85.769  65.900  1.00 15.15 ? 227 VAL C CG2 1 
ATOM   4739  N N   . TYR C 1 206 ? 14.867  82.316  68.335  1.00 9.91  ? 228 TYR C N   1 
ATOM   4740  C CA  . TYR C 1 206 ? 14.537  80.964  68.765  1.00 8.65  ? 228 TYR C CA  1 
ATOM   4741  C C   . TYR C 1 206 ? 13.481  80.289  67.897  1.00 7.16  ? 228 TYR C C   1 
ATOM   4742  O O   . TYR C 1 206 ? 12.658  80.964  67.272  1.00 5.00  ? 228 TYR C O   1 
ATOM   4743  C CB  . TYR C 1 206 ? 14.064  81.010  70.217  1.00 8.43  ? 228 TYR C CB  1 
ATOM   4744  C CG  . TYR C 1 206 ? 15.055  81.669  71.167  1.00 7.74  ? 228 TYR C CG  1 
ATOM   4745  C CD1 . TYR C 1 206 ? 15.869  80.901  71.990  1.00 8.00  ? 228 TYR C CD1 1 
ATOM   4746  C CD2 . TYR C 1 206 ? 15.159  83.054  71.260  1.00 5.00  ? 228 TYR C CD2 1 
ATOM   4747  C CE1 . TYR C 1 206 ? 16.745  81.479  72.876  1.00 5.00  ? 228 TYR C CE1 1 
ATOM   4748  C CE2 . TYR C 1 206 ? 16.035  83.634  72.139  1.00 5.00  ? 228 TYR C CE2 1 
ATOM   4749  C CZ  . TYR C 1 206 ? 16.822  82.835  72.943  1.00 5.00  ? 228 TYR C CZ  1 
ATOM   4750  O OH  . TYR C 1 206 ? 17.716  83.379  73.827  1.00 11.21 ? 228 TYR C OH  1 
ATOM   4751  N N   . THR C 1 207 ? 13.522  78.960  67.852  1.00 5.00  ? 229 THR C N   1 
ATOM   4752  C CA  . THR C 1 207 ? 12.575  78.199  67.056  1.00 5.09  ? 229 THR C CA  1 
ATOM   4753  C C   . THR C 1 207 ? 11.245  78.139  67.767  1.00 9.77  ? 229 THR C C   1 
ATOM   4754  O O   . THR C 1 207 ? 11.187  77.815  68.954  1.00 13.86 ? 229 THR C O   1 
ATOM   4755  C CB  . THR C 1 207 ? 13.024  76.761  66.871  1.00 7.93  ? 229 THR C CB  1 
ATOM   4756  O OG1 . THR C 1 207 ? 14.417  76.736  66.585  1.00 13.96 ? 229 THR C OG1 1 
ATOM   4757  C CG2 . THR C 1 207 ? 12.275  76.114  65.718  1.00 7.25  ? 229 THR C CG2 1 
ATOM   4758  N N   . LYS C 1 208 ? 10.171  78.378  67.025  1.00 10.29 ? 230 LYS C N   1 
ATOM   4759  C CA  . LYS C 1 208 ? 8.821   78.349  67.572  1.00 8.05  ? 230 LYS C CA  1 
ATOM   4760  C C   . LYS C 1 208 ? 8.363   76.881  67.752  1.00 7.42  ? 230 LYS C C   1 
ATOM   4761  O O   . LYS C 1 208 ? 7.738   76.295  66.869  1.00 5.74  ? 230 LYS C O   1 
ATOM   4762  C CB  . LYS C 1 208 ? 7.905   79.117  66.619  1.00 7.50  ? 230 LYS C CB  1 
ATOM   4763  C CG  . LYS C 1 208 ? 6.968   80.081  67.306  1.00 10.91 ? 230 LYS C CG  1 
ATOM   4764  C CD  . LYS C 1 208 ? 6.154   80.893  66.299  1.00 13.71 ? 230 LYS C CD  1 
ATOM   4765  C CE  . LYS C 1 208 ? 4.961   81.583  66.959  1.00 13.99 ? 230 LYS C CE  1 
ATOM   4766  N NZ  . LYS C 1 208 ? 4.195   82.407  65.988  0.00 11.79 ? 230 LYS C NZ  1 
ATOM   4767  N N   . VAL C 1 209 ? 8.655   76.299  68.910  1.00 7.90  ? 231 VAL C N   1 
ATOM   4768  C CA  . VAL C 1 209 ? 8.306   74.909  69.182  1.00 11.21 ? 231 VAL C CA  1 
ATOM   4769  C C   . VAL C 1 209 ? 6.834   74.580  69.003  1.00 15.43 ? 231 VAL C C   1 
ATOM   4770  O O   . VAL C 1 209 ? 6.469   73.459  68.648  1.00 15.60 ? 231 VAL C O   1 
ATOM   4771  C CB  . VAL C 1 209 ? 8.735   74.506  70.605  1.00 11.45 ? 231 VAL C CB  1 
ATOM   4772  C CG1 . VAL C 1 209 ? 8.173   73.130  70.966  1.00 10.78 ? 231 VAL C CG1 1 
ATOM   4773  C CG2 . VAL C 1 209 ? 10.255  74.483  70.695  1.00 12.19 ? 231 VAL C CG2 1 
ATOM   4774  N N   . CYS C 1 210 ? 5.986   75.564  69.250  1.00 19.43 ? 232 CYS C N   1 
ATOM   4775  C CA  . CYS C 1 210 ? 4.544   75.383  69.143  1.00 19.87 ? 232 CYS C CA  1 
ATOM   4776  C C   . CYS C 1 210 ? 4.097   74.982  67.754  1.00 16.66 ? 232 CYS C C   1 
ATOM   4777  O O   . CYS C 1 210 ? 3.156   74.211  67.620  1.00 17.88 ? 232 CYS C O   1 
ATOM   4778  C CB  . CYS C 1 210 ? 3.795   76.644  69.602  1.00 23.23 ? 232 CYS C CB  1 
ATOM   4779  S SG  . CYS C 1 210 ? 4.071   78.147  68.606  1.00 23.94 ? 232 CYS C SG  1 
ATOM   4780  N N   . ASN C 1 211 ? 4.790   75.461  66.728  1.00 14.40 ? 233 ASN C N   1 
ATOM   4781  C CA  . ASN C 1 211 ? 4.431   75.118  65.352  1.00 17.68 ? 233 ASN C CA  1 
ATOM   4782  C C   . ASN C 1 211 ? 4.789   73.669  65.016  1.00 18.74 ? 233 ASN C C   1 
ATOM   4783  O O   . ASN C 1 211 ? 4.271   73.091  64.061  1.00 22.30 ? 233 ASN C O   1 
ATOM   4784  C CB  . ASN C 1 211 ? 5.151   76.024  64.348  1.00 20.31 ? 233 ASN C CB  1 
ATOM   4785  C CG  . ASN C 1 211 ? 4.745   77.474  64.462  1.00 25.05 ? 233 ASN C CG  1 
ATOM   4786  O OD1 . ASN C 1 211 ? 3.846   77.841  65.248  1.00 27.06 ? 233 ASN C OD1 1 
ATOM   4787  N ND2 . ASN C 1 211 ? 5.399   78.320  63.669  1.00 23.24 ? 233 ASN C ND2 1 
ATOM   4788  N N   . TYR C 1 212 ? 5.656   73.059  65.810  1.00 17.06 ? 234 TYR C N   1 
ATOM   4789  C CA  . TYR C 1 212 ? 6.087   71.704  65.518  1.00 11.79 ? 234 TYR C CA  1 
ATOM   4790  C C   . TYR C 1 212 ? 5.564   70.626  66.438  1.00 12.51 ? 234 TYR C C   1 
ATOM   4791  O O   . TYR C 1 212 ? 5.961   69.474  66.297  1.00 13.05 ? 234 TYR C O   1 
ATOM   4792  C CB  . TYR C 1 212 ? 7.611   71.670  65.504  1.00 8.64  ? 234 TYR C CB  1 
ATOM   4793  C CG  . TYR C 1 212 ? 8.222   72.667  64.549  1.00 5.00  ? 234 TYR C CG  1 
ATOM   4794  C CD1 . TYR C 1 212 ? 8.367   72.364  63.200  1.00 5.00  ? 234 TYR C CD1 1 
ATOM   4795  C CD2 . TYR C 1 212 ? 8.634   73.913  64.990  1.00 5.00  ? 234 TYR C CD2 1 
ATOM   4796  C CE1 . TYR C 1 212 ? 8.908   73.275  62.314  1.00 5.00  ? 234 TYR C CE1 1 
ATOM   4797  C CE2 . TYR C 1 212 ? 9.176   74.838  64.115  1.00 5.00  ? 234 TYR C CE2 1 
ATOM   4798  C CZ  . TYR C 1 212 ? 9.315   74.516  62.780  1.00 5.41  ? 234 TYR C CZ  1 
ATOM   4799  O OH  . TYR C 1 212 ? 9.886   75.424  61.915  1.00 5.00  ? 234 TYR C OH  1 
ATOM   4800  N N   . VAL C 1 213 ? 4.663   70.976  67.356  1.00 12.74 ? 235 VAL C N   1 
ATOM   4801  C CA  . VAL C 1 213 ? 4.111   70.000  68.304  1.00 12.39 ? 235 VAL C CA  1 
ATOM   4802  C C   . VAL C 1 213 ? 3.537   68.751  67.631  1.00 12.10 ? 235 VAL C C   1 
ATOM   4803  O O   . VAL C 1 213 ? 3.743   67.626  68.089  1.00 7.56  ? 235 VAL C O   1 
ATOM   4804  C CB  . VAL C 1 213 ? 3.015   70.602  69.161  1.00 11.17 ? 235 VAL C CB  1 
ATOM   4805  C CG1 . VAL C 1 213 ? 2.584   69.599  70.223  1.00 10.71 ? 235 VAL C CG1 1 
ATOM   4806  C CG2 . VAL C 1 213 ? 3.503   71.875  69.792  1.00 16.37 ? 235 VAL C CG2 1 
ATOM   4807  N N   . SER C 1 214 ? 2.815   68.958  66.539  1.00 14.73 ? 236 SER C N   1 
ATOM   4808  C CA  . SER C 1 214 ? 2.225   67.852  65.806  1.00 16.45 ? 236 SER C CA  1 
ATOM   4809  C C   . SER C 1 214 ? 3.332   66.918  65.283  1.00 15.35 ? 236 SER C C   1 
ATOM   4810  O O   . SER C 1 214 ? 3.331   65.700  65.546  1.00 11.88 ? 236 SER C O   1 
ATOM   4811  C CB  . SER C 1 214 ? 1.382   68.403  64.649  1.00 17.08 ? 236 SER C CB  1 
ATOM   4812  O OG  . SER C 1 214 ? 0.452   69.366  65.118  0.00 18.68 ? 236 SER C OG  1 
ATOM   4813  N N   . TRP C 1 215 ? 4.293   67.506  64.568  1.00 14.81 ? 237 TRP C N   1 
ATOM   4814  C CA  . TRP C 1 215 ? 5.410   66.750  63.995  1.00 11.89 ? 237 TRP C CA  1 
ATOM   4815  C C   . TRP C 1 215 ? 6.117   65.951  65.090  1.00 9.04  ? 237 TRP C C   1 
ATOM   4816  O O   . TRP C 1 215 ? 6.378   64.756  64.932  1.00 5.00  ? 237 TRP C O   1 
ATOM   4817  C CB  . TRP C 1 215 ? 6.408   67.689  63.293  1.00 12.83 ? 237 TRP C CB  1 
ATOM   4818  C CG  . TRP C 1 215 ? 7.611   66.956  62.774  1.00 13.91 ? 237 TRP C CG  1 
ATOM   4819  C CD1 . TRP C 1 215 ? 7.638   66.079  61.719  1.00 17.23 ? 237 TRP C CD1 1 
ATOM   4820  C CD2 . TRP C 1 215 ? 8.929   66.931  63.347  1.00 10.66 ? 237 TRP C CD2 1 
ATOM   4821  N NE1 . TRP C 1 215 ? 8.882   65.500  61.613  1.00 15.09 ? 237 TRP C NE1 1 
ATOM   4822  C CE2 . TRP C 1 215 ? 9.689   66.002  62.600  1.00 12.82 ? 237 TRP C CE2 1 
ATOM   4823  C CE3 . TRP C 1 215 ? 9.534   67.590  64.422  1.00 8.86  ? 237 TRP C CE3 1 
ATOM   4824  C CZ2 . TRP C 1 215 ? 11.020  65.712  62.900  1.00 14.38 ? 237 TRP C CZ2 1 
ATOM   4825  C CZ3 . TRP C 1 215 ? 10.860  67.306  64.722  1.00 11.29 ? 237 TRP C CZ3 1 
ATOM   4826  C CH2 . TRP C 1 215 ? 11.588  66.371  63.964  1.00 15.40 ? 237 TRP C CH2 1 
ATOM   4827  N N   . ILE C 1 216 ? 6.421   66.629  66.193  1.00 7.80  ? 238 ILE C N   1 
ATOM   4828  C CA  . ILE C 1 216 ? 7.080   65.993  67.310  1.00 6.14  ? 238 ILE C CA  1 
ATOM   4829  C C   . ILE C 1 216 ? 6.276   64.754  67.678  1.00 9.15  ? 238 ILE C C   1 
ATOM   4830  O O   . ILE C 1 216 ? 6.775   63.626  67.556  1.00 8.88  ? 238 ILE C O   1 
ATOM   4831  C CB  . ILE C 1 216 ? 7.174   66.928  68.526  1.00 5.00  ? 238 ILE C CB  1 
ATOM   4832  C CG1 . ILE C 1 216 ? 7.888   68.228  68.153  1.00 5.00  ? 238 ILE C CG1 1 
ATOM   4833  C CG2 . ILE C 1 216 ? 7.902   66.229  69.647  1.00 5.00  ? 238 ILE C CG2 1 
ATOM   4834  C CD1 . ILE C 1 216 ? 8.043   69.212  69.290  1.00 5.00  ? 238 ILE C CD1 1 
ATOM   4835  N N   . LYS C 1 217 ? 4.998   64.964  68.005  1.00 10.84 ? 239 LYS C N   1 
ATOM   4836  C CA  . LYS C 1 217 ? 4.091   63.880  68.408  1.00 10.61 ? 239 LYS C CA  1 
ATOM   4837  C C   . LYS C 1 217 ? 4.013   62.724  67.417  1.00 8.92  ? 239 LYS C C   1 
ATOM   4838  O O   . LYS C 1 217 ? 4.088   61.557  67.821  1.00 5.00  ? 239 LYS C O   1 
ATOM   4839  C CB  . LYS C 1 217 ? 2.678   64.412  68.710  1.00 13.28 ? 239 LYS C CB  1 
ATOM   4840  C CG  . LYS C 1 217 ? 2.526   65.182  70.044  1.00 12.82 ? 239 LYS C CG  1 
ATOM   4841  C CD  . LYS C 1 217 ? 1.100   65.668  70.248  0.00 11.38 ? 239 LYS C CD  1 
ATOM   4842  C CE  . LYS C 1 217 ? 0.946   66.396  71.575  0.00 10.31 ? 239 LYS C CE  1 
ATOM   4843  N NZ  . LYS C 1 217 ? -0.436  66.923  71.761  0.00 9.06  ? 239 LYS C NZ  1 
ATOM   4844  N N   . GLN C 1 218 ? 3.893   63.031  66.129  1.00 8.99  ? 240 GLN C N   1 
ATOM   4845  C CA  . GLN C 1 218 ? 3.820   61.965  65.133  1.00 13.37 ? 240 GLN C CA  1 
ATOM   4846  C C   . GLN C 1 218 ? 5.130   61.162  65.053  1.00 15.80 ? 240 GLN C C   1 
ATOM   4847  O O   . GLN C 1 218 ? 5.109   59.923  65.098  1.00 14.99 ? 240 GLN C O   1 
ATOM   4848  C CB  . GLN C 1 218 ? 3.429   62.512  63.752  1.00 12.23 ? 240 GLN C CB  1 
ATOM   4849  C CG  . GLN C 1 218 ? 3.241   61.433  62.687  0.00 13.73 ? 240 GLN C CG  1 
ATOM   4850  C CD  . GLN C 1 218 ? 2.074   60.508  62.988  0.00 14.18 ? 240 GLN C CD  1 
ATOM   4851  O OE1 . GLN C 1 218 ? 0.919   60.930  62.983  0.00 14.19 ? 240 GLN C OE1 1 
ATOM   4852  N NE2 . GLN C 1 218 ? 2.369   59.240  63.245  0.00 14.26 ? 240 GLN C NE2 1 
ATOM   4853  N N   . THR C 1 219 ? 6.264   61.864  64.986  1.00 17.76 ? 241 THR C N   1 
ATOM   4854  C CA  . THR C 1 219 ? 7.586   61.227  64.905  1.00 13.02 ? 241 THR C CA  1 
ATOM   4855  C C   . THR C 1 219 ? 7.831   60.243  66.068  1.00 11.16 ? 241 THR C C   1 
ATOM   4856  O O   . THR C 1 219 ? 8.249   59.095  65.853  1.00 10.51 ? 241 THR C O   1 
ATOM   4857  C CB  . THR C 1 219 ? 8.689   62.289  64.860  1.00 11.80 ? 241 THR C CB  1 
ATOM   4858  O OG1 . THR C 1 219 ? 8.419   63.205  63.789  1.00 12.12 ? 241 THR C OG1 1 
ATOM   4859  C CG2 . THR C 1 219 ? 10.022  61.651  64.618  1.00 8.92  ? 241 THR C CG2 1 
ATOM   4860  N N   . ILE C 1 220 ? 7.519   60.675  67.284  1.00 7.91  ? 242 ILE C N   1 
ATOM   4861  C CA  . ILE C 1 220 ? 7.669   59.837  68.464  1.00 8.89  ? 242 ILE C CA  1 
ATOM   4862  C C   . ILE C 1 220 ? 6.801   58.544  68.416  1.00 10.18 ? 242 ILE C C   1 
ATOM   4863  O O   . ILE C 1 220 ? 7.255   57.444  68.774  1.00 10.58 ? 242 ILE C O   1 
ATOM   4864  C CB  . ILE C 1 220 ? 7.310   60.664  69.701  1.00 7.52  ? 242 ILE C CB  1 
ATOM   4865  C CG1 . ILE C 1 220 ? 8.300   61.795  69.852  1.00 8.10  ? 242 ILE C CG1 1 
ATOM   4866  C CG2 . ILE C 1 220 ? 7.309   59.817  70.948  1.00 9.94  ? 242 ILE C CG2 1 
ATOM   4867  C CD1 . ILE C 1 220 ? 7.835   62.833  70.798  1.00 13.12 ? 242 ILE C CD1 1 
ATOM   4868  N N   . ALA C 1 221 ? 5.547   58.679  67.989  1.00 9.50  ? 243 ALA C N   1 
ATOM   4869  C CA  . ALA C 1 221 ? 4.653   57.531  67.924  1.00 7.95  ? 243 ALA C CA  1 
ATOM   4870  C C   . ALA C 1 221 ? 5.044   56.521  66.879  1.00 9.19  ? 243 ALA C C   1 
ATOM   4871  O O   . ALA C 1 221 ? 4.636   55.368  66.973  1.00 10.04 ? 243 ALA C O   1 
ATOM   4872  C CB  . ALA C 1 221 ? 3.243   57.983  67.660  1.00 8.56  ? 243 ALA C CB  1 
ATOM   4873  N N   . SER C 1 222 ? 5.793   56.962  65.868  1.00 9.39  ? 244 SER C N   1 
ATOM   4874  C CA  . SER C 1 222 ? 6.192   56.096  64.762  1.00 7.63  ? 244 SER C CA  1 
ATOM   4875  C C   . SER C 1 222 ? 7.573   55.511  64.875  1.00 5.00  ? 244 SER C C   1 
ATOM   4876  O O   . SER C 1 222 ? 7.874   54.500  64.244  1.00 5.00  ? 244 SER C O   1 
ATOM   4877  C CB  . SER C 1 222 ? 6.116   56.870  63.453  1.00 9.34  ? 244 SER C CB  1 
ATOM   4878  O OG  . SER C 1 222 ? 4.981   57.710  63.436  1.00 12.40 ? 244 SER C OG  1 
ATOM   4879  N N   . ASN C 1 223 ? 8.415   56.166  65.653  1.00 5.00  ? 245 ASN C N   1 
ATOM   4880  C CA  . ASN C 1 223 ? 9.775   55.709  65.793  1.00 7.15  ? 245 ASN C CA  1 
ATOM   4881  C C   . ASN C 1 223 ? 10.089  55.073  67.151  1.00 9.55  ? 245 ASN C C   1 
ATOM   4882  O O   . ASN C 1 223 ? 11.236  55.208  67.620  1.00 13.58 ? 245 ASN C O   1 
ATOM   4883  C CB  . ASN C 1 223 ? 10.735  56.863  65.461  1.00 7.77  ? 245 ASN C CB  1 
ATOM   4884  C CG  . ASN C 1 223 ? 10.636  57.304  64.003  1.00 5.00  ? 245 ASN C CG  1 
ATOM   4885  O OD1 . ASN C 1 223 ? 11.124  56.634  63.112  1.00 5.00  ? 245 ASN C OD1 1 
ATOM   4886  N ND2 . ASN C 1 223 ? 9.978   58.417  63.763  1.00 6.43  ? 245 ASN C ND2 1 
ATOM   4887  O OXT . ASN C 1 223 ? 9.210   54.390  67.716  1.00 7.84  ? 245 ASN C OXT 1 
ATOM   4888  N N   . ILE D 1 1   ? 73.392  97.272  84.583  1.00 14.81 ? 16  ILE D N   1 
ATOM   4889  C CA  . ILE D 1 1   ? 72.509  97.391  83.401  1.00 17.79 ? 16  ILE D CA  1 
ATOM   4890  C C   . ILE D 1 1   ? 73.419  97.369  82.181  1.00 21.07 ? 16  ILE D C   1 
ATOM   4891  O O   . ILE D 1 1   ? 74.200  98.297  81.957  1.00 21.46 ? 16  ILE D O   1 
ATOM   4892  C CB  . ILE D 1 1   ? 71.705  98.720  83.446  1.00 18.78 ? 16  ILE D CB  1 
ATOM   4893  C CG1 . ILE D 1 1   ? 70.692  98.677  84.581  1.00 20.74 ? 16  ILE D CG1 1 
ATOM   4894  C CG2 . ILE D 1 1   ? 70.948  98.960  82.140  1.00 19.07 ? 16  ILE D CG2 1 
ATOM   4895  C CD1 . ILE D 1 1   ? 69.533  97.738  84.307  1.00 20.18 ? 16  ILE D CD1 1 
ATOM   4896  N N   . VAL D 1 2   ? 73.355  96.277  81.430  1.00 25.23 ? 17  VAL D N   1 
ATOM   4897  C CA  . VAL D 1 2   ? 74.163  96.115  80.230  1.00 28.54 ? 17  VAL D CA  1 
ATOM   4898  C C   . VAL D 1 2   ? 73.560  96.965  79.117  1.00 31.11 ? 17  VAL D C   1 
ATOM   4899  O O   . VAL D 1 2   ? 72.382  96.839  78.787  1.00 33.39 ? 17  VAL D O   1 
ATOM   4900  C CB  . VAL D 1 2   ? 74.226  94.644  79.775  0.00 29.22 ? 17  VAL D CB  1 
ATOM   4901  C CG1 . VAL D 1 2   ? 75.046  94.524  78.500  0.00 29.19 ? 17  VAL D CG1 1 
ATOM   4902  C CG2 . VAL D 1 2   ? 74.841  93.792  80.865  0.00 29.22 ? 17  VAL D CG2 1 
ATOM   4903  N N   . GLY D 1 3   ? 74.357  97.893  78.613  1.00 30.48 ? 18  GLY D N   1 
ATOM   4904  C CA  . GLY D 1 3   ? 73.905  98.747  77.540  1.00 27.71 ? 18  GLY D CA  1 
ATOM   4905  C C   . GLY D 1 3   ? 72.871  99.750  77.954  1.00 27.21 ? 18  GLY D C   1 
ATOM   4906  O O   . GLY D 1 3   ? 71.816  99.828  77.345  1.00 26.97 ? 18  GLY D O   1 
ATOM   4907  N N   . GLY D 1 4   ? 73.189  100.543 78.966  1.00 27.52 ? 19  GLY D N   1 
ATOM   4908  C CA  . GLY D 1 4   ? 72.247  101.548 79.420  1.00 28.54 ? 19  GLY D CA  1 
ATOM   4909  C C   . GLY D 1 4   ? 72.806  102.957 79.386  1.00 26.69 ? 19  GLY D C   1 
ATOM   4910  O O   . GLY D 1 4   ? 73.863  103.192 78.813  1.00 30.75 ? 19  GLY D O   1 
ATOM   4911  N N   . TYR D 1 5   ? 72.098  103.902 79.987  1.00 23.04 ? 20  TYR D N   1 
ATOM   4912  C CA  . TYR D 1 5   ? 72.558  105.280 80.030  1.00 23.24 ? 20  TYR D CA  1 
ATOM   4913  C C   . TYR D 1 5   ? 72.550  105.713 81.485  1.00 26.10 ? 20  TYR D C   1 
ATOM   4914  O O   . TYR D 1 5   ? 71.819  105.135 82.283  1.00 29.06 ? 20  TYR D O   1 
ATOM   4915  C CB  . TYR D 1 5   ? 71.633  106.183 79.203  1.00 20.86 ? 20  TYR D CB  1 
ATOM   4916  C CG  . TYR D 1 5   ? 70.229  106.308 79.732  1.00 15.92 ? 20  TYR D CG  1 
ATOM   4917  C CD1 . TYR D 1 5   ? 69.890  107.333 80.596  1.00 16.61 ? 20  TYR D CD1 1 
ATOM   4918  C CD2 . TYR D 1 5   ? 69.236  105.402 79.361  1.00 13.53 ? 20  TYR D CD2 1 
ATOM   4919  C CE1 . TYR D 1 5   ? 68.590  107.453 81.087  1.00 18.42 ? 20  TYR D CE1 1 
ATOM   4920  C CE2 . TYR D 1 5   ? 67.943  105.514 79.837  1.00 11.78 ? 20  TYR D CE2 1 
ATOM   4921  C CZ  . TYR D 1 5   ? 67.623  106.538 80.701  1.00 13.50 ? 20  TYR D CZ  1 
ATOM   4922  O OH  . TYR D 1 5   ? 66.353  106.647 81.200  1.00 9.04  ? 20  TYR D OH  1 
ATOM   4923  N N   . THR D 1 6   ? 73.387  106.682 81.851  1.00 25.96 ? 21  THR D N   1 
ATOM   4924  C CA  . THR D 1 6   ? 73.398  107.169 83.230  1.00 22.05 ? 21  THR D CA  1 
ATOM   4925  C C   . THR D 1 6   ? 72.078  107.897 83.457  1.00 20.20 ? 21  THR D C   1 
ATOM   4926  O O   . THR D 1 6   ? 71.683  108.719 82.633  1.00 19.32 ? 21  THR D O   1 
ATOM   4927  C CB  . THR D 1 6   ? 74.521  108.177 83.480  1.00 20.02 ? 21  THR D CB  1 
ATOM   4928  O OG1 . THR D 1 6   ? 75.751  107.664 82.969  1.00 21.67 ? 21  THR D OG1 1 
ATOM   4929  C CG2 . THR D 1 6   ? 74.676  108.402 84.962  1.00 20.77 ? 21  THR D CG2 1 
ATOM   4930  N N   . CYS D 1 7   ? 71.388  107.581 84.549  1.00 17.86 ? 22  CYS D N   1 
ATOM   4931  C CA  . CYS D 1 7   ? 70.126  108.235 84.838  1.00 17.42 ? 22  CYS D CA  1 
ATOM   4932  C C   . CYS D 1 7   ? 70.415  109.691 85.202  1.00 20.91 ? 22  CYS D C   1 
ATOM   4933  O O   . CYS D 1 7   ? 69.710  110.605 84.771  1.00 22.26 ? 22  CYS D O   1 
ATOM   4934  C CB  . CYS D 1 7   ? 69.423  107.539 85.988  1.00 16.74 ? 22  CYS D CB  1 
ATOM   4935  S SG  . CYS D 1 7   ? 69.259  105.736 85.836  1.00 14.63 ? 22  CYS D SG  1 
ATOM   4936  N N   . GLY D 1 8   ? 71.494  109.907 85.949  0.00 23.26 ? 23  GLY D N   1 
ATOM   4937  C CA  . GLY D 1 8   ? 71.877  111.254 86.336  0.00 26.99 ? 23  GLY D CA  1 
ATOM   4938  C C   . GLY D 1 8   ? 70.884  111.976 87.226  0.00 29.69 ? 23  GLY D C   1 
ATOM   4939  O O   . GLY D 1 8   ? 69.725  111.572 87.341  0.00 27.97 ? 23  GLY D O   1 
ATOM   4940  N N   . ALA D 1 9   ? 71.352  113.054 87.852  0.00 33.81 ? 24  ALA D N   1 
ATOM   4941  C CA  . ALA D 1 9   ? 70.538  113.868 88.751  0.00 40.62 ? 24  ALA D CA  1 
ATOM   4942  C C   . ALA D 1 9   ? 69.739  112.983 89.706  0.00 48.16 ? 24  ALA D C   1 
ATOM   4943  O O   . ALA D 1 9   ? 70.297  112.419 90.647  0.00 47.49 ? 24  ALA D O   1 
ATOM   4944  C CB  . ALA D 1 9   ? 69.615  114.791 87.949  0.00 41.75 ? 24  ALA D CB  1 
ATOM   4945  N N   . ASN D 1 10  ? 68.447  112.837 89.437  1.00 55.53 ? 25  ASN D N   1 
ATOM   4946  C CA  . ASN D 1 10  ? 67.564  112.008 90.258  1.00 61.17 ? 25  ASN D CA  1 
ATOM   4947  C C   . ASN D 1 10  ? 66.156  111.910 89.646  1.00 57.27 ? 25  ASN D C   1 
ATOM   4948  O O   . ASN D 1 10  ? 65.282  112.768 89.877  1.00 57.02 ? 25  ASN D O   1 
ATOM   4949  C CB  . ASN D 1 10  ? 67.485  112.522 91.704  1.00 68.26 ? 25  ASN D CB  1 
ATOM   4950  C CG  . ASN D 1 10  ? 67.007  111.446 92.671  1.00 77.00 ? 25  ASN D CG  1 
ATOM   4951  O OD1 . ASN D 1 10  ? 66.812  110.290 92.281  1.00 81.48 ? 25  ASN D OD1 1 
ATOM   4952  N ND2 . ASN D 1 10  ? 66.814  111.819 93.930  1.00 85.13 ? 25  ASN D ND2 1 
ATOM   4953  N N   . THR D 1 11  ? 65.967  110.868 88.841  1.00 50.96 ? 26  THR D N   1 
ATOM   4954  C CA  . THR D 1 11  ? 64.704  110.615 88.160  1.00 45.31 ? 26  THR D CA  1 
ATOM   4955  C C   . THR D 1 11  ? 64.184  109.228 88.541  1.00 38.15 ? 26  THR D C   1 
ATOM   4956  O O   . THR D 1 11  ? 63.151  108.765 88.046  1.00 39.55 ? 26  THR D O   1 
ATOM   4957  C CB  . THR D 1 11  ? 64.892  110.730 86.617  1.00 48.40 ? 26  THR D CB  1 
ATOM   4958  O OG1 . THR D 1 11  ? 65.943  109.854 86.180  1.00 44.74 ? 26  THR D OG1 1 
ATOM   4959  C CG2 . THR D 1 11  ? 65.241  112.178 86.239  1.00 49.59 ? 26  THR D CG2 1 
ATOM   4960  N N   . VAL D 1 12  ? 64.931  108.562 89.415  1.00 28.86 ? 27  VAL D N   1 
ATOM   4961  C CA  . VAL D 1 12  ? 64.578  107.242 89.892  1.00 17.51 ? 27  VAL D CA  1 
ATOM   4962  C C   . VAL D 1 12  ? 64.682  107.323 91.418  1.00 14.76 ? 27  VAL D C   1 
ATOM   4963  O O   . VAL D 1 12  ? 65.427  106.567 92.034  1.00 13.55 ? 27  VAL D O   1 
ATOM   4964  C CB  . VAL D 1 12  ? 65.555  106.174 89.375  1.00 10.55 ? 27  VAL D CB  1 
ATOM   4965  C CG1 . VAL D 1 12  ? 64.884  104.850 89.354  1.00 9.60  ? 27  VAL D CG1 1 
ATOM   4966  C CG2 . VAL D 1 12  ? 66.076  106.520 88.006  1.00 5.00  ? 27  VAL D CG2 1 
ATOM   4967  N N   . PRO D 1 13  ? 63.868  108.201 92.048  1.00 13.13 ? 28  PRO D N   1 
ATOM   4968  C CA  . PRO D 1 13  ? 63.767  108.481 93.492  1.00 9.07  ? 28  PRO D CA  1 
ATOM   4969  C C   . PRO D 1 13  ? 63.395  107.256 94.310  1.00 12.07 ? 28  PRO D C   1 
ATOM   4970  O O   . PRO D 1 13  ? 63.759  107.134 95.474  1.00 12.74 ? 28  PRO D O   1 
ATOM   4971  C CB  . PRO D 1 13  ? 62.611  109.475 93.572  1.00 6.01  ? 28  PRO D CB  1 
ATOM   4972  C CG  . PRO D 1 13  ? 62.489  110.028 92.198  1.00 9.93  ? 28  PRO D CG  1 
ATOM   4973  C CD  . PRO D 1 13  ? 62.749  108.845 91.342  1.00 12.04 ? 28  PRO D CD  1 
ATOM   4974  N N   . TYR D 1 14  ? 62.593  106.386 93.710  1.00 11.88 ? 29  TYR D N   1 
ATOM   4975  C CA  . TYR D 1 14  ? 62.133  105.173 94.355  1.00 7.72  ? 29  TYR D CA  1 
ATOM   4976  C C   . TYR D 1 14  ? 63.137  104.065 94.351  1.00 5.00  ? 29  TYR D C   1 
ATOM   4977  O O   . TYR D 1 14  ? 62.820  102.968 94.778  1.00 6.39  ? 29  TYR D O   1 
ATOM   4978  C CB  . TYR D 1 14  ? 60.873  104.674 93.659  1.00 9.35  ? 29  TYR D CB  1 
ATOM   4979  C CG  . TYR D 1 14  ? 61.034  104.469 92.178  1.00 6.76  ? 29  TYR D CG  1 
ATOM   4980  C CD1 . TYR D 1 14  ? 61.640  103.318 91.674  1.00 5.00  ? 29  TYR D CD1 1 
ATOM   4981  C CD2 . TYR D 1 14  ? 60.606  105.441 91.281  1.00 5.00  ? 29  TYR D CD2 1 
ATOM   4982  C CE1 . TYR D 1 14  ? 61.823  103.145 90.307  1.00 6.07  ? 29  TYR D CE1 1 
ATOM   4983  C CE2 . TYR D 1 14  ? 60.781  105.276 89.915  1.00 6.11  ? 29  TYR D CE2 1 
ATOM   4984  C CZ  . TYR D 1 14  ? 61.392  104.130 89.434  1.00 6.32  ? 29  TYR D CZ  1 
ATOM   4985  O OH  . TYR D 1 14  ? 61.600  103.988 88.086  1.00 6.18  ? 29  TYR D OH  1 
ATOM   4986  N N   . GLN D 1 15  ? 64.304  104.304 93.773  1.00 5.94  ? 30  GLN D N   1 
ATOM   4987  C CA  . GLN D 1 15  ? 65.339  103.268 93.713  1.00 10.04 ? 30  GLN D CA  1 
ATOM   4988  C C   . GLN D 1 15  ? 66.087  103.142 95.053  1.00 11.20 ? 30  GLN D C   1 
ATOM   4989  O O   . GLN D 1 15  ? 66.244  104.135 95.773  1.00 13.09 ? 30  GLN D O   1 
ATOM   4990  C CB  . GLN D 1 15  ? 66.340  103.583 92.586  1.00 6.12  ? 30  GLN D CB  1 
ATOM   4991  C CG  . GLN D 1 15  ? 67.504  102.614 92.500  1.00 5.00  ? 30  GLN D CG  1 
ATOM   4992  C CD  . GLN D 1 15  ? 67.232  101.409 91.598  1.00 6.64  ? 30  GLN D CD  1 
ATOM   4993  O OE1 . GLN D 1 15  ? 67.712  100.285 91.844  1.00 5.00  ? 30  GLN D OE1 1 
ATOM   4994  N NE2 . GLN D 1 15  ? 66.497  101.647 90.523  1.00 7.54  ? 30  GLN D NE2 1 
ATOM   4995  N N   . VAL D 1 16  ? 66.449  101.923 95.441  1.00 9.71  ? 31  VAL D N   1 
ATOM   4996  C CA  . VAL D 1 16  ? 67.225  101.725 96.670  1.00 13.04 ? 31  VAL D CA  1 
ATOM   4997  C C   . VAL D 1 16  ? 68.227  100.588 96.449  1.00 12.89 ? 31  VAL D C   1 
ATOM   4998  O O   . VAL D 1 16  ? 68.013  99.672  95.641  1.00 9.42  ? 31  VAL D O   1 
ATOM   4999  C CB  . VAL D 1 16  ? 66.388  101.430 97.984  1.00 12.69 ? 31  VAL D CB  1 
ATOM   5000  C CG1 . VAL D 1 16  ? 65.210  102.370 98.127  1.00 12.52 ? 31  VAL D CG1 1 
ATOM   5001  C CG2 . VAL D 1 16  ? 65.972  99.959  98.061  1.00 13.20 ? 31  VAL D CG2 1 
ATOM   5002  N N   . SER D 1 17  ? 69.326  100.674 97.182  1.00 12.97 ? 32  SER D N   1 
ATOM   5003  C CA  . SER D 1 17  ? 70.405  99.716  97.103  1.00 10.42 ? 32  SER D CA  1 
ATOM   5004  C C   . SER D 1 17  ? 70.415  98.857  98.361  1.00 9.64  ? 32  SER D C   1 
ATOM   5005  O O   . SER D 1 17  ? 70.400  99.389  99.476  1.00 10.00 ? 32  SER D O   1 
ATOM   5006  C CB  . SER D 1 17  ? 71.722  100.485 96.964  1.00 8.39  ? 32  SER D CB  1 
ATOM   5007  O OG  . SER D 1 17  ? 72.845  99.665  97.226  1.00 10.36 ? 32  SER D OG  1 
ATOM   5008  N N   . LEU D 1 18  ? 70.415  97.541  98.186  1.00 7.20  ? 33  LEU D N   1 
ATOM   5009  C CA  . LEU D 1 18  ? 70.440  96.642  99.324  1.00 5.97  ? 33  LEU D CA  1 
ATOM   5010  C C   . LEU D 1 18  ? 71.902  96.354  99.554  1.00 6.95  ? 33  LEU D C   1 
ATOM   5011  O O   . LEU D 1 18  ? 72.597  95.912  98.632  1.00 9.32  ? 33  LEU D O   1 
ATOM   5012  C CB  . LEU D 1 18  ? 69.673  95.352  99.021  1.00 6.58  ? 33  LEU D CB  1 
ATOM   5013  C CG  . LEU D 1 18  ? 68.175  95.501  98.829  1.00 5.00  ? 33  LEU D CG  1 
ATOM   5014  C CD1 . LEU D 1 18  ? 67.535  94.176  98.898  1.00 5.00  ? 33  LEU D CD1 1 
ATOM   5015  C CD2 . LEU D 1 18  ? 67.650  96.359  99.942  1.00 7.68  ? 33  LEU D CD2 1 
ATOM   5016  N N   . ASN D 1 19  ? 72.375  96.652  100.759 1.00 6.41  ? 34  ASN D N   1 
ATOM   5017  C CA  . ASN D 1 19  ? 73.767  96.468  101.124 1.00 7.16  ? 34  ASN D CA  1 
ATOM   5018  C C   . ASN D 1 19  ? 73.897  95.425  102.177 1.00 5.00  ? 34  ASN D C   1 
ATOM   5019  O O   . ASN D 1 19  ? 73.026  95.310  103.009 1.00 8.70  ? 34  ASN D O   1 
ATOM   5020  C CB  . ASN D 1 19  ? 74.317  97.785  101.670 1.00 11.14 ? 34  ASN D CB  1 
ATOM   5021  C CG  . ASN D 1 19  ? 75.701  97.645  102.287 1.00 17.34 ? 34  ASN D CG  1 
ATOM   5022  O OD1 . ASN D 1 19  ? 75.853  97.117  103.374 1.00 17.83 ? 34  ASN D OD1 1 
ATOM   5023  N ND2 . ASN D 1 19  ? 76.711  98.163  101.605 1.00 23.43 ? 34  ASN D ND2 1 
ATOM   5024  N N   . SER D 1 20  ? 74.962  94.637  102.111 1.00 5.92  ? 37  SER D N   1 
ATOM   5025  C CA  . SER D 1 20  ? 75.253  93.616  103.120 1.00 8.15  ? 37  SER D CA  1 
ATOM   5026  C C   . SER D 1 20  ? 76.755  93.609  103.175 1.00 9.30  ? 37  SER D C   1 
ATOM   5027  O O   . SER D 1 20  ? 77.387  92.613  102.887 1.00 9.97  ? 37  SER D O   1 
ATOM   5028  C CB  . SER D 1 20  ? 74.718  92.235  102.725 1.00 8.05  ? 37  SER D CB  1 
ATOM   5029  O OG  . SER D 1 20  ? 75.232  91.794  101.480 1.00 10.05 ? 37  SER D OG  1 
ATOM   5030  N N   . GLY D 1 21  ? 77.323  94.759  103.511 1.00 12.80 ? 38  GLY D N   1 
ATOM   5031  C CA  . GLY D 1 21  ? 78.766  94.911  103.554 1.00 13.14 ? 38  GLY D CA  1 
ATOM   5032  C C   . GLY D 1 21  ? 79.125  95.574  102.235 1.00 12.52 ? 38  GLY D C   1 
ATOM   5033  O O   . GLY D 1 21  ? 80.028  96.414  102.162 1.00 12.37 ? 38  GLY D O   1 
ATOM   5034  N N   . TYR D 1 22  ? 78.358  95.227  101.200 1.00 11.97 ? 39  TYR D N   1 
ATOM   5035  C CA  . TYR D 1 22  ? 78.540  95.764  99.859  1.00 12.99 ? 39  TYR D CA  1 
ATOM   5036  C C   . TYR D 1 22  ? 77.199  95.692  99.131  1.00 14.12 ? 39  TYR D C   1 
ATOM   5037  O O   . TYR D 1 22  ? 76.272  95.010  99.602  1.00 13.73 ? 39  TYR D O   1 
ATOM   5038  C CB  . TYR D 1 22  ? 79.576  94.925  99.110  1.00 12.25 ? 39  TYR D CB  1 
ATOM   5039  C CG  . TYR D 1 22  ? 79.211  93.479  99.026  1.00 7.57  ? 39  TYR D CG  1 
ATOM   5040  C CD1 . TYR D 1 22  ? 79.548  92.597  100.047 1.00 7.59  ? 39  TYR D CD1 1 
ATOM   5041  C CD2 . TYR D 1 22  ? 78.481  93.008  97.956  1.00 8.35  ? 39  TYR D CD2 1 
ATOM   5042  C CE1 . TYR D 1 22  ? 79.154  91.276  100.003 1.00 10.87 ? 39  TYR D CE1 1 
ATOM   5043  C CE2 . TYR D 1 22  ? 78.078  91.699  97.898  1.00 14.80 ? 39  TYR D CE2 1 
ATOM   5044  C CZ  . TYR D 1 22  ? 78.407  90.829  98.922  1.00 14.99 ? 39  TYR D CZ  1 
ATOM   5045  O OH  . TYR D 1 22  ? 77.928  89.536  98.856  1.00 18.26 ? 39  TYR D OH  1 
ATOM   5046  N N   . HIS D 1 23  ? 77.086  96.413  98.013  1.00 13.21 ? 40  HIS D N   1 
ATOM   5047  C CA  . HIS D 1 23  ? 75.863  96.402  97.225  1.00 10.69 ? 40  HIS D CA  1 
ATOM   5048  C C   . HIS D 1 23  ? 75.716  95.032  96.595  1.00 10.30 ? 40  HIS D C   1 
ATOM   5049  O O   . HIS D 1 23  ? 76.652  94.533  95.970  1.00 9.27  ? 40  HIS D O   1 
ATOM   5050  C CB  . HIS D 1 23  ? 75.916  97.438  96.116  1.00 10.54 ? 40  HIS D CB  1 
ATOM   5051  C CG  . HIS D 1 23  ? 74.798  97.314  95.125  1.00 13.99 ? 40  HIS D CG  1 
ATOM   5052  N ND1 . HIS D 1 23  ? 73.705  98.152  95.129  1.00 16.83 ? 40  HIS D ND1 1 
ATOM   5053  C CD2 . HIS D 1 23  ? 74.606  96.456  94.092  1.00 16.57 ? 40  HIS D CD2 1 
ATOM   5054  C CE1 . HIS D 1 23  ? 72.888  97.820  94.143  1.00 17.75 ? 40  HIS D CE1 1 
ATOM   5055  N NE2 . HIS D 1 23  ? 73.411  96.792  93.499  1.00 18.43 ? 40  HIS D NE2 1 
ATOM   5056  N N   . PHE D 1 24  ? 74.535  94.442  96.736  1.00 9.67  ? 41  PHE D N   1 
ATOM   5057  C CA  . PHE D 1 24  ? 74.286  93.138  96.150  1.00 8.19  ? 41  PHE D CA  1 
ATOM   5058  C C   . PHE D 1 24  ? 72.934  93.013  95.446  1.00 8.05  ? 41  PHE D C   1 
ATOM   5059  O O   . PHE D 1 24  ? 72.676  91.998  94.796  1.00 10.46 ? 41  PHE D O   1 
ATOM   5060  C CB  . PHE D 1 24  ? 74.423  92.063  97.206  1.00 6.33  ? 41  PHE D CB  1 
ATOM   5061  C CG  . PHE D 1 24  ? 73.346  92.087  98.207  1.00 6.64  ? 41  PHE D CG  1 
ATOM   5062  C CD1 . PHE D 1 24  ? 72.260  91.234  98.080  1.00 7.00  ? 41  PHE D CD1 1 
ATOM   5063  C CD2 . PHE D 1 24  ? 73.394  92.969  99.270  1.00 7.43  ? 41  PHE D CD2 1 
ATOM   5064  C CE1 . PHE D 1 24  ? 71.227  91.256  99.001  1.00 6.22  ? 41  PHE D CE1 1 
ATOM   5065  C CE2 . PHE D 1 24  ? 72.363  93.002  100.203 1.00 7.10  ? 41  PHE D CE2 1 
ATOM   5066  C CZ  . PHE D 1 24  ? 71.278  92.138  100.061 1.00 7.29  ? 41  PHE D CZ  1 
ATOM   5067  N N   . CYS D 1 25  ? 72.077  94.021  95.598  1.00 5.16  ? 42  CYS D N   1 
ATOM   5068  C CA  . CYS D 1 25  ? 70.761  94.037  94.964  1.00 7.42  ? 42  CYS D CA  1 
ATOM   5069  C C   . CYS D 1 25  ? 70.172  95.423  95.044  1.00 9.24  ? 42  CYS D C   1 
ATOM   5070  O O   . CYS D 1 25  ? 70.709  96.297  95.743  1.00 9.95  ? 42  CYS D O   1 
ATOM   5071  C CB  . CYS D 1 25  ? 69.778  93.097  95.661  1.00 7.44  ? 42  CYS D CB  1 
ATOM   5072  S SG  . CYS D 1 25  ? 69.997  91.335  95.295  1.00 15.08 ? 42  CYS D SG  1 
ATOM   5073  N N   . GLY D 1 26  ? 69.059  95.607  94.334  1.00 8.71  ? 43  GLY D N   1 
ATOM   5074  C CA  . GLY D 1 26  ? 68.344  96.870  94.336  1.00 8.48  ? 43  GLY D CA  1 
ATOM   5075  C C   . GLY D 1 26  ? 66.988  96.601  94.957  1.00 7.51  ? 43  GLY D C   1 
ATOM   5076  O O   . GLY D 1 26  ? 66.766  95.539  95.531  1.00 10.76 ? 43  GLY D O   1 
ATOM   5077  N N   . GLY D 1 27  ? 66.078  97.549  94.856  1.00 6.57  ? 44  GLY D N   1 
ATOM   5078  C CA  . GLY D 1 27  ? 64.753  97.357  95.408  1.00 5.52  ? 44  GLY D CA  1 
ATOM   5079  C C   . GLY D 1 27  ? 63.939  98.595  95.128  1.00 6.04  ? 44  GLY D C   1 
ATOM   5080  O O   . GLY D 1 27  ? 64.496  99.618  94.728  1.00 8.35  ? 44  GLY D O   1 
ATOM   5081  N N   . SER D 1 28  ? 62.633  98.530  95.309  1.00 5.00  ? 45  SER D N   1 
ATOM   5082  C CA  . SER D 1 28  ? 61.826  99.709  95.078  1.00 5.00  ? 45  SER D CA  1 
ATOM   5083  C C   . SER D 1 28  ? 61.141  100.114 96.363  1.00 5.00  ? 45  SER D C   1 
ATOM   5084  O O   . SER D 1 28  ? 60.759  99.256  97.161  1.00 5.00  ? 45  SER D O   1 
ATOM   5085  C CB  . SER D 1 28  ? 60.791  99.436  94.000  1.00 5.00  ? 45  SER D CB  1 
ATOM   5086  O OG  . SER D 1 28  ? 61.415  98.897  92.858  1.00 5.00  ? 45  SER D OG  1 
ATOM   5087  N N   . LEU D 1 29  ? 61.054  101.416 96.596  1.00 5.00  ? 46  LEU D N   1 
ATOM   5088  C CA  . LEU D 1 29  ? 60.391  101.941 97.774  1.00 5.00  ? 46  LEU D CA  1 
ATOM   5089  C C   . LEU D 1 29  ? 58.898  102.082 97.436  1.00 5.00  ? 46  LEU D C   1 
ATOM   5090  O O   . LEU D 1 29  ? 58.513  102.849 96.556  1.00 5.00  ? 46  LEU D O   1 
ATOM   5091  C CB  . LEU D 1 29  ? 61.011  103.276 98.159  1.00 5.00  ? 46  LEU D CB  1 
ATOM   5092  C CG  . LEU D 1 29  ? 60.602  103.934 99.478  1.00 7.39  ? 46  LEU D CG  1 
ATOM   5093  C CD1 . LEU D 1 29  ? 60.806  103.008 100.640 1.00 5.00  ? 46  LEU D CD1 1 
ATOM   5094  C CD2 . LEU D 1 29  ? 61.413  105.195 99.679  1.00 8.69  ? 46  LEU D CD2 1 
ATOM   5095  N N   . ILE D 1 30  ? 58.073  101.283 98.103  1.00 7.24  ? 47  ILE D N   1 
ATOM   5096  C CA  . ILE D 1 30  ? 56.634  101.261 97.891  1.00 7.12  ? 47  ILE D CA  1 
ATOM   5097  C C   . ILE D 1 30  ? 55.948  102.342 98.721  1.00 5.80  ? 47  ILE D C   1 
ATOM   5098  O O   . ILE D 1 30  ? 54.909  102.864 98.328  1.00 5.00  ? 47  ILE D O   1 
ATOM   5099  C CB  . ILE D 1 30  ? 56.081  99.850  98.188  1.00 12.63 ? 47  ILE D CB  1 
ATOM   5100  C CG1 . ILE D 1 30  ? 56.478  98.912  97.064  1.00 15.09 ? 47  ILE D CG1 1 
ATOM   5101  C CG2 . ILE D 1 30  ? 54.564  99.831  98.299  1.00 17.52 ? 47  ILE D CG2 1 
ATOM   5102  C CD1 . ILE D 1 30  ? 55.844  97.569  97.209  1.00 21.97 ? 47  ILE D CD1 1 
ATOM   5103  N N   . ASN D 1 31  ? 56.557  102.703 99.847  1.00 8.13  ? 48  ASN D N   1 
ATOM   5104  C CA  . ASN D 1 31  ? 56.045  103.764 100.728 1.00 8.46  ? 48  ASN D CA  1 
ATOM   5105  C C   . ASN D 1 31  ? 56.990  103.911 101.899 1.00 5.78  ? 48  ASN D C   1 
ATOM   5106  O O   . ASN D 1 31  ? 57.613  102.940 102.296 1.00 6.23  ? 48  ASN D O   1 
ATOM   5107  C CB  . ASN D 1 31  ? 54.655  103.419 101.253 1.00 11.91 ? 48  ASN D CB  1 
ATOM   5108  C CG  . ASN D 1 31  ? 54.670  102.297 102.285 1.00 11.25 ? 48  ASN D CG  1 
ATOM   5109  O OD1 . ASN D 1 31  ? 54.675  101.102 101.947 1.00 5.00  ? 48  ASN D OD1 1 
ATOM   5110  N ND2 . ASN D 1 31  ? 54.655  102.685 103.562 1.00 13.84 ? 48  ASN D ND2 1 
ATOM   5111  N N   . SER D 1 32  ? 57.016  105.084 102.503 1.00 5.00  ? 49  SER D N   1 
ATOM   5112  C CA  . SER D 1 32  ? 57.898  105.378 103.631 1.00 6.46  ? 49  SER D CA  1 
ATOM   5113  C C   . SER D 1 32  ? 58.607  104.235 104.356 1.00 8.92  ? 49  SER D C   1 
ATOM   5114  O O   . SER D 1 32  ? 59.813  104.267 104.490 1.00 12.69 ? 49  SER D O   1 
ATOM   5115  C CB  . SER D 1 32  ? 57.163  106.228 104.665 1.00 6.32  ? 49  SER D CB  1 
ATOM   5116  O OG  . SER D 1 32  ? 55.920  105.634 104.984 1.00 7.09  ? 49  SER D OG  1 
ATOM   5117  N N   . GLN D 1 33  ? 57.879  103.212 104.789 1.00 9.79  ? 50  GLN D N   1 
ATOM   5118  C CA  . GLN D 1 33  ? 58.483  102.123 105.550 1.00 6.10  ? 50  GLN D CA  1 
ATOM   5119  C C   . GLN D 1 33  ? 58.740  100.792 104.873 1.00 5.00  ? 50  GLN D C   1 
ATOM   5120  O O   . GLN D 1 33  ? 59.429  99.959  105.448 1.00 5.00  ? 50  GLN D O   1 
ATOM   5121  C CB  . GLN D 1 33  ? 57.659  101.886 106.815 1.00 6.75  ? 50  GLN D CB  1 
ATOM   5122  C CG  . GLN D 1 33  ? 58.451  101.946 108.111 1.00 8.59  ? 50  GLN D CG  1 
ATOM   5123  C CD  . GLN D 1 33  ? 57.576  101.832 109.357 1.00 8.60  ? 50  GLN D CD  1 
ATOM   5124  O OE1 . GLN D 1 33  ? 58.009  101.338 110.388 1.00 5.00  ? 50  GLN D OE1 1 
ATOM   5125  N NE2 . GLN D 1 33  ? 56.349  102.317 109.268 1.00 12.00 ? 50  GLN D NE2 1 
ATOM   5126  N N   . TRP D 1 34  ? 58.193  100.565 103.682 1.00 5.26  ? 51  TRP D N   1 
ATOM   5127  C CA  . TRP D 1 34  ? 58.396  99.275  102.999 1.00 6.52  ? 51  TRP D CA  1 
ATOM   5128  C C   . TRP D 1 34  ? 59.145  99.350  101.676 1.00 5.00  ? 51  TRP D C   1 
ATOM   5129  O O   . TRP D 1 34  ? 59.000  100.306 100.933 1.00 5.00  ? 51  TRP D O   1 
ATOM   5130  C CB  . TRP D 1 34  ? 57.054  98.537  102.779 1.00 8.73  ? 51  TRP D CB  1 
ATOM   5131  C CG  . TRP D 1 34  ? 56.426  97.979  104.035 1.00 6.60  ? 51  TRP D CG  1 
ATOM   5132  C CD1 . TRP D 1 34  ? 55.698  98.671  104.938 1.00 6.93  ? 51  TRP D CD1 1 
ATOM   5133  C CD2 . TRP D 1 34  ? 56.507  96.631  104.528 1.00 5.00  ? 51  TRP D CD2 1 
ATOM   5134  N NE1 . TRP D 1 34  ? 55.324  97.853  105.967 1.00 7.80  ? 51  TRP D NE1 1 
ATOM   5135  C CE2 . TRP D 1 34  ? 55.805  96.594  105.742 1.00 5.00  ? 51  TRP D CE2 1 
ATOM   5136  C CE3 . TRP D 1 34  ? 57.110  95.457  104.064 1.00 5.00  ? 51  TRP D CE3 1 
ATOM   5137  C CZ2 . TRP D 1 34  ? 55.685  95.436  106.507 1.00 5.00  ? 51  TRP D CZ2 1 
ATOM   5138  C CZ3 . TRP D 1 34  ? 56.992  94.296  104.829 1.00 5.00  ? 51  TRP D CZ3 1 
ATOM   5139  C CH2 . TRP D 1 34  ? 56.286  94.299  106.036 1.00 5.00  ? 51  TRP D CH2 1 
ATOM   5140  N N   . VAL D 1 35  ? 59.902  98.304  101.373 1.00 5.00  ? 52  VAL D N   1 
ATOM   5141  C CA  . VAL D 1 35  ? 60.686  98.196  100.147 1.00 5.00  ? 52  VAL D CA  1 
ATOM   5142  C C   . VAL D 1 35  ? 60.427  96.828  99.515  1.00 5.93  ? 52  VAL D C   1 
ATOM   5143  O O   . VAL D 1 35  ? 60.607  95.797  100.171 1.00 6.88  ? 52  VAL D O   1 
ATOM   5144  C CB  . VAL D 1 35  ? 62.178  98.265  100.463 1.00 5.00  ? 52  VAL D CB  1 
ATOM   5145  C CG1 . VAL D 1 35  ? 62.969  98.187  99.202  1.00 5.71  ? 52  VAL D CG1 1 
ATOM   5146  C CG2 . VAL D 1 35  ? 62.499  99.516  101.217 1.00 5.00  ? 52  VAL D CG2 1 
ATOM   5147  N N   . VAL D 1 36  ? 60.028  96.798  98.251  1.00 5.00  ? 53  VAL D N   1 
ATOM   5148  C CA  . VAL D 1 36  ? 59.760  95.516  97.581  1.00 6.35  ? 53  VAL D CA  1 
ATOM   5149  C C   . VAL D 1 36  ? 61.001  95.100  96.804  1.00 6.88  ? 53  VAL D C   1 
ATOM   5150  O O   . VAL D 1 36  ? 61.686  95.964  96.256  1.00 9.09  ? 53  VAL D O   1 
ATOM   5151  C CB  . VAL D 1 36  ? 58.541  95.618  96.613  1.00 5.00  ? 53  VAL D CB  1 
ATOM   5152  C CG1 . VAL D 1 36  ? 58.830  96.554  95.482  1.00 5.00  ? 53  VAL D CG1 1 
ATOM   5153  C CG2 . VAL D 1 36  ? 58.161  94.271  96.088  1.00 5.00  ? 53  VAL D CG2 1 
ATOM   5154  N N   . SER D 1 37  ? 61.300  93.803  96.758  1.00 7.81  ? 54  SER D N   1 
ATOM   5155  C CA  . SER D 1 37  ? 62.480  93.319  96.035  1.00 8.05  ? 54  SER D CA  1 
ATOM   5156  C C   . SER D 1 37  ? 62.418  91.835  95.671  1.00 11.57 ? 54  SER D C   1 
ATOM   5157  O O   . SER D 1 37  ? 61.421  91.151  95.952  1.00 15.54 ? 54  SER D O   1 
ATOM   5158  C CB  . SER D 1 37  ? 63.739  93.576  96.843  1.00 5.00  ? 54  SER D CB  1 
ATOM   5159  O OG  . SER D 1 37  ? 64.848  93.365  96.013  1.00 5.00  ? 54  SER D OG  1 
ATOM   5160  N N   . ALA D 1 38  ? 63.479  91.344  95.033  1.00 9.89  ? 55  ALA D N   1 
ATOM   5161  C CA  . ALA D 1 38  ? 63.564  89.940  94.623  1.00 6.47  ? 55  ALA D CA  1 
ATOM   5162  C C   . ALA D 1 38  ? 63.756  89.059  95.846  1.00 5.00  ? 55  ALA D C   1 
ATOM   5163  O O   . ALA D 1 38  ? 64.595  89.336  96.682  1.00 5.00  ? 55  ALA D O   1 
ATOM   5164  C CB  . ALA D 1 38  ? 64.711  89.749  93.646  0.00 7.45  ? 55  ALA D CB  1 
ATOM   5165  N N   . ALA D 1 39  ? 62.991  87.983  95.940  1.00 5.00  ? 56  ALA D N   1 
ATOM   5166  C CA  . ALA D 1 39  ? 63.082  87.083  97.087  1.00 5.31  ? 56  ALA D CA  1 
ATOM   5167  C C   . ALA D 1 39  ? 64.450  86.492  97.236  1.00 7.26  ? 56  ALA D C   1 
ATOM   5168  O O   . ALA D 1 39  ? 64.864  86.194  98.350  1.00 6.96  ? 56  ALA D O   1 
ATOM   5169  C CB  . ALA D 1 39  ? 62.047  85.970  96.993  1.00 5.00  ? 56  ALA D CB  1 
ATOM   5170  N N   . HIS D 1 40  ? 65.138  86.298  96.105  1.00 11.24 ? 57  HIS D N   1 
ATOM   5171  C CA  . HIS D 1 40  ? 66.505  85.731  96.086  1.00 9.87  ? 57  HIS D CA  1 
ATOM   5172  C C   . HIS D 1 40  ? 67.605  86.725  96.534  1.00 5.83  ? 57  HIS D C   1 
ATOM   5173  O O   . HIS D 1 40  ? 68.776  86.389  96.606  1.00 5.00  ? 57  HIS D O   1 
ATOM   5174  C CB  . HIS D 1 40  ? 66.828  85.083  94.725  1.00 10.20 ? 57  HIS D CB  1 
ATOM   5175  C CG  . HIS D 1 40  ? 67.194  86.060  93.651  1.00 11.51 ? 57  HIS D CG  1 
ATOM   5176  N ND1 . HIS D 1 40  ? 66.302  86.476  92.685  1.00 13.26 ? 57  HIS D ND1 1 
ATOM   5177  C CD2 . HIS D 1 40  ? 68.366  86.682  93.376  1.00 11.17 ? 57  HIS D CD2 1 
ATOM   5178  C CE1 . HIS D 1 40  ? 66.908  87.314  91.863  1.00 12.75 ? 57  HIS D CE1 1 
ATOM   5179  N NE2 . HIS D 1 40  ? 68.161  87.455  92.260  1.00 10.20 ? 57  HIS D NE2 1 
ATOM   5180  N N   . CYS D 1 41  ? 67.201  87.953  96.813  1.00 5.00  ? 58  CYS D N   1 
ATOM   5181  C CA  . CYS D 1 41  ? 68.091  88.966  97.321  1.00 5.00  ? 58  CYS D CA  1 
ATOM   5182  C C   . CYS D 1 41  ? 68.025  88.934  98.844  1.00 5.00  ? 58  CYS D C   1 
ATOM   5183  O O   . CYS D 1 41  ? 68.610  89.781  99.513  1.00 5.00  ? 58  CYS D O   1 
ATOM   5184  C CB  . CYS D 1 41  ? 67.659  90.329  96.830  1.00 5.00  ? 58  CYS D CB  1 
ATOM   5185  S SG  . CYS D 1 41  ? 68.121  90.600  95.101  1.00 5.00  ? 58  CYS D SG  1 
ATOM   5186  N N   . TYR D 1 42  ? 67.266  87.988  99.391  1.00 5.80  ? 59  TYR D N   1 
ATOM   5187  C CA  . TYR D 1 42  ? 67.148  87.858  100.833 1.00 8.33  ? 59  TYR D CA  1 
ATOM   5188  C C   . TYR D 1 42  ? 68.505  87.538  101.418 1.00 11.18 ? 59  TYR D C   1 
ATOM   5189  O O   . TYR D 1 42  ? 69.238  86.706  100.895 1.00 11.15 ? 59  TYR D O   1 
ATOM   5190  C CB  . TYR D 1 42  ? 66.179  86.738  101.234 1.00 8.07  ? 59  TYR D CB  1 
ATOM   5191  C CG  . TYR D 1 42  ? 66.148  86.496  102.734 1.00 8.13  ? 59  TYR D CG  1 
ATOM   5192  C CD1 . TYR D 1 42  ? 67.015  85.591  103.329 1.00 8.34  ? 59  TYR D CD1 1 
ATOM   5193  C CD2 . TYR D 1 42  ? 65.309  87.234  103.560 1.00 12.35 ? 59  TYR D CD2 1 
ATOM   5194  C CE1 . TYR D 1 42  ? 67.068  85.426  104.698 1.00 10.29 ? 59  TYR D CE1 1 
ATOM   5195  C CE2 . TYR D 1 42  ? 65.346  87.077  104.940 1.00 15.68 ? 59  TYR D CE2 1 
ATOM   5196  C CZ  . TYR D 1 42  ? 66.236  86.171  105.505 1.00 14.93 ? 59  TYR D CZ  1 
ATOM   5197  O OH  . TYR D 1 42  ? 66.299  86.030  106.883 1.00 19.36 ? 59  TYR D OH  1 
ATOM   5198  N N   . LYS D 1 43  ? 68.812  88.189  102.529 1.00 14.40 ? 60  LYS D N   1 
ATOM   5199  C CA  . LYS D 1 43  ? 70.056  87.979  103.254 1.00 15.98 ? 60  LYS D CA  1 
ATOM   5200  C C   . LYS D 1 43  ? 69.738  88.345  104.706 1.00 18.00 ? 60  LYS D C   1 
ATOM   5201  O O   . LYS D 1 43  ? 68.804  89.122  104.965 1.00 20.75 ? 60  LYS D O   1 
ATOM   5202  C CB  . LYS D 1 43  ? 71.161  88.905  102.729 1.00 14.77 ? 60  LYS D CB  1 
ATOM   5203  C CG  . LYS D 1 43  ? 71.949  88.402  101.527 1.00 11.74 ? 60  LYS D CG  1 
ATOM   5204  C CD  . LYS D 1 43  ? 73.154  89.297  101.284 1.00 10.13 ? 60  LYS D CD  1 
ATOM   5205  C CE  . LYS D 1 43  ? 74.098  88.704  100.253 1.00 12.32 ? 60  LYS D CE  1 
ATOM   5206  N NZ  . LYS D 1 43  ? 74.709  87.427  100.717 0.00 11.25 ? 60  LYS D NZ  1 
ATOM   5207  N N   . SER D 1 44  ? 70.474  87.760  105.648 1.00 17.81 ? 61  SER D N   1 
ATOM   5208  C CA  . SER D 1 44  ? 70.280  88.062  107.058 1.00 17.45 ? 61  SER D CA  1 
ATOM   5209  C C   . SER D 1 44  ? 70.789  89.472  107.287 1.00 21.34 ? 61  SER D C   1 
ATOM   5210  O O   . SER D 1 44  ? 71.894  89.814  106.859 1.00 23.73 ? 61  SER D O   1 
ATOM   5211  C CB  . SER D 1 44  ? 71.053  87.078  107.937 1.00 16.59 ? 61  SER D CB  1 
ATOM   5212  O OG  . SER D 1 44  ? 72.335  86.778  107.408 0.00 18.33 ? 61  SER D OG  1 
ATOM   5213  N N   . GLY D 1 45  ? 69.949  90.309  107.885 1.00 23.92 ? 62  GLY D N   1 
ATOM   5214  C CA  . GLY D 1 45  ? 70.338  91.681  108.172 1.00 25.76 ? 62  GLY D CA  1 
ATOM   5215  C C   . GLY D 1 45  ? 70.797  92.515  106.984 1.00 23.52 ? 62  GLY D C   1 
ATOM   5216  O O   . GLY D 1 45  ? 71.982  92.766  106.806 1.00 27.63 ? 62  GLY D O   1 
ATOM   5217  N N   . ILE D 1 46  ? 69.841  92.954  106.180 1.00 21.07 ? 63  ILE D N   1 
ATOM   5218  C CA  . ILE D 1 46  ? 70.091  93.777  105.000 1.00 16.02 ? 63  ILE D CA  1 
ATOM   5219  C C   . ILE D 1 46  ? 70.022  95.247  105.428 1.00 14.13 ? 63  ILE D C   1 
ATOM   5220  O O   . ILE D 1 46  ? 69.308  95.584  106.356 1.00 18.07 ? 63  ILE D O   1 
ATOM   5221  C CB  . ILE D 1 46  ? 68.981  93.514  103.941 1.00 13.06 ? 63  ILE D CB  1 
ATOM   5222  C CG1 . ILE D 1 46  ? 68.893  92.019  103.620 1.00 10.47 ? 63  ILE D CG1 1 
ATOM   5223  C CG2 . ILE D 1 46  ? 69.218  94.335  102.713 1.00 15.67 ? 63  ILE D CG2 1 
ATOM   5224  C CD1 . ILE D 1 46  ? 67.986  91.702  102.502 1.00 5.74  ? 63  ILE D CD1 1 
ATOM   5225  N N   . GLN D 1 47  ? 70.806  96.110  104.810 1.00 12.33 ? 64  GLN D N   1 
ATOM   5226  C CA  . GLN D 1 47  ? 70.763  97.528  105.130 1.00 13.21 ? 64  GLN D CA  1 
ATOM   5227  C C   . GLN D 1 47  ? 70.383  98.242  103.845 1.00 13.51 ? 64  GLN D C   1 
ATOM   5228  O O   . GLN D 1 47  ? 71.057  98.095  102.823 1.00 16.74 ? 64  GLN D O   1 
ATOM   5229  C CB  . GLN D 1 47  ? 72.109  98.017  105.621 1.00 17.17 ? 64  GLN D CB  1 
ATOM   5230  C CG  . GLN D 1 47  ? 72.576  97.304  106.862 1.00 24.74 ? 64  GLN D CG  1 
ATOM   5231  C CD  . GLN D 1 47  ? 73.844  97.902  107.420 1.00 29.46 ? 64  GLN D CD  1 
ATOM   5232  O OE1 . GLN D 1 47  ? 73.821  98.613  108.428 1.00 31.59 ? 64  GLN D OE1 1 
ATOM   5233  N NE2 . GLN D 1 47  ? 74.960  97.635  106.760 1.00 31.45 ? 64  GLN D NE2 1 
ATOM   5234  N N   . VAL D 1 48  ? 69.306  99.013  103.888 1.00 11.09 ? 65  VAL D N   1 
ATOM   5235  C CA  . VAL D 1 48  ? 68.819  99.697  102.709 1.00 9.64  ? 65  VAL D CA  1 
ATOM   5236  C C   . VAL D 1 48  ? 69.410  101.083 102.572 1.00 11.66 ? 65  VAL D C   1 
ATOM   5237  O O   . VAL D 1 48  ? 69.425  101.813 103.555 1.00 13.62 ? 65  VAL D O   1 
ATOM   5238  C CB  . VAL D 1 48  ? 67.278  99.762  102.742 1.00 6.43  ? 65  VAL D CB  1 
ATOM   5239  C CG1 . VAL D 1 48  ? 66.723  100.441 101.486 1.00 5.62  ? 65  VAL D CG1 1 
ATOM   5240  C CG2 . VAL D 1 48  ? 66.719  98.347  102.873 1.00 5.00  ? 65  VAL D CG2 1 
ATOM   5241  N N   . ARG D 1 49  ? 69.980  101.390 101.394 1.00 14.42 ? 66  ARG D N   1 
ATOM   5242  C CA  . ARG D 1 49  ? 70.546  102.710 101.095 1.00 17.48 ? 66  ARG D CA  1 
ATOM   5243  C C   . ARG D 1 49  ? 69.588  103.324 100.102 1.00 17.09 ? 66  ARG D C   1 
ATOM   5244  O O   . ARG D 1 49  ? 69.364  102.758 99.042  1.00 14.01 ? 66  ARG D O   1 
ATOM   5245  C CB  . ARG D 1 49  ? 71.930  102.602 100.463 1.00 22.70 ? 66  ARG D CB  1 
ATOM   5246  C CG  . ARG D 1 49  ? 73.049  102.205 101.419 1.00 30.62 ? 66  ARG D CG  1 
ATOM   5247  C CD  . ARG D 1 49  ? 74.371  102.048 100.671 1.00 39.40 ? 66  ARG D CD  1 
ATOM   5248  N NE  . ARG D 1 49  ? 74.890  103.326 100.168 1.00 48.47 ? 66  ARG D NE  1 
ATOM   5249  C CZ  . ARG D 1 49  ? 75.878  103.446 99.280  1.00 51.96 ? 66  ARG D CZ  1 
ATOM   5250  N NH1 . ARG D 1 49  ? 76.456  102.357 98.781  1.00 54.25 ? 66  ARG D NH1 1 
ATOM   5251  N NH2 . ARG D 1 49  ? 76.329  104.655 98.935  1.00 51.19 ? 66  ARG D NH2 1 
ATOM   5252  N N   . LEU D 1 50  ? 68.957  104.428 100.481 1.00 19.69 ? 67  LEU D N   1 
ATOM   5253  C CA  . LEU D 1 50  ? 67.992  105.095 99.608  1.00 23.23 ? 67  LEU D CA  1 
ATOM   5254  C C   . LEU D 1 50  ? 68.576  106.370 99.030  1.00 25.81 ? 67  LEU D C   1 
ATOM   5255  O O   . LEU D 1 50  ? 69.652  106.795 99.437  1.00 28.40 ? 67  LEU D O   1 
ATOM   5256  C CB  . LEU D 1 50  ? 66.721  105.454 100.380 1.00 22.09 ? 67  LEU D CB  1 
ATOM   5257  C CG  . LEU D 1 50  ? 66.015  104.378 101.190 1.00 20.51 ? 67  LEU D CG  1 
ATOM   5258  C CD1 . LEU D 1 50  ? 66.704  104.215 102.528 1.00 20.63 ? 67  LEU D CD1 1 
ATOM   5259  C CD2 . LEU D 1 50  ? 64.592  104.810 101.405 1.00 22.56 ? 67  LEU D CD2 1 
ATOM   5260  N N   . GLY D 1 51  ? 67.866  106.977 98.085  1.00 27.09 ? 69  GLY D N   1 
ATOM   5261  C CA  . GLY D 1 51  ? 68.313  108.218 97.479  1.00 30.35 ? 69  GLY D CA  1 
ATOM   5262  C C   . GLY D 1 51  ? 69.762  108.239 97.055  1.00 35.13 ? 69  GLY D C   1 
ATOM   5263  O O   . GLY D 1 51  ? 70.422  109.265 97.160  1.00 35.41 ? 69  GLY D O   1 
ATOM   5264  N N   . GLU D 1 52  ? 70.247  107.106 96.559  1.00 36.89 ? 70  GLU D N   1 
ATOM   5265  C CA  . GLU D 1 52  ? 71.623  106.967 96.105  1.00 34.62 ? 70  GLU D CA  1 
ATOM   5266  C C   . GLU D 1 52  ? 71.799  107.462 94.683  1.00 34.73 ? 70  GLU D C   1 
ATOM   5267  O O   . GLU D 1 52  ? 70.900  107.359 93.852  1.00 35.25 ? 70  GLU D O   1 
ATOM   5268  C CB  . GLU D 1 52  ? 72.042  105.504 96.140  1.00 34.35 ? 70  GLU D CB  1 
ATOM   5269  C CG  . GLU D 1 52  ? 72.200  104.914 97.511  1.00 38.51 ? 70  GLU D CG  1 
ATOM   5270  C CD  . GLU D 1 52  ? 73.373  105.500 98.268  1.00 43.58 ? 70  GLU D CD  1 
ATOM   5271  O OE1 . GLU D 1 52  ? 74.384  105.878 97.635  1.00 46.05 ? 70  GLU D OE1 1 
ATOM   5272  O OE2 . GLU D 1 52  ? 73.291  105.574 99.509  1.00 45.84 ? 70  GLU D OE2 1 
ATOM   5273  N N   . ASP D 1 53  ? 72.964  108.024 94.416  1.00 34.67 ? 71  ASP D N   1 
ATOM   5274  C CA  . ASP D 1 53  ? 73.318  108.507 93.091  1.00 34.58 ? 71  ASP D CA  1 
ATOM   5275  C C   . ASP D 1 53  ? 74.542  107.649 92.799  1.00 35.84 ? 71  ASP D C   1 
ATOM   5276  O O   . ASP D 1 53  ? 74.500  106.755 91.955  1.00 35.98 ? 71  ASP D O   1 
ATOM   5277  C CB  . ASP D 1 53  ? 73.700  109.989 93.149  0.00 34.38 ? 71  ASP D CB  1 
ATOM   5278  C CG  . ASP D 1 53  ? 74.031  110.563 91.785  0.00 34.33 ? 71  ASP D CG  1 
ATOM   5279  O OD1 . ASP D 1 53  ? 75.232  110.671 91.458  0.00 33.70 ? 71  ASP D OD1 1 
ATOM   5280  O OD2 . ASP D 1 53  ? 73.089  110.912 91.043  0.00 33.68 ? 71  ASP D OD2 1 
ATOM   5281  N N   . ASN D 1 54  ? 75.603  107.884 93.567  1.00 35.74 ? 72  ASN D N   1 
ATOM   5282  C CA  . ASN D 1 54  ? 76.838  107.127 93.444  1.00 37.16 ? 72  ASN D CA  1 
ATOM   5283  C C   . ASN D 1 54  ? 76.832  106.239 94.680  1.00 38.46 ? 72  ASN D C   1 
ATOM   5284  O O   . ASN D 1 54  ? 76.586  106.716 95.784  1.00 40.88 ? 72  ASN D O   1 
ATOM   5285  C CB  . ASN D 1 54  ? 78.054  108.065 93.446  1.00 36.47 ? 72  ASN D CB  1 
ATOM   5286  C CG  . ASN D 1 54  ? 79.373  107.319 93.379  0.00 35.05 ? 72  ASN D CG  1 
ATOM   5287  O OD1 . ASN D 1 54  ? 79.753  106.627 94.320  0.00 34.90 ? 72  ASN D OD1 1 
ATOM   5288  N ND2 . ASN D 1 54  ? 80.094  107.486 92.279  0.00 34.95 ? 72  ASN D ND2 1 
ATOM   5289  N N   . ILE D 1 55  ? 77.021  104.942 94.501  1.00 37.47 ? 73  ILE D N   1 
ATOM   5290  C CA  . ILE D 1 55  ? 77.013  104.048 95.641  1.00 37.82 ? 73  ILE D CA  1 
ATOM   5291  C C   . ILE D 1 55  ? 78.382  103.885 96.295  1.00 41.00 ? 73  ILE D C   1 
ATOM   5292  O O   . ILE D 1 55  ? 78.778  102.785 96.688  1.00 41.29 ? 73  ILE D O   1 
ATOM   5293  C CB  . ILE D 1 55  ? 76.376  102.688 95.290  1.00 37.36 ? 73  ILE D CB  1 
ATOM   5294  C CG1 . ILE D 1 55  ? 76.797  102.204 93.897  1.00 39.60 ? 73  ILE D CG1 1 
ATOM   5295  C CG2 . ILE D 1 55  ? 74.889  102.804 95.357  1.00 36.23 ? 73  ILE D CG2 1 
ATOM   5296  C CD1 . ILE D 1 55  ? 78.208  101.599 93.804  1.00 39.52 ? 73  ILE D CD1 1 
ATOM   5297  N N   . ASN D 1 56  ? 79.096  104.996 96.431  1.00 43.90 ? 74  ASN D N   1 
ATOM   5298  C CA  . ASN D 1 56  ? 80.417  104.994 97.050  1.00 46.77 ? 74  ASN D CA  1 
ATOM   5299  C C   . ASN D 1 56  ? 80.697  106.349 97.691  1.00 47.61 ? 74  ASN D C   1 
ATOM   5300  O O   . ASN D 1 56  ? 81.317  106.433 98.754  1.00 46.08 ? 74  ASN D O   1 
ATOM   5301  C CB  . ASN D 1 56  ? 81.496  104.647 96.020  1.00 47.12 ? 74  ASN D CB  1 
ATOM   5302  C CG  . ASN D 1 56  ? 81.372  103.218 95.507  1.00 49.44 ? 74  ASN D CG  1 
ATOM   5303  O OD1 . ASN D 1 56  ? 81.220  102.984 94.301  1.00 51.76 ? 74  ASN D OD1 1 
ATOM   5304  N ND2 . ASN D 1 56  ? 81.405  102.253 96.426  1.00 48.78 ? 74  ASN D ND2 1 
ATOM   5305  N N   . VAL D 1 57  ? 80.211  107.408 97.056  1.00 49.01 ? 75  VAL D N   1 
ATOM   5306  C CA  . VAL D 1 57  ? 80.405  108.756 97.572  1.00 54.49 ? 75  VAL D CA  1 
ATOM   5307  C C   . VAL D 1 57  ? 79.084  109.317 98.088  1.00 58.72 ? 75  VAL D C   1 
ATOM   5308  O O   . VAL D 1 57  ? 78.027  109.003 97.549  1.00 60.22 ? 75  VAL D O   1 
ATOM   5309  C CB  . VAL D 1 57  ? 80.961  109.706 96.473  0.00 53.44 ? 75  VAL D CB  1 
ATOM   5310  C CG1 . VAL D 1 57  ? 81.323  111.062 97.068  0.00 54.54 ? 75  VAL D CG1 1 
ATOM   5311  C CG2 . VAL D 1 57  ? 82.174  109.085 95.793  0.00 54.57 ? 75  VAL D CG2 1 
ATOM   5312  N N   . VAL D 1 58  ? 79.145  110.143 99.132  1.00 64.02 ? 76  VAL D N   1 
ATOM   5313  C CA  . VAL D 1 58  ? 77.937  110.771 99.704  1.00 63.39 ? 76  VAL D CA  1 
ATOM   5314  C C   . VAL D 1 58  ? 77.393  111.873 98.768  1.00 55.11 ? 76  VAL D C   1 
ATOM   5315  O O   . VAL D 1 58  ? 77.692  113.066 98.941  1.00 54.41 ? 76  VAL D O   1 
ATOM   5316  C CB  . VAL D 1 58  ? 78.193  111.373 101.144 1.00 68.28 ? 76  VAL D CB  1 
ATOM   5317  C CG1 . VAL D 1 58  ? 76.918  112.023 101.688 1.00 68.76 ? 76  VAL D CG1 1 
ATOM   5318  C CG2 . VAL D 1 58  ? 78.678  110.281 102.112 1.00 69.16 ? 76  VAL D CG2 1 
ATOM   5319  N N   . GLU D 1 59  ? 76.600  111.463 97.784  0.00 44.25 ? 77  GLU D N   1 
ATOM   5320  C CA  . GLU D 1 59  ? 76.022  112.397 96.826  0.00 36.61 ? 77  GLU D CA  1 
ATOM   5321  C C   . GLU D 1 59  ? 74.769  113.068 97.379  0.00 33.53 ? 77  GLU D C   1 
ATOM   5322  O O   . GLU D 1 59  ? 73.657  112.840 96.896  0.00 34.76 ? 77  GLU D O   1 
ATOM   5323  C CB  . GLU D 1 59  ? 75.712  111.688 95.505  0.00 35.86 ? 77  GLU D CB  1 
ATOM   5324  C CG  . GLU D 1 59  ? 76.941  111.187 94.762  0.00 28.79 ? 77  GLU D CG  1 
ATOM   5325  C CD  . GLU D 1 59  ? 77.875  112.308 94.346  0.00 22.99 ? 77  GLU D CD  1 
ATOM   5326  O OE1 . GLU D 1 59  ? 77.587  112.980 93.333  0.00 20.32 ? 77  GLU D OE1 1 
ATOM   5327  O OE2 . GLU D 1 59  ? 78.899  112.516 95.031  0.00 20.16 ? 77  GLU D OE2 1 
ATOM   5328  N N   . GLY D 1 60  ? 74.963  113.897 98.400  0.00 30.26 ? 78  GLY D N   1 
ATOM   5329  C CA  . GLY D 1 60  ? 73.856  114.606 99.013  0.00 24.30 ? 78  GLY D CA  1 
ATOM   5330  C C   . GLY D 1 60  ? 72.916  113.698 99.780  0.00 20.34 ? 78  GLY D C   1 
ATOM   5331  O O   . GLY D 1 60  ? 72.995  113.603 101.005 0.00 18.92 ? 78  GLY D O   1 
ATOM   5332  N N   . ASN D 1 61  ? 72.025  113.028 99.057  0.00 18.08 ? 79  ASN D N   1 
ATOM   5333  C CA  . ASN D 1 61  ? 71.059  112.126 99.671  0.00 16.80 ? 79  ASN D CA  1 
ATOM   5334  C C   . ASN D 1 61  ? 71.757  110.848 100.110 0.00 16.34 ? 79  ASN D C   1 
ATOM   5335  O O   . ASN D 1 61  ? 72.273  110.094 99.283  0.00 16.19 ? 79  ASN D O   1 
ATOM   5336  C CB  . ASN D 1 61  ? 69.934  111.795 98.687  0.00 16.47 ? 79  ASN D CB  1 
ATOM   5337  C CG  . ASN D 1 61  ? 69.241  113.031 98.156  0.00 16.18 ? 79  ASN D CG  1 
ATOM   5338  O OD1 . ASN D 1 61  ? 68.557  113.740 98.895  0.00 16.08 ? 79  ASN D OD1 1 
ATOM   5339  N ND2 . ASN D 1 61  ? 69.396  113.288 96.865  0.00 16.14 ? 79  ASN D ND2 1 
ATOM   5340  N N   . GLU D 1 62  ? 71.804  110.628 101.418 0.00 16.10 ? 80  GLU D N   1 
ATOM   5341  C CA  . GLU D 1 62  ? 72.442  109.444 101.971 0.00 15.96 ? 80  GLU D CA  1 
ATOM   5342  C C   . GLU D 1 62  ? 71.587  108.921 103.114 0.00 15.62 ? 80  GLU D C   1 
ATOM   5343  O O   . GLU D 1 62  ? 71.436  109.585 104.140 0.00 15.92 ? 80  GLU D O   1 
ATOM   5344  C CB  . GLU D 1 62  ? 73.843  109.791 102.482 0.00 16.03 ? 80  GLU D CB  1 
ATOM   5345  C CG  . GLU D 1 62  ? 74.916  108.787 102.088 0.00 16.12 ? 80  GLU D CG  1 
ATOM   5346  C CD  . GLU D 1 62  ? 75.100  108.678 100.585 0.00 16.13 ? 80  GLU D CD  1 
ATOM   5347  O OE1 . GLU D 1 62  ? 74.983  109.712 99.893  0.00 16.15 ? 80  GLU D OE1 1 
ATOM   5348  O OE2 . GLU D 1 62  ? 75.368  107.560 100.097 0.00 16.15 ? 80  GLU D OE2 1 
ATOM   5349  N N   . GLN D 1 63  ? 70.997  107.747 102.920 0.00 15.05 ? 81  GLN D N   1 
ATOM   5350  C CA  . GLN D 1 63  ? 70.146  107.156 103.943 0.00 14.67 ? 81  GLN D CA  1 
ATOM   5351  C C   . GLN D 1 63  ? 70.370  105.664 104.106 0.00 14.07 ? 81  GLN D C   1 
ATOM   5352  O O   . GLN D 1 63  ? 69.914  104.869 103.283 0.00 13.57 ? 81  GLN D O   1 
ATOM   5353  C CB  . GLN D 1 63  ? 68.670  107.405 103.622 0.00 15.35 ? 81  GLN D CB  1 
ATOM   5354  C CG  . GLN D 1 63  ? 68.249  108.861 103.664 0.00 15.87 ? 81  GLN D CG  1 
ATOM   5355  C CD  . GLN D 1 63  ? 66.787  109.052 103.319 0.00 15.92 ? 81  GLN D CD  1 
ATOM   5356  O OE1 . GLN D 1 63  ? 65.927  108.284 103.751 0.00 15.94 ? 81  GLN D OE1 1 
ATOM   5357  N NE2 . GLN D 1 63  ? 66.495  110.082 102.540 0.00 15.99 ? 81  GLN D NE2 1 
ATOM   5358  N N   . PHE D 1 64  ? 71.114  105.294 105.140 1.00 11.69 ? 82  PHE D N   1 
ATOM   5359  C CA  . PHE D 1 64  ? 71.365  103.888 105.432 1.00 14.40 ? 82  PHE D CA  1 
ATOM   5360  C C   . PHE D 1 64  ? 70.397  103.471 106.574 1.00 15.68 ? 82  PHE D C   1 
ATOM   5361  O O   . PHE D 1 64  ? 70.551  103.908 107.723 1.00 18.92 ? 82  PHE D O   1 
ATOM   5362  C CB  . PHE D 1 64  ? 72.827  103.659 105.881 1.00 16.79 ? 82  PHE D CB  1 
ATOM   5363  C CG  . PHE D 1 64  ? 73.867  104.029 104.852 0.00 17.26 ? 82  PHE D CG  1 
ATOM   5364  C CD1 . PHE D 1 64  ? 73.891  105.297 104.284 0.00 18.02 ? 82  PHE D CD1 1 
ATOM   5365  C CD2 . PHE D 1 64  ? 74.855  103.116 104.487 0.00 18.05 ? 82  PHE D CD2 1 
ATOM   5366  C CE1 . PHE D 1 64  ? 74.879  105.654 103.371 0.00 18.80 ? 82  PHE D CE1 1 
ATOM   5367  C CE2 . PHE D 1 64  ? 75.850  103.465 103.574 0.00 18.64 ? 82  PHE D CE2 1 
ATOM   5368  C CZ  . PHE D 1 64  ? 75.861  104.738 103.016 0.00 19.08 ? 82  PHE D CZ  1 
ATOM   5369  N N   . ILE D 1 65  ? 69.400  102.643 106.265 1.00 12.03 ? 83  ILE D N   1 
ATOM   5370  C CA  . ILE D 1 65  ? 68.429  102.194 107.262 1.00 5.00  ? 83  ILE D CA  1 
ATOM   5371  C C   . ILE D 1 65  ? 68.428  100.678 107.380 1.00 6.43  ? 83  ILE D C   1 
ATOM   5372  O O   . ILE D 1 65  ? 68.370  99.975  106.375 1.00 8.56  ? 83  ILE D O   1 
ATOM   5373  C CB  . ILE D 1 65  ? 67.022  102.598 106.850 1.00 6.53  ? 83  ILE D CB  1 
ATOM   5374  C CG1 . ILE D 1 65  ? 66.954  104.106 106.600 1.00 7.21  ? 83  ILE D CG1 1 
ATOM   5375  C CG2 . ILE D 1 65  ? 66.029  102.154 107.899 1.00 6.61  ? 83  ILE D CG2 1 
ATOM   5376  C CD1 . ILE D 1 65  ? 65.601  104.594 106.092 1.00 8.05  ? 83  ILE D CD1 1 
ATOM   5377  N N   . SER D 1 66  ? 68.454  100.168 108.602 1.00 7.68  ? 84  SER D N   1 
ATOM   5378  C CA  . SER D 1 66  ? 68.434  98.716  108.820 1.00 7.94  ? 84  SER D CA  1 
ATOM   5379  C C   . SER D 1 66  ? 67.041  98.137  108.529 1.00 6.49  ? 84  SER D C   1 
ATOM   5380  O O   . SER D 1 66  ? 66.037  98.825  108.671 1.00 9.99  ? 84  SER D O   1 
ATOM   5381  C CB  . SER D 1 66  ? 68.798  98.431  110.269 1.00 7.62  ? 84  SER D CB  1 
ATOM   5382  O OG  . SER D 1 66  ? 69.646  99.447  110.776 0.00 7.49  ? 84  SER D OG  1 
ATOM   5383  N N   . ALA D 1 67  ? 66.960  96.879  108.140 1.00 5.00  ? 85  ALA D N   1 
ATOM   5384  C CA  . ALA D 1 67  ? 65.663  96.292  107.862 1.00 6.72  ? 85  ALA D CA  1 
ATOM   5385  C C   . ALA D 1 67  ? 65.086  95.543  109.076 1.00 11.42 ? 85  ALA D C   1 
ATOM   5386  O O   . ALA D 1 67  ? 65.740  94.628  109.588 1.00 13.15 ? 85  ALA D O   1 
ATOM   5387  C CB  . ALA D 1 67  ? 65.779  95.373  106.701 1.00 5.00  ? 85  ALA D CB  1 
ATOM   5388  N N   . SER D 1 68  ? 63.878  95.923  109.528 1.00 12.24 ? 86  SER D N   1 
ATOM   5389  C CA  . SER D 1 68  ? 63.212  95.289  110.684 1.00 9.33  ? 86  SER D CA  1 
ATOM   5390  C C   . SER D 1 68  ? 62.746  93.894  110.330 1.00 10.56 ? 86  SER D C   1 
ATOM   5391  O O   . SER D 1 68  ? 63.261  92.928  110.851 1.00 15.05 ? 86  SER D O   1 
ATOM   5392  C CB  . SER D 1 68  ? 62.019  96.109  111.151 1.00 6.23  ? 86  SER D CB  1 
ATOM   5393  O OG  . SER D 1 68  ? 61.557  95.678  112.418 0.00 6.93  ? 86  SER D OG  1 
ATOM   5394  N N   . LYS D 1 69  ? 61.765  93.779  109.447 1.00 10.88 ? 87  LYS D N   1 
ATOM   5395  C CA  . LYS D 1 69  ? 61.275  92.466  109.016 1.00 8.77  ? 87  LYS D CA  1 
ATOM   5396  C C   . LYS D 1 69  ? 61.643  92.279  107.532 1.00 10.70 ? 87  LYS D C   1 
ATOM   5397  O O   . LYS D 1 69  ? 61.429  93.194  106.720 1.00 13.92 ? 87  LYS D O   1 
ATOM   5398  C CB  . LYS D 1 69  ? 59.733  92.369  109.131 1.00 5.88  ? 87  LYS D CB  1 
ATOM   5399  C CG  . LYS D 1 69  ? 59.134  92.386  110.518 1.00 5.00  ? 87  LYS D CG  1 
ATOM   5400  C CD  . LYS D 1 69  ? 59.182  93.770  111.138 0.00 6.65  ? 87  LYS D CD  1 
ATOM   5401  C CE  . LYS D 1 69  ? 58.523  93.787  112.508 0.00 7.50  ? 87  LYS D CE  1 
ATOM   5402  N NZ  . LYS D 1 69  ? 57.080  93.427  112.433 0.00 8.02  ? 87  LYS D NZ  1 
ATOM   5403  N N   . SER D 1 70  ? 62.249  91.151  107.178 1.00 8.39  ? 88  SER D N   1 
ATOM   5404  C CA  . SER D 1 70  ? 62.551  90.873  105.778 1.00 8.77  ? 88  SER D CA  1 
ATOM   5405  C C   . SER D 1 70  ? 61.634  89.682  105.449 1.00 10.18 ? 88  SER D C   1 
ATOM   5406  O O   . SER D 1 70  ? 61.960  88.523  105.759 1.00 11.47 ? 88  SER D O   1 
ATOM   5407  C CB  . SER D 1 70  ? 64.035  90.538  105.595 1.00 5.67  ? 88  SER D CB  1 
ATOM   5408  O OG  . SER D 1 70  ? 64.854  91.638  105.957 0.00 5.94  ? 88  SER D OG  1 
ATOM   5409  N N   . ILE D 1 71  ? 60.468  89.980  104.868 1.00 8.24  ? 89  ILE D N   1 
ATOM   5410  C CA  . ILE D 1 71  ? 59.465  88.957  104.562 1.00 8.67  ? 89  ILE D CA  1 
ATOM   5411  C C   . ILE D 1 71  ? 59.483  88.461  103.124 1.00 9.73  ? 89  ILE D C   1 
ATOM   5412  O O   . ILE D 1 71  ? 59.092  89.174  102.214 1.00 7.64  ? 89  ILE D O   1 
ATOM   5413  C CB  . ILE D 1 71  ? 58.042  89.465  104.916 1.00 6.39  ? 89  ILE D CB  1 
ATOM   5414  C CG1 . ILE D 1 71  ? 57.958  89.820  106.404 1.00 5.00  ? 89  ILE D CG1 1 
ATOM   5415  C CG2 . ILE D 1 71  ? 57.002  88.435  104.530 1.00 5.12  ? 89  ILE D CG2 1 
ATOM   5416  C CD1 . ILE D 1 71  ? 56.920  90.821  106.716 1.00 5.00  ? 89  ILE D CD1 1 
ATOM   5417  N N   . VAL D 1 72  ? 59.929  87.220  102.949 1.00 12.49 ? 90  VAL D N   1 
ATOM   5418  C CA  . VAL D 1 72  ? 60.026  86.558  101.638 1.00 10.83 ? 90  VAL D CA  1 
ATOM   5419  C C   . VAL D 1 72  ? 58.664  85.931  101.290 1.00 12.16 ? 90  VAL D C   1 
ATOM   5420  O O   . VAL D 1 72  ? 57.901  85.591  102.192 1.00 15.96 ? 90  VAL D O   1 
ATOM   5421  C CB  . VAL D 1 72  ? 61.120  85.456  101.695 1.00 6.81  ? 90  VAL D CB  1 
ATOM   5422  C CG1 . VAL D 1 72  ? 61.036  84.537  100.502 1.00 5.00  ? 90  VAL D CG1 1 
ATOM   5423  C CG2 . VAL D 1 72  ? 62.483  86.099  101.777 1.00 5.00  ? 90  VAL D CG2 1 
ATOM   5424  N N   . HIS D 1 73  ? 58.333  85.814  100.003 1.00 9.78  ? 91  HIS D N   1 
ATOM   5425  C CA  . HIS D 1 73  ? 57.057  85.220  99.607  1.00 5.00  ? 91  HIS D CA  1 
ATOM   5426  C C   . HIS D 1 73  ? 57.034  83.750  99.918  1.00 5.00  ? 91  HIS D C   1 
ATOM   5427  O O   . HIS D 1 73  ? 57.828  83.005  99.370  1.00 6.00  ? 91  HIS D O   1 
ATOM   5428  C CB  . HIS D 1 73  ? 56.802  85.404  98.132  1.00 6.75  ? 91  HIS D CB  1 
ATOM   5429  C CG  . HIS D 1 73  ? 55.432  84.988  97.713  1.00 8.06  ? 91  HIS D CG  1 
ATOM   5430  N ND1 . HIS D 1 73  ? 55.088  83.667  97.509  1.00 7.28  ? 91  HIS D ND1 1 
ATOM   5431  C CD2 . HIS D 1 73  ? 54.323  85.718  97.441  1.00 5.00  ? 91  HIS D CD2 1 
ATOM   5432  C CE1 . HIS D 1 73  ? 53.828  83.606  97.120  1.00 6.32  ? 91  HIS D CE1 1 
ATOM   5433  N NE2 . HIS D 1 73  ? 53.341  84.834  97.070  1.00 5.00  ? 91  HIS D NE2 1 
ATOM   5434  N N   . PRO D 1 74  ? 56.003  83.290  100.657 1.00 9.42  ? 92  PRO D N   1 
ATOM   5435  C CA  . PRO D 1 74  ? 55.742  81.924  101.120 1.00 11.30 ? 92  PRO D CA  1 
ATOM   5436  C C   . PRO D 1 74  ? 55.679  80.804  100.100 1.00 16.76 ? 92  PRO D C   1 
ATOM   5437  O O   . PRO D 1 74  ? 55.413  79.666  100.469 1.00 18.23 ? 92  PRO D O   1 
ATOM   5438  C CB  . PRO D 1 74  ? 54.424  82.065  101.828 1.00 7.58  ? 92  PRO D CB  1 
ATOM   5439  C CG  . PRO D 1 74  ? 53.763  83.069  100.998 1.00 7.31  ? 92  PRO D CG  1 
ATOM   5440  C CD  . PRO D 1 74  ? 54.816  84.112  100.923 1.00 8.20  ? 92  PRO D CD  1 
ATOM   5441  N N   . SER D 1 75  ? 55.938  81.104  98.833  1.00 20.19 ? 93  SER D N   1 
ATOM   5442  C CA  . SER D 1 75  ? 55.911  80.063  97.813  1.00 21.18 ? 93  SER D CA  1 
ATOM   5443  C C   . SER D 1 75  ? 57.050  80.224  96.840  1.00 21.01 ? 93  SER D C   1 
ATOM   5444  O O   . SER D 1 75  ? 57.071  79.554  95.800  1.00 20.63 ? 93  SER D O   1 
ATOM   5445  C CB  . SER D 1 75  ? 54.593  80.080  97.050  1.00 22.06 ? 93  SER D CB  1 
ATOM   5446  O OG  . SER D 1 75  ? 53.494  79.945  97.930  1.00 22.63 ? 93  SER D OG  1 
ATOM   5447  N N   . TYR D 1 76  ? 57.959  81.151  97.150  1.00 18.80 ? 94  TYR D N   1 
ATOM   5448  C CA  . TYR D 1 76  ? 59.120  81.402  96.310  1.00 15.22 ? 94  TYR D CA  1 
ATOM   5449  C C   . TYR D 1 76  ? 59.867  80.085  96.223  1.00 17.50 ? 94  TYR D C   1 
ATOM   5450  O O   . TYR D 1 76  ? 60.085  79.439  97.246  1.00 21.01 ? 94  TYR D O   1 
ATOM   5451  C CB  . TYR D 1 76  ? 60.012  82.448  96.967  1.00 13.48 ? 94  TYR D CB  1 
ATOM   5452  C CG  . TYR D 1 76  ? 61.469  82.341  96.588  1.00 13.30 ? 94  TYR D CG  1 
ATOM   5453  C CD1 . TYR D 1 76  ? 62.450  82.087  97.555  1.00 12.27 ? 94  TYR D CD1 1 
ATOM   5454  C CD2 . TYR D 1 76  ? 61.871  82.449  95.260  1.00 13.62 ? 94  TYR D CD2 1 
ATOM   5455  C CE1 . TYR D 1 76  ? 63.787  81.943  97.199  1.00 10.78 ? 94  TYR D CE1 1 
ATOM   5456  C CE2 . TYR D 1 76  ? 63.210  82.298  94.898  1.00 11.83 ? 94  TYR D CE2 1 
ATOM   5457  C CZ  . TYR D 1 76  ? 64.155  82.049  95.869  1.00 11.17 ? 94  TYR D CZ  1 
ATOM   5458  O OH  . TYR D 1 76  ? 65.473  81.921  95.499  1.00 13.17 ? 94  TYR D OH  1 
ATOM   5459  N N   . ASN D 1 77  ? 60.182  79.649  95.006  1.00 18.40 ? 95  ASN D N   1 
ATOM   5460  C CA  . ASN D 1 77  ? 60.926  78.407  94.828  1.00 20.10 ? 95  ASN D CA  1 
ATOM   5461  C C   . ASN D 1 77  ? 62.358  78.759  94.437  1.00 21.78 ? 95  ASN D C   1 
ATOM   5462  O O   . ASN D 1 77  ? 62.596  79.275  93.349  1.00 20.72 ? 95  ASN D O   1 
ATOM   5463  C CB  . ASN D 1 77  ? 60.287  77.533  93.755  1.00 19.09 ? 95  ASN D CB  1 
ATOM   5464  C CG  . ASN D 1 77  ? 60.920  76.160  93.671  0.00 20.02 ? 95  ASN D CG  1 
ATOM   5465  O OD1 . ASN D 1 77  ? 61.961  75.989  93.045  0.00 19.49 ? 95  ASN D OD1 1 
ATOM   5466  N ND2 . ASN D 1 77  ? 60.294  75.173  94.298  0.00 19.42 ? 95  ASN D ND2 1 
ATOM   5467  N N   . SER D 1 78  ? 63.302  78.504  95.335  1.00 22.32 ? 96  SER D N   1 
ATOM   5468  C CA  . SER D 1 78  ? 64.694  78.814  95.074  1.00 21.87 ? 96  SER D CA  1 
ATOM   5469  C C   . SER D 1 78  ? 65.228  78.160  93.817  1.00 22.88 ? 96  SER D C   1 
ATOM   5470  O O   . SER D 1 78  ? 66.245  78.591  93.287  1.00 26.67 ? 96  SER D O   1 
ATOM   5471  C CB  . SER D 1 78  ? 65.568  78.436  96.268  1.00 20.80 ? 96  SER D CB  1 
ATOM   5472  O OG  . SER D 1 78  ? 65.270  77.130  96.717  1.00 22.33 ? 96  SER D OG  1 
ATOM   5473  N N   . ASN D 1 79  ? 64.572  77.117  93.338  1.00 21.65 ? 97  ASN D N   1 
ATOM   5474  C CA  . ASN D 1 79  ? 65.061  76.487  92.134  1.00 25.04 ? 97  ASN D CA  1 
ATOM   5475  C C   . ASN D 1 79  ? 64.515  77.164  90.893  1.00 24.81 ? 97  ASN D C   1 
ATOM   5476  O O   . ASN D 1 79  ? 65.271  77.756  90.133  1.00 28.91 ? 97  ASN D O   1 
ATOM   5477  C CB  . ASN D 1 79  ? 64.736  75.003  92.123  1.00 32.27 ? 97  ASN D CB  1 
ATOM   5478  C CG  . ASN D 1 79  ? 65.481  74.244  93.190  1.00 38.19 ? 97  ASN D CG  1 
ATOM   5479  O OD1 . ASN D 1 79  ? 65.735  74.758  94.284  1.00 37.76 ? 97  ASN D OD1 1 
ATOM   5480  N ND2 . ASN D 1 79  ? 65.837  73.009  92.881  1.00 42.58 ? 97  ASN D ND2 1 
ATOM   5481  N N   . THR D 1 80  ? 63.197  77.138  90.726  1.00 22.16 ? 98  THR D N   1 
ATOM   5482  C CA  . THR D 1 80  ? 62.551  77.719  89.550  1.00 18.22 ? 98  THR D CA  1 
ATOM   5483  C C   . THR D 1 80  ? 62.525  79.228  89.554  1.00 12.94 ? 98  THR D C   1 
ATOM   5484  O O   . THR D 1 80  ? 62.283  79.857  88.535  1.00 11.11 ? 98  THR D O   1 
ATOM   5485  C CB  . THR D 1 80  ? 61.110  77.279  89.459  1.00 20.91 ? 98  THR D CB  1 
ATOM   5486  O OG1 . THR D 1 80  ? 60.389  77.862  90.549  1.00 29.96 ? 98  THR D OG1 1 
ATOM   5487  C CG2 . THR D 1 80  ? 61.004  75.785  89.569  1.00 22.72 ? 98  THR D CG2 1 
ATOM   5488  N N   . LEU D 1 81  ? 62.760  79.809  90.713  1.00 11.78 ? 99  LEU D N   1 
ATOM   5489  C CA  . LEU D 1 81  ? 62.711  81.254  90.865  1.00 12.30 ? 99  LEU D CA  1 
ATOM   5490  C C   . LEU D 1 81  ? 61.280  81.717  90.557  1.00 13.63 ? 99  LEU D C   1 
ATOM   5491  O O   . LEU D 1 81  ? 61.059  82.747  89.902  1.00 14.66 ? 99  LEU D O   1 
ATOM   5492  C CB  . LEU D 1 81  ? 63.746  81.984  89.982  1.00 10.85 ? 99  LEU D CB  1 
ATOM   5493  C CG  . LEU D 1 81  ? 65.224  81.693  90.290  1.00 11.31 ? 99  LEU D CG  1 
ATOM   5494  C CD1 . LEU D 1 81  ? 66.095  82.612  89.459  1.00 9.34  ? 99  LEU D CD1 1 
ATOM   5495  C CD2 . LEU D 1 81  ? 65.531  81.859  91.784  1.00 8.75  ? 99  LEU D CD2 1 
ATOM   5496  N N   . ASN D 1 82  ? 60.306  80.908  90.975  1.00 12.73 ? 100 ASN D N   1 
ATOM   5497  C CA  . ASN D 1 82  ? 58.910  81.273  90.791  1.00 10.69 ? 100 ASN D CA  1 
ATOM   5498  C C   . ASN D 1 82  ? 58.507  81.974  92.063  1.00 10.31 ? 100 ASN D C   1 
ATOM   5499  O O   . ASN D 1 82  ? 58.837  81.520  93.161  1.00 10.54 ? 100 ASN D O   1 
ATOM   5500  C CB  . ASN D 1 82  ? 58.032  80.056  90.593  1.00 9.82  ? 100 ASN D CB  1 
ATOM   5501  C CG  . ASN D 1 82  ? 56.642  80.424  90.152  1.00 12.12 ? 100 ASN D CG  1 
ATOM   5502  O OD1 . ASN D 1 82  ? 56.394  81.514  89.633  1.00 10.83 ? 100 ASN D OD1 1 
ATOM   5503  N ND2 . ASN D 1 82  ? 55.718  79.509  90.339  1.00 19.68 ? 100 ASN D ND2 1 
ATOM   5504  N N   . ASN D 1 83  ? 57.797  83.079  91.918  1.00 10.73 ? 101 ASN D N   1 
ATOM   5505  C CA  . ASN D 1 83  ? 57.376  83.864  93.060  1.00 11.95 ? 101 ASN D CA  1 
ATOM   5506  C C   . ASN D 1 83  ? 58.591  84.514  93.662  1.00 15.50 ? 101 ASN D C   1 
ATOM   5507  O O   . ASN D 1 83  ? 58.776  84.485  94.881  1.00 15.14 ? 101 ASN D O   1 
ATOM   5508  C CB  . ASN D 1 83  ? 56.722  83.016  94.128  1.00 10.86 ? 101 ASN D CB  1 
ATOM   5509  C CG  . ASN D 1 83  ? 55.477  82.378  93.656  1.00 11.60 ? 101 ASN D CG  1 
ATOM   5510  O OD1 . ASN D 1 83  ? 54.478  83.042  93.356  1.00 10.94 ? 101 ASN D OD1 1 
ATOM   5511  N ND2 . ASN D 1 83  ? 55.504  81.069  93.603  1.00 13.07 ? 101 ASN D ND2 1 
ATOM   5512  N N   . ASP D 1 84  ? 59.454  85.053  92.799  1.00 17.61 ? 102 ASP D N   1 
ATOM   5513  C CA  . ASP D 1 84  ? 60.650  85.757  93.255  1.00 15.39 ? 102 ASP D CA  1 
ATOM   5514  C C   . ASP D 1 84  ? 60.209  87.156  93.714  1.00 11.62 ? 102 ASP D C   1 
ATOM   5515  O O   . ASP D 1 84  ? 60.235  88.085  92.925  1.00 11.17 ? 102 ASP D O   1 
ATOM   5516  C CB  . ASP D 1 84  ? 61.681  85.849  92.126  0.00 16.81 ? 102 ASP D CB  1 
ATOM   5517  C CG  . ASP D 1 84  ? 62.941  86.584  92.541  0.00 18.80 ? 102 ASP D CG  1 
ATOM   5518  O OD1 . ASP D 1 84  ? 63.520  86.239  93.591  0.00 20.21 ? 102 ASP D OD1 1 
ATOM   5519  O OD2 . ASP D 1 84  ? 63.349  87.514  91.817  0.00 20.31 ? 102 ASP D OD2 1 
ATOM   5520  N N   . ILE D 1 85  ? 59.676  87.258  94.937  1.00 9.43  ? 103 ILE D N   1 
ATOM   5521  C CA  . ILE D 1 85  ? 59.237  88.544  95.516  1.00 8.40  ? 103 ILE D CA  1 
ATOM   5522  C C   . ILE D 1 85  ? 59.413  88.546  97.047  1.00 7.22  ? 103 ILE D C   1 
ATOM   5523  O O   . ILE D 1 85  ? 59.118  87.553  97.730  1.00 6.34  ? 103 ILE D O   1 
ATOM   5524  C CB  . ILE D 1 85  ? 57.764  88.955  95.121  1.00 7.35  ? 103 ILE D CB  1 
ATOM   5525  C CG1 . ILE D 1 85  ? 57.536  90.415  95.469  1.00 5.00  ? 103 ILE D CG1 1 
ATOM   5526  C CG2 . ILE D 1 85  ? 56.721  88.156  95.886  1.00 8.64  ? 103 ILE D CG2 1 
ATOM   5527  C CD1 . ILE D 1 85  ? 56.346  90.954  94.842  1.00 5.00  ? 103 ILE D CD1 1 
ATOM   5528  N N   . MET D 1 86  ? 59.942  89.645  97.567  1.00 5.00  ? 104 MET D N   1 
ATOM   5529  C CA  . MET D 1 86  ? 60.197  89.769  98.985  1.00 5.00  ? 104 MET D CA  1 
ATOM   5530  C C   . MET D 1 86  ? 59.882  91.188  99.393  1.00 7.66  ? 104 MET D C   1 
ATOM   5531  O O   . MET D 1 86  ? 60.018  92.107  98.584  1.00 9.75  ? 104 MET D O   1 
ATOM   5532  C CB  . MET D 1 86  ? 61.661  89.476  99.258  1.00 6.03  ? 104 MET D CB  1 
ATOM   5533  C CG  . MET D 1 86  ? 62.133  89.794  100.658 1.00 10.55 ? 104 MET D CG  1 
ATOM   5534  S SD  . MET D 1 86  ? 63.946  89.581  100.862 1.00 14.22 ? 104 MET D SD  1 
ATOM   5535  C CE  . MET D 1 86  ? 64.551  90.923  99.810  1.00 12.28 ? 104 MET D CE  1 
ATOM   5536  N N   . LEU D 1 87  ? 59.392  91.355  100.619 1.00 7.04  ? 105 LEU D N   1 
ATOM   5537  C CA  . LEU D 1 87  ? 59.056  92.661  101.147 1.00 5.98  ? 105 LEU D CA  1 
ATOM   5538  C C   . LEU D 1 87  ? 59.962  92.912  102.324 1.00 5.55  ? 105 LEU D C   1 
ATOM   5539  O O   . LEU D 1 87  ? 60.196  92.011  103.147 1.00 5.00  ? 105 LEU D O   1 
ATOM   5540  C CB  . LEU D 1 87  ? 57.605  92.712  101.598 1.00 7.64  ? 105 LEU D CB  1 
ATOM   5541  C CG  . LEU D 1 87  ? 56.548  92.755  100.507 1.00 8.46  ? 105 LEU D CG  1 
ATOM   5542  C CD1 . LEU D 1 87  ? 55.195  92.752  101.182 1.00 10.15 ? 105 LEU D CD1 1 
ATOM   5543  C CD2 . LEU D 1 87  ? 56.707  94.007  99.644  1.00 8.62  ? 105 LEU D CD2 1 
ATOM   5544  N N   . ILE D 1 88  ? 60.480  94.136  102.374 1.00 5.00  ? 106 ILE D N   1 
ATOM   5545  C CA  . ILE D 1 88  ? 61.395  94.586  103.417 1.00 6.09  ? 106 ILE D CA  1 
ATOM   5546  C C   . ILE D 1 88  ? 60.790  95.745  104.182 1.00 6.04  ? 106 ILE D C   1 
ATOM   5547  O O   . ILE D 1 88  ? 60.301  96.695  103.571 1.00 6.34  ? 106 ILE D O   1 
ATOM   5548  C CB  . ILE D 1 88  ? 62.746  95.083  102.794 1.00 6.68  ? 106 ILE D CB  1 
ATOM   5549  C CG1 . ILE D 1 88  ? 63.530  93.900  102.198 1.00 10.23 ? 106 ILE D CG1 1 
ATOM   5550  C CG2 . ILE D 1 88  ? 63.601  95.762  103.833 1.00 5.00  ? 106 ILE D CG2 1 
ATOM   5551  C CD1 . ILE D 1 88  ? 64.687  94.290  101.279 1.00 9.03  ? 106 ILE D CD1 1 
ATOM   5552  N N   . LYS D 1 89  ? 60.779  95.651  105.508 1.00 5.00  ? 107 LYS D N   1 
ATOM   5553  C CA  . LYS D 1 89  ? 60.279  96.742  106.327 1.00 5.00  ? 107 LYS D CA  1 
ATOM   5554  C C   . LYS D 1 89  ? 61.482  97.411  106.986 1.00 5.19  ? 107 LYS D C   1 
ATOM   5555  O O   . LYS D 1 89  ? 62.263  96.757  107.676 1.00 5.00  ? 107 LYS D O   1 
ATOM   5556  C CB  . LYS D 1 89  ? 59.323  96.248  107.395 1.00 5.00  ? 107 LYS D CB  1 
ATOM   5557  C CG  . LYS D 1 89  ? 58.788  97.396  108.246 1.00 5.92  ? 107 LYS D CG  1 
ATOM   5558  C CD  . LYS D 1 89  ? 57.765  96.925  109.248 1.00 8.82  ? 107 LYS D CD  1 
ATOM   5559  C CE  . LYS D 1 89  ? 57.206  98.089  110.048 1.00 10.78 ? 107 LYS D CE  1 
ATOM   5560  N NZ  . LYS D 1 89  ? 56.164  97.670  111.064 1.00 13.28 ? 107 LYS D NZ  1 
ATOM   5561  N N   . LEU D 1 90  ? 61.624  98.712  106.770 1.00 5.00  ? 108 LEU D N   1 
ATOM   5562  C CA  . LEU D 1 90  ? 62.729  99.482  107.316 1.00 5.00  ? 108 LEU D CA  1 
ATOM   5563  C C   . LEU D 1 90  ? 62.523  99.744  108.799 1.00 5.00  ? 108 LEU D C   1 
ATOM   5564  O O   . LEU D 1 90  ? 61.431  100.135 109.229 1.00 5.00  ? 108 LEU D O   1 
ATOM   5565  C CB  . LEU D 1 90  ? 62.824  100.821 106.595 1.00 5.54  ? 108 LEU D CB  1 
ATOM   5566  C CG  . LEU D 1 90  ? 62.957  100.801 105.079 1.00 5.00  ? 108 LEU D CG  1 
ATOM   5567  C CD1 . LEU D 1 90  ? 62.884  102.184 104.490 1.00 5.00  ? 108 LEU D CD1 1 
ATOM   5568  C CD2 . LEU D 1 90  ? 64.257  100.153 104.752 1.00 5.39  ? 108 LEU D CD2 1 
ATOM   5569  N N   . LYS D 1 91  ? 63.588  99.554  109.566 1.00 5.00  ? 109 LYS D N   1 
ATOM   5570  C CA  . LYS D 1 91  ? 63.566  99.779  110.998 1.00 5.00  ? 109 LYS D CA  1 
ATOM   5571  C C   . LYS D 1 91  ? 62.905  101.103 111.264 1.00 8.12  ? 109 LYS D C   1 
ATOM   5572  O O   . LYS D 1 91  ? 62.097  101.201 112.152 1.00 11.10 ? 109 LYS D O   1 
ATOM   5573  C CB  . LYS D 1 91  ? 64.989  99.810  111.550 1.00 5.00  ? 109 LYS D CB  1 
ATOM   5574  C CG  . LYS D 1 91  ? 65.137  100.351 112.976 1.00 5.00  ? 109 LYS D CG  1 
ATOM   5575  C CD  . LYS D 1 91  ? 66.531  100.088 113.509 0.00 6.96  ? 109 LYS D CD  1 
ATOM   5576  C CE  . LYS D 1 91  ? 66.783  98.594  113.641 0.00 7.44  ? 109 LYS D CE  1 
ATOM   5577  N NZ  . LYS D 1 91  ? 68.185  98.291  114.023 0.00 7.66  ? 109 LYS D NZ  1 
ATOM   5578  N N   . SER D 1 92  ? 63.259  102.115 110.484 1.00 10.83 ? 110 SER D N   1 
ATOM   5579  C CA  . SER D 1 92  ? 62.707  103.459 110.619 1.00 13.14 ? 110 SER D CA  1 
ATOM   5580  C C   . SER D 1 92  ? 62.088  103.849 109.269 1.00 16.34 ? 110 SER D C   1 
ATOM   5581  O O   . SER D 1 92  ? 62.599  103.446 108.227 1.00 19.42 ? 110 SER D O   1 
ATOM   5582  C CB  . SER D 1 92  ? 63.835  104.435 110.962 1.00 11.76 ? 110 SER D CB  1 
ATOM   5583  O OG  . SER D 1 92  ? 64.552  104.014 112.109 0.00 10.53 ? 110 SER D OG  1 
ATOM   5584  N N   . ALA D 1 93  ? 61.016  104.640 109.267 1.00 16.42 ? 111 ALA D N   1 
ATOM   5585  C CA  . ALA D 1 93  ? 60.403  105.021 108.005 1.00 17.52 ? 111 ALA D CA  1 
ATOM   5586  C C   . ALA D 1 93  ? 61.297  106.001 107.265 1.00 24.22 ? 111 ALA D C   1 
ATOM   5587  O O   . ALA D 1 93  ? 61.867  106.911 107.871 1.00 24.77 ? 111 ALA D O   1 
ATOM   5588  C CB  . ALA D 1 93  ? 59.044  105.612 108.232 1.00 15.77 ? 111 ALA D CB  1 
ATOM   5589  N N   . ALA D 1 94  ? 61.461  105.758 105.964 1.00 29.54 ? 112 ALA D N   1 
ATOM   5590  C CA  . ALA D 1 94  ? 62.263  106.582 105.068 1.00 29.95 ? 112 ALA D CA  1 
ATOM   5591  C C   . ALA D 1 94  ? 61.575  107.924 104.880 1.00 33.76 ? 112 ALA D C   1 
ATOM   5592  O O   . ALA D 1 94  ? 60.343  108.023 104.866 1.00 34.89 ? 112 ALA D O   1 
ATOM   5593  C CB  . ALA D 1 94  ? 62.421  105.891 103.727 0.00 28.08 ? 112 ALA D CB  1 
ATOM   5594  N N   . SER D 1 95  ? 62.385  108.949 104.684 1.00 37.71 ? 113 SER D N   1 
ATOM   5595  C CA  . SER D 1 95  ? 61.914  110.310 104.500 1.00 40.23 ? 113 SER D CA  1 
ATOM   5596  C C   . SER D 1 95  ? 61.450  110.584 103.080 1.00 40.12 ? 113 SER D C   1 
ATOM   5597  O O   . SER D 1 95  ? 62.263  110.851 102.203 1.00 38.85 ? 113 SER D O   1 
ATOM   5598  C CB  . SER D 1 95  ? 63.070  111.218 104.802 1.00 44.38 ? 113 SER D CB  1 
ATOM   5599  O OG  . SER D 1 95  ? 64.192  110.739 104.082 1.00 48.54 ? 113 SER D OG  1 
ATOM   5600  N N   . LEU D 1 96  ? 60.151  110.518 102.842 1.00 41.31 ? 114 LEU D N   1 
ATOM   5601  C CA  . LEU D 1 96  ? 59.648  110.786 101.502 1.00 40.00 ? 114 LEU D CA  1 
ATOM   5602  C C   . LEU D 1 96  ? 59.798  112.266 101.182 1.00 35.62 ? 114 LEU D C   1 
ATOM   5603  O O   . LEU D 1 96  ? 59.851  113.096 102.088 1.00 35.99 ? 114 LEU D O   1 
ATOM   5604  C CB  . LEU D 1 96  ? 58.185  110.358 101.376 1.00 41.42 ? 114 LEU D CB  1 
ATOM   5605  C CG  . LEU D 1 96  ? 57.981  108.857 101.541 1.00 41.50 ? 114 LEU D CG  1 
ATOM   5606  C CD1 . LEU D 1 96  ? 56.527  108.502 101.370 1.00 43.88 ? 114 LEU D CD1 1 
ATOM   5607  C CD2 . LEU D 1 96  ? 58.824  108.137 100.512 1.00 44.07 ? 114 LEU D CD2 1 
ATOM   5608  N N   . ASN D 1 97  ? 59.941  112.574 99.900  0.00 30.61 ? 115 ASN D N   1 
ATOM   5609  C CA  . ASN D 1 97  ? 60.080  113.946 99.425  0.00 26.28 ? 115 ASN D CA  1 
ATOM   5610  C C   . ASN D 1 97  ? 60.421  113.933 97.941  0.00 24.49 ? 115 ASN D C   1 
ATOM   5611  O O   . ASN D 1 97  ? 60.215  112.929 97.258  0.00 24.23 ? 115 ASN D O   1 
ATOM   5612  C CB  . ASN D 1 97  ? 61.155  114.712 100.217 0.00 24.95 ? 115 ASN D CB  1 
ATOM   5613  C CG  . ASN D 1 97  ? 62.561  114.168 100.005 0.00 22.31 ? 115 ASN D CG  1 
ATOM   5614  O OD1 . ASN D 1 97  ? 62.752  113.058 99.516  0.00 21.19 ? 115 ASN D OD1 1 
ATOM   5615  N ND2 . ASN D 1 97  ? 63.556  114.965 100.363 0.00 21.07 ? 115 ASN D ND2 1 
ATOM   5616  N N   . SER D 1 98  ? 60.921  115.057 97.442  0.00 22.70 ? 116 SER D N   1 
ATOM   5617  C CA  . SER D 1 98  ? 61.297  115.179 96.041  0.00 20.55 ? 116 SER D CA  1 
ATOM   5618  C C   . SER D 1 98  ? 62.506  114.308 95.700  0.00 20.12 ? 116 SER D C   1 
ATOM   5619  O O   . SER D 1 98  ? 62.739  113.987 94.535  0.00 19.47 ? 116 SER D O   1 
ATOM   5620  C CB  . SER D 1 98  ? 61.592  116.643 95.715  0.00 19.04 ? 116 SER D CB  1 
ATOM   5621  O OG  . SER D 1 98  ? 62.330  117.251 96.763  0.00 18.18 ? 116 SER D OG  1 
ATOM   5622  N N   . ARG D 1 99  ? 63.277  113.945 96.721  0.00 20.31 ? 117 ARG D N   1 
ATOM   5623  C CA  . ARG D 1 99  ? 64.463  113.117 96.538  0.00 20.97 ? 117 ARG D CA  1 
ATOM   5624  C C   . ARG D 1 99  ? 64.095  111.636 96.575  0.00 22.72 ? 117 ARG D C   1 
ATOM   5625  O O   . ARG D 1 99  ? 64.149  110.961 95.552  0.00 22.75 ? 117 ARG D O   1 
ATOM   5626  C CB  . ARG D 1 99  ? 65.508  113.442 97.609  0.00 19.88 ? 117 ARG D CB  1 
ATOM   5627  C CG  . ARG D 1 99  ? 65.900  114.914 97.666  0.00 18.44 ? 117 ARG D CG  1 
ATOM   5628  C CD  . ARG D 1 99  ? 66.474  115.394 96.342  0.00 17.48 ? 117 ARG D CD  1 
ATOM   5629  N NE  . ARG D 1 99  ? 66.806  116.816 96.372  0.00 16.79 ? 117 ARG D NE  1 
ATOM   5630  C CZ  . ARG D 1 99  ? 67.272  117.501 95.332  0.00 16.74 ? 117 ARG D CZ  1 
ATOM   5631  N NH1 . ARG D 1 99  ? 67.466  116.901 94.164  0.00 16.40 ? 117 ARG D NH1 1 
ATOM   5632  N NH2 . ARG D 1 99  ? 67.546  118.792 95.459  0.00 16.50 ? 117 ARG D NH2 1 
ATOM   5633  N N   . VAL D 1 100 ? 63.735  111.132 97.753  1.00 25.17 ? 118 VAL D N   1 
ATOM   5634  C CA  . VAL D 1 100 ? 63.344  109.738 97.899  1.00 24.86 ? 118 VAL D CA  1 
ATOM   5635  C C   . VAL D 1 100 ? 61.830  109.767 97.789  1.00 25.96 ? 118 VAL D C   1 
ATOM   5636  O O   . VAL D 1 100 ? 61.176  110.482 98.543  1.00 29.14 ? 118 VAL D O   1 
ATOM   5637  C CB  . VAL D 1 100 ? 63.702  109.202 99.288  1.00 25.45 ? 118 VAL D CB  1 
ATOM   5638  C CG1 . VAL D 1 100 ? 63.578  107.713 99.311  1.00 26.02 ? 118 VAL D CG1 1 
ATOM   5639  C CG2 . VAL D 1 100 ? 65.090  109.635 99.684  1.00 27.68 ? 118 VAL D CG2 1 
ATOM   5640  N N   . ALA D 1 101 ? 61.270  109.044 96.827  1.00 25.14 ? 119 ALA D N   1 
ATOM   5641  C CA  . ALA D 1 101 ? 59.813  109.008 96.651  1.00 24.00 ? 119 ALA D CA  1 
ATOM   5642  C C   . ALA D 1 101 ? 59.402  107.580 96.356  1.00 22.17 ? 119 ALA D C   1 
ATOM   5643  O O   . ALA D 1 101 ? 60.179  106.820 95.798  1.00 25.24 ? 119 ALA D O   1 
ATOM   5644  C CB  . ALA D 1 101 ? 59.381  109.924 95.524  1.00 22.63 ? 119 ALA D CB  1 
ATOM   5645  N N   . SER D 1 102 ? 58.198  107.204 96.740  1.00 18.04 ? 120 SER D N   1 
ATOM   5646  C CA  . SER D 1 102 ? 57.755  105.848 96.515  1.00 17.04 ? 120 SER D CA  1 
ATOM   5647  C C   . SER D 1 102 ? 57.259  105.694 95.091  1.00 15.74 ? 120 SER D C   1 
ATOM   5648  O O   . SER D 1 102 ? 56.963  106.694 94.438  1.00 19.34 ? 120 SER D O   1 
ATOM   5649  C CB  . SER D 1 102 ? 56.641  105.525 97.502  1.00 21.95 ? 120 SER D CB  1 
ATOM   5650  O OG  . SER D 1 102 ? 55.587  106.470 97.404  1.00 28.41 ? 120 SER D OG  1 
ATOM   5651  N N   . ILE D 1 103 ? 57.255  104.458 94.592  1.00 11.02 ? 121 ILE D N   1 
ATOM   5652  C CA  . ILE D 1 103 ? 56.746  104.152 93.260  1.00 11.18 ? 121 ILE D CA  1 
ATOM   5653  C C   . ILE D 1 103 ? 55.387  103.492 93.484  1.00 15.93 ? 121 ILE D C   1 
ATOM   5654  O O   . ILE D 1 103 ? 55.220  102.783 94.473  1.00 21.22 ? 121 ILE D O   1 
ATOM   5655  C CB  . ILE D 1 103 ? 57.618  103.161 92.542  1.00 5.00  ? 121 ILE D CB  1 
ATOM   5656  C CG1 . ILE D 1 103 ? 56.984  102.779 91.209  1.00 7.75  ? 121 ILE D CG1 1 
ATOM   5657  C CG2 . ILE D 1 103 ? 57.792  101.939 93.380  1.00 5.00  ? 121 ILE D CG2 1 
ATOM   5658  C CD1 . ILE D 1 103 ? 56.741  103.960 90.302  1.00 8.16  ? 121 ILE D CD1 1 
ATOM   5659  N N   . SER D 1 104 ? 54.432  103.685 92.573  1.00 15.90 ? 122 SER D N   1 
ATOM   5660  C CA  . SER D 1 104 ? 53.090  103.115 92.725  1.00 14.67 ? 122 SER D CA  1 
ATOM   5661  C C   . SER D 1 104 ? 52.964  101.665 92.311  1.00 14.66 ? 122 SER D C   1 
ATOM   5662  O O   . SER D 1 104 ? 53.594  101.240 91.341  1.00 18.11 ? 122 SER D O   1 
ATOM   5663  C CB  . SER D 1 104 ? 52.082  103.917 91.907  1.00 15.34 ? 122 SER D CB  1 
ATOM   5664  O OG  . SER D 1 104 ? 52.164  105.296 92.204  1.00 19.43 ? 122 SER D OG  1 
ATOM   5665  N N   . LEU D 1 105 ? 52.159  100.902 93.051  1.00 13.40 ? 123 LEU D N   1 
ATOM   5666  C CA  . LEU D 1 105 ? 51.904  99.503  92.710  1.00 12.59 ? 123 LEU D CA  1 
ATOM   5667  C C   . LEU D 1 105 ? 50.898  99.518  91.551  1.00 15.90 ? 123 LEU D C   1 
ATOM   5668  O O   . LEU D 1 105 ? 50.082  100.446 91.425  1.00 21.86 ? 123 LEU D O   1 
ATOM   5669  C CB  . LEU D 1 105 ? 51.326  98.744  93.907  1.00 8.10  ? 123 LEU D CB  1 
ATOM   5670  C CG  . LEU D 1 105 ? 52.319  98.362  95.005  1.00 6.41  ? 123 LEU D CG  1 
ATOM   5671  C CD1 . LEU D 1 105 ? 51.618  97.637  96.107  1.00 5.00  ? 123 LEU D CD1 1 
ATOM   5672  C CD2 . LEU D 1 105 ? 53.430  97.491  94.444  1.00 5.00  ? 123 LEU D CD2 1 
ATOM   5673  N N   . PRO D 1 106 ? 50.946  98.510  90.675  1.00 15.79 ? 124 PRO D N   1 
ATOM   5674  C CA  . PRO D 1 106 ? 50.025  98.453  89.535  1.00 20.21 ? 124 PRO D CA  1 
ATOM   5675  C C   . PRO D 1 106 ? 48.626  97.995  89.907  1.00 25.79 ? 124 PRO D C   1 
ATOM   5676  O O   . PRO D 1 106 ? 48.437  97.360  90.942  1.00 25.03 ? 124 PRO D O   1 
ATOM   5677  C CB  . PRO D 1 106 ? 50.685  97.408  88.650  1.00 16.82 ? 124 PRO D CB  1 
ATOM   5678  C CG  . PRO D 1 106 ? 51.195  96.439  89.666  1.00 13.20 ? 124 PRO D CG  1 
ATOM   5679  C CD  . PRO D 1 106 ? 51.836  97.338  90.689  1.00 12.91 ? 124 PRO D CD  1 
ATOM   5680  N N   . THR D 1 107 ? 47.648  98.317  89.066  1.00 33.17 ? 125 THR D N   1 
ATOM   5681  C CA  . THR D 1 107 ? 46.285  97.846  89.305  1.00 38.20 ? 125 THR D CA  1 
ATOM   5682  C C   . THR D 1 107 ? 45.949  96.809  88.238  1.00 39.19 ? 125 THR D C   1 
ATOM   5683  O O   . THR D 1 107 ? 45.092  95.949  88.435  1.00 44.17 ? 125 THR D O   1 
ATOM   5684  C CB  . THR D 1 107 ? 45.229  98.961  89.271  1.00 37.51 ? 125 THR D CB  1 
ATOM   5685  O OG1 . THR D 1 107 ? 45.208  99.557  87.979  1.00 39.98 ? 125 THR D OG1 1 
ATOM   5686  C CG2 . THR D 1 107 ? 45.544  100.008 90.288  1.00 39.57 ? 125 THR D CG2 1 
ATOM   5687  N N   . SER D 1 108 ? 46.633  96.891  87.106  1.00 36.37 ? 127 SER D N   1 
ATOM   5688  C CA  . SER D 1 108 ? 46.411  95.957  86.023  1.00 37.96 ? 127 SER D CA  1 
ATOM   5689  C C   . SER D 1 108 ? 47.761  95.718  85.384  1.00 37.48 ? 127 SER D C   1 
ATOM   5690  O O   . SER D 1 108 ? 48.581  96.630  85.304  1.00 40.14 ? 127 SER D O   1 
ATOM   5691  C CB  . SER D 1 108 ? 45.450  96.557  85.005  1.00 43.10 ? 127 SER D CB  1 
ATOM   5692  O OG  . SER D 1 108 ? 44.320  97.112  85.648  1.00 47.81 ? 127 SER D OG  1 
ATOM   5693  N N   . CYS D 1 109 ? 48.001  94.486  84.959  1.00 33.85 ? 128 CYS D N   1 
ATOM   5694  C CA  . CYS D 1 109 ? 49.262  94.116  84.334  1.00 29.29 ? 128 CYS D CA  1 
ATOM   5695  C C   . CYS D 1 109 ? 49.503  94.817  82.993  1.00 29.86 ? 128 CYS D C   1 
ATOM   5696  O O   . CYS D 1 109 ? 48.558  95.039  82.214  1.00 31.78 ? 128 CYS D O   1 
ATOM   5697  C CB  . CYS D 1 109 ? 49.287  92.609  84.144  1.00 26.15 ? 128 CYS D CB  1 
ATOM   5698  S SG  . CYS D 1 109 ? 48.734  91.734  85.635  1.00 22.40 ? 128 CYS D SG  1 
ATOM   5699  N N   . ALA D 1 110 ? 50.769  95.143  82.726  1.00 27.15 ? 129 ALA D N   1 
ATOM   5700  C CA  . ALA D 1 110 ? 51.159  95.808  81.490  1.00 25.18 ? 129 ALA D CA  1 
ATOM   5701  C C   . ALA D 1 110 ? 51.038  94.837  80.320  1.00 24.88 ? 129 ALA D C   1 
ATOM   5702  O O   . ALA D 1 110 ? 51.422  93.672  80.431  1.00 22.51 ? 129 ALA D O   1 
ATOM   5703  C CB  . ALA D 1 110 ? 52.576  96.329  81.600  1.00 26.14 ? 129 ALA D CB  1 
ATOM   5704  N N   . SER D 1 111 ? 50.429  95.306  79.235  1.00 26.54 ? 130 SER D N   1 
ATOM   5705  C CA  . SER D 1 111 ? 50.260  94.504  78.031  1.00 26.35 ? 130 SER D CA  1 
ATOM   5706  C C   . SER D 1 111 ? 51.621  94.458  77.319  1.00 26.31 ? 130 SER D C   1 
ATOM   5707  O O   . SER D 1 111 ? 52.424  95.382  77.446  1.00 25.07 ? 130 SER D O   1 
ATOM   5708  C CB  . SER D 1 111 ? 49.195  95.131  77.122  0.00 25.25 ? 130 SER D CB  1 
ATOM   5709  O OG  . SER D 1 111 ? 47.941  95.208  77.782  0.00 25.12 ? 130 SER D OG  1 
ATOM   5710  N N   . ALA D 1 112 ? 51.913  93.362  76.628  1.00 26.18 ? 132 ALA D N   1 
ATOM   5711  C CA  . ALA D 1 112 ? 53.178  93.244  75.913  1.00 25.10 ? 132 ALA D CA  1 
ATOM   5712  C C   . ALA D 1 112 ? 53.276  94.417  74.956  1.00 27.54 ? 132 ALA D C   1 
ATOM   5713  O O   . ALA D 1 112 ? 52.278  94.857  74.376  1.00 31.92 ? 132 ALA D O   1 
ATOM   5714  C CB  . ALA D 1 112 ? 53.246  91.938  75.151  1.00 27.77 ? 132 ALA D CB  1 
ATOM   5715  N N   . GLY D 1 113 ? 54.479  94.934  74.799  1.00 27.25 ? 133 GLY D N   1 
ATOM   5716  C CA  . GLY D 1 113 ? 54.670  96.076  73.940  1.00 27.57 ? 133 GLY D CA  1 
ATOM   5717  C C   . GLY D 1 113 ? 54.886  97.327  74.773  1.00 26.78 ? 133 GLY D C   1 
ATOM   5718  O O   . GLY D 1 113 ? 55.502  98.278  74.290  1.00 29.71 ? 133 GLY D O   1 
ATOM   5719  N N   . THR D 1 114 ? 54.395  97.339  76.013  1.00 24.58 ? 134 THR D N   1 
ATOM   5720  C CA  . THR D 1 114 ? 54.562  98.497  76.901  1.00 24.05 ? 134 THR D CA  1 
ATOM   5721  C C   . THR D 1 114 ? 56.033  98.802  77.111  1.00 24.69 ? 134 THR D C   1 
ATOM   5722  O O   . THR D 1 114 ? 56.842  97.885  77.320  1.00 23.69 ? 134 THR D O   1 
ATOM   5723  C CB  . THR D 1 114 ? 53.974  98.261  78.313  1.00 22.21 ? 134 THR D CB  1 
ATOM   5724  O OG1 . THR D 1 114 ? 52.577  97.966  78.220  1.00 23.55 ? 134 THR D OG1 1 
ATOM   5725  C CG2 . THR D 1 114 ? 54.169  99.499  79.180  1.00 18.58 ? 134 THR D CG2 1 
ATOM   5726  N N   . GLN D 1 115 ? 56.373  100.087 77.069  1.00 24.74 ? 135 GLN D N   1 
ATOM   5727  C CA  . GLN D 1 115 ? 57.760  100.505 77.275  1.00 24.24 ? 135 GLN D CA  1 
ATOM   5728  C C   . GLN D 1 115 ? 57.974  100.827 78.762  1.00 21.46 ? 135 GLN D C   1 
ATOM   5729  O O   . GLN D 1 115 ? 57.225  101.608 79.354  1.00 21.43 ? 135 GLN D O   1 
ATOM   5730  C CB  . GLN D 1 115 ? 58.091  101.721 76.408  1.00 24.65 ? 135 GLN D CB  1 
ATOM   5731  C CG  . GLN D 1 115 ? 59.574  101.926 76.129  1.00 23.89 ? 135 GLN D CG  1 
ATOM   5732  C CD  . GLN D 1 115 ? 59.852  103.269 75.476  0.00 26.73 ? 135 GLN D CD  1 
ATOM   5733  O OE1 . GLN D 1 115 ? 60.446  104.152 76.090  0.00 27.85 ? 135 GLN D OE1 1 
ATOM   5734  N NE2 . GLN D 1 115 ? 59.419  103.432 74.232  0.00 27.86 ? 135 GLN D NE2 1 
ATOM   5735  N N   . CYS D 1 116 ? 58.991  100.210 79.354  1.00 18.28 ? 136 CYS D N   1 
ATOM   5736  C CA  . CYS D 1 116 ? 59.318  100.379 80.767  1.00 14.94 ? 136 CYS D CA  1 
ATOM   5737  C C   . CYS D 1 116 ? 60.749  100.848 81.020  1.00 12.67 ? 136 CYS D C   1 
ATOM   5738  O O   . CYS D 1 116 ? 61.584  100.839 80.123  1.00 13.13 ? 136 CYS D O   1 
ATOM   5739  C CB  . CYS D 1 116 ? 59.107  99.063  81.481  1.00 15.60 ? 136 CYS D CB  1 
ATOM   5740  S SG  . CYS D 1 116 ? 57.496  98.315  81.106  1.00 21.02 ? 136 CYS D SG  1 
ATOM   5741  N N   . LEU D 1 117 ? 61.021  101.238 82.258  1.00 10.59 ? 137 LEU D N   1 
ATOM   5742  C CA  . LEU D 1 117 ? 62.324  101.731 82.657  1.00 10.50 ? 137 LEU D CA  1 
ATOM   5743  C C   . LEU D 1 117 ? 62.874  100.829 83.729  1.00 13.04 ? 137 LEU D C   1 
ATOM   5744  O O   . LEU D 1 117 ? 62.309  100.759 84.835  1.00 15.14 ? 137 LEU D O   1 
ATOM   5745  C CB  . LEU D 1 117 ? 62.208  103.145 83.222  1.00 9.14  ? 137 LEU D CB  1 
ATOM   5746  C CG  . LEU D 1 117 ? 63.516  103.768 83.694  1.00 7.75  ? 137 LEU D CG  1 
ATOM   5747  C CD1 . LEU D 1 117 ? 64.551  103.737 82.530  1.00 9.39  ? 137 LEU D CD1 1 
ATOM   5748  C CD2 . LEU D 1 117 ? 63.234  105.187 84.180  1.00 5.00  ? 137 LEU D CD2 1 
ATOM   5749  N N   . ILE D 1 118 ? 63.958  100.134 83.391  1.00 11.07 ? 138 ILE D N   1 
ATOM   5750  C CA  . ILE D 1 118 ? 64.635  99.225  84.303  1.00 8.83  ? 138 ILE D CA  1 
ATOM   5751  C C   . ILE D 1 118 ? 65.819  100.027 84.792  1.00 9.73  ? 138 ILE D C   1 
ATOM   5752  O O   . ILE D 1 118 ? 66.359  100.832 84.027  1.00 12.92 ? 138 ILE D O   1 
ATOM   5753  C CB  . ILE D 1 118 ? 65.145  98.015  83.553  1.00 8.04  ? 138 ILE D CB  1 
ATOM   5754  C CG1 . ILE D 1 118 ? 64.002  97.397  82.745  1.00 10.37 ? 138 ILE D CG1 1 
ATOM   5755  C CG2 . ILE D 1 118 ? 65.734  97.034  84.515  1.00 7.89  ? 138 ILE D CG2 1 
ATOM   5756  C CD1 . ILE D 1 118 ? 64.427  96.305  81.762  1.00 13.03 ? 138 ILE D CD1 1 
ATOM   5757  N N   . SER D 1 119 ? 66.222  99.840  86.043  1.00 6.96  ? 139 SER D N   1 
ATOM   5758  C CA  . SER D 1 119 ? 67.348  100.597 86.577  1.00 7.40  ? 139 SER D CA  1 
ATOM   5759  C C   . SER D 1 119 ? 68.167  99.874  87.648  1.00 8.08  ? 139 SER D C   1 
ATOM   5760  O O   . SER D 1 119 ? 67.636  99.059  88.421  1.00 10.45 ? 139 SER D O   1 
ATOM   5761  C CB  . SER D 1 119 ? 66.841  101.934 87.126  1.00 6.60  ? 139 SER D CB  1 
ATOM   5762  O OG  . SER D 1 119 ? 65.820  101.726 88.087  1.00 6.57  ? 139 SER D OG  1 
ATOM   5763  N N   . GLY D 1 120 ? 69.457  100.187 87.719  1.00 6.92  ? 140 GLY D N   1 
ATOM   5764  C CA  . GLY D 1 120 ? 70.294  99.559  88.720  1.00 9.21  ? 140 GLY D CA  1 
ATOM   5765  C C   . GLY D 1 120 ? 71.750  99.952  88.670  1.00 11.90 ? 140 GLY D C   1 
ATOM   5766  O O   . GLY D 1 120 ? 72.164  100.750 87.832  1.00 16.46 ? 140 GLY D O   1 
ATOM   5767  N N   . TRP D 1 121 ? 72.533  99.399  89.586  1.00 11.74 ? 141 TRP D N   1 
ATOM   5768  C CA  . TRP D 1 121 ? 73.960  99.676  89.658  1.00 9.21  ? 141 TRP D CA  1 
ATOM   5769  C C   . TRP D 1 121 ? 74.726  98.434  89.291  1.00 8.67  ? 141 TRP D C   1 
ATOM   5770  O O   . TRP D 1 121 ? 75.905  98.316  89.589  1.00 9.19  ? 141 TRP D O   1 
ATOM   5771  C CB  . TRP D 1 121 ? 74.352  100.060 91.078  1.00 8.14  ? 141 TRP D CB  1 
ATOM   5772  C CG  . TRP D 1 121 ? 74.014  101.446 91.464  1.00 6.34  ? 141 TRP D CG  1 
ATOM   5773  C CD1 . TRP D 1 121 ? 74.719  102.553 91.170  1.00 5.00  ? 141 TRP D CD1 1 
ATOM   5774  C CD2 . TRP D 1 121 ? 72.933  101.863 92.300  1.00 5.06  ? 141 TRP D CD2 1 
ATOM   5775  N NE1 . TRP D 1 121 ? 74.165  103.640 91.780  1.00 5.00  ? 141 TRP D NE1 1 
ATOM   5776  C CE2 . TRP D 1 121 ? 73.061  103.244 92.479  1.00 6.15  ? 141 TRP D CE2 1 
ATOM   5777  C CE3 . TRP D 1 121 ? 71.878  101.197 92.930  1.00 8.89  ? 141 TRP D CE3 1 
ATOM   5778  C CZ2 . TRP D 1 121 ? 72.171  103.985 93.260  1.00 7.32  ? 141 TRP D CZ2 1 
ATOM   5779  C CZ3 . TRP D 1 121 ? 70.996  101.928 93.713  1.00 9.01  ? 141 TRP D CZ3 1 
ATOM   5780  C CH2 . TRP D 1 121 ? 71.148  103.310 93.869  1.00 7.44  ? 141 TRP D CH2 1 
ATOM   5781  N N   . GLY D 1 122 ? 74.038  97.475  88.698  1.00 10.93 ? 142 GLY D N   1 
ATOM   5782  C CA  . GLY D 1 122 ? 74.691  96.234  88.331  1.00 12.65 ? 142 GLY D CA  1 
ATOM   5783  C C   . GLY D 1 122 ? 75.683  96.369  87.192  1.00 13.17 ? 142 GLY D C   1 
ATOM   5784  O O   . GLY D 1 122 ? 75.775  97.417  86.536  1.00 11.30 ? 142 GLY D O   1 
ATOM   5785  N N   . ASN D 1 123 ? 76.365  95.263  86.914  1.00 14.42 ? 143 ASN D N   1 
ATOM   5786  C CA  . ASN D 1 123 ? 77.367  95.190  85.870  1.00 15.59 ? 143 ASN D CA  1 
ATOM   5787  C C   . ASN D 1 123 ? 76.868  95.844  84.590  1.00 19.63 ? 143 ASN D C   1 
ATOM   5788  O O   . ASN D 1 123 ? 75.653  95.852  84.327  1.00 20.32 ? 143 ASN D O   1 
ATOM   5789  C CB  . ASN D 1 123 ? 77.690  93.720  85.615  1.00 13.28 ? 143 ASN D CB  1 
ATOM   5790  C CG  . ASN D 1 123 ? 78.771  93.529  84.588  1.00 13.02 ? 143 ASN D CG  1 
ATOM   5791  O OD1 . ASN D 1 123 ? 79.384  94.481  84.129  1.00 11.54 ? 143 ASN D OD1 1 
ATOM   5792  N ND2 . ASN D 1 123 ? 79.030  92.290  84.240  1.00 14.43 ? 143 ASN D ND2 1 
ATOM   5793  N N   . THR D 1 124 ? 77.785  96.486  83.860  1.00 23.49 ? 144 THR D N   1 
ATOM   5794  C CA  . THR D 1 124 ? 77.458  97.116  82.573  1.00 26.79 ? 144 THR D CA  1 
ATOM   5795  C C   . THR D 1 124 ? 77.954  96.289  81.375  1.00 29.90 ? 144 THR D C   1 
ATOM   5796  O O   . THR D 1 124 ? 77.327  96.281  80.313  1.00 29.38 ? 144 THR D O   1 
ATOM   5797  C CB  . THR D 1 124 ? 78.006  98.564  82.442  1.00 21.72 ? 144 THR D CB  1 
ATOM   5798  O OG1 . THR D 1 124 ? 79.318  98.651  82.997  1.00 19.90 ? 144 THR D OG1 1 
ATOM   5799  C CG2 . THR D 1 124 ? 77.100  99.540  83.130  1.00 23.64 ? 144 THR D CG2 1 
ATOM   5800  N N   . LYS D 1 125 ? 79.041  95.554  81.572  1.00 32.63 ? 145 LYS D N   1 
ATOM   5801  C CA  . LYS D 1 125 ? 79.625  94.754  80.508  1.00 36.90 ? 145 LYS D CA  1 
ATOM   5802  C C   . LYS D 1 125 ? 78.944  93.419  80.325  1.00 37.94 ? 145 LYS D C   1 
ATOM   5803  O O   . LYS D 1 125 ? 78.534  92.778  81.300  1.00 34.39 ? 145 LYS D O   1 
ATOM   5804  C CB  . LYS D 1 125 ? 81.121  94.536  80.750  1.00 42.73 ? 145 LYS D CB  1 
ATOM   5805  C CG  . LYS D 1 125 ? 81.999  95.751  80.474  1.00 45.63 ? 145 LYS D CG  1 
ATOM   5806  C CD  . LYS D 1 125 ? 83.474  95.354  80.480  1.00 50.80 ? 145 LYS D CD  1 
ATOM   5807  C CE  . LYS D 1 125 ? 84.370  96.486  79.964  1.00 54.79 ? 145 LYS D CE  1 
ATOM   5808  N NZ  . LYS D 1 125 ? 85.812  96.098  79.904  1.00 56.00 ? 145 LYS D NZ  1 
ATOM   5809  N N   . SER D 1 126 ? 78.833  93.016  79.059  1.00 42.01 ? 146 SER D N   1 
ATOM   5810  C CA  . SER D 1 126 ? 78.207  91.752  78.681  1.00 46.32 ? 146 SER D CA  1 
ATOM   5811  C C   . SER D 1 126 ? 79.175  90.627  79.012  1.00 49.20 ? 146 SER D C   1 
ATOM   5812  O O   . SER D 1 126 ? 78.782  89.604  79.589  1.00 52.98 ? 146 SER D O   1 
ATOM   5813  C CB  . SER D 1 126 ? 77.864  91.751  77.182  1.00 44.74 ? 146 SER D CB  1 
ATOM   5814  O OG  . SER D 1 126 ? 78.968  92.193  76.406  0.00 47.69 ? 146 SER D OG  1 
ATOM   5815  N N   . SER D 1 127 ? 80.435  90.829  78.627  1.00 49.80 ? 147 SER D N   1 
ATOM   5816  C CA  . SER D 1 127 ? 81.504  89.876  78.876  1.00 51.13 ? 147 SER D CA  1 
ATOM   5817  C C   . SER D 1 127 ? 82.470  90.610  79.778  1.00 51.38 ? 147 SER D C   1 
ATOM   5818  O O   . SER D 1 127 ? 83.081  91.602  79.363  1.00 52.63 ? 147 SER D O   1 
ATOM   5819  C CB  . SER D 1 127 ? 82.192  89.487  77.566  1.00 52.32 ? 147 SER D CB  1 
ATOM   5820  O OG  . SER D 1 127 ? 81.250  88.978  76.635  0.00 54.55 ? 147 SER D OG  1 
ATOM   5821  N N   . GLY D 1 128 ? 82.551  90.163  81.028  1.00 50.14 ? 148 GLY D N   1 
ATOM   5822  C CA  . GLY D 1 128 ? 83.441  90.793  81.985  1.00 49.32 ? 148 GLY D CA  1 
ATOM   5823  C C   . GLY D 1 128 ? 82.666  91.629  82.984  1.00 46.25 ? 148 GLY D C   1 
ATOM   5824  O O   . GLY D 1 128 ? 81.523  91.999  82.730  1.00 47.40 ? 148 GLY D O   1 
ATOM   5825  N N   . THR D 1 129 ? 83.282  91.929  84.120  1.00 43.70 ? 149 THR D N   1 
ATOM   5826  C CA  . THR D 1 129 ? 82.631  92.707  85.154  1.00 40.09 ? 149 THR D CA  1 
ATOM   5827  C C   . THR D 1 129 ? 83.094  94.162  85.199  1.00 37.99 ? 149 THR D C   1 
ATOM   5828  O O   . THR D 1 129 ? 84.288  94.434  85.326  1.00 40.32 ? 149 THR D O   1 
ATOM   5829  C CB  . THR D 1 129 ? 82.843  92.053  86.533  0.00 41.46 ? 149 THR D CB  1 
ATOM   5830  O OG1 . THR D 1 129 ? 84.216  91.666  86.672  0.00 42.65 ? 149 THR D OG1 1 
ATOM   5831  C CG2 . THR D 1 129 ? 81.957  90.824  86.677  0.00 42.77 ? 149 THR D CG2 1 
ATOM   5832  N N   . SER D 1 130 ? 82.144  95.084  85.040  1.00 33.71 ? 150 SER D N   1 
ATOM   5833  C CA  . SER D 1 130 ? 82.383  96.524  85.118  1.00 27.48 ? 150 SER D CA  1 
ATOM   5834  C C   . SER D 1 130 ? 81.186  97.110  85.897  1.00 24.54 ? 150 SER D C   1 
ATOM   5835  O O   . SER D 1 130 ? 80.183  97.520  85.312  1.00 23.91 ? 150 SER D O   1 
ATOM   5836  C CB  . SER D 1 130 ? 82.478  97.136  83.719  0.00 27.69 ? 150 SER D CB  1 
ATOM   5837  O OG  . SER D 1 130 ? 82.872  98.496  83.775  0.00 25.97 ? 150 SER D OG  1 
ATOM   5838  N N   . TYR D 1 131 ? 81.241  97.030  87.222  1.00 21.33 ? 151 TYR D N   1 
ATOM   5839  C CA  . TYR D 1 131 ? 80.167  97.563  88.052  1.00 21.26 ? 151 TYR D CA  1 
ATOM   5840  C C   . TYR D 1 131 ? 80.247  99.087  88.247  1.00 23.36 ? 151 TYR D C   1 
ATOM   5841  O O   . TYR D 1 131 ? 81.126  99.606  88.951  1.00 25.10 ? 151 TYR D O   1 
ATOM   5842  C CB  . TYR D 1 131 ? 80.136  96.861  89.398  1.00 20.29 ? 151 TYR D CB  1 
ATOM   5843  C CG  . TYR D 1 131 ? 79.755  95.411  89.293  1.00 21.11 ? 151 TYR D CG  1 
ATOM   5844  C CD1 . TYR D 1 131 ? 78.429  95.018  89.227  1.00 20.82 ? 151 TYR D CD1 1 
ATOM   5845  C CD2 . TYR D 1 131 ? 80.722  94.429  89.266  1.00 25.98 ? 151 TYR D CD2 1 
ATOM   5846  C CE1 . TYR D 1 131 ? 78.085  93.681  89.134  1.00 22.81 ? 151 TYR D CE1 1 
ATOM   5847  C CE2 . TYR D 1 131 ? 80.385  93.083  89.178  1.00 27.13 ? 151 TYR D CE2 1 
ATOM   5848  C CZ  . TYR D 1 131 ? 79.076  92.718  89.109  1.00 24.76 ? 151 TYR D CZ  1 
ATOM   5849  O OH  . TYR D 1 131 ? 78.807  91.377  88.986  1.00 27.72 ? 151 TYR D OH  1 
ATOM   5850  N N   . PRO D 1 132 ? 79.326  99.823  87.618  1.00 21.81 ? 152 PRO D N   1 
ATOM   5851  C CA  . PRO D 1 132 ? 79.243  101.284 87.678  1.00 22.30 ? 152 PRO D CA  1 
ATOM   5852  C C   . PRO D 1 132 ? 79.020  101.853 89.060  1.00 24.81 ? 152 PRO D C   1 
ATOM   5853  O O   . PRO D 1 132 ? 78.496  101.185 89.951  1.00 23.86 ? 152 PRO D O   1 
ATOM   5854  C CB  . PRO D 1 132 ? 78.071  101.599 86.763  1.00 22.38 ? 152 PRO D CB  1 
ATOM   5855  C CG  . PRO D 1 132 ? 77.209  100.381 86.901  1.00 24.66 ? 152 PRO D CG  1 
ATOM   5856  C CD  . PRO D 1 132 ? 78.222  99.271  86.821  1.00 23.25 ? 152 PRO D CD  1 
ATOM   5857  N N   . ASP D 1 133 ? 79.427  103.106 89.212  1.00 30.19 ? 153 ASP D N   1 
ATOM   5858  C CA  . ASP D 1 133 ? 79.297  103.828 90.468  1.00 34.38 ? 153 ASP D CA  1 
ATOM   5859  C C   . ASP D 1 133 ? 77.999  104.561 90.491  1.00 28.89 ? 153 ASP D C   1 
ATOM   5860  O O   . ASP D 1 133 ? 77.441  104.791 91.551  1.00 30.42 ? 153 ASP D O   1 
ATOM   5861  C CB  . ASP D 1 133 ? 80.416  104.850 90.630  1.00 45.56 ? 153 ASP D CB  1 
ATOM   5862  C CG  . ASP D 1 133 ? 81.595  104.314 91.426  1.00 56.90 ? 153 ASP D CG  1 
ATOM   5863  O OD1 . ASP D 1 133 ? 81.987  104.976 92.413  1.00 61.77 ? 153 ASP D OD1 1 
ATOM   5864  O OD2 . ASP D 1 133 ? 82.132  103.239 91.068  1.00 63.14 ? 153 ASP D OD2 1 
ATOM   5865  N N   . VAL D 1 134 ? 77.544  104.971 89.316  1.00 22.83 ? 154 VAL D N   1 
ATOM   5866  C CA  . VAL D 1 134 ? 76.293  105.698 89.212  1.00 20.92 ? 154 VAL D CA  1 
ATOM   5867  C C   . VAL D 1 134 ? 75.159  104.836 88.693  1.00 18.68 ? 154 VAL D C   1 
ATOM   5868  O O   . VAL D 1 134 ? 75.372  103.815 88.040  1.00 18.34 ? 154 VAL D O   1 
ATOM   5869  C CB  . VAL D 1 134 ? 76.423  106.933 88.313  1.00 22.58 ? 154 VAL D CB  1 
ATOM   5870  C CG1 . VAL D 1 134 ? 77.332  107.966 88.973  1.00 20.00 ? 154 VAL D CG1 1 
ATOM   5871  C CG2 . VAL D 1 134 ? 76.948  106.522 86.928  1.00 24.15 ? 154 VAL D CG2 1 
ATOM   5872  N N   . LEU D 1 135 ? 73.946  105.277 88.982  1.00 16.05 ? 155 LEU D N   1 
ATOM   5873  C CA  . LEU D 1 135 ? 72.757  104.572 88.560  1.00 12.45 ? 155 LEU D CA  1 
ATOM   5874  C C   . LEU D 1 135 ? 72.608  104.628 87.055  1.00 11.35 ? 155 LEU D C   1 
ATOM   5875  O O   . LEU D 1 135 ? 72.761  105.686 86.434  1.00 10.63 ? 155 LEU D O   1 
ATOM   5876  C CB  . LEU D 1 135 ? 71.531  105.205 89.199  1.00 8.90  ? 155 LEU D CB  1 
ATOM   5877  C CG  . LEU D 1 135 ? 70.259  104.396 89.045  1.00 6.01  ? 155 LEU D CG  1 
ATOM   5878  C CD1 . LEU D 1 135 ? 70.339  103.148 89.943  1.00 5.00  ? 155 LEU D CD1 1 
ATOM   5879  C CD2 . LEU D 1 135 ? 69.092  105.278 89.406  1.00 5.70  ? 155 LEU D CD2 1 
ATOM   5880  N N   . LYS D 1 136 ? 72.293  103.481 86.479  1.00 10.32 ? 156 LYS D N   1 
ATOM   5881  C CA  . LYS D 1 136 ? 72.092  103.362 85.053  1.00 11.44 ? 156 LYS D CA  1 
ATOM   5882  C C   . LYS D 1 136 ? 70.639  103.067 84.794  1.00 9.71  ? 156 LYS D C   1 
ATOM   5883  O O   . LYS D 1 136 ? 69.998  102.374 85.561  1.00 11.51 ? 156 LYS D O   1 
ATOM   5884  C CB  . LYS D 1 136 ? 72.937  102.223 84.518  1.00 18.22 ? 156 LYS D CB  1 
ATOM   5885  C CG  . LYS D 1 136 ? 74.420  102.448 84.704  1.00 21.54 ? 156 LYS D CG  1 
ATOM   5886  C CD  . LYS D 1 136 ? 74.878  103.659 83.916  1.00 23.75 ? 156 LYS D CD  1 
ATOM   5887  C CE  . LYS D 1 136 ? 76.305  103.950 84.257  1.00 30.35 ? 156 LYS D CE  1 
ATOM   5888  N NZ  . LYS D 1 136 ? 76.903  104.977 83.372  1.00 36.00 ? 156 LYS D NZ  1 
ATOM   5889  N N   . CYS D 1 137 ? 70.134  103.562 83.684  1.00 11.91 ? 157 CYS D N   1 
ATOM   5890  C CA  . CYS D 1 137 ? 68.743  103.382 83.304  1.00 14.30 ? 157 CYS D CA  1 
ATOM   5891  C C   . CYS D 1 137 ? 68.703  102.713 81.943  1.00 16.68 ? 157 CYS D C   1 
ATOM   5892  O O   . CYS D 1 137 ? 69.630  102.857 81.146  1.00 16.92 ? 157 CYS D O   1 
ATOM   5893  C CB  . CYS D 1 137 ? 68.055  104.740 83.195  1.00 11.62 ? 157 CYS D CB  1 
ATOM   5894  S SG  . CYS D 1 137 ? 67.567  105.495 84.760  1.00 10.68 ? 157 CYS D SG  1 
ATOM   5895  N N   . LEU D 1 138 ? 67.626  101.983 81.680  1.00 18.93 ? 158 LEU D N   1 
ATOM   5896  C CA  . LEU D 1 138 ? 67.442  101.308 80.408  1.00 16.43 ? 158 LEU D CA  1 
ATOM   5897  C C   . LEU D 1 138 ? 65.962  101.281 80.064  1.00 18.52 ? 158 LEU D C   1 
ATOM   5898  O O   . LEU D 1 138 ? 65.152  100.861 80.888  1.00 20.40 ? 158 LEU D O   1 
ATOM   5899  C CB  . LEU D 1 138 ? 67.969  99.877  80.484  1.00 10.69 ? 158 LEU D CB  1 
ATOM   5900  C CG  . LEU D 1 138 ? 67.671  99.044  79.236  1.00 10.67 ? 158 LEU D CG  1 
ATOM   5901  C CD1 . LEU D 1 138 ? 68.225  99.756  78.015  1.00 10.36 ? 158 LEU D CD1 1 
ATOM   5902  C CD2 . LEU D 1 138 ? 68.262  97.646  79.355  1.00 10.50 ? 158 LEU D CD2 1 
ATOM   5903  N N   . LYS D 1 139 ? 65.614  101.843 78.907  1.00 19.07 ? 159 LYS D N   1 
ATOM   5904  C CA  . LYS D 1 139 ? 64.243  101.831 78.401  1.00 18.47 ? 159 LYS D CA  1 
ATOM   5905  C C   . LYS D 1 139 ? 64.153  100.456 77.711  1.00 18.68 ? 159 LYS D C   1 
ATOM   5906  O O   . LYS D 1 139 ? 65.111  100.020 77.077  1.00 22.37 ? 159 LYS D O   1 
ATOM   5907  C CB  . LYS D 1 139 ? 64.041  102.944 77.370  0.00 19.68 ? 159 LYS D CB  1 
ATOM   5908  C CG  . LYS D 1 139 ? 64.294  104.338 77.910  0.00 21.35 ? 159 LYS D CG  1 
ATOM   5909  C CD  . LYS D 1 139 ? 63.266  104.717 78.960  0.00 23.23 ? 159 LYS D CD  1 
ATOM   5910  C CE  . LYS D 1 139 ? 63.667  105.989 79.684  0.00 24.38 ? 159 LYS D CE  1 
ATOM   5911  N NZ  . LYS D 1 139 ? 63.985  107.096 78.742  0.00 24.64 ? 159 LYS D NZ  1 
ATOM   5912  N N   . ALA D 1 140 ? 63.052  99.741  77.886  1.00 16.14 ? 160 ALA D N   1 
ATOM   5913  C CA  . ALA D 1 140 ? 62.912  98.432  77.271  1.00 15.74 ? 160 ALA D CA  1 
ATOM   5914  C C   . ALA D 1 140 ? 61.443  98.069  77.263  1.00 15.08 ? 160 ALA D C   1 
ATOM   5915  O O   . ALA D 1 140 ? 60.715  98.450  78.152  1.00 18.71 ? 160 ALA D O   1 
ATOM   5916  C CB  . ALA D 1 140 ? 63.713  97.388  78.060  1.00 16.33 ? 160 ALA D CB  1 
ATOM   5917  N N   . PRO D 1 141 ? 60.967  97.398  76.216  1.00 15.20 ? 161 PRO D N   1 
ATOM   5918  C CA  . PRO D 1 141 ? 59.559  97.028  76.177  1.00 13.39 ? 161 PRO D CA  1 
ATOM   5919  C C   . PRO D 1 141 ? 59.359  95.674  76.819  1.00 13.96 ? 161 PRO D C   1 
ATOM   5920  O O   . PRO D 1 141 ? 60.323  94.941  77.112  1.00 10.47 ? 161 PRO D O   1 
ATOM   5921  C CB  . PRO D 1 141 ? 59.285  96.926  74.688  1.00 13.47 ? 161 PRO D CB  1 
ATOM   5922  C CG  . PRO D 1 141 ? 60.524  96.244  74.213  1.00 15.83 ? 161 PRO D CG  1 
ATOM   5923  C CD  . PRO D 1 141 ? 61.622  97.046  74.947  1.00 18.90 ? 161 PRO D CD  1 
ATOM   5924  N N   . ILE D 1 142 ? 58.091  95.351  77.021  1.00 15.54 ? 162 ILE D N   1 
ATOM   5925  C CA  . ILE D 1 142 ? 57.685  94.080  77.592  1.00 15.50 ? 162 ILE D CA  1 
ATOM   5926  C C   . ILE D 1 142 ? 57.473  93.143  76.397  1.00 15.11 ? 162 ILE D C   1 
ATOM   5927  O O   . ILE D 1 142 ? 56.700  93.457  75.496  1.00 18.91 ? 162 ILE D O   1 
ATOM   5928  C CB  . ILE D 1 142 ? 56.396  94.284  78.414  1.00 15.43 ? 162 ILE D CB  1 
ATOM   5929  C CG1 . ILE D 1 142 ? 56.744  94.960  79.746  1.00 14.47 ? 162 ILE D CG1 1 
ATOM   5930  C CG2 . ILE D 1 142 ? 55.652  92.977  78.591  1.00 17.17 ? 162 ILE D CG2 1 
ATOM   5931  C CD1 . ILE D 1 142 ? 55.539  95.388  80.571  1.00 17.64 ? 162 ILE D CD1 1 
ATOM   5932  N N   . LEU D 1 143 ? 58.208  92.040  76.341  1.00 14.61 ? 163 LEU D N   1 
ATOM   5933  C CA  . LEU D 1 143 ? 58.067  91.120  75.215  1.00 15.69 ? 163 LEU D CA  1 
ATOM   5934  C C   . LEU D 1 143 ? 56.823  90.273  75.386  1.00 20.11 ? 163 LEU D C   1 
ATOM   5935  O O   . LEU D 1 143 ? 56.285  90.161  76.483  1.00 23.60 ? 163 LEU D O   1 
ATOM   5936  C CB  . LEU D 1 143 ? 59.283  90.202  75.085  1.00 11.44 ? 163 LEU D CB  1 
ATOM   5937  C CG  . LEU D 1 143 ? 60.694  90.755  75.191  1.00 6.66  ? 163 LEU D CG  1 
ATOM   5938  C CD1 . LEU D 1 143 ? 61.623  89.697  74.723  1.00 5.00  ? 163 LEU D CD1 1 
ATOM   5939  C CD2 . LEU D 1 143 ? 60.867  91.961  74.347  1.00 6.89  ? 163 LEU D CD2 1 
ATOM   5940  N N   . SER D 1 144 ? 56.377  89.657  74.302  1.00 22.56 ? 164 SER D N   1 
ATOM   5941  C CA  . SER D 1 144 ? 55.193  88.820  74.343  1.00 25.02 ? 164 SER D CA  1 
ATOM   5942  C C   . SER D 1 144 ? 55.460  87.519  75.088  1.00 24.88 ? 164 SER D C   1 
ATOM   5943  O O   . SER D 1 144 ? 56.499  86.896  74.893  1.00 23.13 ? 164 SER D O   1 
ATOM   5944  C CB  . SER D 1 144 ? 54.712  88.538  72.923  1.00 26.45 ? 164 SER D CB  1 
ATOM   5945  O OG  . SER D 1 144 ? 55.805  88.263  72.064  1.00 30.27 ? 164 SER D OG  1 
ATOM   5946  N N   . ASP D 1 145 ? 54.517  87.121  75.942  0.00 24.33 ? 165 ASP D N   1 
ATOM   5947  C CA  . ASP D 1 145 ? 54.619  85.886  76.726  0.00 23.10 ? 165 ASP D CA  1 
ATOM   5948  C C   . ASP D 1 145 ? 55.116  84.738  75.846  0.00 23.65 ? 165 ASP D C   1 
ATOM   5949  O O   . ASP D 1 145 ? 55.831  83.849  76.305  0.00 23.83 ? 165 ASP D O   1 
ATOM   5950  C CB  . ASP D 1 145 ? 53.250  85.541  77.331  0.00 22.06 ? 165 ASP D CB  1 
ATOM   5951  C CG  . ASP D 1 145 ? 53.274  84.272  78.167  0.00 20.02 ? 165 ASP D CG  1 
ATOM   5952  O OD1 . ASP D 1 145 ? 54.053  84.206  79.143  0.00 19.35 ? 165 ASP D OD1 1 
ATOM   5953  O OD2 . ASP D 1 145 ? 52.503  83.343  77.851  0.00 19.28 ? 165 ASP D OD2 1 
ATOM   5954  N N   . SER D 1 146 ? 54.777  84.812  74.565  1.00 23.47 ? 166 SER D N   1 
ATOM   5955  C CA  . SER D 1 146 ? 55.171  83.822  73.571  1.00 26.92 ? 166 SER D CA  1 
ATOM   5956  C C   . SER D 1 146 ? 56.680  83.809  73.305  1.00 28.61 ? 166 SER D C   1 
ATOM   5957  O O   . SER D 1 146 ? 57.327  82.775  73.479  1.00 32.85 ? 166 SER D O   1 
ATOM   5958  C CB  . SER D 1 146 ? 54.406  84.068  72.270  1.00 27.15 ? 166 SER D CB  1 
ATOM   5959  O OG  . SER D 1 146 ? 54.314  85.460  72.014  0.00 29.53 ? 166 SER D OG  1 
ATOM   5960  N N   . SER D 1 147 ? 57.250  84.944  72.891  1.00 26.71 ? 167 SER D N   1 
ATOM   5961  C CA  . SER D 1 147 ? 58.693  85.020  72.626  1.00 23.28 ? 167 SER D CA  1 
ATOM   5962  C C   . SER D 1 147 ? 59.439  84.643  73.895  1.00 18.72 ? 167 SER D C   1 
ATOM   5963  O O   . SER D 1 147 ? 60.414  83.924  73.868  1.00 14.20 ? 167 SER D O   1 
ATOM   5964  C CB  . SER D 1 147 ? 59.100  86.418  72.174  1.00 25.65 ? 167 SER D CB  1 
ATOM   5965  O OG  . SER D 1 147 ? 58.300  86.862  71.092  1.00 30.74 ? 167 SER D OG  1 
ATOM   5966  N N   . CYS D 1 148 ? 58.894  85.065  75.019  1.00 18.95 ? 168 CYS D N   1 
ATOM   5967  C CA  . CYS D 1 148 ? 59.448  84.776  76.326  1.00 17.55 ? 168 CYS D CA  1 
ATOM   5968  C C   . CYS D 1 148 ? 59.530  83.258  76.524  1.00 17.31 ? 168 CYS D C   1 
ATOM   5969  O O   . CYS D 1 148 ? 60.607  82.690  76.669  1.00 16.44 ? 168 CYS D O   1 
ATOM   5970  C CB  . CYS D 1 148 ? 58.519  85.374  77.374  1.00 18.62 ? 168 CYS D CB  1 
ATOM   5971  S SG  . CYS D 1 148 ? 59.255  85.503  79.009  1.00 20.21 ? 168 CYS D SG  1 
ATOM   5972  N N   . LYS D 1 149 ? 58.378  82.601  76.505  1.00 17.42 ? 169 LYS D N   1 
ATOM   5973  C CA  . LYS D 1 149 ? 58.311  81.166  76.690  1.00 16.15 ? 169 LYS D CA  1 
ATOM   5974  C C   . LYS D 1 149 ? 59.139  80.428  75.675  1.00 15.65 ? 169 LYS D C   1 
ATOM   5975  O O   . LYS D 1 149 ? 59.663  79.369  75.978  1.00 14.67 ? 169 LYS D O   1 
ATOM   5976  C CB  . LYS D 1 149 ? 56.855  80.695  76.635  1.00 19.98 ? 169 LYS D CB  1 
ATOM   5977  C CG  . LYS D 1 149 ? 56.030  81.012  77.911  1.00 19.84 ? 169 LYS D CG  1 
ATOM   5978  C CD  . LYS D 1 149 ? 54.593  80.516  77.792  1.00 17.22 ? 169 LYS D CD  1 
ATOM   5979  C CE  . LYS D 1 149 ? 53.847  80.575  79.108  0.00 17.33 ? 169 LYS D CE  1 
ATOM   5980  N NZ  . LYS D 1 149 ? 54.357  79.598  80.105  0.00 17.34 ? 169 LYS D NZ  1 
ATOM   5981  N N   . SER D 1 150 ? 59.237  80.970  74.464  1.00 18.69 ? 170 SER D N   1 
ATOM   5982  C CA  . SER D 1 150 ? 60.033  80.326  73.427  1.00 19.38 ? 170 SER D CA  1 
ATOM   5983  C C   . SER D 1 150 ? 61.523  80.417  73.768  1.00 21.61 ? 170 SER D C   1 
ATOM   5984  O O   . SER D 1 150 ? 62.253  79.436  73.616  1.00 24.78 ? 170 SER D O   1 
ATOM   5985  C CB  . SER D 1 150 ? 59.731  80.902  72.043  1.00 15.30 ? 170 SER D CB  1 
ATOM   5986  O OG  . SER D 1 150 ? 59.831  82.308  72.026  0.00 16.51 ? 170 SER D OG  1 
ATOM   5987  N N   . ALA D 1 151 ? 61.961  81.565  74.281  1.00 21.04 ? 171 ALA D N   1 
ATOM   5988  C CA  . ALA D 1 151 ? 63.362  81.749  74.667  1.00 22.35 ? 171 ALA D CA  1 
ATOM   5989  C C   . ALA D 1 151 ? 63.761  80.823  75.826  1.00 23.21 ? 171 ALA D C   1 
ATOM   5990  O O   . ALA D 1 151 ? 64.846  80.235  75.833  1.00 22.96 ? 171 ALA D O   1 
ATOM   5991  C CB  . ALA D 1 151 ? 63.612  83.198  75.047  1.00 23.54 ? 171 ALA D CB  1 
ATOM   5992  N N   . TYR D 1 152 ? 62.886  80.714  76.817  1.00 22.45 ? 172 TYR D N   1 
ATOM   5993  C CA  . TYR D 1 152 ? 63.141  79.867  77.972  1.00 21.05 ? 172 TYR D CA  1 
ATOM   5994  C C   . TYR D 1 152 ? 61.989  78.873  78.131  1.00 25.99 ? 172 TYR D C   1 
ATOM   5995  O O   . TYR D 1 152 ? 61.187  78.987  79.071  1.00 28.89 ? 172 TYR D O   1 
ATOM   5996  C CB  . TYR D 1 152 ? 63.240  80.730  79.222  1.00 16.02 ? 172 TYR D CB  1 
ATOM   5997  C CG  . TYR D 1 152 ? 64.241  81.855  79.124  1.00 9.76  ? 172 TYR D CG  1 
ATOM   5998  C CD1 . TYR D 1 152 ? 63.858  83.135  78.694  1.00 6.50  ? 172 TYR D CD1 1 
ATOM   5999  C CD2 . TYR D 1 152 ? 65.556  81.651  79.501  1.00 5.61  ? 172 TYR D CD2 1 
ATOM   6000  C CE1 . TYR D 1 152 ? 64.765  84.166  78.652  1.00 5.00  ? 172 TYR D CE1 1 
ATOM   6001  C CE2 . TYR D 1 152 ? 66.463  82.666  79.465  1.00 5.00  ? 172 TYR D CE2 1 
ATOM   6002  C CZ  . TYR D 1 152 ? 66.075  83.923  79.042  1.00 5.78  ? 172 TYR D CZ  1 
ATOM   6003  O OH  . TYR D 1 152 ? 67.031  84.916  79.008  1.00 5.72  ? 172 TYR D OH  1 
ATOM   6004  N N   . PRO D 1 153 ? 61.937  77.838  77.265  1.00 25.18 ? 173 PRO D N   1 
ATOM   6005  C CA  . PRO D 1 153 ? 60.933  76.771  77.213  1.00 24.61 ? 173 PRO D CA  1 
ATOM   6006  C C   . PRO D 1 153 ? 60.393  76.260  78.546  1.00 24.64 ? 173 PRO D C   1 
ATOM   6007  O O   . PRO D 1 153 ? 61.134  75.715  79.354  1.00 25.07 ? 173 PRO D O   1 
ATOM   6008  C CB  . PRO D 1 153 ? 61.655  75.672  76.438  1.00 23.96 ? 173 PRO D CB  1 
ATOM   6009  C CG  . PRO D 1 153 ? 63.090  75.964  76.660  1.00 26.81 ? 173 PRO D CG  1 
ATOM   6010  C CD  . PRO D 1 153 ? 63.098  77.445  76.458  1.00 25.95 ? 173 PRO D CD  1 
ATOM   6011  N N   . GLY D 1 154 ? 59.099  76.467  78.776  0.00 26.52 ? 174 GLY D N   1 
ATOM   6012  C CA  . GLY D 1 154 ? 58.457  76.004  79.999  0.00 27.46 ? 174 GLY D CA  1 
ATOM   6013  C C   . GLY D 1 154 ? 58.844  76.709  81.288  0.00 27.68 ? 174 GLY D C   1 
ATOM   6014  O O   . GLY D 1 154 ? 58.012  76.885  82.176  0.00 27.27 ? 174 GLY D O   1 
ATOM   6015  N N   . GLN D 1 155 ? 60.112  77.088  81.398  1.00 29.06 ? 175 GLN D N   1 
ATOM   6016  C CA  . GLN D 1 155 ? 60.644  77.777  82.572  1.00 28.69 ? 175 GLN D CA  1 
ATOM   6017  C C   . GLN D 1 155 ? 59.922  79.067  82.892  1.00 25.61 ? 175 GLN D C   1 
ATOM   6018  O O   . GLN D 1 155 ? 59.962  79.515  84.037  1.00 26.38 ? 175 GLN D O   1 
ATOM   6019  C CB  . GLN D 1 155 ? 62.114  78.099  82.374  1.00 31.38 ? 175 GLN D CB  1 
ATOM   6020  C CG  . GLN D 1 155 ? 62.982  76.893  82.175  1.00 36.18 ? 175 GLN D CG  1 
ATOM   6021  C CD  . GLN D 1 155 ? 64.424  77.267  82.069  1.00 39.70 ? 175 GLN D CD  1 
ATOM   6022  O OE1 . GLN D 1 155 ? 65.181  77.125  83.025  1.00 41.44 ? 175 GLN D OE1 1 
ATOM   6023  N NE2 . GLN D 1 155 ? 64.817  77.775  80.910  1.00 42.52 ? 175 GLN D NE2 1 
ATOM   6024  N N   . ILE D 1 156 ? 59.360  79.705  81.864  1.00 20.49 ? 176 ILE D N   1 
ATOM   6025  C CA  . ILE D 1 156 ? 58.617  80.943  82.041  1.00 16.69 ? 176 ILE D CA  1 
ATOM   6026  C C   . ILE D 1 156 ? 57.247  80.653  82.647  1.00 16.27 ? 176 ILE D C   1 
ATOM   6027  O O   . ILE D 1 156 ? 56.395  80.042  82.000  1.00 16.61 ? 176 ILE D O   1 
ATOM   6028  C CB  . ILE D 1 156 ? 58.446  81.693  80.707  1.00 14.84 ? 176 ILE D CB  1 
ATOM   6029  C CG1 . ILE D 1 156 ? 59.814  82.078  80.152  1.00 15.46 ? 176 ILE D CG1 1 
ATOM   6030  C CG2 . ILE D 1 156 ? 57.646  82.964  80.906  1.00 14.25 ? 176 ILE D CG2 1 
ATOM   6031  C CD1 . ILE D 1 156 ? 60.690  82.848  81.138  1.00 15.46 ? 176 ILE D CD1 1 
ATOM   6032  N N   . THR D 1 157 ? 57.055  81.065  83.899  1.00 14.31 ? 177 THR D N   1 
ATOM   6033  C CA  . THR D 1 157 ? 55.792  80.856  84.586  1.00 11.46 ? 177 THR D CA  1 
ATOM   6034  C C   . THR D 1 157 ? 54.846  82.047  84.358  1.00 12.15 ? 177 THR D C   1 
ATOM   6035  O O   . THR D 1 157 ? 55.197  83.023  83.690  1.00 11.07 ? 177 THR D O   1 
ATOM   6036  C CB  . THR D 1 157 ? 55.996  80.638  86.103  1.00 8.76  ? 177 THR D CB  1 
ATOM   6037  O OG1 . THR D 1 157 ? 56.507  81.830  86.707  1.00 10.48 ? 177 THR D OG1 1 
ATOM   6038  C CG2 . THR D 1 157 ? 56.943  79.504  86.349  1.00 5.00  ? 177 THR D CG2 1 
ATOM   6039  N N   . SER D 1 158 ? 53.649  81.958  84.923  1.00 12.06 ? 178 SER D N   1 
ATOM   6040  C CA  . SER D 1 158 ? 52.664  83.008  84.800  1.00 11.76 ? 178 SER D CA  1 
ATOM   6041  C C   . SER D 1 158 ? 53.040  84.181  85.688  1.00 12.96 ? 178 SER D C   1 
ATOM   6042  O O   . SER D 1 158 ? 52.419  85.248  85.615  1.00 12.46 ? 178 SER D O   1 
ATOM   6043  C CB  . SER D 1 158 ? 51.306  82.464  85.210  1.00 14.19 ? 178 SER D CB  1 
ATOM   6044  O OG  . SER D 1 158 ? 51.399  81.685  86.395  0.00 13.88 ? 178 SER D OG  1 
ATOM   6045  N N   . ASN D 1 159 ? 54.045  83.969  86.539  1.00 12.73 ? 179 ASN D N   1 
ATOM   6046  C CA  . ASN D 1 159 ? 54.528  85.002  87.450  1.00 14.03 ? 179 ASN D CA  1 
ATOM   6047  C C   . ASN D 1 159 ? 55.816  85.642  86.936  1.00 12.86 ? 179 ASN D C   1 
ATOM   6048  O O   . ASN D 1 159 ? 56.515  86.358  87.677  1.00 10.81 ? 179 ASN D O   1 
ATOM   6049  C CB  . ASN D 1 159 ? 54.771  84.405  88.829  1.00 16.82 ? 179 ASN D CB  1 
ATOM   6050  C CG  . ASN D 1 159 ? 53.494  83.939  89.497  1.00 20.93 ? 179 ASN D CG  1 
ATOM   6051  O OD1 . ASN D 1 159 ? 52.401  84.459  89.223  1.00 23.38 ? 179 ASN D OD1 1 
ATOM   6052  N ND2 . ASN D 1 159 ? 53.617  82.950  90.377  1.00 21.39 ? 179 ASN D ND2 1 
ATOM   6053  N N   . MET D 1 160 ? 56.100  85.404  85.656  1.00 11.37 ? 180 MET D N   1 
ATOM   6054  C CA  . MET D 1 160 ? 57.289  85.904  84.992  1.00 7.40  ? 180 MET D CA  1 
ATOM   6055  C C   . MET D 1 160 ? 56.950  86.578  83.664  1.00 7.30  ? 180 MET D C   1 
ATOM   6056  O O   . MET D 1 160 ? 55.922  86.287  83.050  1.00 5.00  ? 180 MET D O   1 
ATOM   6057  C CB  . MET D 1 160 ? 58.229  84.732  84.750  1.00 5.00  ? 180 MET D CB  1 
ATOM   6058  C CG  . MET D 1 160 ? 58.585  84.019  86.014  1.00 5.00  ? 180 MET D CG  1 
ATOM   6059  S SD  . MET D 1 160 ? 59.859  82.847  85.772  1.00 8.23  ? 180 MET D SD  1 
ATOM   6060  C CE  . MET D 1 160 ? 59.638  81.776  87.206  1.00 5.00  ? 180 MET D CE  1 
ATOM   6061  N N   . PHE D 1 161 ? 57.785  87.522  83.252  1.00 8.87  ? 181 PHE D N   1 
ATOM   6062  C CA  . PHE D 1 161 ? 57.575  88.186  81.977  1.00 12.08 ? 181 PHE D CA  1 
ATOM   6063  C C   . PHE D 1 161 ? 58.915  88.608  81.433  1.00 12.83 ? 181 PHE D C   1 
ATOM   6064  O O   . PHE D 1 161 ? 59.806  88.913  82.215  1.00 14.81 ? 181 PHE D O   1 
ATOM   6065  C CB  . PHE D 1 161 ? 56.575  89.370  82.090  1.00 12.65 ? 181 PHE D CB  1 
ATOM   6066  C CG  . PHE D 1 161 ? 57.120  90.640  82.738  1.00 7.84  ? 181 PHE D CG  1 
ATOM   6067  C CD1 . PHE D 1 161 ? 57.932  91.514  82.028  1.00 5.56  ? 181 PHE D CD1 1 
ATOM   6068  C CD2 . PHE D 1 161 ? 56.733  90.998  84.023  1.00 5.00  ? 181 PHE D CD2 1 
ATOM   6069  C CE1 . PHE D 1 161 ? 58.335  92.712  82.591  1.00 7.02  ? 181 PHE D CE1 1 
ATOM   6070  C CE2 . PHE D 1 161 ? 57.136  92.197  84.591  1.00 5.00  ? 181 PHE D CE2 1 
ATOM   6071  C CZ  . PHE D 1 161 ? 57.930  93.053  83.884  1.00 5.21  ? 181 PHE D CZ  1 
ATOM   6072  N N   . CYS D 1 162 ? 59.086  88.539  80.114  1.00 13.20 ? 182 CYS D N   1 
ATOM   6073  C CA  . CYS D 1 162 ? 60.349  88.930  79.477  1.00 13.48 ? 182 CYS D CA  1 
ATOM   6074  C C   . CYS D 1 162 ? 60.299  90.385  79.068  1.00 13.93 ? 182 CYS D C   1 
ATOM   6075  O O   . CYS D 1 162 ? 59.238  90.907  78.733  1.00 13.67 ? 182 CYS D O   1 
ATOM   6076  C CB  . CYS D 1 162 ? 60.606  88.104  78.225  1.00 12.75 ? 182 CYS D CB  1 
ATOM   6077  S SG  . CYS D 1 162 ? 61.020  86.366  78.516  1.00 20.49 ? 182 CYS D SG  1 
ATOM   6078  N N   . ALA D 1 163 ? 61.444  91.044  79.097  1.00 14.50 ? 183 ALA D N   1 
ATOM   6079  C CA  . ALA D 1 163 ? 61.533  92.442  78.693  1.00 17.12 ? 183 ALA D CA  1 
ATOM   6080  C C   . ALA D 1 163 ? 62.947  92.648  78.181  1.00 21.17 ? 183 ALA D C   1 
ATOM   6081  O O   . ALA D 1 163 ? 63.894  92.022  78.671  1.00 22.84 ? 183 ALA D O   1 
ATOM   6082  C CB  . ALA D 1 163 ? 61.250  93.377  79.865  1.00 19.17 ? 183 ALA D CB  1 
ATOM   6083  N N   . GLY D 1 164 A 63.090  93.507  77.182  1.00 22.62 ? 184 GLY D N   1 
ATOM   6084  C CA  . GLY D 1 164 A 64.400  93.743  76.612  1.00 19.74 ? 184 GLY D CA  1 
ATOM   6085  C C   . GLY D 1 164 A 64.353  93.695  75.095  1.00 17.85 ? 184 GLY D C   1 
ATOM   6086  O O   . GLY D 1 164 A 63.332  94.016  74.482  1.00 16.93 ? 184 GLY D O   1 
ATOM   6087  N N   . TYR D 1 165 ? 65.444  93.248  74.488  1.00 17.25 ? 184 TYR D N   1 
ATOM   6088  C CA  . TYR D 1 165 ? 65.550  93.192  73.045  1.00 16.88 ? 184 TYR D CA  1 
ATOM   6089  C C   . TYR D 1 165 ? 66.032  91.830  72.628  1.00 17.97 ? 184 TYR D C   1 
ATOM   6090  O O   . TYR D 1 165 ? 67.109  91.402  73.006  1.00 16.66 ? 184 TYR D O   1 
ATOM   6091  C CB  . TYR D 1 165 ? 66.528  94.262  72.580  1.00 17.01 ? 184 TYR D CB  1 
ATOM   6092  C CG  . TYR D 1 165 ? 66.140  95.628  73.067  1.00 16.28 ? 184 TYR D CG  1 
ATOM   6093  C CD1 . TYR D 1 165 ? 66.788  96.218  74.143  1.00 14.02 ? 184 TYR D CD1 1 
ATOM   6094  C CD2 . TYR D 1 165 ? 65.059  96.295  72.499  1.00 17.80 ? 184 TYR D CD2 1 
ATOM   6095  C CE1 . TYR D 1 165 ? 66.358  97.432  74.645  1.00 16.46 ? 184 TYR D CE1 1 
ATOM   6096  C CE2 . TYR D 1 165 ? 64.627  97.504  72.986  1.00 17.50 ? 184 TYR D CE2 1 
ATOM   6097  C CZ  . TYR D 1 165 ? 65.271  98.067  74.057  1.00 18.78 ? 184 TYR D CZ  1 
ATOM   6098  O OH  . TYR D 1 165 ? 64.796  99.264  74.532  1.00 23.33 ? 184 TYR D OH  1 
ATOM   6099  N N   . LEU D 1 166 ? 65.231  91.141  71.836  1.00 20.67 ? 185 LEU D N   1 
ATOM   6100  C CA  . LEU D 1 166 ? 65.605  89.811  71.385  1.00 24.39 ? 185 LEU D CA  1 
ATOM   6101  C C   . LEU D 1 166 ? 66.932  89.854  70.637  1.00 28.16 ? 185 LEU D C   1 
ATOM   6102  O O   . LEU D 1 166 ? 67.651  88.856  70.596  1.00 25.53 ? 185 LEU D O   1 
ATOM   6103  C CB  . LEU D 1 166 ? 64.502  89.200  70.507  1.00 22.60 ? 185 LEU D CB  1 
ATOM   6104  C CG  . LEU D 1 166 ? 63.240  88.691  71.210  1.00 18.84 ? 185 LEU D CG  1 
ATOM   6105  C CD1 . LEU D 1 166 ? 62.185  88.313  70.183  0.00 19.11 ? 185 LEU D CD1 1 
ATOM   6106  C CD2 . LEU D 1 166 ? 63.587  87.493  72.079  0.00 19.10 ? 185 LEU D CD2 1 
ATOM   6107  N N   . GLU D 1 167 ? 67.260  91.016  70.066  1.00 31.31 ? 186 GLU D N   1 
ATOM   6108  C CA  . GLU D 1 167 ? 68.518  91.169  69.339  1.00 32.66 ? 186 GLU D CA  1 
ATOM   6109  C C   . GLU D 1 167 ? 69.679  91.108  70.335  1.00 34.96 ? 186 GLU D C   1 
ATOM   6110  O O   . GLU D 1 167 ? 70.692  90.448  70.083  1.00 37.54 ? 186 GLU D O   1 
ATOM   6111  C CB  . GLU D 1 167 ? 68.571  92.497  68.576  0.00 31.64 ? 186 GLU D CB  1 
ATOM   6112  C CG  . GLU D 1 167 ? 69.873  92.685  67.798  0.00 31.55 ? 186 GLU D CG  1 
ATOM   6113  C CD  . GLU D 1 167 ? 70.061  94.088  67.259  0.00 32.79 ? 186 GLU D CD  1 
ATOM   6114  O OE1 . GLU D 1 167 ? 70.344  94.223  66.051  0.00 33.66 ? 186 GLU D OE1 1 
ATOM   6115  O OE2 . GLU D 1 167 ? 69.948  95.054  68.044  0.00 33.71 ? 186 GLU D OE2 1 
ATOM   6116  N N   . GLY D 1 168 ? 69.500  91.761  71.482  1.00 34.24 ? 187 GLY D N   1 
ATOM   6117  C CA  . GLY D 1 168 ? 70.535  91.791  72.501  1.00 33.09 ? 187 GLY D CA  1 
ATOM   6118  C C   . GLY D 1 168 ? 71.215  93.153  72.535  1.00 33.58 ? 187 GLY D C   1 
ATOM   6119  O O   . GLY D 1 168 ? 70.850  94.068  71.778  1.00 32.56 ? 187 GLY D O   1 
ATOM   6120  N N   . GLY D 1 169 A 72.204  93.294  73.415  1.00 32.02 ? 188 GLY D N   1 
ATOM   6121  C CA  . GLY D 1 169 A 72.919  94.555  73.529  1.00 27.18 ? 188 GLY D CA  1 
ATOM   6122  C C   . GLY D 1 169 A 72.488  95.384  74.720  1.00 23.57 ? 188 GLY D C   1 
ATOM   6123  O O   . GLY D 1 169 A 73.286  96.100  75.323  1.00 22.14 ? 188 GLY D O   1 
ATOM   6124  N N   . LYS D 1 170 ? 71.227  95.246  75.095  1.00 21.64 ? 188 LYS D N   1 
ATOM   6125  C CA  . LYS D 1 170 ? 70.673  95.988  76.213  1.00 18.68 ? 188 LYS D CA  1 
ATOM   6126  C C   . LYS D 1 170 ? 69.884  94.982  77.066  1.00 18.22 ? 188 LYS D C   1 
ATOM   6127  O O   . LYS D 1 170 ? 69.109  94.188  76.521  1.00 19.22 ? 188 LYS D O   1 
ATOM   6128  C CB  . LYS D 1 170 ? 69.787  97.114  75.667  1.00 15.70 ? 188 LYS D CB  1 
ATOM   6129  C CG  . LYS D 1 170 ? 70.511  98.052  74.681  1.00 11.52 ? 188 LYS D CG  1 
ATOM   6130  C CD  . LYS D 1 170 ? 69.561  99.066  74.069  1.00 14.02 ? 188 LYS D CD  1 
ATOM   6131  C CE  . LYS D 1 170 ? 70.256  100.049 73.152  0.00 14.02 ? 188 LYS D CE  1 
ATOM   6132  N NZ  . LYS D 1 170 ? 69.292  101.054 72.619  0.00 14.58 ? 188 LYS D NZ  1 
ATOM   6133  N N   . ASP D 1 171 ? 70.140  94.967  78.377  1.00 14.56 ? 189 ASP D N   1 
ATOM   6134  C CA  . ASP D 1 171 ? 69.494  94.031  79.309  1.00 11.65 ? 189 ASP D CA  1 
ATOM   6135  C C   . ASP D 1 171 ? 70.032  94.303  80.706  1.00 11.22 ? 189 ASP D C   1 
ATOM   6136  O O   . ASP D 1 171 ? 71.053  94.978  80.844  1.00 11.18 ? 189 ASP D O   1 
ATOM   6137  C CB  . ASP D 1 171 ? 69.840  92.592  78.910  1.00 10.51 ? 189 ASP D CB  1 
ATOM   6138  C CG  . ASP D 1 171 ? 69.208  91.534  79.818  1.00 9.28  ? 189 ASP D CG  1 
ATOM   6139  O OD1 . ASP D 1 171 ? 69.598  90.361  79.690  1.00 7.92  ? 189 ASP D OD1 1 
ATOM   6140  O OD2 . ASP D 1 171 ? 68.316  91.831  80.626  1.00 5.00  ? 189 ASP D OD2 1 
ATOM   6141  N N   . SER D 1 172 ? 69.312  93.855  81.737  1.00 8.85  ? 190 SER D N   1 
ATOM   6142  C CA  . SER D 1 172 ? 69.737  94.051  83.116  1.00 6.48  ? 190 SER D CA  1 
ATOM   6143  C C   . SER D 1 172 ? 70.803  93.010  83.353  1.00 6.60  ? 190 SER D C   1 
ATOM   6144  O O   . SER D 1 172 ? 70.963  92.111  82.532  1.00 5.00  ? 190 SER D O   1 
ATOM   6145  C CB  . SER D 1 172 ? 68.569  93.889  84.070  1.00 5.21  ? 190 SER D CB  1 
ATOM   6146  O OG  . SER D 1 172 ? 67.831  92.737  83.734  1.00 9.63  ? 190 SER D OG  1 
ATOM   6147  N N   . CYS D 1 173 ? 71.507  93.101  84.479  1.00 8.45  ? 191 CYS D N   1 
ATOM   6148  C CA  . CYS D 1 173 ? 72.613  92.186  84.743  1.00 6.85  ? 191 CYS D CA  1 
ATOM   6149  C C   . CYS D 1 173 ? 72.957  92.100  86.218  1.00 7.35  ? 191 CYS D C   1 
ATOM   6150  O O   . CYS D 1 173 ? 72.532  92.949  87.020  1.00 5.00  ? 191 CYS D O   1 
ATOM   6151  C CB  . CYS D 1 173 ? 73.845  92.653  83.963  1.00 9.19  ? 191 CYS D CB  1 
ATOM   6152  S SG  . CYS D 1 173 ? 75.073  91.378  83.567  1.00 13.16 ? 191 CYS D SG  1 
ATOM   6153  N N   . GLN D 1 174 ? 73.757  91.078  86.541  1.00 8.94  ? 192 GLN D N   1 
ATOM   6154  C CA  . GLN D 1 174 ? 74.199  90.764  87.900  1.00 5.73  ? 192 GLN D CA  1 
ATOM   6155  C C   . GLN D 1 174 ? 74.494  92.009  88.698  1.00 5.00  ? 192 GLN D C   1 
ATOM   6156  O O   . GLN D 1 174 ? 75.268  92.851  88.278  1.00 5.00  ? 192 GLN D O   1 
ATOM   6157  C CB  . GLN D 1 174 ? 75.373  89.784  87.859  1.00 5.81  ? 192 GLN D CB  1 
ATOM   6158  C CG  . GLN D 1 174 ? 74.964  88.302  87.545  1.00 5.00  ? 192 GLN D CG  1 
ATOM   6159  C CD  . GLN D 1 174 ? 74.419  88.101  86.145  1.00 5.00  ? 192 GLN D CD  1 
ATOM   6160  O OE1 . GLN D 1 174 ? 73.277  88.451  85.856  0.00 5.04  ? 192 GLN D OE1 1 
ATOM   6161  N NE2 . GLN D 1 174 ? 75.246  87.567  85.257  0.00 5.04  ? 192 GLN D NE2 1 
ATOM   6162  N N   . GLY D 1 175 ? 73.742  92.171  89.780  1.00 7.65  ? 193 GLY D N   1 
ATOM   6163  C CA  . GLY D 1 175 ? 73.846  93.352  90.628  1.00 8.67  ? 193 GLY D CA  1 
ATOM   6164  C C   . GLY D 1 175 ? 72.563  94.180  90.517  1.00 7.91  ? 193 GLY D C   1 
ATOM   6165  O O   . GLY D 1 175 ? 72.307  95.085  91.322  1.00 5.77  ? 193 GLY D O   1 
ATOM   6166  N N   . ASP D 1 176 ? 71.773  93.879  89.487  1.00 8.23  ? 194 ASP D N   1 
ATOM   6167  C CA  . ASP D 1 176 ? 70.511  94.548  89.233  1.00 8.55  ? 194 ASP D CA  1 
ATOM   6168  C C   . ASP D 1 176 ? 69.296  93.817  89.840  1.00 14.02 ? 194 ASP D C   1 
ATOM   6169  O O   . ASP D 1 176 ? 68.169  94.336  89.771  1.00 17.35 ? 194 ASP D O   1 
ATOM   6170  C CB  . ASP D 1 176 ? 70.296  94.701  87.729  1.00 5.00  ? 194 ASP D CB  1 
ATOM   6171  C CG  . ASP D 1 176 ? 71.127  95.806  87.126  1.00 6.19  ? 194 ASP D CG  1 
ATOM   6172  O OD1 . ASP D 1 176 ? 71.438  95.708  85.924  1.00 6.75  ? 194 ASP D OD1 1 
ATOM   6173  O OD2 . ASP D 1 176 ? 71.435  96.790  87.828  1.00 5.00  ? 194 ASP D OD2 1 
ATOM   6174  N N   . SER D 1 177 ? 69.487  92.601  90.367  1.00 12.53 ? 195 SER D N   1 
ATOM   6175  C CA  . SER D 1 177 ? 68.381  91.847  90.976  1.00 9.55  ? 195 SER D CA  1 
ATOM   6176  C C   . SER D 1 177 ? 67.589  92.666  91.987  1.00 12.21 ? 195 SER D C   1 
ATOM   6177  O O   . SER D 1 177 ? 68.155  93.463  92.747  1.00 14.32 ? 195 SER D O   1 
ATOM   6178  C CB  . SER D 1 177 ? 68.892  90.599  91.691  1.00 5.57  ? 195 SER D CB  1 
ATOM   6179  O OG  . SER D 1 177 ? 68.950  89.506  90.808  1.00 5.00  ? 195 SER D OG  1 
ATOM   6180  N N   . GLY D 1 178 ? 66.273  92.472  91.992  1.00 13.41 ? 196 GLY D N   1 
ATOM   6181  C CA  . GLY D 1 178 ? 65.429  93.176  92.945  1.00 11.17 ? 196 GLY D CA  1 
ATOM   6182  C C   . GLY D 1 178 ? 65.114  94.587  92.540  1.00 9.12  ? 196 GLY D C   1 
ATOM   6183  O O   . GLY D 1 178 ? 64.298  95.229  93.165  1.00 9.69  ? 196 GLY D O   1 
ATOM   6184  N N   . GLY D 1 179 ? 65.765  95.066  91.490  1.00 10.42 ? 197 GLY D N   1 
ATOM   6185  C CA  . GLY D 1 179 ? 65.517  96.414  91.009  1.00 8.97  ? 197 GLY D CA  1 
ATOM   6186  C C   . GLY D 1 179 ? 64.139  96.537  90.377  1.00 6.61  ? 197 GLY D C   1 
ATOM   6187  O O   . GLY D 1 179 ? 63.468  95.525  90.107  1.00 6.63  ? 197 GLY D O   1 
ATOM   6188  N N   . PRO D 1 180 ? 63.692  97.773  90.141  1.00 5.00  ? 198 PRO D N   1 
ATOM   6189  C CA  . PRO D 1 180 ? 62.396  98.093  89.548  1.00 5.00  ? 198 PRO D CA  1 
ATOM   6190  C C   . PRO D 1 180 ? 62.283  98.063  88.036  1.00 5.00  ? 198 PRO D C   1 
ATOM   6191  O O   . PRO D 1 180 ? 63.248  98.299  87.319  1.00 5.00  ? 198 PRO D O   1 
ATOM   6192  C CB  . PRO D 1 180 ? 62.165  99.506  90.039  1.00 6.27  ? 198 PRO D CB  1 
ATOM   6193  C CG  . PRO D 1 180 ? 63.554  100.100 90.018  1.00 5.00  ? 198 PRO D CG  1 
ATOM   6194  C CD  . PRO D 1 180 ? 64.363  98.989  90.639  1.00 5.00  ? 198 PRO D CD  1 
ATOM   6195  N N   . VAL D 1 181 ? 61.083  97.763  87.559  1.00 5.26  ? 199 VAL D N   1 
ATOM   6196  C CA  . VAL D 1 181 ? 60.768  97.776  86.125  1.00 6.56  ? 199 VAL D CA  1 
ATOM   6197  C C   . VAL D 1 181 ? 59.496  98.589  86.125  1.00 8.33  ? 199 VAL D C   1 
ATOM   6198  O O   . VAL D 1 181 ? 58.418  98.057  86.421  1.00 8.98  ? 199 VAL D O   1 
ATOM   6199  C CB  . VAL D 1 181 ? 60.442  96.386  85.537  1.00 6.13  ? 199 VAL D CB  1 
ATOM   6200  C CG1 . VAL D 1 181 ? 59.764  96.545  84.184  1.00 5.00  ? 199 VAL D CG1 1 
ATOM   6201  C CG2 . VAL D 1 181 ? 61.712  95.562  85.378  1.00 5.35  ? 199 VAL D CG2 1 
ATOM   6202  N N   . VAL D 1 182 ? 59.641  99.892  85.920  1.00 9.55  ? 200 VAL D N   1 
ATOM   6203  C CA  . VAL D 1 182 ? 58.491  100.775 85.941  1.00 10.74 ? 200 VAL D CA  1 
ATOM   6204  C C   . VAL D 1 182 ? 57.898  100.979 84.563  1.00 13.67 ? 200 VAL D C   1 
ATOM   6205  O O   . VAL D 1 182 ? 58.624  101.188 83.613  1.00 19.28 ? 200 VAL D O   1 
ATOM   6206  C CB  . VAL D 1 182 ? 58.850  102.122 86.563  1.00 5.00  ? 200 VAL D CB  1 
ATOM   6207  C CG1 . VAL D 1 182 ? 57.641  103.013 86.593  1.00 5.00  ? 200 VAL D CG1 1 
ATOM   6208  C CG2 . VAL D 1 182 ? 59.374  101.908 87.955  1.00 5.00  ? 200 VAL D CG2 1 
ATOM   6209  N N   . CYS D 1 183 ? 56.586  100.867 84.445  1.00 12.53 ? 201 CYS D N   1 
ATOM   6210  C CA  . CYS D 1 183 ? 55.932  101.087 83.176  1.00 14.94 ? 201 CYS D CA  1 
ATOM   6211  C C   . CYS D 1 183 ? 54.795  102.026 83.475  1.00 18.88 ? 201 CYS D C   1 
ATOM   6212  O O   . CYS D 1 183 ? 53.949  101.736 84.311  1.00 20.24 ? 201 CYS D O   1 
ATOM   6213  C CB  . CYS D 1 183 ? 55.380  99.799  82.645  1.00 15.48 ? 201 CYS D CB  1 
ATOM   6214  S SG  . CYS D 1 183 ? 56.524  98.429  82.886  1.00 15.63 ? 201 CYS D SG  1 
ATOM   6215  N N   . SER D 1 184 ? 54.840  103.202 82.873  1.00 21.97 ? 202 SER D N   1 
ATOM   6216  C CA  . SER D 1 184 ? 53.814  104.203 83.075  1.00 22.38 ? 202 SER D CA  1 
ATOM   6217  C C   . SER D 1 184 ? 53.605  104.552 84.552  1.00 20.47 ? 202 SER D C   1 
ATOM   6218  O O   . SER D 1 184 ? 52.482  104.561 85.044  1.00 23.64 ? 202 SER D O   1 
ATOM   6219  C CB  . SER D 1 184 ? 52.522  103.713 82.441  1.00 24.18 ? 202 SER D CB  1 
ATOM   6220  O OG  . SER D 1 184 ? 52.805  103.161 81.168  1.00 28.02 ? 202 SER D OG  1 
ATOM   6221  N N   . GLY D 1 185 ? 54.695  104.825 85.258  1.00 16.89 ? 203 GLY D N   1 
ATOM   6222  C CA  . GLY D 1 185 ? 54.593  105.195 86.660  1.00 12.93 ? 203 GLY D CA  1 
ATOM   6223  C C   . GLY D 1 185 ? 54.243  104.090 87.639  1.00 10.78 ? 203 GLY D C   1 
ATOM   6224  O O   . GLY D 1 185 ? 54.166  104.335 88.834  1.00 10.65 ? 203 GLY D O   1 
ATOM   6225  N N   . LYS D 1 186 ? 54.055  102.873 87.160  1.00 9.11  ? 204 LYS D N   1 
ATOM   6226  C CA  . LYS D 1 186 ? 53.719  101.781 88.059  1.00 9.79  ? 204 LYS D CA  1 
ATOM   6227  C C   . LYS D 1 186 ? 54.865  100.812 88.157  1.00 7.81  ? 204 LYS D C   1 
ATOM   6228  O O   . LYS D 1 186 ? 55.684  100.760 87.255  1.00 8.86  ? 204 LYS D O   1 
ATOM   6229  C CB  . LYS D 1 186 ? 52.485  101.048 87.543  1.00 12.69 ? 204 LYS D CB  1 
ATOM   6230  C CG  . LYS D 1 186 ? 51.248  101.918 87.464  1.00 16.33 ? 204 LYS D CG  1 
ATOM   6231  C CD  . LYS D 1 186 ? 50.917  102.496 88.827  1.00 18.61 ? 204 LYS D CD  1 
ATOM   6232  C CE  . LYS D 1 186 ? 49.613  103.258 88.797  1.00 20.83 ? 204 LYS D CE  1 
ATOM   6233  N NZ  . LYS D 1 186 ? 49.197  103.648 90.174  0.00 19.22 ? 204 LYS D NZ  1 
ATOM   6234  N N   . LEU D 1 187 ? 54.944  100.072 89.256  1.00 6.18  ? 209 LEU D N   1 
ATOM   6235  C CA  . LEU D 1 187 ? 56.000  99.078  89.439  1.00 10.19 ? 209 LEU D CA  1 
ATOM   6236  C C   . LEU D 1 187 ? 55.525  97.764  88.812  1.00 12.84 ? 209 LEU D C   1 
ATOM   6237  O O   . LEU D 1 187 ? 54.826  97.011  89.469  1.00 18.60 ? 209 LEU D O   1 
ATOM   6238  C CB  . LEU D 1 187 ? 56.275  98.858  90.932  1.00 6.71  ? 209 LEU D CB  1 
ATOM   6239  C CG  . LEU D 1 187 ? 57.320  97.790  91.246  1.00 5.00  ? 209 LEU D CG  1 
ATOM   6240  C CD1 . LEU D 1 187 ? 58.700  98.304  90.892  1.00 5.00  ? 209 LEU D CD1 1 
ATOM   6241  C CD2 . LEU D 1 187 ? 57.267  97.453  92.688  1.00 5.00  ? 209 LEU D CD2 1 
ATOM   6242  N N   . GLN D 1 188 ? 55.935  97.455  87.586  1.00 11.43 ? 210 GLN D N   1 
ATOM   6243  C CA  . GLN D 1 188 ? 55.467  96.236  86.929  1.00 11.79 ? 210 GLN D CA  1 
ATOM   6244  C C   . GLN D 1 188 ? 56.238  94.985  87.168  1.00 10.54 ? 210 GLN D C   1 
ATOM   6245  O O   . GLN D 1 188 ? 55.648  93.915  87.201  1.00 12.53 ? 210 GLN D O   1 
ATOM   6246  C CB  . GLN D 1 188 ? 55.363  96.403  85.419  1.00 17.01 ? 210 GLN D CB  1 
ATOM   6247  C CG  . GLN D 1 188 ? 54.157  97.199  84.969  1.00 21.46 ? 210 GLN D CG  1 
ATOM   6248  C CD  . GLN D 1 188 ? 52.849  96.597  85.433  1.00 20.21 ? 210 GLN D CD  1 
ATOM   6249  O OE1 . GLN D 1 188 ? 51.873  97.321  85.657  1.00 22.13 ? 210 GLN D OE1 1 
ATOM   6250  N NE2 . GLN D 1 188 ? 52.809  95.268  85.554  1.00 15.19 ? 210 GLN D NE2 1 
ATOM   6251  N N   . GLY D 1 189 ? 57.553  95.088  87.253  1.00 7.88  ? 211 GLY D N   1 
ATOM   6252  C CA  . GLY D 1 189 ? 58.335  93.889  87.455  1.00 5.45  ? 211 GLY D CA  1 
ATOM   6253  C C   . GLY D 1 189 ? 59.570  94.119  88.275  1.00 6.07  ? 211 GLY D C   1 
ATOM   6254  O O   . GLY D 1 189 ? 59.969  95.258  88.489  1.00 6.12  ? 211 GLY D O   1 
ATOM   6255  N N   . ILE D 1 190 ? 60.150  93.031  88.760  1.00 7.89  ? 212 ILE D N   1 
ATOM   6256  C CA  . ILE D 1 190 ? 61.363  93.092  89.555  1.00 9.53  ? 212 ILE D CA  1 
ATOM   6257  C C   . ILE D 1 190 ? 62.401  92.285  88.792  1.00 9.31  ? 212 ILE D C   1 
ATOM   6258  O O   . ILE D 1 190 ? 62.109  91.168  88.325  1.00 8.62  ? 212 ILE D O   1 
ATOM   6259  C CB  . ILE D 1 190 ? 61.166  92.449  90.956  1.00 13.89 ? 212 ILE D CB  1 
ATOM   6260  C CG1 . ILE D 1 190 ? 59.952  93.083  91.666  1.00 14.28 ? 212 ILE D CG1 1 
ATOM   6261  C CG2 . ILE D 1 190 ? 62.430  92.639  91.802  1.00 12.83 ? 212 ILE D CG2 1 
ATOM   6262  C CD1 . ILE D 1 190 ? 59.476  92.347  92.903  1.00 12.28 ? 212 ILE D CD1 1 
ATOM   6263  N N   . VAL D 1 191 ? 63.578  92.887  88.619  1.00 7.51  ? 213 VAL D N   1 
ATOM   6264  C CA  . VAL D 1 191 ? 64.700  92.258  87.937  1.00 5.30  ? 213 VAL D CA  1 
ATOM   6265  C C   . VAL D 1 191 ? 64.950  90.901  88.618  1.00 5.35  ? 213 VAL D C   1 
ATOM   6266  O O   . VAL D 1 191 ? 65.204  90.851  89.828  1.00 6.21  ? 213 VAL D O   1 
ATOM   6267  C CB  . VAL D 1 191 ? 65.969  93.131  88.064  1.00 5.00  ? 213 VAL D CB  1 
ATOM   6268  C CG1 . VAL D 1 191 ? 67.102  92.491  87.331  1.00 9.54  ? 213 VAL D CG1 1 
ATOM   6269  C CG2 . VAL D 1 191 ? 65.732  94.521  87.509  1.00 5.00  ? 213 VAL D CG2 1 
ATOM   6270  N N   . SER D 1 192 ? 64.852  89.809  87.861  1.00 5.70  ? 214 SER D N   1 
ATOM   6271  C CA  . SER D 1 192 ? 65.060  88.495  88.430  1.00 5.00  ? 214 SER D CA  1 
ATOM   6272  C C   . SER D 1 192 ? 66.183  87.688  87.783  1.00 7.21  ? 214 SER D C   1 
ATOM   6273  O O   . SER D 1 192 ? 67.288  87.660  88.302  1.00 10.32 ? 214 SER D O   1 
ATOM   6274  C CB  . SER D 1 192 ? 63.756  87.701  88.431  1.00 7.65  ? 214 SER D CB  1 
ATOM   6275  O OG  . SER D 1 192 ? 63.817  86.592  89.330  1.00 8.75  ? 214 SER D OG  1 
ATOM   6276  N N   . TRP D 1 193 ? 65.938  87.046  86.649  1.00 8.67  ? 215 TRP D N   1 
ATOM   6277  C CA  . TRP D 1 193 ? 66.980  86.216  86.037  1.00 12.47 ? 215 TRP D CA  1 
ATOM   6278  C C   . TRP D 1 193 ? 67.056  86.244  84.502  1.00 13.75 ? 215 TRP D C   1 
ATOM   6279  O O   . TRP D 1 193 ? 66.383  87.028  83.837  1.00 13.73 ? 215 TRP D O   1 
ATOM   6280  C CB  . TRP D 1 193 ? 66.833  84.760  86.512  1.00 13.02 ? 215 TRP D CB  1 
ATOM   6281  C CG  . TRP D 1 193 ? 65.501  84.153  86.185  1.00 15.51 ? 215 TRP D CG  1 
ATOM   6282  C CD1 . TRP D 1 193 ? 64.329  84.343  86.857  1.00 18.55 ? 215 TRP D CD1 1 
ATOM   6283  C CD2 . TRP D 1 193 ? 65.192  83.288  85.088  1.00 16.85 ? 215 TRP D CD2 1 
ATOM   6284  N NE1 . TRP D 1 193 ? 63.312  83.659  86.245  1.00 19.33 ? 215 TRP D NE1 1 
ATOM   6285  C CE2 . TRP D 1 193 ? 63.813  83.002  85.154  1.00 18.45 ? 215 TRP D CE2 1 
ATOM   6286  C CE3 . TRP D 1 193 ? 65.947  82.724  84.053  1.00 17.47 ? 215 TRP D CE3 1 
ATOM   6287  C CZ2 . TRP D 1 193 ? 63.171  82.178  84.220  1.00 18.63 ? 215 TRP D CZ2 1 
ATOM   6288  C CZ3 . TRP D 1 193 ? 65.306  81.896  83.121  1.00 14.28 ? 215 TRP D CZ3 1 
ATOM   6289  C CH2 . TRP D 1 193 ? 63.939  81.637  83.214  1.00 15.93 ? 215 TRP D CH2 1 
ATOM   6290  N N   . GLY D 1 194 ? 67.915  85.400  83.953  1.00 13.51 ? 216 GLY D N   1 
ATOM   6291  C CA  . GLY D 1 194 ? 68.070  85.321  82.520  1.00 16.24 ? 216 GLY D CA  1 
ATOM   6292  C C   . GLY D 1 194 ? 69.353  84.571  82.234  1.00 20.41 ? 216 GLY D C   1 
ATOM   6293  O O   . GLY D 1 194 ? 70.001  84.070  83.168  1.00 21.73 ? 216 GLY D O   1 
ATOM   6294  N N   . SER D 1 195 ? 69.697  84.431  80.954  1.00 21.26 ? 217 SER D N   1 
ATOM   6295  C CA  . SER D 1 195 ? 70.933  83.751  80.565  1.00 20.94 ? 217 SER D CA  1 
ATOM   6296  C C   . SER D 1 195 ? 71.940  84.834  80.275  1.00 19.00 ? 217 SER D C   1 
ATOM   6297  O O   . SER D 1 195 ? 71.746  85.633  79.350  1.00 15.42 ? 217 SER D O   1 
ATOM   6298  C CB  . SER D 1 195 ? 70.739  82.916  79.304  1.00 24.15 ? 217 SER D CB  1 
ATOM   6299  O OG  . SER D 1 195 ? 69.639  82.046  79.443  1.00 31.65 ? 217 SER D OG  1 
ATOM   6300  N N   . GLY D 1 196 ? 73.012  84.856  81.063  1.00 20.09 ? 219 GLY D N   1 
ATOM   6301  C CA  . GLY D 1 196 ? 74.054  85.856  80.898  1.00 21.84 ? 219 GLY D CA  1 
ATOM   6302  C C   . GLY D 1 196 ? 73.444  87.243  80.892  1.00 20.03 ? 219 GLY D C   1 
ATOM   6303  O O   . GLY D 1 196 ? 72.511  87.494  81.654  1.00 19.04 ? 219 GLY D O   1 
ATOM   6304  N N   . CYS D 1 197 ? 73.946  88.124  80.025  1.00 18.96 ? 220 CYS D N   1 
ATOM   6305  C CA  . CYS D 1 197 ? 73.418  89.481  79.919  1.00 18.54 ? 220 CYS D CA  1 
ATOM   6306  C C   . CYS D 1 197 ? 73.448  89.998  78.498  1.00 21.32 ? 220 CYS D C   1 
ATOM   6307  O O   . CYS D 1 197 ? 74.443  89.850  77.793  1.00 22.18 ? 220 CYS D O   1 
ATOM   6308  C CB  . CYS D 1 197 ? 74.176  90.436  80.834  1.00 14.69 ? 220 CYS D CB  1 
ATOM   6309  S SG  . CYS D 1 197 ? 73.989  89.996  82.577  1.00 11.54 ? 220 CYS D SG  1 
ATOM   6310  N N   . ALA D 1 198 A 72.324  90.559  78.070  1.00 24.59 ? 221 ALA D N   1 
ATOM   6311  C CA  . ALA D 1 198 A 72.172  91.131  76.734  1.00 26.08 ? 221 ALA D CA  1 
ATOM   6312  C C   . ALA D 1 198 A 72.435  90.134  75.616  1.00 25.58 ? 221 ALA D C   1 
ATOM   6313  O O   . ALA D 1 198 A 72.630  90.520  74.460  1.00 26.79 ? 221 ALA D O   1 
ATOM   6314  C CB  . ALA D 1 198 A 73.052  92.362  76.574  1.00 25.26 ? 221 ALA D CB  1 
ATOM   6315  N N   . GLN D 1 199 ? 72.409  88.854  75.964  1.00 23.50 ? 221 GLN D N   1 
ATOM   6316  C CA  . GLN D 1 199 ? 72.629  87.789  75.004  1.00 24.26 ? 221 GLN D CA  1 
ATOM   6317  C C   . GLN D 1 199 ? 71.437  87.732  74.055  1.00 23.37 ? 221 GLN D C   1 
ATOM   6318  O O   . GLN D 1 199 ? 70.298  87.890  74.463  1.00 24.71 ? 221 GLN D O   1 
ATOM   6319  C CB  . GLN D 1 199 ? 72.805  86.447  75.731  1.00 26.31 ? 221 GLN D CB  1 
ATOM   6320  C CG  . GLN D 1 199 ? 74.189  85.805  75.588  1.00 24.44 ? 221 GLN D CG  1 
ATOM   6321  C CD  . GLN D 1 199 ? 75.313  86.712  76.059  1.00 23.14 ? 221 GLN D CD  1 
ATOM   6322  O OE1 . GLN D 1 199 ? 76.169  87.111  75.272  0.00 22.45 ? 221 GLN D OE1 1 
ATOM   6323  N NE2 . GLN D 1 199 ? 75.312  87.047  77.342  0.00 22.57 ? 221 GLN D NE2 1 
ATOM   6324  N N   . LYS D 1 200 ? 71.721  87.550  72.776  1.00 23.39 ? 222 LYS D N   1 
ATOM   6325  C CA  . LYS D 1 200 ? 70.701  87.471  71.739  1.00 19.92 ? 222 LYS D CA  1 
ATOM   6326  C C   . LYS D 1 200 ? 69.753  86.356  72.078  1.00 16.78 ? 222 LYS D C   1 
ATOM   6327  O O   . LYS D 1 200 ? 70.176  85.332  72.581  1.00 15.95 ? 222 LYS D O   1 
ATOM   6328  C CB  . LYS D 1 200 ? 71.371  87.159  70.399  1.00 22.25 ? 222 LYS D CB  1 
ATOM   6329  C CG  . LYS D 1 200 ? 70.437  87.023  69.221  1.00 21.59 ? 222 LYS D CG  1 
ATOM   6330  C CD  . LYS D 1 200 ? 71.182  86.585  67.977  0.00 20.72 ? 222 LYS D CD  1 
ATOM   6331  C CE  . LYS D 1 200 ? 70.218  86.306  66.837  0.00 19.73 ? 222 LYS D CE  1 
ATOM   6332  N NZ  . LYS D 1 200 ? 70.934  85.867  65.610  0.00 19.17 ? 222 LYS D NZ  1 
ATOM   6333  N N   . ASN D 1 201 ? 68.475  86.556  71.793  1.00 16.74 ? 223 ASN D N   1 
ATOM   6334  C CA  . ASN D 1 201 ? 67.434  85.562  72.053  1.00 18.90 ? 223 ASN D CA  1 
ATOM   6335  C C   . ASN D 1 201 ? 67.321  85.057  73.507  1.00 20.40 ? 223 ASN D C   1 
ATOM   6336  O O   . ASN D 1 201 ? 66.716  84.013  73.770  1.00 21.42 ? 223 ASN D O   1 
ATOM   6337  C CB  . ASN D 1 201 ? 67.579  84.382  71.088  1.00 17.13 ? 223 ASN D CB  1 
ATOM   6338  C CG  . ASN D 1 201 ? 67.360  84.780  69.640  1.00 15.74 ? 223 ASN D CG  1 
ATOM   6339  O OD1 . ASN D 1 201 ? 66.758  85.814  69.348  0.00 16.90 ? 223 ASN D OD1 1 
ATOM   6340  N ND2 . ASN D 1 201 ? 67.850  83.960  68.722  0.00 16.98 ? 223 ASN D ND2 1 
ATOM   6341  N N   . LYS D 1 202 ? 67.921  85.789  74.442  1.00 19.35 ? 224 LYS D N   1 
ATOM   6342  C CA  . LYS D 1 202 ? 67.869  85.457  75.860  1.00 17.01 ? 224 LYS D CA  1 
ATOM   6343  C C   . LYS D 1 202 ? 67.580  86.778  76.541  1.00 14.86 ? 224 LYS D C   1 
ATOM   6344  O O   . LYS D 1 202 ? 68.490  87.460  77.010  1.00 16.19 ? 224 LYS D O   1 
ATOM   6345  C CB  . LYS D 1 202 ? 69.202  84.886  76.357  1.00 19.30 ? 224 LYS D CB  1 
ATOM   6346  C CG  . LYS D 1 202 ? 69.546  83.527  75.788  1.00 23.05 ? 224 LYS D CG  1 
ATOM   6347  C CD  . LYS D 1 202 ? 68.426  82.533  76.056  1.00 27.39 ? 224 LYS D CD  1 
ATOM   6348  C CE  . LYS D 1 202 ? 68.539  81.271  75.195  1.00 31.56 ? 224 LYS D CE  1 
ATOM   6349  N NZ  . LYS D 1 202 ? 67.505  80.239  75.533  1.00 29.89 ? 224 LYS D NZ  1 
ATOM   6350  N N   . PRO D 1 203 ? 66.310  87.190  76.544  1.00 13.81 ? 225 PRO D N   1 
ATOM   6351  C CA  . PRO D 1 203 ? 65.865  88.445  77.154  1.00 13.65 ? 225 PRO D CA  1 
ATOM   6352  C C   . PRO D 1 203 ? 65.826  88.344  78.662  1.00 13.49 ? 225 PRO D C   1 
ATOM   6353  O O   . PRO D 1 203 ? 65.744  87.247  79.203  1.00 12.76 ? 225 PRO D O   1 
ATOM   6354  C CB  . PRO D 1 203 ? 64.448  88.615  76.606  1.00 13.09 ? 225 PRO D CB  1 
ATOM   6355  C CG  . PRO D 1 203 ? 64.310  87.536  75.520  1.00 12.90 ? 225 PRO D CG  1 
ATOM   6356  C CD  . PRO D 1 203 ? 65.169  86.442  76.003  1.00 13.22 ? 225 PRO D CD  1 
ATOM   6357  N N   . GLY D 1 204 ? 65.875  89.488  79.334  1.00 13.75 ? 226 GLY D N   1 
ATOM   6358  C CA  . GLY D 1 204 ? 65.808  89.491  80.783  1.00 15.30 ? 226 GLY D CA  1 
ATOM   6359  C C   . GLY D 1 204 ? 64.419  89.063  81.247  1.00 14.78 ? 226 GLY D C   1 
ATOM   6360  O O   . GLY D 1 204 ? 63.406  89.435  80.641  1.00 14.84 ? 226 GLY D O   1 
ATOM   6361  N N   . VAL D 1 205 ? 64.364  88.246  82.290  1.00 12.88 ? 227 VAL D N   1 
ATOM   6362  C CA  . VAL D 1 205 ? 63.099  87.775  82.831  1.00 10.66 ? 227 VAL D CA  1 
ATOM   6363  C C   . VAL D 1 205 ? 62.848  88.534  84.125  1.00 10.92 ? 227 VAL D C   1 
ATOM   6364  O O   . VAL D 1 205 ? 63.771  88.759  84.908  1.00 11.46 ? 227 VAL D O   1 
ATOM   6365  C CB  . VAL D 1 205 ? 63.155  86.274  83.113  1.00 10.00 ? 227 VAL D CB  1 
ATOM   6366  C CG1 . VAL D 1 205 ? 61.896  85.826  83.814  1.00 7.77  ? 227 VAL D CG1 1 
ATOM   6367  C CG2 . VAL D 1 205 ? 63.375  85.510  81.809  1.00 9.00  ? 227 VAL D CG2 1 
ATOM   6368  N N   . TYR D 1 206 ? 61.603  88.940  84.342  1.00 11.75 ? 228 TYR D N   1 
ATOM   6369  C CA  . TYR D 1 206 ? 61.228  89.709  85.527  1.00 9.55  ? 228 TYR D CA  1 
ATOM   6370  C C   . TYR D 1 206 ? 59.981  89.162  86.206  1.00 7.73  ? 228 TYR D C   1 
ATOM   6371  O O   . TYR D 1 206 ? 59.155  88.498  85.571  1.00 5.00  ? 228 TYR D O   1 
ATOM   6372  C CB  . TYR D 1 206 ? 60.983  91.175  85.134  1.00 9.64  ? 228 TYR D CB  1 
ATOM   6373  C CG  . TYR D 1 206 ? 62.142  91.824  84.414  1.00 8.30  ? 228 TYR D CG  1 
ATOM   6374  C CD1 . TYR D 1 206 ? 63.008  92.676  85.089  1.00 6.47  ? 228 TYR D CD1 1 
ATOM   6375  C CD2 . TYR D 1 206 ? 62.403  91.532  83.068  1.00 9.22  ? 228 TYR D CD2 1 
ATOM   6376  C CE1 . TYR D 1 206 ? 64.107  93.215  84.452  1.00 10.68 ? 228 TYR D CE1 1 
ATOM   6377  C CE2 . TYR D 1 206 ? 63.506  92.065  82.409  1.00 11.99 ? 228 TYR D CE2 1 
ATOM   6378  C CZ  . TYR D 1 206 ? 64.361  92.906  83.103  1.00 13.55 ? 228 TYR D CZ  1 
ATOM   6379  O OH  . TYR D 1 206 ? 65.468  93.432  82.455  1.00 14.33 ? 228 TYR D OH  1 
ATOM   6380  N N   . THR D 1 207 ? 59.847  89.463  87.495  1.00 8.78  ? 229 THR D N   1 
ATOM   6381  C CA  . THR D 1 207 ? 58.687  89.031  88.295  1.00 10.47 ? 229 THR D CA  1 
ATOM   6382  C C   . THR D 1 207 ? 57.462  89.906  88.041  1.00 9.77  ? 229 THR D C   1 
ATOM   6383  O O   . THR D 1 207 ? 57.521  91.123  88.224  1.00 10.61 ? 229 THR D O   1 
ATOM   6384  C CB  . THR D 1 207 ? 58.978  89.104  89.801  1.00 12.84 ? 229 THR D CB  1 
ATOM   6385  O OG1 . THR D 1 207 ? 60.214  88.436  90.081  1.00 15.30 ? 229 THR D OG1 1 
ATOM   6386  C CG2 . THR D 1 207 ? 57.872  88.423  90.573  1.00 8.15  ? 229 THR D CG2 1 
ATOM   6387  N N   . LYS D 1 208 ? 56.347  89.275  87.686  1.00 7.00  ? 230 LYS D N   1 
ATOM   6388  C CA  . LYS D 1 208 ? 55.104  89.977  87.390  1.00 5.00  ? 230 LYS D CA  1 
ATOM   6389  C C   . LYS D 1 208 ? 54.527  90.573  88.684  1.00 6.01  ? 230 LYS D C   1 
ATOM   6390  O O   . LYS D 1 208 ? 53.733  89.935  89.370  1.00 7.31  ? 230 LYS D O   1 
ATOM   6391  C CB  . LYS D 1 208 ? 54.139  88.982  86.756  1.00 5.00  ? 230 LYS D CB  1 
ATOM   6392  C CG  . LYS D 1 208 ? 53.393  89.517  85.572  1.00 5.00  ? 230 LYS D CG  1 
ATOM   6393  C CD  . LYS D 1 208 ? 52.548  88.433  84.899  1.00 5.00  ? 230 LYS D CD  1 
ATOM   6394  C CE  . LYS D 1 208 ? 51.678  89.021  83.782  1.00 5.00  ? 230 LYS D CE  1 
ATOM   6395  N NZ  . LYS D 1 208 ? 50.788  88.001  83.168  0.00 6.56  ? 230 LYS D NZ  1 
ATOM   6396  N N   . VAL D 1 209 ? 54.911  91.800  89.019  1.00 5.00  ? 231 VAL D N   1 
ATOM   6397  C CA  . VAL D 1 209 ? 54.448  92.431  90.253  1.00 6.25  ? 231 VAL D CA  1 
ATOM   6398  C C   . VAL D 1 209 ? 52.938  92.525  90.396  1.00 7.40  ? 231 VAL D C   1 
ATOM   6399  O O   . VAL D 1 209 ? 52.399  92.427  91.504  1.00 9.17  ? 231 VAL D O   1 
ATOM   6400  C CB  . VAL D 1 209 ? 55.094  93.831  90.462  1.00 5.00  ? 231 VAL D CB  1 
ATOM   6401  C CG1 . VAL D 1 209 ? 54.400  94.583  91.588  1.00 5.56  ? 231 VAL D CG1 1 
ATOM   6402  C CG2 . VAL D 1 209 ? 56.565  93.676  90.814  1.00 5.70  ? 231 VAL D CG2 1 
ATOM   6403  N N   . CYS D 1 210 ? 52.253  92.648  89.274  1.00 7.49  ? 232 CYS D N   1 
ATOM   6404  C CA  . CYS D 1 210 ? 50.805  92.762  89.273  1.00 12.68 ? 232 CYS D CA  1 
ATOM   6405  C C   . CYS D 1 210 ? 50.078  91.572  89.909  1.00 14.42 ? 232 CYS D C   1 
ATOM   6406  O O   . CYS D 1 210 ? 49.054  91.744  90.559  1.00 15.77 ? 232 CYS D O   1 
ATOM   6407  C CB  . CYS D 1 210 ? 50.294  93.007  87.859  1.00 16.47 ? 232 CYS D CB  1 
ATOM   6408  S SG  . CYS D 1 210 ? 50.418  91.583  86.746  1.00 17.98 ? 232 CYS D SG  1 
ATOM   6409  N N   . ASN D 1 211 ? 50.614  90.372  89.742  1.00 13.86 ? 233 ASN D N   1 
ATOM   6410  C CA  . ASN D 1 211 ? 50.013  89.183  90.327  1.00 11.43 ? 233 ASN D CA  1 
ATOM   6411  C C   . ASN D 1 211 ? 50.205  89.174  91.843  1.00 14.78 ? 233 ASN D C   1 
ATOM   6412  O O   . ASN D 1 211 ? 49.562  88.392  92.538  1.00 16.59 ? 233 ASN D O   1 
ATOM   6413  C CB  . ASN D 1 211 ? 50.664  87.908  89.773  1.00 13.64 ? 233 ASN D CB  1 
ATOM   6414  C CG  . ASN D 1 211 ? 50.403  87.692  88.289  1.00 14.84 ? 233 ASN D CG  1 
ATOM   6415  O OD1 . ASN D 1 211 ? 49.768  88.514  87.627  1.00 15.15 ? 233 ASN D OD1 1 
ATOM   6416  N ND2 . ASN D 1 211 ? 50.895  86.572  87.760  1.00 13.65 ? 233 ASN D ND2 1 
ATOM   6417  N N   . TYR D 1 212 ? 51.101  90.015  92.367  1.00 15.48 ? 234 TYR D N   1 
ATOM   6418  C CA  . TYR D 1 212 ? 51.369  90.029  93.814  1.00 13.01 ? 234 TYR D CA  1 
ATOM   6419  C C   . TYR D 1 212 ? 50.881  91.245  94.594  1.00 12.03 ? 234 TYR D C   1 
ATOM   6420  O O   . TYR D 1 212 ? 51.101  91.318  95.811  1.00 11.43 ? 234 TYR D O   1 
ATOM   6421  C CB  . TYR D 1 212 ? 52.856  89.814  94.093  1.00 9.74  ? 234 TYR D CB  1 
ATOM   6422  C CG  . TYR D 1 212 ? 53.435  88.575  93.470  1.00 6.05  ? 234 TYR D CG  1 
ATOM   6423  C CD1 . TYR D 1 212 ? 53.415  87.375  94.144  1.00 8.05  ? 234 TYR D CD1 1 
ATOM   6424  C CD2 . TYR D 1 212 ? 53.982  88.601  92.190  1.00 5.00  ? 234 TYR D CD2 1 
ATOM   6425  C CE1 . TYR D 1 212 ? 53.926  86.214  93.558  1.00 8.73  ? 234 TYR D CE1 1 
ATOM   6426  C CE2 . TYR D 1 212 ? 54.488  87.452  91.596  1.00 5.00  ? 234 TYR D CE2 1 
ATOM   6427  C CZ  . TYR D 1 212 ? 54.457  86.263  92.286  1.00 5.00  ? 234 TYR D CZ  1 
ATOM   6428  O OH  . TYR D 1 212 ? 54.952  85.116  91.736  1.00 5.00  ? 234 TYR D OH  1 
ATOM   6429  N N   . VAL D 1 213 ? 50.188  92.162  93.916  1.00 9.51  ? 235 VAL D N   1 
ATOM   6430  C CA  . VAL D 1 213 ? 49.651  93.366  94.557  1.00 7.85  ? 235 VAL D CA  1 
ATOM   6431  C C   . VAL D 1 213 ? 48.854  93.063  95.827  1.00 7.47  ? 235 VAL D C   1 
ATOM   6432  O O   . VAL D 1 213 ? 49.014  93.728  96.850  1.00 5.00  ? 235 VAL D O   1 
ATOM   6433  C CB  . VAL D 1 213 ? 48.739  94.162  93.618  1.00 5.00  ? 235 VAL D CB  1 
ATOM   6434  C CG1 . VAL D 1 213 ? 48.338  95.440  94.279  1.00 5.00  ? 235 VAL D CG1 1 
ATOM   6435  C CG2 . VAL D 1 213 ? 49.432  94.466  92.334  1.00 8.23  ? 235 VAL D CG2 1 
ATOM   6436  N N   . SER D 1 214 ? 47.976  92.070  95.755  1.00 10.56 ? 236 SER D N   1 
ATOM   6437  C CA  . SER D 1 214 ? 47.168  91.699  96.909  1.00 13.05 ? 236 SER D CA  1 
ATOM   6438  C C   . SER D 1 214 ? 48.071  91.284  98.069  1.00 11.85 ? 236 SER D C   1 
ATOM   6439  O O   . SER D 1 214 ? 48.021  91.871  99.161  1.00 10.70 ? 236 SER D O   1 
ATOM   6440  C CB  . SER D 1 214 ? 46.206  90.567  96.543  1.00 14.71 ? 236 SER D CB  1 
ATOM   6441  O OG  . SER D 1 214 ? 45.460  90.899  95.383  0.00 15.98 ? 236 SER D OG  1 
ATOM   6442  N N   . TRP D 1 215 ? 48.943  90.314  97.803  1.00 10.79 ? 237 TRP D N   1 
ATOM   6443  C CA  . TRP D 1 215 ? 49.865  89.824  98.819  1.00 8.30  ? 237 TRP D CA  1 
ATOM   6444  C C   . TRP D 1 215 ? 50.612  90.984  99.437  1.00 8.63  ? 237 TRP D C   1 
ATOM   6445  O O   . TRP D 1 215 ? 50.673  91.117  100.657 1.00 8.02  ? 237 TRP D O   1 
ATOM   6446  C CB  . TRP D 1 215 ? 50.871  88.847  98.245  1.00 5.00  ? 237 TRP D CB  1 
ATOM   6447  C CG  . TRP D 1 215 ? 51.816  88.412  99.282  1.00 5.00  ? 237 TRP D CG  1 
ATOM   6448  C CD1 . TRP D 1 215 ? 51.541  87.611  100.329 1.00 7.00  ? 237 TRP D CD1 1 
ATOM   6449  C CD2 . TRP D 1 215 ? 53.206  88.755  99.392  1.00 8.53  ? 237 TRP D CD2 1 
ATOM   6450  N NE1 . TRP D 1 215 ? 52.668  87.412  101.089 1.00 8.89  ? 237 TRP D NE1 1 
ATOM   6451  C CE2 . TRP D 1 215 ? 53.706  88.102  100.534 1.00 7.76  ? 237 TRP D CE2 1 
ATOM   6452  C CE3 . TRP D 1 215 ? 54.073  89.551  98.637  1.00 9.36  ? 237 TRP D CE3 1 
ATOM   6453  C CZ2 . TRP D 1 215 ? 55.032  88.216  100.939 1.00 5.44  ? 237 TRP D CZ2 1 
ATOM   6454  C CZ3 . TRP D 1 215 ? 55.386  89.665  99.042  1.00 7.72  ? 237 TRP D CZ3 1 
ATOM   6455  C CH2 . TRP D 1 215 ? 55.853  89.000  100.182 1.00 7.83  ? 237 TRP D CH2 1 
ATOM   6456  N N   . ILE D 1 216 ? 51.192  91.823  98.588  1.00 9.72  ? 238 ILE D N   1 
ATOM   6457  C CA  . ILE D 1 216 ? 51.914  92.985  99.081  1.00 8.68  ? 238 ILE D CA  1 
ATOM   6458  C C   . ILE D 1 216 ? 51.015  93.760  100.060 1.00 9.53  ? 238 ILE D C   1 
ATOM   6459  O O   . ILE D 1 216 ? 51.345  93.896  101.244 1.00 8.31  ? 238 ILE D O   1 
ATOM   6460  C CB  . ILE D 1 216 ? 52.339  93.920  97.941  1.00 5.00  ? 238 ILE D CB  1 
ATOM   6461  C CG1 . ILE D 1 216 ? 53.159  93.163  96.912  1.00 5.00  ? 238 ILE D CG1 1 
ATOM   6462  C CG2 . ILE D 1 216 ? 53.133  95.066  98.493  1.00 5.00  ? 238 ILE D CG2 1 
ATOM   6463  C CD1 . ILE D 1 216 ? 53.555  94.008  95.704  1.00 5.00  ? 238 ILE D CD1 1 
ATOM   6464  N N   . LYS D 1 217 ? 49.834  94.157  99.582  1.00 9.90  ? 239 LYS D N   1 
ATOM   6465  C CA  . LYS D 1 217 ? 48.896  94.923  100.394 1.00 7.77  ? 239 LYS D CA  1 
ATOM   6466  C C   . LYS D 1 217 ? 48.535  94.250  101.718 1.00 6.91  ? 239 LYS D C   1 
ATOM   6467  O O   . LYS D 1 217 ? 48.514  94.921  102.764 1.00 5.26  ? 239 LYS D O   1 
ATOM   6468  C CB  . LYS D 1 217 ? 47.643  95.284  99.595  1.00 5.67  ? 239 LYS D CB  1 
ATOM   6469  C CG  . LYS D 1 217 ? 47.815  96.430  98.612  1.00 5.00  ? 239 LYS D CG  1 
ATOM   6470  C CD  . LYS D 1 217 ? 46.519  96.661  97.841  0.00 7.28  ? 239 LYS D CD  1 
ATOM   6471  C CE  . LYS D 1 217 ? 46.657  97.780  96.821  0.00 8.13  ? 239 LYS D CE  1 
ATOM   6472  N NZ  . LYS D 1 217 ? 45.394  97.991  96.057  0.00 8.33  ? 239 LYS D NZ  1 
ATOM   6473  N N   . GLN D 1 218 ? 48.308  92.938  101.705 1.00 5.87  ? 240 GLN D N   1 
ATOM   6474  C CA  . GLN D 1 218 ? 47.963  92.261  102.956 1.00 9.86  ? 240 GLN D CA  1 
ATOM   6475  C C   . GLN D 1 218 ? 49.148  92.230  103.954 1.00 12.12 ? 240 GLN D C   1 
ATOM   6476  O O   . GLN D 1 218 ? 49.005  92.593  105.137 1.00 12.62 ? 240 GLN D O   1 
ATOM   6477  C CB  . GLN D 1 218 ? 47.404  90.854  102.704 1.00 7.59  ? 240 GLN D CB  1 
ATOM   6478  C CG  . GLN D 1 218 ? 46.902  90.146  103.962 0.00 10.58 ? 240 GLN D CG  1 
ATOM   6479  C CD  . GLN D 1 218 ? 45.700  90.830  104.593 0.00 11.37 ? 240 GLN D CD  1 
ATOM   6480  O OE1 . GLN D 1 218 ? 44.616  90.865  104.013 0.00 12.11 ? 240 GLN D OE1 1 
ATOM   6481  N NE2 . GLN D 1 218 ? 45.884  91.368  105.792 0.00 11.95 ? 240 GLN D NE2 1 
ATOM   6482  N N   . THR D 1 219 ? 50.333  91.902  103.451 1.00 11.15 ? 241 THR D N   1 
ATOM   6483  C CA  . THR D 1 219 ? 51.537  91.819  104.271 1.00 8.46  ? 241 THR D CA  1 
ATOM   6484  C C   . THR D 1 219 ? 51.855  93.108  105.008 1.00 6.42  ? 241 THR D C   1 
ATOM   6485  O O   . THR D 1 219 ? 52.267  93.102  106.157 1.00 5.00  ? 241 THR D O   1 
ATOM   6486  C CB  . THR D 1 219 ? 52.730  91.460  103.412 1.00 7.56  ? 241 THR D CB  1 
ATOM   6487  O OG1 . THR D 1 219 ? 52.450  90.252  102.694 1.00 10.25 ? 241 THR D OG1 1 
ATOM   6488  C CG2 . THR D 1 219 ? 53.933  91.256  104.267 1.00 6.82  ? 241 THR D CG2 1 
ATOM   6489  N N   . ILE D 1 220 ? 51.677  94.214  104.311 1.00 8.16  ? 242 ILE D N   1 
ATOM   6490  C CA  . ILE D 1 220 ? 51.928  95.542  104.844 1.00 7.45  ? 242 ILE D CA  1 
ATOM   6491  C C   . ILE D 1 220 ? 50.951  95.908  105.961 1.00 9.69  ? 242 ILE D C   1 
ATOM   6492  O O   . ILE D 1 220 ? 51.335  96.471  107.003 1.00 8.34  ? 242 ILE D O   1 
ATOM   6493  C CB  . ILE D 1 220 ? 51.811  96.559  103.699 1.00 5.00  ? 242 ILE D CB  1 
ATOM   6494  C CG1 . ILE D 1 220 ? 52.997  96.385  102.756 1.00 10.21 ? 242 ILE D CG1 1 
ATOM   6495  C CG2 . ILE D 1 220 ? 51.736  97.972  104.221 1.00 8.89  ? 242 ILE D CG2 1 
ATOM   6496  C CD1 . ILE D 1 220 ? 52.816  97.041  101.415 1.00 14.33 ? 242 ILE D CD1 1 
ATOM   6497  N N   . ALA D 1 221 ? 49.682  95.585  105.735 1.00 10.77 ? 243 ALA D N   1 
ATOM   6498  C CA  . ALA D 1 221 ? 48.635  95.898  106.697 1.00 10.30 ? 243 ALA D CA  1 
ATOM   6499  C C   . ALA D 1 221 ? 48.733  95.133  108.005 1.00 9.10  ? 243 ALA D C   1 
ATOM   6500  O O   . ALA D 1 221 ? 48.242  95.601  109.037 1.00 9.76  ? 243 ALA D O   1 
ATOM   6501  C CB  . ALA D 1 221 ? 47.280  95.662  106.067 1.00 11.63 ? 243 ALA D CB  1 
ATOM   6502  N N   . SER D 1 222 ? 49.310  93.937  107.944 1.00 7.34  ? 244 SER D N   1 
ATOM   6503  C CA  . SER D 1 222 ? 49.440  93.081  109.117 1.00 5.04  ? 244 SER D CA  1 
ATOM   6504  C C   . SER D 1 222 ? 50.763  93.124  109.863 1.00 5.00  ? 244 SER D C   1 
ATOM   6505  O O   . SER D 1 222 ? 50.822  92.682  111.001 1.00 5.00  ? 244 SER D O   1 
ATOM   6506  C CB  . SER D 1 222 ? 49.164  91.643  108.710 1.00 5.00  ? 244 SER D CB  1 
ATOM   6507  O OG  . SER D 1 222 ? 48.211  91.606  107.665 1.00 5.00  ? 244 SER D OG  1 
ATOM   6508  N N   . ASN D 1 223 ? 51.819  93.612  109.220 1.00 5.00  ? 245 ASN D N   1 
ATOM   6509  C CA  . ASN D 1 223 ? 53.130  93.658  109.843 1.00 5.00  ? 245 ASN D CA  1 
ATOM   6510  C C   . ASN D 1 223 ? 53.617  95.066  110.104 1.00 8.38  ? 245 ASN D C   1 
ATOM   6511  O O   . ASN D 1 223 ? 54.830  95.291  110.110 1.00 8.64  ? 245 ASN D O   1 
ATOM   6512  C CB  . ASN D 1 223 ? 54.116  92.931  108.971 1.00 5.00  ? 245 ASN D CB  1 
ATOM   6513  C CG  . ASN D 1 223 ? 53.775  91.493  108.812 1.00 5.00  ? 245 ASN D CG  1 
ATOM   6514  O OD1 . ASN D 1 223 ? 53.990  90.703  109.719 1.00 5.00  ? 245 ASN D OD1 1 
ATOM   6515  N ND2 . ASN D 1 223 ? 53.261  91.125  107.649 1.00 5.00  ? 245 ASN D ND2 1 
ATOM   6516  O OXT . ASN D 1 223 ? 52.774  95.949  110.331 1.00 16.61 ? 245 ASN D OXT 1 
ATOM   6517  N N   . ILE E 1 1   ? 82.255  33.544  68.653  1.00 19.84 ? 16  ILE E N   1 
ATOM   6518  C CA  . ILE E 1 1   ? 81.007  34.342  68.551  1.00 19.84 ? 16  ILE E CA  1 
ATOM   6519  C C   . ILE E 1 1   ? 79.890  33.386  68.191  1.00 23.50 ? 16  ILE E C   1 
ATOM   6520  O O   . ILE E 1 1   ? 79.837  32.909  67.058  1.00 23.93 ? 16  ILE E O   1 
ATOM   6521  C CB  . ILE E 1 1   ? 81.129  35.383  67.435  1.00 19.20 ? 16  ILE E CB  1 
ATOM   6522  C CG1 . ILE E 1 1   ? 82.175  36.430  67.812  1.00 19.08 ? 16  ILE E CG1 1 
ATOM   6523  C CG2 . ILE E 1 1   ? 79.777  36.026  67.142  1.00 17.07 ? 16  ILE E CG2 1 
ATOM   6524  C CD1 . ILE E 1 1   ? 81.756  37.325  68.945  1.00 20.96 ? 16  ILE E CD1 1 
ATOM   6525  N N   . VAL E 1 2   ? 79.035  33.073  69.168  1.00 27.93 ? 17  VAL E N   1 
ATOM   6526  C CA  . VAL E 1 2   ? 77.915  32.155  68.960  1.00 29.41 ? 17  VAL E CA  1 
ATOM   6527  C C   . VAL E 1 2   ? 76.883  32.869  68.113  1.00 30.30 ? 17  VAL E C   1 
ATOM   6528  O O   . VAL E 1 2   ? 76.456  33.979  68.435  1.00 30.70 ? 17  VAL E O   1 
ATOM   6529  C CB  . VAL E 1 2   ? 77.280  31.692  70.292  0.00 30.07 ? 17  VAL E CB  1 
ATOM   6530  C CG1 . VAL E 1 2   ? 76.095  30.775  70.020  0.00 31.01 ? 17  VAL E CG1 1 
ATOM   6531  C CG2 . VAL E 1 2   ? 78.310  30.959  71.128  0.00 31.06 ? 17  VAL E CG2 1 
ATOM   6532  N N   . GLY E 1 3   ? 76.560  32.263  66.980  1.00 31.90 ? 18  GLY E N   1 
ATOM   6533  C CA  . GLY E 1 3   ? 75.578  32.840  66.082  1.00 32.55 ? 18  GLY E CA  1 
ATOM   6534  C C   . GLY E 1 3   ? 76.021  34.154  65.484  1.00 30.63 ? 18  GLY E C   1 
ATOM   6535  O O   . GLY E 1 3   ? 75.410  35.194  65.720  1.00 30.71 ? 18  GLY E O   1 
ATOM   6536  N N   . GLY E 1 4   ? 77.096  34.101  64.710  1.00 30.19 ? 19  GLY E N   1 
ATOM   6537  C CA  . GLY E 1 4   ? 77.602  35.297  64.070  1.00 29.16 ? 19  GLY E CA  1 
ATOM   6538  C C   . GLY E 1 4   ? 77.798  35.058  62.589  1.00 27.30 ? 19  GLY E C   1 
ATOM   6539  O O   . GLY E 1 4   ? 77.393  34.025  62.057  1.00 30.79 ? 19  GLY E O   1 
ATOM   6540  N N   . TYR E 1 5   ? 78.418  36.016  61.921  1.00 23.78 ? 20  TYR E N   1 
ATOM   6541  C CA  . TYR E 1 5   ? 78.686  35.908  60.499  1.00 22.84 ? 20  TYR E CA  1 
ATOM   6542  C C   . TYR E 1 5   ? 80.176  36.151  60.288  1.00 25.89 ? 20  TYR E C   1 
ATOM   6543  O O   . TYR E 1 5   ? 80.797  36.889  61.053  1.00 28.99 ? 20  TYR E O   1 
ATOM   6544  C CB  . TYR E 1 5   ? 77.889  36.964  59.738  1.00 20.51 ? 20  TYR E CB  1 
ATOM   6545  C CG  . TYR E 1 5   ? 78.318  38.402  59.994  1.00 16.46 ? 20  TYR E CG  1 
ATOM   6546  C CD1 . TYR E 1 5   ? 79.260  39.029  59.177  1.00 14.73 ? 20  TYR E CD1 1 
ATOM   6547  C CD2 . TYR E 1 5   ? 77.752  39.146  61.023  1.00 14.27 ? 20  TYR E CD2 1 
ATOM   6548  C CE1 . TYR E 1 5   ? 79.618  40.357  59.376  1.00 13.60 ? 20  TYR E CE1 1 
ATOM   6549  C CE2 . TYR E 1 5   ? 78.109  40.475  61.233  1.00 11.99 ? 20  TYR E CE2 1 
ATOM   6550  C CZ  . TYR E 1 5   ? 79.041  41.075  60.403  1.00 11.51 ? 20  TYR E CZ  1 
ATOM   6551  O OH  . TYR E 1 5   ? 79.412  42.388  60.588  1.00 7.40  ? 20  TYR E OH  1 
ATOM   6552  N N   . THR E 1 6   ? 80.765  35.528  59.276  1.00 25.04 ? 21  THR E N   1 
ATOM   6553  C CA  . THR E 1 6   ? 82.174  35.744  59.004  1.00 21.30 ? 21  THR E CA  1 
ATOM   6554  C C   . THR E 1 6   ? 82.310  37.210  58.625  1.00 19.37 ? 21  THR E C   1 
ATOM   6555  O O   . THR E 1 6   ? 81.511  37.715  57.840  1.00 18.62 ? 21  THR E O   1 
ATOM   6556  C CB  . THR E 1 6   ? 82.632  34.923  57.812  1.00 21.51 ? 21  THR E CB  1 
ATOM   6557  O OG1 . THR E 1 6   ? 82.205  33.564  57.968  1.00 22.86 ? 21  THR E OG1 1 
ATOM   6558  C CG2 . THR E 1 6   ? 84.144  34.974  57.709  1.00 24.20 ? 21  THR E CG2 1 
ATOM   6559  N N   . CYS E 1 7   ? 83.279  37.903  59.209  1.00 18.52 ? 22  CYS E N   1 
ATOM   6560  C CA  . CYS E 1 7   ? 83.477  39.308  58.883  1.00 19.08 ? 22  CYS E CA  1 
ATOM   6561  C C   . CYS E 1 7   ? 84.051  39.392  57.468  1.00 22.48 ? 22  CYS E C   1 
ATOM   6562  O O   . CYS E 1 7   ? 83.667  40.254  56.687  1.00 25.02 ? 22  CYS E O   1 
ATOM   6563  C CB  . CYS E 1 7   ? 84.432  39.955  59.870  1.00 15.79 ? 22  CYS E CB  1 
ATOM   6564  S SG  . CYS E 1 7   ? 84.081  39.548  61.598  1.00 10.05 ? 22  CYS E SG  1 
ATOM   6565  N N   . GLY E 1 8   ? 84.956  38.476  57.138  0.00 24.57 ? 23  GLY E N   1 
ATOM   6566  C CA  . GLY E 1 8   ? 85.550  38.458  55.811  0.00 27.98 ? 23  GLY E CA  1 
ATOM   6567  C C   . GLY E 1 8   ? 86.411  39.662  55.478  0.00 30.73 ? 23  GLY E C   1 
ATOM   6568  O O   . GLY E 1 8   ? 86.356  40.688  56.159  0.00 29.02 ? 23  GLY E O   1 
ATOM   6569  N N   . ALA E 1 9   ? 87.214  39.524  54.425  0.00 35.07 ? 24  ALA E N   1 
ATOM   6570  C CA  . ALA E 1 9   ? 88.114  40.580  53.964  0.00 41.93 ? 24  ALA E CA  1 
ATOM   6571  C C   . ALA E 1 9   ? 88.859  41.223  55.136  0.00 49.40 ? 24  ALA E C   1 
ATOM   6572  O O   . ALA E 1 9   ? 89.749  40.603  55.720  0.00 48.95 ? 24  ALA E O   1 
ATOM   6573  C CB  . ALA E 1 9   ? 87.338  41.628  53.161  0.00 42.16 ? 24  ALA E CB  1 
ATOM   6574  N N   . ASN E 1 10  ? 88.477  42.448  55.491  1.00 57.67 ? 25  ASN E N   1 
ATOM   6575  C CA  . ASN E 1 10  ? 89.096  43.167  56.603  1.00 61.36 ? 25  ASN E CA  1 
ATOM   6576  C C   . ASN E 1 10  ? 88.315  44.446  56.936  1.00 56.38 ? 25  ASN E C   1 
ATOM   6577  O O   . ASN E 1 10  ? 88.510  45.504  56.328  1.00 53.38 ? 25  ASN E O   1 
ATOM   6578  C CB  . ASN E 1 10  ? 90.561  43.490  56.302  1.00 68.08 ? 25  ASN E CB  1 
ATOM   6579  C CG  . ASN E 1 10  ? 91.375  43.676  57.560  1.00 78.12 ? 25  ASN E CG  1 
ATOM   6580  O OD1 . ASN E 1 10  ? 90.854  43.559  58.676  1.00 82.67 ? 25  ASN E OD1 1 
ATOM   6581  N ND2 . ASN E 1 10  ? 92.659  43.968  57.392  1.00 84.29 ? 25  ASN E ND2 1 
ATOM   6582  N N   . THR E 1 11  ? 87.396  44.308  57.885  1.00 51.64 ? 26  THR E N   1 
ATOM   6583  C CA  . THR E 1 11  ? 86.546  45.398  58.335  1.00 44.51 ? 26  THR E CA  1 
ATOM   6584  C C   . THR E 1 11  ? 86.650  45.565  59.846  1.00 34.98 ? 26  THR E C   1 
ATOM   6585  O O   . THR E 1 11  ? 85.948  46.379  60.434  1.00 34.80 ? 26  THR E O   1 
ATOM   6586  C CB  . THR E 1 11  ? 85.110  45.105  57.954  1.00 50.42 ? 26  THR E CB  1 
ATOM   6587  O OG1 . THR E 1 11  ? 84.755  43.803  58.450  1.00 53.51 ? 26  THR E OG1 1 
ATOM   6588  C CG2 . THR E 1 11  ? 84.974  45.114  56.425  1.00 53.51 ? 26  THR E CG2 1 
ATOM   6589  N N   . VAL E 1 12  ? 87.526  44.770  60.457  1.00 26.59 ? 27  VAL E N   1 
ATOM   6590  C CA  . VAL E 1 12  ? 87.782  44.811  61.891  1.00 18.92 ? 27  VAL E CA  1 
ATOM   6591  C C   . VAL E 1 12  ? 89.308  44.831  61.970  1.00 16.00 ? 27  VAL E C   1 
ATOM   6592  O O   . VAL E 1 12  ? 89.937  43.903  62.510  1.00 17.91 ? 27  VAL E O   1 
ATOM   6593  C CB  . VAL E 1 12  ? 87.264  43.537  62.622  1.00 17.11 ? 27  VAL E CB  1 
ATOM   6594  C CG1 . VAL E 1 12  ? 86.923  43.867  64.070  1.00 13.56 ? 27  VAL E CG1 1 
ATOM   6595  C CG2 . VAL E 1 12  ? 86.069  42.949  61.907  1.00 14.99 ? 27  VAL E CG2 1 
ATOM   6596  N N   . PRO E 1 13  ? 89.919  45.921  61.490  1.00 10.00 ? 28  PRO E N   1 
ATOM   6597  C CA  . PRO E 1 13  ? 91.360  46.171  61.441  1.00 8.93  ? 28  PRO E CA  1 
ATOM   6598  C C   . PRO E 1 13  ? 91.995  46.264  62.799  1.00 8.66  ? 28  PRO E C   1 
ATOM   6599  O O   . PRO E 1 13  ? 93.145  45.905  62.975  1.00 9.64  ? 28  PRO E O   1 
ATOM   6600  C CB  . PRO E 1 13  ? 91.451  47.535  60.773  1.00 9.38  ? 28  PRO E CB  1 
ATOM   6601  C CG  . PRO E 1 13  ? 90.105  47.763  60.180  1.00 11.92 ? 28  PRO E CG  1 
ATOM   6602  C CD  . PRO E 1 13  ? 89.197  47.156  61.178  1.00 9.09  ? 28  PRO E CD  1 
ATOM   6603  N N   . TYR E 1 14  ? 91.241  46.796  63.747  1.00 10.07 ? 29  TYR E N   1 
ATOM   6604  C CA  . TYR E 1 14  ? 91.710  46.987  65.115  1.00 8.65  ? 29  TYR E CA  1 
ATOM   6605  C C   . TYR E 1 14  ? 91.682  45.718  65.948  1.00 6.62  ? 29  TYR E C   1 
ATOM   6606  O O   . TYR E 1 14  ? 92.028  45.758  67.127  1.00 5.82  ? 29  TYR E O   1 
ATOM   6607  C CB  . TYR E 1 14  ? 90.860  48.067  65.792  1.00 10.71 ? 29  TYR E CB  1 
ATOM   6608  C CG  . TYR E 1 14  ? 89.377  47.771  65.700  1.00 14.80 ? 29  TYR E CG  1 
ATOM   6609  C CD1 . TYR E 1 14  ? 88.774  46.862  66.574  1.00 18.29 ? 29  TYR E CD1 1 
ATOM   6610  C CD2 . TYR E 1 14  ? 88.600  48.305  64.679  1.00 16.09 ? 29  TYR E CD2 1 
ATOM   6611  C CE1 . TYR E 1 14  ? 87.436  46.475  66.424  1.00 19.58 ? 29  TYR E CE1 1 
ATOM   6612  C CE2 . TYR E 1 14  ? 87.254  47.923  64.522  1.00 19.37 ? 29  TYR E CE2 1 
ATOM   6613  C CZ  . TYR E 1 14  ? 86.683  47.004  65.392  1.00 18.92 ? 29  TYR E CZ  1 
ATOM   6614  O OH  . TYR E 1 14  ? 85.383  46.580  65.202  1.00 17.40 ? 29  TYR E OH  1 
ATOM   6615  N N   . GLN E 1 15  ? 91.245  44.611  65.353  1.00 5.00  ? 30  GLN E N   1 
ATOM   6616  C CA  . GLN E 1 15  ? 91.164  43.344  66.070  1.00 5.63  ? 30  GLN E CA  1 
ATOM   6617  C C   . GLN E 1 15  ? 92.539  42.707  66.195  1.00 7.76  ? 30  GLN E C   1 
ATOM   6618  O O   . GLN E 1 15  ? 93.328  42.807  65.266  1.00 11.21 ? 30  GLN E O   1 
ATOM   6619  C CB  . GLN E 1 15  ? 90.238  42.386  65.313  1.00 5.00  ? 30  GLN E CB  1 
ATOM   6620  C CG  . GLN E 1 15  ? 90.149  40.985  65.897  1.00 5.00  ? 30  GLN E CG  1 
ATOM   6621  C CD  . GLN E 1 15  ? 89.148  40.851  67.008  1.00 5.00  ? 30  GLN E CD  1 
ATOM   6622  O OE1 . GLN E 1 15  ? 89.345  40.082  67.933  1.00 7.63  ? 30  GLN E OE1 1 
ATOM   6623  N NE2 . GLN E 1 15  ? 88.048  41.561  66.904  1.00 5.00  ? 30  GLN E NE2 1 
ATOM   6624  N N   . VAL E 1 16  ? 92.857  42.119  67.347  1.00 7.30  ? 31  VAL E N   1 
ATOM   6625  C CA  . VAL E 1 16  ? 94.130  41.412  67.527  1.00 8.63  ? 31  VAL E CA  1 
ATOM   6626  C C   . VAL E 1 16  ? 93.903  40.146  68.350  1.00 11.69 ? 31  VAL E C   1 
ATOM   6627  O O   . VAL E 1 16  ? 92.992  40.092  69.192  1.00 14.11 ? 31  VAL E O   1 
ATOM   6628  C CB  . VAL E 1 16  ? 95.227  42.242  68.234  1.00 7.25  ? 31  VAL E CB  1 
ATOM   6629  C CG1 . VAL E 1 16  ? 95.235  43.649  67.727  1.00 9.98  ? 31  VAL E CG1 1 
ATOM   6630  C CG2 . VAL E 1 16  ? 95.073  42.188  69.747  1.00 7.51  ? 31  VAL E CG2 1 
ATOM   6631  N N   . SER E 1 17  ? 94.743  39.142  68.112  1.00 11.46 ? 32  SER E N   1 
ATOM   6632  C CA  . SER E 1 17  ? 94.674  37.861  68.802  1.00 8.44  ? 32  SER E CA  1 
ATOM   6633  C C   . SER E 1 17  ? 95.781  37.695  69.835  1.00 6.70  ? 32  SER E C   1 
ATOM   6634  O O   . SER E 1 17  ? 96.937  37.865  69.515  1.00 11.32 ? 32  SER E O   1 
ATOM   6635  C CB  . SER E 1 17  ? 94.786  36.741  67.783  1.00 8.09  ? 32  SER E CB  1 
ATOM   6636  O OG  . SER E 1 17  ? 94.976  35.509  68.448  1.00 12.32 ? 32  SER E OG  1 
ATOM   6637  N N   . LEU E 1 18  ? 95.440  37.354  71.066  1.00 5.00  ? 33  LEU E N   1 
ATOM   6638  C CA  . LEU E 1 18  ? 96.453  37.159  72.082  1.00 5.00  ? 33  LEU E CA  1 
ATOM   6639  C C   . LEU E 1 18  ? 96.782  35.696  72.038  1.00 6.20  ? 33  LEU E C   1 
ATOM   6640  O O   . LEU E 1 18  ? 95.910  34.842  72.147  1.00 6.73  ? 33  LEU E O   1 
ATOM   6641  C CB  . LEU E 1 18  ? 95.958  37.544  73.475  1.00 5.00  ? 33  LEU E CB  1 
ATOM   6642  C CG  . LEU E 1 18  ? 95.626  39.017  73.671  1.00 5.00  ? 33  LEU E CG  1 
ATOM   6643  C CD1 . LEU E 1 18  ? 95.585  39.336  75.142  1.00 5.00  ? 33  LEU E CD1 1 
ATOM   6644  C CD2 . LEU E 1 18  ? 96.653  39.868  72.986  1.00 7.75  ? 33  LEU E CD2 1 
ATOM   6645  N N   . ASN E 1 19  ? 98.044  35.407  71.818  1.00 10.13 ? 34  ASN E N   1 
ATOM   6646  C CA  . ASN E 1 19  ? 98.503  34.048  71.737  1.00 14.07 ? 34  ASN E CA  1 
ATOM   6647  C C   . ASN E 1 19  ? 99.470  33.780  72.886  1.00 14.44 ? 34  ASN E C   1 
ATOM   6648  O O   . ASN E 1 19  ? 100.148 34.700  73.362  1.00 14.13 ? 34  ASN E O   1 
ATOM   6649  C CB  . ASN E 1 19  ? 99.202  33.855  70.386  1.00 18.54 ? 34  ASN E CB  1 
ATOM   6650  C CG  . ASN E 1 19  ? 99.945  32.534  70.290  1.00 26.53 ? 34  ASN E CG  1 
ATOM   6651  O OD1 . ASN E 1 19  ? 100.963 32.321  70.957  1.00 27.87 ? 34  ASN E OD1 1 
ATOM   6652  N ND2 . ASN E 1 19  ? 99.447  31.639  69.441  1.00 33.67 ? 34  ASN E ND2 1 
ATOM   6653  N N   . SER E 1 20  ? 99.469  32.534  73.359  1.00 15.29 ? 37  SER E N   1 
ATOM   6654  C CA  . SER E 1 20  ? 100.372 32.043  74.418  1.00 15.43 ? 37  SER E CA  1 
ATOM   6655  C C   . SER E 1 20  ? 100.580 30.567  74.048  1.00 13.58 ? 37  SER E C   1 
ATOM   6656  O O   . SER E 1 20  ? 100.324 29.657  74.841  1.00 10.31 ? 37  SER E O   1 
ATOM   6657  C CB  . SER E 1 20  ? 99.717  32.149  75.797  1.00 16.49 ? 37  SER E CB  1 
ATOM   6658  O OG  . SER E 1 20  ? 98.515  31.381  75.838  1.00 20.71 ? 37  SER E OG  1 
ATOM   6659  N N   . GLY E 1 21  ? 101.031 30.349  72.818  1.00 12.84 ? 38  GLY E N   1 
ATOM   6660  C CA  . GLY E 1 21  ? 101.211 29.006  72.306  1.00 13.79 ? 38  GLY E CA  1 
ATOM   6661  C C   . GLY E 1 21  ? 100.015 28.755  71.390  1.00 15.19 ? 38  GLY E C   1 
ATOM   6662  O O   . GLY E 1 21  ? 100.114 28.152  70.321  1.00 17.25 ? 38  GLY E O   1 
ATOM   6663  N N   . TYR E 1 22  ? 98.874  29.292  71.789  1.00 14.00 ? 39  TYR E N   1 
ATOM   6664  C CA  . TYR E 1 22  ? 97.646  29.144  71.041  1.00 13.35 ? 39  TYR E CA  1 
ATOM   6665  C C   . TYR E 1 22  ? 96.820  30.386  71.344  1.00 14.95 ? 39  TYR E C   1 
ATOM   6666  O O   . TYR E 1 22  ? 97.170  31.172  72.245  1.00 13.82 ? 39  TYR E O   1 
ATOM   6667  C CB  . TYR E 1 22  ? 96.903  27.899  71.520  1.00 15.73 ? 39  TYR E CB  1 
ATOM   6668  C CG  . TYR E 1 22  ? 96.612  27.921  73.003  1.00 19.74 ? 39  TYR E CG  1 
ATOM   6669  C CD1 . TYR E 1 22  ? 97.514  27.385  73.918  1.00 20.70 ? 39  TYR E CD1 1 
ATOM   6670  C CD2 . TYR E 1 22  ? 95.449  28.514  73.497  1.00 22.16 ? 39  TYR E CD2 1 
ATOM   6671  C CE1 . TYR E 1 22  ? 97.267  27.441  75.290  1.00 21.73 ? 39  TYR E CE1 1 
ATOM   6672  C CE2 . TYR E 1 22  ? 95.196  28.577  74.856  1.00 22.60 ? 39  TYR E CE2 1 
ATOM   6673  C CZ  . TYR E 1 22  ? 96.109  28.037  75.750  1.00 23.36 ? 39  TYR E CZ  1 
ATOM   6674  O OH  . TYR E 1 22  ? 95.848  28.095  77.102  1.00 26.04 ? 39  TYR E OH  1 
ATOM   6675  N N   . HIS E 1 23  ? 95.740  30.569  70.585  1.00 14.86 ? 40  HIS E N   1 
ATOM   6676  C CA  . HIS E 1 23  ? 94.851  31.715  70.765  1.00 11.62 ? 40  HIS E CA  1 
ATOM   6677  C C   . HIS E 1 23  ? 94.062  31.494  72.040  1.00 8.78  ? 40  HIS E C   1 
ATOM   6678  O O   . HIS E 1 23  ? 93.539  30.399  72.256  1.00 8.05  ? 40  HIS E O   1 
ATOM   6679  C CB  . HIS E 1 23  ? 93.885  31.832  69.580  1.00 12.50 ? 40  HIS E CB  1 
ATOM   6680  C CG  . HIS E 1 23  ? 92.782  32.821  69.791  1.00 13.47 ? 40  HIS E CG  1 
ATOM   6681  N ND1 . HIS E 1 23  ? 92.835  34.109  69.305  1.00 14.34 ? 40  HIS E ND1 1 
ATOM   6682  C CD2 . HIS E 1 23  ? 91.607  32.718  70.454  1.00 14.40 ? 40  HIS E CD2 1 
ATOM   6683  C CE1 . HIS E 1 23  ? 91.744  34.761  69.664  1.00 16.59 ? 40  HIS E CE1 1 
ATOM   6684  N NE2 . HIS E 1 23  ? 90.982  33.939  70.364  1.00 16.42 ? 40  HIS E NE2 1 
ATOM   6685  N N   . PHE E 1 24  ? 93.989  32.514  72.885  1.00 5.00  ? 41  PHE E N   1 
ATOM   6686  C CA  . PHE E 1 24  ? 93.234  32.385  74.126  1.00 6.43  ? 41  PHE E CA  1 
ATOM   6687  C C   . PHE E 1 24  ? 92.367  33.606  74.445  1.00 6.34  ? 41  PHE E C   1 
ATOM   6688  O O   . PHE E 1 24  ? 91.548  33.554  75.357  1.00 5.00  ? 41  PHE E O   1 
ATOM   6689  C CB  . PHE E 1 24  ? 94.154  32.033  75.314  1.00 6.11  ? 41  PHE E CB  1 
ATOM   6690  C CG  . PHE E 1 24  ? 95.072  33.150  75.733  1.00 8.07  ? 41  PHE E CG  1 
ATOM   6691  C CD1 . PHE E 1 24  ? 94.756  33.960  76.806  1.00 7.10  ? 41  PHE E CD1 1 
ATOM   6692  C CD2 . PHE E 1 24  ? 96.245  33.416  75.030  1.00 10.96 ? 41  PHE E CD2 1 
ATOM   6693  C CE1 . PHE E 1 24  ? 95.586  35.023  77.176  1.00 5.00  ? 41  PHE E CE1 1 
ATOM   6694  C CE2 . PHE E 1 24  ? 97.080  34.483  75.401  1.00 8.01  ? 41  PHE E CE2 1 
ATOM   6695  C CZ  . PHE E 1 24  ? 96.738  35.278  76.474  1.00 5.00  ? 41  PHE E CZ  1 
ATOM   6696  N N   . CYS E 1 25  ? 92.515  34.674  73.657  1.00 6.80  ? 42  CYS E N   1 
ATOM   6697  C CA  . CYS E 1 25  ? 91.762  35.926  73.844  1.00 5.00  ? 42  CYS E CA  1 
ATOM   6698  C C   . CYS E 1 25  ? 91.946  36.844  72.657  1.00 5.00  ? 42  CYS E C   1 
ATOM   6699  O O   . CYS E 1 25  ? 92.698  36.556  71.745  1.00 5.00  ? 42  CYS E O   1 
ATOM   6700  C CB  . CYS E 1 25  ? 92.255  36.683  75.065  1.00 5.00  ? 42  CYS E CB  1 
ATOM   6701  S SG  . CYS E 1 25  ? 91.797  35.997  76.671  1.00 5.00  ? 42  CYS E SG  1 
ATOM   6702  N N   . GLY E 1 26  ? 91.247  37.954  72.670  1.00 5.00  ? 43  GLY E N   1 
ATOM   6703  C CA  . GLY E 1 26  ? 91.372  38.911  71.599  1.00 5.00  ? 43  GLY E CA  1 
ATOM   6704  C C   . GLY E 1 26  ? 91.746  40.204  72.292  1.00 6.02  ? 43  GLY E C   1 
ATOM   6705  O O   . GLY E 1 26  ? 92.090  40.197  73.478  1.00 9.36  ? 43  GLY E O   1 
ATOM   6706  N N   . GLY E 1 27  ? 91.705  41.313  71.573  1.00 5.00  ? 44  GLY E N   1 
ATOM   6707  C CA  . GLY E 1 27  ? 92.021  42.589  72.183  1.00 5.00  ? 44  GLY E CA  1 
ATOM   6708  C C   . GLY E 1 27  ? 91.884  43.623  71.101  1.00 5.00  ? 44  GLY E C   1 
ATOM   6709  O O   . GLY E 1 27  ? 91.803  43.257  69.925  1.00 5.00  ? 44  GLY E O   1 
ATOM   6710  N N   . SER E 1 28  ? 91.862  44.896  71.461  1.00 5.00  ? 45  SER E N   1 
ATOM   6711  C CA  . SER E 1 28  ? 91.735  45.926  70.439  1.00 6.17  ? 45  SER E CA  1 
ATOM   6712  C C   . SER E 1 28  ? 92.951  46.810  70.438  1.00 6.84  ? 45  SER E C   1 
ATOM   6713  O O   . SER E 1 28  ? 93.503  47.101  71.505  1.00 7.70  ? 45  SER E O   1 
ATOM   6714  C CB  . SER E 1 28  ? 90.494  46.777  70.669  1.00 8.50  ? 45  SER E CB  1 
ATOM   6715  O OG  . SER E 1 28  ? 89.363  45.948  70.842  1.00 11.55 ? 45  SER E OG  1 
ATOM   6716  N N   . LEU E 1 29  ? 93.380  47.206  69.243  1.00 5.50  ? 46  LEU E N   1 
ATOM   6717  C CA  . LEU E 1 29  ? 94.538  48.075  69.082  1.00 5.56  ? 46  LEU E CA  1 
ATOM   6718  C C   . LEU E 1 29  ? 94.112  49.543  69.294  1.00 6.12  ? 46  LEU E C   1 
ATOM   6719  O O   . LEU E 1 29  ? 93.340  50.096  68.510  1.00 6.57  ? 46  LEU E O   1 
ATOM   6720  C CB  . LEU E 1 29  ? 95.137  47.855  67.689  1.00 7.31  ? 46  LEU E CB  1 
ATOM   6721  C CG  . LEU E 1 29  ? 96.455  48.528  67.290  1.00 6.86  ? 46  LEU E CG  1 
ATOM   6722  C CD1 . LEU E 1 29  ? 97.536  48.262  68.324  1.00 5.00  ? 46  LEU E CD1 1 
ATOM   6723  C CD2 . LEU E 1 29  ? 96.858  47.995  65.942  1.00 5.00  ? 46  LEU E CD2 1 
ATOM   6724  N N   . ILE E 1 30  ? 94.616  50.162  70.355  1.00 5.52  ? 47  ILE E N   1 
ATOM   6725  C CA  . ILE E 1 30  ? 94.258  51.538  70.682  1.00 12.39 ? 47  ILE E CA  1 
ATOM   6726  C C   . ILE E 1 30  ? 95.109  52.568  69.948  1.00 13.54 ? 47  ILE E C   1 
ATOM   6727  O O   . ILE E 1 30  ? 94.708  53.747  69.784  1.00 12.18 ? 47  ILE E O   1 
ATOM   6728  C CB  . ILE E 1 30  ? 94.283  51.767  72.216  1.00 14.93 ? 47  ILE E CB  1 
ATOM   6729  C CG1 . ILE E 1 30  ? 93.028  51.162  72.831  1.00 20.26 ? 47  ILE E CG1 1 
ATOM   6730  C CG2 . ILE E 1 30  ? 94.304  53.246  72.573  1.00 15.23 ? 47  ILE E CG2 1 
ATOM   6731  C CD1 . ILE E 1 30  ? 92.897  51.463  74.294  1.00 24.69 ? 47  ILE E CD1 1 
ATOM   6732  N N   . ASN E 1 31  ? 96.282  52.110  69.509  1.00 13.83 ? 48  ASN E N   1 
ATOM   6733  C CA  . ASN E 1 31  ? 97.239  52.925  68.751  1.00 11.70 ? 48  ASN E CA  1 
ATOM   6734  C C   . ASN E 1 31  ? 98.496  52.088  68.588  1.00 7.54  ? 48  ASN E C   1 
ATOM   6735  O O   . ASN E 1 31  ? 98.797  51.287  69.454  1.00 9.56  ? 48  ASN E O   1 
ATOM   6736  C CB  . ASN E 1 31  ? 97.583  54.221  69.502  1.00 13.83 ? 48  ASN E CB  1 
ATOM   6737  C CG  . ASN E 1 31  ? 98.470  53.975  70.711  1.00 13.29 ? 48  ASN E CG  1 
ATOM   6738  O OD1 . ASN E 1 31  ? 97.994  53.640  71.779  1.00 15.16 ? 48  ASN E OD1 1 
ATOM   6739  N ND2 . ASN E 1 31  ? 99.773  54.087  70.524  1.00 16.91 ? 48  ASN E ND2 1 
ATOM   6740  N N   . SER E 1 32  ? 99.247  52.329  67.522  1.00 5.17  ? 49  SER E N   1 
ATOM   6741  C CA  . SER E 1 32  ? 100.488 51.621  67.208  1.00 6.18  ? 49  SER E CA  1 
ATOM   6742  C C   . SER E 1 32  ? 101.132 50.739  68.292  1.00 6.23  ? 49  SER E C   1 
ATOM   6743  O O   . SER E 1 32  ? 101.382 49.558  68.087  1.00 5.00  ? 49  SER E O   1 
ATOM   6744  C CB  . SER E 1 32  ? 101.512 52.632  66.742  1.00 6.84  ? 49  SER E CB  1 
ATOM   6745  O OG  . SER E 1 32  ? 101.604 53.659  67.711  1.00 13.33 ? 49  SER E OG  1 
ATOM   6746  N N   . GLN E 1 33  ? 101.395 51.302  69.458  1.00 7.74  ? 50  GLN E N   1 
ATOM   6747  C CA  . GLN E 1 33  ? 102.031 50.519  70.499  1.00 8.56  ? 50  GLN E CA  1 
ATOM   6748  C C   . GLN E 1 33  ? 101.194 49.921  71.623  1.00 11.15 ? 50  GLN E C   1 
ATOM   6749  O O   . GLN E 1 33  ? 101.717 49.093  72.372  1.00 16.04 ? 50  GLN E O   1 
ATOM   6750  C CB  . GLN E 1 33  ? 103.164 51.309  71.112  1.00 9.25  ? 50  GLN E CB  1 
ATOM   6751  C CG  . GLN E 1 33  ? 104.528 50.677  70.936  1.00 8.34  ? 50  GLN E CG  1 
ATOM   6752  C CD  . GLN E 1 33  ? 105.638 51.579  71.457  1.00 7.71  ? 50  GLN E CD  1 
ATOM   6753  O OE1 . GLN E 1 33  ? 106.615 51.092  72.019  1.00 9.44  ? 50  GLN E OE1 1 
ATOM   6754  N NE2 . GLN E 1 33  ? 105.492 52.901  71.276  1.00 5.00  ? 50  GLN E NE2 1 
ATOM   6755  N N   . TRP E 1 34  ? 99.940  50.332  71.802  1.00 8.75  ? 51  TRP E N   1 
ATOM   6756  C CA  . TRP E 1 34  ? 99.153  49.733  72.874  1.00 6.15  ? 51  TRP E CA  1 
ATOM   6757  C C   . TRP E 1 34  ? 97.936  48.918  72.444  1.00 8.45  ? 51  TRP E C   1 
ATOM   6758  O O   . TRP E 1 34  ? 97.317  49.182  71.410  1.00 9.33  ? 51  TRP E O   1 
ATOM   6759  C CB  . TRP E 1 34  ? 98.761  50.769  73.889  1.00 5.82  ? 51  TRP E CB  1 
ATOM   6760  C CG  . TRP E 1 34  ? 99.914  51.279  74.667  1.00 7.85  ? 51  TRP E CG  1 
ATOM   6761  C CD1 . TRP E 1 34  ? 100.757 52.298  74.312  1.00 11.22 ? 51  TRP E CD1 1 
ATOM   6762  C CD2 . TRP E 1 34  ? 100.259 50.926  76.006  1.00 7.04  ? 51  TRP E CD2 1 
ATOM   6763  N NE1 . TRP E 1 34  ? 101.586 52.622  75.364  1.00 9.39  ? 51  TRP E NE1 1 
ATOM   6764  C CE2 . TRP E 1 34  ? 101.298 51.799  76.418  1.00 7.40  ? 51  TRP E CE2 1 
ATOM   6765  C CE3 . TRP E 1 34  ? 99.780  49.979  76.905  1.00 5.00  ? 51  TRP E CE3 1 
ATOM   6766  C CZ2 . TRP E 1 34  ? 101.859 51.750  77.692  1.00 5.00  ? 51  TRP E CZ2 1 
ATOM   6767  C CZ3 . TRP E 1 34  ? 100.335 49.929  78.170  1.00 7.81  ? 51  TRP E CZ3 1 
ATOM   6768  C CH2 . TRP E 1 34  ? 101.366 50.814  78.554  1.00 7.56  ? 51  TRP E CH2 1 
ATOM   6769  N N   . VAL E 1 35  ? 97.603  47.922  73.257  1.00 8.81  ? 52  VAL E N   1 
ATOM   6770  C CA  . VAL E 1 35  ? 96.475  47.030  73.016  1.00 9.11  ? 52  VAL E CA  1 
ATOM   6771  C C   . VAL E 1 35  ? 95.634  46.932  74.290  1.00 9.98  ? 52  VAL E C   1 
ATOM   6772  O O   . VAL E 1 35  ? 96.176  46.628  75.352  1.00 11.09 ? 52  VAL E O   1 
ATOM   6773  C CB  . VAL E 1 35  ? 96.979  45.617  72.645  1.00 8.52  ? 52  VAL E CB  1 
ATOM   6774  C CG1 . VAL E 1 35  ? 95.827  44.630  72.518  1.00 7.26  ? 52  VAL E CG1 1 
ATOM   6775  C CG2 . VAL E 1 35  ? 97.738  45.690  71.358  1.00 8.16  ? 52  VAL E CG2 1 
ATOM   6776  N N   . VAL E 1 36  ? 94.326  47.185  74.195  1.00 9.02  ? 53  VAL E N   1 
ATOM   6777  C CA  . VAL E 1 36  ? 93.445  47.096  75.371  1.00 8.81  ? 53  VAL E CA  1 
ATOM   6778  C C   . VAL E 1 36  ? 92.759  45.732  75.385  1.00 9.21  ? 53  VAL E C   1 
ATOM   6779  O O   . VAL E 1 36  ? 92.423  45.195  74.318  1.00 10.70 ? 53  VAL E O   1 
ATOM   6780  C CB  . VAL E 1 36  ? 92.380  48.227  75.401  1.00 5.00  ? 53  VAL E CB  1 
ATOM   6781  C CG1 . VAL E 1 36  ? 91.441  48.099  74.262  1.00 5.00  ? 53  VAL E CG1 1 
ATOM   6782  C CG2 . VAL E 1 36  ? 91.640  48.203  76.690  1.00 5.00  ? 53  VAL E CG2 1 
ATOM   6783  N N   . SER E 1 37  ? 92.570  45.161  76.570  1.00 7.39  ? 54  SER E N   1 
ATOM   6784  C CA  . SER E 1 37  ? 91.927  43.860  76.671  1.00 9.17  ? 54  SER E CA  1 
ATOM   6785  C C   . SER E 1 37  ? 91.379  43.533  78.081  1.00 11.66 ? 54  SER E C   1 
ATOM   6786  O O   . SER E 1 37  ? 91.452  44.342  79.017  1.00 11.76 ? 54  SER E O   1 
ATOM   6787  C CB  . SER E 1 37  ? 92.901  42.770  76.208  1.00 8.63  ? 54  SER E CB  1 
ATOM   6788  O OG  . SER E 1 37  ? 92.244  41.534  75.967  1.00 6.93  ? 54  SER E OG  1 
ATOM   6789  N N   . ALA E 1 38  ? 90.787  42.349  78.214  1.00 11.82 ? 55  ALA E N   1 
ATOM   6790  C CA  . ALA E 1 38  ? 90.229  41.894  79.473  1.00 7.36  ? 55  ALA E CA  1 
ATOM   6791  C C   . ALA E 1 38  ? 91.361  41.488  80.419  1.00 7.87  ? 55  ALA E C   1 
ATOM   6792  O O   . ALA E 1 38  ? 92.173  40.622  80.079  1.00 7.91  ? 55  ALA E O   1 
ATOM   6793  C CB  . ALA E 1 38  ? 89.317  40.704  79.224  0.00 7.21  ? 55  ALA E CB  1 
ATOM   6794  N N   . ALA E 1 39  ? 91.393  42.087  81.610  1.00 6.11  ? 56  ALA E N   1 
ATOM   6795  C CA  . ALA E 1 39  ? 92.399  41.775  82.628  1.00 5.00  ? 56  ALA E CA  1 
ATOM   6796  C C   . ALA E 1 39  ? 92.499  40.308  82.949  1.00 5.43  ? 56  ALA E C   1 
ATOM   6797  O O   . ALA E 1 39  ? 93.516  39.857  83.409  1.00 8.29  ? 56  ALA E O   1 
ATOM   6798  C CB  . ALA E 1 39  ? 92.129  42.516  83.885  1.00 5.00  ? 56  ALA E CB  1 
ATOM   6799  N N   . HIS E 1 40  ? 91.427  39.560  82.773  1.00 8.02  ? 57  HIS E N   1 
ATOM   6800  C CA  . HIS E 1 40  ? 91.494  38.140  83.059  1.00 8.37  ? 57  HIS E CA  1 
ATOM   6801  C C   . HIS E 1 40  ? 92.198  37.378  81.925  1.00 7.87  ? 57  HIS E C   1 
ATOM   6802  O O   . HIS E 1 40  ? 92.389  36.175  82.015  1.00 10.03 ? 57  HIS E O   1 
ATOM   6803  C CB  . HIS E 1 40  ? 90.096  37.560  83.432  1.00 9.83  ? 57  HIS E CB  1 
ATOM   6804  C CG  . HIS E 1 40  ? 89.177  37.311  82.269  1.00 10.51 ? 57  HIS E CG  1 
ATOM   6805  N ND1 . HIS E 1 40  ? 88.251  38.241  81.835  1.00 15.11 ? 57  HIS E ND1 1 
ATOM   6806  C CD2 . HIS E 1 40  ? 89.035  36.233  81.458  1.00 7.57  ? 57  HIS E CD2 1 
ATOM   6807  C CE1 . HIS E 1 40  ? 87.588  37.752  80.802  1.00 13.80 ? 57  HIS E CE1 1 
ATOM   6808  N NE2 . HIS E 1 40  ? 88.044  36.535  80.554  1.00 11.49 ? 57  HIS E NE2 1 
ATOM   6809  N N   . CYS E 1 41  ? 92.584  38.085  80.864  1.00 7.24  ? 58  CYS E N   1 
ATOM   6810  C CA  . CYS E 1 41  ? 93.293  37.474  79.732  1.00 6.85  ? 58  CYS E CA  1 
ATOM   6811  C C   . CYS E 1 41  ? 94.803  37.583  79.962  1.00 8.36  ? 58  CYS E C   1 
ATOM   6812  O O   . CYS E 1 41  ? 95.612  37.135  79.142  1.00 6.00  ? 58  CYS E O   1 
ATOM   6813  C CB  . CYS E 1 41  ? 92.936  38.177  78.426  1.00 7.08  ? 58  CYS E CB  1 
ATOM   6814  S SG  . CYS E 1 41  ? 91.357  37.677  77.696  1.00 5.00  ? 58  CYS E SG  1 
ATOM   6815  N N   . TYR E 1 42  ? 95.172  38.252  81.049  1.00 10.28 ? 59  TYR E N   1 
ATOM   6816  C CA  . TYR E 1 42  ? 96.562  38.406  81.402  1.00 10.52 ? 59  TYR E CA  1 
ATOM   6817  C C   . TYR E 1 42  ? 97.167  37.033  81.539  1.00 12.19 ? 59  TYR E C   1 
ATOM   6818  O O   . TYR E 1 42  ? 96.579  36.124  82.135  1.00 10.01 ? 59  TYR E O   1 
ATOM   6819  C CB  . TYR E 1 42  ? 96.720  39.122  82.743  1.00 14.14 ? 59  TYR E CB  1 
ATOM   6820  C CG  . TYR E 1 42  ? 98.157  39.142  83.248  1.00 16.00 ? 59  TYR E CG  1 
ATOM   6821  C CD1 . TYR E 1 42  ? 98.699  38.049  83.925  1.00 16.39 ? 59  TYR E CD1 1 
ATOM   6822  C CD2 . TYR E 1 42  ? 98.984  40.227  82.998  1.00 14.89 ? 59  TYR E CD2 1 
ATOM   6823  C CE1 . TYR E 1 42  ? 100.017 38.032  84.321  1.00 17.07 ? 59  TYR E CE1 1 
ATOM   6824  C CE2 . TYR E 1 42  ? 100.303 40.223  83.400  1.00 16.05 ? 59  TYR E CE2 1 
ATOM   6825  C CZ  . TYR E 1 42  ? 100.824 39.115  84.060  1.00 18.14 ? 59  TYR E CZ  1 
ATOM   6826  O OH  . TYR E 1 42  ? 102.163 39.051  84.441  1.00 19.47 ? 59  TYR E OH  1 
ATOM   6827  N N   . LYS E 1 43  ? 98.385  36.934  81.030  1.00 15.58 ? 60  LYS E N   1 
ATOM   6828  C CA  . LYS E 1 43  ? 99.196  35.725  81.069  1.00 16.78 ? 60  LYS E CA  1 
ATOM   6829  C C   . LYS E 1 43  ? 100.637 36.245  81.030  1.00 19.83 ? 60  LYS E C   1 
ATOM   6830  O O   . LYS E 1 43  ? 100.872 37.419  80.684  1.00 19.70 ? 60  LYS E O   1 
ATOM   6831  C CB  . LYS E 1 43  ? 98.922  34.841  79.849  1.00 13.88 ? 60  LYS E CB  1 
ATOM   6832  C CG  . LYS E 1 43  ? 97.797  33.836  80.006  1.00 13.80 ? 60  LYS E CG  1 
ATOM   6833  C CD  . LYS E 1 43  ? 97.784  32.914  78.783  1.00 15.38 ? 60  LYS E CD  1 
ATOM   6834  C CE  . LYS E 1 43  ? 96.845  31.720  78.917  1.00 15.39 ? 60  LYS E CE  1 
ATOM   6835  N NZ  . LYS E 1 43  ? 97.135  30.890  80.119  0.00 14.45 ? 60  LYS E NZ  1 
ATOM   6836  N N   . SER E 1 44  ? 101.588 35.410  81.447  1.00 22.58 ? 61  SER E N   1 
ATOM   6837  C CA  . SER E 1 44  ? 102.995 35.794  81.432  1.00 21.86 ? 61  SER E CA  1 
ATOM   6838  C C   . SER E 1 44  ? 103.476 35.655  79.998  1.00 22.89 ? 61  SER E C   1 
ATOM   6839  O O   . SER E 1 44  ? 103.201 34.659  79.336  1.00 22.51 ? 61  SER E O   1 
ATOM   6840  C CB  . SER E 1 44  ? 103.813 34.900  82.367  1.00 21.12 ? 61  SER E CB  1 
ATOM   6841  O OG  . SER E 1 44  ? 103.414 33.538  82.283  0.00 21.75 ? 61  SER E OG  1 
ATOM   6842  N N   . GLY E 1 45  ? 104.097 36.707  79.486  1.00 25.17 ? 62  GLY E N   1 
ATOM   6843  C CA  . GLY E 1 45  ? 104.608 36.665  78.127  1.00 26.48 ? 62  GLY E CA  1 
ATOM   6844  C C   . GLY E 1 45  ? 103.598 36.321  77.043  1.00 26.17 ? 62  GLY E C   1 
ATOM   6845  O O   . GLY E 1 45  ? 103.629 35.223  76.485  1.00 26.45 ? 62  GLY E O   1 
ATOM   6846  N N   . ILE E 1 46  ? 102.718 37.275  76.745  1.00 24.58 ? 63  ILE E N   1 
ATOM   6847  C CA  . ILE E 1 46  ? 101.683 37.142  75.717  1.00 19.69 ? 63  ILE E CA  1 
ATOM   6848  C C   . ILE E 1 46  ? 102.250 37.627  74.379  1.00 18.29 ? 63  ILE E C   1 
ATOM   6849  O O   . ILE E 1 46  ? 103.094 38.538  74.341  1.00 20.32 ? 63  ILE E O   1 
ATOM   6850  C CB  . ILE E 1 46  ? 100.483 38.045  76.053  1.00 18.03 ? 63  ILE E CB  1 
ATOM   6851  C CG1 . ILE E 1 46  ? 99.944  37.715  77.434  1.00 16.65 ? 63  ILE E CG1 1 
ATOM   6852  C CG2 . ILE E 1 46  ? 99.409  37.924  74.997  1.00 16.85 ? 63  ILE E CG2 1 
ATOM   6853  C CD1 . ILE E 1 46  ? 98.763  38.566  77.809  1.00 21.08 ? 63  ILE E CD1 1 
ATOM   6854  N N   . GLN E 1 47  ? 101.793 37.044  73.283  1.00 14.16 ? 64  GLN E N   1 
ATOM   6855  C CA  . GLN E 1 47  ? 102.264 37.488  71.979  1.00 14.67 ? 64  GLN E CA  1 
ATOM   6856  C C   . GLN E 1 47  ? 101.039 37.935  71.220  1.00 13.58 ? 64  GLN E C   1 
ATOM   6857  O O   . GLN E 1 47  ? 100.081 37.183  71.109  1.00 14.88 ? 64  GLN E O   1 
ATOM   6858  C CB  . GLN E 1 47  ? 102.971 36.353  71.231  1.00 18.64 ? 64  GLN E CB  1 
ATOM   6859  C CG  . GLN E 1 47  ? 104.149 35.770  71.990  1.00 20.66 ? 64  GLN E CG  1 
ATOM   6860  C CD  . GLN E 1 47  ? 104.912 34.750  71.192  1.00 20.23 ? 64  GLN E CD  1 
ATOM   6861  O OE1 . GLN E 1 47  ? 106.052 34.982  70.826  1.00 21.53 ? 64  GLN E OE1 1 
ATOM   6862  N NE2 . GLN E 1 47  ? 104.296 33.611  70.926  1.00 19.92 ? 64  GLN E NE2 1 
ATOM   6863  N N   . VAL E 1 48  ? 101.064 39.159  70.714  1.00 12.00 ? 65  VAL E N   1 
ATOM   6864  C CA  . VAL E 1 48  ? 99.945  39.723  69.974  1.00 8.73  ? 65  VAL E CA  1 
ATOM   6865  C C   . VAL E 1 48  ? 100.020 39.480  68.454  1.00 11.85 ? 65  VAL E C   1 
ATOM   6866  O O   . VAL E 1 48  ? 101.035 39.756  67.830  1.00 13.75 ? 65  VAL E O   1 
ATOM   6867  C CB  . VAL E 1 48  ? 99.865  41.241  70.239  1.00 5.00  ? 65  VAL E CB  1 
ATOM   6868  C CG1 . VAL E 1 48  ? 98.651  41.844  69.576  1.00 6.56  ? 65  VAL E CG1 1 
ATOM   6869  C CG2 . VAL E 1 48  ? 99.848  41.513  71.723  1.00 5.00  ? 65  VAL E CG2 1 
ATOM   6870  N N   . ARG E 1 49  ? 98.981  38.895  67.875  1.00 14.13 ? 66  ARG E N   1 
ATOM   6871  C CA  . ARG E 1 49  ? 98.922  38.698  66.430  1.00 19.22 ? 66  ARG E CA  1 
ATOM   6872  C C   . ARG E 1 49  ? 97.903  39.709  65.911  1.00 21.22 ? 66  ARG E C   1 
ATOM   6873  O O   . ARG E 1 49  ? 96.732  39.631  66.244  1.00 23.76 ? 66  ARG E O   1 
ATOM   6874  C CB  . ARG E 1 49  ? 98.438  37.306  66.074  1.00 22.51 ? 66  ARG E CB  1 
ATOM   6875  C CG  . ARG E 1 49  ? 99.427  36.223  66.327  1.00 33.13 ? 66  ARG E CG  1 
ATOM   6876  C CD  . ARG E 1 49  ? 98.795  34.859  66.066  1.00 44.08 ? 66  ARG E CD  1 
ATOM   6877  N NE  . ARG E 1 49  ? 98.556  34.604  64.646  1.00 50.31 ? 66  ARG E NE  1 
ATOM   6878  C CZ  . ARG E 1 49  ? 97.818  33.598  64.183  1.00 55.24 ? 66  ARG E CZ  1 
ATOM   6879  N NH1 . ARG E 1 49  ? 97.237  32.755  65.033  1.00 61.00 ? 66  ARG E NH1 1 
ATOM   6880  N NH2 . ARG E 1 49  ? 97.699  33.408  62.872  1.00 54.40 ? 66  ARG E NH2 1 
ATOM   6881  N N   . LEU E 1 50  ? 98.352  40.696  65.156  1.00 22.75 ? 67  LEU E N   1 
ATOM   6882  C CA  . LEU E 1 50  ? 97.455  41.706  64.612  1.00 25.85 ? 67  LEU E CA  1 
ATOM   6883  C C   . LEU E 1 50  ? 97.102  41.325  63.191  1.00 30.91 ? 67  LEU E C   1 
ATOM   6884  O O   . LEU E 1 50  ? 97.586  40.311  62.684  1.00 30.82 ? 67  LEU E O   1 
ATOM   6885  C CB  . LEU E 1 50  ? 98.125  43.079  64.604  1.00 22.23 ? 67  LEU E CB  1 
ATOM   6886  C CG  . LEU E 1 50  ? 98.677  43.517  65.954  1.00 22.85 ? 67  LEU E CG  1 
ATOM   6887  C CD1 . LEU E 1 50  ? 100.025 42.862  66.205  1.00 25.67 ? 67  LEU E CD1 1 
ATOM   6888  C CD2 . LEU E 1 50  ? 98.825  45.008  65.957  1.00 21.88 ? 67  LEU E CD2 1 
ATOM   6889  N N   . GLY E 1 51  ? 96.262  42.141  62.558  1.00 34.70 ? 69  GLY E N   1 
ATOM   6890  C CA  . GLY E 1 51  ? 95.860  41.916  61.174  1.00 40.80 ? 69  GLY E CA  1 
ATOM   6891  C C   . GLY E 1 51  ? 95.539  40.496  60.743  1.00 41.07 ? 69  GLY E C   1 
ATOM   6892  O O   . GLY E 1 51  ? 95.802  40.102  59.593  1.00 41.59 ? 69  GLY E O   1 
ATOM   6893  N N   . GLU E 1 52  ? 94.954  39.731  61.654  1.00 40.83 ? 70  GLU E N   1 
ATOM   6894  C CA  . GLU E 1 52  ? 94.603  38.351  61.380  1.00 41.66 ? 70  GLU E CA  1 
ATOM   6895  C C   . GLU E 1 52  ? 93.278  38.215  60.656  1.00 41.48 ? 70  GLU E C   1 
ATOM   6896  O O   . GLU E 1 52  ? 92.372  39.034  60.797  1.00 39.00 ? 70  GLU E O   1 
ATOM   6897  C CB  . GLU E 1 52  ? 94.534  37.564  62.684  1.00 44.66 ? 70  GLU E CB  1 
ATOM   6898  C CG  . GLU E 1 52  ? 95.849  37.412  63.403  1.00 44.16 ? 70  GLU E CG  1 
ATOM   6899  C CD  . GLU E 1 52  ? 96.776  36.453  62.704  1.00 41.33 ? 70  GLU E CD  1 
ATOM   6900  O OE1 . GLU E 1 52  ? 96.301  35.536  62.003  1.00 37.00 ? 70  GLU E OE1 1 
ATOM   6901  O OE2 . GLU E 1 52  ? 97.993  36.611  62.873  1.00 42.54 ? 70  GLU E OE2 1 
ATOM   6902  N N   . ASP E 1 53  ? 93.208  37.183  59.838  1.00 42.64 ? 71  ASP E N   1 
ATOM   6903  C CA  . ASP E 1 53  ? 92.020  36.838  59.089  1.00 41.53 ? 71  ASP E CA  1 
ATOM   6904  C C   . ASP E 1 53  ? 91.761  35.416  59.580  1.00 40.92 ? 71  ASP E C   1 
ATOM   6905  O O   . ASP E 1 53  ? 90.803  35.161  60.333  1.00 40.20 ? 71  ASP E O   1 
ATOM   6906  C CB  . ASP E 1 53  ? 92.308  36.850  57.584  0.00 39.64 ? 71  ASP E CB  1 
ATOM   6907  C CG  . ASP E 1 53  ? 91.069  36.583  56.750  0.00 38.99 ? 71  ASP E CG  1 
ATOM   6908  O OD1 . ASP E 1 53  ? 90.879  35.427  56.318  0.00 40.06 ? 71  ASP E OD1 1 
ATOM   6909  O OD2 . ASP E 1 53  ? 90.288  37.531  56.525  0.00 40.06 ? 71  ASP E OD2 1 
ATOM   6910  N N   . ASN E 1 54  ? 92.666  34.509  59.220  1.00 37.66 ? 72  ASN E N   1 
ATOM   6911  C CA  . ASN E 1 54  ? 92.561  33.119  59.645  1.00 36.56 ? 72  ASN E CA  1 
ATOM   6912  C C   . ASN E 1 54  ? 93.647  32.974  60.689  1.00 36.73 ? 72  ASN E C   1 
ATOM   6913  O O   . ASN E 1 54  ? 94.773  33.399  60.452  1.00 43.19 ? 72  ASN E O   1 
ATOM   6914  C CB  . ASN E 1 54  ? 92.810  32.176  58.463  1.00 36.26 ? 72  ASN E CB  1 
ATOM   6915  C CG  . ASN E 1 54  ? 92.785  30.719  58.859  0.00 35.22 ? 72  ASN E CG  1 
ATOM   6916  O OD1 . ASN E 1 54  ? 93.667  30.246  59.570  0.00 34.31 ? 72  ASN E OD1 1 
ATOM   6917  N ND2 . ASN E 1 54  ? 91.792  29.990  58.373  0.00 34.29 ? 72  ASN E ND2 1 
ATOM   6918  N N   . ILE E 1 55  ? 93.313  32.478  61.873  1.00 34.77 ? 73  ILE E N   1 
ATOM   6919  C CA  . ILE E 1 55  ? 94.333  32.325  62.895  1.00 35.44 ? 73  ILE E CA  1 
ATOM   6920  C C   . ILE E 1 55  ? 95.065  30.997  62.813  1.00 41.22 ? 73  ILE E C   1 
ATOM   6921  O O   . ILE E 1 55  ? 95.289  30.341  63.827  1.00 42.93 ? 73  ILE E O   1 
ATOM   6922  C CB  . ILE E 1 55  ? 93.815  32.565  64.325  1.00 29.34 ? 73  ILE E CB  1 
ATOM   6923  C CG1 . ILE E 1 55  ? 92.426  31.977  64.512  1.00 32.01 ? 73  ILE E CG1 1 
ATOM   6924  C CG2 . ILE E 1 55  ? 93.855  34.014  64.651  1.00 29.24 ? 73  ILE E CG2 1 
ATOM   6925  C CD1 . ILE E 1 55  ? 92.417  30.481  64.730  1.00 32.86 ? 73  ILE E CD1 1 
ATOM   6926  N N   . ASN E 1 56  ? 95.457  30.615  61.601  1.00 45.04 ? 74  ASN E N   1 
ATOM   6927  C CA  . ASN E 1 56  ? 96.200  29.375  61.363  1.00 46.82 ? 74  ASN E CA  1 
ATOM   6928  C C   . ASN E 1 56  ? 97.026  29.461  60.059  1.00 46.56 ? 74  ASN E C   1 
ATOM   6929  O O   . ASN E 1 56  ? 98.119  28.892  59.954  1.00 43.22 ? 74  ASN E O   1 
ATOM   6930  C CB  . ASN E 1 56  ? 95.248  28.172  61.326  1.00 48.82 ? 74  ASN E CB  1 
ATOM   6931  C CG  . ASN E 1 56  ? 94.534  27.935  62.665  1.00 50.65 ? 74  ASN E CG  1 
ATOM   6932  O OD1 . ASN E 1 56  ? 93.305  28.021  62.756  1.00 52.11 ? 74  ASN E OD1 1 
ATOM   6933  N ND2 . ASN E 1 56  ? 95.306  27.645  63.708  1.00 53.71 ? 74  ASN E ND2 1 
ATOM   6934  N N   . VAL E 1 57  ? 96.502  30.180  59.070  1.00 47.57 ? 75  VAL E N   1 
ATOM   6935  C CA  . VAL E 1 57  ? 97.193  30.366  57.798  1.00 52.61 ? 75  VAL E CA  1 
ATOM   6936  C C   . VAL E 1 57  ? 97.639  31.836  57.655  1.00 58.66 ? 75  VAL E C   1 
ATOM   6937  O O   . VAL E 1 57  ? 96.973  32.744  58.168  1.00 59.12 ? 75  VAL E O   1 
ATOM   6938  C CB  . VAL E 1 57  ? 96.282  29.995  56.606  0.00 53.05 ? 75  VAL E CB  1 
ATOM   6939  C CG1 . VAL E 1 57  ? 97.073  30.020  55.307  0.00 54.61 ? 75  VAL E CG1 1 
ATOM   6940  C CG2 . VAL E 1 57  ? 95.657  28.625  56.823  0.00 54.51 ? 75  VAL E CG2 1 
ATOM   6941  N N   . VAL E 1 58  ? 98.765  32.068  56.971  1.00 62.97 ? 76  VAL E N   1 
ATOM   6942  C CA  . VAL E 1 58  ? 99.289  33.432  56.762  1.00 61.13 ? 76  VAL E CA  1 
ATOM   6943  C C   . VAL E 1 58  ? 98.436  34.194  55.734  1.00 53.19 ? 76  VAL E C   1 
ATOM   6944  O O   . VAL E 1 58  ? 98.774  34.261  54.550  1.00 53.24 ? 76  VAL E O   1 
ATOM   6945  C CB  . VAL E 1 58  ? 100.802 33.417  56.303  1.00 67.71 ? 76  VAL E CB  1 
ATOM   6946  C CG1 . VAL E 1 58  ? 101.313 34.839  56.025  1.00 69.70 ? 76  VAL E CG1 1 
ATOM   6947  C CG2 . VAL E 1 58  ? 101.683 32.772  57.372  1.00 71.10 ? 76  VAL E CG2 1 
ATOM   6948  N N   . GLU E 1 59  ? 97.317  34.745  56.177  0.00 43.04 ? 77  GLU E N   1 
ATOM   6949  C CA  . GLU E 1 59  ? 96.447  35.477  55.270  0.00 35.45 ? 77  GLU E CA  1 
ATOM   6950  C C   . GLU E 1 59  ? 96.960  36.886  54.985  0.00 32.66 ? 77  GLU E C   1 
ATOM   6951  O O   . GLU E 1 59  ? 96.350  37.876  55.388  0.00 33.44 ? 77  GLU E O   1 
ATOM   6952  C CB  . GLU E 1 59  ? 95.020  35.513  55.817  0.00 34.67 ? 77  GLU E CB  1 
ATOM   6953  C CG  . GLU E 1 59  ? 94.360  34.144  55.903  0.00 27.78 ? 77  GLU E CG  1 
ATOM   6954  C CD  . GLU E 1 59  ? 94.195  33.482  54.547  0.00 22.93 ? 77  GLU E CD  1 
ATOM   6955  O OE1 . GLU E 1 59  ? 93.251  33.850  53.816  0.00 20.12 ? 77  GLU E OE1 1 
ATOM   6956  O OE2 . GLU E 1 59  ? 95.006  32.593  54.213  0.00 20.15 ? 77  GLU E OE2 1 
ATOM   6957  N N   . GLY E 1 60  ? 98.086  36.964  54.283  0.00 29.42 ? 78  GLY E N   1 
ATOM   6958  C CA  . GLY E 1 60  ? 98.670  38.248  53.943  0.00 23.88 ? 78  GLY E CA  1 
ATOM   6959  C C   . GLY E 1 60  ? 99.221  38.992  55.143  0.00 20.24 ? 78  GLY E C   1 
ATOM   6960  O O   . GLY E 1 60  ? 100.427 38.980  55.388  0.00 19.01 ? 78  GLY E O   1 
ATOM   6961  N N   . ASN E 1 61  ? 98.335  39.636  55.894  0.00 18.11 ? 79  ASN E N   1 
ATOM   6962  C CA  . ASN E 1 61  ? 98.736  40.396  57.071  0.00 16.88 ? 79  ASN E CA  1 
ATOM   6963  C C   . ASN E 1 61  ? 99.082  39.439  58.201  0.00 16.45 ? 79  ASN E C   1 
ATOM   6964  O O   . ASN E 1 61  ? 98.224  38.703  58.690  0.00 16.21 ? 79  ASN E O   1 
ATOM   6965  C CB  . ASN E 1 61  ? 97.612  41.335  57.512  0.00 16.47 ? 79  ASN E CB  1 
ATOM   6966  C CG  . ASN E 1 61  ? 97.166  42.269  56.409  0.00 16.17 ? 79  ASN E CG  1 
ATOM   6967  O OD1 . ASN E 1 61  ? 97.903  43.168  56.003  0.00 16.09 ? 79  ASN E OD1 1 
ATOM   6968  N ND2 . ASN E 1 61  ? 95.957  42.057  55.908  0.00 16.06 ? 79  ASN E ND2 1 
ATOM   6969  N N   . GLU E 1 62  ? 100.352 39.428  58.588  0.00 16.26 ? 80  GLU E N   1 
ATOM   6970  C CA  . GLU E 1 62  ? 100.815 38.559  59.658  0.00 16.01 ? 80  GLU E CA  1 
ATOM   6971  C C   . GLU E 1 62  ? 101.792 39.339  60.523  0.00 15.58 ? 80  GLU E C   1 
ATOM   6972  O O   . GLU E 1 62  ? 102.869 39.721  60.066  0.00 15.81 ? 80  GLU E O   1 
ATOM   6973  C CB  . GLU E 1 62  ? 101.501 37.325  59.069  0.00 15.96 ? 80  GLU E CB  1 
ATOM   6974  C CG  . GLU E 1 62  ? 101.093 36.011  59.721  0.00 16.02 ? 80  GLU E CG  1 
ATOM   6975  C CD  . GLU E 1 62  ? 99.607  35.710  59.584  0.00 16.21 ? 80  GLU E CD  1 
ATOM   6976  O OE1 . GLU E 1 62  ? 99.017  36.034  58.531  0.00 16.06 ? 80  GLU E OE1 1 
ATOM   6977  O OE2 . GLU E 1 62  ? 99.029  35.140  60.532  0.00 16.09 ? 80  GLU E OE2 1 
ATOM   6978  N N   . GLN E 1 63  ? 101.396 39.610  61.762  0.00 14.85 ? 81  GLN E N   1 
ATOM   6979  C CA  . GLN E 1 63  ? 102.244 40.361  62.677  0.00 14.30 ? 81  GLN E CA  1 
ATOM   6980  C C   . GLN E 1 63  ? 102.236 39.792  64.083  0.00 13.76 ? 81  GLN E C   1 
ATOM   6981  O O   . GLN E 1 63  ? 101.287 40.001  64.839  0.00 12.97 ? 81  GLN E O   1 
ATOM   6982  C CB  . GLN E 1 63  ? 101.808 41.827  62.734  0.00 14.99 ? 81  GLN E CB  1 
ATOM   6983  C CG  . GLN E 1 63  ? 101.982 42.595  61.438  0.00 15.81 ? 81  GLN E CG  1 
ATOM   6984  C CD  . GLN E 1 63  ? 101.521 44.033  61.551  0.00 15.82 ? 81  GLN E CD  1 
ATOM   6985  O OE1 . GLN E 1 63  ? 101.776 44.703  62.551  0.00 15.96 ? 81  GLN E OE1 1 
ATOM   6986  N NE2 . GLN E 1 63  ? 100.840 44.517  60.523  0.00 16.00 ? 81  GLN E NE2 1 
ATOM   6987  N N   . PHE E 1 64  ? 103.265 39.021  64.406  1.00 11.52 ? 82  PHE E N   1 
ATOM   6988  C CA  . PHE E 1 64  ? 103.395 38.453  65.751  1.00 15.83 ? 82  PHE E CA  1 
ATOM   6989  C C   . PHE E 1 64  ? 104.336 39.365  66.549  1.00 14.47 ? 82  PHE E C   1 
ATOM   6990  O O   . PHE E 1 64  ? 105.526 39.402  66.247  1.00 20.18 ? 82  PHE E O   1 
ATOM   6991  C CB  . PHE E 1 64  ? 103.980 37.021  65.713  1.00 16.83 ? 82  PHE E CB  1 
ATOM   6992  C CG  . PHE E 1 64  ? 103.140 36.032  64.955  0.00 17.21 ? 82  PHE E CG  1 
ATOM   6993  C CD1 . PHE E 1 64  ? 102.743 36.287  63.646  0.00 17.97 ? 82  PHE E CD1 1 
ATOM   6994  C CD2 . PHE E 1 64  ? 102.766 34.829  65.543  0.00 18.02 ? 82  PHE E CD2 1 
ATOM   6995  C CE1 . PHE E 1 64  ? 101.990 35.361  62.936  0.00 18.80 ? 82  PHE E CE1 1 
ATOM   6996  C CE2 . PHE E 1 64  ? 102.012 33.894  64.839  0.00 18.74 ? 82  PHE E CE2 1 
ATOM   6997  C CZ  . PHE E 1 64  ? 101.623 34.162  63.532  0.00 19.05 ? 82  PHE E CZ  1 
ATOM   6998  N N   . ILE E 1 65  ? 103.816 40.103  67.536  1.00 10.51 ? 83  ILE E N   1 
ATOM   6999  C CA  . ILE E 1 65  ? 104.621 41.020  68.358  1.00 6.90  ? 83  ILE E CA  1 
ATOM   7000  C C   . ILE E 1 65  ? 104.620 40.642  69.834  1.00 6.72  ? 83  ILE E C   1 
ATOM   7001  O O   . ILE E 1 65  ? 103.592 40.276  70.388  1.00 7.17  ? 83  ILE E O   1 
ATOM   7002  C CB  . ILE E 1 65  ? 104.108 42.459  68.233  1.00 5.63  ? 83  ILE E CB  1 
ATOM   7003  C CG1 . ILE E 1 65  ? 104.122 42.878  66.768  1.00 7.06  ? 83  ILE E CG1 1 
ATOM   7004  C CG2 . ILE E 1 65  ? 104.940 43.393  69.079  1.00 5.00  ? 83  ILE E CG2 1 
ATOM   7005  C CD1 . ILE E 1 65  ? 103.722 44.287  66.557  1.00 10.35 ? 83  ILE E CD1 1 
ATOM   7006  N N   . SER E 1 66  ? 105.774 40.718  70.481  1.00 8.64  ? 84  SER E N   1 
ATOM   7007  C CA  . SER E 1 66  ? 105.841 40.373  71.902  1.00 9.53  ? 84  SER E CA  1 
ATOM   7008  C C   . SER E 1 66  ? 105.337 41.568  72.705  1.00 9.44  ? 84  SER E C   1 
ATOM   7009  O O   . SER E 1 66  ? 105.417 42.714  72.250  1.00 8.37  ? 84  SER E O   1 
ATOM   7010  C CB  . SER E 1 66  ? 107.277 40.038  72.310  1.00 10.54 ? 84  SER E CB  1 
ATOM   7011  O OG  . SER E 1 66  ? 107.979 39.430  71.235  0.00 9.26  ? 84  SER E OG  1 
ATOM   7012  N N   . ALA E 1 67  ? 104.788 41.305  73.881  1.00 9.21  ? 85  ALA E N   1 
ATOM   7013  C CA  . ALA E 1 67  ? 104.278 42.376  74.714  1.00 7.22  ? 85  ALA E CA  1 
ATOM   7014  C C   . ALA E 1 67  ? 105.322 42.803  75.738  1.00 8.56  ? 85  ALA E C   1 
ATOM   7015  O O   . ALA E 1 67  ? 105.785 41.978  76.524  1.00 10.67 ? 85  ALA E O   1 
ATOM   7016  C CB  . ALA E 1 67  ? 103.024 41.914  75.405  1.00 5.00  ? 85  ALA E CB  1 
ATOM   7017  N N   . SER E 1 68  ? 105.711 44.077  75.704  1.00 8.22  ? 86  SER E N   1 
ATOM   7018  C CA  . SER E 1 68  ? 106.694 44.622  76.642  1.00 7.84  ? 86  SER E CA  1 
ATOM   7019  C C   . SER E 1 68  ? 106.130 44.668  78.064  1.00 8.97  ? 86  SER E C   1 
ATOM   7020  O O   . SER E 1 68  ? 106.581 43.939  78.929  1.00 8.66  ? 86  SER E O   1 
ATOM   7021  C CB  . SER E 1 68  ? 107.155 46.019  76.201  1.00 5.00  ? 86  SER E CB  1 
ATOM   7022  O OG  . SER E 1 68  ? 108.298 46.440  76.929  0.00 6.71  ? 86  SER E OG  1 
ATOM   7023  N N   . LYS E 1 69  ? 105.149 45.534  78.300  1.00 13.43 ? 87  LYS E N   1 
ATOM   7024  C CA  . LYS E 1 69  ? 104.506 45.670  79.616  1.00 11.01 ? 87  LYS E CA  1 
ATOM   7025  C C   . LYS E 1 69  ? 103.079 45.167  79.451  1.00 11.43 ? 87  LYS E C   1 
ATOM   7026  O O   . LYS E 1 69  ? 102.445 45.466  78.444  1.00 13.43 ? 87  LYS E O   1 
ATOM   7027  C CB  . LYS E 1 69  ? 104.423 47.150  80.068  1.00 8.03  ? 87  LYS E CB  1 
ATOM   7028  C CG  . LYS E 1 69  ? 105.732 47.872  80.417  1.00 5.00  ? 87  LYS E CG  1 
ATOM   7029  C CD  . LYS E 1 69  ? 106.559 48.178  79.169  0.00 6.98  ? 87  LYS E CD  1 
ATOM   7030  C CE  . LYS E 1 69  ? 107.851 48.911  79.502  0.00 7.61  ? 87  LYS E CE  1 
ATOM   7031  N NZ  . LYS E 1 69  ? 107.602 50.229  80.150  0.00 7.86  ? 87  LYS E NZ  1 
ATOM   7032  N N   . SER E 1 70  ? 102.619 44.329  80.374  1.00 11.23 ? 88  SER E N   1 
ATOM   7033  C CA  . SER E 1 70  ? 101.236 43.844  80.376  1.00 8.52  ? 88  SER E CA  1 
ATOM   7034  C C   . SER E 1 70  ? 100.646 44.390  81.711  1.00 9.32  ? 88  SER E C   1 
ATOM   7035  O O   . SER E 1 70  ? 100.720 43.763  82.782  1.00 7.50  ? 88  SER E O   1 
ATOM   7036  C CB  . SER E 1 70  ? 101.179 42.317  80.295  1.00 5.00  ? 88  SER E CB  1 
ATOM   7037  O OG  . SER E 1 70  ? 101.798 41.839  79.113  0.00 5.95  ? 88  SER E OG  1 
ATOM   7038  N N   . ILE E 1 71  ? 100.092 45.593  81.634  1.00 7.53  ? 89  ILE E N   1 
ATOM   7039  C CA  . ILE E 1 71  ? 99.548  46.270  82.790  1.00 6.85  ? 89  ILE E CA  1 
ATOM   7040  C C   . ILE E 1 71  ? 98.069  46.013  83.062  1.00 7.09  ? 89  ILE E C   1 
ATOM   7041  O O   . ILE E 1 71  ? 97.195  46.549  82.379  1.00 5.74  ? 89  ILE E O   1 
ATOM   7042  C CB  . ILE E 1 71  ? 99.784  47.792  82.655  1.00 8.68  ? 89  ILE E CB  1 
ATOM   7043  C CG1 . ILE E 1 71  ? 101.281 48.093  82.545  1.00 5.00  ? 89  ILE E CG1 1 
ATOM   7044  C CG2 . ILE E 1 71  ? 99.180  48.537  83.831  1.00 12.52 ? 89  ILE E CG2 1 
ATOM   7045  C CD1 . ILE E 1 71  ? 101.565 49.507  82.128  1.00 5.00  ? 89  ILE E CD1 1 
ATOM   7046  N N   . VAL E 1 72  ? 97.805  45.216  84.091  1.00 9.21  ? 90  VAL E N   1 
ATOM   7047  C CA  . VAL E 1 72  ? 96.440  44.895  84.525  1.00 9.12  ? 90  VAL E CA  1 
ATOM   7048  C C   . VAL E 1 72  ? 95.850  46.028  85.406  1.00 11.29 ? 90  VAL E C   1 
ATOM   7049  O O   . VAL E 1 72  ? 96.606  46.749  86.066  1.00 13.65 ? 90  VAL E O   1 
ATOM   7050  C CB  . VAL E 1 72  ? 96.451  43.582  85.307  1.00 5.11  ? 90  VAL E CB  1 
ATOM   7051  C CG1 . VAL E 1 72  ? 95.143  43.362  85.987  1.00 5.00  ? 90  VAL E CG1 1 
ATOM   7052  C CG2 . VAL E 1 72  ? 96.739  42.447  84.364  1.00 5.00  ? 90  VAL E CG2 1 
ATOM   7053  N N   . HIS E 1 73  ? 94.526  46.225  85.381  1.00 10.92 ? 91  HIS E N   1 
ATOM   7054  C CA  . HIS E 1 73  ? 93.906  47.269  86.216  1.00 11.32 ? 91  HIS E CA  1 
ATOM   7055  C C   . HIS E 1 73  ? 94.111  46.958  87.704  1.00 9.77  ? 91  HIS E C   1 
ATOM   7056  O O   . HIS E 1 73  ? 93.749  45.877  88.184  1.00 5.00  ? 91  HIS E O   1 
ATOM   7057  C CB  . HIS E 1 73  ? 92.401  47.438  85.935  1.00 11.95 ? 91  HIS E CB  1 
ATOM   7058  C CG  . HIS E 1 73  ? 91.797  48.653  86.592  1.00 10.50 ? 91  HIS E CG  1 
ATOM   7059  N ND1 . HIS E 1 73  ? 91.356  48.657  87.898  1.00 7.22  ? 91  HIS E ND1 1 
ATOM   7060  C CD2 . HIS E 1 73  ? 91.600  49.913  86.129  1.00 10.75 ? 91  HIS E CD2 1 
ATOM   7061  C CE1 . HIS E 1 73  ? 90.921  49.865  88.211  1.00 6.07  ? 91  HIS E CE1 1 
ATOM   7062  N NE2 . HIS E 1 73  ? 91.057  50.647  87.156  1.00 5.00  ? 91  HIS E NE2 1 
ATOM   7063  N N   . PRO E 1 74  ? 94.580  47.954  88.464  1.00 7.33  ? 92  PRO E N   1 
ATOM   7064  C CA  . PRO E 1 74  ? 94.873  47.921  89.895  1.00 10.12 ? 92  PRO E CA  1 
ATOM   7065  C C   . PRO E 1 74  ? 93.750  47.583  90.871  1.00 15.16 ? 92  PRO E C   1 
ATOM   7066  O O   . PRO E 1 74  ? 93.975  47.565  92.079  1.00 17.35 ? 92  PRO E O   1 
ATOM   7067  C CB  . PRO E 1 74  ? 95.414  49.319  90.150  1.00 8.11  ? 92  PRO E CB  1 
ATOM   7068  C CG  . PRO E 1 74  ? 94.668  50.109  89.181  1.00 5.00  ? 92  PRO E CG  1 
ATOM   7069  C CD  . PRO E 1 74  ? 94.795  49.310  87.946  1.00 5.00  ? 92  PRO E CD  1 
ATOM   7070  N N   . SER E 1 75  ? 92.553  47.314  90.369  1.00 16.69 ? 93  SER E N   1 
ATOM   7071  C CA  . SER E 1 75  ? 91.435  46.989  91.244  1.00 15.05 ? 93  SER E CA  1 
ATOM   7072  C C   . SER E 1 75  ? 90.636  45.849  90.655  1.00 15.07 ? 93  SER E C   1 
ATOM   7073  O O   . SER E 1 75  ? 89.552  45.526  91.116  1.00 16.50 ? 93  SER E O   1 
ATOM   7074  C CB  . SER E 1 75  ? 90.536  48.203  91.408  1.00 15.37 ? 93  SER E CB  1 
ATOM   7075  O OG  . SER E 1 75  ? 91.278  49.319  91.845  1.00 19.44 ? 93  SER E OG  1 
ATOM   7076  N N   . TYR E 1 76  ? 91.153  45.263  89.591  1.00 14.80 ? 94  TYR E N   1 
ATOM   7077  C CA  . TYR E 1 76  ? 90.453  44.174  88.962  1.00 12.48 ? 94  TYR E CA  1 
ATOM   7078  C C   . TYR E 1 76  ? 90.294  43.132  90.043  1.00 13.54 ? 94  TYR E C   1 
ATOM   7079  O O   . TYR E 1 76  ? 91.224  42.877  90.795  1.00 11.85 ? 94  TYR E O   1 
ATOM   7080  C CB  . TYR E 1 76  ? 91.269  43.643  87.789  1.00 8.15  ? 94  TYR E CB  1 
ATOM   7081  C CG  . TYR E 1 76  ? 91.022  42.205  87.499  1.00 5.88  ? 94  TYR E CG  1 
ATOM   7082  C CD1 . TYR E 1 76  ? 92.015  41.259  87.724  1.00 5.38  ? 94  TYR E CD1 1 
ATOM   7083  C CD2 . TYR E 1 76  ? 89.791  41.778  87.057  1.00 7.38  ? 94  TYR E CD2 1 
ATOM   7084  C CE1 . TYR E 1 76  ? 91.790  39.923  87.523  1.00 10.81 ? 94  TYR E CE1 1 
ATOM   7085  C CE2 . TYR E 1 76  ? 89.544  40.432  86.851  1.00 11.90 ? 94  TYR E CE2 1 
ATOM   7086  C CZ  . TYR E 1 76  ? 90.549  39.503  87.087  1.00 13.43 ? 94  TYR E CZ  1 
ATOM   7087  O OH  . TYR E 1 76  ? 90.312  38.148  86.907  1.00 17.89 ? 94  TYR E OH  1 
ATOM   7088  N N   . ASN E 1 77  ? 89.079  42.628  90.199  1.00 17.72 ? 95  ASN E N   1 
ATOM   7089  C CA  . ASN E 1 77  ? 88.813  41.598  91.198  1.00 19.37 ? 95  ASN E CA  1 
ATOM   7090  C C   . ASN E 1 77  ? 88.596  40.277  90.487  1.00 19.30 ? 95  ASN E C   1 
ATOM   7091  O O   . ASN E 1 77  ? 87.580  40.086  89.823  1.00 19.62 ? 95  ASN E O   1 
ATOM   7092  C CB  . ASN E 1 77  ? 87.580  41.942  92.028  1.00 19.58 ? 95  ASN E CB  1 
ATOM   7093  C CG  . ASN E 1 77  ? 87.370  40.984  93.179  0.00 20.32 ? 95  ASN E CG  1 
ATOM   7094  O OD1 . ASN E 1 77  ? 86.828  39.897  93.000  0.00 21.60 ? 95  ASN E OD1 1 
ATOM   7095  N ND2 . ASN E 1 77  ? 87.797  41.380  94.369  0.00 21.47 ? 95  ASN E ND2 1 
ATOM   7096  N N   . SER E 1 78  ? 89.558  39.373  90.613  1.00 19.74 ? 96  SER E N   1 
ATOM   7097  C CA  . SER E 1 78  ? 89.467  38.073  89.968  1.00 21.71 ? 96  SER E CA  1 
ATOM   7098  C C   . SER E 1 78  ? 88.180  37.312  90.259  1.00 24.90 ? 96  SER E C   1 
ATOM   7099  O O   . SER E 1 78  ? 87.803  36.425  89.506  1.00 23.94 ? 96  SER E O   1 
ATOM   7100  C CB  . SER E 1 78  ? 90.660  37.220  90.379  1.00 22.01 ? 96  SER E CB  1 
ATOM   7101  O OG  . SER E 1 78  ? 90.906  37.353  91.768  1.00 22.81 ? 96  SER E OG  1 
ATOM   7102  N N   . ASN E 1 79  ? 87.507  37.657  91.351  1.00 29.32 ? 97  ASN E N   1 
ATOM   7103  C CA  . ASN E 1 79  ? 86.281  36.962  91.717  1.00 29.69 ? 97  ASN E CA  1 
ATOM   7104  C C   . ASN E 1 79  ? 85.080  37.544  91.028  1.00 26.31 ? 97  ASN E C   1 
ATOM   7105  O O   . ASN E 1 79  ? 84.455  36.875  90.207  1.00 28.90 ? 97  ASN E O   1 
ATOM   7106  C CB  . ASN E 1 79  ? 86.093  36.960  93.230  1.00 35.18 ? 97  ASN E CB  1 
ATOM   7107  C CG  . ASN E 1 79  ? 87.092  36.059  93.938  1.00 41.09 ? 97  ASN E CG  1 
ATOM   7108  O OD1 . ASN E 1 79  ? 88.256  35.944  93.535  1.00 43.46 ? 97  ASN E OD1 1 
ATOM   7109  N ND2 . ASN E 1 79  ? 86.640  35.413  94.999  1.00 46.33 ? 97  ASN E ND2 1 
ATOM   7110  N N   . THR E 1 80  ? 84.787  38.802  91.326  1.00 20.68 ? 98  THR E N   1 
ATOM   7111  C CA  . THR E 1 80  ? 83.652  39.481  90.723  1.00 18.50 ? 98  THR E CA  1 
ATOM   7112  C C   . THR E 1 80  ? 83.829  39.787  89.238  1.00 14.49 ? 98  THR E C   1 
ATOM   7113  O O   . THR E 1 80  ? 82.857  39.881  88.500  1.00 15.39 ? 98  THR E O   1 
ATOM   7114  C CB  . THR E 1 80  ? 83.366  40.809  91.449  1.00 24.27 ? 98  THR E CB  1 
ATOM   7115  O OG1 . THR E 1 80  ? 84.349  41.806  91.101  1.00 28.00 ? 98  THR E OG1 1 
ATOM   7116  C CG2 . THR E 1 80  ? 83.404  40.578  92.943  1.00 29.46 ? 98  THR E CG2 1 
ATOM   7117  N N   . LEU E 1 81  ? 85.079  39.912  88.809  1.00 12.52 ? 99  LEU E N   1 
ATOM   7118  C CA  . LEU E 1 81  ? 85.430  40.265  87.441  1.00 9.43  ? 99  LEU E CA  1 
ATOM   7119  C C   . LEU E 1 81  ? 85.066  41.738  87.252  1.00 11.29 ? 99  LEU E C   1 
ATOM   7120  O O   . LEU E 1 81  ? 84.592  42.159  86.186  1.00 10.03 ? 99  LEU E O   1 
ATOM   7121  C CB  . LEU E 1 81  ? 84.723  39.379  86.414  1.00 5.80  ? 99  LEU E CB  1 
ATOM   7122  C CG  . LEU E 1 81  ? 85.115  37.898  86.434  1.00 6.84  ? 99  LEU E CG  1 
ATOM   7123  C CD1 . LEU E 1 81  ? 84.560  37.208  85.199  1.00 5.78  ? 99  LEU E CD1 1 
ATOM   7124  C CD2 . LEU E 1 81  ? 86.626  37.732  86.468  1.00 7.26  ? 99  LEU E CD2 1 
ATOM   7125  N N   . ASN E 1 82  ? 85.205  42.499  88.335  1.00 11.72 ? 100 ASN E N   1 
ATOM   7126  C CA  . ASN E 1 82  ? 84.922  43.920  88.287  1.00 12.18 ? 100 ASN E CA  1 
ATOM   7127  C C   . ASN E 1 82  ? 86.245  44.544  87.829  1.00 13.18 ? 100 ASN E C   1 
ATOM   7128  O O   . ASN E 1 82  ? 87.319  44.063  88.208  1.00 15.94 ? 100 ASN E O   1 
ATOM   7129  C CB  . ASN E 1 82  ? 84.496  44.431  89.674  1.00 10.17 ? 100 ASN E CB  1 
ATOM   7130  C CG  . ASN E 1 82  ? 84.036  45.877  89.646  1.00 12.17 ? 100 ASN E CG  1 
ATOM   7131  O OD1 . ASN E 1 82  ? 83.570  46.393  88.621  1.00 13.48 ? 100 ASN E OD1 1 
ATOM   7132  N ND2 . ASN E 1 82  ? 84.172  46.547  90.774  1.00 14.68 ? 100 ASN E ND2 1 
ATOM   7133  N N   . ASN E 1 83  ? 86.179  45.574  86.990  1.00 11.62 ? 101 ASN E N   1 
ATOM   7134  C CA  . ASN E 1 83  ? 87.378  46.231  86.484  1.00 8.91  ? 101 ASN E CA  1 
ATOM   7135  C C   . ASN E 1 83  ? 88.182  45.250  85.644  1.00 10.00 ? 101 ASN E C   1 
ATOM   7136  O O   . ASN E 1 83  ? 89.399  45.147  85.756  1.00 8.53  ? 101 ASN E O   1 
ATOM   7137  C CB  . ASN E 1 83  ? 88.240  46.767  87.614  1.00 5.00  ? 101 ASN E CB  1 
ATOM   7138  C CG  . ASN E 1 83  ? 87.523  47.753  88.454  1.00 5.00  ? 101 ASN E CG  1 
ATOM   7139  O OD1 . ASN E 1 83  ? 87.253  48.885  88.045  1.00 8.72  ? 101 ASN E OD1 1 
ATOM   7140  N ND2 . ASN E 1 83  ? 87.223  47.349  89.657  1.00 8.27  ? 101 ASN E ND2 1 
ATOM   7141  N N   . ASP E 1 84  ? 87.476  44.488  84.831  1.00 11.74 ? 102 ASP E N   1 
ATOM   7142  C CA  . ASP E 1 84  ? 88.124  43.544  83.959  1.00 12.99 ? 102 ASP E CA  1 
ATOM   7143  C C   . ASP E 1 84  ? 88.677  44.373  82.799  1.00 13.60 ? 102 ASP E C   1 
ATOM   7144  O O   . ASP E 1 84  ? 88.006  44.525  81.777  1.00 17.88 ? 102 ASP E O   1 
ATOM   7145  C CB  . ASP E 1 84  ? 87.116  42.504  83.459  0.00 14.91 ? 102 ASP E CB  1 
ATOM   7146  C CG  . ASP E 1 84  ? 87.735  41.498  82.512  0.00 16.29 ? 102 ASP E CG  1 
ATOM   7147  O OD1 . ASP E 1 84  ? 88.798  40.934  82.846  0.00 17.39 ? 102 ASP E OD1 1 
ATOM   7148  O OD2 . ASP E 1 84  ? 87.159  41.275  81.429  0.00 17.40 ? 102 ASP E OD2 1 
ATOM   7149  N N   . ILE E 1 85  ? 89.842  44.997  83.000  1.00 10.18 ? 103 ILE E N   1 
ATOM   7150  C CA  . ILE E 1 85  ? 90.503  45.773  81.946  1.00 5.82  ? 103 ILE E CA  1 
ATOM   7151  C C   . ILE E 1 85  ? 92.020  45.740  82.124  1.00 5.27  ? 103 ILE E C   1 
ATOM   7152  O O   . ILE E 1 85  ? 92.535  45.936  83.226  1.00 5.00  ? 103 ILE E O   1 
ATOM   7153  C CB  . ILE E 1 85  ? 90.003  47.237  81.879  1.00 5.00  ? 103 ILE E CB  1 
ATOM   7154  C CG1 . ILE E 1 85  ? 90.310  47.829  80.508  1.00 5.00  ? 103 ILE E CG1 1 
ATOM   7155  C CG2 . ILE E 1 85  ? 90.685  48.085  82.923  1.00 5.00  ? 103 ILE E CG2 1 
ATOM   7156  C CD1 . ILE E 1 85  ? 89.796  49.223  80.296  1.00 5.00  ? 103 ILE E CD1 1 
ATOM   7157  N N   . MET E 1 86  ? 92.725  45.472  81.033  1.00 6.65  ? 104 MET E N   1 
ATOM   7158  C CA  . MET E 1 86  ? 94.187  45.397  81.011  1.00 7.65  ? 104 MET E CA  1 
ATOM   7159  C C   . MET E 1 86  ? 94.730  46.135  79.777  1.00 10.13 ? 104 MET E C   1 
ATOM   7160  O O   . MET E 1 86  ? 94.055  46.211  78.738  1.00 11.61 ? 104 MET E O   1 
ATOM   7161  C CB  . MET E 1 86  ? 94.600  43.931  80.942  1.00 5.00  ? 104 MET E CB  1 
ATOM   7162  C CG  . MET E 1 86  ? 96.071  43.637  80.936  1.00 5.00  ? 104 MET E CG  1 
ATOM   7163  S SD  . MET E 1 86  ? 96.284  41.847  80.856  1.00 5.00  ? 104 MET E SD  1 
ATOM   7164  C CE  . MET E 1 86  ? 95.525  41.525  79.207  1.00 5.00  ? 104 MET E CE  1 
ATOM   7165  N N   . LEU E 1 87  ? 95.922  46.716  79.904  1.00 10.64 ? 105 LEU E N   1 
ATOM   7166  C CA  . LEU E 1 87  ? 96.582  47.409  78.790  1.00 7.89  ? 105 LEU E CA  1 
ATOM   7167  C C   . LEU E 1 87  ? 97.877  46.678  78.479  1.00 5.00  ? 105 LEU E C   1 
ATOM   7168  O O   . LEU E 1 87  ? 98.644  46.348  79.376  1.00 5.00  ? 105 LEU E O   1 
ATOM   7169  C CB  . LEU E 1 87  ? 96.878  48.876  79.130  1.00 9.59  ? 105 LEU E CB  1 
ATOM   7170  C CG  . LEU E 1 87  ? 95.677  49.840  79.150  1.00 10.17 ? 105 LEU E CG  1 
ATOM   7171  C CD1 . LEU E 1 87  ? 96.077  51.220  79.646  1.00 9.96  ? 105 LEU E CD1 1 
ATOM   7172  C CD2 . LEU E 1 87  ? 95.094  49.958  77.762  1.00 7.95  ? 105 LEU E CD2 1 
ATOM   7173  N N   . ILE E 1 88  ? 98.075  46.377  77.207  1.00 5.00  ? 106 ILE E N   1 
ATOM   7174  C CA  . ILE E 1 88  ? 99.253  45.683  76.737  1.00 5.00  ? 106 ILE E CA  1 
ATOM   7175  C C   . ILE E 1 88  ? 100.092 46.601  75.874  1.00 8.92  ? 106 ILE E C   1 
ATOM   7176  O O   . ILE E 1 88  ? 99.553  47.302  75.018  1.00 10.13 ? 106 ILE E O   1 
ATOM   7177  C CB  . ILE E 1 88  ? 98.863  44.513  75.899  1.00 5.00  ? 106 ILE E CB  1 
ATOM   7178  C CG1 . ILE E 1 88  ? 98.167  43.477  76.778  1.00 8.68  ? 106 ILE E CG1 1 
ATOM   7179  C CG2 . ILE E 1 88  ? 100.082 43.949  75.233  1.00 7.06  ? 106 ILE E CG2 1 
ATOM   7180  C CD1 . ILE E 1 88  ? 97.505  42.344  75.994  1.00 12.15 ? 106 ILE E CD1 1 
ATOM   7181  N N   . LYS E 1 89  ? 101.398 46.647  76.141  1.00 10.86 ? 107 LYS E N   1 
ATOM   7182  C CA  . LYS E 1 89  ? 102.313 47.475  75.356  1.00 9.95  ? 107 LYS E CA  1 
ATOM   7183  C C   . LYS E 1 89  ? 103.146 46.553  74.486  1.00 9.39  ? 107 LYS E C   1 
ATOM   7184  O O   . LYS E 1 89  ? 103.792 45.629  74.989  1.00 10.37 ? 107 LYS E O   1 
ATOM   7185  C CB  . LYS E 1 89  ? 103.243 48.314  76.234  1.00 7.40  ? 107 LYS E CB  1 
ATOM   7186  C CG  . LYS E 1 89  ? 104.152 49.209  75.391  1.00 5.00  ? 107 LYS E CG  1 
ATOM   7187  C CD  . LYS E 1 89  ? 104.922 50.190  76.233  1.00 5.00  ? 107 LYS E CD  1 
ATOM   7188  C CE  . LYS E 1 89  ? 105.744 51.090  75.353  1.00 6.51  ? 107 LYS E CE  1 
ATOM   7189  N NZ  . LYS E 1 89  ? 106.564 52.043  76.136  1.00 9.98  ? 107 LYS E NZ  1 
ATOM   7190  N N   . LEU E 1 90  ? 103.106 46.788  73.183  1.00 7.51  ? 108 LEU E N   1 
ATOM   7191  C CA  . LEU E 1 90  ? 103.848 45.977  72.244  1.00 7.52  ? 108 LEU E CA  1 
ATOM   7192  C C   . LEU E 1 90  ? 105.327 46.328  72.265  1.00 8.35  ? 108 LEU E C   1 
ATOM   7193  O O   . LEU E 1 90  ? 105.685 47.515  72.247  1.00 7.79  ? 108 LEU E O   1 
ATOM   7194  C CB  . LEU E 1 90  ? 103.305 46.211  70.849  1.00 6.71  ? 108 LEU E CB  1 
ATOM   7195  C CG  . LEU E 1 90  ? 101.832 45.912  70.661  1.00 5.00  ? 108 LEU E CG  1 
ATOM   7196  C CD1 . LEU E 1 90  ? 101.433 46.281  69.244  1.00 5.00  ? 108 LEU E CD1 1 
ATOM   7197  C CD2 . LEU E 1 90  ? 101.589 44.451  70.919  1.00 5.54  ? 108 LEU E CD2 1 
ATOM   7198  N N   . LYS E 1 91  ? 106.168 45.293  72.296  1.00 8.41  ? 109 LYS E N   1 
ATOM   7199  C CA  . LYS E 1 91  ? 107.623 45.444  72.293  1.00 9.08  ? 109 LYS E CA  1 
ATOM   7200  C C   . LYS E 1 91  ? 107.982 46.472  71.223  1.00 12.33 ? 109 LYS E C   1 
ATOM   7201  O O   . LYS E 1 91  ? 108.719 47.431  71.478  1.00 14.25 ? 109 LYS E O   1 
ATOM   7202  C CB  . LYS E 1 91  ? 108.284 44.092  71.967  1.00 6.73  ? 109 LYS E CB  1 
ATOM   7203  C CG  . LYS E 1 91  ? 109.771 44.153  71.652  1.00 6.52  ? 109 LYS E CG  1 
ATOM   7204  C CD  . LYS E 1 91  ? 110.415 42.779  71.679  0.00 7.80  ? 109 LYS E CD  1 
ATOM   7205  C CE  . LYS E 1 91  ? 110.418 42.204  73.087  0.00 8.69  ? 109 LYS E CE  1 
ATOM   7206  N NZ  . LYS E 1 91  ? 110.912 40.801  73.119  0.00 8.48  ? 109 LYS E NZ  1 
ATOM   7207  N N   . SER E 1 92  ? 107.395 46.286  70.043  1.00 12.44 ? 110 SER E N   1 
ATOM   7208  C CA  . SER E 1 92  ? 107.602 47.159  68.895  1.00 10.93 ? 110 SER E CA  1 
ATOM   7209  C C   . SER E 1 92  ? 106.256 47.732  68.483  1.00 10.57 ? 110 SER E C   1 
ATOM   7210  O O   . SER E 1 92  ? 105.254 47.043  68.559  1.00 11.80 ? 110 SER E O   1 
ATOM   7211  C CB  . SER E 1 92  ? 108.170 46.343  67.729  1.00 10.71 ? 110 SER E CB  1 
ATOM   7212  O OG  . SER E 1 92  ? 109.316 45.609  68.134  0.00 10.64 ? 110 SER E OG  1 
ATOM   7213  N N   . ALA E 1 93  ? 106.232 48.973  68.025  1.00 10.89 ? 111 ALA E N   1 
ATOM   7214  C CA  . ALA E 1 93  ? 104.982 49.581  67.601  1.00 16.37 ? 111 ALA E CA  1 
ATOM   7215  C C   . ALA E 1 93  ? 104.448 48.904  66.354  1.00 22.27 ? 111 ALA E C   1 
ATOM   7216  O O   . ALA E 1 93  ? 105.199 48.635  65.422  1.00 25.82 ? 111 ALA E O   1 
ATOM   7217  C CB  . ALA E 1 93  ? 105.169 51.048  67.346  1.00 14.55 ? 111 ALA E CB  1 
ATOM   7218  N N   . ALA E 1 94  ? 103.158 48.586  66.370  1.00 26.49 ? 112 ALA E N   1 
ATOM   7219  C CA  . ALA E 1 94  ? 102.488 47.946  65.250  1.00 29.73 ? 112 ALA E CA  1 
ATOM   7220  C C   . ALA E 1 94  ? 102.449 48.908  64.070  1.00 34.85 ? 112 ALA E C   1 
ATOM   7221  O O   . ALA E 1 94  ? 102.476 50.127  64.240  1.00 37.12 ? 112 ALA E O   1 
ATOM   7222  C CB  . ALA E 1 94  ? 101.078 47.541  65.646  0.00 29.46 ? 112 ALA E CB  1 
ATOM   7223  N N   . SER E 1 95  ? 102.356 48.338  62.877  1.00 38.93 ? 113 SER E N   1 
ATOM   7224  C CA  . SER E 1 95  ? 102.322 49.079  61.621  1.00 42.10 ? 113 SER E CA  1 
ATOM   7225  C C   . SER E 1 95  ? 100.926 49.528  61.223  1.00 43.12 ? 113 SER E C   1 
ATOM   7226  O O   . SER E 1 95  ? 100.198 48.795  60.542  1.00 42.27 ? 113 SER E O   1 
ATOM   7227  C CB  . SER E 1 95  ? 102.836 48.161  60.535  1.00 44.98 ? 113 SER E CB  1 
ATOM   7228  O OG  . SER E 1 95  ? 102.125 46.932  60.593  1.00 43.69 ? 113 SER E OG  1 
ATOM   7229  N N   . LEU E 1 96  ? 100.550 50.734  61.614  1.00 43.57 ? 114 LEU E N   1 
ATOM   7230  C CA  . LEU E 1 96  ? 99.223  51.213  61.267  1.00 41.81 ? 114 LEU E CA  1 
ATOM   7231  C C   . LEU E 1 96  ? 99.117  51.368  59.760  1.00 36.80 ? 114 LEU E C   1 
ATOM   7232  O O   . LEU E 1 96  ? 100.134 51.474  59.073  1.00 37.51 ? 114 LEU E O   1 
ATOM   7233  C CB  . LEU E 1 96  ? 98.923  52.531  61.979  1.00 43.50 ? 114 LEU E CB  1 
ATOM   7234  C CG  . LEU E 1 96  ? 98.877  52.356  63.494  1.00 45.31 ? 114 LEU E CG  1 
ATOM   7235  C CD1 . LEU E 1 96  ? 98.465  53.662  64.162  1.00 49.78 ? 114 LEU E CD1 1 
ATOM   7236  C CD2 . LEU E 1 96  ? 97.899  51.237  63.830  1.00 46.40 ? 114 LEU E CD2 1 
ATOM   7237  N N   . ASN E 1 97  ? 97.891  51.295  59.254  0.00 31.56 ? 115 ASN E N   1 
ATOM   7238  C CA  . ASN E 1 97  ? 97.599  51.444  57.832  0.00 27.29 ? 115 ASN E CA  1 
ATOM   7239  C C   . ASN E 1 97  ? 96.165  51.006  57.559  0.00 25.52 ? 115 ASN E C   1 
ATOM   7240  O O   . ASN E 1 97  ? 95.351  50.909  58.478  0.00 25.97 ? 115 ASN E O   1 
ATOM   7241  C CB  . ASN E 1 97  ? 98.581  50.643  56.955  0.00 26.21 ? 115 ASN E CB  1 
ATOM   7242  C CG  . ASN E 1 97  ? 98.449  49.138  57.127  0.00 23.62 ? 115 ASN E CG  1 
ATOM   7243  O OD1 . ASN E 1 97  ? 97.843  48.650  58.078  0.00 21.72 ? 115 ASN E OD1 1 
ATOM   7244  N ND2 . ASN E 1 97  ? 99.005  48.392  56.184  0.00 21.66 ? 115 ASN E ND2 1 
ATOM   7245  N N   . SER E 1 98  ? 95.857  50.765  56.289  0.00 23.41 ? 116 SER E N   1 
ATOM   7246  C CA  . SER E 1 98  ? 94.527  50.333  55.884  0.00 20.57 ? 116 SER E CA  1 
ATOM   7247  C C   . SER E 1 98  ? 94.205  48.930  56.396  0.00 19.70 ? 116 SER E C   1 
ATOM   7248  O O   . SER E 1 98  ? 93.039  48.547  56.490  0.00 18.58 ? 116 SER E O   1 
ATOM   7249  C CB  . SER E 1 98  ? 94.416  50.376  54.359  0.00 19.18 ? 116 SER E CB  1 
ATOM   7250  O OG  . SER E 1 98  ? 95.600  49.879  53.755  0.00 18.36 ? 116 SER E OG  1 
ATOM   7251  N N   . ARG E 1 99  ? 95.246  48.163  56.704  0.00 19.61 ? 117 ARG E N   1 
ATOM   7252  C CA  . ARG E 1 99  ? 95.080  46.805  57.202  0.00 19.62 ? 117 ARG E CA  1 
ATOM   7253  C C   . ARG E 1 99  ? 94.900  46.833  58.718  0.00 20.44 ? 117 ARG E C   1 
ATOM   7254  O O   . ARG E 1 99  ? 93.811  46.557  59.220  0.00 21.33 ? 117 ARG E O   1 
ATOM   7255  C CB  . ARG E 1 99  ? 96.285  45.945  56.809  0.00 18.74 ? 117 ARG E CB  1 
ATOM   7256  C CG  . ARG E 1 99  ? 96.569  45.927  55.310  0.00 17.40 ? 117 ARG E CG  1 
ATOM   7257  C CD  . ARG E 1 99  ? 95.381  45.397  54.520  0.00 16.94 ? 117 ARG E CD  1 
ATOM   7258  N NE  . ARG E 1 99  ? 95.621  45.425  53.080  0.00 16.65 ? 117 ARG E NE  1 
ATOM   7259  C CZ  . ARG E 1 99  ? 94.726  45.069  52.162  0.00 16.58 ? 117 ARG E CZ  1 
ATOM   7260  N NH1 . ARG E 1 99  ? 93.519  44.655  52.526  0.00 16.54 ? 117 ARG E NH1 1 
ATOM   7261  N NH2 . ARG E 1 99  ? 95.039  45.128  50.875  0.00 16.48 ? 117 ARG E NH2 1 
ATOM   7262  N N   . VAL E 1 100 ? 95.976  47.118  59.444  1.00 21.37 ? 118 VAL E N   1 
ATOM   7263  C CA  . VAL E 1 100 ? 95.937  47.204  60.893  1.00 24.18 ? 118 VAL E CA  1 
ATOM   7264  C C   . VAL E 1 100 ? 95.702  48.683  61.220  1.00 26.95 ? 118 VAL E C   1 
ATOM   7265  O O   . VAL E 1 100 ? 96.477  49.547  60.816  1.00 27.76 ? 118 VAL E O   1 
ATOM   7266  C CB  . VAL E 1 100 ? 97.273  46.775  61.530  1.00 23.95 ? 118 VAL E CB  1 
ATOM   7267  C CG1 . VAL E 1 100 ? 97.092  46.551  63.007  1.00 28.36 ? 118 VAL E CG1 1 
ATOM   7268  C CG2 . VAL E 1 100 ? 97.808  45.528  60.879  1.00 27.26 ? 118 VAL E CG2 1 
ATOM   7269  N N   . ALA E 1 101 ? 94.604  48.987  61.903  1.00 28.52 ? 119 ALA E N   1 
ATOM   7270  C CA  . ALA E 1 101 ? 94.288  50.370  62.275  1.00 25.31 ? 119 ALA E CA  1 
ATOM   7271  C C   . ALA E 1 101 ? 93.759  50.379  63.699  1.00 21.74 ? 119 ALA E C   1 
ATOM   7272  O O   . ALA E 1 101 ? 93.255  49.377  64.206  1.00 22.95 ? 119 ALA E O   1 
ATOM   7273  C CB  . ALA E 1 101 ? 93.268  50.988  61.320  1.00 19.52 ? 119 ALA E CB  1 
ATOM   7274  N N   . SER E 1 102 ? 93.910  51.502  64.362  1.00 17.71 ? 120 SER E N   1 
ATOM   7275  C CA  . SER E 1 102 ? 93.465  51.591  65.721  1.00 20.75 ? 120 SER E CA  1 
ATOM   7276  C C   . SER E 1 102 ? 91.992  51.957  65.776  1.00 22.60 ? 120 SER E C   1 
ATOM   7277  O O   . SER E 1 102 ? 91.443  52.512  64.819  1.00 19.92 ? 120 SER E O   1 
ATOM   7278  C CB  . SER E 1 102 ? 94.304  52.631  66.445  1.00 25.94 ? 120 SER E CB  1 
ATOM   7279  O OG  . SER E 1 102 ? 94.327  53.848  65.722  1.00 29.60 ? 120 SER E OG  1 
ATOM   7280  N N   . ILE E 1 103 ? 91.344  51.571  66.876  1.00 24.46 ? 121 ILE E N   1 
ATOM   7281  C CA  . ILE E 1 103 ? 89.930  51.876  67.120  1.00 20.17 ? 121 ILE E CA  1 
ATOM   7282  C C   . ILE E 1 103 ? 89.948  53.061  68.095  1.00 17.95 ? 121 ILE E C   1 
ATOM   7283  O O   . ILE E 1 103 ? 90.894  53.182  68.884  1.00 18.34 ? 121 ILE E O   1 
ATOM   7284  C CB  . ILE E 1 103 ? 89.170  50.662  67.745  1.00 17.17 ? 121 ILE E CB  1 
ATOM   7285  C CG1 . ILE E 1 103 ? 87.739  51.068  68.098  1.00 17.64 ? 121 ILE E CG1 1 
ATOM   7286  C CG2 . ILE E 1 103 ? 89.874  50.165  68.996  1.00 14.94 ? 121 ILE E CG2 1 
ATOM   7287  C CD1 . ILE E 1 103 ? 86.940  51.574  66.921  1.00 20.20 ? 121 ILE E CD1 1 
ATOM   7288  N N   . SER E 1 104 ? 88.940  53.933  68.042  1.00 13.31 ? 122 SER E N   1 
ATOM   7289  C CA  . SER E 1 104 ? 88.920  55.095  68.927  1.00 13.04 ? 122 SER E CA  1 
ATOM   7290  C C   . SER E 1 104 ? 88.349  54.816  70.296  1.00 12.94 ? 122 SER E C   1 
ATOM   7291  O O   . SER E 1 104 ? 87.512  53.931  70.457  1.00 17.47 ? 122 SER E O   1 
ATOM   7292  C CB  . SER E 1 104 ? 88.134  56.219  68.290  1.00 16.11 ? 122 SER E CB  1 
ATOM   7293  O OG  . SER E 1 104 ? 88.461  56.315  66.919  1.00 22.11 ? 122 SER E OG  1 
ATOM   7294  N N   . LEU E 1 105 ? 88.852  55.524  71.297  1.00 12.15 ? 123 LEU E N   1 
ATOM   7295  C CA  . LEU E 1 105 ? 88.350  55.367  72.651  1.00 12.40 ? 123 LEU E CA  1 
ATOM   7296  C C   . LEU E 1 105 ? 87.127  56.272  72.655  1.00 14.24 ? 123 LEU E C   1 
ATOM   7297  O O   . LEU E 1 105 ? 87.064  57.227  71.868  1.00 16.41 ? 123 LEU E O   1 
ATOM   7298  C CB  . LEU E 1 105 ? 89.390  55.823  73.688  1.00 7.91  ? 123 LEU E CB  1 
ATOM   7299  C CG  . LEU E 1 105 ? 90.563  54.878  73.979  1.00 5.00  ? 123 LEU E CG  1 
ATOM   7300  C CD1 . LEU E 1 105 ? 91.480  55.427  75.010  1.00 5.00  ? 123 LEU E CD1 1 
ATOM   7301  C CD2 . LEU E 1 105 ? 90.046  53.547  74.449  1.00 6.23  ? 123 LEU E CD2 1 
ATOM   7302  N N   . PRO E 1 106 ? 86.107  55.944  73.464  1.00 16.22 ? 124 PRO E N   1 
ATOM   7303  C CA  . PRO E 1 106 ? 84.875  56.728  73.559  1.00 17.51 ? 124 PRO E CA  1 
ATOM   7304  C C   . PRO E 1 106 ? 85.075  57.968  74.397  1.00 23.19 ? 124 PRO E C   1 
ATOM   7305  O O   . PRO E 1 106 ? 86.061  58.074  75.113  1.00 28.70 ? 124 PRO E O   1 
ATOM   7306  C CB  . PRO E 1 106 ? 83.958  55.779  74.294  1.00 17.33 ? 124 PRO E CB  1 
ATOM   7307  C CG  . PRO E 1 106 ? 84.891  55.159  75.281  1.00 14.95 ? 124 PRO E CG  1 
ATOM   7308  C CD  . PRO E 1 106 ? 86.060  54.803  74.392  1.00 14.17 ? 124 PRO E CD  1 
ATOM   7309  N N   . THR E 1 107 ? 84.145  58.909  74.307  1.00 28.65 ? 125 THR E N   1 
ATOM   7310  C CA  . THR E 1 107 ? 84.211  60.119  75.126  1.00 33.62 ? 125 THR E CA  1 
ATOM   7311  C C   . THR E 1 107 ? 83.002  60.140  76.068  1.00 34.95 ? 125 THR E C   1 
ATOM   7312  O O   . THR E 1 107 ? 83.038  60.751  77.139  1.00 37.26 ? 125 THR E O   1 
ATOM   7313  C CB  . THR E 1 107 ? 84.179  61.381  74.273  1.00 37.01 ? 125 THR E CB  1 
ATOM   7314  O OG1 . THR E 1 107 ? 82.979  61.394  73.487  1.00 39.09 ? 125 THR E OG1 1 
ATOM   7315  C CG2 . THR E 1 107 ? 85.409  61.438  73.363  1.00 41.72 ? 125 THR E CG2 1 
ATOM   7316  N N   . SER E 1 108 ? 81.940  59.451  75.653  1.00 34.59 ? 127 SER E N   1 
ATOM   7317  C CA  . SER E 1 108 ? 80.702  59.364  76.406  1.00 32.31 ? 127 SER E CA  1 
ATOM   7318  C C   . SER E 1 108 ? 80.164  57.966  76.225  1.00 27.56 ? 127 SER E C   1 
ATOM   7319  O O   . SER E 1 108 ? 80.261  57.413  75.131  1.00 24.51 ? 127 SER E O   1 
ATOM   7320  C CB  . SER E 1 108 ? 79.702  60.356  75.843  1.00 38.82 ? 127 SER E CB  1 
ATOM   7321  O OG  . SER E 1 108 ? 80.315  61.620  75.639  1.00 45.18 ? 127 SER E OG  1 
ATOM   7322  N N   . CYS E 1 109 ? 79.585  57.415  77.289  1.00 24.32 ? 128 CYS E N   1 
ATOM   7323  C CA  . CYS E 1 109 ? 79.050  56.058  77.274  1.00 23.21 ? 128 CYS E CA  1 
ATOM   7324  C C   . CYS E 1 109 ? 77.864  55.868  76.340  1.00 22.90 ? 128 CYS E C   1 
ATOM   7325  O O   . CYS E 1 109 ? 77.021  56.750  76.212  1.00 18.27 ? 128 CYS E O   1 
ATOM   7326  C CB  . CYS E 1 109 ? 78.657  55.638  78.678  1.00 22.57 ? 128 CYS E CB  1 
ATOM   7327  S SG  . CYS E 1 109 ? 79.956  55.890  79.912  1.00 19.10 ? 128 CYS E SG  1 
ATOM   7328  N N   . ALA E 1 110 ? 77.798  54.695  75.711  1.00 23.92 ? 129 ALA E N   1 
ATOM   7329  C CA  . ALA E 1 110 ? 76.727  54.370  74.776  1.00 22.45 ? 129 ALA E CA  1 
ATOM   7330  C C   . ALA E 1 110 ? 75.440  54.155  75.550  1.00 25.90 ? 129 ALA E C   1 
ATOM   7331  O O   . ALA E 1 110 ? 75.431  53.409  76.545  1.00 26.79 ? 129 ALA E O   1 
ATOM   7332  C CB  . ALA E 1 110 ? 77.080  53.131  74.002  1.00 16.38 ? 129 ALA E CB  1 
ATOM   7333  N N   . SER E 1 111 ? 74.372  54.830  75.115  1.00 27.15 ? 130 SER E N   1 
ATOM   7334  C CA  . SER E 1 111 ? 73.060  54.727  75.749  1.00 25.44 ? 130 SER E CA  1 
ATOM   7335  C C   . SER E 1 111 ? 72.469  53.375  75.388  1.00 25.89 ? 130 SER E C   1 
ATOM   7336  O O   . SER E 1 111 ? 72.710  52.866  74.296  1.00 27.42 ? 130 SER E O   1 
ATOM   7337  C CB  . SER E 1 111 ? 72.145  55.852  75.258  0.00 25.38 ? 130 SER E CB  1 
ATOM   7338  O OG  . SER E 1 111 ? 72.683  57.124  75.581  0.00 25.55 ? 130 SER E OG  1 
ATOM   7339  N N   . ALA E 1 112 ? 71.751  52.755  76.316  1.00 26.26 ? 132 ALA E N   1 
ATOM   7340  C CA  . ALA E 1 112 ? 71.136  51.467  76.022  1.00 27.35 ? 132 ALA E CA  1 
ATOM   7341  C C   . ALA E 1 112 ? 70.332  51.572  74.719  1.00 27.96 ? 132 ALA E C   1 
ATOM   7342  O O   . ALA E 1 112 ? 69.683  52.587  74.430  1.00 28.47 ? 132 ALA E O   1 
ATOM   7343  C CB  . ALA E 1 112 ? 70.239  51.037  77.162  1.00 30.20 ? 132 ALA E CB  1 
ATOM   7344  N N   . GLY E 1 113 ? 70.402  50.528  73.916  1.00 28.05 ? 133 GLY E N   1 
ATOM   7345  C CA  . GLY E 1 113 ? 69.690  50.544  72.660  1.00 28.70 ? 133 GLY E CA  1 
ATOM   7346  C C   . GLY E 1 113 ? 70.642  50.720  71.503  1.00 27.40 ? 133 GLY E C   1 
ATOM   7347  O O   . GLY E 1 113 ? 70.276  50.393  70.371  1.00 30.19 ? 133 GLY E O   1 
ATOM   7348  N N   . THR E 1 114 ? 71.856  51.216  71.780  1.00 24.83 ? 134 THR E N   1 
ATOM   7349  C CA  . THR E 1 114 ? 72.867  51.427  70.747  1.00 20.59 ? 134 THR E CA  1 
ATOM   7350  C C   . THR E 1 114 ? 73.289  50.119  70.152  1.00 21.80 ? 134 THR E C   1 
ATOM   7351  O O   . THR E 1 114 ? 73.545  49.153  70.879  1.00 23.17 ? 134 THR E O   1 
ATOM   7352  C CB  . THR E 1 114 ? 74.116  52.068  71.287  1.00 21.46 ? 134 THR E CB  1 
ATOM   7353  O OG1 . THR E 1 114 ? 73.813  53.355  71.835  1.00 24.69 ? 134 THR E OG1 1 
ATOM   7354  C CG2 . THR E 1 114 ? 75.113  52.231  70.171  1.00 25.62 ? 134 THR E CG2 1 
ATOM   7355  N N   . GLN E 1 115 ? 73.364  50.082  68.831  1.00 21.78 ? 135 GLN E N   1 
ATOM   7356  C CA  . GLN E 1 115 ? 73.769  48.862  68.146  1.00 22.48 ? 135 GLN E CA  1 
ATOM   7357  C C   . GLN E 1 115 ? 75.309  48.833  68.032  1.00 21.77 ? 135 GLN E C   1 
ATOM   7358  O O   . GLN E 1 115 ? 75.934  49.841  67.657  1.00 22.22 ? 135 GLN E O   1 
ATOM   7359  C CB  . GLN E 1 115 ? 73.106  48.811  66.770  1.00 22.29 ? 135 GLN E CB  1 
ATOM   7360  C CG  . GLN E 1 115 ? 72.941  47.409  66.221  1.00 26.34 ? 135 GLN E CG  1 
ATOM   7361  C CD  . GLN E 1 115 ? 72.576  47.402  64.747  0.00 27.75 ? 135 GLN E CD  1 
ATOM   7362  O OE1 . GLN E 1 115 ? 73.398  47.079  63.890  0.00 29.18 ? 135 GLN E OE1 1 
ATOM   7363  N NE2 . GLN E 1 115 ? 71.338  47.761  64.447  0.00 29.11 ? 135 GLN E NE2 1 
ATOM   7364  N N   . CYS E 1 116 ? 75.920  47.701  68.379  1.00 17.61 ? 136 CYS E N   1 
ATOM   7365  C CA  . CYS E 1 116 ? 77.377  47.566  68.331  1.00 16.63 ? 136 CYS E CA  1 
ATOM   7366  C C   . CYS E 1 116 ? 77.847  46.333  67.551  1.00 17.98 ? 136 CYS E C   1 
ATOM   7367  O O   . CYS E 1 116 ? 77.041  45.466  67.194  1.00 22.85 ? 136 CYS E O   1 
ATOM   7368  C CB  . CYS E 1 116 ? 77.912  47.482  69.758  1.00 14.15 ? 136 CYS E CB  1 
ATOM   7369  S SG  . CYS E 1 116 ? 77.221  48.759  70.838  1.00 12.94 ? 136 CYS E SG  1 
ATOM   7370  N N   . LEU E 1 117 ? 79.147  46.256  67.286  1.00 14.56 ? 137 LEU E N   1 
ATOM   7371  C CA  . LEU E 1 117 ? 79.713  45.104  66.599  1.00 11.09 ? 137 LEU E CA  1 
ATOM   7372  C C   . LEU E 1 117 ? 80.736  44.437  67.525  1.00 11.65 ? 137 LEU E C   1 
ATOM   7373  O O   . LEU E 1 117 ? 81.668  45.097  68.025  1.00 9.33  ? 137 LEU E O   1 
ATOM   7374  C CB  . LEU E 1 117 ? 80.368  45.521  65.283  1.00 9.88  ? 137 LEU E CB  1 
ATOM   7375  C CG  . LEU E 1 117 ? 81.162  44.448  64.536  1.00 5.00  ? 137 LEU E CG  1 
ATOM   7376  C CD1 . LEU E 1 117 ? 80.240  43.314  64.181  1.00 8.47  ? 137 LEU E CD1 1 
ATOM   7377  C CD2 . LEU E 1 117 ? 81.793  45.023  63.289  1.00 5.00  ? 137 LEU E CD2 1 
ATOM   7378  N N   . ILE E 1 118 ? 80.480  43.166  67.832  1.00 11.18 ? 138 ILE E N   1 
ATOM   7379  C CA  . ILE E 1 118 ? 81.345  42.352  68.689  1.00 10.03 ? 138 ILE E CA  1 
ATOM   7380  C C   . ILE E 1 118 ? 82.056  41.408  67.714  1.00 10.17 ? 138 ILE E C   1 
ATOM   7381  O O   . ILE E 1 118 ? 81.457  40.996  66.719  1.00 11.64 ? 138 ILE E O   1 
ATOM   7382  C CB  . ILE E 1 118 ? 80.499  41.522  69.705  1.00 8.75  ? 138 ILE E CB  1 
ATOM   7383  C CG1 . ILE E 1 118 ? 79.491  42.419  70.406  1.00 9.58  ? 138 ILE E CG1 1 
ATOM   7384  C CG2 . ILE E 1 118 ? 81.381  40.913  70.769  1.00 5.00  ? 138 ILE E CG2 1 
ATOM   7385  C CD1 . ILE E 1 118 ? 78.509  41.656  71.243  1.00 14.08 ? 138 ILE E CD1 1 
ATOM   7386  N N   . SER E 1 119 ? 83.323  41.086  67.959  1.00 8.81  ? 139 SER E N   1 
ATOM   7387  C CA  . SER E 1 119 ? 84.059  40.191  67.053  1.00 7.60  ? 139 SER E CA  1 
ATOM   7388  C C   . SER E 1 119 ? 85.116  39.347  67.748  1.00 7.77  ? 139 SER E C   1 
ATOM   7389  O O   . SER E 1 119 ? 85.684  39.744  68.770  1.00 10.76 ? 139 SER E O   1 
ATOM   7390  C CB  . SER E 1 119 ? 84.744  40.992  65.962  1.00 7.43  ? 139 SER E CB  1 
ATOM   7391  O OG  . SER E 1 119 ? 85.619  41.947  66.547  1.00 7.93  ? 139 SER E OG  1 
ATOM   7392  N N   . GLY E 1 120 ? 85.427  38.204  67.158  1.00 5.00  ? 140 GLY E N   1 
ATOM   7393  C CA  . GLY E 1 120 ? 86.407  37.333  67.763  1.00 5.00  ? 140 GLY E CA  1 
ATOM   7394  C C   . GLY E 1 120 ? 86.491  35.994  67.075  1.00 6.29  ? 140 GLY E C   1 
ATOM   7395  O O   . GLY E 1 120 ? 85.767  35.727  66.111  1.00 5.98  ? 140 GLY E O   1 
ATOM   7396  N N   . TRP E 1 121 ? 87.384  35.149  67.578  1.00 6.52  ? 141 TRP E N   1 
ATOM   7397  C CA  . TRP E 1 121 ? 87.614  33.826  67.015  1.00 8.41  ? 141 TRP E CA  1 
ATOM   7398  C C   . TRP E 1 121 ? 87.140  32.765  67.985  1.00 9.93  ? 141 TRP E C   1 
ATOM   7399  O O   . TRP E 1 121 ? 87.427  31.581  67.833  1.00 11.61 ? 141 TRP E O   1 
ATOM   7400  C CB  . TRP E 1 121 ? 89.102  33.620  66.711  1.00 5.38  ? 141 TRP E CB  1 
ATOM   7401  C CG  . TRP E 1 121 ? 89.601  34.323  65.488  1.00 5.00  ? 141 TRP E CG  1 
ATOM   7402  C CD1 . TRP E 1 121 ? 89.468  33.911  64.202  1.00 5.00  ? 141 TRP E CD1 1 
ATOM   7403  C CD2 . TRP E 1 121 ? 90.395  35.512  65.451  1.00 5.00  ? 141 TRP E CD2 1 
ATOM   7404  N NE1 . TRP E 1 121 ? 90.143  34.759  63.364  1.00 5.34  ? 141 TRP E NE1 1 
ATOM   7405  C CE2 . TRP E 1 121 ? 90.722  35.752  64.109  1.00 5.00  ? 141 TRP E CE2 1 
ATOM   7406  C CE3 . TRP E 1 121 ? 90.863  36.398  66.431  1.00 6.90  ? 141 TRP E CE3 1 
ATOM   7407  C CZ2 . TRP E 1 121 ? 91.505  36.836  63.714  1.00 5.22  ? 141 TRP E CZ2 1 
ATOM   7408  C CZ3 . TRP E 1 121 ? 91.633  37.473  66.042  1.00 8.08  ? 141 TRP E CZ3 1 
ATOM   7409  C CH2 . TRP E 1 121 ? 91.949  37.683  64.693  1.00 7.31  ? 141 TRP E CH2 1 
ATOM   7410  N N   . GLY E 1 122 ? 86.411  33.198  68.996  1.00 11.44 ? 142 GLY E N   1 
ATOM   7411  C CA  . GLY E 1 122 ? 85.916  32.267  69.987  1.00 12.65 ? 142 GLY E CA  1 
ATOM   7412  C C   . GLY E 1 122 ? 84.950  31.261  69.412  1.00 12.96 ? 142 GLY E C   1 
ATOM   7413  O O   . GLY E 1 122 ? 84.529  31.362  68.261  1.00 11.26 ? 142 GLY E O   1 
ATOM   7414  N N   . ASN E 1 123 ? 84.553  30.327  70.264  1.00 15.11 ? 143 ASN E N   1 
ATOM   7415  C CA  . ASN E 1 123 ? 83.638  29.246  69.920  1.00 16.76 ? 143 ASN E CA  1 
ATOM   7416  C C   . ASN E 1 123 ? 82.401  29.777  69.212  1.00 16.89 ? 143 ASN E C   1 
ATOM   7417  O O   . ASN E 1 123 ? 82.001  30.912  69.432  1.00 14.64 ? 143 ASN E O   1 
ATOM   7418  C CB  . ASN E 1 123 ? 83.239  28.515  71.214  1.00 18.16 ? 143 ASN E CB  1 
ATOM   7419  C CG  . ASN E 1 123 ? 82.497  27.211  70.966  1.00 16.49 ? 143 ASN E CG  1 
ATOM   7420  O OD1 . ASN E 1 123 ? 82.422  26.732  69.840  1.00 15.24 ? 143 ASN E OD1 1 
ATOM   7421  N ND2 . ASN E 1 123 ? 81.957  26.626  72.030  1.00 16.87 ? 143 ASN E ND2 1 
ATOM   7422  N N   . THR E 1 124 ? 81.863  28.987  68.293  1.00 21.08 ? 144 THR E N   1 
ATOM   7423  C CA  . THR E 1 124 ? 80.659  29.364  67.581  1.00 25.24 ? 144 THR E CA  1 
ATOM   7424  C C   . THR E 1 124 ? 79.454  28.602  68.124  1.00 31.15 ? 144 THR E C   1 
ATOM   7425  O O   . THR E 1 124 ? 78.359  29.166  68.210  1.00 35.08 ? 144 THR E O   1 
ATOM   7426  C CB  . THR E 1 124 ? 80.776  29.126  66.072  1.00 23.96 ? 144 THR E CB  1 
ATOM   7427  O OG1 . THR E 1 124 ? 81.398  27.861  65.815  1.00 21.01 ? 144 THR E OG1 1 
ATOM   7428  C CG2 . THR E 1 124 ? 81.576  30.234  65.433  1.00 26.86 ? 144 THR E CG2 1 
ATOM   7429  N N   . LYS E 1 125 ? 79.662  27.344  68.520  1.00 33.97 ? 145 LYS E N   1 
ATOM   7430  C CA  . LYS E 1 125 ? 78.590  26.501  69.057  1.00 38.92 ? 145 LYS E CA  1 
ATOM   7431  C C   . LYS E 1 125 ? 78.157  26.800  70.492  1.00 42.79 ? 145 LYS E C   1 
ATOM   7432  O O   . LYS E 1 125 ? 78.988  27.006  71.382  1.00 39.19 ? 145 LYS E O   1 
ATOM   7433  C CB  . LYS E 1 125 ? 78.957  25.023  68.958  1.00 40.09 ? 145 LYS E CB  1 
ATOM   7434  C CG  . LYS E 1 125 ? 78.837  24.436  67.569  1.00 44.03 ? 145 LYS E CG  1 
ATOM   7435  C CD  . LYS E 1 125 ? 78.978  22.914  67.608  1.00 45.79 ? 145 LYS E CD  1 
ATOM   7436  C CE  . LYS E 1 125 ? 78.764  22.302  66.233  1.00 49.21 ? 145 LYS E CE  1 
ATOM   7437  N NZ  . LYS E 1 125 ? 78.843  20.819  66.269  1.00 50.93 ? 145 LYS E NZ  1 
ATOM   7438  N N   . SER E 1 126 ? 76.838  26.793  70.701  1.00 48.63 ? 146 SER E N   1 
ATOM   7439  C CA  . SER E 1 126 ? 76.228  27.039  72.014  1.00 50.77 ? 146 SER E CA  1 
ATOM   7440  C C   . SER E 1 126 ? 76.537  25.840  72.907  1.00 53.17 ? 146 SER E C   1 
ATOM   7441  O O   . SER E 1 126 ? 76.985  25.987  74.052  1.00 53.35 ? 146 SER E O   1 
ATOM   7442  C CB  . SER E 1 126 ? 74.708  27.222  71.869  1.00 46.86 ? 146 SER E CB  1 
ATOM   7443  O OG  . SER E 1 126 ? 74.144  26.215  71.045  0.00 50.50 ? 146 SER E OG  1 
ATOM   7444  N N   . SER E 1 127 ? 76.286  24.655  72.359  1.00 54.86 ? 147 SER E N   1 
ATOM   7445  C CA  . SER E 1 127 ? 76.546  23.397  73.038  1.00 55.44 ? 147 SER E CA  1 
ATOM   7446  C C   . SER E 1 127 ? 77.629  22.690  72.212  1.00 54.31 ? 147 SER E C   1 
ATOM   7447  O O   . SER E 1 127 ? 77.385  22.290  71.070  1.00 57.29 ? 147 SER E O   1 
ATOM   7448  C CB  . SER E 1 127 ? 75.263  22.554  73.093  1.00 57.54 ? 147 SER E CB  1 
ATOM   7449  O OG  . SER E 1 127 ? 74.197  23.288  73.672  0.00 58.25 ? 147 SER E OG  1 
ATOM   7450  N N   . GLY E 1 128 ? 78.829  22.576  72.774  1.00 50.81 ? 148 GLY E N   1 
ATOM   7451  C CA  . GLY E 1 128 ? 79.916  21.933  72.065  1.00 48.84 ? 148 GLY E CA  1 
ATOM   7452  C C   . GLY E 1 128 ? 80.920  22.972  71.611  1.00 49.78 ? 148 GLY E C   1 
ATOM   7453  O O   . GLY E 1 128 ? 80.588  24.154  71.493  1.00 50.63 ? 148 GLY E O   1 
ATOM   7454  N N   . THR E 1 129 ? 82.150  22.537  71.364  1.00 47.36 ? 149 THR E N   1 
ATOM   7455  C CA  . THR E 1 129 ? 83.216  23.436  70.941  1.00 40.56 ? 149 THR E CA  1 
ATOM   7456  C C   . THR E 1 129 ? 83.531  23.342  69.447  1.00 36.64 ? 149 THR E C   1 
ATOM   7457  O O   . THR E 1 129 ? 83.888  22.277  68.945  1.00 38.54 ? 149 THR E O   1 
ATOM   7458  C CB  . THR E 1 129 ? 84.505  23.169  71.750  0.00 40.21 ? 149 THR E CB  1 
ATOM   7459  O OG1 . THR E 1 129 ? 84.729  21.756  71.842  0.00 38.99 ? 149 THR E OG1 1 
ATOM   7460  C CG2 . THR E 1 129 ? 84.388  23.751  73.151  0.00 39.01 ? 149 THR E CG2 1 
ATOM   7461  N N   . SER E 1 130 ? 83.402  24.463  68.747  1.00 30.15 ? 150 SER E N   1 
ATOM   7462  C CA  . SER E 1 130 ? 83.677  24.547  67.322  1.00 25.44 ? 150 SER E CA  1 
ATOM   7463  C C   . SER E 1 130 ? 84.347  25.897  67.169  1.00 25.00 ? 150 SER E C   1 
ATOM   7464  O O   . SER E 1 130 ? 83.683  26.912  66.967  1.00 26.01 ? 150 SER E O   1 
ATOM   7465  C CB  . SER E 1 130 ? 82.364  24.500  66.531  0.00 27.61 ? 150 SER E CB  1 
ATOM   7466  O OG  . SER E 1 130 ? 82.592  24.536  65.133  0.00 25.35 ? 150 SER E OG  1 
ATOM   7467  N N   . TYR E 1 131 ? 85.658  25.923  67.376  1.00 26.44 ? 151 TYR E N   1 
ATOM   7468  C CA  . TYR E 1 131 ? 86.433  27.164  67.267  1.00 26.19 ? 151 TYR E CA  1 
ATOM   7469  C C   . TYR E 1 131 ? 86.789  27.499  65.817  1.00 22.66 ? 151 TYR E C   1 
ATOM   7470  O O   . TYR E 1 131 ? 87.545  26.776  65.163  1.00 20.58 ? 151 TYR E O   1 
ATOM   7471  C CB  . TYR E 1 131 ? 87.680  27.108  68.156  1.00 21.32 ? 151 TYR E CB  1 
ATOM   7472  C CG  . TYR E 1 131 ? 87.351  27.140  69.638  1.00 19.36 ? 151 TYR E CG  1 
ATOM   7473  C CD1 . TYR E 1 131 ? 87.106  28.342  70.291  1.00 17.74 ? 151 TYR E CD1 1 
ATOM   7474  C CD2 . TYR E 1 131 ? 87.298  25.970  70.387  1.00 19.88 ? 151 TYR E CD2 1 
ATOM   7475  C CE1 . TYR E 1 131 ? 86.825  28.376  71.648  1.00 17.66 ? 151 TYR E CE1 1 
ATOM   7476  C CE2 . TYR E 1 131 ? 87.014  25.996  71.742  1.00 17.65 ? 151 TYR E CE2 1 
ATOM   7477  C CZ  . TYR E 1 131 ? 86.781  27.201  72.365  1.00 17.94 ? 151 TYR E CZ  1 
ATOM   7478  O OH  . TYR E 1 131 ? 86.517  27.241  73.711  1.00 18.97 ? 151 TYR E OH  1 
ATOM   7479  N N   . PRO E 1 132 ? 86.191  28.581  65.284  1.00 27.35 ? 152 PRO E N   1 
ATOM   7480  C CA  . PRO E 1 132 ? 86.398  29.057  63.913  1.00 26.52 ? 152 PRO E CA  1 
ATOM   7481  C C   . PRO E 1 132 ? 87.815  29.513  63.586  1.00 32.28 ? 152 PRO E C   1 
ATOM   7482  O O   . PRO E 1 132 ? 88.570  29.941  64.461  1.00 33.55 ? 152 PRO E O   1 
ATOM   7483  C CB  . PRO E 1 132 ? 85.400  30.211  63.795  1.00 25.25 ? 152 PRO E CB  1 
ATOM   7484  C CG  . PRO E 1 132 ? 85.331  30.736  65.192  1.00 21.40 ? 152 PRO E CG  1 
ATOM   7485  C CD  . PRO E 1 132 ? 85.260  29.470  66.004  1.00 22.93 ? 152 PRO E CD  1 
ATOM   7486  N N   . ASP E 1 133 ? 88.166  29.389  62.311  1.00 37.31 ? 153 ASP E N   1 
ATOM   7487  C CA  . ASP E 1 133 ? 89.472  29.784  61.827  1.00 38.71 ? 153 ASP E CA  1 
ATOM   7488  C C   . ASP E 1 133 ? 89.436  31.247  61.460  1.00 33.86 ? 153 ASP E C   1 
ATOM   7489  O O   . ASP E 1 133 ? 90.399  31.989  61.660  1.00 36.21 ? 153 ASP E O   1 
ATOM   7490  C CB  . ASP E 1 133 ? 89.835  28.958  60.605  1.00 47.93 ? 153 ASP E CB  1 
ATOM   7491  C CG  . ASP E 1 133 ? 90.637  27.734  60.961  1.00 60.08 ? 153 ASP E CG  1 
ATOM   7492  O OD1 . ASP E 1 133 ? 91.746  27.595  60.403  1.00 68.97 ? 153 ASP E OD1 1 
ATOM   7493  O OD2 . ASP E 1 133 ? 90.177  26.926  61.803  1.00 64.88 ? 153 ASP E OD2 1 
ATOM   7494  N N   . VAL E 1 134 ? 88.304  31.665  60.928  1.00 27.58 ? 154 VAL E N   1 
ATOM   7495  C CA  . VAL E 1 134 ? 88.153  33.038  60.519  1.00 23.02 ? 154 VAL E CA  1 
ATOM   7496  C C   . VAL E 1 134 ? 87.442  33.883  61.556  1.00 18.86 ? 154 VAL E C   1 
ATOM   7497  O O   . VAL E 1 134 ? 86.751  33.375  62.441  1.00 16.10 ? 154 VAL E O   1 
ATOM   7498  C CB  . VAL E 1 134 ? 87.424  33.111  59.178  1.00 24.99 ? 154 VAL E CB  1 
ATOM   7499  C CG1 . VAL E 1 134 ? 88.234  32.408  58.124  1.00 22.81 ? 154 VAL E CG1 1 
ATOM   7500  C CG2 . VAL E 1 134 ? 86.087  32.436  59.279  1.00 30.20 ? 154 VAL E CG2 1 
ATOM   7501  N N   . LEU E 1 135 ? 87.664  35.180  61.450  1.00 16.73 ? 155 LEU E N   1 
ATOM   7502  C CA  . LEU E 1 135 ? 87.068  36.145  62.346  1.00 15.17 ? 155 LEU E CA  1 
ATOM   7503  C C   . LEU E 1 135 ? 85.573  36.234  62.109  1.00 17.06 ? 155 LEU E C   1 
ATOM   7504  O O   . LEU E 1 135 ? 85.132  36.417  60.960  1.00 16.34 ? 155 LEU E O   1 
ATOM   7505  C CB  . LEU E 1 135 ? 87.662  37.520  62.088  1.00 9.84  ? 155 LEU E CB  1 
ATOM   7506  C CG  . LEU E 1 135 ? 87.247  38.569  63.099  1.00 6.97  ? 155 LEU E CG  1 
ATOM   7507  C CD1 . LEU E 1 135 ? 87.900  38.249  64.439  1.00 8.11  ? 155 LEU E CD1 1 
ATOM   7508  C CD2 . LEU E 1 135 ? 87.663  39.931  62.611  1.00 6.11  ? 155 LEU E CD2 1 
ATOM   7509  N N   . LYS E 1 136 ? 84.809  36.144  63.200  1.00 16.65 ? 156 LYS E N   1 
ATOM   7510  C CA  . LYS E 1 136 ? 83.354  36.237  63.168  1.00 14.52 ? 156 LYS E CA  1 
ATOM   7511  C C   . LYS E 1 136 ? 82.907  37.587  63.730  1.00 15.29 ? 156 LYS E C   1 
ATOM   7512  O O   . LYS E 1 136 ? 83.525  38.138  64.648  1.00 17.71 ? 156 LYS E O   1 
ATOM   7513  C CB  . LYS E 1 136 ? 82.737  35.115  64.002  1.00 13.65 ? 156 LYS E CB  1 
ATOM   7514  C CG  . LYS E 1 136 ? 83.062  33.728  63.508  1.00 16.27 ? 156 LYS E CG  1 
ATOM   7515  C CD  . LYS E 1 136 ? 82.532  33.503  62.103  1.00 19.82 ? 156 LYS E CD  1 
ATOM   7516  C CE  . LYS E 1 136 ? 83.060  32.189  61.557  1.00 24.17 ? 156 LYS E CE  1 
ATOM   7517  N NZ  . LYS E 1 136 ? 82.454  31.800  60.251  1.00 29.03 ? 156 LYS E NZ  1 
ATOM   7518  N N   . CYS E 1 137 ? 81.839  38.126  63.169  1.00 15.27 ? 157 CYS E N   1 
ATOM   7519  C CA  . CYS E 1 137 ? 81.295  39.394  63.622  1.00 16.05 ? 157 CYS E CA  1 
ATOM   7520  C C   . CYS E 1 137 ? 79.860  39.188  64.103  1.00 18.35 ? 157 CYS E C   1 
ATOM   7521  O O   . CYS E 1 137 ? 79.208  38.200  63.735  1.00 19.24 ? 157 CYS E O   1 
ATOM   7522  C CB  . CYS E 1 137 ? 81.338  40.416  62.494  1.00 13.85 ? 157 CYS E CB  1 
ATOM   7523  S SG  . CYS E 1 137 ? 82.990  41.124  62.205  1.00 7.58  ? 157 CYS E SG  1 
ATOM   7524  N N   . LEU E 1 138 ? 79.391  40.088  64.962  1.00 17.35 ? 158 LEU E N   1 
ATOM   7525  C CA  . LEU E 1 138 ? 78.037  40.004  65.488  1.00 17.09 ? 158 LEU E CA  1 
ATOM   7526  C C   . LEU E 1 138 ? 77.528  41.389  65.840  1.00 17.30 ? 158 LEU E C   1 
ATOM   7527  O O   . LEU E 1 138 ? 78.182  42.127  66.591  1.00 15.65 ? 158 LEU E O   1 
ATOM   7528  C CB  . LEU E 1 138 ? 77.977  39.104  66.737  1.00 18.32 ? 158 LEU E CB  1 
ATOM   7529  C CG  . LEU E 1 138 ? 76.592  38.960  67.396  1.00 17.21 ? 158 LEU E CG  1 
ATOM   7530  C CD1 . LEU E 1 138 ? 75.618  38.368  66.392  1.00 15.00 ? 158 LEU E CD1 1 
ATOM   7531  C CD2 . LEU E 1 138 ? 76.647  38.097  68.651  1.00 18.15 ? 158 LEU E CD2 1 
ATOM   7532  N N   . LYS E 1 139 ? 76.402  41.759  65.229  1.00 17.26 ? 159 LYS E N   1 
ATOM   7533  C CA  . LYS E 1 139 ? 75.752  43.035  65.493  1.00 16.39 ? 159 LYS E CA  1 
ATOM   7534  C C   . LYS E 1 139 ? 74.880  42.719  66.701  1.00 16.71 ? 159 LYS E C   1 
ATOM   7535  O O   . LYS E 1 139 ? 74.252  41.667  66.745  1.00 21.10 ? 159 LYS E O   1 
ATOM   7536  C CB  . LYS E 1 139 ? 74.863  43.425  64.315  0.00 18.70 ? 159 LYS E CB  1 
ATOM   7537  C CG  . LYS E 1 139 ? 75.606  43.532  63.005  0.00 20.18 ? 159 LYS E CG  1 
ATOM   7538  C CD  . LYS E 1 139 ? 76.591  44.685  63.034  0.00 20.71 ? 159 LYS E CD  1 
ATOM   7539  C CE  . LYS E 1 139 ? 77.501  44.655  61.823  0.00 21.14 ? 159 LYS E CE  1 
ATOM   7540  N NZ  . LYS E 1 139 ? 76.738  44.547  60.549  0.00 21.09 ? 159 LYS E NZ  1 
ATOM   7541  N N   . ALA E 1 140 ? 74.903  43.558  67.720  1.00 14.72 ? 160 ALA E N   1 
ATOM   7542  C CA  . ALA E 1 140 ? 74.087  43.314  68.901  1.00 13.30 ? 160 ALA E CA  1 
ATOM   7543  C C   . ALA E 1 140 ? 73.951  44.641  69.585  1.00 14.76 ? 160 ALA E C   1 
ATOM   7544  O O   . ALA E 1 140 ? 74.824  45.512  69.447  1.00 16.47 ? 160 ALA E O   1 
ATOM   7545  C CB  . ALA E 1 140 ? 74.732  42.318  69.826  1.00 5.00  ? 160 ALA E CB  1 
ATOM   7546  N N   . PRO E 1 141 ? 72.813  44.856  70.262  1.00 17.81 ? 161 PRO E N   1 
ATOM   7547  C CA  . PRO E 1 141 ? 72.570  46.113  70.967  1.00 12.14 ? 161 PRO E CA  1 
ATOM   7548  C C   . PRO E 1 141 ? 72.989  46.051  72.426  1.00 9.95  ? 161 PRO E C   1 
ATOM   7549  O O   . PRO E 1 141 ? 73.258  44.982  72.981  1.00 5.00  ? 161 PRO E O   1 
ATOM   7550  C CB  . PRO E 1 141 ? 71.073  46.253  70.857  1.00 13.06 ? 161 PRO E CB  1 
ATOM   7551  C CG  . PRO E 1 141 ? 70.654  44.820  71.086  1.00 14.55 ? 161 PRO E CG  1 
ATOM   7552  C CD  . PRO E 1 141 ? 71.588  44.042  70.209  1.00 13.47 ? 161 PRO E CD  1 
ATOM   7553  N N   . ILE E 1 142 ? 73.084  47.226  73.012  1.00 10.60 ? 162 ILE E N   1 
ATOM   7554  C CA  . ILE E 1 142 ? 73.419  47.381  74.411  1.00 14.24 ? 162 ILE E CA  1 
ATOM   7555  C C   . ILE E 1 142 ? 72.094  47.298  75.194  1.00 15.48 ? 162 ILE E C   1 
ATOM   7556  O O   . ILE E 1 142 ? 71.211  48.138  75.018  1.00 14.98 ? 162 ILE E O   1 
ATOM   7557  C CB  . ILE E 1 142 ? 74.088  48.763  74.623  1.00 14.80 ? 162 ILE E CB  1 
ATOM   7558  C CG1 . ILE E 1 142 ? 75.514  48.737  74.059  1.00 11.00 ? 162 ILE E CG1 1 
ATOM   7559  C CG2 . ILE E 1 142 ? 74.000  49.200  76.091  1.00 16.22 ? 162 ILE E CG2 1 
ATOM   7560  C CD1 . ILE E 1 142 ? 76.271  50.029  74.197  1.00 5.00  ? 162 ILE E CD1 1 
ATOM   7561  N N   . LEU E 1 143 ? 71.937  46.276  76.027  1.00 16.84 ? 163 LEU E N   1 
ATOM   7562  C CA  . LEU E 1 143 ? 70.698  46.123  76.781  1.00 18.47 ? 163 LEU E CA  1 
ATOM   7563  C C   . LEU E 1 143 ? 70.673  47.129  77.916  1.00 23.38 ? 163 LEU E C   1 
ATOM   7564  O O   . LEU E 1 143 ? 71.710  47.721  78.275  1.00 21.73 ? 163 LEU E O   1 
ATOM   7565  C CB  . LEU E 1 143 ? 70.553  44.714  77.354  1.00 15.91 ? 163 LEU E CB  1 
ATOM   7566  C CG  . LEU E 1 143 ? 70.950  43.532  76.469  1.00 15.00 ? 163 LEU E CG  1 
ATOM   7567  C CD1 . LEU E 1 143 ? 70.612  42.239  77.172  1.00 12.70 ? 163 LEU E CD1 1 
ATOM   7568  C CD2 . LEU E 1 143 ? 70.242  43.617  75.132  1.00 13.89 ? 163 LEU E CD2 1 
ATOM   7569  N N   . SER E 1 144 ? 69.483  47.295  78.489  1.00 26.84 ? 164 SER E N   1 
ATOM   7570  C CA  . SER E 1 144 ? 69.261  48.232  79.580  1.00 28.05 ? 164 SER E CA  1 
ATOM   7571  C C   . SER E 1 144 ? 69.862  47.736  80.886  1.00 27.75 ? 164 SER E C   1 
ATOM   7572  O O   . SER E 1 144 ? 69.694  46.569  81.239  1.00 29.76 ? 164 SER E O   1 
ATOM   7573  C CB  . SER E 1 144 ? 67.756  48.518  79.729  1.00 28.25 ? 164 SER E CB  1 
ATOM   7574  O OG  . SER E 1 144 ? 66.966  47.346  79.609  1.00 26.94 ? 164 SER E OG  1 
ATOM   7575  N N   . ASP E 1 145 ? 70.582  48.614  81.581  0.00 27.70 ? 165 ASP E N   1 
ATOM   7576  C CA  . ASP E 1 145 ? 71.213  48.279  82.859  0.00 27.69 ? 165 ASP E CA  1 
ATOM   7577  C C   . ASP E 1 145 ? 70.250  47.458  83.711  0.00 29.57 ? 165 ASP E C   1 
ATOM   7578  O O   . ASP E 1 145 ? 70.655  46.577  84.466  0.00 30.34 ? 165 ASP E O   1 
ATOM   7579  C CB  . ASP E 1 145 ? 71.613  49.561  83.596  0.00 25.70 ? 165 ASP E CB  1 
ATOM   7580  C CG  . ASP E 1 145 ? 72.282  49.288  84.931  0.00 22.72 ? 165 ASP E CG  1 
ATOM   7581  O OD1 . ASP E 1 145 ? 73.315  48.585  84.953  0.00 20.77 ? 165 ASP E OD1 1 
ATOM   7582  O OD2 . ASP E 1 145 ? 71.772  49.781  85.958  0.00 20.82 ? 165 ASP E OD2 1 
ATOM   7583  N N   . SER E 1 146 ? 68.965  47.732  83.530  1.00 30.97 ? 166 SER E N   1 
ATOM   7584  C CA  . SER E 1 146 ? 67.888  47.038  84.233  1.00 33.59 ? 166 SER E CA  1 
ATOM   7585  C C   . SER E 1 146 ? 67.782  45.538  83.853  1.00 33.10 ? 166 SER E C   1 
ATOM   7586  O O   . SER E 1 146 ? 67.910  44.659  84.716  1.00 31.44 ? 166 SER E O   1 
ATOM   7587  C CB  . SER E 1 146 ? 66.563  47.771  83.976  1.00 30.97 ? 166 SER E CB  1 
ATOM   7588  O OG  . SER E 1 146 ? 66.427  48.125  82.610  0.00 33.17 ? 166 SER E OG  1 
ATOM   7589  N N   . SER E 1 147 ? 67.572  45.252  82.568  1.00 31.43 ? 167 SER E N   1 
ATOM   7590  C CA  . SER E 1 147 ? 67.469  43.873  82.101  1.00 30.22 ? 167 SER E CA  1 
ATOM   7591  C C   . SER E 1 147 ? 68.765  43.160  82.413  1.00 26.89 ? 167 SER E C   1 
ATOM   7592  O O   . SER E 1 147 ? 68.790  41.958  82.664  1.00 29.23 ? 167 SER E O   1 
ATOM   7593  C CB  . SER E 1 147 ? 67.201  43.823  80.602  1.00 34.00 ? 167 SER E CB  1 
ATOM   7594  O OG  . SER E 1 147 ? 66.095  44.651  80.274  1.00 37.53 ? 167 SER E OG  1 
ATOM   7595  N N   . CYS E 1 148 ? 69.846  43.915  82.405  1.00 22.85 ? 168 CYS E N   1 
ATOM   7596  C CA  . CYS E 1 148 ? 71.142  43.357  82.722  1.00 21.85 ? 168 CYS E CA  1 
ATOM   7597  C C   . CYS E 1 148 ? 71.180  42.896  84.182  1.00 21.15 ? 168 CYS E C   1 
ATOM   7598  O O   . CYS E 1 148 ? 71.380  41.706  84.448  1.00 21.31 ? 168 CYS E O   1 
ATOM   7599  C CB  . CYS E 1 148 ? 72.234  44.392  82.473  1.00 20.92 ? 168 CYS E CB  1 
ATOM   7600  S SG  . CYS E 1 148 ? 73.898  43.684  82.579  1.00 17.46 ? 168 CYS E SG  1 
ATOM   7601  N N   . LYS E 1 149 ? 70.952  43.832  85.111  1.00 18.66 ? 169 LYS E N   1 
ATOM   7602  C CA  . LYS E 1 149 ? 70.966  43.536  86.537  1.00 16.78 ? 169 LYS E CA  1 
ATOM   7603  C C   . LYS E 1 149 ? 69.961  42.458  86.909  1.00 18.39 ? 169 LYS E C   1 
ATOM   7604  O O   . LYS E 1 149 ? 70.188  41.689  87.838  1.00 18.22 ? 169 LYS E O   1 
ATOM   7605  C CB  . LYS E 1 149 ? 70.695  44.798  87.343  1.00 15.89 ? 169 LYS E CB  1 
ATOM   7606  C CG  . LYS E 1 149 ? 71.897  45.679  87.510  1.00 16.82 ? 169 LYS E CG  1 
ATOM   7607  C CD  . LYS E 1 149 ? 71.543  46.968  88.223  1.00 17.35 ? 169 LYS E CD  1 
ATOM   7608  C CE  . LYS E 1 149 ? 72.764  47.840  88.483  0.00 17.24 ? 169 LYS E CE  1 
ATOM   7609  N NZ  . LYS E 1 149 ? 73.722  47.226  89.442  0.00 17.39 ? 169 LYS E NZ  1 
ATOM   7610  N N   . SER E 1 150 ? 68.834  42.423  86.207  1.00 20.00 ? 170 SER E N   1 
ATOM   7611  C CA  . SER E 1 150 ? 67.824  41.421  86.481  1.00 21.32 ? 170 SER E CA  1 
ATOM   7612  C C   . SER E 1 150 ? 68.345  40.033  86.102  1.00 23.54 ? 170 SER E C   1 
ATOM   7613  O O   . SER E 1 150 ? 68.195  39.071  86.864  1.00 23.06 ? 170 SER E O   1 
ATOM   7614  C CB  . SER E 1 150 ? 66.516  41.760  85.752  1.00 19.98 ? 170 SER E CB  1 
ATOM   7615  O OG  . SER E 1 150 ? 66.719  42.016  84.376  0.00 20.17 ? 170 SER E OG  1 
ATOM   7616  N N   . ALA E 1 151 ? 69.008  39.949  84.949  1.00 25.11 ? 171 ALA E N   1 
ATOM   7617  C CA  . ALA E 1 151 ? 69.569  38.687  84.459  1.00 24.84 ? 171 ALA E CA  1 
ATOM   7618  C C   . ALA E 1 151 ? 70.639  38.146  85.397  1.00 24.66 ? 171 ALA E C   1 
ATOM   7619  O O   . ALA E 1 151 ? 70.679  36.951  85.656  1.00 25.50 ? 171 ALA E O   1 
ATOM   7620  C CB  . ALA E 1 151 ? 70.136  38.863  83.065  1.00 21.58 ? 171 ALA E CB  1 
ATOM   7621  N N   . TYR E 1 152 ? 71.519  39.025  85.875  1.00 24.89 ? 172 TYR E N   1 
ATOM   7622  C CA  . TYR E 1 152 ? 72.591  38.651  86.799  1.00 24.35 ? 172 TYR E CA  1 
ATOM   7623  C C   . TYR E 1 152 ? 72.492  39.531  88.047  1.00 28.88 ? 172 TYR E C   1 
ATOM   7624  O O   . TYR E 1 152 ? 73.282  40.466  88.231  1.00 32.11 ? 172 TYR E O   1 
ATOM   7625  C CB  . TYR E 1 152 ? 73.946  38.856  86.140  1.00 18.90 ? 172 TYR E CB  1 
ATOM   7626  C CG  . TYR E 1 152 ? 74.090  38.159  84.808  1.00 15.28 ? 172 TYR E CG  1 
ATOM   7627  C CD1 . TYR E 1 152 ? 73.854  38.832  83.606  1.00 12.51 ? 172 TYR E CD1 1 
ATOM   7628  C CD2 . TYR E 1 152 ? 74.459  36.820  84.744  1.00 13.30 ? 172 TYR E CD2 1 
ATOM   7629  C CE1 . TYR E 1 152 ? 73.981  38.177  82.382  1.00 5.28  ? 172 TYR E CE1 1 
ATOM   7630  C CE2 . TYR E 1 152 ? 74.586  36.171  83.530  1.00 5.56  ? 172 TYR E CE2 1 
ATOM   7631  C CZ  . TYR E 1 152 ? 74.340  36.857  82.368  1.00 5.00  ? 172 TYR E CZ  1 
ATOM   7632  O OH  . TYR E 1 152 ? 74.403  36.196  81.191  1.00 5.00  ? 172 TYR E OH  1 
ATOM   7633  N N   . PRO E 1 153 ? 71.559  39.202  88.955  1.00 28.75 ? 173 PRO E N   1 
ATOM   7634  C CA  . PRO E 1 153 ? 71.276  39.899  90.215  1.00 30.48 ? 173 PRO E CA  1 
ATOM   7635  C C   . PRO E 1 153 ? 72.458  40.457  91.024  1.00 28.95 ? 173 PRO E C   1 
ATOM   7636  O O   . PRO E 1 153 ? 73.281  39.700  91.538  1.00 28.74 ? 173 PRO E O   1 
ATOM   7637  C CB  . PRO E 1 153 ? 70.503  38.839  91.004  1.00 29.67 ? 173 PRO E CB  1 
ATOM   7638  C CG  . PRO E 1 153 ? 70.950  37.538  90.383  1.00 26.93 ? 173 PRO E CG  1 
ATOM   7639  C CD  . PRO E 1 153 ? 70.875  37.902  88.948  1.00 27.65 ? 173 PRO E CD  1 
ATOM   7640  N N   . GLY E 1 154 ? 72.523  41.779  91.148  0.00 29.05 ? 174 GLY E N   1 
ATOM   7641  C CA  . GLY E 1 154 ? 73.586  42.407  91.917  0.00 28.97 ? 174 GLY E CA  1 
ATOM   7642  C C   . GLY E 1 154 ? 74.985  42.275  91.346  0.00 28.69 ? 174 GLY E C   1 
ATOM   7643  O O   . GLY E 1 154 ? 75.811  43.172  91.513  0.00 29.69 ? 174 GLY E O   1 
ATOM   7644  N N   . GLN E 1 155 ? 75.258  41.154  90.686  1.00 28.95 ? 175 GLN E N   1 
ATOM   7645  C CA  . GLN E 1 155 ? 76.562  40.898  90.084  1.00 27.96 ? 175 GLN E CA  1 
ATOM   7646  C C   . GLN E 1 155 ? 76.966  42.003  89.121  1.00 25.67 ? 175 GLN E C   1 
ATOM   7647  O O   . GLN E 1 155 ? 78.132  42.369  89.057  1.00 30.84 ? 175 GLN E O   1 
ATOM   7648  C CB  . GLN E 1 155 ? 76.566  39.558  89.350  1.00 28.13 ? 175 GLN E CB  1 
ATOM   7649  C CG  . GLN E 1 155 ? 76.327  38.372  90.236  1.00 32.94 ? 175 GLN E CG  1 
ATOM   7650  C CD  . GLN E 1 155 ? 76.412  37.073  89.482  1.00 36.99 ? 175 GLN E CD  1 
ATOM   7651  O OE1 . GLN E 1 155 ? 77.434  36.389  89.528  1.00 40.06 ? 175 GLN E OE1 1 
ATOM   7652  N NE2 . GLN E 1 155 ? 75.338  36.720  88.776  1.00 37.68 ? 175 GLN E NE2 1 
ATOM   7653  N N   . ILE E 1 156 ? 76.010  42.526  88.366  1.00 20.04 ? 176 ILE E N   1 
ATOM   7654  C CA  . ILE E 1 156 ? 76.294  43.591  87.408  1.00 15.43 ? 176 ILE E CA  1 
ATOM   7655  C C   . ILE E 1 156 ? 76.733  44.886  88.113  1.00 15.86 ? 176 ILE E C   1 
ATOM   7656  O O   . ILE E 1 156 ? 75.927  45.546  88.753  1.00 18.39 ? 176 ILE E O   1 
ATOM   7657  C CB  . ILE E 1 156 ? 75.056  43.858  86.502  1.00 12.44 ? 176 ILE E CB  1 
ATOM   7658  C CG1 . ILE E 1 156 ? 74.671  42.589  85.722  1.00 9.46  ? 176 ILE E CG1 1 
ATOM   7659  C CG2 . ILE E 1 156 ? 75.294  45.046  85.586  1.00 8.97  ? 176 ILE E CG2 1 
ATOM   7660  C CD1 . ILE E 1 156 ? 75.792  41.919  84.971  1.00 5.00  ? 176 ILE E CD1 1 
ATOM   7661  N N   . THR E 1 157 ? 78.013  45.234  88.015  1.00 14.62 ? 177 THR E N   1 
ATOM   7662  C CA  . THR E 1 157 ? 78.530  46.462  88.639  1.00 12.22 ? 177 THR E CA  1 
ATOM   7663  C C   . THR E 1 157 ? 78.384  47.655  87.699  1.00 12.18 ? 177 THR E C   1 
ATOM   7664  O O   . THR E 1 157 ? 77.954  47.497  86.562  1.00 15.78 ? 177 THR E O   1 
ATOM   7665  C CB  . THR E 1 157 ? 80.002  46.339  88.963  1.00 9.32  ? 177 THR E CB  1 
ATOM   7666  O OG1 . THR E 1 157 ? 80.716  46.102  87.747  1.00 11.99 ? 177 THR E OG1 1 
ATOM   7667  C CG2 . THR E 1 157 ? 80.241  45.193  89.915  1.00 8.11  ? 177 THR E CG2 1 
ATOM   7668  N N   . SER E 1 158 ? 78.816  48.833  88.139  1.00 9.58  ? 178 SER E N   1 
ATOM   7669  C CA  . SER E 1 158 ? 78.702  50.034  87.311  1.00 11.35 ? 178 SER E CA  1 
ATOM   7670  C C   . SER E 1 158 ? 79.699  50.009  86.165  1.00 15.74 ? 178 SER E C   1 
ATOM   7671  O O   . SER E 1 158 ? 79.641  50.829  85.249  1.00 20.15 ? 178 SER E O   1 
ATOM   7672  C CB  . SER E 1 158 ? 78.921  51.286  88.158  1.00 5.00  ? 178 SER E CB  1 
ATOM   7673  O OG  . SER E 1 158 ? 79.958  51.075  89.097  0.00 9.46  ? 178 SER E OG  1 
ATOM   7674  N N   . ASN E 1 159 ? 80.608  49.045  86.212  1.00 17.19 ? 179 ASN E N   1 
ATOM   7675  C CA  . ASN E 1 159 ? 81.642  48.927  85.202  1.00 14.94 ? 179 ASN E CA  1 
ATOM   7676  C C   . ASN E 1 159 ? 81.311  47.800  84.272  1.00 12.70 ? 179 ASN E C   1 
ATOM   7677  O O   . ASN E 1 159 ? 82.191  47.308  83.581  1.00 16.86 ? 179 ASN E O   1 
ATOM   7678  C CB  . ASN E 1 159 ? 83.000  48.665  85.864  1.00 14.53 ? 179 ASN E CB  1 
ATOM   7679  C CG  . ASN E 1 159 ? 83.447  49.814  86.771  1.00 16.10 ? 179 ASN E CG  1 
ATOM   7680  O OD1 . ASN E 1 159 ? 83.154  50.997  86.510  1.00 13.21 ? 179 ASN E OD1 1 
ATOM   7681  N ND2 . ASN E 1 159 ? 84.157  49.471  87.846  1.00 15.45 ? 179 ASN E ND2 1 
ATOM   7682  N N   . MET E 1 160 ? 80.064  47.352  84.284  1.00 8.04  ? 180 MET E N   1 
ATOM   7683  C CA  . MET E 1 160 ? 79.654  46.274  83.404  1.00 9.10  ? 180 MET E CA  1 
ATOM   7684  C C   . MET E 1 160 ? 78.429  46.716  82.600  1.00 11.58 ? 180 MET E C   1 
ATOM   7685  O O   . MET E 1 160 ? 77.824  47.750  82.917  1.00 14.37 ? 180 MET E O   1 
ATOM   7686  C CB  . MET E 1 160 ? 79.339  45.025  84.215  1.00 5.86  ? 180 MET E CB  1 
ATOM   7687  C CG  . MET E 1 160 ? 80.446  44.632  85.143  1.00 5.00  ? 180 MET E CG  1 
ATOM   7688  S SD  . MET E 1 160 ? 80.227  43.000  85.864  1.00 5.00  ? 180 MET E SD  1 
ATOM   7689  C CE  . MET E 1 160 ? 81.355  43.114  87.207  1.00 5.00  ? 180 MET E CE  1 
ATOM   7690  N N   . PHE E 1 161 ? 78.138  46.015  81.503  1.00 9.19  ? 181 PHE E N   1 
ATOM   7691  C CA  . PHE E 1 161 ? 76.966  46.314  80.690  1.00 8.09  ? 181 PHE E CA  1 
ATOM   7692  C C   . PHE E 1 161 ? 76.623  45.103  79.879  1.00 9.60  ? 181 PHE E C   1 
ATOM   7693  O O   . PHE E 1 161 ? 77.510  44.377  79.482  1.00 12.65 ? 181 PHE E O   1 
ATOM   7694  C CB  . PHE E 1 161 ? 77.140  47.569  79.828  1.00 7.34  ? 181 PHE E CB  1 
ATOM   7695  C CG  . PHE E 1 161 ? 77.957  47.387  78.572  1.00 9.35  ? 181 PHE E CG  1 
ATOM   7696  C CD1 . PHE E 1 161 ? 77.433  46.760  77.444  1.00 9.66  ? 181 PHE E CD1 1 
ATOM   7697  C CD2 . PHE E 1 161 ? 79.205  47.986  78.463  1.00 12.30 ? 181 PHE E CD2 1 
ATOM   7698  C CE1 . PHE E 1 161 ? 78.138  46.744  76.229  1.00 9.74  ? 181 PHE E CE1 1 
ATOM   7699  C CE2 . PHE E 1 161 ? 79.911  47.974  77.255  1.00 12.40 ? 181 PHE E CE2 1 
ATOM   7700  C CZ  . PHE E 1 161 ? 79.371  47.354  76.139  1.00 11.10 ? 181 PHE E CZ  1 
ATOM   7701  N N   . CYS E 1 162 ? 75.337  44.822  79.719  1.00 12.29 ? 182 CYS E N   1 
ATOM   7702  C CA  . CYS E 1 162 ? 74.900  43.648  78.969  1.00 11.19 ? 182 CYS E CA  1 
ATOM   7703  C C   . CYS E 1 162 ? 74.595  44.022  77.540  1.00 9.48  ? 182 CYS E C   1 
ATOM   7704  O O   . CYS E 1 162 ? 74.092  45.105  77.267  1.00 6.44  ? 182 CYS E O   1 
ATOM   7705  C CB  . CYS E 1 162 ? 73.654  43.022  79.601  1.00 13.73 ? 182 CYS E CB  1 
ATOM   7706  S SG  . CYS E 1 162 ? 73.885  42.182  81.210  1.00 15.78 ? 182 CYS E SG  1 
ATOM   7707  N N   . ALA E 1 163 ? 74.913  43.122  76.628  1.00 11.05 ? 183 ALA E N   1 
ATOM   7708  C CA  . ALA E 1 163 ? 74.666  43.346  75.214  1.00 13.99 ? 183 ALA E CA  1 
ATOM   7709  C C   . ALA E 1 163 ? 74.301  41.987  74.613  1.00 16.90 ? 183 ALA E C   1 
ATOM   7710  O O   . ALA E 1 163 ? 74.758  40.942  75.100  1.00 19.10 ? 183 ALA E O   1 
ATOM   7711  C CB  . ALA E 1 163 ? 75.920  43.923  74.542  1.00 9.06  ? 183 ALA E CB  1 
ATOM   7712  N N   . GLY E 1 164 A 73.464  41.986  73.581  1.00 16.22 ? 184 GLY E N   1 
ATOM   7713  C CA  . GLY E 1 164 A 73.083  40.729  72.973  1.00 15.96 ? 184 GLY E CA  1 
ATOM   7714  C C   . GLY E 1 164 A 71.591  40.626  72.807  1.00 18.01 ? 184 GLY E C   1 
ATOM   7715  O O   . GLY E 1 164 A 70.922  41.623  72.584  1.00 21.53 ? 184 GLY E O   1 
ATOM   7716  N N   . TYR E 1 165 ? 71.053  39.428  72.943  1.00 18.09 ? 184 TYR E N   1 
ATOM   7717  C CA  . TYR E 1 165 ? 69.623  39.239  72.771  1.00 19.11 ? 184 TYR E CA  1 
ATOM   7718  C C   . TYR E 1 165 ? 69.052  38.398  73.900  1.00 19.60 ? 184 TYR E C   1 
ATOM   7719  O O   . TYR E 1 165 ? 69.478  37.251  74.096  1.00 15.09 ? 184 TYR E O   1 
ATOM   7720  C CB  . TYR E 1 165 ? 69.360  38.566  71.427  1.00 20.20 ? 184 TYR E CB  1 
ATOM   7721  C CG  . TYR E 1 165 ? 69.975  39.322  70.281  1.00 22.01 ? 184 TYR E CG  1 
ATOM   7722  C CD1 . TYR E 1 165 ? 71.115  38.836  69.616  1.00 22.87 ? 184 TYR E CD1 1 
ATOM   7723  C CD2 . TYR E 1 165 ? 69.434  40.533  69.860  1.00 21.12 ? 184 TYR E CD2 1 
ATOM   7724  C CE1 . TYR E 1 165 ? 71.692  39.548  68.561  1.00 20.38 ? 184 TYR E CE1 1 
ATOM   7725  C CE2 . TYR E 1 165 ? 70.001  41.243  68.810  1.00 20.58 ? 184 TYR E CE2 1 
ATOM   7726  C CZ  . TYR E 1 165 ? 71.121  40.745  68.170  1.00 20.15 ? 184 TYR E CZ  1 
ATOM   7727  O OH  . TYR E 1 165 ? 71.633  41.451  67.125  1.00 22.67 ? 184 TYR E OH  1 
ATOM   7728  N N   . LEU E 1 166 ? 68.065  38.948  74.617  1.00 19.59 ? 185 LEU E N   1 
ATOM   7729  C CA  . LEU E 1 166 ? 67.462  38.220  75.730  1.00 18.94 ? 185 LEU E CA  1 
ATOM   7730  C C   . LEU E 1 166 ? 66.872  36.890  75.266  1.00 19.96 ? 185 LEU E C   1 
ATOM   7731  O O   . LEU E 1 166 ? 66.831  35.928  76.025  1.00 20.49 ? 185 LEU E O   1 
ATOM   7732  C CB  . LEU E 1 166 ? 66.430  39.074  76.463  1.00 16.35 ? 185 LEU E CB  1 
ATOM   7733  C CG  . LEU E 1 166 ? 66.946  40.192  77.368  1.00 13.82 ? 185 LEU E CG  1 
ATOM   7734  C CD1 . LEU E 1 166 ? 65.792  41.069  77.824  0.00 14.19 ? 185 LEU E CD1 1 
ATOM   7735  C CD2 . LEU E 1 166 ? 67.694  39.618  78.561  0.00 14.17 ? 185 LEU E CD2 1 
ATOM   7736  N N   . GLU E 1 167 ? 66.462  36.829  74.004  1.00 20.47 ? 186 GLU E N   1 
ATOM   7737  C CA  . GLU E 1 167 ? 65.918  35.600  73.458  1.00 22.28 ? 186 GLU E CA  1 
ATOM   7738  C C   . GLU E 1 167 ? 67.025  34.557  73.392  1.00 26.34 ? 186 GLU E C   1 
ATOM   7739  O O   . GLU E 1 167 ? 66.806  33.394  73.713  1.00 29.87 ? 186 GLU E O   1 
ATOM   7740  C CB  . GLU E 1 167 ? 65.349  35.824  72.057  0.00 23.05 ? 186 GLU E CB  1 
ATOM   7741  C CG  . GLU E 1 167 ? 64.756  34.558  71.448  0.00 22.27 ? 186 GLU E CG  1 
ATOM   7742  C CD  . GLU E 1 167 ? 64.414  34.704  69.979  0.00 21.31 ? 186 GLU E CD  1 
ATOM   7743  O OE1 . GLU E 1 167 ? 63.260  34.404  69.608  0.00 20.58 ? 186 GLU E OE1 1 
ATOM   7744  O OE2 . GLU E 1 167 ? 65.301  35.101  69.194  0.00 20.57 ? 186 GLU E OE2 1 
ATOM   7745  N N   . GLY E 1 168 ? 68.221  34.979  72.990  1.00 27.70 ? 187 GLY E N   1 
ATOM   7746  C CA  . GLY E 1 168 ? 69.336  34.052  72.882  1.00 25.99 ? 187 GLY E CA  1 
ATOM   7747  C C   . GLY E 1 168 ? 69.633  33.716  71.436  1.00 23.53 ? 187 GLY E C   1 
ATOM   7748  O O   . GLY E 1 168 ? 68.978  34.234  70.526  1.00 22.53 ? 187 GLY E O   1 
ATOM   7749  N N   . GLY E 1 169 A 70.623  32.858  71.223  1.00 20.63 ? 188 GLY E N   1 
ATOM   7750  C CA  . GLY E 1 169 A 70.997  32.467  69.875  1.00 21.13 ? 188 GLY E CA  1 
ATOM   7751  C C   . GLY E 1 169 A 72.181  33.218  69.279  1.00 19.77 ? 188 GLY E C   1 
ATOM   7752  O O   . GLY E 1 169 A 72.821  32.718  68.350  1.00 23.16 ? 188 GLY E O   1 
ATOM   7753  N N   . LYS E 1 170 ? 72.467  34.411  69.799  1.00 16.21 ? 188 LYS E N   1 
ATOM   7754  C CA  . LYS E 1 170 ? 73.567  35.245  69.324  1.00 13.36 ? 188 LYS E CA  1 
ATOM   7755  C C   . LYS E 1 170 ? 74.228  35.830  70.564  1.00 12.90 ? 188 LYS E C   1 
ATOM   7756  O O   . LYS E 1 170 ? 73.579  36.496  71.369  1.00 10.99 ? 188 LYS E O   1 
ATOM   7757  C CB  . LYS E 1 170 ? 73.036  36.360  68.421  1.00 11.57 ? 188 LYS E CB  1 
ATOM   7758  C CG  . LYS E 1 170 ? 72.255  35.851  67.229  1.00 10.22 ? 188 LYS E CG  1 
ATOM   7759  C CD  . LYS E 1 170 ? 71.713  36.979  66.381  1.00 9.49  ? 188 LYS E CD  1 
ATOM   7760  C CE  . LYS E 1 170 ? 71.022  36.437  65.130  0.00 10.55 ? 188 LYS E CE  1 
ATOM   7761  N NZ  . LYS E 1 170 ? 70.503  37.530  64.260  0.00 10.93 ? 188 LYS E NZ  1 
ATOM   7762  N N   . ASP E 1 171 ? 75.522  35.576  70.717  1.00 12.24 ? 189 ASP E N   1 
ATOM   7763  C CA  . ASP E 1 171 ? 76.264  36.033  71.882  1.00 11.94 ? 189 ASP E CA  1 
ATOM   7764  C C   . ASP E 1 171 ? 77.738  35.700  71.699  1.00 12.60 ? 189 ASP E C   1 
ATOM   7765  O O   . ASP E 1 171 ? 78.083  34.857  70.872  1.00 12.86 ? 189 ASP E O   1 
ATOM   7766  C CB  . ASP E 1 171 ? 75.733  35.290  73.111  1.00 11.66 ? 189 ASP E CB  1 
ATOM   7767  C CG  . ASP E 1 171 ? 76.384  35.727  74.416  1.00 11.66 ? 189 ASP E CG  1 
ATOM   7768  O OD1 . ASP E 1 171 ? 76.171  35.020  75.424  1.00 11.46 ? 189 ASP E OD1 1 
ATOM   7769  O OD2 . ASP E 1 171 ? 77.080  36.764  74.459  1.00 9.38  ? 189 ASP E OD2 1 
ATOM   7770  N N   . SER E 1 172 ? 78.610  36.410  72.423  1.00 13.81 ? 190 SER E N   1 
ATOM   7771  C CA  . SER E 1 172 ? 80.054  36.155  72.384  1.00 12.20 ? 190 SER E CA  1 
ATOM   7772  C C   . SER E 1 172 ? 80.287  34.839  73.138  1.00 13.19 ? 190 SER E C   1 
ATOM   7773  O O   . SER E 1 172 ? 79.396  34.349  73.829  1.00 12.78 ? 190 SER E O   1 
ATOM   7774  C CB  . SER E 1 172 ? 80.826  37.304  73.030  1.00 5.00  ? 190 SER E CB  1 
ATOM   7775  O OG  . SER E 1 172 ? 80.302  37.614  74.304  1.00 5.00  ? 190 SER E OG  1 
ATOM   7776  N N   . CYS E 1 173 ? 81.489  34.294  73.072  1.00 14.05 ? 191 CYS E N   1 
ATOM   7777  C CA  . CYS E 1 173 ? 81.725  33.019  73.729  1.00 13.85 ? 191 CYS E CA  1 
ATOM   7778  C C   . CYS E 1 173 ? 83.209  32.770  74.038  1.00 13.40 ? 191 CYS E C   1 
ATOM   7779  O O   . CYS E 1 173 ? 84.087  33.505  73.580  1.00 12.68 ? 191 CYS E O   1 
ATOM   7780  C CB  . CYS E 1 173 ? 81.157  31.909  72.835  1.00 12.68 ? 191 CYS E CB  1 
ATOM   7781  S SG  . CYS E 1 173 ? 80.711  30.396  73.709  1.00 15.63 ? 191 CYS E SG  1 
ATOM   7782  N N   . GLN E 1 174 ? 83.465  31.733  74.829  1.00 13.13 ? 192 GLN E N   1 
ATOM   7783  C CA  . GLN E 1 174 ? 84.810  31.339  75.229  1.00 10.61 ? 192 GLN E CA  1 
ATOM   7784  C C   . GLN E 1 174 ? 85.756  31.383  74.035  1.00 9.57  ? 192 GLN E C   1 
ATOM   7785  O O   . GLN E 1 174 ? 85.510  30.772  72.999  1.00 7.75  ? 192 GLN E O   1 
ATOM   7786  C CB  . GLN E 1 174 ? 84.779  29.952  75.902  1.00 12.32 ? 192 GLN E CB  1 
ATOM   7787  C CG  . GLN E 1 174 ? 84.199  29.908  77.365  1.00 5.00  ? 192 GLN E CG  1 
ATOM   7788  C CD  . GLN E 1 174 ? 82.752  30.314  77.454  1.00 5.00  ? 192 GLN E CD  1 
ATOM   7789  O OE1 . GLN E 1 174 ? 82.417  31.492  77.340  0.00 5.00  ? 192 GLN E OE1 1 
ATOM   7790  N NE2 . GLN E 1 174 ? 81.877  29.338  77.641  0.00 5.00  ? 192 GLN E NE2 1 
ATOM   7791  N N   . GLY E 1 175 ? 86.788  32.205  74.181  1.00 11.32 ? 193 GLY E N   1 
ATOM   7792  C CA  . GLY E 1 175 ? 87.760  32.428  73.132  1.00 9.64  ? 193 GLY E CA  1 
ATOM   7793  C C   . GLY E 1 175 ? 87.599  33.866  72.657  1.00 8.20  ? 193 GLY E C   1 
ATOM   7794  O O   . GLY E 1 175 ? 88.461  34.393  71.954  1.00 8.37  ? 193 GLY E O   1 
ATOM   7795  N N   . ASP E 1 176 ? 86.498  34.506  73.045  1.00 7.59  ? 194 ASP E N   1 
ATOM   7796  C CA  . ASP E 1 176 ? 86.211  35.885  72.649  1.00 8.43  ? 194 ASP E CA  1 
ATOM   7797  C C   . ASP E 1 176 ? 86.610  36.928  73.695  1.00 9.07  ? 194 ASP E C   1 
ATOM   7798  O O   . ASP E 1 176 ? 86.513  38.138  73.426  1.00 11.27 ? 194 ASP E O   1 
ATOM   7799  C CB  . ASP E 1 176 ? 84.710  36.070  72.314  1.00 9.47  ? 194 ASP E CB  1 
ATOM   7800  C CG  . ASP E 1 176 ? 84.292  35.411  70.992  1.00 10.11 ? 194 ASP E CG  1 
ATOM   7801  O OD1 . ASP E 1 176 ? 83.133  34.961  70.876  1.00 6.34  ? 194 ASP E OD1 1 
ATOM   7802  O OD2 . ASP E 1 176 ? 85.103  35.374  70.047  1.00 15.52 ? 194 ASP E OD2 1 
ATOM   7803  N N   . SER E 1 177 ? 87.025  36.478  74.881  1.00 6.68  ? 195 SER E N   1 
ATOM   7804  C CA  . SER E 1 177 ? 87.409  37.396  75.948  1.00 5.46  ? 195 SER E CA  1 
ATOM   7805  C C   . SER E 1 177 ? 88.391  38.432  75.465  1.00 6.93  ? 195 SER E C   1 
ATOM   7806  O O   . SER E 1 177 ? 89.187  38.169  74.580  1.00 11.92 ? 195 SER E O   1 
ATOM   7807  C CB  . SER E 1 177 ? 88.020  36.657  77.126  1.00 5.00  ? 195 SER E CB  1 
ATOM   7808  O OG  . SER E 1 177 ? 87.026  36.235  78.037  1.00 5.00  ? 195 SER E OG  1 
ATOM   7809  N N   . GLY E 1 178 ? 88.311  39.628  76.018  1.00 5.68  ? 196 GLY E N   1 
ATOM   7810  C CA  . GLY E 1 178 ? 89.225  40.664  75.615  1.00 5.00  ? 196 GLY E CA  1 
ATOM   7811  C C   . GLY E 1 178 ? 88.856  41.290  74.302  1.00 5.00  ? 196 GLY E C   1 
ATOM   7812  O O   . GLY E 1 178 ? 89.377  42.354  73.988  1.00 8.75  ? 196 GLY E O   1 
ATOM   7813  N N   . GLY E 1 179 ? 87.973  40.656  73.538  1.00 5.00  ? 197 GLY E N   1 
ATOM   7814  C CA  . GLY E 1 179 ? 87.575  41.212  72.258  1.00 5.00  ? 197 GLY E CA  1 
ATOM   7815  C C   . GLY E 1 179 ? 86.928  42.586  72.331  1.00 5.00  ? 197 GLY E C   1 
ATOM   7816  O O   . GLY E 1 179 ? 86.567  43.060  73.404  1.00 5.00  ? 197 GLY E O   1 
ATOM   7817  N N   . PRO E 1 180 ? 86.800  43.273  71.198  1.00 6.52  ? 198 PRO E N   1 
ATOM   7818  C CA  . PRO E 1 180 ? 86.189  44.610  71.132  1.00 7.00  ? 198 PRO E CA  1 
ATOM   7819  C C   . PRO E 1 180 ? 84.660  44.641  70.942  1.00 6.80  ? 198 PRO E C   1 
ATOM   7820  O O   . PRO E 1 180 ? 84.075  43.728  70.344  1.00 6.74  ? 198 PRO E O   1 
ATOM   7821  C CB  . PRO E 1 180 ? 86.875  45.223  69.911  1.00 7.31  ? 198 PRO E CB  1 
ATOM   7822  C CG  . PRO E 1 180 ? 87.009  44.036  69.001  1.00 5.48  ? 198 PRO E CG  1 
ATOM   7823  C CD  . PRO E 1 180 ? 87.466  42.926  69.929  1.00 5.00  ? 198 PRO E CD  1 
ATOM   7824  N N   . VAL E 1 181 ? 84.034  45.698  71.452  1.00 5.00  ? 199 VAL E N   1 
ATOM   7825  C CA  . VAL E 1 181 ? 82.595  45.932  71.304  1.00 6.26  ? 199 VAL E CA  1 
ATOM   7826  C C   . VAL E 1 181 ? 82.633  47.363  70.791  1.00 9.23  ? 199 VAL E C   1 
ATOM   7827  O O   . VAL E 1 181 ? 82.887  48.315  71.549  1.00 7.76  ? 199 VAL E O   1 
ATOM   7828  C CB  . VAL E 1 181 ? 81.788  45.875  72.661  1.00 5.00  ? 199 VAL E CB  1 
ATOM   7829  C CG1 . VAL E 1 181 ? 80.371  46.405  72.474  1.00 5.00  ? 199 VAL E CG1 1 
ATOM   7830  C CG2 . VAL E 1 181 ? 81.706  44.456  73.173  1.00 5.00  ? 199 VAL E CG2 1 
ATOM   7831  N N   . VAL E 1 182 ? 82.503  47.509  69.482  1.00 10.94 ? 200 VAL E N   1 
ATOM   7832  C CA  . VAL E 1 182 ? 82.546  48.833  68.898  1.00 12.39 ? 200 VAL E CA  1 
ATOM   7833  C C   . VAL E 1 182 ? 81.141  49.324  68.598  1.00 14.74 ? 200 VAL E C   1 
ATOM   7834  O O   . VAL E 1 182 ? 80.345  48.595  68.001  1.00 14.88 ? 200 VAL E O   1 
ATOM   7835  C CB  . VAL E 1 182 ? 83.377  48.827  67.600  1.00 12.24 ? 200 VAL E CB  1 
ATOM   7836  C CG1 . VAL E 1 182 ? 83.468  50.234  67.008  1.00 13.75 ? 200 VAL E CG1 1 
ATOM   7837  C CG2 . VAL E 1 182 ? 84.756  48.295  67.883  1.00 9.98  ? 200 VAL E CG2 1 
ATOM   7838  N N   . CYS E 1 183 ? 80.829  50.536  69.051  1.00 16.05 ? 201 CYS E N   1 
ATOM   7839  C CA  . CYS E 1 183 ? 79.524  51.146  68.800  1.00 17.64 ? 201 CYS E CA  1 
ATOM   7840  C C   . CYS E 1 183 ? 79.809  52.516  68.231  1.00 18.65 ? 201 CYS E C   1 
ATOM   7841  O O   . CYS E 1 183 ? 80.433  53.346  68.887  1.00 17.76 ? 201 CYS E O   1 
ATOM   7842  C CB  . CYS E 1 183 ? 78.718  51.322  70.085  1.00 16.23 ? 201 CYS E CB  1 
ATOM   7843  S SG  . CYS E 1 183 ? 78.792  49.952  71.275  1.00 15.67 ? 201 CYS E SG  1 
ATOM   7844  N N   . SER E 1 184 ? 79.390  52.737  66.995  1.00 21.67 ? 202 SER E N   1 
ATOM   7845  C CA  . SER E 1 184 ? 79.602  54.020  66.333  1.00 25.21 ? 202 SER E CA  1 
ATOM   7846  C C   . SER E 1 184 ? 81.081  54.423  66.252  1.00 24.23 ? 202 SER E C   1 
ATOM   7847  O O   . SER E 1 184 ? 81.457  55.567  66.549  1.00 22.90 ? 202 SER E O   1 
ATOM   7848  C CB  . SER E 1 184 ? 78.790  55.091  67.048  1.00 27.74 ? 202 SER E CB  1 
ATOM   7849  O OG  . SER E 1 184 ? 77.480  54.601  67.279  1.00 32.09 ? 202 SER E OG  1 
ATOM   7850  N N   . GLY E 1 185 ? 81.914  53.454  65.877  1.00 22.47 ? 203 GLY E N   1 
ATOM   7851  C CA  . GLY E 1 185 ? 83.339  53.696  65.739  1.00 20.25 ? 203 GLY E CA  1 
ATOM   7852  C C   . GLY E 1 185 ? 84.157  53.776  67.014  1.00 14.31 ? 203 GLY E C   1 
ATOM   7853  O O   . GLY E 1 185 ? 85.377  53.910  66.972  1.00 17.30 ? 203 GLY E O   1 
ATOM   7854  N N   . LYS E 1 186 ? 83.505  53.696  68.152  1.00 9.58  ? 204 LYS E N   1 
ATOM   7855  C CA  . LYS E 1 186 ? 84.235  53.759  69.390  1.00 12.71 ? 204 LYS E CA  1 
ATOM   7856  C C   . LYS E 1 186 ? 84.324  52.413  70.123  1.00 14.57 ? 204 LYS E C   1 
ATOM   7857  O O   . LYS E 1 186 ? 83.504  51.500  69.919  1.00 15.05 ? 204 LYS E O   1 
ATOM   7858  C CB  . LYS E 1 186 ? 83.587  54.796  70.274  1.00 14.95 ? 204 LYS E CB  1 
ATOM   7859  C CG  . LYS E 1 186 ? 83.481  56.142  69.594  1.00 17.86 ? 204 LYS E CG  1 
ATOM   7860  C CD  . LYS E 1 186 ? 84.856  56.750  69.426  1.00 18.63 ? 204 LYS E CD  1 
ATOM   7861  C CE  . LYS E 1 186 ? 84.769  58.236  69.113  1.00 19.37 ? 204 LYS E CE  1 
ATOM   7862  N NZ  . LYS E 1 186 ? 86.126  58.823  68.981  0.00 17.68 ? 204 LYS E NZ  1 
ATOM   7863  N N   . LEU E 1 187 ? 85.352  52.267  70.946  1.00 14.91 ? 209 LEU E N   1 
ATOM   7864  C CA  . LEU E 1 187 ? 85.505  51.047  71.713  1.00 15.11 ? 209 LEU E CA  1 
ATOM   7865  C C   . LEU E 1 187 ? 84.637  51.198  72.974  1.00 18.28 ? 209 LEU E C   1 
ATOM   7866  O O   . LEU E 1 187 ? 85.063  51.858  73.925  1.00 21.97 ? 209 LEU E O   1 
ATOM   7867  C CB  . LEU E 1 187 ? 86.975  50.849  72.102  1.00 8.55  ? 209 LEU E CB  1 
ATOM   7868  C CG  . LEU E 1 187 ? 87.236  49.567  72.909  1.00 5.72  ? 209 LEU E CG  1 
ATOM   7869  C CD1 . LEU E 1 187 ? 86.971  48.317  72.075  1.00 5.00  ? 209 LEU E CD1 1 
ATOM   7870  C CD2 . LEU E 1 187 ? 88.649  49.569  73.405  1.00 6.38  ? 209 LEU E CD2 1 
ATOM   7871  N N   . GLN E 1 188 ? 83.426  50.621  72.988  1.00 18.22 ? 210 GLN E N   1 
ATOM   7872  C CA  . GLN E 1 188 ? 82.532  50.734  74.165  1.00 14.16 ? 210 GLN E CA  1 
ATOM   7873  C C   . GLN E 1 188 ? 82.696  49.679  75.232  1.00 14.57 ? 210 GLN E C   1 
ATOM   7874  O O   . GLN E 1 188 ? 82.482  49.973  76.402  1.00 17.73 ? 210 GLN E O   1 
ATOM   7875  C CB  . GLN E 1 188 ? 81.059  50.762  73.781  1.00 10.28 ? 210 GLN E CB  1 
ATOM   7876  C CG  . GLN E 1 188 ? 80.580  52.081  73.239  1.00 10.14 ? 210 GLN E CG  1 
ATOM   7877  C CD  . GLN E 1 188 ? 80.826  53.248  74.179  1.00 8.83  ? 210 GLN E CD  1 
ATOM   7878  O OE1 . GLN E 1 188 ? 80.874  54.392  73.740  1.00 8.58  ? 210 GLN E OE1 1 
ATOM   7879  N NE2 . GLN E 1 188 ? 80.967  52.973  75.465  1.00 5.00  ? 210 GLN E NE2 1 
ATOM   7880  N N   . GLY E 1 189 ? 83.034  48.455  74.839  1.00 13.03 ? 211 GLY E N   1 
ATOM   7881  C CA  . GLY E 1 189 ? 83.204  47.403  75.820  1.00 10.93 ? 211 GLY E CA  1 
ATOM   7882  C C   . GLY E 1 189 ? 84.171  46.298  75.451  1.00 8.85  ? 211 GLY E C   1 
ATOM   7883  O O   . GLY E 1 189 ? 84.609  46.187  74.307  1.00 11.22 ? 211 GLY E O   1 
ATOM   7884  N N   . ILE E 1 190 ? 84.499  45.472  76.430  1.00 5.54  ? 212 ILE E N   1 
ATOM   7885  C CA  . ILE E 1 190 ? 85.412  44.377  76.220  1.00 5.00  ? 212 ILE E CA  1 
ATOM   7886  C C   . ILE E 1 190 ? 84.684  43.128  76.671  1.00 5.00  ? 212 ILE E C   1 
ATOM   7887  O O   . ILE E 1 190 ? 84.135  43.087  77.765  1.00 5.00  ? 212 ILE E O   1 
ATOM   7888  C CB  . ILE E 1 190 ? 86.699  44.552  77.079  1.00 7.68  ? 212 ILE E CB  1 
ATOM   7889  C CG1 . ILE E 1 190 ? 87.348  45.919  76.816  1.00 7.62  ? 212 ILE E CG1 1 
ATOM   7890  C CG2 . ILE E 1 190 ? 87.713  43.458  76.775  1.00 7.75  ? 212 ILE E CG2 1 
ATOM   7891  C CD1 . ILE E 1 190 ? 88.463  46.274  77.781  1.00 5.00  ? 212 ILE E CD1 1 
ATOM   7892  N N   . VAL E 1 191 ? 84.645  42.138  75.789  1.00 5.70  ? 213 VAL E N   1 
ATOM   7893  C CA  . VAL E 1 191 ? 84.015  40.849  76.041  1.00 5.00  ? 213 VAL E CA  1 
ATOM   7894  C C   . VAL E 1 191 ? 84.545  40.341  77.354  1.00 5.00  ? 213 VAL E C   1 
ATOM   7895  O O   . VAL E 1 191 ? 85.718  40.081  77.482  1.00 8.84  ? 213 VAL E O   1 
ATOM   7896  C CB  . VAL E 1 191 ? 84.390  39.821  74.952  1.00 5.00  ? 213 VAL E CB  1 
ATOM   7897  C CG1 . VAL E 1 191 ? 83.781  38.477  75.266  1.00 5.00  ? 213 VAL E CG1 1 
ATOM   7898  C CG2 . VAL E 1 191 ? 83.975  40.317  73.573  1.00 5.00  ? 213 VAL E CG2 1 
ATOM   7899  N N   . SER E 1 192 ? 83.679  40.156  78.325  1.00 8.12  ? 214 SER E N   1 
ATOM   7900  C CA  . SER E 1 192 ? 84.121  39.695  79.622  1.00 10.34 ? 214 SER E CA  1 
ATOM   7901  C C   . SER E 1 192 ? 83.576  38.335  80.041  1.00 12.92 ? 214 SER E C   1 
ATOM   7902  O O   . SER E 1 192 ? 84.249  37.320  79.854  1.00 15.03 ? 214 SER E O   1 
ATOM   7903  C CB  . SER E 1 192 ? 83.805  40.749  80.670  1.00 7.46  ? 214 SER E CB  1 
ATOM   7904  O OG  . SER E 1 192 ? 84.549  40.473  81.831  1.00 11.90 ? 214 SER E OG  1 
ATOM   7905  N N   . TRP E 1 193 ? 82.345  38.298  80.548  1.00 16.33 ? 215 TRP E N   1 
ATOM   7906  C CA  . TRP E 1 193 ? 81.735  37.043  81.020  1.00 17.49 ? 215 TRP E CA  1 
ATOM   7907  C C   . TRP E 1 193 ? 80.223  36.900  80.757  1.00 17.55 ? 215 TRP E C   1 
ATOM   7908  O O   . TRP E 1 193 ? 79.573  37.788  80.174  1.00 16.18 ? 215 TRP E O   1 
ATOM   7909  C CB  . TRP E 1 193 ? 81.998  36.876  82.519  1.00 15.59 ? 215 TRP E CB  1 
ATOM   7910  C CG  . TRP E 1 193 ? 81.464  38.011  83.331  1.00 13.58 ? 215 TRP E CG  1 
ATOM   7911  C CD1 . TRP E 1 193 ? 82.033  39.243  83.497  1.00 13.76 ? 215 TRP E CD1 1 
ATOM   7912  C CD2 . TRP E 1 193 ? 80.262  38.017  84.096  1.00 13.47 ? 215 TRP E CD2 1 
ATOM   7913  N NE1 . TRP E 1 193 ? 81.256  40.018  84.325  1.00 15.25 ? 215 TRP E NE1 1 
ATOM   7914  C CE2 . TRP E 1 193 ? 80.163  39.290  84.711  1.00 15.58 ? 215 TRP E CE2 1 
ATOM   7915  C CE3 . TRP E 1 193 ? 79.261  37.071  84.331  1.00 11.31 ? 215 TRP E CE3 1 
ATOM   7916  C CZ2 . TRP E 1 193 ? 79.106  39.635  85.545  1.00 14.75 ? 215 TRP E CZ2 1 
ATOM   7917  C CZ3 . TRP E 1 193 ? 78.216  37.406  85.155  1.00 12.08 ? 215 TRP E CZ3 1 
ATOM   7918  C CH2 . TRP E 1 193 ? 78.143  38.679  85.756  1.00 16.39 ? 215 TRP E CH2 1 
ATOM   7919  N N   . GLY E 1 194 ? 79.687  35.759  81.178  1.00 15.72 ? 216 GLY E N   1 
ATOM   7920  C CA  . GLY E 1 194 ? 78.277  35.473  81.004  1.00 16.84 ? 216 GLY E CA  1 
ATOM   7921  C C   . GLY E 1 194 ? 77.997  34.022  81.342  1.00 18.10 ? 216 GLY E C   1 
ATOM   7922  O O   . GLY E 1 194 ? 78.918  33.261  81.661  1.00 17.74 ? 216 GLY E O   1 
ATOM   7923  N N   . SER E 1 195 ? 76.733  33.627  81.311  1.00 18.71 ? 217 SER E N   1 
ATOM   7924  C CA  . SER E 1 195 ? 76.406  32.254  81.636  1.00 22.31 ? 217 SER E CA  1 
ATOM   7925  C C   . SER E 1 195 ? 76.359  31.515  80.338  1.00 23.50 ? 217 SER E C   1 
ATOM   7926  O O   . SER E 1 195 ? 75.512  31.808  79.495  1.00 23.82 ? 217 SER E O   1 
ATOM   7927  C CB  . SER E 1 195 ? 75.053  32.160  82.336  1.00 25.86 ? 217 SER E CB  1 
ATOM   7928  O OG  . SER E 1 195 ? 75.024  32.967  83.505  1.00 31.05 ? 217 SER E OG  1 
ATOM   7929  N N   . GLY E 1 196 ? 77.263  30.551  80.180  1.00 23.91 ? 219 GLY E N   1 
ATOM   7930  C CA  . GLY E 1 196 ? 77.310  29.782  78.955  1.00 22.47 ? 219 GLY E CA  1 
ATOM   7931  C C   . GLY E 1 196 ? 77.387  30.745  77.782  1.00 24.64 ? 219 GLY E C   1 
ATOM   7932  O O   . GLY E 1 196 ? 77.988  31.813  77.886  1.00 20.63 ? 219 GLY E O   1 
ATOM   7933  N N   . CYS E 1 197 ? 76.693  30.421  76.699  1.00 27.08 ? 220 CYS E N   1 
ATOM   7934  C CA  . CYS E 1 197 ? 76.718  31.261  75.505  1.00 25.98 ? 220 CYS E CA  1 
ATOM   7935  C C   . CYS E 1 197 ? 75.384  31.247  74.769  1.00 27.78 ? 220 CYS E C   1 
ATOM   7936  O O   . CYS E 1 197 ? 74.784  30.187  74.565  1.00 29.83 ? 220 CYS E O   1 
ATOM   7937  C CB  . CYS E 1 197 ? 77.837  30.800  74.556  1.00 20.75 ? 220 CYS E CB  1 
ATOM   7938  S SG  . CYS E 1 197 ? 79.515  31.062  75.208  1.00 14.58 ? 220 CYS E SG  1 
ATOM   7939  N N   . ALA E 1 198 A 74.894  32.433  74.433  1.00 27.72 ? 221 ALA E N   1 
ATOM   7940  C CA  . ALA E 1 198 A 73.642  32.559  73.701  1.00 32.06 ? 221 ALA E CA  1 
ATOM   7941  C C   . ALA E 1 198 A 72.445  31.952  74.441  1.00 33.05 ? 221 ALA E C   1 
ATOM   7942  O O   . ALA E 1 198 A 71.387  31.697  73.854  1.00 33.86 ? 221 ALA E O   1 
ATOM   7943  C CB  . ALA E 1 198 A 73.786  31.941  72.309  1.00 35.11 ? 221 ALA E CB  1 
ATOM   7944  N N   . GLN E 1 199 ? 72.625  31.725  75.734  1.00 32.63 ? 221 GLN E N   1 
ATOM   7945  C CA  . GLN E 1 199 ? 71.573  31.186  76.571  1.00 31.52 ? 221 GLN E CA  1 
ATOM   7946  C C   . GLN E 1 199 ? 70.513  32.268  76.760  1.00 30.41 ? 221 GLN E C   1 
ATOM   7947  O O   . GLN E 1 199 ? 70.818  33.470  76.860  1.00 29.29 ? 221 GLN E O   1 
ATOM   7948  C CB  . GLN E 1 199 ? 72.139  30.748  77.929  1.00 31.29 ? 221 GLN E CB  1 
ATOM   7949  C CG  . GLN E 1 199 ? 72.086  29.230  78.191  1.00 31.24 ? 221 GLN E CG  1 
ATOM   7950  C CD  . GLN E 1 199 ? 72.768  28.397  77.107  1.00 28.70 ? 221 GLN E CD  1 
ATOM   7951  O OE1 . GLN E 1 199 ? 72.120  27.613  76.418  0.00 28.03 ? 221 GLN E OE1 1 
ATOM   7952  N NE2 . GLN E 1 199 ? 74.071  28.574  76.954  0.00 27.99 ? 221 GLN E NE2 1 
ATOM   7953  N N   . LYS E 1 200 ? 69.264  31.833  76.731  1.00 29.18 ? 222 LYS E N   1 
ATOM   7954  C CA  . LYS E 1 200 ? 68.119  32.713  76.904  1.00 26.84 ? 222 LYS E CA  1 
ATOM   7955  C C   . LYS E 1 200 ? 68.195  33.410  78.256  1.00 22.74 ? 222 LYS E C   1 
ATOM   7956  O O   . LYS E 1 200 ? 68.566  32.801  79.261  1.00 21.31 ? 222 LYS E O   1 
ATOM   7957  C CB  . LYS E 1 200 ? 66.826  31.890  76.829  1.00 29.27 ? 222 LYS E CB  1 
ATOM   7958  C CG  . LYS E 1 200 ? 65.547  32.691  77.066  1.00 29.99 ? 222 LYS E CG  1 
ATOM   7959  C CD  . LYS E 1 200 ? 64.326  31.799  77.066  0.00 28.93 ? 222 LYS E CD  1 
ATOM   7960  C CE  . LYS E 1 200 ? 63.075  32.591  77.398  0.00 28.50 ? 222 LYS E CE  1 
ATOM   7961  N NZ  . LYS E 1 200 ? 61.875  31.715  77.459  0.00 28.33 ? 222 LYS E NZ  1 
ATOM   7962  N N   . ASN E 1 201 ? 67.853  34.688  78.269  1.00 21.43 ? 223 ASN E N   1 
ATOM   7963  C CA  . ASN E 1 201 ? 67.861  35.470  79.492  1.00 24.17 ? 223 ASN E CA  1 
ATOM   7964  C C   . ASN E 1 201 ? 69.227  35.561  80.180  1.00 23.76 ? 223 ASN E C   1 
ATOM   7965  O O   . ASN E 1 201 ? 69.331  35.955  81.344  1.00 26.46 ? 223 ASN E O   1 
ATOM   7966  C CB  . ASN E 1 201 ? 66.779  34.948  80.461  1.00 25.94 ? 223 ASN E CB  1 
ATOM   7967  C CG  . ASN E 1 201 ? 65.357  35.192  79.946  1.00 24.99 ? 223 ASN E CG  1 
ATOM   7968  O OD1 . ASN E 1 201 ? 65.133  36.028  79.070  0.00 24.31 ? 223 ASN E OD1 1 
ATOM   7969  N ND2 . ASN E 1 201 ? 64.401  34.447  80.480  0.00 24.20 ? 223 ASN E ND2 1 
ATOM   7970  N N   . LYS E 1 202 ? 70.277  35.211  79.452  1.00 24.19 ? 224 LYS E N   1 
ATOM   7971  C CA  . LYS E 1 202 ? 71.637  35.275  79.980  1.00 24.75 ? 224 LYS E CA  1 
ATOM   7972  C C   . LYS E 1 202 ? 72.461  35.919  78.885  1.00 21.43 ? 224 LYS E C   1 
ATOM   7973  O O   . LYS E 1 202 ? 73.128  35.238  78.112  1.00 19.89 ? 224 LYS E O   1 
ATOM   7974  C CB  . LYS E 1 202 ? 72.159  33.876  80.322  1.00 27.19 ? 224 LYS E CB  1 
ATOM   7975  C CG  . LYS E 1 202 ? 71.381  33.213  81.473  1.00 28.71 ? 224 LYS E CG  1 
ATOM   7976  C CD  . LYS E 1 202 ? 71.453  34.051  82.756  1.00 28.18 ? 224 LYS E CD  1 
ATOM   7977  C CE  . LYS E 1 202 ? 70.496  33.552  83.822  1.00 28.70 ? 224 LYS E CE  1 
ATOM   7978  N NZ  . LYS E 1 202 ? 70.690  34.217  85.142  1.00 27.12 ? 224 LYS E NZ  1 
ATOM   7979  N N   . PRO E 1 203 ? 72.387  37.258  78.784  1.00 23.14 ? 225 PRO E N   1 
ATOM   7980  C CA  . PRO E 1 203 ? 73.100  38.042  77.782  1.00 19.20 ? 225 PRO E CA  1 
ATOM   7981  C C   . PRO E 1 203 ? 74.570  38.115  78.117  1.00 20.74 ? 225 PRO E C   1 
ATOM   7982  O O   . PRO E 1 203 ? 74.948  37.906  79.274  1.00 22.79 ? 225 PRO E O   1 
ATOM   7983  C CB  . PRO E 1 203 ? 72.469  39.442  77.920  1.00 17.38 ? 225 PRO E CB  1 
ATOM   7984  C CG  . PRO E 1 203 ? 71.355  39.291  78.876  1.00 15.70 ? 225 PRO E CG  1 
ATOM   7985  C CD  . PRO E 1 203 ? 71.755  38.163  79.752  1.00 19.81 ? 225 PRO E CD  1 
ATOM   7986  N N   . GLY E 1 204 ? 75.388  38.428  77.114  1.00 17.05 ? 226 GLY E N   1 
ATOM   7987  C CA  . GLY E 1 204 ? 76.809  38.580  77.346  1.00 13.89 ? 226 GLY E CA  1 
ATOM   7988  C C   . GLY E 1 204 ? 77.070  39.868  78.116  1.00 12.73 ? 226 GLY E C   1 
ATOM   7989  O O   . GLY E 1 204 ? 76.442  40.898  77.836  1.00 7.81  ? 226 GLY E O   1 
ATOM   7990  N N   . VAL E 1 205 ? 77.964  39.797  79.105  1.00 13.49 ? 227 VAL E N   1 
ATOM   7991  C CA  . VAL E 1 205 ? 78.330  40.946  79.936  1.00 11.48 ? 227 VAL E CA  1 
ATOM   7992  C C   . VAL E 1 205 ? 79.658  41.500  79.420  1.00 10.61 ? 227 VAL E C   1 
ATOM   7993  O O   . VAL E 1 205 ? 80.548  40.736  79.092  1.00 11.59 ? 227 VAL E O   1 
ATOM   7994  C CB  . VAL E 1 205 ? 78.461  40.538  81.425  1.00 8.34  ? 227 VAL E CB  1 
ATOM   7995  C CG1 . VAL E 1 205 ? 78.869  41.748  82.274  1.00 8.19  ? 227 VAL E CG1 1 
ATOM   7996  C CG2 . VAL E 1 205 ? 77.142  39.963  81.918  1.00 5.00  ? 227 VAL E CG2 1 
ATOM   7997  N N   . TYR E 1 206 ? 79.779  42.818  79.328  1.00 9.20  ? 228 TYR E N   1 
ATOM   7998  C CA  . TYR E 1 206 ? 80.984  43.464  78.822  1.00 7.64  ? 228 TYR E CA  1 
ATOM   7999  C C   . TYR E 1 206 ? 81.493  44.583  79.719  1.00 11.75 ? 228 TYR E C   1 
ATOM   8000  O O   . TYR E 1 206 ? 80.715  45.181  80.455  1.00 16.13 ? 228 TYR E O   1 
ATOM   8001  C CB  . TYR E 1 206 ? 80.700  44.027  77.451  1.00 5.00  ? 228 TYR E CB  1 
ATOM   8002  C CG  . TYR E 1 206 ? 80.235  42.977  76.501  1.00 5.00  ? 228 TYR E CG  1 
ATOM   8003  C CD1 . TYR E 1 206 ? 81.105  42.411  75.587  1.00 5.00  ? 228 TYR E CD1 1 
ATOM   8004  C CD2 . TYR E 1 206 ? 78.934  42.528  76.529  1.00 5.89  ? 228 TYR E CD2 1 
ATOM   8005  C CE1 . TYR E 1 206 ? 80.694  41.416  74.718  1.00 6.72  ? 228 TYR E CE1 1 
ATOM   8006  C CE2 . TYR E 1 206 ? 78.504  41.538  75.670  1.00 10.55 ? 228 TYR E CE2 1 
ATOM   8007  C CZ  . TYR E 1 206 ? 79.389  40.978  74.761  1.00 10.85 ? 228 TYR E CZ  1 
ATOM   8008  O OH  . TYR E 1 206 ? 78.970  39.982  73.894  1.00 14.49 ? 228 TYR E OH  1 
ATOM   8009  N N   . THR E 1 207 ? 82.794  44.868  79.656  1.00 10.96 ? 229 THR E N   1 
ATOM   8010  C CA  . THR E 1 207 ? 83.404  45.925  80.467  1.00 7.38  ? 229 THR E CA  1 
ATOM   8011  C C   . THR E 1 207 ? 83.121  47.298  79.892  1.00 5.71  ? 229 THR E C   1 
ATOM   8012  O O   . THR E 1 207 ? 83.386  47.550  78.729  1.00 5.00  ? 229 THR E O   1 
ATOM   8013  C CB  . THR E 1 207 ? 84.914  45.769  80.538  1.00 8.51  ? 229 THR E CB  1 
ATOM   8014  O OG1 . THR E 1 207 ? 85.229  44.417  80.855  1.00 14.73 ? 229 THR E OG1 1 
ATOM   8015  C CG2 . THR E 1 207 ? 85.487  46.663  81.607  1.00 7.82  ? 229 THR E CG2 1 
ATOM   8016  N N   . LYS E 1 208 ? 82.650  48.202  80.738  1.00 7.35  ? 230 LYS E N   1 
ATOM   8017  C CA  . LYS E 1 208 ? 82.314  49.566  80.335  1.00 8.27  ? 230 LYS E CA  1 
ATOM   8018  C C   . LYS E 1 208 ? 83.593  50.371  80.074  1.00 8.86  ? 230 LYS E C   1 
ATOM   8019  O O   . LYS E 1 208 ? 84.067  51.116  80.938  1.00 9.15  ? 230 LYS E O   1 
ATOM   8020  C CB  . LYS E 1 208 ? 81.466  50.224  81.437  1.00 6.78  ? 230 LYS E CB  1 
ATOM   8021  C CG  . LYS E 1 208 ? 80.382  51.156  80.928  1.00 7.98  ? 230 LYS E CG  1 
ATOM   8022  C CD  . LYS E 1 208 ? 79.444  51.582  82.053  1.00 7.63  ? 230 LYS E CD  1 
ATOM   8023  C CE  . LYS E 1 208 ? 78.340  52.498  81.550  1.00 6.27  ? 230 LYS E CE  1 
ATOM   8024  N NZ  . LYS E 1 208 ? 77.423  52.932  82.636  0.00 7.19  ? 230 LYS E NZ  1 
ATOM   8025  N N   . VAL E 1 209 ? 84.154  50.226  78.881  1.00 9.73  ? 231 VAL E N   1 
ATOM   8026  C CA  . VAL E 1 209 ? 85.384  50.932  78.537  1.00 11.33 ? 231 VAL E CA  1 
ATOM   8027  C C   . VAL E 1 209 ? 85.324  52.436  78.781  1.00 14.62 ? 231 VAL E C   1 
ATOM   8028  O O   . VAL E 1 209 ? 86.350  53.059  79.075  1.00 17.19 ? 231 VAL E O   1 
ATOM   8029  C CB  . VAL E 1 209 ? 85.804  50.682  77.074  1.00 8.41  ? 231 VAL E CB  1 
ATOM   8030  C CG1 . VAL E 1 209 ? 86.983  51.571  76.707  1.00 7.07  ? 231 VAL E CG1 1 
ATOM   8031  C CG2 . VAL E 1 209 ? 86.184  49.226  76.877  1.00 5.00  ? 231 VAL E CG2 1 
ATOM   8032  N N   . CYS E 1 210 ? 84.132  53.012  78.700  1.00 15.73 ? 232 CYS E N   1 
ATOM   8033  C CA  . CYS E 1 210 ? 83.972  54.443  78.906  1.00 16.91 ? 232 CYS E CA  1 
ATOM   8034  C C   . CYS E 1 210 ? 84.405  54.908  80.281  1.00 12.64 ? 232 CYS E C   1 
ATOM   8035  O O   . CYS E 1 210 ? 84.992  55.966  80.404  1.00 11.18 ? 232 CYS E O   1 
ATOM   8036  C CB  . CYS E 1 210 ? 82.533  54.893  78.598  1.00 23.80 ? 232 CYS E CB  1 
ATOM   8037  S SG  . CYS E 1 210 ? 81.160  54.268  79.655  1.00 27.13 ? 232 CYS E SG  1 
ATOM   8038  N N   . ASN E 1 211 ? 84.196  54.085  81.297  1.00 12.71 ? 233 ASN E N   1 
ATOM   8039  C CA  . ASN E 1 211 ? 84.580  54.459  82.658  1.00 18.25 ? 233 ASN E CA  1 
ATOM   8040  C C   . ASN E 1 211 ? 86.096  54.484  82.875  1.00 19.62 ? 233 ASN E C   1 
ATOM   8041  O O   . ASN E 1 211 ? 86.605  55.128  83.814  1.00 19.28 ? 233 ASN E O   1 
ATOM   8042  C CB  . ASN E 1 211 ? 83.978  53.483  83.673  1.00 21.96 ? 233 ASN E CB  1 
ATOM   8043  C CG  . ASN E 1 211 ? 82.491  53.640  83.821  1.00 23.97 ? 233 ASN E CG  1 
ATOM   8044  O OD1 . ASN E 1 211 ? 81.881  54.505  83.180  1.00 25.72 ? 233 ASN E OD1 1 
ATOM   8045  N ND2 . ASN E 1 211 ? 81.889  52.806  84.675  1.00 23.28 ? 233 ASN E ND2 1 
ATOM   8046  N N   . TYR E 1 212 ? 86.812  53.773  82.007  1.00 18.60 ? 234 TYR E N   1 
ATOM   8047  C CA  . TYR E 1 212 ? 88.257  53.662  82.114  1.00 14.10 ? 234 TYR E CA  1 
ATOM   8048  C C   . TYR E 1 212 ? 89.104  54.505  81.162  1.00 12.98 ? 234 TYR E C   1 
ATOM   8049  O O   . TYR E 1 212 ? 90.324  54.466  81.241  1.00 15.37 ? 234 TYR E O   1 
ATOM   8050  C CB  . TYR E 1 212 ? 88.640  52.197  81.998  1.00 10.30 ? 234 TYR E CB  1 
ATOM   8051  C CG  . TYR E 1 212 ? 87.919  51.308  82.980  1.00 6.23  ? 234 TYR E CG  1 
ATOM   8052  C CD1 . TYR E 1 212 ? 88.411  51.116  84.264  1.00 5.46  ? 234 TYR E CD1 1 
ATOM   8053  C CD2 . TYR E 1 212 ? 86.775  50.622  82.610  1.00 7.01  ? 234 TYR E CD2 1 
ATOM   8054  C CE1 . TYR E 1 212 ? 87.795  50.261  85.147  1.00 5.00  ? 234 TYR E CE1 1 
ATOM   8055  C CE2 . TYR E 1 212 ? 86.150  49.763  83.494  1.00 7.84  ? 234 TYR E CE2 1 
ATOM   8056  C CZ  . TYR E 1 212 ? 86.675  49.591  84.757  1.00 5.77  ? 234 TYR E CZ  1 
ATOM   8057  O OH  . TYR E 1 212 ? 86.090  48.721  85.627  1.00 8.39  ? 234 TYR E OH  1 
ATOM   8058  N N   . VAL E 1 213 ? 88.476  55.291  80.297  1.00 11.57 ? 235 VAL E N   1 
ATOM   8059  C CA  . VAL E 1 213 ? 89.207  56.140  79.350  1.00 12.07 ? 235 VAL E CA  1 
ATOM   8060  C C   . VAL E 1 213 ? 90.319  56.941  80.008  1.00 14.11 ? 235 VAL E C   1 
ATOM   8061  O O   . VAL E 1 213 ? 91.416  57.030  79.474  1.00 12.72 ? 235 VAL E O   1 
ATOM   8062  C CB  . VAL E 1 213 ? 88.274  57.137  78.627  1.00 11.37 ? 235 VAL E CB  1 
ATOM   8063  C CG1 . VAL E 1 213 ? 89.060  58.046  77.718  1.00 6.16  ? 235 VAL E CG1 1 
ATOM   8064  C CG2 . VAL E 1 213 ? 87.243  56.377  77.823  1.00 16.36 ? 235 VAL E CG2 1 
ATOM   8065  N N   . SER E 1 214 ? 90.038  57.534  81.161  1.00 16.57 ? 236 SER E N   1 
ATOM   8066  C CA  . SER E 1 214 ? 91.047  58.318  81.867  1.00 16.64 ? 236 SER E CA  1 
ATOM   8067  C C   . SER E 1 214 ? 92.214  57.416  82.261  1.00 16.12 ? 236 SER E C   1 
ATOM   8068  O O   . SER E 1 214 ? 93.360  57.702  81.919  1.00 19.33 ? 236 SER E O   1 
ATOM   8069  C CB  . SER E 1 214 ? 90.450  58.963  83.119  1.00 19.50 ? 236 SER E CB  1 
ATOM   8070  O OG  . SER E 1 214 ? 89.251  59.655  82.813  0.00 19.17 ? 236 SER E OG  1 
ATOM   8071  N N   . TRP E 1 215 ? 91.918  56.303  82.935  1.00 12.95 ? 237 TRP E N   1 
ATOM   8072  C CA  . TRP E 1 215 ? 92.956  55.384  83.368  1.00 6.10  ? 237 TRP E CA  1 
ATOM   8073  C C   . TRP E 1 215 ? 93.784  55.027  82.182  1.00 8.60  ? 237 TRP E C   1 
ATOM   8074  O O   . TRP E 1 215 ? 95.005  55.159  82.224  1.00 13.74 ? 237 TRP E O   1 
ATOM   8075  C CB  . TRP E 1 215 ? 92.365  54.121  83.939  1.00 5.00  ? 237 TRP E CB  1 
ATOM   8076  C CG  . TRP E 1 215 ? 93.394  53.151  84.333  1.00 5.89  ? 237 TRP E CG  1 
ATOM   8077  C CD1 . TRP E 1 215 ? 94.251  53.263  85.379  1.00 8.96  ? 237 TRP E CD1 1 
ATOM   8078  C CD2 . TRP E 1 215 ? 93.690  51.897  83.700  1.00 7.07  ? 237 TRP E CD2 1 
ATOM   8079  N NE1 . TRP E 1 215 ? 95.065  52.154  85.446  1.00 10.68 ? 237 TRP E NE1 1 
ATOM   8080  C CE2 . TRP E 1 215 ? 94.739  51.297  84.428  1.00 8.70  ? 237 TRP E CE2 1 
ATOM   8081  C CE3 . TRP E 1 215 ? 93.174  51.227  82.589  1.00 5.00  ? 237 TRP E CE3 1 
ATOM   8082  C CZ2 . TRP E 1 215 ? 95.281  50.057  84.085  1.00 8.84  ? 237 TRP E CZ2 1 
ATOM   8083  C CZ3 . TRP E 1 215 ? 93.711  50.002  82.249  1.00 7.22  ? 237 TRP E CZ3 1 
ATOM   8084  C CH2 . TRP E 1 215 ? 94.756  49.427  82.994  1.00 8.86  ? 237 TRP E CH2 1 
ATOM   8085  N N   . ILE E 1 216 ? 93.117  54.594  81.116  1.00 8.03  ? 238 ILE E N   1 
ATOM   8086  C CA  . ILE E 1 216 ? 93.805  54.226  79.883  1.00 9.51  ? 238 ILE E CA  1 
ATOM   8087  C C   . ILE E 1 216 ? 94.778  55.347  79.493  1.00 9.28  ? 238 ILE E C   1 
ATOM   8088  O O   . ILE E 1 216 ? 95.999  55.139  79.505  1.00 11.44 ? 238 ILE E O   1 
ATOM   8089  C CB  . ILE E 1 216 ? 92.812  53.964  78.714  1.00 8.82  ? 238 ILE E CB  1 
ATOM   8090  C CG1 . ILE E 1 216 ? 91.852  52.827  79.079  1.00 8.23  ? 238 ILE E CG1 1 
ATOM   8091  C CG2 . ILE E 1 216 ? 93.568  53.591  77.438  1.00 7.53  ? 238 ILE E CG2 1 
ATOM   8092  C CD1 . ILE E 1 216 ? 90.786  52.589  78.029  1.00 8.10  ? 238 ILE E CD1 1 
ATOM   8093  N N   . LYS E 1 217 ? 94.247  56.547  79.266  1.00 5.33  ? 239 LYS E N   1 
ATOM   8094  C CA  . LYS E 1 217 ? 95.046  57.699  78.877  1.00 5.00  ? 239 LYS E CA  1 
ATOM   8095  C C   . LYS E 1 217 ? 96.251  57.982  79.761  1.00 5.00  ? 239 LYS E C   1 
ATOM   8096  O O   . LYS E 1 217 ? 97.340  58.227  79.256  1.00 5.00  ? 239 LYS E O   1 
ATOM   8097  C CB  . LYS E 1 217 ? 94.169  58.941  78.761  1.00 5.00  ? 239 LYS E CB  1 
ATOM   8098  C CG  . LYS E 1 217 ? 93.252  58.948  77.537  1.00 5.00  ? 239 LYS E CG  1 
ATOM   8099  C CD  . LYS E 1 217 ? 92.492  60.254  77.427  0.00 7.28  ? 239 LYS E CD  1 
ATOM   8100  C CE  . LYS E 1 217 ? 91.645  60.296  76.167  0.00 8.00  ? 239 LYS E CE  1 
ATOM   8101  N NZ  . LYS E 1 217 ? 90.806  61.524  76.117  0.00 8.35  ? 239 LYS E NZ  1 
ATOM   8102  N N   . GLN E 1 218 ? 96.074  57.939  81.073  1.00 5.71  ? 240 GLN E N   1 
ATOM   8103  C CA  . GLN E 1 218 ? 97.192  58.187  81.975  1.00 9.35  ? 240 GLN E CA  1 
ATOM   8104  C C   . GLN E 1 218 ? 98.244  57.054  81.867  1.00 11.94 ? 240 GLN E C   1 
ATOM   8105  O O   . GLN E 1 218 ? 99.433  57.326  81.647  1.00 16.41 ? 240 GLN E O   1 
ATOM   8106  C CB  . GLN E 1 218 ? 96.714  58.362  83.429  1.00 5.81  ? 240 GLN E CB  1 
ATOM   8107  C CG  . GLN E 1 218 ? 97.814  58.701  84.422  0.00 9.96  ? 240 GLN E CG  1 
ATOM   8108  C CD  . GLN E 1 218 ? 98.410  60.072  84.175  0.00 12.02 ? 240 GLN E CD  1 
ATOM   8109  O OE1 . GLN E 1 218 ? 97.732  61.089  84.317  0.00 12.97 ? 240 GLN E OE1 1 
ATOM   8110  N NE2 . GLN E 1 218 ? 99.680  60.108  83.796  0.00 13.12 ? 240 GLN E NE2 1 
ATOM   8111  N N   . THR E 1 219 ? 97.819  55.796  81.938  1.00 7.92  ? 241 THR E N   1 
ATOM   8112  C CA  . THR E 1 219 ? 98.764  54.697  81.874  1.00 7.30  ? 241 THR E CA  1 
ATOM   8113  C C   . THR E 1 219 ? 99.671  54.764  80.647  1.00 10.13 ? 241 THR E C   1 
ATOM   8114  O O   . THR E 1 219 ? 100.877 54.551  80.733  1.00 12.01 ? 241 THR E O   1 
ATOM   8115  C CB  . THR E 1 219 ? 98.027  53.366  81.924  1.00 9.55  ? 241 THR E CB  1 
ATOM   8116  O OG1 . THR E 1 219 ? 97.202  53.347  83.088  1.00 5.76  ? 241 THR E OG1 1 
ATOM   8117  C CG2 . THR E 1 219 ? 99.008  52.193  82.014  1.00 13.27 ? 241 THR E CG2 1 
ATOM   8118  N N   . ILE E 1 220 ? 99.084  55.080  79.507  1.00 11.03 ? 242 ILE E N   1 
ATOM   8119  C CA  . ILE E 1 220 ? 99.816  55.181  78.258  1.00 10.20 ? 242 ILE E CA  1 
ATOM   8120  C C   . ILE E 1 220 ? 100.896 56.274  78.308  1.00 11.56 ? 242 ILE E C   1 
ATOM   8121  O O   . ILE E 1 220 ? 102.068 56.022  77.986  1.00 14.78 ? 242 ILE E O   1 
ATOM   8122  C CB  . ILE E 1 220 ? 98.810  55.399  77.100  1.00 9.78  ? 242 ILE E CB  1 
ATOM   8123  C CG1 . ILE E 1 220 ? 98.028  54.104  76.860  1.00 7.05  ? 242 ILE E CG1 1 
ATOM   8124  C CG2 . ILE E 1 220 ? 99.504  55.820  75.837  1.00 12.92 ? 242 ILE E CG2 1 
ATOM   8125  C CD1 . ILE E 1 220 ? 96.818  54.291  75.996  1.00 7.06  ? 242 ILE E CD1 1 
ATOM   8126  N N   . ALA E 1 221 ? 100.522 57.467  78.762  1.00 10.49 ? 243 ALA E N   1 
ATOM   8127  C CA  . ALA E 1 221 ? 101.461 58.592  78.849  1.00 8.49  ? 243 ALA E CA  1 
ATOM   8128  C C   . ALA E 1 221 ? 102.611 58.410  79.824  1.00 7.96  ? 243 ALA E C   1 
ATOM   8129  O O   . ALA E 1 221 ? 103.596 59.111  79.743  1.00 9.22  ? 243 ALA E O   1 
ATOM   8130  C CB  . ALA E 1 221 ? 100.722 59.850  79.196  1.00 12.71 ? 243 ALA E CB  1 
ATOM   8131  N N   . SER E 1 222 ? 102.468 57.514  80.783  1.00 9.67  ? 244 SER E N   1 
ATOM   8132  C CA  . SER E 1 222 ? 103.517 57.286  81.772  1.00 9.94  ? 244 SER E CA  1 
ATOM   8133  C C   . SER E 1 222 ? 104.364 56.053  81.520  1.00 9.42  ? 244 SER E C   1 
ATOM   8134  O O   . SER E 1 222 ? 105.428 55.913  82.116  1.00 10.22 ? 244 SER E O   1 
ATOM   8135  C CB  . SER E 1 222 ? 102.888 57.132  83.153  1.00 10.81 ? 244 SER E CB  1 
ATOM   8136  O OG  . SER E 1 222 ? 101.758 57.974  83.276  1.00 13.00 ? 244 SER E OG  1 
ATOM   8137  N N   . ASN E 1 223 ? 103.872 55.138  80.692  1.00 8.74  ? 245 ASN E N   1 
ATOM   8138  C CA  . ASN E 1 223 ? 104.592 53.902  80.419  1.00 8.86  ? 245 ASN E CA  1 
ATOM   8139  C C   . ASN E 1 223 ? 105.119 53.814  78.987  1.00 7.61  ? 245 ASN E C   1 
ATOM   8140  O O   . ASN E 1 223 ? 105.381 52.681  78.524  1.00 5.83  ? 245 ASN E O   1 
ATOM   8141  C CB  . ASN E 1 223 ? 103.707 52.697  80.765  1.00 8.54  ? 245 ASN E CB  1 
ATOM   8142  C CG  . ASN E 1 223 ? 103.356 52.636  82.252  1.00 9.86  ? 245 ASN E CG  1 
ATOM   8143  O OD1 . ASN E 1 223 ? 104.185 52.303  83.089  1.00 12.31 ? 245 ASN E OD1 1 
ATOM   8144  N ND2 . ASN E 1 223 ? 102.122 52.956  82.582  1.00 9.96  ? 245 ASN E ND2 1 
ATOM   8145  O OXT . ASN E 1 223 ? 105.306 54.889  78.366  1.00 6.68  ? 245 ASN E OXT 1 
ATOM   8146  N N   . ILE F 1 1   ? 18.397  59.859  39.199  1.00 15.20 ? 16  ILE F N   1 
ATOM   8147  C CA  . ILE F 1 1   ? 18.370  59.023  37.975  1.00 17.42 ? 16  ILE F CA  1 
ATOM   8148  C C   . ILE F 1 1   ? 18.066  59.976  36.845  1.00 21.01 ? 16  ILE F C   1 
ATOM   8149  O O   . ILE F 1 1   ? 16.957  60.486  36.754  1.00 21.54 ? 16  ILE F O   1 
ATOM   8150  C CB  . ILE F 1 1   ? 17.254  57.957  38.034  1.00 15.36 ? 16  ILE F CB  1 
ATOM   8151  C CG1 . ILE F 1 1   ? 17.563  56.911  39.114  1.00 14.42 ? 16  ILE F CG1 1 
ATOM   8152  C CG2 . ILE F 1 1   ? 17.048  57.319  36.659  1.00 15.34 ? 16  ILE F CG2 1 
ATOM   8153  C CD1 . ILE F 1 1   ? 18.640  55.915  38.761  1.00 12.71 ? 16  ILE F CD1 1 
ATOM   8154  N N   . VAL F 1 2   ? 19.071  60.261  36.027  1.00 26.47 ? 17  VAL F N   1 
ATOM   8155  C CA  . VAL F 1 2   ? 18.916  61.162  34.893  1.00 30.32 ? 17  VAL F CA  1 
ATOM   8156  C C   . VAL F 1 2   ? 18.152  60.433  33.796  1.00 32.28 ? 17  VAL F C   1 
ATOM   8157  O O   . VAL F 1 2   ? 18.552  59.355  33.361  1.00 32.21 ? 17  VAL F O   1 
ATOM   8158  C CB  . VAL F 1 2   ? 20.278  61.623  34.347  0.00 29.72 ? 17  VAL F CB  1 
ATOM   8159  C CG1 . VAL F 1 2   ? 20.080  62.534  33.147  0.00 29.94 ? 17  VAL F CG1 1 
ATOM   8160  C CG2 . VAL F 1 2   ? 21.049  62.347  35.431  0.00 29.87 ? 17  VAL F CG2 1 
ATOM   8161  N N   . GLY F 1 3   ? 17.022  61.006  33.396  1.00 33.96 ? 18  GLY F N   1 
ATOM   8162  C CA  . GLY F 1 3   ? 16.203  60.410  32.351  1.00 34.51 ? 18  GLY F CA  1 
ATOM   8163  C C   . GLY F 1 3   ? 15.532  59.109  32.751  1.00 34.39 ? 18  GLY F C   1 
ATOM   8164  O O   . GLY F 1 3   ? 15.736  58.077  32.115  1.00 33.81 ? 18  GLY F O   1 
ATOM   8165  N N   . GLY F 1 4   ? 14.713  59.160  33.795  1.00 34.42 ? 19  GLY F N   1 
ATOM   8166  C CA  . GLY F 1 4   ? 14.030  57.967  34.253  1.00 31.80 ? 19  GLY F CA  1 
ATOM   8167  C C   . GLY F 1 4   ? 12.554  58.236  34.398  1.00 30.42 ? 19  GLY F C   1 
ATOM   8168  O O   . GLY F 1 4   ? 12.073  59.313  34.021  1.00 33.87 ? 19  GLY F O   1 
ATOM   8169  N N   . TYR F 1 5   ? 11.837  57.272  34.960  1.00 26.43 ? 20  TYR F N   1 
ATOM   8170  C CA  . TYR F 1 5   ? 10.399  57.394  35.160  1.00 24.47 ? 20  TYR F CA  1 
ATOM   8171  C C   . TYR F 1 5   ? 10.106  57.165  36.626  1.00 25.79 ? 20  TYR F C   1 
ATOM   8172  O O   . TYR F 1 5   ? 10.872  56.482  37.298  1.00 29.09 ? 20  TYR F O   1 
ATOM   8173  C CB  . TYR F 1 5   ? 9.660   56.345  34.333  1.00 20.56 ? 20  TYR F CB  1 
ATOM   8174  C CG  . TYR F 1 5   ? 9.919   54.928  34.759  1.00 18.78 ? 20  TYR F CG  1 
ATOM   8175  C CD1 . TYR F 1 5   ? 9.078   54.302  35.669  1.00 19.62 ? 20  TYR F CD1 1 
ATOM   8176  C CD2 . TYR F 1 5   ? 10.976  54.190  34.212  1.00 18.85 ? 20  TYR F CD2 1 
ATOM   8177  C CE1 . TYR F 1 5   ? 9.271   52.969  36.023  1.00 22.95 ? 20  TYR F CE1 1 
ATOM   8178  C CE2 . TYR F 1 5   ? 11.184  52.852  34.556  1.00 18.27 ? 20  TYR F CE2 1 
ATOM   8179  C CZ  . TYR F 1 5   ? 10.321  52.247  35.459  1.00 21.79 ? 20  TYR F CZ  1 
ATOM   8180  O OH  . TYR F 1 5   ? 10.462  50.914  35.791  1.00 24.81 ? 20  TYR F OH  1 
ATOM   8181  N N   . THR F 1 6   ? 9.017   57.735  37.133  1.00 25.77 ? 21  THR F N   1 
ATOM   8182  C CA  . THR F 1 6   ? 8.660   57.527  38.530  1.00 23.09 ? 21  THR F CA  1 
ATOM   8183  C C   . THR F 1 6   ? 8.274   56.074  38.684  1.00 21.76 ? 21  THR F C   1 
ATOM   8184  O O   . THR F 1 6   ? 7.504   55.542  37.886  1.00 22.65 ? 21  THR F O   1 
ATOM   8185  C CB  . THR F 1 6   ? 7.472   58.345  38.934  1.00 22.96 ? 21  THR F CB  1 
ATOM   8186  O OG1 . THR F 1 6   ? 7.649   59.698  38.491  1.00 25.78 ? 21  THR F OG1 1 
ATOM   8187  C CG2 . THR F 1 6   ? 7.319   58.290  40.448  1.00 23.82 ? 21  THR F CG2 1 
ATOM   8188  N N   . CYS F 1 7   ? 8.822   55.420  39.692  1.00 20.71 ? 22  CYS F N   1 
ATOM   8189  C CA  . CYS F 1 7   ? 8.510   54.022  39.876  1.00 21.88 ? 22  CYS F CA  1 
ATOM   8190  C C   . CYS F 1 7   ? 7.061   53.907  40.317  1.00 23.64 ? 22  CYS F C   1 
ATOM   8191  O O   . CYS F 1 7   ? 6.346   53.019  39.867  1.00 26.20 ? 22  CYS F O   1 
ATOM   8192  C CB  . CYS F 1 7   ? 9.439   53.383  40.908  1.00 21.49 ? 22  CYS F CB  1 
ATOM   8193  S SG  . CYS F 1 7   ? 11.226  53.649  40.674  1.00 15.62 ? 22  CYS F SG  1 
ATOM   8194  N N   . GLY F 1 8   ? 6.636   54.817  41.190  0.00 24.79 ? 23  GLY F N   1 
ATOM   8195  C CA  . GLY F 1 8   ? 5.266   54.821  41.673  0.00 27.41 ? 23  GLY F CA  1 
ATOM   8196  C C   . GLY F 1 8   ? 4.885   53.629  42.530  0.00 30.28 ? 23  GLY F C   1 
ATOM   8197  O O   . GLY F 1 8   ? 5.573   52.607  42.533  0.00 28.79 ? 23  GLY F O   1 
ATOM   8198  N N   . ALA F 1 9   ? 3.781   53.773  43.261  0.00 34.38 ? 24  ALA F N   1 
ATOM   8199  C CA  . ALA F 1 9   ? 3.268   52.727  44.142  0.00 39.97 ? 24  ALA F CA  1 
ATOM   8200  C C   . ALA F 1 9   ? 4.391   52.098  44.968  0.00 46.26 ? 24  ALA F C   1 
ATOM   8201  O O   . ALA F 1 9   ? 4.893   52.721  45.904  0.00 46.58 ? 24  ALA F O   1 
ATOM   8202  C CB  . ALA F 1 9   ? 2.520   51.667  43.330  0.00 39.41 ? 24  ALA F CB  1 
ATOM   8203  N N   . ASN F 1 10  ? 4.799   50.885  44.602  1.00 53.46 ? 25  ASN F N   1 
ATOM   8204  C CA  . ASN F 1 10  ? 5.873   50.183  45.300  1.00 58.28 ? 25  ASN F CA  1 
ATOM   8205  C C   . ASN F 1 10  ? 6.262   48.903  44.545  1.00 54.85 ? 25  ASN F C   1 
ATOM   8206  O O   . ASN F 1 10  ? 5.671   47.827  44.724  1.00 53.94 ? 25  ASN F O   1 
ATOM   8207  C CB  . ASN F 1 10  ? 5.480   49.873  46.750  1.00 64.99 ? 25  ASN F CB  1 
ATOM   8208  C CG  . ASN F 1 10  ? 6.685   49.654  47.643  1.00 73.93 ? 25  ASN F CG  1 
ATOM   8209  O OD1 . ASN F 1 10  ? 7.830   49.838  47.216  1.00 78.11 ? 25  ASN F OD1 1 
ATOM   8210  N ND2 . ASN F 1 10  ? 6.439   49.261  48.891  1.00 78.10 ? 25  ASN F ND2 1 
ATOM   8211  N N   . THR F 1 11  ? 7.245   49.054  43.668  1.00 50.51 ? 26  THR F N   1 
ATOM   8212  C CA  . THR F 1 11  ? 7.745   47.957  42.852  1.00 44.25 ? 26  THR F CA  1 
ATOM   8213  C C   . THR F 1 11  ? 9.236   47.753  43.096  1.00 33.93 ? 26  THR F C   1 
ATOM   8214  O O   . THR F 1 11  ? 9.863   46.874  42.509  1.00 34.68 ? 26  THR F O   1 
ATOM   8215  C CB  . THR F 1 11  ? 7.470   48.242  41.360  1.00 49.52 ? 26  THR F CB  1 
ATOM   8216  O OG1 . THR F 1 11  ? 7.985   49.539  41.010  1.00 46.89 ? 26  THR F OG1 1 
ATOM   8217  C CG2 . THR F 1 11  ? 5.955   48.220  41.100  1.00 52.60 ? 26  THR F CG2 1 
ATOM   8218  N N   . VAL F 1 12  ? 9.786   48.580  43.978  1.00 23.78 ? 27  VAL F N   1 
ATOM   8219  C CA  . VAL F 1 12  ? 11.185  48.526  44.345  1.00 15.71 ? 27  VAL F CA  1 
ATOM   8220  C C   . VAL F 1 12  ? 11.206  48.524  45.870  1.00 11.91 ? 27  VAL F C   1 
ATOM   8221  O O   . VAL F 1 12  ? 11.755  49.442  46.500  1.00 12.22 ? 27  VAL F O   1 
ATOM   8222  C CB  . VAL F 1 12  ? 11.972  49.768  43.840  1.00 13.39 ? 27  VAL F CB  1 
ATOM   8223  C CG1 . VAL F 1 12  ? 13.406  49.381  43.551  1.00 11.66 ? 27  VAL F CG1 1 
ATOM   8224  C CG2 . VAL F 1 12  ? 11.321  50.384  42.607  1.00 10.84 ? 27  VAL F CG2 1 
ATOM   8225  N N   . PRO F 1 13  ? 10.675  47.451  46.477  1.00 7.10  ? 28  PRO F N   1 
ATOM   8226  C CA  . PRO F 1 13  ? 10.546  47.165  47.918  1.00 7.24  ? 28  PRO F CA  1 
ATOM   8227  C C   . PRO F 1 13  ? 11.876  47.047  48.647  1.00 8.25  ? 28  PRO F C   1 
ATOM   8228  O O   . PRO F 1 13  ? 11.989  47.332  49.835  1.00 8.46  ? 28  PRO F O   1 
ATOM   8229  C CB  . PRO F 1 13  ? 9.889   45.789  47.944  1.00 6.60  ? 28  PRO F CB  1 
ATOM   8230  C CG  . PRO F 1 13  ? 9.347   45.603  46.565  1.00 10.48 ? 28  PRO F CG  1 
ATOM   8231  C CD  . PRO F 1 13  ? 10.351  46.254  45.694  1.00 6.98  ? 28  PRO F CD  1 
ATOM   8232  N N   . TYR F 1 14  ? 12.868  46.539  47.935  1.00 8.32  ? 29  TYR F N   1 
ATOM   8233  C CA  . TYR F 1 14  ? 14.183  46.326  48.487  1.00 5.92  ? 29  TYR F CA  1 
ATOM   8234  C C   . TYR F 1 14  ? 15.002  47.595  48.520  1.00 6.89  ? 29  TYR F C   1 
ATOM   8235  O O   . TYR F 1 14  ? 16.118  47.581  49.016  1.00 9.31  ? 29  TYR F O   1 
ATOM   8236  C CB  . TYR F 1 14  ? 14.894  45.262  47.665  1.00 5.00  ? 29  TYR F CB  1 
ATOM   8237  C CG  . TYR F 1 14  ? 14.886  45.571  46.187  1.00 9.04  ? 29  TYR F CG  1 
ATOM   8238  C CD1 . TYR F 1 14  ? 15.788  46.481  45.647  1.00 12.85 ? 29  TYR F CD1 1 
ATOM   8239  C CD2 . TYR F 1 14  ? 13.949  45.001  45.336  1.00 11.33 ? 29  TYR F CD2 1 
ATOM   8240  C CE1 . TYR F 1 14  ? 15.758  46.824  44.303  1.00 14.74 ? 29  TYR F CE1 1 
ATOM   8241  C CE2 . TYR F 1 14  ? 13.910  45.339  43.979  1.00 13.91 ? 29  TYR F CE2 1 
ATOM   8242  C CZ  . TYR F 1 14  ? 14.818  46.257  43.472  1.00 14.64 ? 29  TYR F CZ  1 
ATOM   8243  O OH  . TYR F 1 14  ? 14.775  46.644  42.145  1.00 17.33 ? 29  TYR F OH  1 
ATOM   8244  N N   . GLN F 1 15  ? 14.475  48.683  47.969  1.00 5.00  ? 30  GLN F N   1 
ATOM   8245  C CA  . GLN F 1 15  ? 15.204  49.944  47.956  1.00 5.00  ? 30  GLN F CA  1 
ATOM   8246  C C   . GLN F 1 15  ? 15.229  50.563  49.344  1.00 6.40  ? 30  GLN F C   1 
ATOM   8247  O O   . GLN F 1 15  ? 14.293  50.376  50.105  1.00 10.41 ? 30  GLN F O   1 
ATOM   8248  C CB  . GLN F 1 15  ? 14.517  50.915  47.005  1.00 5.00  ? 30  GLN F CB  1 
ATOM   8249  C CG  . GLN F 1 15  ? 15.153  52.299  46.974  1.00 5.78  ? 30  GLN F CG  1 
ATOM   8250  C CD  . GLN F 1 15  ? 16.300  52.425  45.991  1.00 5.08  ? 30  GLN F CD  1 
ATOM   8251  O OE1 . GLN F 1 15  ? 17.234  53.170  46.231  1.00 9.64  ? 30  GLN F OE1 1 
ATOM   8252  N NE2 . GLN F 1 15  ? 16.213  51.741  44.865  1.00 5.00  ? 30  GLN F NE2 1 
ATOM   8253  N N   . VAL F 1 16  ? 16.309  51.243  49.708  1.00 5.70  ? 31  VAL F N   1 
ATOM   8254  C CA  . VAL F 1 16  ? 16.382  51.930  51.001  1.00 7.41  ? 31  VAL F CA  1 
ATOM   8255  C C   . VAL F 1 16  ? 17.214  53.189  50.813  1.00 9.66  ? 31  VAL F C   1 
ATOM   8256  O O   . VAL F 1 16  ? 18.037  53.262  49.899  1.00 10.21 ? 31  VAL F O   1 
ATOM   8257  C CB  . VAL F 1 16  ? 17.007  51.096  52.148  1.00 5.00  ? 31  VAL F CB  1 
ATOM   8258  C CG1 . VAL F 1 16  ? 16.502  49.687  52.134  1.00 5.00  ? 31  VAL F CG1 1 
ATOM   8259  C CG2 . VAL F 1 16  ? 18.512  51.145  52.093  1.00 10.21 ? 31  VAL F CG2 1 
ATOM   8260  N N   . SER F 1 17  ? 16.963  54.188  51.653  1.00 11.68 ? 32  SER F N   1 
ATOM   8261  C CA  . SER F 1 17  ? 17.674  55.471  51.608  1.00 9.77  ? 32  SER F CA  1 
ATOM   8262  C C   . SER F 1 17  ? 18.644  55.571  52.778  1.00 9.30  ? 32  SER F C   1 
ATOM   8263  O O   . SER F 1 17  ? 18.283  55.232  53.899  1.00 12.91 ? 32  SER F O   1 
ATOM   8264  C CB  . SER F 1 17  ? 16.666  56.622  51.680  1.00 6.89  ? 32  SER F CB  1 
ATOM   8265  O OG  . SER F 1 17  ? 17.303  57.838  52.033  1.00 5.00  ? 32  SER F OG  1 
ATOM   8266  N N   . LEU F 1 18  ? 19.872  56.007  52.532  1.00 6.05  ? 33  LEU F N   1 
ATOM   8267  C CA  . LEU F 1 18  ? 20.832  56.135  53.616  1.00 5.00  ? 33  LEU F CA  1 
ATOM   8268  C C   . LEU F 1 18  ? 20.824  57.584  53.982  1.00 5.00  ? 33  LEU F C   1 
ATOM   8269  O O   . LEU F 1 18  ? 21.070  58.441  53.148  1.00 8.31  ? 33  LEU F O   1 
ATOM   8270  C CB  . LEU F 1 18  ? 22.222  55.684  53.192  1.00 6.22  ? 33  LEU F CB  1 
ATOM   8271  C CG  . LEU F 1 18  ? 22.385  54.193  52.844  1.00 6.94  ? 33  LEU F CG  1 
ATOM   8272  C CD1 . LEU F 1 18  ? 23.857  53.811  52.843  1.00 5.66  ? 33  LEU F CD1 1 
ATOM   8273  C CD2 . LEU F 1 18  ? 21.654  53.341  53.846  1.00 6.83  ? 33  LEU F CD2 1 
ATOM   8274  N N   . ASN F 1 19  ? 20.482  57.859  55.222  1.00 6.61  ? 34  ASN F N   1 
ATOM   8275  C CA  . ASN F 1 19  ? 20.377  59.218  55.691  1.00 12.16 ? 34  ASN F CA  1 
ATOM   8276  C C   . ASN F 1 19  ? 21.435  59.513  56.740  1.00 11.06 ? 34  ASN F C   1 
ATOM   8277  O O   . ASN F 1 19  ? 21.803  58.639  57.515  1.00 9.40  ? 34  ASN F O   1 
ATOM   8278  C CB  . ASN F 1 19  ? 18.946  59.432  56.257  1.00 18.58 ? 34  ASN F CB  1 
ATOM   8279  C CG  . ASN F 1 19  ? 18.767  60.776  56.998  1.00 24.12 ? 34  ASN F CG  1 
ATOM   8280  O OD1 . ASN F 1 19  ? 19.358  61.011  58.056  1.00 27.77 ? 34  ASN F OD1 1 
ATOM   8281  N ND2 . ASN F 1 19  ? 17.908  61.632  56.465  1.00 25.54 ? 34  ASN F ND2 1 
ATOM   8282  N N   . SER F 1 20  ? 21.951  60.736  56.708  1.00 11.37 ? 37  SER F N   1 
ATOM   8283  C CA  . SER F 1 20  ? 22.923  61.225  57.674  1.00 12.06 ? 37  SER F CA  1 
ATOM   8284  C C   . SER F 1 20  ? 22.524  62.683  57.806  1.00 11.33 ? 37  SER F C   1 
ATOM   8285  O O   . SER F 1 20  ? 23.271  63.577  57.414  1.00 11.42 ? 37  SER F O   1 
ATOM   8286  C CB  . SER F 1 20  ? 24.327  61.131  57.108  1.00 14.69 ? 37  SER F CB  1 
ATOM   8287  O OG  . SER F 1 20  ? 24.404  61.867  55.892  1.00 21.35 ? 37  SER F OG  1 
ATOM   8288  N N   . GLY F 1 21  ? 21.313  62.908  58.304  1.00 10.45 ? 38  GLY F N   1 
ATOM   8289  C CA  . GLY F 1 21  ? 20.795  64.251  58.439  1.00 9.60  ? 38  GLY F CA  1 
ATOM   8290  C C   . GLY F 1 21  ? 19.987  64.531  57.189  1.00 10.14 ? 38  GLY F C   1 
ATOM   8291  O O   . GLY F 1 21  ? 18.975  65.213  57.258  1.00 14.68 ? 38  GLY F O   1 
ATOM   8292  N N   . TYR F 1 22  ? 20.428  63.985  56.057  1.00 8.09  ? 39  TYR F N   1 
ATOM   8293  C CA  . TYR F 1 22  ? 19.752  64.148  54.771  1.00 9.14  ? 39  TYR F CA  1 
ATOM   8294  C C   . TYR F 1 22  ? 20.090  62.927  53.928  1.00 9.96  ? 39  TYR F C   1 
ATOM   8295  O O   . TYR F 1 22  ? 20.995  62.163  54.284  1.00 11.13 ? 39  TYR F O   1 
ATOM   8296  C CB  . TYR F 1 22  ? 20.237  65.416  54.053  1.00 13.29 ? 39  TYR F CB  1 
ATOM   8297  C CG  . TYR F 1 22  ? 21.720  65.440  53.826  1.00 15.31 ? 39  TYR F CG  1 
ATOM   8298  C CD1 . TYR F 1 22  ? 22.569  65.949  54.799  1.00 18.84 ? 39  TYR F CD1 1 
ATOM   8299  C CD2 . TYR F 1 22  ? 22.276  64.877  52.689  1.00 16.40 ? 39  TYR F CD2 1 
ATOM   8300  C CE1 . TYR F 1 22  ? 23.927  65.890  54.662  1.00 23.74 ? 39  TYR F CE1 1 
ATOM   8301  C CE2 . TYR F 1 22  ? 23.628  64.808  52.535  1.00 22.63 ? 39  TYR F CE2 1 
ATOM   8302  C CZ  . TYR F 1 22  ? 24.462  65.317  53.534  1.00 28.13 ? 39  TYR F CZ  1 
ATOM   8303  O OH  . TYR F 1 22  ? 25.842  65.238  53.422  1.00 37.42 ? 39  TYR F OH  1 
ATOM   8304  N N   . HIS F 1 23  ? 19.366  62.734  52.827  1.00 8.68  ? 40  HIS F N   1 
ATOM   8305  C CA  . HIS F 1 23  ? 19.621  61.599  51.943  1.00 8.66  ? 40  HIS F CA  1 
ATOM   8306  C C   . HIS F 1 23  ? 20.928  61.841  51.217  1.00 8.36  ? 40  HIS F C   1 
ATOM   8307  O O   . HIS F 1 23  ? 21.156  62.937  50.694  1.00 8.49  ? 40  HIS F O   1 
ATOM   8308  C CB  . HIS F 1 23  ? 18.503  61.451  50.907  1.00 11.46 ? 40  HIS F CB  1 
ATOM   8309  C CG  . HIS F 1 23  ? 18.799  60.465  49.814  1.00 10.77 ? 40  HIS F CG  1 
ATOM   8310  N ND1 . HIS F 1 23  ? 18.402  59.148  49.875  1.00 11.15 ? 40  HIS F ND1 1 
ATOM   8311  C CD2 . HIS F 1 23  ? 19.434  60.608  48.626  1.00 10.14 ? 40  HIS F CD2 1 
ATOM   8312  C CE1 . HIS F 1 23  ? 18.776  58.521  48.775  1.00 11.89 ? 40  HIS F CE1 1 
ATOM   8313  N NE2 . HIS F 1 23  ? 19.407  59.385  48.001  1.00 11.15 ? 40  HIS F NE2 1 
ATOM   8314  N N   . PHE F 1 24  ? 21.778  60.820  51.185  1.00 7.24  ? 41  PHE F N   1 
ATOM   8315  C CA  . PHE F 1 24  ? 23.055  60.934  50.496  1.00 9.19  ? 41  PHE F CA  1 
ATOM   8316  C C   . PHE F 1 24  ? 23.404  59.694  49.669  1.00 9.06  ? 41  PHE F C   1 
ATOM   8317  O O   . PHE F 1 24  ? 24.325  59.723  48.851  1.00 10.16 ? 41  PHE F O   1 
ATOM   8318  C CB  . PHE F 1 24  ? 24.192  61.284  51.480  1.00 9.90  ? 41  PHE F CB  1 
ATOM   8319  C CG  . PHE F 1 24  ? 24.558  60.174  52.418  1.00 8.81  ? 41  PHE F CG  1 
ATOM   8320  C CD1 . PHE F 1 24  ? 25.690  59.398  52.180  1.00 5.66  ? 41  PHE F CD1 1 
ATOM   8321  C CD2 . PHE F 1 24  ? 23.762  59.900  53.535  1.00 11.31 ? 41  PHE F CD2 1 
ATOM   8322  C CE1 . PHE F 1 24  ? 26.037  58.357  53.032  1.00 6.79  ? 41  PHE F CE1 1 
ATOM   8323  C CE2 . PHE F 1 24  ? 24.094  58.857  54.405  1.00 13.29 ? 41  PHE F CE2 1 
ATOM   8324  C CZ  . PHE F 1 24  ? 25.242  58.078  54.152  1.00 10.01 ? 41  PHE F CZ  1 
ATOM   8325  N N   . CYS F 1 25  ? 22.636  58.627  49.845  1.00 7.86  ? 42  CYS F N   1 
ATOM   8326  C CA  . CYS F 1 25  ? 22.873  57.387  49.115  1.00 7.27  ? 42  CYS F CA  1 
ATOM   8327  C C   . CYS F 1 25  ? 21.661  56.459  49.200  1.00 5.00  ? 42  CYS F C   1 
ATOM   8328  O O   . CYS F 1 25  ? 20.677  56.747  49.882  1.00 5.00  ? 42  CYS F O   1 
ATOM   8329  C CB  . CYS F 1 25  ? 24.095  56.654  49.703  1.00 8.02  ? 42  CYS F CB  1 
ATOM   8330  S SG  . CYS F 1 25  ? 25.760  57.327  49.349  1.00 7.59  ? 42  CYS F SG  1 
ATOM   8331  N N   . GLY F 1 26  ? 21.734  55.365  48.468  1.00 5.00  ? 43  GLY F N   1 
ATOM   8332  C CA  . GLY F 1 26  ? 20.692  54.371  48.488  1.00 5.00  ? 43  GLY F CA  1 
ATOM   8333  C C   . GLY F 1 26  ? 21.362  53.108  49.009  1.00 7.21  ? 43  GLY F C   1 
ATOM   8334  O O   . GLY F 1 26  ? 22.488  53.157  49.514  1.00 6.95  ? 43  GLY F O   1 
ATOM   8335  N N   . GLY F 1 27  ? 20.676  51.977  48.896  1.00 8.45  ? 44  GLY F N   1 
ATOM   8336  C CA  . GLY F 1 27  ? 21.217  50.703  49.339  1.00 6.75  ? 44  GLY F CA  1 
ATOM   8337  C C   . GLY F 1 27  ? 20.153  49.660  49.076  1.00 6.40  ? 44  GLY F C   1 
ATOM   8338  O O   . GLY F 1 27  ? 19.005  50.013  48.839  1.00 9.87  ? 44  GLY F O   1 
ATOM   8339  N N   . SER F 1 28  ? 20.509  48.388  49.074  1.00 5.49  ? 45  SER F N   1 
ATOM   8340  C CA  . SER F 1 28  ? 19.519  47.350  48.849  1.00 5.00  ? 45  SER F CA  1 
ATOM   8341  C C   . SER F 1 28  ? 19.405  46.456  50.065  1.00 5.22  ? 45  SER F C   1 
ATOM   8342  O O   . SER F 1 28  ? 20.390  46.195  50.759  1.00 5.00  ? 45  SER F O   1 
ATOM   8343  C CB  . SER F 1 28  ? 19.863  46.530  47.626  1.00 5.00  ? 45  SER F CB  1 
ATOM   8344  O OG  . SER F 1 28  ? 19.964  47.376  46.510  1.00 5.00  ? 45  SER F OG  1 
ATOM   8345  N N   . LEU F 1 29  ? 18.180  46.032  50.353  1.00 6.31  ? 46  LEU F N   1 
ATOM   8346  C CA  . LEU F 1 29  ? 17.912  45.173  51.495  1.00 5.84  ? 46  LEU F CA  1 
ATOM   8347  C C   . LEU F 1 29  ? 18.158  43.743  51.071  1.00 5.00  ? 46  LEU F C   1 
ATOM   8348  O O   . LEU F 1 29  ? 17.475  43.234  50.195  1.00 5.00  ? 46  LEU F O   1 
ATOM   8349  C CB  . LEU F 1 29  ? 16.475  45.373  51.968  1.00 5.31  ? 46  LEU F CB  1 
ATOM   8350  C CG  . LEU F 1 29  ? 16.029  44.750  53.290  1.00 7.38  ? 46  LEU F CG  1 
ATOM   8351  C CD1 . LEU F 1 29  ? 16.968  45.077  54.442  1.00 6.84  ? 46  LEU F CD1 1 
ATOM   8352  C CD2 . LEU F 1 29  ? 14.654  45.289  53.577  1.00 7.93  ? 46  LEU F CD2 1 
ATOM   8353  N N   . ILE F 1 30  ? 19.169  43.120  51.666  1.00 6.23  ? 47  ILE F N   1 
ATOM   8354  C CA  . ILE F 1 30  ? 19.544  41.755  51.322  1.00 10.94 ? 47  ILE F CA  1 
ATOM   8355  C C   . ILE F 1 30  ? 18.770  40.731  52.146  1.00 9.74  ? 47  ILE F C   1 
ATOM   8356  O O   . ILE F 1 30  ? 18.643  39.542  51.755  1.00 7.96  ? 47  ILE F O   1 
ATOM   8357  C CB  . ILE F 1 30  ? 21.078  41.556  51.445  1.00 14.37 ? 47  ILE F CB  1 
ATOM   8358  C CG1 . ILE F 1 30  ? 21.784  42.224  50.272  1.00 13.47 ? 47  ILE F CG1 1 
ATOM   8359  C CG2 . ILE F 1 30  ? 21.445  40.081  51.442  1.00 19.96 ? 47  ILE F CG2 1 
ATOM   8360  C CD1 . ILE F 1 30  ? 23.231  41.936  50.259  1.00 15.38 ? 47  ILE F CD1 1 
ATOM   8361  N N   . ASN F 1 31  ? 18.274  41.204  53.288  1.00 7.33  ? 48  ASN F N   1 
ATOM   8362  C CA  . ASN F 1 31  ? 17.461  40.403  54.193  1.00 7.14  ? 48  ASN F CA  1 
ATOM   8363  C C   . ASN F 1 31  ? 17.190  41.255  55.416  1.00 5.86  ? 48  ASN F C   1 
ATOM   8364  O O   . ASN F 1 31  ? 17.948  42.161  55.692  1.00 7.99  ? 48  ASN F O   1 
ATOM   8365  C CB  . ASN F 1 31  ? 18.163  39.096  54.578  1.00 8.99  ? 48  ASN F CB  1 
ATOM   8366  C CG  . ASN F 1 31  ? 19.310  39.309  55.539  1.00 12.23 ? 48  ASN F CG  1 
ATOM   8367  O OD1 . ASN F 1 31  ? 20.426  39.626  55.136  1.00 16.74 ? 48  ASN F OD1 1 
ATOM   8368  N ND2 . ASN F 1 31  ? 19.034  39.161  56.823  1.00 15.10 ? 48  ASN F ND2 1 
ATOM   8369  N N   . SER F 1 32  ? 16.132  40.936  56.146  1.00 5.00  ? 49  SER F N   1 
ATOM   8370  C CA  . SER F 1 32  ? 15.709  41.642  57.347  1.00 5.00  ? 49  SER F CA  1 
ATOM   8371  C C   . SER F 1 32  ? 16.709  42.543  58.027  1.00 6.14  ? 49  SER F C   1 
ATOM   8372  O O   . SER F 1 32  ? 16.456  43.720  58.220  1.00 5.83  ? 49  SER F O   1 
ATOM   8373  C CB  . SER F 1 32  ? 15.237  40.630  58.359  1.00 5.67  ? 49  SER F CB  1 
ATOM   8374  O OG  . SER F 1 32  ? 16.195  39.597  58.452  1.00 8.35  ? 49  SER F OG  1 
ATOM   8375  N N   . GLN F 1 33  ? 17.850  41.982  58.413  1.00 10.55 ? 50  GLN F N   1 
ATOM   8376  C CA  . GLN F 1 33  ? 18.891  42.760  59.099  1.00 10.78 ? 50  GLN F CA  1 
ATOM   8377  C C   . GLN F 1 33  ? 20.073  43.371  58.325  1.00 9.93  ? 50  GLN F C   1 
ATOM   8378  O O   . GLN F 1 33  ? 20.776  44.202  58.891  1.00 11.95 ? 50  GLN F O   1 
ATOM   8379  C CB  . GLN F 1 33  ? 19.432  41.982  60.297  1.00 8.61  ? 50  GLN F CB  1 
ATOM   8380  C CG  . GLN F 1 33  ? 19.145  42.657  61.627  1.00 7.32  ? 50  GLN F CG  1 
ATOM   8381  C CD  . GLN F 1 33  ? 19.560  41.806  62.809  1.00 8.18  ? 50  GLN F CD  1 
ATOM   8382  O OE1 . GLN F 1 33  ? 19.948  42.335  63.851  1.00 6.84  ? 50  GLN F OE1 1 
ATOM   8383  N NE2 . GLN F 1 33  ? 19.467  40.475  62.665  1.00 8.11  ? 50  GLN F NE2 1 
ATOM   8384  N N   . TRP F 1 34  ? 20.307  42.995  57.070  1.00 6.64  ? 51  TRP F N   1 
ATOM   8385  C CA  . TRP F 1 34  ? 21.431  43.583  56.349  1.00 7.69  ? 51  TRP F CA  1 
ATOM   8386  C C   . TRP F 1 34  ? 21.092  44.394  55.105  1.00 8.46  ? 51  TRP F C   1 
ATOM   8387  O O   . TRP F 1 34  ? 20.165  44.067  54.369  1.00 8.36  ? 51  TRP F O   1 
ATOM   8388  C CB  . TRP F 1 34  ? 22.465  42.520  56.014  1.00 5.61  ? 51  TRP F CB  1 
ATOM   8389  C CG  . TRP F 1 34  ? 23.177  42.001  57.212  1.00 6.37  ? 51  TRP F CG  1 
ATOM   8390  C CD1 . TRP F 1 34  ? 22.766  40.986  58.040  1.00 8.35  ? 51  TRP F CD1 1 
ATOM   8391  C CD2 . TRP F 1 34  ? 24.468  42.401  57.677  1.00 5.00  ? 51  TRP F CD2 1 
ATOM   8392  N NE1 . TRP F 1 34  ? 23.739  40.724  58.979  1.00 9.09  ? 51  TRP F NE1 1 
ATOM   8393  C CE2 . TRP F 1 34  ? 24.791  41.580  58.778  1.00 7.40  ? 51  TRP F CE2 1 
ATOM   8394  C CE3 . TRP F 1 34  ? 25.388  43.364  57.266  1.00 6.50  ? 51  TRP F CE3 1 
ATOM   8395  C CZ2 . TRP F 1 34  ? 25.999  41.698  59.469  1.00 7.89  ? 51  TRP F CZ2 1 
ATOM   8396  C CZ3 . TRP F 1 34  ? 26.597  43.482  57.955  1.00 6.90  ? 51  TRP F CZ3 1 
ATOM   8397  C CH2 . TRP F 1 34  ? 26.887  42.652  59.041  1.00 8.58  ? 51  TRP F CH2 1 
ATOM   8398  N N   . VAL F 1 35  ? 21.893  45.425  54.855  1.00 8.87  ? 52  VAL F N   1 
ATOM   8399  C CA  . VAL F 1 35  ? 21.730  46.313  53.698  1.00 9.22  ? 52  VAL F CA  1 
ATOM   8400  C C   . VAL F 1 35  ? 23.071  46.459  52.941  1.00 9.33  ? 52  VAL F C   1 
ATOM   8401  O O   . VAL F 1 35  ? 24.055  46.936  53.508  1.00 9.12  ? 52  VAL F O   1 
ATOM   8402  C CB  . VAL F 1 35  ? 21.335  47.726  54.157  1.00 10.19 ? 52  VAL F CB  1 
ATOM   8403  C CG1 . VAL F 1 35  ? 21.178  48.652  52.977  1.00 6.94  ? 52  VAL F CG1 1 
ATOM   8404  C CG2 . VAL F 1 35  ? 20.084  47.673  54.967  1.00 12.13 ? 52  VAL F CG2 1 
ATOM   8405  N N   . VAL F 1 36  ? 23.095  46.112  51.658  1.00 7.27  ? 53  VAL F N   1 
ATOM   8406  C CA  . VAL F 1 36  ? 24.310  46.213  50.855  1.00 5.00  ? 53  VAL F CA  1 
ATOM   8407  C C   . VAL F 1 36  ? 24.364  47.573  50.175  1.00 5.00  ? 53  VAL F C   1 
ATOM   8408  O O   . VAL F 1 36  ? 23.351  48.087  49.728  1.00 5.00  ? 53  VAL F O   1 
ATOM   8409  C CB  . VAL F 1 36  ? 24.375  45.092  49.789  1.00 5.77  ? 53  VAL F CB  1 
ATOM   8410  C CG1 . VAL F 1 36  ? 23.327  45.298  48.723  1.00 7.81  ? 53  VAL F CG1 1 
ATOM   8411  C CG2 . VAL F 1 36  ? 25.737  45.033  49.158  1.00 9.32  ? 53  VAL F CG2 1 
ATOM   8412  N N   . SER F 1 37  ? 25.547  48.157  50.094  1.00 7.78  ? 54  SER F N   1 
ATOM   8413  C CA  . SER F 1 37  ? 25.679  49.461  49.476  1.00 10.40 ? 54  SER F CA  1 
ATOM   8414  C C   . SER F 1 37  ? 27.087  49.741  48.980  1.00 12.38 ? 54  SER F C   1 
ATOM   8415  O O   . SER F 1 37  ? 27.958  48.867  49.038  1.00 11.66 ? 54  SER F O   1 
ATOM   8416  C CB  . SER F 1 37  ? 25.256  50.554  50.454  1.00 9.56  ? 54  SER F CB  1 
ATOM   8417  O OG  . SER F 1 37  ? 25.100  51.789  49.770  1.00 13.17 ? 54  SER F OG  1 
ATOM   8418  N N   . ALA F 1 38  ? 27.279  50.949  48.439  1.00 11.85 ? 55  ALA F N   1 
ATOM   8419  C CA  . ALA F 1 38  ? 28.564  51.397  47.926  1.00 9.69  ? 55  ALA F CA  1 
ATOM   8420  C C   . ALA F 1 38  ? 29.434  51.780  49.124  1.00 10.53 ? 55  ALA F C   1 
ATOM   8421  O O   . ALA F 1 38  ? 28.995  52.561  49.976  1.00 14.37 ? 55  ALA F O   1 
ATOM   8422  C CB  . ALA F 1 38  ? 28.372  52.601  47.010  0.00 10.10 ? 55  ALA F CB  1 
ATOM   8423  N N   . ALA F 1 39  ? 30.648  51.222  49.201  1.00 8.05  ? 56  ALA F N   1 
ATOM   8424  C CA  . ALA F 1 39  ? 31.589  51.525  50.287  1.00 6.68  ? 56  ALA F CA  1 
ATOM   8425  C C   . ALA F 1 39  ? 31.966  53.001  50.380  1.00 7.17  ? 56  ALA F C   1 
ATOM   8426  O O   . ALA F 1 39  ? 32.472  53.436  51.409  1.00 6.42  ? 56  ALA F O   1 
ATOM   8427  C CB  . ALA F 1 39  ? 32.826  50.718  50.146  1.00 9.93  ? 56  ALA F CB  1 
ATOM   8428  N N   . HIS F 1 40  ? 31.820  53.750  49.286  1.00 7.11  ? 57  HIS F N   1 
ATOM   8429  C CA  . HIS F 1 40  ? 32.112  55.169  49.342  1.00 5.68  ? 57  HIS F CA  1 
ATOM   8430  C C   . HIS F 1 40  ? 30.948  55.932  49.967  1.00 6.22  ? 57  HIS F C   1 
ATOM   8431  O O   . HIS F 1 40  ? 31.044  57.146  50.159  1.00 7.52  ? 57  HIS F O   1 
ATOM   8432  C CB  . HIS F 1 40  ? 32.539  55.741  47.979  1.00 8.92  ? 57  HIS F CB  1 
ATOM   8433  C CG  . HIS F 1 40  ? 31.426  55.936  46.993  1.00 12.64 ? 57  HIS F CG  1 
ATOM   8434  N ND1 . HIS F 1 40  ? 31.130  55.015  46.005  1.00 17.62 ? 57  HIS F ND1 1 
ATOM   8435  C CD2 . HIS F 1 40  ? 30.570  56.971  46.809  1.00 13.33 ? 57  HIS F CD2 1 
ATOM   8436  C CE1 . HIS F 1 40  ? 30.134  55.471  45.262  1.00 17.40 ? 57  HIS F CE1 1 
ATOM   8437  N NE2 . HIS F 1 40  ? 29.777  56.656  45.730  1.00 16.88 ? 57  HIS F NE2 1 
ATOM   8438  N N   . CYS F 1 41  ? 29.858  55.212  50.284  1.00 6.80  ? 58  CYS F N   1 
ATOM   8439  C CA  . CYS F 1 41  ? 28.667  55.774  50.946  1.00 5.63  ? 58  CYS F CA  1 
ATOM   8440  C C   . CYS F 1 41  ? 28.806  55.660  52.453  1.00 7.16  ? 58  CYS F C   1 
ATOM   8441  O O   . CYS F 1 41  ? 27.936  56.108  53.197  1.00 10.01 ? 58  CYS F O   1 
ATOM   8442  C CB  . CYS F 1 41  ? 27.393  55.068  50.520  1.00 5.05  ? 58  CYS F CB  1 
ATOM   8443  S SG  . CYS F 1 41  ? 26.808  55.648  48.917  1.00 11.54 ? 58  CYS F SG  1 
ATOM   8444  N N   . TYR F 1 42  ? 29.871  55.003  52.899  1.00 6.72  ? 59  TYR F N   1 
ATOM   8445  C CA  . TYR F 1 42  ? 30.145  54.877  54.314  1.00 6.89  ? 59  TYR F CA  1 
ATOM   8446  C C   . TYR F 1 42  ? 30.198  56.263  54.941  1.00 10.46 ? 59  TYR F C   1 
ATOM   8447  O O   . TYR F 1 42  ? 30.778  57.197  54.376  1.00 11.60 ? 59  TYR F O   1 
ATOM   8448  C CB  . TYR F 1 42  ? 31.496  54.211  54.557  1.00 5.00  ? 59  TYR F CB  1 
ATOM   8449  C CG  . TYR F 1 42  ? 31.867  54.156  56.019  1.00 5.00  ? 59  TYR F CG  1 
ATOM   8450  C CD1 . TYR F 1 42  ? 32.455  55.237  56.639  1.00 9.53  ? 59  TYR F CD1 1 
ATOM   8451  C CD2 . TYR F 1 42  ? 31.563  53.055  56.795  1.00 5.00  ? 59  TYR F CD2 1 
ATOM   8452  C CE1 . TYR F 1 42  ? 32.721  55.234  57.991  1.00 11.77 ? 59  TYR F CE1 1 
ATOM   8453  C CE2 . TYR F 1 42  ? 31.830  53.039  58.151  1.00 7.03  ? 59  TYR F CE2 1 
ATOM   8454  C CZ  . TYR F 1 42  ? 32.407  54.139  58.741  1.00 9.62  ? 59  TYR F CZ  1 
ATOM   8455  O OH  . TYR F 1 42  ? 32.673  54.163  60.087  1.00 13.85 ? 59  TYR F OH  1 
ATOM   8456  N N   . LYS F 1 43  ? 29.613  56.363  56.129  1.00 11.69 ? 60  LYS F N   1 
ATOM   8457  C CA  . LYS F 1 43  ? 29.582  57.587  56.918  1.00 14.79 ? 60  LYS F CA  1 
ATOM   8458  C C   . LYS F 1 43  ? 29.446  57.118  58.355  1.00 18.20 ? 60  LYS F C   1 
ATOM   8459  O O   . LYS F 1 43  ? 28.997  55.996  58.604  1.00 17.90 ? 60  LYS F O   1 
ATOM   8460  C CB  . LYS F 1 43  ? 28.384  58.464  56.557  1.00 13.01 ? 60  LYS F CB  1 
ATOM   8461  C CG  . LYS F 1 43  ? 28.612  59.478  55.459  1.00 11.35 ? 60  LYS F CG  1 
ATOM   8462  C CD  . LYS F 1 43  ? 27.426  60.431  55.411  1.00 9.85  ? 60  LYS F CD  1 
ATOM   8463  C CE  . LYS F 1 43  ? 27.614  61.581  54.438  1.00 11.02 ? 60  LYS F CE  1 
ATOM   8464  N NZ  . LYS F 1 43  ? 28.803  62.416  54.772  0.00 9.91  ? 60  LYS F NZ  1 
ATOM   8465  N N   . SER F 1 44  ? 29.860  57.950  59.300  1.00 22.23 ? 61  SER F N   1 
ATOM   8466  C CA  . SER F 1 44  ? 29.757  57.577  60.698  1.00 26.16 ? 61  SER F CA  1 
ATOM   8467  C C   . SER F 1 44  ? 28.294  57.680  61.089  1.00 29.56 ? 61  SER F C   1 
ATOM   8468  O O   . SER F 1 44  ? 27.647  58.689  60.801  1.00 30.09 ? 61  SER F O   1 
ATOM   8469  C CB  . SER F 1 44  ? 30.616  58.495  61.576  1.00 24.31 ? 61  SER F CB  1 
ATOM   8470  O OG  . SER F 1 44  ? 30.552  59.849  61.163  0.00 24.33 ? 61  SER F OG  1 
ATOM   8471  N N   . GLY F 1 45  ? 27.751  56.611  61.666  1.00 30.95 ? 62  GLY F N   1 
ATOM   8472  C CA  . GLY F 1 45  ? 26.359  56.640  62.093  1.00 31.19 ? 62  GLY F CA  1 
ATOM   8473  C C   . GLY F 1 45  ? 25.339  56.994  61.020  1.00 28.26 ? 62  GLY F C   1 
ATOM   8474  O O   . GLY F 1 45  ? 24.821  58.113  60.979  1.00 28.54 ? 62  GLY F O   1 
ATOM   8475  N N   . ILE F 1 46  ? 25.071  56.032  60.145  1.00 25.79 ? 63  ILE F N   1 
ATOM   8476  C CA  . ILE F 1 46  ? 24.110  56.188  59.065  1.00 21.20 ? 63  ILE F CA  1 
ATOM   8477  C C   . ILE F 1 46  ? 22.769  55.695  59.605  1.00 19.24 ? 63  ILE F C   1 
ATOM   8478  O O   . ILE F 1 46  ? 22.726  54.872  60.526  1.00 19.53 ? 63  ILE F O   1 
ATOM   8479  C CB  . ILE F 1 46  ? 24.525  55.302  57.860  1.00 21.21 ? 63  ILE F CB  1 
ATOM   8480  C CG1 . ILE F 1 46  ? 25.945  55.661  57.421  1.00 24.27 ? 63  ILE F CG1 1 
ATOM   8481  C CG2 . ILE F 1 46  ? 23.533  55.430  56.708  1.00 18.44 ? 63  ILE F CG2 1 
ATOM   8482  C CD1 . ILE F 1 46  ? 26.466  54.835  56.243  1.00 26.37 ? 63  ILE F CD1 1 
ATOM   8483  N N   . GLN F 1 47  ? 21.679  56.230  59.073  1.00 17.98 ? 64  GLN F N   1 
ATOM   8484  C CA  . GLN F 1 47  ? 20.349  55.799  59.476  1.00 16.40 ? 64  GLN F CA  1 
ATOM   8485  C C   . GLN F 1 47  ? 19.660  55.390  58.195  1.00 14.71 ? 64  GLN F C   1 
ATOM   8486  O O   . GLN F 1 47  ? 19.597  56.176  57.249  1.00 14.24 ? 64  GLN F O   1 
ATOM   8487  C CB  . GLN F 1 47  ? 19.570  56.939  60.137  1.00 20.76 ? 64  GLN F CB  1 
ATOM   8488  C CG  . GLN F 1 47  ? 20.234  57.506  61.390  1.00 22.29 ? 64  GLN F CG  1 
ATOM   8489  C CD  . GLN F 1 47  ? 19.405  58.566  62.095  1.00 19.08 ? 64  GLN F CD  1 
ATOM   8490  O OE1 . GLN F 1 47  ? 18.952  58.358  63.202  1.00 15.95 ? 64  GLN F OE1 1 
ATOM   8491  N NE2 . GLN F 1 47  ? 19.229  59.708  61.464  1.00 20.52 ? 64  GLN F NE2 1 
ATOM   8492  N N   . VAL F 1 48  ? 19.169  54.155  58.165  1.00 14.03 ? 65  VAL F N   1 
ATOM   8493  C CA  . VAL F 1 48  ? 18.473  53.588  57.003  1.00 12.13 ? 65  VAL F CA  1 
ATOM   8494  C C   . VAL F 1 48  ? 16.932  53.857  56.976  1.00 14.79 ? 65  VAL F C   1 
ATOM   8495  O O   . VAL F 1 48  ? 16.242  53.607  57.960  1.00 17.02 ? 65  VAL F O   1 
ATOM   8496  C CB  . VAL F 1 48  ? 18.721  52.066  56.965  1.00 5.00  ? 65  VAL F CB  1 
ATOM   8497  C CG1 . VAL F 1 48  ? 18.215  51.469  55.679  1.00 6.31  ? 65  VAL F CG1 1 
ATOM   8498  C CG2 . VAL F 1 48  ? 20.185  51.785  57.143  1.00 5.00  ? 65  VAL F CG2 1 
ATOM   8499  N N   . ARG F 1 49  ? 16.411  54.430  55.893  1.00 15.50 ? 66  ARG F N   1 
ATOM   8500  C CA  . ARG F 1 49  ? 14.974  54.650  55.761  1.00 17.46 ? 66  ARG F CA  1 
ATOM   8501  C C   . ARG F 1 49  ? 14.514  53.664  54.708  1.00 19.29 ? 66  ARG F C   1 
ATOM   8502  O O   . ARG F 1 49  ? 14.888  53.794  53.546  1.00 20.13 ? 66  ARG F O   1 
ATOM   8503  C CB  . ARG F 1 49  ? 14.682  56.037  55.252  1.00 22.60 ? 66  ARG F CB  1 
ATOM   8504  C CG  . ARG F 1 49  ? 14.975  57.142  56.230  1.00 35.23 ? 66  ARG F CG  1 
ATOM   8505  C CD  . ARG F 1 49  ? 14.731  58.530  55.600  1.00 45.43 ? 66  ARG F CD  1 
ATOM   8506  N NE  . ARG F 1 49  ? 13.327  58.766  55.242  1.00 52.89 ? 66  ARG F NE  1 
ATOM   8507  C CZ  . ARG F 1 49  ? 12.904  59.738  54.430  1.00 57.49 ? 66  ARG F CZ  1 
ATOM   8508  N NH1 . ARG F 1 49  ? 13.782  60.578  53.874  1.00 60.29 ? 66  ARG F NH1 1 
ATOM   8509  N NH2 . ARG F 1 49  ? 11.599  59.888  54.200  1.00 56.53 ? 66  ARG F NH2 1 
ATOM   8510  N N   . LEU F 1 50  ? 13.761  52.646  55.109  1.00 21.84 ? 67  LEU F N   1 
ATOM   8511  C CA  . LEU F 1 50  ? 13.281  51.631  54.161  1.00 24.50 ? 67  LEU F CA  1 
ATOM   8512  C C   . LEU F 1 50  ? 11.885  51.973  53.700  1.00 29.67 ? 67  LEU F C   1 
ATOM   8513  O O   . LEU F 1 50  ? 11.291  52.937  54.192  1.00 32.63 ? 67  LEU F O   1 
ATOM   8514  C CB  . LEU F 1 50  ? 13.234  50.247  54.806  1.00 19.59 ? 67  LEU F CB  1 
ATOM   8515  C CG  . LEU F 1 50  ? 14.483  49.782  55.528  1.00 18.79 ? 67  LEU F CG  1 
ATOM   8516  C CD1 . LEU F 1 50  ? 14.593  50.418  56.902  1.00 18.52 ? 67  LEU F CD1 1 
ATOM   8517  C CD2 . LEU F 1 50  ? 14.399  48.311  55.658  1.00 17.29 ? 67  LEU F CD2 1 
ATOM   8518  N N   . GLY F 1 51  ? 11.363  51.172  52.772  1.00 32.03 ? 69  GLY F N   1 
ATOM   8519  C CA  . GLY F 1 51  ? 10.010  51.358  52.259  1.00 37.00 ? 69  GLY F CA  1 
ATOM   8520  C C   . GLY F 1 51  ? 9.566   52.780  51.963  1.00 37.55 ? 69  GLY F C   1 
ATOM   8521  O O   . GLY F 1 51  ? 8.391   53.135  52.155  1.00 36.73 ? 69  GLY F O   1 
ATOM   8522  N N   . GLU F 1 52  ? 10.503  53.586  51.475  1.00 37.55 ? 70  GLU F N   1 
ATOM   8523  C CA  . GLU F 1 52  ? 10.245  54.974  51.139  1.00 37.15 ? 70  GLU F CA  1 
ATOM   8524  C C   . GLU F 1 52  ? 9.586   55.115  49.780  1.00 37.70 ? 70  GLU F C   1 
ATOM   8525  O O   . GLU F 1 52  ? 9.763   54.281  48.883  1.00 36.48 ? 70  GLU F O   1 
ATOM   8526  C CB  . GLU F 1 52  ? 11.552  55.746  51.120  1.00 38.65 ? 70  GLU F CB  1 
ATOM   8527  C CG  . GLU F 1 52  ? 12.204  55.887  52.453  1.00 39.23 ? 70  GLU F CG  1 
ATOM   8528  C CD  . GLU F 1 52  ? 11.494  56.876  53.315  1.00 38.95 ? 70  GLU F CD  1 
ATOM   8529  O OE1 . GLU F 1 52  ? 10.871  57.816  52.773  1.00 40.13 ? 70  GLU F OE1 1 
ATOM   8530  O OE2 . GLU F 1 52  ? 11.571  56.717  54.541  1.00 39.34 ? 70  GLU F OE2 1 
ATOM   8531  N N   . ASP F 1 53  ? 8.803   56.171  49.648  1.00 37.07 ? 71  ASP F N   1 
ATOM   8532  C CA  . ASP F 1 53  ? 8.136   56.482  48.405  1.00 37.72 ? 71  ASP F CA  1 
ATOM   8533  C C   . ASP F 1 53  ? 8.648   57.891  48.146  1.00 39.23 ? 71  ASP F C   1 
ATOM   8534  O O   . ASP F 1 53  ? 9.454   58.126  47.237  1.00 41.89 ? 71  ASP F O   1 
ATOM   8535  C CB  . ASP F 1 53  ? 6.613   56.472  48.580  0.00 36.31 ? 71  ASP F CB  1 
ATOM   8536  C CG  . ASP F 1 53  ? 5.871   56.728  47.279  0.00 35.92 ? 71  ASP F CG  1 
ATOM   8537  O OD1 . ASP F 1 53  ? 5.453   57.883  47.049  0.00 35.98 ? 71  ASP F OD1 1 
ATOM   8538  O OD2 . ASP F 1 53  ? 5.700   55.775  46.489  0.00 35.93 ? 71  ASP F OD2 1 
ATOM   8539  N N   . ASN F 1 54  ? 8.253   58.812  49.011  1.00 37.55 ? 72  ASN F N   1 
ATOM   8540  C CA  . ASN F 1 54  ? 8.692   60.195  48.899  1.00 37.78 ? 72  ASN F CA  1 
ATOM   8541  C C   . ASN F 1 54  ? 9.645   60.329  50.075  1.00 38.49 ? 72  ASN F C   1 
ATOM   8542  O O   . ASN F 1 54  ? 9.344   59.863  51.174  1.00 40.63 ? 72  ASN F O   1 
ATOM   8543  C CB  . ASN F 1 54  ? 7.489   61.139  49.023  1.00 38.14 ? 72  ASN F CB  1 
ATOM   8544  C CG  . ASN F 1 54  ? 7.881   62.594  49.077  0.00 36.61 ? 72  ASN F CG  1 
ATOM   8545  O OD1 . ASN F 1 54  ? 8.525   63.041  50.023  0.00 36.12 ? 72  ASN F OD1 1 
ATOM   8546  N ND2 . ASN F 1 54  ? 7.456   63.354  48.081  0.00 35.90 ? 72  ASN F ND2 1 
ATOM   8547  N N   . ILE F 1 55  ? 10.834  60.854  49.835  1.00 38.61 ? 73  ILE F N   1 
ATOM   8548  C CA  . ILE F 1 55  ? 11.789  60.986  50.922  1.00 40.23 ? 73  ILE F CA  1 
ATOM   8549  C C   . ILE F 1 55  ? 11.684  62.312  51.655  1.00 43.83 ? 73  ILE F C   1 
ATOM   8550  O O   . ILE F 1 55  ? 12.697  62.958  51.961  1.00 43.39 ? 73  ILE F O   1 
ATOM   8551  C CB  . ILE F 1 55  ? 13.244  60.714  50.476  1.00 38.78 ? 73  ILE F CB  1 
ATOM   8552  C CG1 . ILE F 1 55  ? 13.531  61.326  49.099  1.00 37.46 ? 73  ILE F CG1 1 
ATOM   8553  C CG2 . ILE F 1 55  ? 13.519  59.224  50.505  1.00 38.58 ? 73  ILE F CG2 1 
ATOM   8554  C CD1 . ILE F 1 55  ? 13.716  62.833  49.102  1.00 37.03 ? 73  ILE F CD1 1 
ATOM   8555  N N   . ASN F 1 56  ? 10.448  62.694  51.964  1.00 45.77 ? 74  ASN F N   1 
ATOM   8556  C CA  . ASN F 1 56  ? 10.165  63.933  52.680  1.00 46.95 ? 74  ASN F CA  1 
ATOM   8557  C C   . ASN F 1 56  ? 8.806   63.869  53.397  1.00 47.19 ? 74  ASN F C   1 
ATOM   8558  O O   . ASN F 1 56  ? 8.615   64.492  54.434  1.00 46.31 ? 74  ASN F O   1 
ATOM   8559  C CB  . ASN F 1 56  ? 10.224  65.129  51.719  1.00 50.02 ? 74  ASN F CB  1 
ATOM   8560  C CG  . ASN F 1 56  ? 11.618  65.326  51.096  1.00 49.14 ? 74  ASN F CG  1 
ATOM   8561  O OD1 . ASN F 1 56  ? 11.791  65.217  49.886  1.00 50.04 ? 74  ASN F OD1 1 
ATOM   8562  N ND2 . ASN F 1 56  ? 12.611  65.593  51.930  1.00 49.83 ? 74  ASN F ND2 1 
ATOM   8563  N N   . VAL F 1 57  ? 7.861   63.123  52.838  1.00 48.93 ? 75  VAL F N   1 
ATOM   8564  C CA  . VAL F 1 57  ? 6.548   62.961  53.452  1.00 52.99 ? 75  VAL F CA  1 
ATOM   8565  C C   . VAL F 1 57  ? 6.391   61.488  53.896  1.00 58.06 ? 75  VAL F C   1 
ATOM   8566  O O   . VAL F 1 57  ? 6.979   60.582  53.288  1.00 59.19 ? 75  VAL F O   1 
ATOM   8567  C CB  . VAL F 1 57  ? 5.413   63.319  52.459  0.00 52.58 ? 75  VAL F CB  1 
ATOM   8568  C CG1 . VAL F 1 57  ? 4.063   63.296  53.163  0.00 52.97 ? 75  VAL F CG1 1 
ATOM   8569  C CG2 . VAL F 1 57  ? 5.663   64.686  51.838  0.00 52.96 ? 75  VAL F CG2 1 
ATOM   8570  N N   . VAL F 1 58  ? 5.620   61.252  54.963  1.00 61.55 ? 76  VAL F N   1 
ATOM   8571  C CA  . VAL F 1 58  ? 5.368   59.890  55.477  1.00 59.89 ? 76  VAL F CA  1 
ATOM   8572  C C   . VAL F 1 58  ? 4.398   59.132  54.556  1.00 51.10 ? 76  VAL F C   1 
ATOM   8573  O O   . VAL F 1 58  ? 3.197   59.072  54.817  1.00 51.70 ? 76  VAL F O   1 
ATOM   8574  C CB  . VAL F 1 58  ? 4.775   59.910  56.938  1.00 65.76 ? 76  VAL F CB  1 
ATOM   8575  C CG1 . VAL F 1 58  ? 4.489   58.486  57.422  1.00 69.87 ? 76  VAL F CG1 1 
ATOM   8576  C CG2 . VAL F 1 58  ? 5.738   60.587  57.912  1.00 69.78 ? 76  VAL F CG2 1 
ATOM   8577  N N   . GLU F 1 59  ? 4.908   58.575  53.467  0.00 42.40 ? 77  GLU F N   1 
ATOM   8578  C CA  . GLU F 1 59  ? 4.053   57.846  52.541  0.00 35.00 ? 77  GLU F CA  1 
ATOM   8579  C C   . GLU F 1 59  ? 3.741   56.436  53.033  0.00 31.78 ? 77  GLU F C   1 
ATOM   8580  O O   . GLU F 1 59  ? 4.200   55.446  52.456  0.00 32.19 ? 77  GLU F O   1 
ATOM   8581  C CB  . GLU F 1 59  ? 4.684   57.809  51.150  0.00 33.57 ? 77  GLU F CB  1 
ATOM   8582  C CG  . GLU F 1 59  ? 4.814   59.177  50.494  0.00 27.09 ? 77  GLU F CG  1 
ATOM   8583  C CD  . GLU F 1 59  ? 3.472   59.838  50.241  0.00 22.23 ? 77  GLU F CD  1 
ATOM   8584  O OE1 . GLU F 1 59  ? 2.803   59.467  49.253  0.00 19.97 ? 77  GLU F OE1 1 
ATOM   8585  O OE2 . GLU F 1 59  ? 3.086   60.728  51.028  0.00 20.05 ? 77  GLU F OE2 1 
ATOM   8586  N N   . GLY F 1 60  ? 2.962   56.356  54.109  0.00 28.51 ? 78  GLY F N   1 
ATOM   8587  C CA  . GLY F 1 60  ? 2.585   55.074  54.674  0.00 23.24 ? 78  GLY F CA  1 
ATOM   8588  C C   . GLY F 1 60  ? 3.748   54.335  55.305  0.00 19.82 ? 78  GLY F C   1 
ATOM   8589  O O   . GLY F 1 60  ? 3.919   54.356  56.523  0.00 18.65 ? 78  GLY F O   1 
ATOM   8590  N N   . ASN F 1 61  ? 4.549   53.681  54.472  0.00 17.91 ? 79  ASN F N   1 
ATOM   8591  C CA  . ASN F 1 61  ? 5.700   52.925  54.946  0.00 16.80 ? 79  ASN F CA  1 
ATOM   8592  C C   . ASN F 1 61  ? 6.806   53.884  55.360  0.00 16.38 ? 79  ASN F C   1 
ATOM   8593  O O   . ASN F 1 61  ? 7.337   54.629  54.533  0.00 16.29 ? 79  ASN F O   1 
ATOM   8594  C CB  . ASN F 1 61  ? 6.208   51.984  53.851  0.00 16.46 ? 79  ASN F CB  1 
ATOM   8595  C CG  . ASN F 1 61  ? 5.135   51.039  53.349  0.00 16.27 ? 79  ASN F CG  1 
ATOM   8596  O OD1 . ASN F 1 61  ? 4.690   50.148  54.072  0.00 16.17 ? 79  ASN F OD1 1 
ATOM   8597  N ND2 . ASN F 1 61  ? 4.711   51.229  52.108  0.00 16.04 ? 79  ASN F ND2 1 
ATOM   8598  N N   . GLU F 1 62  ? 7.121   53.893  56.650  0.00 16.08 ? 80  GLU F N   1 
ATOM   8599  C CA  . GLU F 1 62  ? 8.159   54.764  57.180  0.00 15.94 ? 80  GLU F CA  1 
ATOM   8600  C C   . GLU F 1 62  ? 8.960   53.988  58.216  0.00 15.75 ? 80  GLU F C   1 
ATOM   8601  O O   . GLU F 1 62  ? 8.430   53.606  59.260  0.00 15.76 ? 80  GLU F O   1 
ATOM   8602  C CB  . GLU F 1 62  ? 7.525   56.000  57.822  0.00 15.95 ? 80  GLU F CB  1 
ATOM   8603  C CG  . GLU F 1 62  ? 8.200   57.315  57.456  0.00 16.10 ? 80  GLU F CG  1 
ATOM   8604  C CD  . GLU F 1 62  ? 8.157   57.613  55.964  0.00 16.04 ? 80  GLU F CD  1 
ATOM   8605  O OE1 . GLU F 1 62  ? 7.142   57.291  55.309  0.00 16.16 ? 80  GLU F OE1 1 
ATOM   8606  O OE2 . GLU F 1 62  ? 9.141   58.179  55.445  0.00 16.13 ? 80  GLU F OE2 1 
ATOM   8607  N N   . GLN F 1 63  ? 10.227  53.726  57.911  0.00 15.53 ? 81  GLN F N   1 
ATOM   8608  C CA  . GLN F 1 63  ? 11.086  52.979  58.823  0.00 15.37 ? 81  GLN F CA  1 
ATOM   8609  C C   . GLN F 1 63  ? 12.495  53.553  58.910  0.00 14.99 ? 81  GLN F C   1 
ATOM   8610  O O   . GLN F 1 63  ? 13.304  53.349  58.004  0.00 15.14 ? 81  GLN F O   1 
ATOM   8611  C CB  . GLN F 1 63  ? 11.169  51.509  58.394  0.00 15.73 ? 81  GLN F CB  1 
ATOM   8612  C CG  . GLN F 1 63  ? 9.859   50.742  58.477  0.00 15.82 ? 81  GLN F CG  1 
ATOM   8613  C CD  . GLN F 1 63  ? 9.993   49.304  58.018  0.00 15.82 ? 81  GLN F CD  1 
ATOM   8614  O OE1 . GLN F 1 63  ? 10.972  48.625  58.329  0.00 15.99 ? 81  GLN F OE1 1 
ATOM   8615  N NE2 . GLN F 1 63  ? 9.004   48.828  57.277  0.00 15.83 ? 81  GLN F NE2 1 
ATOM   8616  N N   . PHE F 1 64  ? 12.768  54.304  59.974  1.00 14.76 ? 82  PHE F N   1 
ATOM   8617  C CA  . PHE F 1 64  ? 14.094  54.881  60.194  1.00 14.59 ? 82  PHE F CA  1 
ATOM   8618  C C   . PHE F 1 64  ? 14.815  53.977  61.206  1.00 12.18 ? 82  PHE F C   1 
ATOM   8619  O O   . PHE F 1 64  ? 14.452  53.964  62.379  1.00 13.49 ? 82  PHE F O   1 
ATOM   8620  C CB  . PHE F 1 64  ? 14.006  56.323  60.751  1.00 13.37 ? 82  PHE F CB  1 
ATOM   8621  C CG  . PHE F 1 64  ? 13.300  57.297  59.845  0.00 15.39 ? 82  PHE F CG  1 
ATOM   8622  C CD1 . PHE F 1 64  ? 12.020  57.033  59.365  0.00 16.07 ? 82  PHE F CD1 1 
ATOM   8623  C CD2 . PHE F 1 64  ? 13.906  58.500  59.499  0.00 16.18 ? 82  PHE F CD2 1 
ATOM   8624  C CE1 . PHE F 1 64  ? 11.356  57.953  58.559  0.00 16.84 ? 82  PHE F CE1 1 
ATOM   8625  C CE2 . PHE F 1 64  ? 13.249  59.427  58.694  0.00 16.80 ? 82  PHE F CE2 1 
ATOM   8626  C CZ  . PHE F 1 64  ? 11.971  59.152  58.224  0.00 17.16 ? 82  PHE F CZ  1 
ATOM   8627  N N   . ILE F 1 65  ? 15.801  53.207  60.749  1.00 8.58  ? 83  ILE F N   1 
ATOM   8628  C CA  . ILE F 1 65  ? 16.571  52.310  61.622  1.00 9.48  ? 83  ILE F CA  1 
ATOM   8629  C C   . ILE F 1 65  ? 18.057  52.683  61.697  1.00 8.65  ? 83  ILE F C   1 
ATOM   8630  O O   . ILE F 1 65  ? 18.682  52.989  60.681  1.00 10.18 ? 83  ILE F O   1 
ATOM   8631  C CB  . ILE F 1 65  ? 16.471  50.849  61.151  1.00 9.17  ? 83  ILE F CB  1 
ATOM   8632  C CG1 . ILE F 1 65  ? 15.006  50.422  61.074  1.00 6.89  ? 83  ILE F CG1 1 
ATOM   8633  C CG2 . ILE F 1 65  ? 17.252  49.938  62.090  1.00 8.45  ? 83  ILE F CG2 1 
ATOM   8634  C CD1 . ILE F 1 65  ? 14.817  49.045  60.509  1.00 6.73  ? 83  ILE F CD1 1 
ATOM   8635  N N   . SER F 1 66  ? 18.630  52.642  62.894  1.00 8.35  ? 84  SER F N   1 
ATOM   8636  C CA  . SER F 1 66  ? 20.042  52.989  63.048  1.00 10.45 ? 84  SER F CA  1 
ATOM   8637  C C   . SER F 1 66  ? 20.859  51.791  62.622  1.00 11.01 ? 84  SER F C   1 
ATOM   8638  O O   . SER F 1 66  ? 20.396  50.669  62.770  1.00 12.23 ? 84  SER F O   1 
ATOM   8639  C CB  . SER F 1 66  ? 20.351  53.300  64.502  1.00 11.12 ? 84  SER F CB  1 
ATOM   8640  O OG  . SER F 1 66  ? 19.240  53.928  65.116  0.00 9.85  ? 84  SER F OG  1 
ATOM   8641  N N   . ALA F 1 67  ? 22.052  52.012  62.077  1.00 10.63 ? 85  ALA F N   1 
ATOM   8642  C CA  . ALA F 1 67  ? 22.891  50.906  61.638  1.00 9.38  ? 85  ALA F CA  1 
ATOM   8643  C C   . ALA F 1 67  ? 23.857  50.484  62.742  1.00 10.23 ? 85  ALA F C   1 
ATOM   8644  O O   . ALA F 1 67  ? 24.595  51.309  63.262  1.00 13.88 ? 85  ALA F O   1 
ATOM   8645  C CB  . ALA F 1 67  ? 23.642  51.300  60.394  1.00 6.28  ? 85  ALA F CB  1 
ATOM   8646  N N   . SER F 1 68  ? 23.816  49.218  63.135  1.00 10.55 ? 86  SER F N   1 
ATOM   8647  C CA  . SER F 1 68  ? 24.708  48.696  64.176  1.00 12.31 ? 86  SER F CA  1 
ATOM   8648  C C   . SER F 1 68  ? 26.193  48.622  63.720  1.00 14.05 ? 86  SER F C   1 
ATOM   8649  O O   . SER F 1 68  ? 27.055  49.292  64.280  1.00 16.25 ? 86  SER F O   1 
ATOM   8650  C CB  . SER F 1 68  ? 24.205  47.320  64.643  1.00 9.56  ? 86  SER F CB  1 
ATOM   8651  O OG  . SER F 1 68  ? 24.905  46.875  65.792  0.00 9.65  ? 86  SER F OG  1 
ATOM   8652  N N   . LYS F 1 69  ? 26.486  47.803  62.712  1.00 15.07 ? 87  LYS F N   1 
ATOM   8653  C CA  . LYS F 1 69  ? 27.844  47.646  62.167  1.00 11.31 ? 87  LYS F CA  1 
ATOM   8654  C C   . LYS F 1 69  ? 27.807  48.132  60.717  1.00 11.18 ? 87  LYS F C   1 
ATOM   8655  O O   . LYS F 1 69  ? 26.910  47.745  59.969  1.00 14.76 ? 87  LYS F O   1 
ATOM   8656  C CB  . LYS F 1 69  ? 28.269  46.154  62.135  1.00 10.11 ? 87  LYS F CB  1 
ATOM   8657  C CG  . LYS F 1 69  ? 28.493  45.424  63.472  1.00 6.82  ? 87  LYS F CG  1 
ATOM   8658  C CD  . LYS F 1 69  ? 27.202  45.137  64.201  0.00 8.04  ? 87  LYS F CD  1 
ATOM   8659  C CE  . LYS F 1 69  ? 27.466  44.402  65.504  0.00 8.29  ? 87  LYS F CE  1 
ATOM   8660  N NZ  . LYS F 1 69  ? 28.157  43.100  65.284  0.00 8.69  ? 87  LYS F NZ  1 
ATOM   8661  N N   . SER F 1 70  ? 28.712  49.029  60.338  1.00 9.98  ? 88  SER F N   1 
ATOM   8662  C CA  . SER F 1 70  ? 28.809  49.495  58.944  1.00 9.02  ? 88  SER F CA  1 
ATOM   8663  C C   . SER F 1 70  ? 30.179  48.946  58.424  1.00 11.69 ? 88  SER F C   1 
ATOM   8664  O O   . SER F 1 70  ? 31.245  49.572  58.583  1.00 12.83 ? 88  SER F O   1 
ATOM   8665  C CB  . SER F 1 70  ? 28.723  51.022  58.876  1.00 5.00  ? 88  SER F CB  1 
ATOM   8666  O OG  . SER F 1 70  ? 27.490  51.488  59.398  0.00 5.00  ? 88  SER F OG  1 
ATOM   8667  N N   . ILE F 1 71  ? 30.141  47.745  57.850  1.00 9.24  ? 89  ILE F N   1 
ATOM   8668  C CA  . ILE F 1 71  ? 31.330  47.047  57.383  1.00 5.92  ? 89  ILE F CA  1 
ATOM   8669  C C   . ILE F 1 71  ? 31.729  47.308  55.931  1.00 8.86  ? 89  ILE F C   1 
ATOM   8670  O O   . ILE F 1 71  ? 31.119  46.778  55.002  1.00 10.63 ? 89  ILE F O   1 
ATOM   8671  C CB  . ILE F 1 71  ? 31.138  45.536  57.601  1.00 5.42  ? 89  ILE F CB  1 
ATOM   8672  C CG1 . ILE F 1 71  ? 30.987  45.232  59.091  1.00 5.00  ? 89  ILE F CG1 1 
ATOM   8673  C CG2 . ILE F 1 71  ? 32.262  44.764  56.975  1.00 7.73  ? 89  ILE F CG2 1 
ATOM   8674  C CD1 . ILE F 1 71  ? 30.481  43.859  59.379  1.00 5.00  ? 89  ILE F CD1 1 
ATOM   8675  N N   . VAL F 1 72  ? 32.790  48.088  55.741  1.00 10.22 ? 90  VAL F N   1 
ATOM   8676  C CA  . VAL F 1 72  ? 33.297  48.413  54.398  1.00 7.66  ? 90  VAL F CA  1 
ATOM   8677  C C   . VAL F 1 72  ? 34.205  47.303  53.868  1.00 9.56  ? 90  VAL F C   1 
ATOM   8678  O O   . VAL F 1 72  ? 34.882  46.635  54.656  1.00 12.88 ? 90  VAL F O   1 
ATOM   8679  C CB  . VAL F 1 72  ? 34.098  49.705  54.442  1.00 5.00  ? 90  VAL F CB  1 
ATOM   8680  C CG1 . VAL F 1 72  ? 34.719  49.980  53.118  1.00 5.00  ? 90  VAL F CG1 1 
ATOM   8681  C CG2 . VAL F 1 72  ? 33.211  50.834  54.823  1.00 5.35  ? 90  VAL F CG2 1 
ATOM   8682  N N   . HIS F 1 73  ? 34.216  47.075  52.554  1.00 9.57  ? 91  HIS F N   1 
ATOM   8683  C CA  . HIS F 1 73  ? 35.093  46.034  52.005  1.00 10.40 ? 91  HIS F CA  1 
ATOM   8684  C C   . HIS F 1 73  ? 36.559  46.347  52.338  1.00 10.97 ? 91  HIS F C   1 
ATOM   8685  O O   . HIS F 1 73  ? 37.047  47.451  52.090  1.00 10.25 ? 91  HIS F O   1 
ATOM   8686  C CB  . HIS F 1 73  ? 34.926  45.863  50.487  1.00 8.43  ? 91  HIS F CB  1 
ATOM   8687  C CG  . HIS F 1 73  ? 35.579  44.617  49.948  1.00 10.90 ? 91  HIS F CG  1 
ATOM   8688  N ND1 . HIS F 1 73  ? 36.897  44.576  49.559  1.00 12.27 ? 91  HIS F ND1 1 
ATOM   8689  C CD2 . HIS F 1 73  ? 35.096  43.366  49.736  1.00 13.55 ? 91  HIS F CD2 1 
ATOM   8690  C CE1 . HIS F 1 73  ? 37.196  43.361  49.131  1.00 10.70 ? 91  HIS F CE1 1 
ATOM   8691  N NE2 . HIS F 1 73  ? 36.120  42.605  49.226  1.00 5.00  ? 91  HIS F NE2 1 
ATOM   8692  N N   . PRO F 1 74  ? 37.301  45.343  52.825  1.00 11.37 ? 92  PRO F N   1 
ATOM   8693  C CA  . PRO F 1 74  ? 38.712  45.382  53.222  1.00 12.99 ? 92  PRO F CA  1 
ATOM   8694  C C   . PRO F 1 74  ? 39.765  45.663  52.141  1.00 15.03 ? 92  PRO F C   1 
ATOM   8695  O O   . PRO F 1 74  ? 40.960  45.548  52.416  1.00 16.04 ? 92  PRO F O   1 
ATOM   8696  C CB  . PRO F 1 74  ? 38.926  43.992  53.790  1.00 10.66 ? 92  PRO F CB  1 
ATOM   8697  C CG  . PRO F 1 74  ? 38.060  43.181  52.916  1.00 9.76  ? 92  PRO F CG  1 
ATOM   8698  C CD  . PRO F 1 74  ? 36.791  43.970  52.951  1.00 10.75 ? 92  PRO F CD  1 
ATOM   8699  N N   . SER F 1 75  ? 39.334  45.990  50.923  1.00 15.54 ? 93  SER F N   1 
ATOM   8700  C CA  . SER F 1 75  ? 40.248  46.284  49.826  1.00 14.36 ? 93  SER F CA  1 
ATOM   8701  C C   . SER F 1 75  ? 39.686  47.403  48.995  1.00 15.74 ? 93  SER F C   1 
ATOM   8702  O O   . SER F 1 75  ? 40.165  47.669  47.898  1.00 19.17 ? 93  SER F O   1 
ATOM   8703  C CB  . SER F 1 75  ? 40.452  45.070  48.932  1.00 13.77 ? 93  SER F CB  1 
ATOM   8704  O OG  . SER F 1 75  ? 40.913  43.968  49.684  1.00 21.06 ? 93  SER F OG  1 
ATOM   8705  N N   . TYR F 1 76  ? 38.638  48.040  49.491  1.00 14.25 ? 94  TYR F N   1 
ATOM   8706  C CA  . TYR F 1 76  ? 38.050  49.127  48.748  1.00 12.00 ? 94  TYR F CA  1 
ATOM   8707  C C   . TYR F 1 76  ? 39.157  50.172  48.647  1.00 12.98 ? 94  TYR F C   1 
ATOM   8708  O O   . TYR F 1 76  ? 39.863  50.411  49.617  1.00 13.08 ? 94  TYR F O   1 
ATOM   8709  C CB  . TYR F 1 76  ? 36.817  49.665  49.485  1.00 8.00  ? 94  TYR F CB  1 
ATOM   8710  C CG  . TYR F 1 76  ? 36.519  51.110  49.205  1.00 5.00  ? 94  TYR F CG  1 
ATOM   8711  C CD1 . TYR F 1 76  ? 36.658  52.063  50.208  1.00 5.27  ? 94  TYR F CD1 1 
ATOM   8712  C CD2 . TYR F 1 76  ? 36.139  51.535  47.944  1.00 5.00  ? 94  TYR F CD2 1 
ATOM   8713  C CE1 . TYR F 1 76  ? 36.424  53.413  49.966  1.00 5.72  ? 94  TYR F CE1 1 
ATOM   8714  C CE2 . TYR F 1 76  ? 35.909  52.886  47.687  1.00 5.00  ? 94  TYR F CE2 1 
ATOM   8715  C CZ  . TYR F 1 76  ? 36.051  53.819  48.704  1.00 5.00  ? 94  TYR F CZ  1 
ATOM   8716  O OH  . TYR F 1 76  ? 35.817  55.160  48.480  1.00 5.00  ? 94  TYR F OH  1 
ATOM   8717  N N   . ASN F 1 77  ? 39.403  50.670  47.441  1.00 14.66 ? 95  ASN F N   1 
ATOM   8718  C CA  . ASN F 1 77  ? 40.418  51.701  47.230  1.00 15.21 ? 95  ASN F CA  1 
ATOM   8719  C C   . ASN F 1 77  ? 39.710  53.024  46.972  1.00 14.56 ? 95  ASN F C   1 
ATOM   8720  O O   . ASN F 1 77  ? 39.079  53.219  45.924  1.00 13.21 ? 95  ASN F O   1 
ATOM   8721  C CB  . ASN F 1 77  ? 41.316  51.355  46.043  1.00 17.39 ? 95  ASN F CB  1 
ATOM   8722  C CG  . ASN F 1 77  ? 42.471  52.312  45.894  0.00 17.93 ? 95  ASN F CG  1 
ATOM   8723  O OD1 . ASN F 1 77  ? 42.319  53.396  45.341  0.00 18.89 ? 95  ASN F OD1 1 
ATOM   8724  N ND2 . ASN F 1 77  ? 43.634  51.920  46.389  0.00 18.75 ? 95  ASN F ND2 1 
ATOM   8725  N N   . SER F 1 78  ? 39.825  53.941  47.920  1.00 13.16 ? 96  SER F N   1 
ATOM   8726  C CA  . SER F 1 78  ? 39.158  55.221  47.780  1.00 15.92 ? 96  SER F CA  1 
ATOM   8727  C C   . SER F 1 78  ? 39.510  55.987  46.539  1.00 19.78 ? 96  SER F C   1 
ATOM   8728  O O   . SER F 1 78  ? 38.818  56.938  46.192  1.00 20.78 ? 96  SER F O   1 
ATOM   8729  C CB  . SER F 1 78  ? 39.420  56.096  48.989  1.00 16.69 ? 96  SER F CB  1 
ATOM   8730  O OG  . SER F 1 78  ? 40.780  56.038  49.336  1.00 22.03 ? 96  SER F OG  1 
ATOM   8731  N N   . ASN F 1 79  ? 40.599  55.603  45.884  1.00 25.13 ? 97  ASN F N   1 
ATOM   8732  C CA  . ASN F 1 79  ? 41.029  56.312  44.686  1.00 29.06 ? 97  ASN F CA  1 
ATOM   8733  C C   . ASN F 1 79  ? 40.436  55.704  43.432  1.00 27.37 ? 97  ASN F C   1 
ATOM   8734  O O   . ASN F 1 79  ? 39.679  56.348  42.711  1.00 29.66 ? 97  ASN F O   1 
ATOM   8735  C CB  . ASN F 1 79  ? 42.555  56.348  44.591  1.00 33.66 ? 97  ASN F CB  1 
ATOM   8736  C CG  . ASN F 1 79  ? 43.188  57.238  45.643  1.00 40.95 ? 97  ASN F CG  1 
ATOM   8737  O OD1 . ASN F 1 79  ? 42.725  57.307  46.784  1.00 46.08 ? 97  ASN F OD1 1 
ATOM   8738  N ND2 . ASN F 1 79  ? 44.268  57.911  45.270  1.00 46.73 ? 97  ASN F ND2 1 
ATOM   8739  N N   . THR F 1 80  ? 40.748  54.443  43.196  1.00 23.58 ? 98  THR F N   1 
ATOM   8740  C CA  . THR F 1 80  ? 40.252  53.760  42.019  1.00 21.06 ? 98  THR F CA  1 
ATOM   8741  C C   . THR F 1 80  ? 38.761  53.451  42.097  1.00 19.81 ? 98  THR F C   1 
ATOM   8742  O O   . THR F 1 80  ? 38.097  53.328  41.056  1.00 20.81 ? 98  THR F O   1 
ATOM   8743  C CB  . THR F 1 80  ? 41.004  52.431  41.825  1.00 23.92 ? 98  THR F CB  1 
ATOM   8744  O OG1 . THR F 1 80  ? 40.705  51.542  42.903  1.00 25.03 ? 98  THR F OG1 1 
ATOM   8745  C CG2 . THR F 1 80  ? 42.495  52.666  41.835  1.00 28.26 ? 98  THR F CG2 1 
ATOM   8746  N N   . LEU F 1 81  ? 38.256  53.349  43.337  1.00 16.01 ? 99  LEU F N   1 
ATOM   8747  C CA  . LEU F 1 81  ? 36.879  52.986  43.644  1.00 7.42  ? 99  LEU F CA  1 
ATOM   8748  C C   . LEU F 1 81  ? 36.723  51.505  43.280  1.00 6.63  ? 99  LEU F C   1 
ATOM   8749  O O   . LEU F 1 81  ? 35.681  51.079  42.799  1.00 7.62  ? 99  LEU F O   1 
ATOM   8750  C CB  . LEU F 1 81  ? 35.882  53.839  42.868  1.00 5.00  ? 99  LEU F CB  1 
ATOM   8751  C CG  . LEU F 1 81  ? 35.907  55.316  43.198  1.00 6.32  ? 99  LEU F CG  1 
ATOM   8752  C CD1 . LEU F 1 81  ? 34.790  56.016  42.456  1.00 7.29  ? 99  LEU F CD1 1 
ATOM   8753  C CD2 . LEU F 1 81  ? 35.746  55.486  44.691  1.00 8.27  ? 99  LEU F CD2 1 
ATOM   8754  N N   . ASN F 1 82  ? 37.795  50.737  43.416  1.00 6.48  ? 100 ASN F N   1 
ATOM   8755  C CA  . ASN F 1 82  ? 37.741  49.316  43.125  1.00 8.13  ? 100 ASN F CA  1 
ATOM   8756  C C   . ASN F 1 82  ? 37.246  48.683  44.413  1.00 10.56 ? 100 ASN F C   1 
ATOM   8757  O O   . ASN F 1 82  ? 37.642  49.097  45.499  1.00 12.62 ? 100 ASN F O   1 
ATOM   8758  C CB  . ASN F 1 82  ? 39.121  48.792  42.777  1.00 8.83  ? 100 ASN F CB  1 
ATOM   8759  C CG  . ASN F 1 82  ? 39.091  47.384  42.236  1.00 12.62 ? 100 ASN F CG  1 
ATOM   8760  O OD1 . ASN F 1 82  ? 38.083  46.919  41.719  1.00 15.86 ? 100 ASN F OD1 1 
ATOM   8761  N ND2 . ASN F 1 82  ? 40.209  46.699  42.338  1.00 15.87 ? 100 ASN F ND2 1 
ATOM   8762  N N   . ASN F 1 83  ? 36.389  47.675  44.304  1.00 12.35 ? 101 ASN F N   1 
ATOM   8763  C CA  . ASN F 1 83  ? 35.803  47.028  45.479  1.00 12.50 ? 101 ASN F CA  1 
ATOM   8764  C C   . ASN F 1 83  ? 34.890  48.004  46.220  1.00 15.33 ? 101 ASN F C   1 
ATOM   8765  O O   . ASN F 1 83  ? 34.909  48.085  47.456  1.00 16.60 ? 101 ASN F O   1 
ATOM   8766  C CB  . ASN F 1 83  ? 36.865  46.506  46.436  1.00 8.52  ? 101 ASN F CB  1 
ATOM   8767  C CG  . ASN F 1 83  ? 37.702  45.435  45.825  1.00 12.24 ? 101 ASN F CG  1 
ATOM   8768  O OD1 . ASN F 1 83  ? 37.257  44.307  45.568  1.00 9.44  ? 101 ASN F OD1 1 
ATOM   8769  N ND2 . ASN F 1 83  ? 38.944  45.768  45.597  1.00 20.11 ? 101 ASN F ND2 1 
ATOM   8770  N N   . ASP F 1 84  ? 34.119  48.773  45.464  1.00 15.01 ? 102 ASP F N   1 
ATOM   8771  C CA  . ASP F 1 84  ? 33.208  49.720  46.063  1.00 15.66 ? 102 ASP F CA  1 
ATOM   8772  C C   . ASP F 1 84  ? 32.018  48.896  46.549  1.00 15.79 ? 102 ASP F C   1 
ATOM   8773  O O   . ASP F 1 84  ? 31.065  48.686  45.798  1.00 20.78 ? 102 ASP F O   1 
ATOM   8774  C CB  . ASP F 1 84  ? 32.772  50.766  45.027  0.00 17.22 ? 102 ASP F CB  1 
ATOM   8775  C CG  . ASP F 1 84  ? 31.790  51.778  45.588  0.00 19.36 ? 102 ASP F CG  1 
ATOM   8776  O OD1 . ASP F 1 84  ? 32.057  52.346  46.668  0.00 21.21 ? 102 ASP F OD1 1 
ATOM   8777  O OD2 . ASP F 1 84  ? 30.746  52.008  44.944  0.00 21.34 ? 102 ASP F OD2 1 
ATOM   8778  N N   . ILE F 1 85  ? 32.126  48.334  47.754  1.00 11.10 ? 103 ILE F N   1 
ATOM   8779  C CA  . ILE F 1 85  ? 31.032  47.570  48.349  1.00 9.39  ? 103 ILE F CA  1 
ATOM   8780  C C   . ILE F 1 85  ? 31.138  47.607  49.868  1.00 10.75 ? 103 ILE F C   1 
ATOM   8781  O O   . ILE F 1 85  ? 32.220  47.387  50.438  1.00 11.99 ? 103 ILE F O   1 
ATOM   8782  C CB  . ILE F 1 85  ? 30.967  46.088  47.849  1.00 9.26  ? 103 ILE F CB  1 
ATOM   8783  C CG1 . ILE F 1 85  ? 29.585  45.509  48.113  1.00 5.73  ? 103 ILE F CG1 1 
ATOM   8784  C CG2 . ILE F 1 85  ? 31.956  45.189  48.599  1.00 10.02 ? 103 ILE F CG2 1 
ATOM   8785  C CD1 . ILE F 1 85  ? 29.410  44.150  47.531  1.00 5.72  ? 103 ILE F CD1 1 
ATOM   8786  N N   . MET F 1 86  ? 29.999  47.886  50.506  1.00 12.24 ? 104 MET F N   1 
ATOM   8787  C CA  . MET F 1 86  ? 29.861  47.976  51.964  1.00 7.89  ? 104 MET F CA  1 
ATOM   8788  C C   . MET F 1 86  ? 28.612  47.235  52.421  1.00 5.00  ? 104 MET F C   1 
ATOM   8789  O O   . MET F 1 86  ? 27.646  47.143  51.687  1.00 5.00  ? 104 MET F O   1 
ATOM   8790  C CB  . MET F 1 86  ? 29.741  49.438  52.359  1.00 5.00  ? 104 MET F CB  1 
ATOM   8791  C CG  . MET F 1 86  ? 29.524  49.696  53.816  1.00 5.00  ? 104 MET F CG  1 
ATOM   8792  S SD  . MET F 1 86  ? 29.417  51.474  54.049  1.00 5.00  ? 104 MET F SD  1 
ATOM   8793  C CE  . MET F 1 86  ? 27.990  51.889  53.056  1.00 5.00  ? 104 MET F CE  1 
ATOM   8794  N N   . LEU F 1 87  ? 28.676  46.650  53.606  1.00 5.35  ? 105 LEU F N   1 
ATOM   8795  C CA  . LEU F 1 87  ? 27.557  45.929  54.206  1.00 6.53  ? 105 LEU F CA  1 
ATOM   8796  C C   . LEU F 1 87  ? 27.132  46.648  55.492  1.00 7.27  ? 105 LEU F C   1 
ATOM   8797  O O   . LEU F 1 87  ? 27.964  46.952  56.349  1.00 8.58  ? 105 LEU F O   1 
ATOM   8798  C CB  . LEU F 1 87  ? 27.934  44.476  54.530  1.00 5.00  ? 105 LEU F CB  1 
ATOM   8799  C CG  . LEU F 1 87  ? 28.038  43.544  53.331  1.00 6.65  ? 105 LEU F CG  1 
ATOM   8800  C CD1 . LEU F 1 87  ? 28.407  42.147  53.776  1.00 7.98  ? 105 LEU F CD1 1 
ATOM   8801  C CD2 . LEU F 1 87  ? 26.719  43.517  52.583  1.00 9.52  ? 105 LEU F CD2 1 
ATOM   8802  N N   . ILE F 1 88  ? 25.841  46.946  55.605  1.00 6.71  ? 106 ILE F N   1 
ATOM   8803  C CA  . ILE F 1 88  ? 25.299  47.617  56.767  1.00 5.46  ? 106 ILE F CA  1 
ATOM   8804  C C   . ILE F 1 88  ? 24.376  46.693  57.509  1.00 5.00  ? 106 ILE F C   1 
ATOM   8805  O O   . ILE F 1 88  ? 23.587  45.974  56.894  1.00 5.00  ? 106 ILE F O   1 
ATOM   8806  C CB  . ILE F 1 88  ? 24.500  48.830  56.360  1.00 8.06  ? 106 ILE F CB  1 
ATOM   8807  C CG1 . ILE F 1 88  ? 25.406  49.821  55.636  1.00 10.29 ? 106 ILE F CG1 1 
ATOM   8808  C CG2 . ILE F 1 88  ? 23.864  49.460  57.581  1.00 7.62  ? 106 ILE F CG2 1 
ATOM   8809  C CD1 . ILE F 1 88  ? 24.669  50.985  55.006  1.00 14.74 ? 106 ILE F CD1 1 
ATOM   8810  N N   . LYS F 1 89  ? 24.536  46.673  58.831  1.00 7.06  ? 107 LYS F N   1 
ATOM   8811  C CA  . LYS F 1 89  ? 23.695  45.861  59.718  1.00 8.72  ? 107 LYS F CA  1 
ATOM   8812  C C   . LYS F 1 89  ? 22.775  46.784  60.492  1.00 7.29  ? 107 LYS F C   1 
ATOM   8813  O O   . LYS F 1 89  ? 23.245  47.697  61.164  1.00 6.98  ? 107 LYS F O   1 
ATOM   8814  C CB  . LYS F 1 89  ? 24.516  45.033  60.713  1.00 7.96  ? 107 LYS F CB  1 
ATOM   8815  C CG  . LYS F 1 89  ? 23.628  44.168  61.626  1.00 5.89  ? 107 LYS F CG  1 
ATOM   8816  C CD  . LYS F 1 89  ? 24.416  43.094  62.397  1.00 6.00  ? 107 LYS F CD  1 
ATOM   8817  C CE  . LYS F 1 89  ? 23.480  42.109  63.096  1.00 5.00  ? 107 LYS F CE  1 
ATOM   8818  N NZ  . LYS F 1 89  ? 24.135  41.199  64.060  1.00 5.00  ? 107 LYS F NZ  1 
ATOM   8819  N N   . LEU F 1 90  ? 21.472  46.548  60.381  1.00 6.76  ? 108 LEU F N   1 
ATOM   8820  C CA  . LEU F 1 90  ? 20.466  47.358  61.053  1.00 6.61  ? 108 LEU F CA  1 
ATOM   8821  C C   . LEU F 1 90  ? 20.355  47.025  62.530  1.00 8.98  ? 108 LEU F C   1 
ATOM   8822  O O   . LEU F 1 90  ? 20.227  45.853  62.899  1.00 10.74 ? 108 LEU F O   1 
ATOM   8823  C CB  . LEU F 1 90  ? 19.119  47.134  60.412  1.00 5.00  ? 108 LEU F CB  1 
ATOM   8824  C CG  . LEU F 1 90  ? 19.067  47.413  58.931  1.00 5.00  ? 108 LEU F CG  1 
ATOM   8825  C CD1 . LEU F 1 90  ? 17.725  46.987  58.415  1.00 5.00  ? 108 LEU F CD1 1 
ATOM   8826  C CD2 . LEU F 1 90  ? 19.306  48.870  58.677  1.00 5.00  ? 108 LEU F CD2 1 
ATOM   8827  N N   . LYS F 1 91  ? 20.393  48.060  63.363  1.00 8.56  ? 109 LYS F N   1 
ATOM   8828  C CA  . LYS F 1 91  ? 20.286  47.911  64.806  1.00 10.71 ? 109 LYS F CA  1 
ATOM   8829  C C   . LYS F 1 91  ? 19.192  46.904  65.062  1.00 14.16 ? 109 LYS F C   1 
ATOM   8830  O O   . LYS F 1 91  ? 19.388  45.941  65.794  1.00 21.07 ? 109 LYS F O   1 
ATOM   8831  C CB  . LYS F 1 91  ? 19.912  49.250  65.467  1.00 8.27  ? 109 LYS F CB  1 
ATOM   8832  C CG  . LYS F 1 91  ? 19.544  49.185  66.948  1.00 5.00  ? 109 LYS F CG  1 
ATOM   8833  C CD  . LYS F 1 91  ? 19.537  50.562  67.573  0.00 6.83  ? 109 LYS F CD  1 
ATOM   8834  C CE  . LYS F 1 91  ? 20.941  51.144  67.624  0.00 8.10  ? 109 LYS F CE  1 
ATOM   8835  N NZ  . LYS F 1 91  ? 20.945  52.545  68.118  0.00 8.41  ? 109 LYS F NZ  1 
ATOM   8836  N N   . SER F 1 92  ? 18.061  47.087  64.400  1.00 12.51 ? 110 SER F N   1 
ATOM   8837  C CA  . SER F 1 92  ? 16.946  46.175  64.574  1.00 13.53 ? 110 SER F CA  1 
ATOM   8838  C C   . SER F 1 92  ? 16.651  45.582  63.207  1.00 15.89 ? 110 SER F C   1 
ATOM   8839  O O   . SER F 1 92  ? 16.956  46.209  62.202  1.00 19.85 ? 110 SER F O   1 
ATOM   8840  C CB  . SER F 1 92  ? 15.737  46.948  65.091  1.00 12.74 ? 110 SER F CB  1 
ATOM   8841  O OG  . SER F 1 92  ? 16.078  47.729  66.226  0.00 11.16 ? 110 SER F OG  1 
ATOM   8842  N N   . ALA F 1 93  ? 16.093  44.378  63.156  1.00 15.86 ? 111 ALA F N   1 
ATOM   8843  C CA  . ALA F 1 93  ? 15.782  43.764  61.873  1.00 18.04 ? 111 ALA F CA  1 
ATOM   8844  C C   . ALA F 1 93  ? 14.594  44.470  61.255  1.00 22.88 ? 111 ALA F C   1 
ATOM   8845  O O   . ALA F 1 93  ? 13.651  44.820  61.955  1.00 24.81 ? 111 ALA F O   1 
ATOM   8846  C CB  . ALA F 1 93  ? 15.477  42.302  62.042  1.00 14.65 ? 111 ALA F CB  1 
ATOM   8847  N N   . ALA F 1 94  ? 14.678  44.730  59.955  1.00 28.27 ? 112 ALA F N   1 
ATOM   8848  C CA  . ALA F 1 94  ? 13.613  45.381  59.202  1.00 31.30 ? 112 ALA F CA  1 
ATOM   8849  C C   . ALA F 1 94  ? 12.437  44.422  59.077  1.00 35.84 ? 112 ALA F C   1 
ATOM   8850  O O   . ALA F 1 94  ? 12.595  43.204  59.103  1.00 36.93 ? 112 ALA F O   1 
ATOM   8851  C CB  . ALA F 1 94  ? 14.113  45.781  57.828  0.00 29.77 ? 112 ALA F CB  1 
ATOM   8852  N N   . SER F 1 95  ? 11.251  44.987  58.932  1.00 40.58 ? 113 SER F N   1 
ATOM   8853  C CA  . SER F 1 95  ? 10.014  44.225  58.826  1.00 43.23 ? 113 SER F CA  1 
ATOM   8854  C C   . SER F 1 95  ? 9.725   43.789  57.405  1.00 43.88 ? 113 SER F C   1 
ATOM   8855  O O   . SER F 1 95  ? 9.128   44.541  56.628  1.00 41.97 ? 113 SER F O   1 
ATOM   8856  C CB  . SER F 1 95  ? 8.883   45.114  59.279  1.00 46.96 ? 113 SER F CB  1 
ATOM   8857  O OG  . SER F 1 95  ? 8.937   46.341  58.559  1.00 49.50 ? 113 SER F OG  1 
ATOM   8858  N N   . LEU F 1 96  ? 10.145  42.584  57.056  1.00 44.85 ? 114 LEU F N   1 
ATOM   8859  C CA  . LEU F 1 96  ? 9.901   42.100  55.710  1.00 43.02 ? 114 LEU F CA  1 
ATOM   8860  C C   . LEU F 1 96  ? 8.403   41.942  55.508  1.00 39.52 ? 114 LEU F C   1 
ATOM   8861  O O   . LEU F 1 96  ? 7.662   41.813  56.483  1.00 42.89 ? 114 LEU F O   1 
ATOM   8862  C CB  . LEU F 1 96  ? 10.624  40.776  55.485  1.00 44.16 ? 114 LEU F CB  1 
ATOM   8863  C CG  . LEU F 1 96  ? 12.140  40.927  55.500  1.00 44.06 ? 114 LEU F CG  1 
ATOM   8864  C CD1 . LEU F 1 96  ? 12.801  39.621  55.115  1.00 46.82 ? 114 LEU F CD1 1 
ATOM   8865  C CD2 . LEU F 1 96  ? 12.532  42.019  54.534  1.00 46.03 ? 114 LEU F CD2 1 
ATOM   8866  N N   . ASN F 1 97  ? 7.960   42.036  54.258  0.00 33.43 ? 115 ASN F N   1 
ATOM   8867  C CA  . ASN F 1 97  ? 6.553   41.883  53.884  0.00 28.53 ? 115 ASN F CA  1 
ATOM   8868  C C   . ASN F 1 97  ? 6.358   42.317  52.435  0.00 26.65 ? 115 ASN F C   1 
ATOM   8869  O O   . ASN F 1 97  ? 7.322   42.411  51.675  0.00 27.02 ? 115 ASN F O   1 
ATOM   8870  C CB  . ASN F 1 97  ? 5.616   42.680  54.814  0.00 27.18 ? 115 ASN F CB  1 
ATOM   8871  C CG  . ASN F 1 97  ? 5.779   44.187  54.682  0.00 24.21 ? 115 ASN F CG  1 
ATOM   8872  O OD1 . ASN F 1 97  ? 6.765   44.681  54.140  0.00 21.90 ? 115 ASN F OD1 1 
ATOM   8873  N ND2 . ASN F 1 97  ? 4.794   44.925  55.170  0.00 22.00 ? 115 ASN F ND2 1 
ATOM   8874  N N   . SER F 1 98  ? 5.109   42.557  52.051  0.00 24.76 ? 116 SER F N   1 
ATOM   8875  C CA  . SER F 1 98  ? 4.785   42.986  50.697  0.00 22.16 ? 116 SER F CA  1 
ATOM   8876  C C   . SER F 1 98  ? 5.312   44.390  50.402  0.00 21.42 ? 116 SER F C   1 
ATOM   8877  O O   . SER F 1 98  ? 5.472   44.770  49.242  0.00 20.70 ? 116 SER F O   1 
ATOM   8878  C CB  . SER F 1 98  ? 3.270   42.936  50.489  0.00 19.85 ? 116 SER F CB  1 
ATOM   8879  O OG  . SER F 1 98  ? 2.588   43.439  51.627  0.00 18.43 ? 116 SER F OG  1 
ATOM   8880  N N   . ARG F 1 99  ? 5.567   45.158  51.458  0.00 21.44 ? 117 ARG F N   1 
ATOM   8881  C CA  . ARG F 1 99  ? 6.070   46.519  51.321  0.00 23.18 ? 117 ARG F CA  1 
ATOM   8882  C C   . ARG F 1 99  ? 7.597   46.523  51.236  0.00 25.76 ? 117 ARG F C   1 
ATOM   8883  O O   . ARG F 1 99  ? 8.159   46.831  50.188  0.00 25.17 ? 117 ARG F O   1 
ATOM   8884  C CB  . ARG F 1 99  ? 5.592   47.379  52.494  0.00 21.53 ? 117 ARG F CB  1 
ATOM   8885  C CG  . ARG F 1 99  ? 4.078   47.390  52.680  0.00 20.04 ? 117 ARG F CG  1 
ATOM   8886  C CD  . ARG F 1 99  ? 3.365   47.921  51.444  0.00 18.22 ? 117 ARG F CD  1 
ATOM   8887  N NE  . ARG F 1 99  ? 1.912   47.895  51.593  0.00 17.15 ? 117 ARG F NE  1 
ATOM   8888  C CZ  . ARG F 1 99  ? 1.054   48.250  50.641  0.00 16.55 ? 117 ARG F CZ  1 
ATOM   8889  N NH1 . ARG F 1 99  ? 1.493   48.662  49.459  0.00 16.48 ? 117 ARG F NH1 1 
ATOM   8890  N NH2 . ARG F 1 99  ? -0.251  48.192  50.872  0.00 16.40 ? 117 ARG F NH2 1 
ATOM   8891  N N   . VAL F 1 100 ? 8.258   46.207  52.346  1.00 28.86 ? 118 VAL F N   1 
ATOM   8892  C CA  . VAL F 1 100 ? 9.713   46.151  52.402  1.00 27.47 ? 118 VAL F CA  1 
ATOM   8893  C C   . VAL F 1 100 ? 10.080  44.686  52.207  1.00 27.75 ? 118 VAL F C   1 
ATOM   8894  O O   . VAL F 1 100 ? 9.691   43.836  53.012  1.00 29.67 ? 118 VAL F O   1 
ATOM   8895  C CB  . VAL F 1 100 ? 10.242  46.582  53.778  1.00 27.96 ? 118 VAL F CB  1 
ATOM   8896  C CG1 . VAL F 1 100 ? 11.738  46.746  53.733  1.00 30.23 ? 118 VAL F CG1 1 
ATOM   8897  C CG2 . VAL F 1 100 ? 9.591   47.865  54.213  1.00 28.92 ? 118 VAL F CG2 1 
ATOM   8898  N N   . ALA F 1 101 ? 10.797  44.375  51.135  1.00 26.15 ? 119 ALA F N   1 
ATOM   8899  C CA  . ALA F 1 101 ? 11.191  42.994  50.879  1.00 24.59 ? 119 ALA F CA  1 
ATOM   8900  C C   . ALA F 1 101 ? 12.640  42.988  50.469  1.00 24.11 ? 119 ALA F C   1 
ATOM   8901  O O   . ALA F 1 101 ? 13.182  43.999  50.038  1.00 30.85 ? 119 ALA F O   1 
ATOM   8902  C CB  . ALA F 1 101 ? 10.339  42.382  49.786  1.00 26.68 ? 119 ALA F CB  1 
ATOM   8903  N N   . SER F 1 102 ? 13.284  41.856  50.624  1.00 20.95 ? 120 SER F N   1 
ATOM   8904  C CA  . SER F 1 102 ? 14.666  41.758  50.254  1.00 21.25 ? 120 SER F CA  1 
ATOM   8905  C C   . SER F 1 102 ? 14.811  41.398  48.778  1.00 19.80 ? 120 SER F C   1 
ATOM   8906  O O   . SER F 1 102 ? 13.878  40.888  48.154  1.00 14.86 ? 120 SER F O   1 
ATOM   8907  C CB  . SER F 1 102 ? 15.336  40.701  51.123  1.00 27.33 ? 120 SER F CB  1 
ATOM   8908  O OG  . SER F 1 102 ? 14.695  39.439  50.998  1.00 32.51 ? 120 SER F OG  1 
ATOM   8909  N N   . ILE F 1 103 ? 15.970  41.738  48.221  1.00 21.05 ? 121 ILE F N   1 
ATOM   8910  C CA  . ILE F 1 103 ? 16.322  41.424  46.831  1.00 20.06 ? 121 ILE F CA  1 
ATOM   8911  C C   . ILE F 1 103 ? 17.287  40.237  46.925  1.00 19.17 ? 121 ILE F C   1 
ATOM   8912  O O   . ILE F 1 103 ? 18.012  40.114  47.916  1.00 20.15 ? 121 ILE F O   1 
ATOM   8913  C CB  . ILE F 1 103 ? 17.027  42.617  46.111  1.00 15.83 ? 121 ILE F CB  1 
ATOM   8914  C CG1 . ILE F 1 103 ? 17.443  42.223  44.692  1.00 14.53 ? 121 ILE F CG1 1 
ATOM   8915  C CG2 . ILE F 1 103 ? 18.245  43.056  46.879  1.00 12.63 ? 121 ILE F CG2 1 
ATOM   8916  C CD1 . ILE F 1 103 ? 16.304  41.780  43.807  1.00 16.25 ? 121 ILE F CD1 1 
ATOM   8917  N N   . SER F 1 104 ? 17.300  39.367  45.921  1.00 15.77 ? 122 SER F N   1 
ATOM   8918  C CA  . SER F 1 104 ? 18.183  38.208  45.966  1.00 17.43 ? 122 SER F CA  1 
ATOM   8919  C C   . SER F 1 104 ? 19.588  38.488  45.456  1.00 18.24 ? 122 SER F C   1 
ATOM   8920  O O   . SER F 1 104 ? 19.798  39.319  44.555  1.00 20.47 ? 122 SER F O   1 
ATOM   8921  C CB  . SER F 1 104 ? 17.612  37.058  45.143  1.00 21.07 ? 122 SER F CB  1 
ATOM   8922  O OG  . SER F 1 104 ? 16.247  36.845  45.427  1.00 29.86 ? 122 SER F OG  1 
ATOM   8923  N N   . LEU F 1 105 ? 20.555  37.792  46.041  1.00 16.03 ? 123 LEU F N   1 
ATOM   8924  C CA  . LEU F 1 105 ? 21.926  37.920  45.598  1.00 13.32 ? 123 LEU F CA  1 
ATOM   8925  C C   . LEU F 1 105 ? 21.999  37.001  44.377  1.00 15.82 ? 123 LEU F C   1 
ATOM   8926  O O   . LEU F 1 105 ? 21.236  36.017  44.287  1.00 15.75 ? 123 LEU F O   1 
ATOM   8927  C CB  . LEU F 1 105 ? 22.887  37.445  46.692  1.00 9.47  ? 123 LEU F CB  1 
ATOM   8928  C CG  . LEU F 1 105 ? 23.104  38.421  47.850  1.00 8.47  ? 123 LEU F CG  1 
ATOM   8929  C CD1 . LEU F 1 105 ? 24.077  37.872  48.844  1.00 5.80  ? 123 LEU F CD1 1 
ATOM   8930  C CD2 . LEU F 1 105 ? 23.624  39.732  47.321  1.00 10.91 ? 123 LEU F CD2 1 
ATOM   8931  N N   . PRO F 1 106 ? 22.858  37.338  43.395  1.00 16.45 ? 124 PRO F N   1 
ATOM   8932  C CA  . PRO F 1 106 ? 23.041  36.555  42.168  1.00 20.83 ? 124 PRO F CA  1 
ATOM   8933  C C   . PRO F 1 106 ? 23.909  35.321  42.414  1.00 29.65 ? 124 PRO F C   1 
ATOM   8934  O O   . PRO F 1 106 ? 24.685  35.262  43.376  1.00 31.31 ? 124 PRO F O   1 
ATOM   8935  C CB  . PRO F 1 106 ? 23.792  37.524  41.275  1.00 16.70 ? 124 PRO F CB  1 
ATOM   8936  C CG  . PRO F 1 106 ? 24.691  38.197  42.252  1.00 15.65 ? 124 PRO F CG  1 
ATOM   8937  C CD  . PRO F 1 106 ? 23.752  38.509  43.392  1.00 15.48 ? 124 PRO F CD  1 
ATOM   8938  N N   . THR F 1 107 ? 23.800  34.337  41.537  1.00 36.72 ? 125 THR F N   1 
ATOM   8939  C CA  . THR F 1 107 ? 24.633  33.144  41.664  1.00 41.49 ? 125 THR F CA  1 
ATOM   8940  C C   . THR F 1 107 ? 25.655  33.125  40.521  1.00 42.62 ? 125 THR F C   1 
ATOM   8941  O O   . THR F 1 107 ? 26.700  32.474  40.619  1.00 42.79 ? 125 THR F O   1 
ATOM   8942  C CB  . THR F 1 107 ? 23.795  31.874  41.590  1.00 42.67 ? 125 THR F CB  1 
ATOM   8943  O OG1 . THR F 1 107 ? 23.085  31.855  40.344  1.00 46.85 ? 125 THR F OG1 1 
ATOM   8944  C CG2 . THR F 1 107 ? 22.808  31.824  42.753  1.00 43.77 ? 125 THR F CG2 1 
ATOM   8945  N N   . SER F 1 108 ? 25.323  33.835  39.437  1.00 41.38 ? 127 SER F N   1 
ATOM   8946  C CA  . SER F 1 108 ? 26.154  33.930  38.246  1.00 39.71 ? 127 SER F CA  1 
ATOM   8947  C C   . SER F 1 108 ? 26.016  35.345  37.717  1.00 38.82 ? 127 SER F C   1 
ATOM   8948  O O   . SER F 1 108 ? 24.944  35.952  37.840  1.00 41.21 ? 127 SER F O   1 
ATOM   8949  C CB  . SER F 1 108 ? 25.658  32.943  37.199  1.00 43.48 ? 127 SER F CB  1 
ATOM   8950  O OG  . SER F 1 108 ? 25.411  31.675  37.790  1.00 47.59 ? 127 SER F OG  1 
ATOM   8951  N N   . CYS F 1 109 ? 27.098  35.859  37.130  1.00 35.04 ? 128 CYS F N   1 
ATOM   8952  C CA  . CYS F 1 109 ? 27.131  37.221  36.599  1.00 28.37 ? 128 CYS F CA  1 
ATOM   8953  C C   . CYS F 1 109 ? 26.281  37.408  35.360  1.00 27.23 ? 128 CYS F C   1 
ATOM   8954  O O   . CYS F 1 109 ? 26.222  36.523  34.516  1.00 25.09 ? 128 CYS F O   1 
ATOM   8955  C CB  . CYS F 1 109 ? 28.563  37.612  36.308  1.00 24.50 ? 128 CYS F CB  1 
ATOM   8956  S SG  . CYS F 1 109 ? 29.633  37.276  37.725  1.00 14.68 ? 128 CYS F SG  1 
ATOM   8957  N N   . ALA F 1 110 ? 25.642  38.571  35.254  1.00 25.96 ? 129 ALA F N   1 
ATOM   8958  C CA  . ALA F 1 110 ? 24.780  38.882  34.121  1.00 22.60 ? 129 ALA F CA  1 
ATOM   8959  C C   . ALA F 1 110 ? 25.625  39.061  32.888  1.00 23.64 ? 129 ALA F C   1 
ATOM   8960  O O   . ALA F 1 110 ? 26.649  39.748  32.941  1.00 28.94 ? 129 ALA F O   1 
ATOM   8961  C CB  . ALA F 1 110 ? 24.009  40.138  34.394  1.00 18.86 ? 129 ALA F CB  1 
ATOM   8962  N N   . SER F 1 111 ? 25.217  38.434  31.790  1.00 22.21 ? 130 SER F N   1 
ATOM   8963  C CA  . SER F 1 111 ? 25.945  38.538  30.528  1.00 23.41 ? 130 SER F CA  1 
ATOM   8964  C C   . SER F 1 111 ? 25.617  39.884  29.895  1.00 24.95 ? 130 SER F C   1 
ATOM   8965  O O   . SER F 1 111 ? 24.517  40.383  30.057  1.00 28.52 ? 130 SER F O   1 
ATOM   8966  C CB  . SER F 1 111 ? 25.532  37.403  29.590  0.00 25.00 ? 130 SER F CB  1 
ATOM   8967  O OG  . SER F 1 111 ? 25.831  36.139  30.158  0.00 24.94 ? 130 SER F OG  1 
ATOM   8968  N N   . ALA F 1 112 ? 26.572  40.496  29.208  1.00 26.71 ? 132 ALA F N   1 
ATOM   8969  C CA  . ALA F 1 112 ? 26.328  41.789  28.573  1.00 27.82 ? 132 ALA F CA  1 
ATOM   8970  C C   . ALA F 1 112 ? 25.098  41.676  27.711  1.00 27.57 ? 132 ALA F C   1 
ATOM   8971  O O   . ALA F 1 112 ? 24.865  40.651  27.076  1.00 27.48 ? 132 ALA F O   1 
ATOM   8972  C CB  . ALA F 1 112 ? 27.511  42.205  27.726  1.00 30.69 ? 132 ALA F CB  1 
ATOM   8973  N N   . GLY F 1 113 ? 24.304  42.731  27.697  1.00 27.86 ? 133 GLY F N   1 
ATOM   8974  C CA  . GLY F 1 113 ? 23.080  42.703  26.926  1.00 27.32 ? 133 GLY F CA  1 
ATOM   8975  C C   . GLY F 1 113 ? 21.873  42.575  27.834  1.00 27.04 ? 133 GLY F C   1 
ATOM   8976  O O   . GLY F 1 113 ? 20.785  42.975  27.434  1.00 26.71 ? 133 GLY F O   1 
ATOM   8977  N N   . THR F 1 114 ? 22.064  42.032  29.044  1.00 26.01 ? 134 THR F N   1 
ATOM   8978  C CA  . THR F 1 114 ? 20.985  41.865  30.022  1.00 23.28 ? 134 THR F CA  1 
ATOM   8979  C C   . THR F 1 114 ? 20.376  43.189  30.401  1.00 22.29 ? 134 THR F C   1 
ATOM   8980  O O   . THR F 1 114 ? 21.091  44.143  30.712  1.00 22.12 ? 134 THR F O   1 
ATOM   8981  C CB  . THR F 1 114 ? 21.460  41.244  31.333  1.00 24.58 ? 134 THR F CB  1 
ATOM   8982  O OG1 . THR F 1 114 ? 21.990  39.939  31.088  1.00 29.14 ? 134 THR F OG1 1 
ATOM   8983  C CG2 . THR F 1 114 ? 20.297  41.132  32.306  1.00 24.50 ? 134 THR F CG2 1 
ATOM   8984  N N   . GLN F 1 115 ? 19.052  43.235  30.404  1.00 20.63 ? 135 GLN F N   1 
ATOM   8985  C CA  . GLN F 1 115 ? 18.352  44.448  30.759  1.00 19.93 ? 135 GLN F CA  1 
ATOM   8986  C C   . GLN F 1 115 ? 18.137  44.443  32.277  1.00 19.48 ? 135 GLN F C   1 
ATOM   8987  O O   . GLN F 1 115 ? 17.756  43.419  32.864  1.00 20.28 ? 135 GLN F O   1 
ATOM   8988  C CB  . GLN F 1 115 ? 17.039  44.508  29.997  1.00 23.12 ? 135 GLN F CB  1 
ATOM   8989  C CG  . GLN F 1 115 ? 16.479  45.910  29.817  1.00 26.90 ? 135 GLN F CG  1 
ATOM   8990  C CD  . GLN F 1 115 ? 15.030  45.891  29.349  0.00 26.69 ? 135 GLN F CD  1 
ATOM   8991  O OE1 . GLN F 1 115 ? 14.113  46.204  30.107  0.00 26.78 ? 135 GLN F OE1 1 
ATOM   8992  N NE2 . GLN F 1 115 ? 14.820  45.517  28.095  0.00 26.79 ? 135 GLN F NE2 1 
ATOM   8993  N N   . CYS F 1 116 ? 18.411  45.585  32.900  1.00 17.72 ? 136 CYS F N   1 
ATOM   8994  C CA  . CYS F 1 116 ? 18.303  45.748  34.349  1.00 17.47 ? 136 CYS F CA  1 
ATOM   8995  C C   . CYS F 1 116 ? 17.513  46.998  34.784  1.00 17.55 ? 136 CYS F C   1 
ATOM   8996  O O   . CYS F 1 116 ? 17.276  47.912  33.982  1.00 19.21 ? 136 CYS F O   1 
ATOM   8997  C CB  . CYS F 1 116 ? 19.720  45.820  34.927  1.00 14.24 ? 136 CYS F CB  1 
ATOM   8998  S SG  . CYS F 1 116 ? 20.773  44.496  34.277  1.00 11.20 ? 136 CYS F SG  1 
ATOM   8999  N N   . LEU F 1 117 ? 17.125  47.041  36.059  1.00 14.17 ? 137 LEU F N   1 
ATOM   9000  C CA  . LEU F 1 117 ? 16.399  48.181  36.611  1.00 12.06 ? 137 LEU F CA  1 
ATOM   9001  C C   . LEU F 1 117 ? 17.257  48.887  37.665  1.00 12.66 ? 137 LEU F C   1 
ATOM   9002  O O   . LEU F 1 117 ? 17.623  48.286  38.687  1.00 12.51 ? 137 LEU F O   1 
ATOM   9003  C CB  . LEU F 1 117 ? 15.067  47.733  37.238  1.00 10.64 ? 137 LEU F CB  1 
ATOM   9004  C CG  . LEU F 1 117 ? 14.189  48.783  37.939  1.00 7.89  ? 137 LEU F CG  1 
ATOM   9005  C CD1 . LEU F 1 117 ? 13.835  49.894  36.967  1.00 7.46  ? 137 LEU F CD1 1 
ATOM   9006  C CD2 . LEU F 1 117 ? 12.935  48.137  38.488  1.00 5.00  ? 137 LEU F CD2 1 
ATOM   9007  N N   . ILE F 1 118 ? 17.615  50.135  37.372  1.00 10.98 ? 138 ILE F N   1 
ATOM   9008  C CA  . ILE F 1 118 ? 18.410  50.986  38.263  1.00 14.03 ? 138 ILE F CA  1 
ATOM   9009  C C   . ILE F 1 118 ? 17.428  51.985  38.930  1.00 14.68 ? 138 ILE F C   1 
ATOM   9010  O O   . ILE F 1 118 ? 16.584  52.586  38.249  1.00 16.45 ? 138 ILE F O   1 
ATOM   9011  C CB  . ILE F 1 118 ? 19.477  51.777  37.443  1.00 13.28 ? 138 ILE F CB  1 
ATOM   9012  C CG1 . ILE F 1 118 ? 20.270  50.811  36.563  1.00 12.77 ? 138 ILE F CG1 1 
ATOM   9013  C CG2 . ILE F 1 118 ? 20.435  52.540  38.364  1.00 11.25 ? 138 ILE F CG2 1 
ATOM   9014  C CD1 . ILE F 1 118 ? 21.159  51.499  35.580  1.00 14.22 ? 138 ILE F CD1 1 
ATOM   9015  N N   . SER F 1 119 ? 17.539  52.190  40.239  1.00 12.67 ? 139 SER F N   1 
ATOM   9016  C CA  . SER F 1 119 ? 16.619  53.094  40.919  1.00 10.24 ? 139 SER F CA  1 
ATOM   9017  C C   . SER F 1 119 ? 17.278  53.953  41.985  1.00 13.24 ? 139 SER F C   1 
ATOM   9018  O O   . SER F 1 119 ? 18.302  53.581  42.563  1.00 16.13 ? 139 SER F O   1 
ATOM   9019  C CB  . SER F 1 119 ? 15.528  52.283  41.579  1.00 8.70  ? 139 SER F CB  1 
ATOM   9020  O OG  . SER F 1 119 ? 16.121  51.330  42.448  1.00 5.85  ? 139 SER F OG  1 
ATOM   9021  N N   . GLY F 1 120 ? 16.649  55.081  42.292  1.00 13.39 ? 140 GLY F N   1 
ATOM   9022  C CA  . GLY F 1 120 ? 17.188  55.978  43.293  1.00 12.15 ? 140 GLY F CA  1 
ATOM   9023  C C   . GLY F 1 120 ? 16.469  57.313  43.313  1.00 12.07 ? 140 GLY F C   1 
ATOM   9024  O O   . GLY F 1 120 ? 15.600  57.582  42.468  1.00 11.09 ? 140 GLY F O   1 
ATOM   9025  N N   . TRP F 1 121 ? 16.840  58.152  44.281  1.00 11.08 ? 141 TRP F N   1 
ATOM   9026  C CA  . TRP F 1 121 ? 16.255  59.482  44.463  1.00 7.48  ? 141 TRP F CA  1 
ATOM   9027  C C   . TRP F 1 121 ? 17.253  60.542  44.071  1.00 5.36  ? 141 TRP F C   1 
ATOM   9028  O O   . TRP F 1 121 ? 17.119  61.688  44.440  1.00 5.00  ? 141 TRP F O   1 
ATOM   9029  C CB  . TRP F 1 121 ? 15.895  59.692  45.934  1.00 8.67  ? 141 TRP F CB  1 
ATOM   9030  C CG  . TRP F 1 121 ? 14.644  58.985  46.390  1.00 9.45  ? 141 TRP F CG  1 
ATOM   9031  C CD1 . TRP F 1 121 ? 13.357  59.397  46.203  1.00 8.99  ? 141 TRP F CD1 1 
ATOM   9032  C CD2 . TRP F 1 121 ? 14.569  57.786  47.164  1.00 8.54  ? 141 TRP F CD2 1 
ATOM   9033  N NE1 . TRP F 1 121 ? 12.492  58.534  46.815  1.00 5.00  ? 141 TRP F NE1 1 
ATOM   9034  C CE2 . TRP F 1 121 ? 13.210  57.537  47.415  1.00 5.00  ? 141 TRP F CE2 1 
ATOM   9035  C CE3 . TRP F 1 121 ? 15.522  56.904  47.679  1.00 12.80 ? 141 TRP F CE3 1 
ATOM   9036  C CZ2 . TRP F 1 121 ? 12.777  56.444  48.158  1.00 5.65  ? 141 TRP F CZ2 1 
ATOM   9037  C CZ3 . TRP F 1 121 ? 15.083  55.811  48.426  1.00 13.91 ? 141 TRP F CZ3 1 
ATOM   9038  C CH2 . TRP F 1 121 ? 13.722  55.595  48.656  1.00 9.14  ? 141 TRP F CH2 1 
ATOM   9039  N N   . GLY F 1 122 ? 18.284  60.133  43.352  1.00 9.66  ? 142 GLY F N   1 
ATOM   9040  C CA  . GLY F 1 122 ? 19.328  61.052  42.951  1.00 12.44 ? 142 GLY F CA  1 
ATOM   9041  C C   . GLY F 1 122 ? 18.875  62.052  41.930  1.00 13.68 ? 142 GLY F C   1 
ATOM   9042  O O   . GLY F 1 122 ? 17.797  61.923  41.370  1.00 15.58 ? 142 GLY F O   1 
ATOM   9043  N N   . ASN F 1 123 ? 19.737  63.019  41.655  1.00 15.46 ? 143 ASN F N   1 
ATOM   9044  C CA  . ASN F 1 123 ? 19.471  64.078  40.695  1.00 17.73 ? 143 ASN F CA  1 
ATOM   9045  C C   . ASN F 1 123 ? 18.857  63.515  39.415  1.00 20.28 ? 143 ASN F C   1 
ATOM   9046  O O   . ASN F 1 123 ? 19.112  62.362  39.034  1.00 18.61 ? 143 ASN F O   1 
ATOM   9047  C CB  . ASN F 1 123 ? 20.789  64.798  40.381  1.00 19.24 ? 143 ASN F CB  1 
ATOM   9048  C CG  . ASN F 1 123 ? 20.602  66.067  39.558  1.00 22.23 ? 143 ASN F CG  1 
ATOM   9049  O OD1 . ASN F 1 123 ? 19.478  66.529  39.354  1.00 22.12 ? 143 ASN F OD1 1 
ATOM   9050  N ND2 . ASN F 1 123 ? 21.715  66.660  39.110  1.00 22.97 ? 143 ASN F ND2 1 
ATOM   9051  N N   . THR F 1 124 ? 17.961  64.290  38.821  1.00 24.63 ? 144 THR F N   1 
ATOM   9052  C CA  . THR F 1 124 ? 17.325  63.909  37.569  1.00 27.97 ? 144 THR F CA  1 
ATOM   9053  C C   . THR F 1 124 ? 17.942  64.655  36.372  1.00 31.98 ? 144 THR F C   1 
ATOM   9054  O O   . THR F 1 124 ? 18.093  64.074  35.293  1.00 33.28 ? 144 THR F O   1 
ATOM   9055  C CB  . THR F 1 124 ? 15.785  64.120  37.605  1.00 27.02 ? 144 THR F CB  1 
ATOM   9056  O OG1 . THR F 1 124 ? 15.459  65.372  38.223  1.00 26.52 ? 144 THR F OG1 1 
ATOM   9057  C CG2 . THR F 1 124 ? 15.122  63.005  38.376  1.00 28.52 ? 144 THR F CG2 1 
ATOM   9058  N N   . LYS F 1 125 ? 18.345  65.912  36.583  1.00 34.21 ? 145 LYS F N   1 
ATOM   9059  C CA  . LYS F 1 125 ? 18.937  66.734  35.525  1.00 37.15 ? 145 LYS F CA  1 
ATOM   9060  C C   . LYS F 1 125 ? 20.400  66.430  35.194  1.00 38.60 ? 145 LYS F C   1 
ATOM   9061  O O   . LYS F 1 125 ? 21.220  66.171  36.079  1.00 37.02 ? 145 LYS F O   1 
ATOM   9062  C CB  . LYS F 1 125 ? 18.789  68.222  35.847  1.00 42.05 ? 145 LYS F CB  1 
ATOM   9063  C CG  . LYS F 1 125 ? 17.389  68.796  35.648  1.00 45.19 ? 145 LYS F CG  1 
ATOM   9064  C CD  . LYS F 1 125 ? 17.413  70.318  35.796  1.00 47.81 ? 145 LYS F CD  1 
ATOM   9065  C CE  . LYS F 1 125 ? 16.057  70.938  35.492  1.00 51.17 ? 145 LYS F CE  1 
ATOM   9066  N NZ  . LYS F 1 125 ? 16.093  72.433  35.533  1.00 54.77 ? 145 LYS F NZ  1 
ATOM   9067  N N   . SER F 1 126 ? 20.706  66.470  33.900  1.00 42.08 ? 146 SER F N   1 
ATOM   9068  C CA  . SER F 1 126 ? 22.049  66.221  33.393  1.00 44.72 ? 146 SER F CA  1 
ATOM   9069  C C   . SER F 1 126 ? 22.912  67.419  33.747  1.00 48.94 ? 146 SER F C   1 
ATOM   9070  O O   . SER F 1 126 ? 24.049  67.267  34.206  1.00 52.38 ? 146 SER F O   1 
ATOM   9071  C CB  . SER F 1 126 ? 22.007  66.033  31.878  1.00 42.78 ? 146 SER F CB  1 
ATOM   9072  O OG  . SER F 1 126 ? 21.220  67.038  31.257  0.00 45.31 ? 146 SER F OG  1 
ATOM   9073  N N   . SER F 1 127 ? 22.361  68.608  33.499  1.00 50.96 ? 147 SER F N   1 
ATOM   9074  C CA  . SER F 1 127 ? 23.017  69.879  33.799  1.00 50.30 ? 147 SER F CA  1 
ATOM   9075  C C   . SER F 1 127 ? 22.116  70.601  34.811  1.00 47.83 ? 147 SER F C   1 
ATOM   9076  O O   . SER F 1 127 ? 20.988  70.999  34.498  1.00 46.37 ? 147 SER F O   1 
ATOM   9077  C CB  . SER F 1 127 ? 23.191  70.718  32.523  1.00 50.64 ? 147 SER F CB  1 
ATOM   9078  O OG  . SER F 1 127 ? 23.835  69.975  31.502  0.00 52.19 ? 147 SER F OG  1 
ATOM   9079  N N   . GLY F 1 128 ? 22.600  70.718  36.039  1.00 45.53 ? 148 GLY F N   1 
ATOM   9080  C CA  . GLY F 1 128 ? 21.827  71.367  37.074  1.00 44.36 ? 148 GLY F CA  1 
ATOM   9081  C C   . GLY F 1 128 ? 21.368  70.324  38.075  1.00 45.59 ? 148 GLY F C   1 
ATOM   9082  O O   . GLY F 1 128 ? 21.369  69.125  37.786  1.00 46.10 ? 148 GLY F O   1 
ATOM   9083  N N   . THR F 1 129 ? 20.993  70.769  39.266  1.00 43.71 ? 149 THR F N   1 
ATOM   9084  C CA  . THR F 1 129 ? 20.546  69.854  40.301  1.00 39.45 ? 149 THR F CA  1 
ATOM   9085  C C   . THR F 1 129 ? 19.042  69.951  40.514  1.00 36.41 ? 149 THR F C   1 
ATOM   9086  O O   . THR F 1 129 ? 18.523  71.030  40.819  1.00 37.44 ? 149 THR F O   1 
ATOM   9087  C CB  . THR F 1 129 ? 21.268  70.128  41.636  0.00 39.67 ? 149 THR F CB  1 
ATOM   9088  O OG1 . THR F 1 129 ? 21.327  71.541  41.871  0.00 39.15 ? 149 THR F OG1 1 
ATOM   9089  C CG2 . THR F 1 129 ? 22.678  69.558  41.610  0.00 39.12 ? 149 THR F CG2 1 
ATOM   9090  N N   . SER F 1 130 ? 18.360  68.816  40.351  1.00 31.73 ? 150 SER F N   1 
ATOM   9091  C CA  . SER F 1 130 ? 16.920  68.707  40.530  1.00 25.94 ? 150 SER F CA  1 
ATOM   9092  C C   . SER F 1 130 ? 16.706  67.362  41.191  1.00 22.62 ? 150 SER F C   1 
ATOM   9093  O O   . SER F 1 130 ? 16.503  66.360  40.526  1.00 21.73 ? 150 SER F O   1 
ATOM   9094  C CB  . SER F 1 130 ? 16.207  68.773  39.172  0.00 27.34 ? 150 SER F CB  1 
ATOM   9095  O OG  . SER F 1 130 ? 14.797  68.747  39.314  0.00 25.35 ? 150 SER F OG  1 
ATOM   9096  N N   . TYR F 1 131 ? 16.859  67.328  42.505  1.00 23.17 ? 151 TYR F N   1 
ATOM   9097  C CA  . TYR F 1 131 ? 16.671  66.095  43.275  1.00 22.87 ? 151 TYR F CA  1 
ATOM   9098  C C   . TYR F 1 131 ? 15.193  65.784  43.544  1.00 21.98 ? 151 TYR F C   1 
ATOM   9099  O O   . TYR F 1 131 ? 14.507  66.518  44.258  1.00 19.87 ? 151 TYR F O   1 
ATOM   9100  C CB  . TYR F 1 131 ? 17.460  66.157  44.592  1.00 21.70 ? 151 TYR F CB  1 
ATOM   9101  C CG  . TYR F 1 131 ? 18.966  66.144  44.386  1.00 23.40 ? 151 TYR F CG  1 
ATOM   9102  C CD1 . TYR F 1 131 ? 19.653  64.943  44.201  1.00 22.51 ? 151 TYR F CD1 1 
ATOM   9103  C CD2 . TYR F 1 131 ? 19.694  67.331  44.339  1.00 25.12 ? 151 TYR F CD2 1 
ATOM   9104  C CE1 . TYR F 1 131 ? 21.008  64.927  43.972  1.00 23.89 ? 151 TYR F CE1 1 
ATOM   9105  C CE2 . TYR F 1 131 ? 21.056  67.323  44.108  1.00 25.28 ? 151 TYR F CE2 1 
ATOM   9106  C CZ  . TYR F 1 131 ? 21.703  66.120  43.920  1.00 26.33 ? 151 TYR F CZ  1 
ATOM   9107  O OH  . TYR F 1 131 ? 23.045  66.116  43.633  1.00 30.30 ? 151 TYR F OH  1 
ATOM   9108  N N   . PRO F 1 132 ? 14.675  64.707  42.933  1.00 22.81 ? 152 PRO F N   1 
ATOM   9109  C CA  . PRO F 1 132 ? 13.283  64.250  43.066  1.00 24.90 ? 152 PRO F CA  1 
ATOM   9110  C C   . PRO F 1 132 ? 12.860  63.740  44.442  1.00 27.52 ? 152 PRO F C   1 
ATOM   9111  O O   . PRO F 1 132 ? 13.633  63.171  45.197  1.00 24.78 ? 152 PRO F O   1 
ATOM   9112  C CB  . PRO F 1 132 ? 13.180  63.139  42.020  1.00 23.32 ? 152 PRO F CB  1 
ATOM   9113  C CG  . PRO F 1 132 ? 14.564  62.576  41.999  1.00 26.43 ? 152 PRO F CG  1 
ATOM   9114  C CD  . PRO F 1 132 ? 15.414  63.843  41.996  1.00 24.94 ? 152 PRO F CD  1 
ATOM   9115  N N   . ASP F 1 133 ? 11.589  63.939  44.741  1.00 34.76 ? 153 ASP F N   1 
ATOM   9116  C CA  . ASP F 1 133 ? 11.014  63.511  46.000  1.00 36.91 ? 153 ASP F CA  1 
ATOM   9117  C C   . ASP F 1 133 ? 10.653  62.041  45.936  1.00 31.34 ? 153 ASP F C   1 
ATOM   9118  O O   . ASP F 1 133 ? 10.750  61.310  46.920  1.00 32.77 ? 153 ASP F O   1 
ATOM   9119  C CB  . ASP F 1 133 ? 9.764   64.329  46.284  1.00 45.71 ? 153 ASP F CB  1 
ATOM   9120  C CG  . ASP F 1 133 ? 10.056  65.575  47.084  1.00 58.28 ? 153 ASP F CG  1 
ATOM   9121  O OD1 . ASP F 1 133 ? 9.396   65.744  48.133  1.00 66.26 ? 153 ASP F OD1 1 
ATOM   9122  O OD2 . ASP F 1 133 ? 10.936  66.376  46.676  1.00 65.08 ? 153 ASP F OD2 1 
ATOM   9123  N N   . VAL F 1 134 ? 10.195  61.620  44.772  1.00 24.20 ? 154 VAL F N   1 
ATOM   9124  C CA  . VAL F 1 134 ? 9.809   60.244  44.586  1.00 20.89 ? 154 VAL F CA  1 
ATOM   9125  C C   . VAL F 1 134 ? 10.885  59.390  43.932  1.00 20.44 ? 154 VAL F C   1 
ATOM   9126  O O   . VAL F 1 134 ? 11.777  59.884  43.217  1.00 20.08 ? 154 VAL F O   1 
ATOM   9127  C CB  . VAL F 1 134 ? 8.517   60.145  43.773  1.00 20.60 ? 154 VAL F CB  1 
ATOM   9128  C CG1 . VAL F 1 134 ? 7.394   60.773  44.540  1.00 21.94 ? 154 VAL F CG1 1 
ATOM   9129  C CG2 . VAL F 1 134 ? 8.673   60.845  42.444  1.00 22.36 ? 154 VAL F CG2 1 
ATOM   9130  N N   . LEU F 1 135 ? 10.785  58.095  44.189  1.00 18.77 ? 155 LEU F N   1 
ATOM   9131  C CA  . LEU F 1 135 ? 11.713  57.135  43.640  1.00 16.44 ? 155 LEU F CA  1 
ATOM   9132  C C   . LEU F 1 135 ? 11.572  57.044  42.118  1.00 17.54 ? 155 LEU F C   1 
ATOM   9133  O O   . LEU F 1 135 ? 10.459  56.873  41.592  1.00 17.24 ? 155 LEU F O   1 
ATOM   9134  C CB  . LEU F 1 135 ? 11.447  55.767  44.245  1.00 9.36  ? 155 LEU F CB  1 
ATOM   9135  C CG  . LEU F 1 135 ? 12.507  54.732  43.922  1.00 5.99  ? 155 LEU F CG  1 
ATOM   9136  C CD1 . LEU F 1 135 ? 13.780  55.089  44.658  1.00 5.00  ? 155 LEU F CD1 1 
ATOM   9137  C CD2 . LEU F 1 135 ? 12.002  53.359  44.316  1.00 5.00  ? 155 LEU F CD2 1 
ATOM   9138  N N   . LYS F 1 136 ? 12.708  57.140  41.427  1.00 16.17 ? 156 LYS F N   1 
ATOM   9139  C CA  . LYS F 1 136 ? 12.766  57.043  39.977  1.00 13.10 ? 156 LYS F CA  1 
ATOM   9140  C C   . LYS F 1 136 ? 13.347  55.687  39.596  1.00 9.66  ? 156 LYS F C   1 
ATOM   9141  O O   . LYS F 1 136 ? 14.140  55.104  40.331  1.00 7.02  ? 156 LYS F O   1 
ATOM   9142  C CB  . LYS F 1 136 ? 13.632  58.166  39.419  1.00 16.97 ? 156 LYS F CB  1 
ATOM   9143  C CG  . LYS F 1 136 ? 13.114  59.548  39.753  1.00 20.91 ? 156 LYS F CG  1 
ATOM   9144  C CD  . LYS F 1 136 ? 11.800  59.791  39.049  1.00 26.12 ? 156 LYS F CD  1 
ATOM   9145  C CE  . LYS F 1 136 ? 11.199  61.112  39.483  1.00 32.19 ? 156 LYS F CE  1 
ATOM   9146  N NZ  . LYS F 1 136 ? 9.951   61.484  38.721  1.00 34.78 ? 156 LYS F NZ  1 
ATOM   9147  N N   . CYS F 1 137 ? 12.916  55.175  38.458  1.00 11.48 ? 157 CYS F N   1 
ATOM   9148  C CA  . CYS F 1 137 ? 13.371  53.890  37.952  1.00 15.06 ? 157 CYS F CA  1 
ATOM   9149  C C   . CYS F 1 137 ? 13.916  54.088  36.544  1.00 17.46 ? 157 CYS F C   1 
ATOM   9150  O O   . CYS F 1 137 ? 13.537  55.036  35.851  1.00 20.06 ? 157 CYS F O   1 
ATOM   9151  C CB  . CYS F 1 137 ? 12.212  52.890  37.925  1.00 14.47 ? 157 CYS F CB  1 
ATOM   9152  S SG  . CYS F 1 137 ? 11.794  52.099  39.522  1.00 10.27 ? 157 CYS F SG  1 
ATOM   9153  N N   . LEU F 1 138 ? 14.823  53.212  36.131  1.00 18.76 ? 158 LEU F N   1 
ATOM   9154  C CA  . LEU F 1 138 ? 15.428  53.298  34.804  1.00 20.59 ? 158 LEU F CA  1 
ATOM   9155  C C   . LEU F 1 138 ? 15.795  51.928  34.298  1.00 21.83 ? 158 LEU F C   1 
ATOM   9156  O O   . LEU F 1 138 ? 16.510  51.173  34.973  1.00 20.66 ? 158 LEU F O   1 
ATOM   9157  C CB  . LEU F 1 138 ? 16.700  54.157  34.831  1.00 20.49 ? 158 LEU F CB  1 
ATOM   9158  C CG  . LEU F 1 138 ? 17.477  54.260  33.514  1.00 18.64 ? 158 LEU F CG  1 
ATOM   9159  C CD1 . LEU F 1 138 ? 16.552  54.785  32.441  1.00 20.13 ? 158 LEU F CD1 1 
ATOM   9160  C CD2 . LEU F 1 138 ? 18.681  55.172  33.658  1.00 18.52 ? 158 LEU F CD2 1 
ATOM   9161  N N   . LYS F 1 139 ? 15.255  51.585  33.137  1.00 22.80 ? 159 LYS F N   1 
ATOM   9162  C CA  . LYS F 1 139 ? 15.568  50.304  32.527  1.00 24.29 ? 159 LYS F CA  1 
ATOM   9163  C C   . LYS F 1 139 ? 16.856  50.616  31.762  1.00 25.35 ? 159 LYS F C   1 
ATOM   9164  O O   . LYS F 1 139 ? 16.991  51.704  31.199  1.00 27.74 ? 159 LYS F O   1 
ATOM   9165  C CB  . LYS F 1 139 ? 14.456  49.889  31.564  0.00 24.72 ? 159 LYS F CB  1 
ATOM   9166  C CG  . LYS F 1 139 ? 13.095  49.758  32.226  0.00 27.12 ? 159 LYS F CG  1 
ATOM   9167  C CD  . LYS F 1 139 ? 13.067  48.602  33.213  0.00 29.41 ? 159 LYS F CD  1 
ATOM   9168  C CE  . LYS F 1 139 ? 11.801  48.622  34.049  0.00 30.38 ? 159 LYS F CE  1 
ATOM   9169  N NZ  . LYS F 1 139 ? 10.572  48.733  33.215  0.00 30.57 ? 159 LYS F NZ  1 
ATOM   9170  N N   . ALA F 1 140 ? 17.837  49.731  31.817  1.00 21.33 ? 160 ALA F N   1 
ATOM   9171  C CA  . ALA F 1 140 ? 19.086  49.966  31.108  1.00 18.12 ? 160 ALA F CA  1 
ATOM   9172  C C   . ALA F 1 140 ? 19.772  48.626  30.968  1.00 21.09 ? 160 ALA F C   1 
ATOM   9173  O O   . ALA F 1 140 ? 19.611  47.737  31.818  1.00 22.58 ? 160 ALA F O   1 
ATOM   9174  C CB  . ALA F 1 140 ? 19.963  50.926  31.878  1.00 15.91 ? 160 ALA F CB  1 
ATOM   9175  N N   . PRO F 1 141 ? 20.496  48.430  29.866  1.00 14.77 ? 161 PRO F N   1 
ATOM   9176  C CA  . PRO F 1 141 ? 21.179  47.156  29.669  1.00 14.94 ? 161 PRO F CA  1 
ATOM   9177  C C   . PRO F 1 141 ? 22.587  47.189  30.211  1.00 14.52 ? 161 PRO F C   1 
ATOM   9178  O O   . PRO F 1 141 ? 23.088  48.250  30.611  1.00 14.42 ? 161 PRO F O   1 
ATOM   9179  C CB  . PRO F 1 141 ? 21.188  47.031  28.163  1.00 14.41 ? 161 PRO F CB  1 
ATOM   9180  C CG  . PRO F 1 141 ? 21.447  48.454  27.760  1.00 16.38 ? 161 PRO F CG  1 
ATOM   9181  C CD  . PRO F 1 141 ? 20.547  49.258  28.653  1.00 14.23 ? 161 PRO F CD  1 
ATOM   9182  N N   . ILE F 1 142 ? 23.197  46.009  30.244  1.00 14.15 ? 162 ILE F N   1 
ATOM   9183  C CA  . ILE F 1 142 ? 24.570  45.830  30.690  1.00 14.18 ? 162 ILE F CA  1 
ATOM   9184  C C   . ILE F 1 142 ? 25.420  45.906  29.433  1.00 11.82 ? 162 ILE F C   1 
ATOM   9185  O O   . ILE F 1 142 ? 25.242  45.095  28.525  1.00 8.40  ? 162 ILE F O   1 
ATOM   9186  C CB  . ILE F 1 142 ? 24.737  44.452  31.375  1.00 13.77 ? 162 ILE F CB  1 
ATOM   9187  C CG1 . ILE F 1 142 ? 24.233  44.538  32.813  1.00 13.27 ? 162 ILE F CG1 1 
ATOM   9188  C CG2 . ILE F 1 142 ? 26.178  43.972  31.330  1.00 12.82 ? 162 ILE F CG2 1 
ATOM   9189  C CD1 . ILE F 1 142 ? 24.167  43.207  33.487  1.00 12.44 ? 162 ILE F CD1 1 
ATOM   9190  N N   . LEU F 1 143 ? 26.288  46.916  29.356  1.00 13.91 ? 163 LEU F N   1 
ATOM   9191  C CA  . LEU F 1 143 ? 27.159  47.098  28.192  1.00 16.46 ? 163 LEU F CA  1 
ATOM   9192  C C   . LEU F 1 143 ? 28.305  46.102  28.238  1.00 18.14 ? 163 LEU F C   1 
ATOM   9193  O O   . LEU F 1 143 ? 28.625  45.525  29.285  1.00 13.59 ? 163 LEU F O   1 
ATOM   9194  C CB  . LEU F 1 143 ? 27.732  48.514  28.117  1.00 15.12 ? 163 LEU F CB  1 
ATOM   9195  C CG  . LEU F 1 143 ? 26.837  49.716  28.429  1.00 15.61 ? 163 LEU F CG  1 
ATOM   9196  C CD1 . LEU F 1 143 ? 27.594  50.982  28.107  1.00 18.55 ? 163 LEU F CD1 1 
ATOM   9197  C CD2 . LEU F 1 143 ? 25.579  49.674  27.606  1.00 16.11 ? 163 LEU F CD2 1 
ATOM   9198  N N   . SER F 1 144 ? 28.932  45.909  27.090  1.00 22.78 ? 164 SER F N   1 
ATOM   9199  C CA  . SER F 1 144 ? 30.037  44.966  26.985  1.00 26.52 ? 164 SER F CA  1 
ATOM   9200  C C   . SER F 1 144 ? 31.307  45.497  27.647  1.00 26.48 ? 164 SER F C   1 
ATOM   9201  O O   . SER F 1 144 ? 31.690  46.658  27.451  1.00 27.37 ? 164 SER F O   1 
ATOM   9202  C CB  . SER F 1 144 ? 30.289  44.618  25.513  1.00 28.60 ? 164 SER F CB  1 
ATOM   9203  O OG  . SER F 1 144 ? 30.234  45.778  24.690  1.00 36.35 ? 164 SER F OG  1 
ATOM   9204  N N   . ASP F 1 145 ? 31.951  44.640  28.434  0.00 25.17 ? 165 ASP F N   1 
ATOM   9205  C CA  . ASP F 1 145 ? 33.186  44.985  29.135  0.00 24.29 ? 165 ASP F CA  1 
ATOM   9206  C C   . ASP F 1 145 ? 34.099  45.813  28.231  0.00 25.21 ? 165 ASP F C   1 
ATOM   9207  O O   . ASP F 1 145 ? 34.825  46.694  28.687  0.00 26.98 ? 165 ASP F O   1 
ATOM   9208  C CB  . ASP F 1 145 ? 33.898  43.705  29.580  0.00 24.09 ? 165 ASP F CB  1 
ATOM   9209  C CG  . ASP F 1 145 ? 35.184  43.978  30.331  0.00 21.96 ? 165 ASP F CG  1 
ATOM   9210  O OD1 . ASP F 1 145 ? 35.140  44.682  31.362  0.00 20.31 ? 165 ASP F OD1 1 
ATOM   9211  O OD2 . ASP F 1 145 ? 36.241  43.483  29.888  0.00 20.27 ? 165 ASP F OD2 1 
ATOM   9212  N N   . SER F 1 146 ? 33.988  45.557  26.936  1.00 24.97 ? 166 SER F N   1 
ATOM   9213  C CA  . SER F 1 146 ? 34.754  46.245  25.903  1.00 28.76 ? 166 SER F CA  1 
ATOM   9214  C C   . SER F 1 146 ? 34.371  47.722  25.757  1.00 30.39 ? 166 SER F C   1 
ATOM   9215  O O   . SER F 1 146 ? 35.213  48.603  25.920  1.00 33.24 ? 166 SER F O   1 
ATOM   9216  C CB  . SER F 1 146 ? 34.600  45.515  24.563  1.00 26.75 ? 166 SER F CB  1 
ATOM   9217  O OG  . SER F 1 146 ? 33.250  45.143  24.334  0.00 28.19 ? 166 SER F OG  1 
ATOM   9218  N N   . SER F 1 147 ? 33.107  48.000  25.455  1.00 30.28 ? 167 SER F N   1 
ATOM   9219  C CA  . SER F 1 147 ? 32.648  49.384  25.310  1.00 29.07 ? 167 SER F CA  1 
ATOM   9220  C C   . SER F 1 147 ? 32.883  50.111  26.614  1.00 25.33 ? 167 SER F C   1 
ATOM   9221  O O   . SER F 1 147 ? 33.130  51.305  26.650  1.00 21.07 ? 167 SER F O   1 
ATOM   9222  C CB  . SER F 1 147 ? 31.169  49.428  24.957  1.00 32.31 ? 167 SER F CB  1 
ATOM   9223  O OG  . SER F 1 147 ? 30.907  48.612  23.824  1.00 34.87 ? 167 SER F OG  1 
ATOM   9224  N N   . CYS F 1 148 ? 32.817  49.364  27.696  1.00 23.57 ? 168 CYS F N   1 
ATOM   9225  C CA  . CYS F 1 148 ? 33.064  49.936  29.001  1.00 21.89 ? 168 CYS F CA  1 
ATOM   9226  C C   . CYS F 1 148 ? 34.538  50.394  29.072  1.00 19.86 ? 168 CYS F C   1 
ATOM   9227  O O   . CYS F 1 148 ? 34.817  51.601  29.114  1.00 19.02 ? 168 CYS F O   1 
ATOM   9228  C CB  . CYS F 1 148 ? 32.761  48.899  30.089  1.00 20.83 ? 168 CYS F CB  1 
ATOM   9229  S SG  . CYS F 1 148 ? 32.614  49.619  31.744  1.00 20.67 ? 168 CYS F SG  1 
ATOM   9230  N N   . LYS F 1 149 ? 35.467  49.439  29.003  1.00 15.80 ? 169 LYS F N   1 
ATOM   9231  C CA  . LYS F 1 149 ? 36.886  49.738  29.080  1.00 13.80 ? 169 LYS F CA  1 
ATOM   9232  C C   . LYS F 1 149 ? 37.300  50.830  28.103  1.00 15.72 ? 169 LYS F C   1 
ATOM   9233  O O   . LYS F 1 149 ? 38.171  51.648  28.415  1.00 16.21 ? 169 LYS F O   1 
ATOM   9234  C CB  . LYS F 1 149 ? 37.708  48.476  28.846  1.00 12.09 ? 169 LYS F CB  1 
ATOM   9235  C CG  . LYS F 1 149 ? 37.783  47.587  30.030  1.00 12.46 ? 169 LYS F CG  1 
ATOM   9236  C CD  . LYS F 1 149 ? 38.570  46.335  29.719  1.00 13.45 ? 169 LYS F CD  1 
ATOM   9237  C CE  . LYS F 1 149 ? 38.712  45.439  30.957  0.00 14.52 ? 169 LYS F CE  1 
ATOM   9238  N NZ  . LYS F 1 149 ? 39.568  46.036  32.024  0.00 15.21 ? 169 LYS F NZ  1 
ATOM   9239  N N   . SER F 1 150 ? 36.686  50.840  26.923  1.00 16.58 ? 170 SER F N   1 
ATOM   9240  C CA  . SER F 1 150 ? 37.015  51.842  25.921  1.00 18.67 ? 170 SER F CA  1 
ATOM   9241  C C   . SER F 1 150 ? 36.585  53.230  26.373  1.00 22.30 ? 170 SER F C   1 
ATOM   9242  O O   . SER F 1 150 ? 37.301  54.205  26.142  1.00 24.79 ? 170 SER F O   1 
ATOM   9243  C CB  . SER F 1 150 ? 36.399  51.496  24.563  1.00 15.77 ? 170 SER F CB  1 
ATOM   9244  O OG  . SER F 1 150 ? 35.020  51.204  24.676  0.00 15.58 ? 170 SER F OG  1 
ATOM   9245  N N   . ALA F 1 151 ? 35.438  53.306  27.052  1.00 23.80 ? 171 ALA F N   1 
ATOM   9246  C CA  . ALA F 1 151 ? 34.897  54.572  27.557  1.00 21.25 ? 171 ALA F CA  1 
ATOM   9247  C C   . ALA F 1 151 ? 35.739  55.110  28.697  1.00 19.21 ? 171 ALA F C   1 
ATOM   9248  O O   . ALA F 1 151 ? 35.947  56.307  28.796  1.00 16.50 ? 171 ALA F O   1 
ATOM   9249  C CB  . ALA F 1 151 ? 33.471  54.387  28.010  1.00 21.07 ? 171 ALA F CB  1 
ATOM   9250  N N   . TYR F 1 152 ? 36.189  54.218  29.571  1.00 19.61 ? 172 TYR F N   1 
ATOM   9251  C CA  . TYR F 1 152 ? 37.032  54.587  30.707  1.00 21.84 ? 172 TYR F CA  1 
ATOM   9252  C C   . TYR F 1 152 ? 38.309  53.732  30.701  1.00 25.38 ? 172 TYR F C   1 
ATOM   9253  O O   . TYR F 1 152 ? 38.496  52.867  31.560  1.00 30.53 ? 172 TYR F O   1 
ATOM   9254  C CB  . TYR F 1 152 ? 36.284  54.369  32.024  1.00 18.87 ? 172 TYR F CB  1 
ATOM   9255  C CG  . TYR F 1 152 ? 34.957  55.082  32.105  1.00 15.92 ? 172 TYR F CG  1 
ATOM   9256  C CD1 . TYR F 1 152 ? 33.759  54.422  31.794  1.00 14.13 ? 172 TYR F CD1 1 
ATOM   9257  C CD2 . TYR F 1 152 ? 34.897  56.430  32.459  1.00 12.52 ? 172 TYR F CD2 1 
ATOM   9258  C CE1 . TYR F 1 152 ? 32.542  55.103  31.827  1.00 9.49  ? 172 TYR F CE1 1 
ATOM   9259  C CE2 . TYR F 1 152 ? 33.692  57.105  32.496  1.00 7.97  ? 172 TYR F CE2 1 
ATOM   9260  C CZ  . TYR F 1 152 ? 32.530  56.443  32.173  1.00 6.08  ? 172 TYR F CZ  1 
ATOM   9261  O OH  . TYR F 1 152 ? 31.375  57.161  32.143  1.00 5.00  ? 172 TYR F OH  1 
ATOM   9262  N N   . PRO F 1 153 ? 39.240  54.022  29.788  1.00 24.20 ? 173 PRO F N   1 
ATOM   9263  C CA  . PRO F 1 153 ? 40.524  53.333  29.605  1.00 28.05 ? 173 PRO F CA  1 
ATOM   9264  C C   . PRO F 1 153 ? 41.269  52.800  30.846  1.00 26.89 ? 173 PRO F C   1 
ATOM   9265  O O   . PRO F 1 153 ? 41.751  53.572  31.681  1.00 24.92 ? 173 PRO F O   1 
ATOM   9266  C CB  . PRO F 1 153 ? 41.356  54.390  28.880  1.00 29.20 ? 173 PRO F CB  1 
ATOM   9267  C CG  . PRO F 1 153 ? 40.674  55.702  29.253  1.00 27.35 ? 173 PRO F CG  1 
ATOM   9268  C CD  . PRO F 1 153 ? 39.259  55.312  29.083  1.00 24.03 ? 173 PRO F CD  1 
ATOM   9269  N N   . GLY F 1 154 ? 41.365  51.479  30.955  0.00 27.96 ? 174 GLY F N   1 
ATOM   9270  C CA  . GLY F 1 154 ? 42.067  50.869  32.075  0.00 28.69 ? 174 GLY F CA  1 
ATOM   9271  C C   . GLY F 1 154 ? 41.397  51.006  33.431  0.00 28.47 ? 174 GLY F C   1 
ATOM   9272  O O   . GLY F 1 154 ? 41.495  50.107  34.265  0.00 28.13 ? 174 GLY F O   1 
ATOM   9273  N N   . GLN F 1 155 ? 40.739  52.140  33.658  1.00 29.95 ? 175 GLN F N   1 
ATOM   9274  C CA  . GLN F 1 155 ? 40.036  52.418  34.912  1.00 30.01 ? 175 GLN F CA  1 
ATOM   9275  C C   . GLN F 1 155 ? 39.032  51.345  35.286  1.00 28.58 ? 175 GLN F C   1 
ATOM   9276  O O   . GLN F 1 155 ? 38.823  51.092  36.462  1.00 31.87 ? 175 GLN F O   1 
ATOM   9277  C CB  . GLN F 1 155 ? 39.315  53.757  34.837  1.00 30.01 ? 175 GLN F CB  1 
ATOM   9278  C CG  . GLN F 1 155 ? 40.249  54.925  34.667  1.00 34.87 ? 175 GLN F CG  1 
ATOM   9279  C CD  . GLN F 1 155 ? 39.537  56.252  34.733  1.00 36.41 ? 175 GLN F CD  1 
ATOM   9280  O OE1 . GLN F 1 155 ? 39.550  56.929  35.766  1.00 32.61 ? 175 GLN F OE1 1 
ATOM   9281  N NE2 . GLN F 1 155 ? 38.914  56.642  33.624  1.00 39.08 ? 175 GLN F NE2 1 
ATOM   9282  N N   . ILE F 1 156 ? 38.386  50.755  34.283  1.00 25.27 ? 176 ILE F N   1 
ATOM   9283  C CA  . ILE F 1 156 ? 37.393  49.694  34.491  1.00 18.59 ? 176 ILE F CA  1 
ATOM   9284  C C   . ILE F 1 156 ? 38.056  48.385  34.967  1.00 16.60 ? 176 ILE F C   1 
ATOM   9285  O O   . ILE F 1 156 ? 38.726  47.699  34.197  1.00 19.49 ? 176 ILE F O   1 
ATOM   9286  C CB  . ILE F 1 156 ? 36.589  49.432  33.177  1.00 14.55 ? 176 ILE F CB  1 
ATOM   9287  C CG1 . ILE F 1 156 ? 35.828  50.689  32.744  1.00 5.00  ? 176 ILE F CG1 1 
ATOM   9288  C CG2 . ILE F 1 156 ? 35.702  48.204  33.317  1.00 13.15 ? 176 ILE F CG2 1 
ATOM   9289  C CD1 . ILE F 1 156 ? 35.067  51.353  33.823  1.00 5.00  ? 176 ILE F CD1 1 
ATOM   9290  N N   . THR F 1 157 ? 37.885  48.051  36.239  1.00 12.21 ? 177 THR F N   1 
ATOM   9291  C CA  . THR F 1 157 ? 38.460  46.824  36.786  1.00 11.71 ? 177 THR F CA  1 
ATOM   9292  C C   . THR F 1 157 ? 37.536  45.622  36.520  1.00 11.92 ? 177 THR F C   1 
ATOM   9293  O O   . THR F 1 157 ? 36.482  45.762  35.905  1.00 12.84 ? 177 THR F O   1 
ATOM   9294  C CB  . THR F 1 157 ? 38.713  46.956  38.311  1.00 9.05  ? 177 THR F CB  1 
ATOM   9295  O OG1 . THR F 1 157 ? 37.487  47.243  38.983  1.00 12.50 ? 177 THR F OG1 1 
ATOM   9296  C CG2 . THR F 1 157 ? 39.647  48.082  38.597  1.00 7.84  ? 177 THR F CG2 1 
ATOM   9297  N N   . SER F 1 158 ? 37.931  44.442  36.977  1.00 10.73 ? 178 SER F N   1 
ATOM   9298  C CA  . SER F 1 158 ? 37.115  43.246  36.794  1.00 11.97 ? 178 SER F CA  1 
ATOM   9299  C C   . SER F 1 158 ? 35.933  43.297  37.746  1.00 16.26 ? 178 SER F C   1 
ATOM   9300  O O   . SER F 1 158 ? 35.015  42.470  37.643  1.00 23.42 ? 178 SER F O   1 
ATOM   9301  C CB  . SER F 1 158 ? 37.932  41.984  37.080  1.00 8.71  ? 178 SER F CB  1 
ATOM   9302  O OG  . SER F 1 158 ? 38.793  42.190  38.190  0.00 10.02 ? 178 SER F OG  1 
ATOM   9303  N N   . ASN F 1 159 ? 35.963  44.248  38.680  1.00 12.84 ? 179 ASN F N   1 
ATOM   9304  C CA  . ASN F 1 159 ? 34.898  44.399  39.653  1.00 10.94 ? 179 ASN F CA  1 
ATOM   9305  C C   . ASN F 1 159 ? 33.963  45.511  39.267  1.00 7.90  ? 179 ASN F C   1 
ATOM   9306  O O   . ASN F 1 159 ? 33.209  45.999  40.096  1.00 10.64 ? 179 ASN F O   1 
ATOM   9307  C CB  . ASN F 1 159 ? 35.485  44.685  41.023  1.00 15.18 ? 179 ASN F CB  1 
ATOM   9308  C CG  . ASN F 1 159 ? 36.315  43.541  41.544  1.00 20.72 ? 179 ASN F CG  1 
ATOM   9309  O OD1 . ASN F 1 159 ? 36.086  42.366  41.203  1.00 20.45 ? 179 ASN F OD1 1 
ATOM   9310  N ND2 . ASN F 1 159 ? 37.288  43.870  42.386  1.00 23.48 ? 179 ASN F ND2 1 
ATOM   9311  N N   . MET F 1 160 ? 34.021  45.916  38.010  1.00 5.00  ? 180 MET F N   1 
ATOM   9312  C CA  . MET F 1 160 ? 33.182  46.983  37.516  1.00 5.00  ? 180 MET F CA  1 
ATOM   9313  C C   . MET F 1 160 ? 32.484  46.548  36.228  1.00 8.69  ? 180 MET F C   1 
ATOM   9314  O O   . MET F 1 160 ? 32.864  45.537  35.624  1.00 11.73 ? 180 MET F O   1 
ATOM   9315  C CB  . MET F 1 160 ? 34.015  48.236  37.282  1.00 5.00  ? 180 MET F CB  1 
ATOM   9316  C CG  . MET F 1 160 ? 34.768  48.685  38.517  1.00 5.00  ? 180 MET F CG  1 
ATOM   9317  S SD  . MET F 1 160 ? 35.510  50.320  38.369  1.00 5.00  ? 180 MET F SD  1 
ATOM   9318  C CE  . MET F 1 160 ? 36.810  50.163  39.578  1.00 5.00  ? 180 MET F CE  1 
ATOM   9319  N N   . PHE F 1 161 ? 31.385  47.224  35.888  1.00 9.92  ? 181 PHE F N   1 
ATOM   9320  C CA  . PHE F 1 161 ? 30.626  46.940  34.666  1.00 10.35 ? 181 PHE F CA  1 
ATOM   9321  C C   . PHE F 1 161 ? 29.824  48.171  34.283  1.00 11.01 ? 181 PHE F C   1 
ATOM   9322  O O   . PHE F 1 161 ? 29.336  48.895  35.155  1.00 8.65  ? 181 PHE F O   1 
ATOM   9323  C CB  . PHE F 1 161 ? 29.749  45.666  34.774  1.00 9.05  ? 181 PHE F CB  1 
ATOM   9324  C CG  . PHE F 1 161 ? 28.443  45.820  35.560  1.00 11.44 ? 181 PHE F CG  1 
ATOM   9325  C CD1 . PHE F 1 161 ? 27.292  46.349  34.950  1.00 14.15 ? 181 PHE F CD1 1 
ATOM   9326  C CD2 . PHE F 1 161 ? 28.323  45.317  36.873  1.00 9.02  ? 181 PHE F CD2 1 
ATOM   9327  C CE1 . PHE F 1 161 ? 26.034  46.369  35.630  1.00 11.11 ? 181 PHE F CE1 1 
ATOM   9328  C CE2 . PHE F 1 161 ? 27.079  45.332  37.554  1.00 6.39  ? 181 PHE F CE2 1 
ATOM   9329  C CZ  . PHE F 1 161 ? 25.939  45.858  36.930  1.00 5.00  ? 181 PHE F CZ  1 
ATOM   9330  N N   . CYS F 1 162 ? 29.793  48.467  32.987  1.00 12.70 ? 182 CYS F N   1 
ATOM   9331  C CA  . CYS F 1 162 ? 29.072  49.641  32.493  1.00 13.50 ? 182 CYS F CA  1 
ATOM   9332  C C   . CYS F 1 162 ? 27.664  49.247  32.128  1.00 12.04 ? 182 CYS F C   1 
ATOM   9333  O O   . CYS F 1 162 ? 27.444  48.149  31.643  1.00 12.01 ? 182 CYS F O   1 
ATOM   9334  C CB  . CYS F 1 162 ? 29.740  50.248  31.247  1.00 15.48 ? 182 CYS F CB  1 
ATOM   9335  S SG  . CYS F 1 162 ? 31.313  51.150  31.472  1.00 15.86 ? 182 CYS F SG  1 
ATOM   9336  N N   . ALA F 1 163 ? 26.722  50.157  32.346  1.00 13.45 ? 183 ALA F N   1 
ATOM   9337  C CA  . ALA F 1 163 ? 25.309  49.935  32.044  1.00 13.91 ? 183 ALA F CA  1 
ATOM   9338  C C   . ALA F 1 163 ? 24.743  51.290  31.672  1.00 16.42 ? 183 ALA F C   1 
ATOM   9339  O O   . ALA F 1 163 ? 25.204  52.326  32.172  1.00 17.65 ? 183 ALA F O   1 
ATOM   9340  C CB  . ALA F 1 163 ? 24.565  49.358  33.253  1.00 9.58  ? 183 ALA F CB  1 
ATOM   9341  N N   . GLY F 1 164 A 23.764  51.287  30.777  1.00 17.94 ? 184 GLY F N   1 
ATOM   9342  C CA  . GLY F 1 164 A 23.172  52.532  30.334  1.00 17.82 ? 184 GLY F CA  1 
ATOM   9343  C C   . GLY F 1 164 A 23.082  52.603  28.825  1.00 18.71 ? 184 GLY F C   1 
ATOM   9344  O O   . GLY F 1 164 A 22.883  51.595  28.169  1.00 18.73 ? 184 GLY F O   1 
ATOM   9345  N N   . TYR F 1 165 ? 23.258  53.792  28.269  1.00 20.54 ? 184 TYR F N   1 
ATOM   9346  C CA  . TYR F 1 165 ? 23.156  53.994  26.830  1.00 22.94 ? 184 TYR F CA  1 
ATOM   9347  C C   . TYR F 1 165 ? 24.309  54.833  26.340  1.00 25.91 ? 184 TYR F C   1 
ATOM   9348  O O   . TYR F 1 165 ? 24.438  56.007  26.735  1.00 25.03 ? 184 TYR F O   1 
ATOM   9349  C CB  . TYR F 1 165 ? 21.853  54.715  26.517  1.00 21.74 ? 184 TYR F CB  1 
ATOM   9350  C CG  . TYR F 1 165 ? 20.665  53.971  27.047  1.00 21.26 ? 184 TYR F CG  1 
ATOM   9351  C CD1 . TYR F 1 165 ? 19.929  54.459  28.130  1.00 21.00 ? 184 TYR F CD1 1 
ATOM   9352  C CD2 . TYR F 1 165 ? 20.313  52.739  26.511  1.00 21.24 ? 184 TYR F CD2 1 
ATOM   9353  C CE1 . TYR F 1 165 ? 18.876  53.727  28.671  1.00 19.43 ? 184 TYR F CE1 1 
ATOM   9354  C CE2 . TYR F 1 165 ? 19.268  52.007  27.038  1.00 23.50 ? 184 TYR F CE2 1 
ATOM   9355  C CZ  . TYR F 1 165 ? 18.556  52.501  28.119  1.00 21.43 ? 184 TYR F CZ  1 
ATOM   9356  O OH  . TYR F 1 165 ? 17.557  51.726  28.640  1.00 21.02 ? 184 TYR F OH  1 
ATOM   9357  N N   . LEU F 1 166 ? 25.116  54.268  25.441  1.00 26.78 ? 185 LEU F N   1 
ATOM   9358  C CA  . LEU F 1 166 ? 26.274  55.009  24.936  1.00 27.06 ? 185 LEU F CA  1 
ATOM   9359  C C   . LEU F 1 166 ? 25.855  56.351  24.337  1.00 28.26 ? 185 LEU F C   1 
ATOM   9360  O O   . LEU F 1 166 ? 26.612  57.323  24.405  1.00 28.18 ? 185 LEU F O   1 
ATOM   9361  C CB  . LEU F 1 166 ? 27.098  54.172  23.946  1.00 24.88 ? 185 LEU F CB  1 
ATOM   9362  C CG  . LEU F 1 166 ? 27.978  53.050  24.525  1.00 22.06 ? 185 LEU F CG  1 
ATOM   9363  C CD1 . LEU F 1 166 ? 28.504  52.174  23.399  0.00 22.21 ? 185 LEU F CD1 1 
ATOM   9364  C CD2 . LEU F 1 166 ? 29.121  53.634  25.334  0.00 22.46 ? 185 LEU F CD2 1 
ATOM   9365  N N   . GLU F 1 167 ? 24.618  56.418  23.838  1.00 28.71 ? 186 GLU F N   1 
ATOM   9366  C CA  . GLU F 1 167 ? 24.101  57.650  23.248  1.00 27.16 ? 186 GLU F CA  1 
ATOM   9367  C C   . GLU F 1 167 ? 23.947  58.691  24.330  1.00 27.05 ? 186 GLU F C   1 
ATOM   9368  O O   . GLU F 1 167 ? 24.237  59.859  24.117  1.00 30.00 ? 186 GLU F O   1 
ATOM   9369  C CB  . GLU F 1 167 ? 22.753  57.421  22.569  0.00 28.44 ? 186 GLU F CB  1 
ATOM   9370  C CG  . GLU F 1 167 ? 22.196  58.686  21.929  0.00 27.58 ? 186 GLU F CG  1 
ATOM   9371  C CD  . GLU F 1 167 ? 20.752  58.550  21.496  0.00 25.64 ? 186 GLU F CD  1 
ATOM   9372  O OE1 . GLU F 1 167 ? 20.456  58.850  20.321  0.00 24.56 ? 186 GLU F OE1 1 
ATOM   9373  O OE2 . GLU F 1 167 ? 19.912  58.158  22.333  0.00 24.51 ? 186 GLU F OE2 1 
ATOM   9374  N N   . GLY F 1 168 ? 23.513  58.246  25.502  1.00 27.53 ? 187 GLY F N   1 
ATOM   9375  C CA  . GLY F 1 168 ? 23.317  59.153  26.617  1.00 28.81 ? 187 GLY F CA  1 
ATOM   9376  C C   . GLY F 1 168 ? 21.859  59.532  26.806  1.00 25.93 ? 187 GLY F C   1 
ATOM   9377  O O   . GLY F 1 168 ? 20.997  59.054  26.074  1.00 26.88 ? 187 GLY F O   1 
ATOM   9378  N N   . GLY F 1 169 A 21.593  60.388  27.787  1.00 21.84 ? 188 GLY F N   1 
ATOM   9379  C CA  . GLY F 1 169 A 20.239  60.816  28.068  1.00 21.42 ? 188 GLY F CA  1 
ATOM   9380  C C   . GLY F 1 169 A 19.583  60.068  29.218  1.00 21.02 ? 188 GLY F C   1 
ATOM   9381  O O   . GLY F 1 169 A 18.625  60.564  29.828  1.00 22.24 ? 188 GLY F O   1 
ATOM   9382  N N   . LYS F 1 170 ? 20.086  58.874  29.510  1.00 16.96 ? 188 LYS F N   1 
ATOM   9383  C CA  . LYS F 1 170 ? 19.540  58.058  30.582  1.00 15.73 ? 188 LYS F CA  1 
ATOM   9384  C C   . LYS F 1 170 ? 20.740  57.482  31.313  1.00 14.48 ? 188 LYS F C   1 
ATOM   9385  O O   . LYS F 1 170 ? 21.610  56.886  30.678  1.00 15.31 ? 188 LYS F O   1 
ATOM   9386  C CB  . LYS F 1 170 ? 18.652  56.942  30.002  1.00 14.04 ? 188 LYS F CB  1 
ATOM   9387  C CG  . LYS F 1 170 ? 17.514  57.450  29.107  1.00 12.70 ? 188 LYS F CG  1 
ATOM   9388  C CD  . LYS F 1 170 ? 16.634  56.331  28.586  1.00 11.51 ? 188 LYS F CD  1 
ATOM   9389  C CE  . LYS F 1 170 ? 15.473  56.862  27.764  0.00 12.58 ? 188 LYS F CE  1 
ATOM   9390  N NZ  . LYS F 1 170 ? 14.644  55.750  27.218  0.00 12.62 ? 188 LYS F NZ  1 
ATOM   9391  N N   . ASP F 1 171 ? 20.806  57.694  32.629  1.00 11.37 ? 189 ASP F N   1 
ATOM   9392  C CA  . ASP F 1 171 ? 21.924  57.227  33.452  1.00 8.57  ? 189 ASP F CA  1 
ATOM   9393  C C   . ASP F 1 171 ? 21.628  57.547  34.899  1.00 5.16  ? 189 ASP F C   1 
ATOM   9394  O O   . ASP F 1 171 ? 20.744  58.336  35.182  1.00 6.23  ? 189 ASP F O   1 
ATOM   9395  C CB  . ASP F 1 171 ? 23.186  57.997  33.031  1.00 11.65 ? 189 ASP F CB  1 
ATOM   9396  C CG  . ASP F 1 171 ? 24.475  57.512  33.712  1.00 12.99 ? 189 ASP F CG  1 
ATOM   9397  O OD1 . ASP F 1 171 ? 25.501  58.193  33.501  1.00 10.89 ? 189 ASP F OD1 1 
ATOM   9398  O OD2 . ASP F 1 171 ? 24.495  56.472  34.421  1.00 14.47 ? 189 ASP F OD2 1 
ATOM   9399  N N   . SER F 1 172 ? 22.316  56.878  35.814  1.00 5.00  ? 190 SER F N   1 
ATOM   9400  C CA  . SER F 1 172 ? 22.173  57.150  37.242  1.00 5.59  ? 190 SER F CA  1 
ATOM   9401  C C   . SER F 1 172 ? 22.924  58.458  37.552  1.00 5.33  ? 190 SER F C   1 
ATOM   9402  O O   . SER F 1 172 ? 23.615  58.993  36.696  1.00 6.15  ? 190 SER F O   1 
ATOM   9403  C CB  . SER F 1 172 ? 22.728  55.982  38.060  1.00 6.44  ? 190 SER F CB  1 
ATOM   9404  O OG  . SER F 1 172 ? 23.977  55.549  37.552  1.00 7.52  ? 190 SER F OG  1 
ATOM   9405  N N   . CYS F 1 173 ? 22.827  58.969  38.766  1.00 5.00  ? 191 CYS F N   1 
ATOM   9406  C CA  . CYS F 1 173 ? 23.488  60.231  39.047  1.00 7.24  ? 191 CYS F CA  1 
ATOM   9407  C C   . CYS F 1 173 ? 23.658  60.532  40.525  1.00 7.43  ? 191 CYS F C   1 
ATOM   9408  O O   . CYS F 1 173 ? 23.074  59.876  41.387  1.00 9.39  ? 191 CYS F O   1 
ATOM   9409  C CB  . CYS F 1 173 ? 22.699  61.353  38.393  1.00 10.00 ? 191 CYS F CB  1 
ATOM   9410  S SG  . CYS F 1 173 ? 23.683  62.841  38.139  1.00 15.47 ? 191 CYS F SG  1 
ATOM   9411  N N   . GLN F 1 174 ? 24.415  61.577  40.808  1.00 7.23  ? 192 GLN F N   1 
ATOM   9412  C CA  . GLN F 1 174 ? 24.709  61.976  42.177  1.00 7.36  ? 192 GLN F CA  1 
ATOM   9413  C C   . GLN F 1 174 ? 23.474  61.895  43.053  1.00 5.00  ? 192 GLN F C   1 
ATOM   9414  O O   . GLN F 1 174 ? 22.453  62.487  42.751  1.00 6.76  ? 192 GLN F O   1 
ATOM   9415  C CB  . GLN F 1 174 ? 25.380  63.373  42.211  1.00 9.77  ? 192 GLN F CB  1 
ATOM   9416  C CG  . GLN F 1 174 ? 26.893  63.442  41.734  1.00 5.00  ? 192 GLN F CG  1 
ATOM   9417  C CD  . GLN F 1 174 ? 27.096  63.032  40.290  1.00 5.00  ? 192 GLN F CD  1 
ATOM   9418  O OE1 . GLN F 1 174 ? 27.000  61.851  39.952  0.00 5.00  ? 192 GLN F OE1 1 
ATOM   9419  N NE2 . GLN F 1 174 ? 27.335  64.001  39.424  0.00 5.00  ? 192 GLN F NE2 1 
ATOM   9420  N N   . GLY F 1 175 ? 23.561  61.057  44.077  1.00 5.00  ? 193 GLY F N   1 
ATOM   9421  C CA  . GLY F 1 175 ? 22.466  60.823  44.993  1.00 5.00  ? 193 GLY F CA  1 
ATOM   9422  C C   . GLY F 1 175 ? 21.998  59.386  44.813  1.00 5.00  ? 193 GLY F C   1 
ATOM   9423  O O   . GLY F 1 175 ? 21.261  58.859  45.650  1.00 5.00  ? 193 GLY F O   1 
ATOM   9424  N N   . ASP F 1 176 ? 22.406  58.754  43.712  1.00 5.00  ? 194 ASP F N   1 
ATOM   9425  C CA  . ASP F 1 176 ? 22.032  57.366  43.419  1.00 5.88  ? 194 ASP F CA  1 
ATOM   9426  C C   . ASP F 1 176 ? 23.038  56.301  43.877  1.00 6.25  ? 194 ASP F C   1 
ATOM   9427  O O   . ASP F 1 176 ? 22.765  55.106  43.798  1.00 5.00  ? 194 ASP F O   1 
ATOM   9428  C CB  . ASP F 1 176 ? 21.783  57.177  41.923  1.00 8.01  ? 194 ASP F CB  1 
ATOM   9429  C CG  . ASP F 1 176 ? 20.495  57.820  41.454  1.00 10.91 ? 194 ASP F CG  1 
ATOM   9430  O OD1 . ASP F 1 176 ? 20.436  58.263  40.286  1.00 13.04 ? 194 ASP F OD1 1 
ATOM   9431  O OD2 . ASP F 1 176 ? 19.528  57.866  42.236  1.00 13.43 ? 194 ASP F OD2 1 
ATOM   9432  N N   . SER F 1 177 ? 24.217  56.734  44.314  1.00 8.29  ? 195 SER F N   1 
ATOM   9433  C CA  . SER F 1 177 ? 25.263  55.824  44.777  1.00 6.44  ? 195 SER F CA  1 
ATOM   9434  C C   . SER F 1 177 ? 24.676  54.839  45.760  1.00 5.00  ? 195 SER F C   1 
ATOM   9435  O O   . SER F 1 177 ? 23.730  55.138  46.446  1.00 7.71  ? 195 SER F O   1 
ATOM   9436  C CB  . SER F 1 177 ? 26.425  56.600  45.441  1.00 5.83  ? 195 SER F CB  1 
ATOM   9437  O OG  . SER F 1 177 ? 27.338  57.147  44.486  1.00 5.00  ? 195 SER F OG  1 
ATOM   9438  N N   . GLY F 1 178 ? 25.192  53.630  45.768  1.00 6.42  ? 196 GLY F N   1 
ATOM   9439  C CA  . GLY F 1 178 ? 24.702  52.646  46.708  1.00 5.79  ? 196 GLY F CA  1 
ATOM   9440  C C   . GLY F 1 178 ? 23.420  51.994  46.261  1.00 6.39  ? 196 GLY F C   1 
ATOM   9441  O O   . GLY F 1 178 ? 23.064  50.923  46.761  1.00 6.35  ? 196 GLY F O   1 
ATOM   9442  N N   . GLY F 1 179 ? 22.742  52.621  45.300  1.00 7.62  ? 197 GLY F N   1 
ATOM   9443  C CA  . GLY F 1 179 ? 21.483  52.093  44.790  1.00 6.49  ? 197 GLY F CA  1 
ATOM   9444  C C   . GLY F 1 179 ? 21.639  50.752  44.116  1.00 5.00  ? 197 GLY F C   1 
ATOM   9445  O O   . GLY F 1 179 ? 22.749  50.357  43.812  1.00 6.83  ? 197 GLY F O   1 
ATOM   9446  N N   . PRO F 1 180 ? 20.553  50.012  43.903  1.00 5.97  ? 198 PRO F N   1 
ATOM   9447  C CA  . PRO F 1 180 ? 20.561  48.692  43.264  1.00 5.87  ? 198 PRO F CA  1 
ATOM   9448  C C   . PRO F 1 180 ? 20.440  48.691  41.750  1.00 5.00  ? 198 PRO F C   1 
ATOM   9449  O O   . PRO F 1 180 ? 19.888  49.618  41.145  1.00 5.00  ? 198 PRO F O   1 
ATOM   9450  C CB  . PRO F 1 180 ? 19.326  48.032  43.857  1.00 7.56  ? 198 PRO F CB  1 
ATOM   9451  C CG  . PRO F 1 180 ? 18.358  49.203  43.943  1.00 7.83  ? 198 PRO F CG  1 
ATOM   9452  C CD  . PRO F 1 180 ? 19.242  50.301  44.516  1.00 8.05  ? 198 PRO F CD  1 
ATOM   9453  N N   . VAL F 1 181 ? 20.977  47.636  41.155  1.00 5.00  ? 199 VAL F N   1 
ATOM   9454  C CA  . VAL F 1 181 ? 20.898  47.386  39.720  1.00 6.09  ? 199 VAL F CA  1 
ATOM   9455  C C   . VAL F 1 181 ? 20.401  45.936  39.703  1.00 9.83  ? 199 VAL F C   1 
ATOM   9456  O O   . VAL F 1 181 ? 21.153  44.980  39.937  1.00 9.44  ? 199 VAL F O   1 
ATOM   9457  C CB  . VAL F 1 181 ? 22.265  47.484  38.996  1.00 5.00  ? 199 VAL F CB  1 
ATOM   9458  C CG1 . VAL F 1 181 ? 22.144  46.968  37.556  1.00 5.00  ? 199 VAL F CG1 1 
ATOM   9459  C CG2 . VAL F 1 181 ? 22.734  48.905  38.973  1.00 5.00  ? 199 VAL F CG2 1 
ATOM   9460  N N   . VAL F 1 182 ? 19.103  45.768  39.538  1.00 11.89 ? 200 VAL F N   1 
ATOM   9461  C CA  . VAL F 1 182 ? 18.559  44.427  39.544  1.00 13.48 ? 200 VAL F CA  1 
ATOM   9462  C C   . VAL F 1 182 ? 18.370  43.924  38.122  1.00 11.02 ? 200 VAL F C   1 
ATOM   9463  O O   . VAL F 1 182 ? 17.881  44.654  37.262  1.00 8.53  ? 200 VAL F O   1 
ATOM   9464  C CB  . VAL F 1 182 ? 17.213  44.385  40.330  1.00 15.01 ? 200 VAL F CB  1 
ATOM   9465  C CG1 . VAL F 1 182 ? 16.677  42.954  40.418  1.00 13.11 ? 200 VAL F CG1 1 
ATOM   9466  C CG2 . VAL F 1 182 ? 17.411  44.939  41.720  1.00 12.59 ? 200 VAL F CG2 1 
ATOM   9467  N N   . CYS F 1 183 ? 18.810  42.702  37.863  1.00 9.85  ? 201 CYS F N   1 
ATOM   9468  C CA  . CYS F 1 183 ? 18.643  42.114  36.539  1.00 15.05 ? 201 CYS F CA  1 
ATOM   9469  C C   . CYS F 1 183 ? 18.064  40.735  36.789  1.00 17.60 ? 201 CYS F C   1 
ATOM   9470  O O   . CYS F 1 183 ? 18.687  39.915  37.454  1.00 17.99 ? 201 CYS F O   1 
ATOM   9471  C CB  . CYS F 1 183 ? 19.973  41.967  35.790  1.00 15.17 ? 201 CYS F CB  1 
ATOM   9472  S SG  . CYS F 1 183 ? 21.158  43.348  35.898  1.00 15.35 ? 201 CYS F SG  1 
ATOM   9473  N N   . SER F 1 184 ? 16.849  40.507  36.305  1.00 20.60 ? 202 SER F N   1 
ATOM   9474  C CA  . SER F 1 184 ? 16.170  39.234  36.492  1.00 20.44 ? 202 SER F CA  1 
ATOM   9475  C C   . SER F 1 184 ? 15.987  38.883  37.974  1.00 18.80 ? 202 SER F C   1 
ATOM   9476  O O   . SER F 1 184 ? 16.300  37.777  38.402  1.00 20.24 ? 202 SER F O   1 
ATOM   9477  C CB  . SER F 1 184 ? 16.956  38.139  35.789  1.00 23.89 ? 202 SER F CB  1 
ATOM   9478  O OG  . SER F 1 184 ? 17.341  38.587  34.507  1.00 32.01 ? 202 SER F OG  1 
ATOM   9479  N N   . GLY F 1 185 ? 15.516  39.844  38.760  1.00 15.73 ? 203 GLY F N   1 
ATOM   9480  C CA  . GLY F 1 185 ? 15.296  39.613  40.174  1.00 14.42 ? 203 GLY F CA  1 
ATOM   9481  C C   . GLY F 1 185 ? 16.516  39.486  41.069  1.00 13.84 ? 203 GLY F C   1 
ATOM   9482  O O   . GLY F 1 185 ? 16.386  39.263  42.271  1.00 17.18 ? 203 GLY F O   1 
ATOM   9483  N N   . LYS F 1 186 ? 17.707  39.611  40.512  1.00 13.43 ? 204 LYS F N   1 
ATOM   9484  C CA  . LYS F 1 186 ? 18.911  39.506  41.316  1.00 10.56 ? 204 LYS F CA  1 
ATOM   9485  C C   . LYS F 1 186 ? 19.602  40.856  41.392  1.00 11.62 ? 204 LYS F C   1 
ATOM   9486  O O   . LYS F 1 186 ? 19.422  41.728  40.520  1.00 10.92 ? 204 LYS F O   1 
ATOM   9487  C CB  . LYS F 1 186 ? 19.857  38.492  40.700  1.00 9.53  ? 204 LYS F CB  1 
ATOM   9488  C CG  . LYS F 1 186 ? 19.284  37.127  40.581  1.00 10.46 ? 204 LYS F CG  1 
ATOM   9489  C CD  . LYS F 1 186 ? 18.998  36.577  41.949  1.00 13.58 ? 204 LYS F CD  1 
ATOM   9490  C CE  . LYS F 1 186 ? 18.665  35.098  41.864  1.00 18.65 ? 204 LYS F CE  1 
ATOM   9491  N NZ  . LYS F 1 186 ? 18.382  34.501  43.191  0.00 17.65 ? 204 LYS F NZ  1 
ATOM   9492  N N   . LEU F 1 187 ? 20.382  41.038  42.451  1.00 12.72 ? 209 LEU F N   1 
ATOM   9493  C CA  . LEU F 1 187 ? 21.139  42.276  42.658  1.00 13.14 ? 209 LEU F CA  1 
ATOM   9494  C C   . LEU F 1 187 ? 22.478  42.148  41.904  1.00 15.95 ? 209 LEU F C   1 
ATOM   9495  O O   . LEU F 1 187 ? 23.426  41.561  42.429  1.00 17.37 ? 209 LEU F O   1 
ATOM   9496  C CB  . LEU F 1 187 ? 21.408  42.445  44.150  1.00 8.46  ? 209 LEU F CB  1 
ATOM   9497  C CG  . LEU F 1 187 ? 22.187  43.686  44.523  1.00 5.52  ? 209 LEU F CG  1 
ATOM   9498  C CD1 . LEU F 1 187 ? 21.387  44.924  44.141  1.00 6.43  ? 209 LEU F CD1 1 
ATOM   9499  C CD2 . LEU F 1 187 ? 22.462  43.631  46.012  1.00 5.00  ? 209 LEU F CD2 1 
ATOM   9500  N N   . GLN F 1 188 ? 22.561  42.678  40.681  1.00 16.30 ? 210 GLN F N   1 
ATOM   9501  C CA  . GLN F 1 188 ? 23.790  42.572  39.873  1.00 13.26 ? 210 GLN F CA  1 
ATOM   9502  C C   . GLN F 1 188 ? 24.854  43.637  40.110  1.00 13.92 ? 210 GLN F C   1 
ATOM   9503  O O   . GLN F 1 188 ? 26.055  43.347  40.045  1.00 16.49 ? 210 GLN F O   1 
ATOM   9504  C CB  . GLN F 1 188 ? 23.472  42.542  38.377  1.00 7.96  ? 210 GLN F CB  1 
ATOM   9505  C CG  . GLN F 1 188 ? 22.961  41.217  37.875  1.00 10.85 ? 210 GLN F CG  1 
ATOM   9506  C CD  . GLN F 1 188 ? 23.889  40.050  38.188  1.00 16.19 ? 210 GLN F CD  1 
ATOM   9507  O OE1 . GLN F 1 188 ? 23.445  38.910  38.321  1.00 16.15 ? 210 GLN F OE1 1 
ATOM   9508  N NE2 . GLN F 1 188 ? 25.183  40.319  38.261  1.00 20.91 ? 210 GLN F NE2 1 
ATOM   9509  N N   . GLY F 1 189 ? 24.425  44.869  40.354  1.00 10.45 ? 211 GLY F N   1 
ATOM   9510  C CA  . GLY F 1 189 ? 25.386  45.929  40.554  1.00 8.92  ? 211 GLY F CA  1 
ATOM   9511  C C   . GLY F 1 189 ? 24.954  47.031  41.474  1.00 6.31  ? 211 GLY F C   1 
ATOM   9512  O O   . GLY F 1 189 ? 23.772  47.160  41.760  1.00 7.04  ? 211 GLY F O   1 
ATOM   9513  N N   . ILE F 1 190 ? 25.922  47.805  41.951  1.00 5.00  ? 212 ILE F N   1 
ATOM   9514  C CA  . ILE F 1 190 ? 25.645  48.909  42.846  1.00 5.00  ? 212 ILE F CA  1 
ATOM   9515  C C   . ILE F 1 190 ? 26.084  50.149  42.105  1.00 5.00  ? 212 ILE F C   1 
ATOM   9516  O O   . ILE F 1 190 ? 27.124  50.156  41.459  1.00 5.01  ? 212 ILE F O   1 
ATOM   9517  C CB  . ILE F 1 190 ? 26.421  48.783  44.196  1.00 5.97  ? 212 ILE F CB  1 
ATOM   9518  C CG1 . ILE F 1 190 ? 26.188  47.401  44.819  1.00 7.84  ? 212 ILE F CG1 1 
ATOM   9519  C CG2 . ILE F 1 190 ? 25.980  49.856  45.181  1.00 5.00  ? 212 ILE F CG2 1 
ATOM   9520  C CD1 . ILE F 1 190 ? 27.023  47.131  46.056  1.00 7.92  ? 212 ILE F CD1 1 
ATOM   9521  N N   . VAL F 1 191 ? 25.233  51.158  42.114  1.00 5.00  ? 213 VAL F N   1 
ATOM   9522  C CA  . VAL F 1 191 ? 25.536  52.419  41.462  1.00 8.31  ? 213 VAL F CA  1 
ATOM   9523  C C   . VAL F 1 191 ? 26.841  52.930  42.076  1.00 10.25 ? 213 VAL F C   1 
ATOM   9524  O O   . VAL F 1 191 ? 26.921  53.130  43.293  1.00 9.54  ? 213 VAL F O   1 
ATOM   9525  C CB  . VAL F 1 191 ? 24.400  53.468  41.702  1.00 9.86  ? 213 VAL F CB  1 
ATOM   9526  C CG1 . VAL F 1 191 ? 24.766  54.825  41.080  1.00 6.48  ? 213 VAL F CG1 1 
ATOM   9527  C CG2 . VAL F 1 191 ? 23.059  52.939  41.154  1.00 10.11 ? 213 VAL F CG2 1 
ATOM   9528  N N   . SER F 1 192 ? 27.860  53.136  41.247  1.00 11.80 ? 214 SER F N   1 
ATOM   9529  C CA  . SER F 1 192 ? 29.125  53.611  41.766  1.00 12.42 ? 214 SER F CA  1 
ATOM   9530  C C   . SER F 1 192 ? 29.608  54.973  41.268  1.00 14.51 ? 214 SER F C   1 
ATOM   9531  O O   . SER F 1 192 ? 29.456  55.979  41.977  1.00 17.04 ? 214 SER F O   1 
ATOM   9532  C CB  . SER F 1 192 ? 30.205  52.566  41.562  1.00 12.24 ? 214 SER F CB  1 
ATOM   9533  O OG  . SER F 1 192 ? 31.335  52.936  42.332  1.00 14.48 ? 214 SER F OG  1 
ATOM   9534  N N   . TRP F 1 193 ? 30.159  55.025  40.053  1.00 16.25 ? 215 TRP F N   1 
ATOM   9535  C CA  . TRP F 1 193 ? 30.696  56.280  39.485  1.00 15.12 ? 215 TRP F CA  1 
ATOM   9536  C C   . TRP F 1 193 ? 30.540  56.390  37.962  1.00 13.92 ? 215 TRP F C   1 
ATOM   9537  O O   . TRP F 1 193 ? 29.983  55.504  37.301  1.00 11.91 ? 215 TRP F O   1 
ATOM   9538  C CB  . TRP F 1 193 ? 32.186  56.445  39.848  1.00 14.32 ? 215 TRP F CB  1 
ATOM   9539  C CG  . TRP F 1 193 ? 33.052  55.299  39.363  1.00 15.86 ? 215 TRP F CG  1 
ATOM   9540  C CD1 . TRP F 1 193 ? 33.158  54.043  39.922  1.00 16.37 ? 215 TRP F CD1 1 
ATOM   9541  C CD2 . TRP F 1 193 ? 33.884  55.282  38.195  1.00 15.61 ? 215 TRP F CD2 1 
ATOM   9542  N NE1 . TRP F 1 193 ? 33.994  53.251  39.163  1.00 16.23 ? 215 TRP F NE1 1 
ATOM   9543  C CE2 . TRP F 1 193 ? 34.456  53.987  38.101  1.00 16.62 ? 215 TRP F CE2 1 
ATOM   9544  C CE3 . TRP F 1 193 ? 34.199  56.235  37.214  1.00 12.14 ? 215 TRP F CE3 1 
ATOM   9545  C CZ2 . TRP F 1 193 ? 35.325  53.628  37.069  1.00 14.12 ? 215 TRP F CZ2 1 
ATOM   9546  C CZ3 . TRP F 1 193 ? 35.061  55.875  36.189  1.00 9.39  ? 215 TRP F CZ3 1 
ATOM   9547  C CH2 . TRP F 1 193 ? 35.614  54.585  36.125  1.00 12.41 ? 215 TRP F CH2 1 
ATOM   9548  N N   . GLY F 1 194 ? 31.044  57.492  37.420  1.00 14.36 ? 216 GLY F N   1 
ATOM   9549  C CA  . GLY F 1 194 ? 30.961  57.737  35.995  1.00 16.77 ? 216 GLY F CA  1 
ATOM   9550  C C   . GLY F 1 194 ? 31.283  59.197  35.761  1.00 19.96 ? 216 GLY F C   1 
ATOM   9551  O O   . GLY F 1 194 ? 31.520  59.937  36.721  1.00 19.71 ? 216 GLY F O   1 
ATOM   9552  N N   . SER F 1 195 ? 31.304  59.623  34.503  1.00 20.83 ? 217 SER F N   1 
ATOM   9553  C CA  . SER F 1 195 ? 31.623  61.011  34.179  1.00 22.13 ? 217 SER F CA  1 
ATOM   9554  C C   . SER F 1 195 ? 30.338  61.775  34.045  1.00 22.39 ? 217 SER F C   1 
ATOM   9555  O O   . SER F 1 195 ? 29.541  61.485  33.156  1.00 24.53 ? 217 SER F O   1 
ATOM   9556  C CB  . SER F 1 195 ? 32.384  61.094  32.856  1.00 24.34 ? 217 SER F CB  1 
ATOM   9557  O OG  . SER F 1 195 ? 33.494  60.211  32.845  1.00 30.16 ? 217 SER F OG  1 
ATOM   9558  N N   . GLY F 1 196 ? 30.140  62.769  34.900  1.00 21.74 ? 219 GLY F N   1 
ATOM   9559  C CA  . GLY F 1 196 ? 28.914  63.541  34.844  1.00 22.24 ? 219 GLY F CA  1 
ATOM   9560  C C   . GLY F 1 196 ? 27.739  62.582  34.893  1.00 24.69 ? 219 GLY F C   1 
ATOM   9561  O O   . GLY F 1 196 ? 27.826  61.524  35.529  1.00 25.29 ? 219 GLY F O   1 
ATOM   9562  N N   . CYS F 1 197 ? 26.683  62.894  34.148  1.00 25.06 ? 220 CYS F N   1 
ATOM   9563  C CA  . CYS F 1 197 ? 25.492  62.052  34.126  1.00 23.28 ? 220 CYS F CA  1 
ATOM   9564  C C   . CYS F 1 197 ? 24.848  62.039  32.751  1.00 23.85 ? 220 CYS F C   1 
ATOM   9565  O O   . CYS F 1 197 ? 24.729  63.078  32.107  1.00 27.02 ? 220 CYS F O   1 
ATOM   9566  C CB  . CYS F 1 197 ? 24.500  62.519  35.199  1.00 18.40 ? 220 CYS F CB  1 
ATOM   9567  S SG  . CYS F 1 197 ? 25.126  62.201  36.878  1.00 11.73 ? 220 CYS F SG  1 
ATOM   9568  N N   . ALA F 1 198 A 24.520  60.847  32.269  1.00 24.32 ? 221 ALA F N   1 
ATOM   9569  C CA  . ALA F 1 198 A 23.886  60.689  30.966  1.00 28.37 ? 221 ALA F CA  1 
ATOM   9570  C C   . ALA F 1 198 A 24.730  61.248  29.822  1.00 30.40 ? 221 ALA F C   1 
ATOM   9571  O O   . ALA F 1 198 A 24.249  61.432  28.702  1.00 28.82 ? 221 ALA F O   1 
ATOM   9572  C CB  . ALA F 1 198 A 22.505  61.330  30.974  1.00 31.78 ? 221 ALA F CB  1 
ATOM   9573  N N   . GLN F 1 199 ? 26.003  61.478  30.103  1.00 31.15 ? 221 GLN F N   1 
ATOM   9574  C CA  . GLN F 1 199 ? 26.913  62.012  29.112  1.00 29.07 ? 221 GLN F CA  1 
ATOM   9575  C C   . GLN F 1 199 ? 27.218  60.967  28.057  1.00 26.02 ? 221 GLN F C   1 
ATOM   9576  O O   . GLN F 1 199 ? 27.452  59.795  28.377  1.00 27.09 ? 221 GLN F O   1 
ATOM   9577  C CB  . GLN F 1 199 ? 28.202  62.486  29.782  1.00 30.27 ? 221 GLN F CB  1 
ATOM   9578  C CG  . GLN F 1 199 ? 28.434  64.008  29.682  1.00 31.04 ? 221 GLN F CG  1 
ATOM   9579  C CD  . GLN F 1 199 ? 27.295  64.833  30.269  1.00 30.00 ? 221 GLN F CD  1 
ATOM   9580  O OE1 . GLN F 1 199 ? 26.658  65.614  29.567  0.00 31.40 ? 221 GLN F OE1 1 
ATOM   9581  N NE2 . GLN F 1 199 ? 27.070  64.692  31.566  0.00 31.44 ? 221 GLN F NE2 1 
ATOM   9582  N N   . LYS F 1 200 ? 27.176  61.402  26.800  1.00 23.05 ? 222 LYS F N   1 
ATOM   9583  C CA  . LYS F 1 200 ? 27.443  60.543  25.654  1.00 21.74 ? 222 LYS F CA  1 
ATOM   9584  C C   . LYS F 1 200 ? 28.769  59.840  25.845  1.00 17.36 ? 222 LYS F C   1 
ATOM   9585  O O   . LYS F 1 200 ? 29.684  60.401  26.416  1.00 14.90 ? 222 LYS F O   1 
ATOM   9586  C CB  . LYS F 1 200 ? 27.469  61.375  24.367  1.00 25.87 ? 222 LYS F CB  1 
ATOM   9587  C CG  . LYS F 1 200 ? 27.777  60.576  23.106  1.00 27.63 ? 222 LYS F CG  1 
ATOM   9588  C CD  . LYS F 1 200 ? 27.842  61.459  21.875  0.00 23.59 ? 222 LYS F CD  1 
ATOM   9589  C CE  . LYS F 1 200 ? 28.249  60.660  20.646  0.00 21.41 ? 222 LYS F CE  1 
ATOM   9590  N NZ  . LYS F 1 200 ? 28.385  61.529  19.445  0.00 20.05 ? 222 LYS F NZ  1 
ATOM   9591  N N   . ASN F 1 201 ? 28.833  58.589  25.418  1.00 19.21 ? 223 ASN F N   1 
ATOM   9592  C CA  . ASN F 1 201 ? 30.033  57.774  25.528  1.00 22.58 ? 223 ASN F CA  1 
ATOM   9593  C C   . ASN F 1 201 ? 30.628  57.695  26.935  1.00 24.01 ? 223 ASN F C   1 
ATOM   9594  O O   . ASN F 1 201 ? 31.772  57.289  27.112  1.00 24.83 ? 223 ASN F O   1 
ATOM   9595  C CB  . ASN F 1 201 ? 31.081  58.230  24.511  1.00 20.90 ? 223 ASN F CB  1 
ATOM   9596  C CG  . ASN F 1 201 ? 30.624  58.026  23.073  1.00 19.55 ? 223 ASN F CG  1 
ATOM   9597  O OD1 . ASN F 1 201 ? 29.750  57.208  22.793  0.00 19.71 ? 223 ASN F OD1 1 
ATOM   9598  N ND2 . ASN F 1 201 ? 31.213  58.783  22.157  0.00 19.60 ? 223 ASN F ND2 1 
ATOM   9599  N N   . LYS F 1 202 ? 29.844  58.080  27.934  1.00 24.94 ? 224 LYS F N   1 
ATOM   9600  C CA  . LYS F 1 202 ? 30.272  58.019  29.322  1.00 25.77 ? 224 LYS F CA  1 
ATOM   9601  C C   . LYS F 1 202 ? 29.114  57.374  30.065  1.00 23.64 ? 224 LYS F C   1 
ATOM   9602  O O   . LYS F 1 202 ? 28.277  58.052  30.653  1.00 22.00 ? 224 LYS F O   1 
ATOM   9603  C CB  . LYS F 1 202 ? 30.561  59.423  29.865  1.00 29.16 ? 224 LYS F CB  1 
ATOM   9604  C CG  . LYS F 1 202 ? 31.771  60.103  29.201  1.00 32.67 ? 224 LYS F CG  1 
ATOM   9605  C CD  . LYS F 1 202 ? 33.045  59.264  29.365  1.00 33.94 ? 224 LYS F CD  1 
ATOM   9606  C CE  . LYS F 1 202 ? 34.190  59.759  28.488  1.00 33.11 ? 224 LYS F CE  1 
ATOM   9607  N NZ  . LYS F 1 202 ? 35.493  59.094  28.799  1.00 31.68 ? 224 LYS F NZ  1 
ATOM   9608  N N   . PRO F 1 203 ? 29.034  56.037  30.010  1.00 26.56 ? 225 PRO F N   1 
ATOM   9609  C CA  . PRO F 1 203 ? 27.982  55.250  30.658  1.00 20.85 ? 225 PRO F CA  1 
ATOM   9610  C C   . PRO F 1 203 ? 28.221  55.162  32.148  1.00 21.30 ? 225 PRO F C   1 
ATOM   9611  O O   . PRO F 1 203 ? 29.334  55.390  32.616  1.00 24.12 ? 225 PRO F O   1 
ATOM   9612  C CB  . PRO F 1 203 ? 28.147  53.854  30.032  1.00 21.14 ? 225 PRO F CB  1 
ATOM   9613  C CG  . PRO F 1 203 ? 29.132  54.031  28.902  1.00 20.74 ? 225 PRO F CG  1 
ATOM   9614  C CD  . PRO F 1 203 ? 30.015  55.144  29.376  1.00 23.46 ? 225 PRO F CD  1 
ATOM   9615  N N   . GLY F 1 204 ? 27.184  54.809  32.893  1.00 18.65 ? 226 GLY F N   1 
ATOM   9616  C CA  . GLY F 1 204 ? 27.357  54.665  34.320  1.00 17.05 ? 226 GLY F CA  1 
ATOM   9617  C C   . GLY F 1 204 ? 28.176  53.408  34.598  1.00 16.08 ? 226 GLY F C   1 
ATOM   9618  O O   . GLY F 1 204 ? 28.094  52.421  33.860  1.00 11.69 ? 226 GLY F O   1 
ATOM   9619  N N   . VAL F 1 205 ? 28.999  53.465  35.640  1.00 16.72 ? 227 VAL F N   1 
ATOM   9620  C CA  . VAL F 1 205 ? 29.825  52.340  36.053  1.00 15.12 ? 227 VAL F CA  1 
ATOM   9621  C C   . VAL F 1 205 ? 29.229  51.799  37.361  1.00 12.41 ? 227 VAL F C   1 
ATOM   9622  O O   . VAL F 1 205 ? 28.871  52.571  38.258  1.00 10.30 ? 227 VAL F O   1 
ATOM   9623  C CB  . VAL F 1 205 ? 31.307  52.778  36.260  1.00 15.61 ? 227 VAL F CB  1 
ATOM   9624  C CG1 . VAL F 1 205 ? 32.158  51.598  36.749  1.00 14.78 ? 227 VAL F CG1 1 
ATOM   9625  C CG2 . VAL F 1 205 ? 31.880  53.339  34.948  1.00 13.03 ? 227 VAL F CG2 1 
ATOM   9626  N N   . TYR F 1 206 ? 29.121  50.476  37.465  1.00 10.82 ? 228 TYR F N   1 
ATOM   9627  C CA  . TYR F 1 206 ? 28.537  49.836  38.640  1.00 10.23 ? 228 TYR F CA  1 
ATOM   9628  C C   . TYR F 1 206 ? 29.390  48.720  39.188  1.00 9.79  ? 228 TYR F C   1 
ATOM   9629  O O   . TYR F 1 206 ? 30.113  48.095  38.436  1.00 15.43 ? 228 TYR F O   1 
ATOM   9630  C CB  . TYR F 1 206 ? 27.181  49.274  38.258  1.00 10.05 ? 228 TYR F CB  1 
ATOM   9631  C CG  . TYR F 1 206 ? 26.270  50.332  37.681  1.00 10.10 ? 228 TYR F CG  1 
ATOM   9632  C CD1 . TYR F 1 206 ? 25.364  51.010  38.492  1.00 10.80 ? 228 TYR F CD1 1 
ATOM   9633  C CD2 . TYR F 1 206 ? 26.339  50.686  36.339  1.00 6.19  ? 228 TYR F CD2 1 
ATOM   9634  C CE1 . TYR F 1 206 ? 24.559  52.014  37.977  1.00 10.34 ? 228 TYR F CE1 1 
ATOM   9635  C CE2 . TYR F 1 206 ? 25.539  51.688  35.821  1.00 5.55  ? 228 TYR F CE2 1 
ATOM   9636  C CZ  . TYR F 1 206 ? 24.658  52.350  36.633  1.00 7.45  ? 228 TYR F CZ  1 
ATOM   9637  O OH  . TYR F 1 206 ? 23.889  53.366  36.104  1.00 7.26  ? 228 TYR F OH  1 
ATOM   9638  N N   . THR F 1 207 ? 29.275  48.444  40.483  1.00 8.27  ? 229 THR F N   1 
ATOM   9639  C CA  . THR F 1 207 ? 30.059  47.395  41.132  1.00 6.84  ? 229 THR F CA  1 
ATOM   9640  C C   . THR F 1 207 ? 29.498  46.047  40.784  1.00 6.55  ? 229 THR F C   1 
ATOM   9641  O O   . THR F 1 207 ? 28.314  45.839  40.931  1.00 10.13 ? 229 THR F O   1 
ATOM   9642  C CB  . THR F 1 207 ? 30.004  47.515  42.648  1.00 5.88  ? 229 THR F CB  1 
ATOM   9643  O OG1 . THR F 1 207 ? 30.263  48.872  43.029  1.00 11.13 ? 229 THR F OG1 1 
ATOM   9644  C CG2 . THR F 1 207 ? 31.036  46.616  43.277  1.00 5.00  ? 229 THR F CG2 1 
ATOM   9645  N N   . LYS F 1 208 ? 30.352  45.118  40.373  1.00 9.03  ? 230 LYS F N   1 
ATOM   9646  C CA  . LYS F 1 208 ? 29.932  43.758  40.006  1.00 8.76  ? 230 LYS F CA  1 
ATOM   9647  C C   . LYS F 1 208 ? 29.584  42.956  41.283  1.00 8.78  ? 230 LYS F C   1 
ATOM   9648  O O   . LYS F 1 208 ? 30.427  42.242  41.834  1.00 8.15  ? 230 LYS F O   1 
ATOM   9649  C CB  . LYS F 1 208 ? 31.072  43.079  39.236  1.00 5.19  ? 230 LYS F CB  1 
ATOM   9650  C CG  . LYS F 1 208 ? 30.633  42.172  38.125  1.00 7.33  ? 230 LYS F CG  1 
ATOM   9651  C CD  . LYS F 1 208 ? 31.817  41.726  37.288  1.00 8.03  ? 230 LYS F CD  1 
ATOM   9652  C CE  . LYS F 1 208 ? 31.368  40.810  36.156  1.00 10.27 ? 230 LYS F CE  1 
ATOM   9653  N NZ  . LYS F 1 208 ? 32.518  40.339  35.330  0.00 9.22  ? 230 LYS F NZ  1 
ATOM   9654  N N   . VAL F 1 209 ? 28.346  43.062  41.754  1.00 8.08  ? 231 VAL F N   1 
ATOM   9655  C CA  . VAL F 1 209 ? 27.959  42.358  42.974  1.00 9.78  ? 231 VAL F CA  1 
ATOM   9656  C C   . VAL F 1 209 ? 28.212  40.836  42.955  1.00 14.39 ? 231 VAL F C   1 
ATOM   9657  O O   . VAL F 1 209 ? 28.455  40.225  44.015  1.00 14.69 ? 231 VAL F O   1 
ATOM   9658  C CB  . VAL F 1 209 ? 26.487  42.624  43.341  1.00 5.61  ? 231 VAL F CB  1 
ATOM   9659  C CG1 . VAL F 1 209 ? 26.079  41.755  44.532  1.00 5.00  ? 231 VAL F CG1 1 
ATOM   9660  C CG2 . VAL F 1 209 ? 26.289  44.074  43.660  1.00 5.00  ? 231 VAL F CG2 1 
ATOM   9661  N N   . CYS F 1 210 ? 28.185  40.231  41.765  1.00 13.88 ? 232 CYS F N   1 
ATOM   9662  C CA  . CYS F 1 210 ? 28.390  38.796  41.648  1.00 15.21 ? 232 CYS F CA  1 
ATOM   9663  C C   . CYS F 1 210 ? 29.751  38.342  42.159  1.00 14.36 ? 232 CYS F C   1 
ATOM   9664  O O   . CYS F 1 210 ? 29.852  37.276  42.764  1.00 15.18 ? 232 CYS F O   1 
ATOM   9665  C CB  . CYS F 1 210 ? 28.143  38.309  40.215  1.00 18.49 ? 232 CYS F CB  1 
ATOM   9666  S SG  . CYS F 1 210 ? 29.335  38.866  38.954  1.00 27.60 ? 232 CYS F SG  1 
ATOM   9667  N N   . ASN F 1 211 ? 30.769  39.184  41.996  1.00 14.82 ? 233 ASN F N   1 
ATOM   9668  C CA  . ASN F 1 211 ? 32.122  38.862  42.443  1.00 17.25 ? 233 ASN F CA  1 
ATOM   9669  C C   . ASN F 1 211 ? 32.236  38.882  43.959  1.00 20.10 ? 233 ASN F C   1 
ATOM   9670  O O   . ASN F 1 211 ? 33.145  38.270  44.527  1.00 23.53 ? 233 ASN F O   1 
ATOM   9671  C CB  . ASN F 1 211 ? 33.136  39.854  41.870  1.00 19.88 ? 233 ASN F CB  1 
ATOM   9672  C CG  . ASN F 1 211 ? 33.335  39.693  40.377  1.00 20.90 ? 233 ASN F CG  1 
ATOM   9673  O OD1 . ASN F 1 211 ? 32.807  38.759  39.773  1.00 23.72 ? 233 ASN F OD1 1 
ATOM   9674  N ND2 . ASN F 1 211 ? 34.125  40.585  39.779  1.00 15.78 ? 233 ASN F ND2 1 
ATOM   9675  N N   . TYR F 1 212 ? 31.309  39.566  44.623  1.00 20.09 ? 234 TYR F N   1 
ATOM   9676  C CA  . TYR F 1 212 ? 31.342  39.661  46.083  1.00 17.07 ? 234 TYR F CA  1 
ATOM   9677  C C   . TYR F 1 212 ? 30.334  38.789  46.868  1.00 16.37 ? 234 TYR F C   1 
ATOM   9678  O O   . TYR F 1 212 ? 30.328  38.817  48.106  1.00 16.60 ? 234 TYR F O   1 
ATOM   9679  C CB  . TYR F 1 212 ? 31.209  41.128  46.500  1.00 12.32 ? 234 TYR F CB  1 
ATOM   9680  C CG  . TYR F 1 212 ? 32.219  42.035  45.849  1.00 7.25  ? 234 TYR F CG  1 
ATOM   9681  C CD1 . TYR F 1 212 ? 33.447  42.279  46.447  1.00 5.00  ? 234 TYR F CD1 1 
ATOM   9682  C CD2 . TYR F 1 212 ? 31.950  42.628  44.626  1.00 6.86  ? 234 TYR F CD2 1 
ATOM   9683  C CE1 . TYR F 1 212 ? 34.379  43.081  45.849  1.00 5.28  ? 234 TYR F CE1 1 
ATOM   9684  C CE2 . TYR F 1 212 ? 32.875  43.431  44.013  1.00 7.41  ? 234 TYR F CE2 1 
ATOM   9685  C CZ  . TYR F 1 212 ? 34.087  43.654  44.626  1.00 8.79  ? 234 TYR F CZ  1 
ATOM   9686  O OH  . TYR F 1 212 ? 35.011  44.460  44.001  1.00 14.51 ? 234 TYR F OH  1 
ATOM   9687  N N   . VAL F 1 213 ? 29.537  37.978  46.172  1.00 14.20 ? 235 VAL F N   1 
ATOM   9688  C CA  . VAL F 1 213 ? 28.536  37.133  46.838  1.00 12.67 ? 235 VAL F CA  1 
ATOM   9689  C C   . VAL F 1 213 ? 29.103  36.380  48.013  1.00 12.59 ? 235 VAL F C   1 
ATOM   9690  O O   . VAL F 1 213 ? 28.521  36.398  49.096  1.00 11.75 ? 235 VAL F O   1 
ATOM   9691  C CB  . VAL F 1 213 ? 27.881  36.108  45.879  1.00 10.89 ? 235 VAL F CB  1 
ATOM   9692  C CG1 . VAL F 1 213 ? 26.870  35.259  46.616  1.00 5.00  ? 235 VAL F CG1 1 
ATOM   9693  C CG2 . VAL F 1 213 ? 27.215  36.829  44.723  1.00 14.53 ? 235 VAL F CG2 1 
ATOM   9694  N N   . SER F 1 214 ? 30.250  35.741  47.805  1.00 13.97 ? 236 SER F N   1 
ATOM   9695  C CA  . SER F 1 214 ? 30.883  34.974  48.864  1.00 14.51 ? 236 SER F CA  1 
ATOM   9696  C C   . SER F 1 214 ? 31.183  35.885  50.057  1.00 13.99 ? 236 SER F C   1 
ATOM   9697  O O   . SER F 1 214 ? 30.709  35.617  51.177  1.00 13.64 ? 236 SER F O   1 
ATOM   9698  C CB  . SER F 1 214 ? 32.162  34.294  48.358  1.00 15.73 ? 236 SER F CB  1 
ATOM   9699  O OG  . SER F 1 214 ? 31.944  33.630  47.126  0.00 16.96 ? 236 SER F OG  1 
ATOM   9700  N N   . TRP F 1 215 ? 31.889  36.995  49.798  1.00 11.15 ? 237 TRP F N   1 
ATOM   9701  C CA  . TRP F 1 215 ? 32.268  37.930  50.857  1.00 9.34  ? 237 TRP F CA  1 
ATOM   9702  C C   . TRP F 1 215 ? 31.057  38.327  51.639  1.00 13.36 ? 237 TRP F C   1 
ATOM   9703  O O   . TRP F 1 215 ? 31.065  38.243  52.870  1.00 18.29 ? 237 TRP F O   1 
ATOM   9704  C CB  . TRP F 1 215 ? 32.919  39.183  50.318  1.00 6.02  ? 237 TRP F CB  1 
ATOM   9705  C CG  . TRP F 1 215 ? 33.239  40.123  51.390  1.00 5.00  ? 237 TRP F CG  1 
ATOM   9706  C CD1 . TRP F 1 215 ? 34.169  39.961  52.368  1.00 6.83  ? 237 TRP F CD1 1 
ATOM   9707  C CD2 . TRP F 1 215 ? 32.607  41.375  51.635  1.00 7.02  ? 237 TRP F CD2 1 
ATOM   9708  N NE1 . TRP F 1 215 ? 34.160  41.042  53.219  1.00 9.48  ? 237 TRP F NE1 1 
ATOM   9709  C CE2 . TRP F 1 215 ? 33.207  41.928  52.792  1.00 9.19  ? 237 TRP F CE2 1 
ATOM   9710  C CE3 . TRP F 1 215 ? 31.587  42.086  50.992  1.00 7.28  ? 237 TRP F CE3 1 
ATOM   9711  C CZ2 . TRP F 1 215 ? 32.817  43.161  53.323  1.00 10.28 ? 237 TRP F CZ2 1 
ATOM   9712  C CZ3 . TRP F 1 215 ? 31.200  43.305  51.510  1.00 9.02  ? 237 TRP F CZ3 1 
ATOM   9713  C CH2 . TRP F 1 215 ? 31.815  43.833  52.671  1.00 11.74 ? 237 TRP F CH2 1 
ATOM   9714  N N   . ILE F 1 216 ? 30.014  38.759  50.930  1.00 14.16 ? 238 ILE F N   1 
ATOM   9715  C CA  . ILE F 1 216 ? 28.758  39.154  51.577  1.00 10.54 ? 238 ILE F CA  1 
ATOM   9716  C C   . ILE F 1 216 ? 28.332  38.003  52.507  1.00 10.23 ? 238 ILE F C   1 
ATOM   9717  O O   . ILE F 1 216 ? 28.328  38.174  53.737  1.00 8.81  ? 238 ILE F O   1 
ATOM   9718  C CB  . ILE F 1 216 ? 27.633  39.416  50.543  1.00 7.08  ? 238 ILE F CB  1 
ATOM   9719  C CG1 . ILE F 1 216 ? 28.088  40.445  49.509  1.00 5.00  ? 238 ILE F CG1 1 
ATOM   9720  C CG2 . ILE F 1 216 ? 26.391  39.904  51.251  1.00 5.00  ? 238 ILE F CG2 1 
ATOM   9721  C CD1 . ILE F 1 216 ? 27.103  40.658  48.382  1.00 5.00  ? 238 ILE F CD1 1 
ATOM   9722  N N   . LYS F 1 217 ? 28.122  36.815  51.926  1.00 6.61  ? 239 LYS F N   1 
ATOM   9723  C CA  . LYS F 1 217 ? 27.690  35.660  52.683  1.00 5.60  ? 239 LYS F CA  1 
ATOM   9724  C C   . LYS F 1 217 ? 28.514  35.387  53.921  1.00 6.49  ? 239 LYS F C   1 
ATOM   9725  O O   . LYS F 1 217 ? 27.958  35.179  55.000  1.00 9.29  ? 239 LYS F O   1 
ATOM   9726  C CB  . LYS F 1 217 ? 27.608  34.416  51.808  1.00 5.00  ? 239 LYS F CB  1 
ATOM   9727  C CG  . LYS F 1 217 ? 26.384  34.349  50.901  1.00 5.00  ? 239 LYS F CG  1 
ATOM   9728  C CD  . LYS F 1 217 ? 26.391  33.077  50.063  0.00 7.11  ? 239 LYS F CD  1 
ATOM   9729  C CE  . LYS F 1 217 ? 25.187  33.011  49.136  0.00 8.20  ? 239 LYS F CE  1 
ATOM   9730  N NZ  . LYS F 1 217 ? 25.212  31.789  48.282  0.00 8.32  ? 239 LYS F NZ  1 
ATOM   9731  N N   . GLN F 1 218 ? 29.829  35.441  53.810  1.00 5.00  ? 240 GLN F N   1 
ATOM   9732  C CA  . GLN F 1 218 ? 30.637  35.175  54.993  1.00 8.86  ? 240 GLN F CA  1 
ATOM   9733  C C   . GLN F 1 218 ? 30.430  36.253  56.075  1.00 10.46 ? 240 GLN F C   1 
ATOM   9734  O O   . GLN F 1 218 ? 30.128  35.932  57.242  1.00 9.76  ? 240 GLN F O   1 
ATOM   9735  C CB  . GLN F 1 218 ? 32.129  35.019  54.636  1.00 5.00  ? 240 GLN F CB  1 
ATOM   9736  C CG  . GLN F 1 218 ? 33.039  34.639  55.807  0.00 9.23  ? 240 GLN F CG  1 
ATOM   9737  C CD  . GLN F 1 218 ? 32.747  33.255  56.364  0.00 10.87 ? 240 GLN F CD  1 
ATOM   9738  O OE1 . GLN F 1 218 ? 32.931  32.247  55.682  0.00 11.89 ? 240 GLN F OE1 1 
ATOM   9739  N NE2 . GLN F 1 218 ? 32.303  33.200  57.612  0.00 11.59 ? 240 GLN F NE2 1 
ATOM   9740  N N   . THR F 1 219 ? 30.504  37.522  55.673  1.00 10.65 ? 241 THR F N   1 
ATOM   9741  C CA  . THR F 1 219 ? 30.389  38.646  56.609  1.00 10.36 ? 241 THR F CA  1 
ATOM   9742  C C   . THR F 1 219 ? 29.122  38.607  57.430  1.00 10.29 ? 241 THR F C   1 
ATOM   9743  O O   . THR F 1 219 ? 29.129  38.899  58.622  1.00 10.74 ? 241 THR F O   1 
ATOM   9744  C CB  . THR F 1 219 ? 30.469  40.001  55.890  1.00 8.20  ? 241 THR F CB  1 
ATOM   9745  O OG1 . THR F 1 219 ? 31.655  40.057  55.098  1.00 10.67 ? 241 THR F OG1 1 
ATOM   9746  C CG2 . THR F 1 219 ? 30.541  41.119  56.886  1.00 9.11  ? 241 THR F CG2 1 
ATOM   9747  N N   . ILE F 1 220 ? 28.033  38.246  56.777  1.00 11.30 ? 242 ILE F N   1 
ATOM   9748  C CA  . ILE F 1 220 ? 26.739  38.153  57.421  1.00 10.76 ? 242 ILE F CA  1 
ATOM   9749  C C   . ILE F 1 220 ? 26.709  37.041  58.477  1.00 11.12 ? 242 ILE F C   1 
ATOM   9750  O O   . ILE F 1 220 ? 26.241  37.253  59.598  1.00 14.19 ? 242 ILE F O   1 
ATOM   9751  C CB  . ILE F 1 220 ? 25.665  37.932  56.356  1.00 10.66 ? 242 ILE F CB  1 
ATOM   9752  C CG1 . ILE F 1 220 ? 25.528  39.200  55.510  1.00 10.46 ? 242 ILE F CG1 1 
ATOM   9753  C CG2 . ILE F 1 220 ? 24.349  37.613  56.986  1.00 15.89 ? 242 ILE F CG2 1 
ATOM   9754  C CD1 . ILE F 1 220 ? 24.663  39.034  54.269  1.00 9.55  ? 242 ILE F CD1 1 
ATOM   9755  N N   . ALA F 1 221 ? 27.234  35.869  58.140  1.00 10.13 ? 243 ALA F N   1 
ATOM   9756  C CA  . ALA F 1 221 ? 27.245  34.748  59.075  1.00 10.06 ? 243 ALA F CA  1 
ATOM   9757  C C   . ALA F 1 221 ? 28.129  34.950  60.310  1.00 10.72 ? 243 ALA F C   1 
ATOM   9758  O O   . ALA F 1 221 ? 27.950  34.302  61.331  1.00 9.63  ? 243 ALA F O   1 
ATOM   9759  C CB  . ALA F 1 221 ? 27.678  33.493  58.350  1.00 14.98 ? 243 ALA F CB  1 
ATOM   9760  N N   . SER F 1 222 ? 29.111  35.826  60.206  1.00 12.57 ? 244 SER F N   1 
ATOM   9761  C CA  . SER F 1 222 ? 30.038  36.053  61.306  1.00 11.98 ? 244 SER F CA  1 
ATOM   9762  C C   . SER F 1 222 ? 29.709  37.257  62.144  1.00 11.86 ? 244 SER F C   1 
ATOM   9763  O O   . SER F 1 222 ? 30.163  37.362  63.281  1.00 14.50 ? 244 SER F O   1 
ATOM   9764  C CB  . SER F 1 222 ? 31.447  36.244  60.744  1.00 11.23 ? 244 SER F CB  1 
ATOM   9765  O OG  . SER F 1 222 ? 31.669  35.346  59.666  1.00 13.76 ? 244 SER F OG  1 
ATOM   9766  N N   . ASN F 1 223 ? 28.954  38.185  61.575  1.00 11.55 ? 245 ASN F N   1 
ATOM   9767  C CA  . ASN F 1 223 ? 28.630  39.414  62.276  1.00 10.42 ? 245 ASN F CA  1 
ATOM   9768  C C   . ASN F 1 223 ? 27.205  39.493  62.761  1.00 7.35  ? 245 ASN F C   1 
ATOM   9769  O O   . ASN F 1 223 ? 26.694  40.616  62.863  1.00 7.99  ? 245 ASN F O   1 
ATOM   9770  C CB  . ASN F 1 223 ? 28.994  40.617  61.385  1.00 12.69 ? 245 ASN F CB  1 
ATOM   9771  C CG  . ASN F 1 223 ? 30.514  40.723  61.127  1.00 15.56 ? 245 ASN F CG  1 
ATOM   9772  O OD1 . ASN F 1 223 ? 31.306  41.062  62.026  1.00 16.02 ? 245 ASN F OD1 1 
ATOM   9773  N ND2 . ASN F 1 223 ? 30.925  40.413  59.904  1.00 17.14 ? 245 ASN F ND2 1 
ATOM   9774  O OXT . ASN F 1 223 ? 26.624  38.434  63.051  1.00 8.18  ? 245 ASN F OXT 1 
ATOM   9775  N N   . THR G 2 7   ? 39.407  24.566  29.248  1.00 54.74 ? 7   THR G N   1 
ATOM   9776  C CA  . THR G 2 7   ? 39.849  25.993  29.392  1.00 55.12 ? 7   THR G CA  1 
ATOM   9777  C C   . THR G 2 7   ? 39.382  26.770  28.156  1.00 51.83 ? 7   THR G C   1 
ATOM   9778  O O   . THR G 2 7   ? 39.759  26.392  27.040  1.00 56.95 ? 7   THR G O   1 
ATOM   9779  C CB  . THR G 2 7   ? 41.391  26.089  29.431  1.00 57.93 ? 7   THR G CB  1 
ATOM   9780  O OG1 . THR G 2 7   ? 41.952  24.805  29.769  1.00 57.02 ? 7   THR G OG1 1 
ATOM   9781  C CG2 . THR G 2 7   ? 41.824  27.178  30.435  1.00 60.50 ? 7   THR G CG2 1 
ATOM   9782  N N   . THR G 2 8   ? 38.631  27.863  28.335  1.00 44.61 ? 8   THR G N   1 
ATOM   9783  C CA  . THR G 2 8   ? 38.114  28.646  27.198  1.00 38.40 ? 8   THR G CA  1 
ATOM   9784  C C   . THR G 2 8   ? 37.288  29.849  27.670  1.00 35.55 ? 8   THR G C   1 
ATOM   9785  O O   . THR G 2 8   ? 36.539  29.737  28.639  1.00 38.94 ? 8   THR G O   1 
ATOM   9786  C CB  . THR G 2 8   ? 37.143  27.766  26.283  1.00 39.59 ? 8   THR G CB  1 
ATOM   9787  O OG1 . THR G 2 8   ? 36.824  26.509  26.927  1.00 37.43 ? 8   THR G OG1 1 
ATOM   9788  C CG2 . THR G 2 8   ? 37.752  27.509  24.892  1.00 37.99 ? 8   THR G CG2 1 
ATOM   9789  N N   . PRO G 2 9   ? 37.422  31.020  27.018  1.00 29.26 ? 9   PRO G N   1 
ATOM   9790  C CA  . PRO G 2 9   ? 36.621  32.178  27.449  1.00 28.68 ? 9   PRO G CA  1 
ATOM   9791  C C   . PRO G 2 9   ? 35.162  31.820  27.155  1.00 29.06 ? 9   PRO G C   1 
ATOM   9792  O O   . PRO G 2 9   ? 34.869  31.221  26.110  1.00 31.32 ? 9   PRO G O   1 
ATOM   9793  C CB  . PRO G 2 9   ? 37.136  33.300  26.551  1.00 25.48 ? 9   PRO G CB  1 
ATOM   9794  C CG  . PRO G 2 9   ? 37.587  32.575  25.310  0.00 26.32 ? 9   PRO G CG  1 
ATOM   9795  C CD  . PRO G 2 9   ? 38.290  31.369  25.880  0.00 28.15 ? 9   PRO G CD  1 
ATOM   9796  N N   . CYS G 2 10  ? 34.244  32.204  28.034  1.00 27.68 ? 10  CYS G N   1 
ATOM   9797  C CA  . CYS G 2 10  ? 32.865  31.797  27.844  1.00 26.21 ? 10  CYS G CA  1 
ATOM   9798  C C   . CYS G 2 10  ? 31.817  32.755  28.393  1.00 25.26 ? 10  CYS G C   1 
ATOM   9799  O O   . CYS G 2 10  ? 31.657  32.899  29.602  1.00 24.14 ? 10  CYS G O   1 
ATOM   9800  C CB  . CYS G 2 10  ? 32.724  30.429  28.489  1.00 24.54 ? 10  CYS G CB  1 
ATOM   9801  S SG  . CYS G 2 10  ? 31.159  29.646  28.146  1.00 21.67 ? 10  CYS G SG  1 
ATOM   9802  N N   . GLY G 2 11  ? 31.063  33.371  27.499  1.00 25.84 ? 11  GLY G N   1 
ATOM   9803  C CA  . GLY G 2 11  ? 30.040  34.304  27.927  1.00 27.06 ? 11  GLY G CA  1 
ATOM   9804  C C   . GLY G 2 11  ? 30.621  35.313  28.889  1.00 28.61 ? 11  GLY G C   1 
ATOM   9805  O O   . GLY G 2 11  ? 31.664  35.910  28.593  1.00 30.61 ? 11  GLY G O   1 
ATOM   9806  N N   . PRO G 2 12  ? 29.986  35.510  30.060  1.00 30.47 ? 12  PRO G N   1 
ATOM   9807  C CA  . PRO G 2 12  ? 30.409  36.448  31.108  1.00 32.10 ? 12  PRO G CA  1 
ATOM   9808  C C   . PRO G 2 12  ? 31.519  35.873  31.997  1.00 36.25 ? 12  PRO G C   1 
ATOM   9809  O O   . PRO G 2 12  ? 32.103  36.577  32.822  1.00 35.89 ? 12  PRO G O   1 
ATOM   9810  C CB  . PRO G 2 12  ? 29.119  36.653  31.893  1.00 30.03 ? 12  PRO G CB  1 
ATOM   9811  C CG  . PRO G 2 12  ? 28.527  35.294  31.863  1.00 28.85 ? 12  PRO G CG  1 
ATOM   9812  C CD  . PRO G 2 12  ? 28.702  34.882  30.422  1.00 29.43 ? 12  PRO G CD  1 
ATOM   9813  N N   . VAL G 2 13  ? 31.801  34.590  31.814  1.00 40.68 ? 13  VAL G N   1 
ATOM   9814  C CA  . VAL G 2 13  ? 32.819  33.899  32.590  1.00 42.64 ? 13  VAL G CA  1 
ATOM   9815  C C   . VAL G 2 13  ? 33.954  33.331  31.724  1.00 41.22 ? 13  VAL G C   1 
ATOM   9816  O O   . VAL G 2 13  ? 34.005  33.555  30.504  1.00 42.39 ? 13  VAL G O   1 
ATOM   9817  C CB  . VAL G 2 13  ? 32.171  32.788  33.448  1.00 46.26 ? 13  VAL G CB  1 
ATOM   9818  C CG1 . VAL G 2 13  ? 31.532  33.406  34.682  1.00 47.07 ? 13  VAL G CG1 1 
ATOM   9819  C CG2 . VAL G 2 13  ? 31.104  32.039  32.640  1.00 47.11 ? 13  VAL G CG2 1 
ATOM   9820  N N   . THR G 2 14  ? 34.861  32.595  32.354  1.00 38.19 ? 14  THR G N   1 
ATOM   9821  C CA  . THR G 2 14  ? 36.001  32.024  31.653  1.00 38.65 ? 14  THR G CA  1 
ATOM   9822  C C   . THR G 2 14  ? 36.291  30.633  32.209  1.00 39.20 ? 14  THR G C   1 
ATOM   9823  O O   . THR G 2 14  ? 36.595  30.481  33.392  1.00 41.23 ? 14  THR G O   1 
ATOM   9824  C CB  . THR G 2 14  ? 37.211  32.928  31.866  1.00 39.21 ? 14  THR G CB  1 
ATOM   9825  O OG1 . THR G 2 14  ? 37.132  33.484  33.188  1.00 39.21 ? 14  THR G OG1 1 
ATOM   9826  C CG2 . THR G 2 14  ? 37.235  34.059  30.822  1.00 37.79 ? 14  THR G CG2 1 
ATOM   9827  N N   . CYS G 2 15  ? 36.165  29.619  31.367  1.00 38.26 ? 15  CYS G N   1 
ATOM   9828  C CA  . CYS G 2 15  ? 36.404  28.250  31.789  1.00 36.56 ? 15  CYS G CA  1 
ATOM   9829  C C   . CYS G 2 15  ? 37.897  27.965  31.990  1.00 35.92 ? 15  CYS G C   1 
ATOM   9830  O O   . CYS G 2 15  ? 38.743  28.294  31.146  1.00 37.54 ? 15  CYS G O   1 
ATOM   9831  C CB  . CYS G 2 15  ? 35.750  27.306  30.784  1.00 33.40 ? 15  CYS G CB  1 
ATOM   9832  S SG  . CYS G 2 15  ? 34.133  27.993  30.305  1.00 28.68 ? 15  CYS G SG  1 
ATOM   9833  N N   . SER G 2 16  ? 38.211  27.397  33.144  1.00 33.74 ? 16  SER G N   1 
ATOM   9834  C CA  . SER G 2 16  ? 39.577  27.077  33.497  1.00 32.11 ? 16  SER G CA  1 
ATOM   9835  C C   . SER G 2 16  ? 39.757  25.584  33.377  1.00 30.71 ? 16  SER G C   1 
ATOM   9836  O O   . SER G 2 16  ? 38.791  24.850  33.184  1.00 28.04 ? 16  SER G O   1 
ATOM   9837  C CB  . SER G 2 16  ? 39.848  27.490  34.941  1.00 34.19 ? 16  SER G CB  1 
ATOM   9838  O OG  . SER G 2 16  ? 41.227  27.745  35.161  0.00 33.33 ? 16  SER G OG  1 
ATOM   9839  N N   . GLY G 2 17  ? 41.014  25.161  33.452  1.00 31.16 ? 17  GLY G N   1 
ATOM   9840  C CA  . GLY G 2 17  ? 41.396  23.762  33.384  1.00 27.57 ? 17  GLY G CA  1 
ATOM   9841  C C   . GLY G 2 17  ? 40.477  22.759  32.730  1.00 23.69 ? 17  GLY G C   1 
ATOM   9842  O O   . GLY G 2 17  ? 40.345  22.717  31.498  1.00 23.79 ? 17  GLY G O   1 
ATOM   9843  N N   . ALA G 2 18  ? 39.803  21.991  33.580  1.00 20.84 ? 18  ALA G N   1 
ATOM   9844  C CA  . ALA G 2 18  ? 38.911  20.926  33.148  1.00 21.04 ? 18  ALA G CA  1 
ATOM   9845  C C   . ALA G 2 18  ? 37.469  21.301  32.861  1.00 20.89 ? 18  ALA G C   1 
ATOM   9846  O O   . ALA G 2 18  ? 36.613  20.422  32.804  1.00 23.49 ? 18  ALA G O   1 
ATOM   9847  C CB  . ALA G 2 18  ? 38.950  19.788  34.166  1.00 21.97 ? 18  ALA G CB  1 
ATOM   9848  N N   . GLN G 2 19  ? 37.188  22.586  32.693  1.00 20.83 ? 19  GLN G N   1 
ATOM   9849  C CA  . GLN G 2 19  ? 35.825  23.027  32.425  1.00 20.30 ? 19  GLN G CA  1 
ATOM   9850  C C   . GLN G 2 19  ? 35.506  23.225  30.967  1.00 22.33 ? 19  GLN G C   1 
ATOM   9851  O O   . GLN G 2 19  ? 36.295  23.803  30.213  1.00 24.92 ? 19  GLN G O   1 
ATOM   9852  C CB  . GLN G 2 19  ? 35.537  24.338  33.122  1.00 18.74 ? 19  GLN G CB  1 
ATOM   9853  C CG  . GLN G 2 19  ? 35.536  24.266  34.605  1.00 17.67 ? 19  GLN G CG  1 
ATOM   9854  C CD  . GLN G 2 19  ? 35.119  25.575  35.201  1.00 18.97 ? 19  GLN G CD  1 
ATOM   9855  O OE1 . GLN G 2 19  ? 35.614  26.629  34.809  1.00 21.70 ? 19  GLN G OE1 1 
ATOM   9856  N NE2 . GLN G 2 19  ? 34.181  25.531  36.131  1.00 21.31 ? 19  GLN G NE2 1 
ATOM   9857  N N   . MET G 2 20  ? 34.305  22.805  30.604  1.00 23.56 ? 20  MET G N   1 
ATOM   9858  C CA  . MET G 2 20  ? 33.789  22.933  29.250  1.00 26.95 ? 20  MET G CA  1 
ATOM   9859  C C   . MET G 2 20  ? 32.779  24.079  29.315  1.00 28.39 ? 20  MET G C   1 
ATOM   9860  O O   . MET G 2 20  ? 32.034  24.201  30.282  1.00 31.26 ? 20  MET G O   1 
ATOM   9861  C CB  . MET G 2 20  ? 33.099  21.630  28.795  1.00 24.38 ? 20  MET G CB  1 
ATOM   9862  C CG  . MET G 2 20  ? 32.618  21.632  27.348  0.00 24.35 ? 20  MET G CG  1 
ATOM   9863  S SD  . MET G 2 20  ? 33.959  21.776  26.146  0.00 24.06 ? 20  MET G SD  1 
ATOM   9864  C CE  . MET G 2 20  ? 33.604  23.374  25.418  0.00 23.96 ? 20  MET G CE  1 
ATOM   9865  N N   . CYS G 2 21  ? 32.795  24.933  28.303  1.00 27.65 ? 21  CYS G N   1 
ATOM   9866  C CA  . CYS G 2 21  ? 31.909  26.083  28.213  1.00 29.28 ? 21  CYS G CA  1 
ATOM   9867  C C   . CYS G 2 21  ? 30.541  25.734  27.629  1.00 30.54 ? 21  CYS G C   1 
ATOM   9868  O O   . CYS G 2 21  ? 30.451  25.179  26.543  1.00 30.92 ? 21  CYS G O   1 
ATOM   9869  C CB  . CYS G 2 21  ? 32.610  27.154  27.370  1.00 31.01 ? 21  CYS G CB  1 
ATOM   9870  S SG  . CYS G 2 21  ? 31.582  28.442  26.595  1.00 30.96 ? 21  CYS G SG  1 
ATOM   9871  N N   . GLU G 2 22  ? 29.486  26.082  28.358  1.00 32.15 ? 22  GLU G N   1 
ATOM   9872  C CA  . GLU G 2 22  ? 28.106  25.827  27.971  1.00 30.80 ? 22  GLU G CA  1 
ATOM   9873  C C   . GLU G 2 22  ? 27.434  27.170  27.712  1.00 26.05 ? 22  GLU G C   1 
ATOM   9874  O O   . GLU G 2 22  ? 26.859  27.748  28.636  1.00 29.27 ? 22  GLU G O   1 
ATOM   9875  C CB  . GLU G 2 22  ? 27.373  25.141  29.123  0.00 36.08 ? 22  GLU G CB  1 
ATOM   9876  C CG  . GLU G 2 22  ? 26.284  24.227  28.657  0.00 43.42 ? 22  GLU G CG  1 
ATOM   9877  C CD  . GLU G 2 22  ? 26.847  23.145  27.782  1.00 48.75 ? 22  GLU G CD  1 
ATOM   9878  O OE1 . GLU G 2 22  ? 27.809  22.488  28.221  1.00 52.78 ? 22  GLU G OE1 1 
ATOM   9879  O OE2 . GLU G 2 22  ? 26.354  22.961  26.651  1.00 53.42 ? 22  GLU G OE2 1 
ATOM   9880  N N   . VAL G 2 23  ? 27.527  27.668  26.478  1.00 18.29 ? 23  VAL G N   1 
ATOM   9881  C CA  . VAL G 2 23  ? 26.943  28.941  26.061  1.00 12.39 ? 23  VAL G CA  1 
ATOM   9882  C C   . VAL G 2 23  ? 27.445  30.123  26.894  1.00 14.54 ? 23  VAL G C   1 
ATOM   9883  O O   . VAL G 2 23  ? 28.267  30.912  26.413  1.00 13.49 ? 23  VAL G O   1 
ATOM   9884  C CB  . VAL G 2 23  ? 25.405  28.912  26.056  0.00 12.50 ? 23  VAL G CB  1 
ATOM   9885  C CG1 . VAL G 2 23  ? 24.885  30.194  25.446  0.00 11.12 ? 23  VAL G CG1 1 
ATOM   9886  C CG2 . VAL G 2 23  ? 24.898  27.711  25.267  0.00 11.12 ? 23  VAL G CG2 1 
ATOM   9887  N N   . ASP G 2 24  ? 26.967  30.232  28.139  1.00 15.61 ? 24  ASP G N   1 
ATOM   9888  C CA  . ASP G 2 24  ? 27.354  31.310  29.055  1.00 14.42 ? 24  ASP G CA  1 
ATOM   9889  C C   . ASP G 2 24  ? 27.930  30.853  30.393  1.00 11.81 ? 24  ASP G C   1 
ATOM   9890  O O   . ASP G 2 24  ? 28.406  31.672  31.173  1.00 12.61 ? 24  ASP G O   1 
ATOM   9891  C CB  . ASP G 2 24  ? 26.184  32.286  29.293  1.00 17.69 ? 24  ASP G CB  1 
ATOM   9892  C CG  . ASP G 2 24  ? 24.830  31.587  29.467  1.00 24.14 ? 24  ASP G CG  1 
ATOM   9893  O OD1 . ASP G 2 24  ? 23.926  31.837  28.639  1.00 27.87 ? 24  ASP G OD1 1 
ATOM   9894  O OD2 . ASP G 2 24  ? 24.647  30.816  30.434  1.00 27.90 ? 24  ASP G OD2 1 
ATOM   9895  N N   . LYS G 2 25  ? 27.907  29.553  30.658  1.00 9.62  ? 25  LYS G N   1 
ATOM   9896  C CA  . LYS G 2 25  ? 28.437  29.032  31.914  1.00 13.70 ? 25  LYS G CA  1 
ATOM   9897  C C   . LYS G 2 25  ? 29.477  27.937  31.698  1.00 16.28 ? 25  LYS G C   1 
ATOM   9898  O O   . LYS G 2 25  ? 29.433  27.234  30.708  1.00 15.59 ? 25  LYS G O   1 
ATOM   9899  C CB  . LYS G 2 25  ? 27.303  28.500  32.797  0.00 11.51 ? 25  LYS G CB  1 
ATOM   9900  C CG  . LYS G 2 25  ? 26.399  29.579  33.385  0.00 9.07  ? 25  LYS G CG  1 
ATOM   9901  C CD  . LYS G 2 25  ? 27.167  30.516  34.313  0.00 6.66  ? 25  LYS G CD  1 
ATOM   9902  C CE  . LYS G 2 25  ? 27.737  29.779  35.519  0.00 5.45  ? 25  LYS G CE  1 
ATOM   9903  N NZ  . LYS G 2 25  ? 26.672  29.238  36.410  0.00 5.08  ? 25  LYS G NZ  1 
ATOM   9904  N N   . CYS G 2 26  ? 30.419  27.807  32.625  1.00 18.23 ? 26  CYS G N   1 
ATOM   9905  C CA  . CYS G 2 26  ? 31.455  26.783  32.540  1.00 17.67 ? 26  CYS G CA  1 
ATOM   9906  C C   . CYS G 2 26  ? 31.079  25.598  33.450  1.00 16.51 ? 26  CYS G C   1 
ATOM   9907  O O   . CYS G 2 26  ? 30.862  25.762  34.649  1.00 15.65 ? 26  CYS G O   1 
ATOM   9908  C CB  . CYS G 2 26  ? 32.820  27.351  32.971  1.00 19.66 ? 26  CYS G CB  1 
ATOM   9909  S SG  . CYS G 2 26  ? 33.478  28.789  32.054  1.00 20.67 ? 26  CYS G SG  1 
ATOM   9910  N N   . VAL G 2 27  ? 30.990  24.409  32.872  1.00 15.22 ? 27  VAL G N   1 
ATOM   9911  C CA  . VAL G 2 27  ? 30.646  23.203  33.622  1.00 15.39 ? 27  VAL G CA  1 
ATOM   9912  C C   . VAL G 2 27  ? 31.705  22.125  33.469  1.00 18.27 ? 27  VAL G C   1 
ATOM   9913  O O   . VAL G 2 27  ? 32.586  22.237  32.620  1.00 19.10 ? 27  VAL G O   1 
ATOM   9914  C CB  . VAL G 2 27  ? 29.353  22.577  33.119  1.00 9.51  ? 27  VAL G CB  1 
ATOM   9915  C CG1 . VAL G 2 27  ? 28.196  23.359  33.617  1.00 9.86  ? 27  VAL G CG1 1 
ATOM   9916  C CG2 . VAL G 2 27  ? 29.366  22.493  31.606  1.00 5.00  ? 27  VAL G CG2 1 
ATOM   9917  N N   . CYS G 2 28  ? 31.623  21.086  34.298  1.00 18.41 ? 28  CYS G N   1 
ATOM   9918  C CA  . CYS G 2 28  ? 32.561  19.977  34.207  1.00 15.49 ? 28  CYS G CA  1 
ATOM   9919  C C   . CYS G 2 28  ? 31.923  18.981  33.264  1.00 14.36 ? 28  CYS G C   1 
ATOM   9920  O O   . CYS G 2 28  ? 30.729  19.102  32.962  1.00 15.28 ? 28  CYS G O   1 
ATOM   9921  C CB  . CYS G 2 28  ? 32.767  19.329  35.558  1.00 15.26 ? 28  CYS G CB  1 
ATOM   9922  S SG  . CYS G 2 28  ? 33.144  20.523  36.858  1.00 14.92 ? 28  CYS G SG  1 
ATOM   9923  N N   . SER G 2 29  ? 32.711  18.016  32.791  1.00 11.62 ? 29  SER G N   1 
ATOM   9924  C CA  . SER G 2 29  ? 32.214  16.990  31.877  1.00 12.47 ? 29  SER G CA  1 
ATOM   9925  C C   . SER G 2 29  ? 32.444  15.603  32.439  1.00 16.16 ? 29  SER G C   1 
ATOM   9926  O O   . SER G 2 29  ? 33.279  15.427  33.314  1.00 22.21 ? 29  SER G O   1 
ATOM   9927  C CB  . SER G 2 29  ? 32.906  17.094  30.526  1.00 8.53  ? 29  SER G CB  1 
ATOM   9928  O OG  . SER G 2 29  ? 32.740  18.387  29.970  0.00 7.21  ? 29  SER G OG  1 
ATOM   9929  N N   . ASP G 2 30  ? 31.671  14.629  31.967  1.00 18.15 ? 30  ASP G N   1 
ATOM   9930  C CA  . ASP G 2 30  ? 31.807  13.236  32.411  1.00 19.19 ? 30  ASP G CA  1 
ATOM   9931  C C   . ASP G 2 30  ? 32.555  12.482  31.305  1.00 17.84 ? 30  ASP G C   1 
ATOM   9932  O O   . ASP G 2 30  ? 32.720  11.264  31.341  1.00 11.98 ? 30  ASP G O   1 
ATOM   9933  C CB  . ASP G 2 30  ? 30.429  12.616  32.697  1.00 18.44 ? 30  ASP G CB  1 
ATOM   9934  C CG  . ASP G 2 30  ? 29.632  13.405  33.720  0.00 14.98 ? 30  ASP G CG  1 
ATOM   9935  O OD1 . ASP G 2 30  ? 29.694  13.061  34.919  0.00 13.55 ? 30  ASP G OD1 1 
ATOM   9936  O OD2 . ASP G 2 30  ? 28.944  14.369  33.325  0.00 13.51 ? 30  ASP G OD2 1 
ATOM   9937  N N   . LEU G 2 31  ? 33.016  13.263  30.333  1.00 19.29 ? 31  LEU G N   1 
ATOM   9938  C CA  . LEU G 2 31  ? 33.784  12.807  29.177  1.00 19.72 ? 31  LEU G CA  1 
ATOM   9939  C C   . LEU G 2 31  ? 35.166  12.327  29.655  1.00 17.24 ? 31  LEU G C   1 
ATOM   9940  O O   . LEU G 2 31  ? 35.932  13.090  30.238  1.00 17.27 ? 31  LEU G O   1 
ATOM   9941  C CB  . LEU G 2 31  ? 33.963  13.995  28.238  1.00 17.18 ? 31  LEU G CB  1 
ATOM   9942  C CG  . LEU G 2 31  ? 34.112  13.669  26.773  1.00 16.70 ? 31  LEU G CG  1 
ATOM   9943  C CD1 . LEU G 2 31  ? 32.767  13.285  26.194  1.00 12.62 ? 31  LEU G CD1 1 
ATOM   9944  C CD2 . LEU G 2 31  ? 34.666  14.912  26.111  1.00 21.36 ? 31  LEU G CD2 1 
ATOM   9945  N N   . HIS G 2 32  ? 35.493  11.079  29.381  1.00 14.75 ? 32  HIS G N   1 
ATOM   9946  C CA  . HIS G 2 32  ? 36.756  10.526  29.824  1.00 16.10 ? 32  HIS G CA  1 
ATOM   9947  C C   . HIS G 2 32  ? 37.252  9.447   28.872  1.00 21.78 ? 32  HIS G C   1 
ATOM   9948  O O   . HIS G 2 32  ? 36.447  8.749   28.229  1.00 27.49 ? 32  HIS G O   1 
ATOM   9949  C CB  . HIS G 2 32  ? 36.552  9.837   31.167  1.00 9.82  ? 32  HIS G CB  1 
ATOM   9950  C CG  . HIS G 2 32  ? 36.631  10.743  32.343  1.00 6.50  ? 32  HIS G CG  1 
ATOM   9951  N ND1 . HIS G 2 32  ? 35.698  10.722  33.352  1.00 5.00  ? 32  HIS G ND1 1 
ATOM   9952  C CD2 . HIS G 2 32  ? 37.575  11.634  32.723  1.00 8.23  ? 32  HIS G CD2 1 
ATOM   9953  C CE1 . HIS G 2 32  ? 36.065  11.553  34.309  1.00 7.21  ? 32  HIS G CE1 1 
ATOM   9954  N NE2 . HIS G 2 32  ? 37.203  12.119  33.950  1.00 8.61  ? 32  HIS G NE2 1 
ATOM   9955  N N   . CYS G 2 33  ? 38.571  9.298   28.785  1.00 19.61 ? 33  CYS G N   1 
ATOM   9956  C CA  . CYS G 2 33  ? 39.151  8.238   27.968  1.00 16.52 ? 33  CYS G CA  1 
ATOM   9957  C C   . CYS G 2 33  ? 38.984  7.039   28.908  1.00 12.98 ? 33  CYS G C   1 
ATOM   9958  O O   . CYS G 2 33  ? 38.792  7.222   30.116  1.00 15.36 ? 33  CYS G O   1 
ATOM   9959  C CB  . CYS G 2 33  ? 40.646  8.499   27.713  1.00 19.46 ? 33  CYS G CB  1 
ATOM   9960  S SG  . CYS G 2 33  ? 41.700  8.420   29.210  1.00 23.41 ? 33  CYS G SG  1 
ATOM   9961  N N   . LYS G 2 34  ? 39.069  5.821   28.399  1.00 8.69  ? 34  LYS G N   1 
ATOM   9962  C CA  . LYS G 2 34  ? 38.904  4.668   29.285  1.00 6.69  ? 34  LYS G CA  1 
ATOM   9963  C C   . LYS G 2 34  ? 40.178  3.990   29.837  1.00 7.44  ? 34  LYS G C   1 
ATOM   9964  O O   . LYS G 2 34  ? 40.357  2.768   29.707  1.00 7.17  ? 34  LYS G O   1 
ATOM   9965  C CB  . LYS G 2 34  ? 37.986  3.631   28.637  1.00 5.00  ? 34  LYS G CB  1 
ATOM   9966  C CG  . LYS G 2 34  ? 36.634  4.165   28.260  1.00 7.61  ? 34  LYS G CG  1 
ATOM   9967  C CD  . LYS G 2 34  ? 35.814  3.097   27.576  1.00 9.45  ? 34  LYS G CD  1 
ATOM   9968  C CE  . LYS G 2 34  ? 34.382  3.533   27.344  1.00 7.83  ? 34  LYS G CE  1 
ATOM   9969  N NZ  . LYS G 2 34  ? 34.253  4.677   26.421  1.00 7.98  ? 34  LYS G NZ  1 
ATOM   9970  N N   . VAL G 2 35  ? 41.070  4.763   30.447  1.00 9.26  ? 35  VAL G N   1 
ATOM   9971  C CA  . VAL G 2 35  ? 42.287  4.174   31.028  1.00 9.96  ? 35  VAL G CA  1 
ATOM   9972  C C   . VAL G 2 35  ? 41.945  3.766   32.455  1.00 10.35 ? 35  VAL G C   1 
ATOM   9973  O O   . VAL G 2 35  ? 40.801  3.871   32.858  1.00 13.62 ? 35  VAL G O   1 
ATOM   9974  C CB  . VAL G 2 35  ? 43.436  5.193   31.114  1.00 7.26  ? 35  VAL G CB  1 
ATOM   9975  C CG1 . VAL G 2 35  ? 43.817  5.669   29.742  1.00 5.00  ? 35  VAL G CG1 1 
ATOM   9976  C CG2 . VAL G 2 35  ? 43.024  6.352   31.994  1.00 5.00  ? 35  VAL G CG2 1 
ATOM   9977  N N   . LYS G 2 36  ? 42.903  3.243   33.204  1.00 10.76 ? 36  LYS G N   1 
ATOM   9978  C CA  . LYS G 2 36  ? 42.641  2.913   34.602  1.00 12.28 ? 36  LYS G CA  1 
ATOM   9979  C C   . LYS G 2 36  ? 43.627  3.661   35.501  1.00 18.82 ? 36  LYS G C   1 
ATOM   9980  O O   . LYS G 2 36  ? 44.752  3.198   35.731  1.00 22.12 ? 36  LYS G O   1 
ATOM   9981  C CB  . LYS G 2 36  ? 42.712  1.419   34.905  1.00 5.00  ? 36  LYS G CB  1 
ATOM   9982  C CG  . LYS G 2 36  ? 42.689  1.154   36.413  1.00 5.00  ? 36  LYS G CG  1 
ATOM   9983  C CD  . LYS G 2 36  ? 42.929  -0.322  36.745  1.00 11.30 ? 36  LYS G CD  1 
ATOM   9984  C CE  . LYS G 2 36  ? 43.209  -0.589  38.248  1.00 9.16  ? 36  LYS G CE  1 
ATOM   9985  N NZ  . LYS G 2 36  ? 43.611  -2.020  38.494  1.00 5.33  ? 36  LYS G NZ  1 
ATOM   9986  N N   . CYS G 2 37  ? 43.235  4.853   35.949  1.00 21.12 ? 37  CYS G N   1 
ATOM   9987  C CA  . CYS G 2 37  ? 44.076  5.643   36.841  1.00 20.51 ? 37  CYS G CA  1 
ATOM   9988  C C   . CYS G 2 37  ? 44.130  4.941   38.183  1.00 21.68 ? 37  CYS G C   1 
ATOM   9989  O O   . CYS G 2 37  ? 43.087  4.610   38.744  1.00 22.57 ? 37  CYS G O   1 
ATOM   9990  C CB  . CYS G 2 37  ? 43.448  6.996   37.095  1.00 18.50 ? 37  CYS G CB  1 
ATOM   9991  S SG  . CYS G 2 37  ? 43.197  7.994   35.618  1.00 19.25 ? 37  CYS G SG  1 
ATOM   9992  N N   . GLU G 2 38  ? 45.327  4.737   38.717  1.00 21.81 ? 38  GLU G N   1 
ATOM   9993  C CA  . GLU G 2 38  ? 45.442  4.097   40.014  1.00 23.10 ? 38  GLU G CA  1 
ATOM   9994  C C   . GLU G 2 38  ? 44.668  4.939   41.013  1.00 24.46 ? 38  GLU G C   1 
ATOM   9995  O O   . GLU G 2 38  ? 43.892  4.418   41.787  1.00 28.91 ? 38  GLU G O   1 
ATOM   9996  C CB  . GLU G 2 38  ? 46.901  4.011   40.459  1.00 25.14 ? 38  GLU G CB  1 
ATOM   9997  C CG  . GLU G 2 38  ? 47.099  3.277   41.792  1.00 24.79 ? 38  GLU G CG  1 
ATOM   9998  C CD  . GLU G 2 38  ? 48.545  3.291   42.302  1.00 24.74 ? 38  GLU G CD  1 
ATOM   9999  O OE1 . GLU G 2 38  ? 48.850  2.472   43.192  1.00 22.49 ? 38  GLU G OE1 1 
ATOM   10000 O OE2 . GLU G 2 38  ? 49.374  4.107   41.830  1.00 25.32 ? 38  GLU G OE2 1 
ATOM   10001 N N   . HIS G 2 39  ? 44.842  6.252   40.966  1.00 23.64 ? 39  HIS G N   1 
ATOM   10002 C CA  . HIS G 2 39  ? 44.146  7.109   41.908  1.00 21.28 ? 39  HIS G CA  1 
ATOM   10003 C C   . HIS G 2 39  ? 42.989  7.924   41.351  1.00 20.94 ? 39  HIS G C   1 
ATOM   10004 O O   . HIS G 2 39  ? 42.485  8.828   42.012  1.00 23.08 ? 39  HIS G O   1 
ATOM   10005 C CB  . HIS G 2 39  ? 45.156  7.991   42.614  1.00 19.57 ? 39  HIS G CB  1 
ATOM   10006 C CG  . HIS G 2 39  ? 46.134  7.214   43.430  1.00 19.81 ? 39  HIS G CG  1 
ATOM   10007 N ND1 . HIS G 2 39  ? 47.492  7.437   43.386  1.00 21.48 ? 39  HIS G ND1 1 
ATOM   10008 C CD2 . HIS G 2 39  ? 45.951  6.193   44.298  1.00 20.55 ? 39  HIS G CD2 1 
ATOM   10009 C CE1 . HIS G 2 39  ? 48.107  6.588   44.190  1.00 20.68 ? 39  HIS G CE1 1 
ATOM   10010 N NE2 . HIS G 2 39  ? 47.193  5.822   44.755  1.00 21.86 ? 39  HIS G NE2 1 
ATOM   10011 N N   . GLY G 2 40  ? 42.520  7.567   40.165  1.00 18.10 ? 40  GLY G N   1 
ATOM   10012 C CA  . GLY G 2 40  ? 41.416  8.306   39.589  1.00 16.22 ? 40  GLY G CA  1 
ATOM   10013 C C   . GLY G 2 40  ? 41.869  9.486   38.758  1.00 14.65 ? 40  GLY G C   1 
ATOM   10014 O O   . GLY G 2 40  ? 43.068  9.760   38.674  1.00 13.46 ? 40  GLY G O   1 
ATOM   10015 N N   . PHE G 2 41  ? 40.910  10.177  38.143  1.00 13.86 ? 41  PHE G N   1 
ATOM   10016 C CA  . PHE G 2 41  ? 41.201  11.314  37.284  1.00 10.95 ? 41  PHE G CA  1 
ATOM   10017 C C   . PHE G 2 41  ? 41.557  12.557  38.059  1.00 8.98  ? 41  PHE G C   1 
ATOM   10018 O O   . PHE G 2 41  ? 40.969  12.812  39.098  1.00 5.00  ? 41  PHE G O   1 
ATOM   10019 C CB  . PHE G 2 41  ? 40.018  11.587  36.367  1.00 9.59  ? 41  PHE G CB  1 
ATOM   10020 C CG  . PHE G 2 41  ? 39.942  10.661  35.200  1.00 6.37  ? 41  PHE G CG  1 
ATOM   10021 C CD1 . PHE G 2 41  ? 38.993  9.656   35.163  1.00 5.00  ? 41  PHE G CD1 1 
ATOM   10022 C CD2 . PHE G 2 41  ? 40.843  10.793  34.143  1.00 5.00  ? 41  PHE G CD2 1 
ATOM   10023 C CE1 . PHE G 2 41  ? 38.936  8.787   34.090  1.00 5.49  ? 41  PHE G CE1 1 
ATOM   10024 C CE2 . PHE G 2 41  ? 40.800  9.935   33.067  1.00 5.57  ? 41  PHE G CE2 1 
ATOM   10025 C CZ  . PHE G 2 41  ? 39.841  8.924   33.036  1.00 6.75  ? 41  PHE G CZ  1 
ATOM   10026 N N   . LYS G 2 42  ? 42.526  13.312  37.539  1.00 11.99 ? 42  LYS G N   1 
ATOM   10027 C CA  . LYS G 2 42  ? 43.017  14.551  38.151  1.00 17.24 ? 42  LYS G CA  1 
ATOM   10028 C C   . LYS G 2 42  ? 41.935  15.635  38.140  1.00 22.94 ? 42  LYS G C   1 
ATOM   10029 O O   . LYS G 2 42  ? 41.290  15.866  37.121  1.00 21.85 ? 42  LYS G O   1 
ATOM   10030 C CB  . LYS G 2 42  ? 44.267  15.044  37.419  0.00 18.30 ? 42  LYS G CB  1 
ATOM   10031 C CG  . LYS G 2 42  ? 44.899  16.288  38.027  0.00 18.84 ? 42  LYS G CG  1 
ATOM   10032 C CD  . LYS G 2 42  ? 46.208  16.644  37.338  0.00 19.10 ? 42  LYS G CD  1 
ATOM   10033 C CE  . LYS G 2 42  ? 47.268  15.571  37.555  0.00 19.37 ? 42  LYS G CE  1 
ATOM   10034 N NZ  . LYS G 2 42  ? 47.607  15.392  38.995  0.00 20.03 ? 42  LYS G NZ  1 
ATOM   10035 N N   . LYS G 2 43  ? 41.737  16.290  39.282  1.00 28.63 ? 43  LYS G N   1 
ATOM   10036 C CA  . LYS G 2 43  ? 40.708  17.322  39.419  1.00 32.65 ? 43  LYS G CA  1 
ATOM   10037 C C   . LYS G 2 43  ? 41.286  18.732  39.535  1.00 35.07 ? 43  LYS G C   1 
ATOM   10038 O O   . LYS G 2 43  ? 42.272  18.963  40.240  1.00 36.02 ? 43  LYS G O   1 
ATOM   10039 C CB  . LYS G 2 43  ? 39.828  17.032  40.636  0.00 33.52 ? 43  LYS G CB  1 
ATOM   10040 C CG  . LYS G 2 43  ? 38.995  15.767  40.517  0.00 36.33 ? 43  LYS G CG  1 
ATOM   10041 C CD  . LYS G 2 43  ? 38.217  15.497  41.794  0.00 39.38 ? 43  LYS G CD  1 
ATOM   10042 C CE  . LYS G 2 43  ? 39.153  15.186  42.950  0.00 41.30 ? 43  LYS G CE  1 
ATOM   10043 N NZ  . LYS G 2 43  ? 39.902  13.918  42.726  0.00 41.54 ? 43  LYS G NZ  1 
ATOM   10044 N N   . ASP G 2 44  ? 40.658  19.674  38.841  1.00 36.65 ? 44  ASP G N   1 
ATOM   10045 C CA  . ASP G 2 44  ? 41.092  21.062  38.867  1.00 39.24 ? 44  ASP G CA  1 
ATOM   10046 C C   . ASP G 2 44  ? 40.588  21.735  40.137  1.00 44.07 ? 44  ASP G C   1 
ATOM   10047 O O   . ASP G 2 44  ? 39.737  21.190  40.846  1.00 43.87 ? 44  ASP G O   1 
ATOM   10048 C CB  . ASP G 2 44  ? 40.579  21.819  37.628  1.00 37.13 ? 44  ASP G CB  1 
ATOM   10049 C CG  . ASP G 2 44  ? 39.065  21.722  37.446  1.00 32.21 ? 44  ASP G CG  1 
ATOM   10050 O OD1 . ASP G 2 44  ? 38.596  21.969  36.318  1.00 30.91 ? 44  ASP G OD1 1 
ATOM   10051 O OD2 . ASP G 2 44  ? 38.339  21.411  38.409  1.00 26.74 ? 44  ASP G OD2 1 
ATOM   10052 N N   . ASP G 2 45  ? 41.037  22.968  40.352  1.00 48.74 ? 45  ASP G N   1 
ATOM   10053 C CA  . ASP G 2 45  ? 40.669  23.763  41.528  1.00 48.91 ? 45  ASP G CA  1 
ATOM   10054 C C   . ASP G 2 45  ? 39.156  24.000  41.624  1.00 46.67 ? 45  ASP G C   1 
ATOM   10055 O O   . ASP G 2 45  ? 38.640  24.353  42.683  1.00 44.36 ? 45  ASP G O   1 
ATOM   10056 C CB  . ASP G 2 45  ? 41.403  25.119  41.510  1.00 52.83 ? 45  ASP G CB  1 
ATOM   10057 C CG  . ASP G 2 45  ? 42.594  25.148  40.535  1.00 56.73 ? 45  ASP G CG  1 
ATOM   10058 O OD1 . ASP G 2 45  ? 43.735  24.862  40.971  1.00 58.77 ? 45  ASP G OD1 1 
ATOM   10059 O OD2 . ASP G 2 45  ? 42.382  25.461  39.336  1.00 56.88 ? 45  ASP G OD2 1 
ATOM   10060 N N   . ASN G 2 46  ? 38.457  23.807  40.510  1.00 45.91 ? 46  ASN G N   1 
ATOM   10061 C CA  . ASN G 2 46  ? 37.014  24.011  40.446  1.00 42.45 ? 46  ASN G CA  1 
ATOM   10062 C C   . ASN G 2 46  ? 36.245  22.734  40.780  1.00 39.75 ? 46  ASN G C   1 
ATOM   10063 O O   . ASN G 2 46  ? 35.022  22.753  40.854  1.00 43.81 ? 46  ASN G O   1 
ATOM   10064 C CB  . ASN G 2 46  ? 36.604  24.479  39.043  0.00 42.32 ? 46  ASN G CB  1 
ATOM   10065 C CG  . ASN G 2 46  ? 37.540  25.529  38.475  0.00 42.84 ? 46  ASN G CG  1 
ATOM   10066 O OD1 . ASN G 2 46  ? 38.727  25.271  38.269  0.00 44.03 ? 46  ASN G OD1 1 
ATOM   10067 N ND2 . ASN G 2 46  ? 37.009  26.712  38.198  0.00 44.03 ? 46  ASN G ND2 1 
ATOM   10068 N N   . GLY G 2 47  ? 36.943  21.617  40.935  1.00 34.70 ? 47  GLY G N   1 
ATOM   10069 C CA  . GLY G 2 47  ? 36.253  20.381  41.235  1.00 30.86 ? 47  GLY G CA  1 
ATOM   10070 C C   . GLY G 2 47  ? 36.079  19.448  40.050  1.00 30.81 ? 47  GLY G C   1 
ATOM   10071 O O   . GLY G 2 47  ? 35.784  18.273  40.238  1.00 33.50 ? 47  GLY G O   1 
ATOM   10072 N N   . CYS G 2 48  ? 36.226  19.945  38.829  1.00 28.70 ? 48  CYS G N   1 
ATOM   10073 C CA  . CYS G 2 48  ? 36.087  19.085  37.653  1.00 26.19 ? 48  CYS G CA  1 
ATOM   10074 C C   . CYS G 2 48  ? 37.266  18.130  37.540  1.00 27.80 ? 48  CYS G C   1 
ATOM   10075 O O   . CYS G 2 48  ? 38.355  18.420  38.032  1.00 26.35 ? 48  CYS G O   1 
ATOM   10076 C CB  . CYS G 2 48  ? 36.062  19.900  36.366  1.00 21.79 ? 48  CYS G CB  1 
ATOM   10077 S SG  . CYS G 2 48  ? 34.933  21.314  36.319  1.00 14.33 ? 48  CYS G SG  1 
ATOM   10078 N N   . GLU G 2 49  ? 37.054  17.012  36.855  1.00 28.88 ? 49  GLU G N   1 
ATOM   10079 C CA  . GLU G 2 49  ? 38.107  16.022  36.626  1.00 27.88 ? 49  GLU G CA  1 
ATOM   10080 C C   . GLU G 2 49  ? 38.572  16.205  35.178  1.00 26.78 ? 49  GLU G C   1 
ATOM   10081 O O   . GLU G 2 49  ? 37.747  16.438  34.289  1.00 31.14 ? 49  GLU G O   1 
ATOM   10082 C CB  . GLU G 2 49  ? 37.544  14.607  36.756  1.00 26.54 ? 49  GLU G CB  1 
ATOM   10083 C CG  . GLU G 2 49  ? 36.883  14.275  38.060  1.00 30.74 ? 49  GLU G CG  1 
ATOM   10084 C CD  . GLU G 2 49  ? 36.347  12.851  38.072  1.00 37.04 ? 49  GLU G CD  1 
ATOM   10085 O OE1 . GLU G 2 49  ? 35.499  12.535  37.205  1.00 39.81 ? 49  GLU G OE1 1 
ATOM   10086 O OE2 . GLU G 2 49  ? 36.777  12.046  38.935  1.00 39.52 ? 49  GLU G OE2 1 
ATOM   10087 N N   . TYR G 2 50  ? 39.866  16.107  34.918  1.00 22.29 ? 50  TYR G N   1 
ATOM   10088 C CA  . TYR G 2 50  ? 40.321  16.250  33.548  1.00 19.93 ? 50  TYR G CA  1 
ATOM   10089 C C   . TYR G 2 50  ? 39.971  14.982  32.775  1.00 22.82 ? 50  TYR G C   1 
ATOM   10090 O O   . TYR G 2 50  ? 40.023  13.863  33.300  1.00 24.24 ? 50  TYR G O   1 
ATOM   10091 C CB  . TYR G 2 50  ? 41.807  16.550  33.474  1.00 13.56 ? 50  TYR G CB  1 
ATOM   10092 C CG  . TYR G 2 50  ? 42.173  17.941  33.924  1.00 7.98  ? 50  TYR G CG  1 
ATOM   10093 C CD1 . TYR G 2 50  ? 42.411  18.219  35.264  1.00 5.69  ? 50  TYR G CD1 1 
ATOM   10094 C CD2 . TYR G 2 50  ? 42.332  18.968  33.008  1.00 5.00  ? 50  TYR G CD2 1 
ATOM   10095 C CE1 . TYR G 2 50  ? 42.799  19.484  35.674  1.00 5.00  ? 50  TYR G CE1 1 
ATOM   10096 C CE2 . TYR G 2 50  ? 42.728  20.239  33.416  1.00 5.00  ? 50  TYR G CE2 1 
ATOM   10097 C CZ  . TYR G 2 50  ? 42.958  20.486  34.746  1.00 5.00  ? 50  TYR G CZ  1 
ATOM   10098 O OH  . TYR G 2 50  ? 43.353  21.727  35.161  1.00 5.00  ? 50  TYR G OH  1 
ATOM   10099 N N   . ALA G 2 51  ? 39.570  15.184  31.529  1.00 23.35 ? 51  ALA G N   1 
ATOM   10100 C CA  . ALA G 2 51  ? 39.172  14.113  30.625  1.00 20.61 ? 51  ALA G CA  1 
ATOM   10101 C C   . ALA G 2 51  ? 40.030  12.880  30.683  1.00 18.28 ? 51  ALA G C   1 
ATOM   10102 O O   . ALA G 2 51  ? 39.543  11.785  30.931  1.00 18.05 ? 51  ALA G O   1 
ATOM   10103 C CB  . ALA G 2 51  ? 39.153  14.632  29.198  1.00 20.57 ? 51  ALA G CB  1 
ATOM   10104 N N   . CYS G 2 52  ? 41.310  13.046  30.394  1.00 19.19 ? 52  CYS G N   1 
ATOM   10105 C CA  . CYS G 2 52  ? 42.204  11.902  30.389  1.00 16.20 ? 52  CYS G CA  1 
ATOM   10106 C C   . CYS G 2 52  ? 43.555  12.207  31.007  1.00 13.66 ? 52  CYS G C   1 
ATOM   10107 O O   . CYS G 2 52  ? 44.570  12.265  30.325  1.00 15.16 ? 52  CYS G O   1 
ATOM   10108 C CB  . CYS G 2 52  ? 42.340  11.367  28.970  1.00 13.92 ? 52  CYS G CB  1 
ATOM   10109 S SG  . CYS G 2 52  ? 43.166  9.772   28.897  1.00 12.36 ? 52  CYS G SG  1 
ATOM   10110 N N   . ILE G 2 53  ? 43.539  12.467  32.305  1.00 10.74 ? 53  ILE G N   1 
ATOM   10111 C CA  . ILE G 2 53  ? 44.749  12.750  33.048  1.00 8.76  ? 53  ILE G CA  1 
ATOM   10112 C C   . ILE G 2 53  ? 44.471  12.201  34.438  1.00 9.52  ? 53  ILE G C   1 
ATOM   10113 O O   . ILE G 2 53  ? 43.416  12.485  35.028  1.00 6.08  ? 53  ILE G O   1 
ATOM   10114 C CB  . ILE G 2 53  ? 45.067  14.258  33.067  1.00 5.66  ? 53  ILE G CB  1 
ATOM   10115 C CG1 . ILE G 2 53  ? 45.206  14.779  31.633  1.00 5.00  ? 53  ILE G CG1 1 
ATOM   10116 C CG2 . ILE G 2 53  ? 46.347  14.507  33.829  1.00 5.00  ? 53  ILE G CG2 1 
ATOM   10117 C CD1 . ILE G 2 53  ? 45.509  16.255  31.506  1.00 5.00  ? 53  ILE G CD1 1 
ATOM   10118 N N   . CYS G 2 54  ? 45.383  11.362  34.922  1.00 10.43 ? 54  CYS G N   1 
ATOM   10119 C CA  . CYS G 2 54  ? 45.224  10.727  36.228  1.00 12.91 ? 54  CYS G CA  1 
ATOM   10120 C C   . CYS G 2 54  ? 45.846  11.498  37.365  1.00 12.98 ? 54  CYS G C   1 
ATOM   10121 O O   . CYS G 2 54  ? 46.860  12.169  37.179  1.00 13.89 ? 54  CYS G O   1 
ATOM   10122 C CB  . CYS G 2 54  ? 45.809  9.323   36.204  1.00 15.78 ? 54  CYS G CB  1 
ATOM   10123 S SG  . CYS G 2 54  ? 45.081  8.226   34.946  1.00 18.56 ? 54  CYS G SG  1 
ATOM   10124 N N   . ALA G 2 55  ? 45.249  11.373  38.545  1.00 12.31 ? 55  ALA G N   1 
ATOM   10125 C CA  . ALA G 2 55  ? 45.730  12.063  39.723  1.00 13.67 ? 55  ALA G CA  1 
ATOM   10126 C C   . ALA G 2 55  ? 46.909  11.316  40.296  1.00 15.50 ? 55  ALA G C   1 
ATOM   10127 O O   . ALA G 2 55  ? 46.909  10.086  40.353  1.00 14.81 ? 55  ALA G O   1 
ATOM   10128 C CB  . ALA G 2 55  ? 44.650  12.179  40.723  1.00 18.66 ? 55  ALA G CB  1 
ATOM   10129 N N   . ASP G 2 56  ? 47.895  12.077  40.751  1.00 19.26 ? 56  ASP G N   1 
ATOM   10130 C CA  . ASP G 2 56  ? 49.123  11.524  41.294  1.00 25.00 ? 56  ASP G CA  1 
ATOM   10131 C C   . ASP G 2 56  ? 49.037  11.011  42.721  1.00 22.03 ? 56  ASP G C   1 
ATOM   10132 O O   . ASP G 2 56  ? 49.928  10.311  43.185  1.00 25.08 ? 56  ASP G O   1 
ATOM   10133 C CB  . ASP G 2 56  ? 50.264  12.535  41.143  1.00 35.94 ? 56  ASP G CB  1 
ATOM   10134 C CG  . ASP G 2 56  ? 50.526  12.912  39.676  1.00 48.55 ? 56  ASP G CG  1 
ATOM   10135 O OD1 . ASP G 2 56  ? 50.717  12.000  38.830  1.00 52.53 ? 56  ASP G OD1 1 
ATOM   10136 O OD2 . ASP G 2 56  ? 50.530  14.128  39.366  1.00 55.67 ? 56  ASP G OD2 1 
ATOM   10137 N N   . ALA G 2 57  ? 47.945  11.310  43.401  1.00 17.74 ? 57  ALA G N   1 
ATOM   10138 C CA  . ALA G 2 57  ? 47.780  10.857  44.761  1.00 15.07 ? 57  ALA G CA  1 
ATOM   10139 C C   . ALA G 2 57  ? 46.278  10.829  45.074  1.00 17.43 ? 57  ALA G C   1 
ATOM   10140 O O   . ALA G 2 57  ? 45.498  11.544  44.444  1.00 16.23 ? 57  ALA G O   1 
ATOM   10141 C CB  . ALA G 2 57  ? 48.534  11.799  45.682  1.00 13.46 ? 57  ALA G CB  1 
ATOM   10142 N N   . PRO G 2 58  ? 45.849  9.941   45.987  1.00 20.25 ? 58  PRO G N   1 
ATOM   10143 C CA  . PRO G 2 58  ? 44.436  9.823   46.371  1.00 21.74 ? 58  PRO G CA  1 
ATOM   10144 C C   . PRO G 2 58  ? 43.922  11.170  46.893  1.00 25.45 ? 58  PRO G C   1 
ATOM   10145 O O   . PRO G 2 58  ? 44.652  11.862  47.599  1.00 23.47 ? 58  PRO G O   1 
ATOM   10146 C CB  . PRO G 2 58  ? 44.484  8.779   47.479  1.00 23.40 ? 58  PRO G CB  1 
ATOM   10147 C CG  . PRO G 2 58  ? 45.717  7.947   47.126  1.00 21.45 ? 58  PRO G CG  1 
ATOM   10148 C CD  . PRO G 2 58  ? 46.694  8.999   46.745  1.00 20.00 ? 58  PRO G CD  1 
ATOM   10149 N N   . GLN G 2 59  ? 42.689  11.535  46.521  1.00 30.04 ? 59  GLN G N   1 
ATOM   10150 C CA  . GLN G 2 59  ? 42.068  12.807  46.912  1.00 30.05 ? 59  GLN G CA  1 
ATOM   10151 C C   . GLN G 2 59  ? 41.601  12.821  48.360  1.00 30.22 ? 59  GLN G C   1 
ATOM   10152 O O   . GLN G 2 59  ? 41.566  13.933  48.921  1.00 27.50 ? 59  GLN G O   1 
ATOM   10153 C CB  . GLN G 2 59  ? 40.886  13.135  45.994  0.00 28.53 ? 59  GLN G CB  1 
ATOM   10154 C CG  . GLN G 2 59  ? 39.724  12.154  46.083  0.00 27.69 ? 59  GLN G CG  1 
ATOM   10155 C CD  . GLN G 2 59  ? 38.438  12.719  45.513  0.00 27.23 ? 59  GLN G CD  1 
ATOM   10156 O OE1 . GLN G 2 59  ? 37.925  12.235  44.506  0.00 27.13 ? 59  GLN G OE1 1 
ATOM   10157 N NE2 . GLN G 2 59  ? 37.909  13.748  46.160  0.00 27.17 ? 59  GLN G NE2 1 
ATOM   10158 O OXT . GLN G 2 59  ? 41.312  11.735  48.913  1.00 30.41 ? 59  GLN G OXT 1 
ATOM   10159 N N   . THR H 2 7   ? -3.335  9.782   77.630  0.00 24.45 ? 7   THR H N   1 
ATOM   10160 C CA  . THR H 2 7   ? -4.812  9.786   77.824  0.00 24.59 ? 7   THR H CA  1 
ATOM   10161 C C   . THR H 2 7   ? -5.507  9.334   76.541  0.00 24.49 ? 7   THR H C   1 
ATOM   10162 O O   . THR H 2 7   ? -5.294  9.931   75.486  0.00 24.45 ? 7   THR H O   1 
ATOM   10163 C CB  . THR H 2 7   ? -5.308  11.198  78.196  0.00 24.14 ? 7   THR H CB  1 
ATOM   10164 O OG1 . THR H 2 7   ? -4.475  11.731  79.232  0.00 23.92 ? 7   THR H OG1 1 
ATOM   10165 C CG2 . THR H 2 7   ? -6.750  11.152  78.684  0.00 23.92 ? 7   THR H CG2 1 
ATOM   10166 N N   . THR H 2 8   ? -6.324  8.285   76.636  0.00 24.04 ? 8   THR H N   1 
ATOM   10167 C CA  . THR H 2 8   ? -7.056  7.738   75.488  0.00 23.58 ? 8   THR H CA  1 
ATOM   10168 C C   . THR H 2 8   ? -7.925  6.540   75.882  0.00 24.01 ? 8   THR H C   1 
ATOM   10169 O O   . THR H 2 8   ? -7.544  5.750   76.746  0.00 23.72 ? 8   THR H O   1 
ATOM   10170 C CB  . THR H 2 8   ? -6.098  7.261   74.358  0.00 22.63 ? 8   THR H CB  1 
ATOM   10171 O OG1 . THR H 2 8   ? -4.766  7.110   74.871  0.00 22.13 ? 8   THR H OG1 1 
ATOM   10172 C CG2 . THR H 2 8   ? -6.104  8.238   73.189  0.00 22.13 ? 8   THR H CG2 1 
ATOM   10173 N N   . PRO H 2 9   ? -9.125  6.415   75.285  0.00 24.77 ? 9   PRO H N   1 
ATOM   10174 C CA  . PRO H 2 9   ? -10.000 5.282   75.611  0.00 26.13 ? 9   PRO H CA  1 
ATOM   10175 C C   . PRO H 2 9   ? -9.299  4.000   75.157  0.00 28.02 ? 9   PRO H C   1 
ATOM   10176 O O   . PRO H 2 9   ? -8.752  3.952   74.054  0.00 27.25 ? 9   PRO H O   1 
ATOM   10177 C CB  . PRO H 2 9   ? -11.256 5.574   74.787  0.00 24.98 ? 9   PRO H CB  1 
ATOM   10178 C CG  . PRO H 2 9   ? -10.729 6.358   73.618  0.00 24.37 ? 9   PRO H CG  1 
ATOM   10179 C CD  . PRO H 2 9   ? -9.751  7.291   74.280  0.00 24.42 ? 9   PRO H CD  1 
ATOM   10180 N N   . CYS H 2 10  ? -9.313  2.967   75.993  0.00 31.23 ? 10  CYS H N   1 
ATOM   10181 C CA  . CYS H 2 10  ? -8.622  1.729   75.650  0.00 34.06 ? 10  CYS H CA  1 
ATOM   10182 C C   . CYS H 2 10  ? -9.347  0.472   76.107  0.00 30.98 ? 10  CYS H C   1 
ATOM   10183 O O   . CYS H 2 10  ? -9.413  0.183   77.302  0.00 29.72 ? 10  CYS H O   1 
ATOM   10184 C CB  . CYS H 2 10  ? -7.216  1.752   76.254  0.00 42.32 ? 10  CYS H CB  1 
ATOM   10185 S SG  . CYS H 2 10  ? -6.106  0.398   75.751  0.00 46.48 ? 10  CYS H SG  1 
ATOM   10186 N N   . GLY H 2 11  ? -9.851  -0.295  75.146  0.00 27.89 ? 11  GLY H N   1 
ATOM   10187 C CA  . GLY H 2 11  ? -10.559 -1.521  75.465  0.00 24.91 ? 11  GLY H CA  1 
ATOM   10188 C C   . GLY H 2 11  ? -11.618 -1.307  76.529  0.00 23.29 ? 11  GLY H C   1 
ATOM   10189 O O   . GLY H 2 11  ? -12.474 -0.436  76.377  0.00 22.87 ? 11  GLY H O   1 
ATOM   10190 N N   . PRO H 2 12  ? -11.590 -2.092  77.616  0.00 22.18 ? 12  PRO H N   1 
ATOM   10191 C CA  . PRO H 2 12  ? -12.557 -1.981  78.712  0.00 22.26 ? 12  PRO H CA  1 
ATOM   10192 C C   . PRO H 2 12  ? -12.228 -0.845  79.684  0.00 22.18 ? 12  PRO H C   1 
ATOM   10193 O O   . PRO H 2 12  ? -13.020 -0.533  80.575  0.00 22.06 ? 12  PRO H O   1 
ATOM   10194 C CB  . PRO H 2 12  ? -12.439 -3.340  79.394  0.00 21.58 ? 12  PRO H CB  1 
ATOM   10195 C CG  . PRO H 2 12  ? -10.983 -3.641  79.250  0.00 21.55 ? 12  PRO H CG  1 
ATOM   10196 C CD  . PRO H 2 12  ? -10.713 -3.262  77.810  0.00 21.92 ? 12  PRO H CD  1 
ATOM   10197 N N   . VAL H 2 13  ? -11.055 -0.242  79.522  0.00 22.59 ? 13  VAL H N   1 
ATOM   10198 C CA  . VAL H 2 13  ? -10.627 0.845   80.393  0.00 23.10 ? 13  VAL H CA  1 
ATOM   10199 C C   . VAL H 2 13  ? -10.365 2.131   79.612  0.00 23.95 ? 13  VAL H C   1 
ATOM   10200 O O   . VAL H 2 13  ? -10.611 2.203   78.408  0.00 24.17 ? 13  VAL H O   1 
ATOM   10201 C CB  . VAL H 2 13  ? -9.356  0.463   81.201  0.00 22.44 ? 13  VAL H CB  1 
ATOM   10202 C CG1 . VAL H 2 13  ? -9.665  -0.673  82.166  0.00 21.91 ? 13  VAL H CG1 1 
ATOM   10203 C CG2 . VAL H 2 13  ? -8.223  0.071   80.262  0.00 21.91 ? 13  VAL H CG2 1 
ATOM   10204 N N   . THR H 2 14  ? -9.887  3.153   80.310  0.00 25.43 ? 14  THR H N   1 
ATOM   10205 C CA  . THR H 2 14  ? -9.591  4.441   79.695  0.00 27.28 ? 14  THR H CA  1 
ATOM   10206 C C   . THR H 2 14  ? -8.294  4.999   80.270  0.00 29.10 ? 14  THR H C   1 
ATOM   10207 O O   . THR H 2 14  ? -8.181  5.214   81.476  0.00 29.09 ? 14  THR H O   1 
ATOM   10208 C CB  . THR H 2 14  ? -10.740 5.450   79.934  0.00 25.90 ? 14  THR H CB  1 
ATOM   10209 O OG1 . THR H 2 14  ? -11.318 5.230   81.228  0.00 25.24 ? 14  THR H OG1 1 
ATOM   10210 C CG2 . THR H 2 14  ? -11.817 5.301   78.870  0.00 25.23 ? 14  THR H CG2 1 
ATOM   10211 N N   . CYS H 2 15  ? -7.307  5.201   79.409  0.00 30.84 ? 15  CYS H N   1 
ATOM   10212 C CA  . CYS H 2 15  ? -6.025  5.722   79.848  0.00 33.61 ? 15  CYS H CA  1 
ATOM   10213 C C   . CYS H 2 15  ? -6.139  7.200   80.176  0.00 37.86 ? 15  CYS H C   1 
ATOM   10214 O O   . CYS H 2 15  ? -6.686  7.979   79.394  0.00 37.20 ? 15  CYS H O   1 
ATOM   10215 C CB  . CYS H 2 15  ? -4.972  5.502   78.761  0.00 32.07 ? 15  CYS H CB  1 
ATOM   10216 S SG  . CYS H 2 15  ? -4.951  3.806   78.094  0.00 29.62 ? 15  CYS H SG  1 
ATOM   10217 N N   . SER H 2 16  ? -5.686  7.583   81.360  1.00 41.80 ? 16  SER H N   1 
ATOM   10218 C CA  . SER H 2 16  ? -5.724  8.995   81.724  1.00 43.72 ? 16  SER H CA  1 
ATOM   10219 C C   . SER H 2 16  ? -4.284  9.553   81.719  1.00 43.22 ? 16  SER H C   1 
ATOM   10220 O O   . SER H 2 16  ? -3.326  8.817   81.444  1.00 45.78 ? 16  SER H O   1 
ATOM   10221 C CB  . SER H 2 16  ? -6.444  9.221   83.070  1.00 42.59 ? 16  SER H CB  1 
ATOM   10222 O OG  . SER H 2 16  ? -7.180  10.451  83.082  1.00 43.85 ? 16  SER H OG  1 
ATOM   10223 N N   . GLY H 2 17  ? -4.155  10.863  81.893  0.00 40.16 ? 17  GLY H N   1 
ATOM   10224 C CA  . GLY H 2 17  ? -2.855  11.518  81.913  0.00 39.43 ? 17  GLY H CA  1 
ATOM   10225 C C   . GLY H 2 17  ? -1.698  10.932  81.113  0.00 38.64 ? 17  GLY H C   1 
ATOM   10226 O O   . GLY H 2 17  ? -1.720  10.891  79.877  0.00 38.55 ? 17  GLY H O   1 
ATOM   10227 N N   . ALA H 2 18  ? -0.695  10.459  81.845  1.00 36.75 ? 18  ALA H N   1 
ATOM   10228 C CA  . ALA H 2 18  ? 0.538   9.879   81.290  1.00 36.65 ? 18  ALA H CA  1 
ATOM   10229 C C   . ALA H 2 18  ? 0.535   8.387   80.916  1.00 38.54 ? 18  ALA H C   1 
ATOM   10230 O O   . ALA H 2 18  ? 1.600   7.749   80.844  1.00 35.40 ? 18  ALA H O   1 
ATOM   10231 C CB  . ALA H 2 18  ? 1.707   10.167  82.247  1.00 35.46 ? 18  ALA H CB  1 
ATOM   10232 N N   . GLN H 2 19  ? -0.646  7.820   80.707  1.00 43.10 ? 19  GLN H N   1 
ATOM   10233 C CA  . GLN H 2 19  ? -0.751  6.407   80.351  1.00 46.40 ? 19  GLN H CA  1 
ATOM   10234 C C   . GLN H 2 19  ? -0.922  6.214   78.848  1.00 47.61 ? 19  GLN H C   1 
ATOM   10235 O O   . GLN H 2 19  ? -1.595  7.009   78.165  1.00 48.10 ? 19  GLN H O   1 
ATOM   10236 C CB  . GLN H 2 19  ? -1.917  5.744   81.082  0.00 46.64 ? 19  GLN H CB  1 
ATOM   10237 C CG  . GLN H 2 19  ? -1.693  5.533   82.563  0.00 50.91 ? 19  GLN H CG  1 
ATOM   10238 C CD  . GLN H 2 19  ? -2.794  4.707   83.186  0.00 54.47 ? 19  GLN H CD  1 
ATOM   10239 O OE1 . GLN H 2 19  ? -3.957  5.109   83.190  0.00 56.28 ? 19  GLN H OE1 1 
ATOM   10240 N NE2 . GLN H 2 19  ? -2.439  3.544   83.710  0.00 56.28 ? 19  GLN H NE2 1 
ATOM   10241 N N   . MET H 2 20  ? -0.278  5.171   78.342  1.00 47.68 ? 20  MET H N   1 
ATOM   10242 C CA  . MET H 2 20  ? -0.342  4.813   76.941  1.00 49.21 ? 20  MET H CA  1 
ATOM   10243 C C   . MET H 2 20  ? -1.125  3.503   76.916  1.00 52.40 ? 20  MET H C   1 
ATOM   10244 O O   . MET H 2 20  ? -0.921  2.627   77.771  1.00 53.81 ? 20  MET H O   1 
ATOM   10245 C CB  . MET H 2 20  ? 1.068   4.614   76.385  1.00 51.09 ? 20  MET H CB  1 
ATOM   10246 C CG  . MET H 2 20  ? 1.113   4.195   74.923  0.00 48.72 ? 20  MET H CG  1 
ATOM   10247 S SD  . MET H 2 20  ? 2.788   3.852   74.354  0.00 45.77 ? 20  MET H SD  1 
ATOM   10248 C CE  . MET H 2 20  ? 2.975   2.147   74.873  0.00 44.31 ? 20  MET H CE  1 
ATOM   10249 N N   . CYS H 2 21  ? -2.066  3.413   75.980  1.00 52.61 ? 21  CYS H N   1 
ATOM   10250 C CA  . CYS H 2 21  ? -2.920  2.236   75.815  1.00 48.28 ? 21  CYS H CA  1 
ATOM   10251 C C   . CYS H 2 21  ? -2.253  1.077   75.084  1.00 41.64 ? 21  CYS H C   1 
ATOM   10252 O O   . CYS H 2 21  ? -1.746  1.241   73.969  1.00 42.48 ? 21  CYS H O   1 
ATOM   10253 C CB  . CYS H 2 21  ? -4.188  2.629   75.053  1.00 48.98 ? 21  CYS H CB  1 
ATOM   10254 S SG  . CYS H 2 21  ? -5.030  1.223   74.242  1.00 58.17 ? 21  CYS H SG  1 
ATOM   10255 N N   . GLU H 2 22  ? -2.319  -0.101  75.690  0.00 36.62 ? 22  GLU H N   1 
ATOM   10256 C CA  . GLU H 2 22  ? -1.752  -1.314  75.125  0.00 32.81 ? 22  GLU H CA  1 
ATOM   10257 C C   . GLU H 2 22  ? -2.890  -2.303  74.877  0.00 31.47 ? 22  GLU H C   1 
ATOM   10258 O O   . GLU H 2 22  ? -3.260  -3.080  75.763  0.00 32.57 ? 22  GLU H O   1 
ATOM   10259 C CB  . GLU H 2 22  ? -0.723  -1.911  76.091  0.00 33.10 ? 22  GLU H CB  1 
ATOM   10260 C CG  . GLU H 2 22  ? 0.021   -3.125  75.554  0.00 26.60 ? 22  GLU H CG  1 
ATOM   10261 C CD  . GLU H 2 22  ? 1.024   -3.678  76.548  0.00 21.50 ? 22  GLU H CD  1 
ATOM   10262 O OE1 . GLU H 2 22  ? 2.208   -3.285  76.480  0.00 19.16 ? 22  GLU H OE1 1 
ATOM   10263 O OE2 . GLU H 2 22  ? 0.629   -4.504  77.397  0.00 19.18 ? 22  GLU H OE2 1 
ATOM   10264 N N   . VAL H 2 23  ? -3.472  -2.230  73.682  0.00 28.83 ? 23  VAL H N   1 
ATOM   10265 C CA  . VAL H 2 23  ? -4.573  -3.101  73.268  0.00 24.19 ? 23  VAL H CA  1 
ATOM   10266 C C   . VAL H 2 23  ? -5.818  -2.952  74.148  0.00 22.59 ? 23  VAL H C   1 
ATOM   10267 O O   . VAL H 2 23  ? -6.792  -2.314  73.746  0.00 21.73 ? 23  VAL H O   1 
ATOM   10268 C CB  . VAL H 2 23  ? -4.137  -4.591  73.208  0.00 21.89 ? 23  VAL H CB  1 
ATOM   10269 C CG1 . VAL H 2 23  ? -5.268  -5.454  72.664  0.00 20.68 ? 23  VAL H CG1 1 
ATOM   10270 C CG2 . VAL H 2 23  ? -2.895  -4.745  72.339  0.00 20.69 ? 23  VAL H CG2 1 
ATOM   10271 N N   . ASP H 2 24  ? -5.778  -3.527  75.348  0.00 21.38 ? 24  ASP H N   1 
ATOM   10272 C CA  . ASP H 2 24  ? -6.909  -3.461  76.270  0.00 20.85 ? 24  ASP H CA  1 
ATOM   10273 C C   . ASP H 2 24  ? -6.537  -2.975  77.671  0.00 21.13 ? 24  ASP H C   1 
ATOM   10274 O O   . ASP H 2 24  ? -7.402  -2.874  78.542  0.00 21.10 ? 24  ASP H O   1 
ATOM   10275 C CB  . ASP H 2 24  ? -7.592  -4.830  76.372  0.00 19.88 ? 24  ASP H CB  1 
ATOM   10276 C CG  . ASP H 2 24  ? -8.226  -5.270  75.065  0.00 19.17 ? 24  ASP H CG  1 
ATOM   10277 O OD1 . ASP H 2 24  ? -7.896  -6.376  74.588  0.00 18.85 ? 24  ASP H OD1 1 
ATOM   10278 O OD2 . ASP H 2 24  ? -9.057  -4.515  74.517  0.00 18.86 ? 24  ASP H OD2 1 
ATOM   10279 N N   . LYS H 2 25  ? -5.260  -2.672  77.889  0.00 21.32 ? 25  LYS H N   1 
ATOM   10280 C CA  . LYS H 2 25  ? -4.798  -2.209  79.195  0.00 21.42 ? 25  LYS H CA  1 
ATOM   10281 C C   . LYS H 2 25  ? -4.002  -0.912  79.078  0.00 22.36 ? 25  LYS H C   1 
ATOM   10282 O O   . LYS H 2 25  ? -3.325  -0.687  78.084  0.00 22.41 ? 25  LYS H O   1 
ATOM   10283 C CB  . LYS H 2 25  ? -3.942  -3.296  79.857  0.00 20.30 ? 25  LYS H CB  1 
ATOM   10284 C CG  . LYS H 2 25  ? -3.466  -2.966  81.266  0.00 19.08 ? 25  LYS H CG  1 
ATOM   10285 C CD  . LYS H 2 25  ? -2.675  -4.117  81.876  0.00 18.07 ? 25  LYS H CD  1 
ATOM   10286 C CE  . LYS H 2 25  ? -1.422  -4.429  81.071  0.00 17.47 ? 25  LYS H CE  1 
ATOM   10287 N NZ  . LYS H 2 25  ? -0.640  -5.548  81.666  0.00 16.93 ? 25  LYS H NZ  1 
ATOM   10288 N N   . CYS H 2 26  ? -4.101  -0.056  80.089  0.00 23.69 ? 26  CYS H N   1 
ATOM   10289 C CA  . CYS H 2 26  ? -3.378  1.211   80.096  0.00 25.32 ? 26  CYS H CA  1 
ATOM   10290 C C   . CYS H 2 26  ? -2.116  1.086   80.940  0.00 26.29 ? 26  CYS H C   1 
ATOM   10291 O O   . CYS H 2 26  ? -2.180  0.745   82.122  0.00 26.40 ? 26  CYS H O   1 
ATOM   10292 C CB  . CYS H 2 26  ? -4.268  2.326   80.643  0.00 25.41 ? 26  CYS H CB  1 
ATOM   10293 S SG  . CYS H 2 26  ? -5.718  2.684   79.602  0.00 26.83 ? 26  CYS H SG  1 
ATOM   10294 N N   . VAL H 2 27  ? -0.974  1.373   80.328  1.00 27.94 ? 27  VAL H N   1 
ATOM   10295 C CA  . VAL H 2 27  ? 0.320   1.284   80.998  1.00 29.04 ? 27  VAL H CA  1 
ATOM   10296 C C   . VAL H 2 27  ? 1.149   2.582   80.896  1.00 29.45 ? 27  VAL H C   1 
ATOM   10297 O O   . VAL H 2 27  ? 0.821   3.483   80.126  1.00 24.51 ? 27  VAL H O   1 
ATOM   10298 C CB  . VAL H 2 27  ? 1.138   0.089   80.430  1.00 29.25 ? 27  VAL H CB  1 
ATOM   10299 C CG1 . VAL H 2 27  ? 0.576   -1.223  80.936  1.00 27.80 ? 27  VAL H CG1 1 
ATOM   10300 C CG2 . VAL H 2 27  ? 1.093   0.098   78.899  1.00 31.77 ? 27  VAL H CG2 1 
ATOM   10301 N N   . CYS H 2 28  ? 2.167   2.693   81.748  1.00 32.78 ? 28  CYS H N   1 
ATOM   10302 C CA  . CYS H 2 28  ? 3.075   3.839   81.770  1.00 37.00 ? 28  CYS H CA  1 
ATOM   10303 C C   . CYS H 2 28  ? 4.144   3.561   80.722  1.00 41.33 ? 28  CYS H C   1 
ATOM   10304 O O   . CYS H 2 28  ? 4.330   2.402   80.333  1.00 45.19 ? 28  CYS H O   1 
ATOM   10305 C CB  . CYS H 2 28  ? 3.789   3.925   83.112  1.00 36.91 ? 28  CYS H CB  1 
ATOM   10306 S SG  . CYS H 2 28  ? 2.689   4.038   84.540  1.00 40.92 ? 28  CYS H SG  1 
ATOM   10307 N N   . SER H 2 29  ? 4.888   4.596   80.315  1.00 41.64 ? 29  SER H N   1 
ATOM   10308 C CA  . SER H 2 29  ? 5.961   4.445   79.320  1.00 39.25 ? 29  SER H CA  1 
ATOM   10309 C C   . SER H 2 29  ? 7.292   4.928   79.866  1.00 37.81 ? 29  SER H C   1 
ATOM   10310 O O   . SER H 2 29  ? 7.330   5.689   80.825  1.00 39.43 ? 29  SER H O   1 
ATOM   10311 C CB  . SER H 2 29  ? 5.661   5.266   78.063  1.00 42.01 ? 29  SER H CB  1 
ATOM   10312 O OG  . SER H 2 29  ? 4.478   4.838   77.415  1.00 45.52 ? 29  SER H OG  1 
ATOM   10313 N N   . ASP H 2 30  ? 8.381   4.466   79.254  1.00 39.37 ? 30  ASP H N   1 
ATOM   10314 C CA  . ASP H 2 30  ? 9.750   4.886   79.615  1.00 38.42 ? 30  ASP H CA  1 
ATOM   10315 C C   . ASP H 2 30  ? 10.105  6.057   78.704  1.00 36.40 ? 30  ASP H C   1 
ATOM   10316 O O   . ASP H 2 30  ? 11.131  6.714   78.895  1.00 36.12 ? 30  ASP H O   1 
ATOM   10317 C CB  . ASP H 2 30  ? 10.802  3.817   79.297  1.00 39.14 ? 30  ASP H CB  1 
ATOM   10318 C CG  . ASP H 2 30  ? 10.489  2.475   79.884  1.00 42.07 ? 30  ASP H CG  1 
ATOM   10319 O OD1 . ASP H 2 30  ? 10.749  1.472   79.181  1.00 43.27 ? 30  ASP H OD1 1 
ATOM   10320 O OD2 . ASP H 2 30  ? 10.021  2.419   81.042  1.00 43.99 ? 30  ASP H OD2 1 
ATOM   10321 N N   . LEU H 2 31  ? 9.292   6.235   77.664  1.00 33.72 ? 31  LEU H N   1 
ATOM   10322 C CA  . LEU H 2 31  ? 9.457   7.278   76.662  1.00 29.85 ? 31  LEU H CA  1 
ATOM   10323 C C   . LEU H 2 31  ? 9.558   8.671   77.297  1.00 28.32 ? 31  LEU H C   1 
ATOM   10324 O O   . LEU H 2 31  ? 8.670   9.090   78.033  1.00 28.67 ? 31  LEU H O   1 
ATOM   10325 C CB  . LEU H 2 31  ? 8.281   7.199   75.674  1.00 26.71 ? 31  LEU H CB  1 
ATOM   10326 C CG  . LEU H 2 31  ? 8.391   7.905   74.316  1.00 24.58 ? 31  LEU H CG  1 
ATOM   10327 C CD1 . LEU H 2 31  ? 7.717   7.050   73.271  1.00 21.78 ? 31  LEU H CD1 1 
ATOM   10328 C CD2 . LEU H 2 31  ? 7.797   9.320   74.350  1.00 24.03 ? 31  LEU H CD2 1 
ATOM   10329 N N   . HIS H 2 32  ? 10.664  9.356   77.050  1.00 27.58 ? 32  HIS H N   1 
ATOM   10330 C CA  . HIS H 2 32  ? 10.869  10.687  77.587  1.00 29.73 ? 32  HIS H CA  1 
ATOM   10331 C C   . HIS H 2 32  ? 11.755  11.488  76.675  1.00 30.25 ? 32  HIS H C   1 
ATOM   10332 O O   . HIS H 2 32  ? 12.570  10.933  75.915  1.00 33.59 ? 32  HIS H O   1 
ATOM   10333 C CB  . HIS H 2 32  ? 11.592  10.632  78.923  1.00 35.51 ? 32  HIS H CB  1 
ATOM   10334 C CG  . HIS H 2 32  ? 10.704  10.395  80.091  1.00 39.87 ? 32  HIS H CG  1 
ATOM   10335 N ND1 . HIS H 2 32  ? 10.432  9.133   80.575  1.00 43.49 ? 32  HIS H ND1 1 
ATOM   10336 C CD2 . HIS H 2 32  ? 10.042  11.258  80.891  1.00 40.33 ? 32  HIS H CD2 1 
ATOM   10337 C CE1 . HIS H 2 32  ? 9.638   9.231   81.626  1.00 44.71 ? 32  HIS H CE1 1 
ATOM   10338 N NE2 . HIS H 2 32  ? 9.387   10.511  81.837  1.00 45.17 ? 32  HIS H NE2 1 
ATOM   10339 N N   . CYS H 2 33  ? 11.595  12.798  76.755  1.00 25.91 ? 33  CYS H N   1 
ATOM   10340 C CA  . CYS H 2 33  ? 12.435  13.690  75.995  1.00 26.74 ? 33  CYS H CA  1 
ATOM   10341 C C   . CYS H 2 33  ? 13.698  13.791  76.866  1.00 25.36 ? 33  CYS H C   1 
ATOM   10342 O O   . CYS H 2 33  ? 13.632  13.502  78.068  1.00 27.11 ? 33  CYS H O   1 
ATOM   10343 C CB  . CYS H 2 33  ? 11.754  15.035  75.865  1.00 28.46 ? 33  CYS H CB  1 
ATOM   10344 S SG  . CYS H 2 33  ? 11.199  15.764  77.433  1.00 35.88 ? 33  CYS H SG  1 
ATOM   10345 N N   . LYS H 2 34  ? 14.832  14.198  76.298  1.00 20.75 ? 34  LYS H N   1 
ATOM   10346 C CA  . LYS H 2 34  ? 16.048  14.257  77.093  1.00 16.48 ? 34  LYS H CA  1 
ATOM   10347 C C   . LYS H 2 34  ? 16.411  15.576  77.794  1.00 16.11 ? 34  LYS H C   1 
ATOM   10348 O O   . LYS H 2 34  ? 17.548  16.035  77.673  1.00 19.22 ? 34  LYS H O   1 
ATOM   10349 C CB  . LYS H 2 34  ? 17.206  13.739  76.255  1.00 16.88 ? 34  LYS H CB  1 
ATOM   10350 C CG  . LYS H 2 34  ? 16.958  12.336  75.710  1.00 16.39 ? 34  LYS H CG  1 
ATOM   10351 C CD  . LYS H 2 34  ? 18.170  11.813  74.920  1.00 15.11 ? 34  LYS H CD  1 
ATOM   10352 C CE  . LYS H 2 34  ? 17.980  10.375  74.442  1.00 11.92 ? 34  LYS H CE  1 
ATOM   10353 N NZ  . LYS H 2 34  ? 18.029  9.434   75.579  1.00 9.96  ? 34  LYS H NZ  1 
ATOM   10354 N N   . VAL H 2 35  ? 15.466  16.174  78.524  1.00 12.80 ? 35  VAL H N   1 
ATOM   10355 C CA  . VAL H 2 35  ? 15.709  17.419  79.269  1.00 8.87  ? 35  VAL H CA  1 
ATOM   10356 C C   . VAL H 2 35  ? 16.283  17.057  80.635  1.00 10.80 ? 35  VAL H C   1 
ATOM   10357 O O   . VAL H 2 35  ? 16.508  15.882  80.934  1.00 9.33  ? 35  VAL H O   1 
ATOM   10358 C CB  . VAL H 2 35  ? 14.413  18.128  79.630  1.00 6.32  ? 35  VAL H CB  1 
ATOM   10359 C CG1 . VAL H 2 35  ? 14.681  19.600  79.964  1.00 5.00  ? 35  VAL H CG1 1 
ATOM   10360 C CG2 . VAL H 2 35  ? 13.374  17.928  78.552  1.00 7.68  ? 35  VAL H CG2 1 
ATOM   10361 N N   . LYS H 2 36  ? 16.546  18.065  81.463  1.00 13.02 ? 36  LYS H N   1 
ATOM   10362 C CA  . LYS H 2 36  ? 17.029  17.799  82.814  1.00 14.19 ? 36  LYS H CA  1 
ATOM   10363 C C   . LYS H 2 36  ? 16.120  18.490  83.789  1.00 17.03 ? 36  LYS H C   1 
ATOM   10364 O O   . LYS H 2 36  ? 16.313  19.663  84.129  1.00 17.55 ? 36  LYS H O   1 
ATOM   10365 C CB  . LYS H 2 36  ? 18.468  18.245  83.104  1.00 10.20 ? 36  LYS H CB  1 
ATOM   10366 C CG  . LYS H 2 36  ? 18.928  17.685  84.462  1.00 6.06  ? 36  LYS H CG  1 
ATOM   10367 C CD  . LYS H 2 36  ? 20.281  18.141  84.866  1.00 5.00  ? 36  LYS H CD  1 
ATOM   10368 C CE  . LYS H 2 36  ? 20.292  19.636  84.923  1.00 8.24  ? 36  LYS H CE  1 
ATOM   10369 N NZ  . LYS H 2 36  ? 21.669  20.201  85.067  1.00 11.16 ? 36  LYS H NZ  1 
ATOM   10370 N N   . CYS H 2 37  ? 15.113  17.748  84.218  1.00 17.85 ? 37  CYS H N   1 
ATOM   10371 C CA  . CYS H 2 37  ? 14.159  18.235  85.183  1.00 18.42 ? 37  CYS H CA  1 
ATOM   10372 C C   . CYS H 2 37  ? 14.883  18.307  86.520  1.00 20.70 ? 37  CYS H C   1 
ATOM   10373 O O   . CYS H 2 37  ? 15.459  17.309  86.972  1.00 19.92 ? 37  CYS H O   1 
ATOM   10374 C CB  . CYS H 2 37  ? 13.009  17.238  85.293  1.00 18.96 ? 37  CYS H CB  1 
ATOM   10375 S SG  . CYS H 2 37  ? 12.084  16.914  83.755  1.00 16.04 ? 37  CYS H SG  1 
ATOM   10376 N N   . GLU H 2 38  ? 14.863  19.483  87.138  1.00 22.85 ? 38  GLU H N   1 
ATOM   10377 C CA  . GLU H 2 38  ? 15.485  19.691  88.433  1.00 25.24 ? 38  GLU H CA  1 
ATOM   10378 C C   . GLU H 2 38  ? 14.936  18.661  89.437  1.00 26.18 ? 38  GLU H C   1 
ATOM   10379 O O   . GLU H 2 38  ? 15.703  18.021  90.161  1.00 25.87 ? 38  GLU H O   1 
ATOM   10380 C CB  . GLU H 2 38  ? 15.172  21.118  88.871  1.00 28.82 ? 38  GLU H CB  1 
ATOM   10381 C CG  . GLU H 2 38  ? 16.037  21.669  89.982  1.00 35.02 ? 38  GLU H CG  1 
ATOM   10382 C CD  . GLU H 2 38  ? 15.844  23.170  90.167  1.00 37.97 ? 38  GLU H CD  1 
ATOM   10383 O OE1 . GLU H 2 38  ? 16.620  23.940  89.560  1.00 39.44 ? 38  GLU H OE1 1 
ATOM   10384 O OE2 . GLU H 2 38  ? 14.915  23.583  90.904  1.00 37.85 ? 38  GLU H OE2 1 
ATOM   10385 N N   . HIS H 2 39  ? 13.615  18.450  89.398  1.00 26.17 ? 39  HIS H N   1 
ATOM   10386 C CA  . HIS H 2 39  ? 12.919  17.512  90.286  1.00 24.27 ? 39  HIS H CA  1 
ATOM   10387 C C   . HIS H 2 39  ? 12.463  16.187  89.655  1.00 24.84 ? 39  HIS H C   1 
ATOM   10388 O O   . HIS H 2 39  ? 11.795  15.380  90.310  1.00 26.33 ? 39  HIS H O   1 
ATOM   10389 C CB  . HIS H 2 39  ? 11.707  18.210  90.870  1.00 22.13 ? 39  HIS H CB  1 
ATOM   10390 C CG  . HIS H 2 39  ? 12.022  19.539  91.461  1.00 24.12 ? 39  HIS H CG  1 
ATOM   10391 N ND1 . HIS H 2 39  ? 11.609  20.721  90.888  1.00 24.27 ? 39  HIS H ND1 1 
ATOM   10392 C CD2 . HIS H 2 39  ? 12.745  19.877  92.554  1.00 24.98 ? 39  HIS H CD2 1 
ATOM   10393 C CE1 . HIS H 2 39  ? 12.064  21.734  91.603  1.00 25.56 ? 39  HIS H CE1 1 
ATOM   10394 N NE2 . HIS H 2 39  ? 12.757  21.248  92.619  1.00 26.48 ? 39  HIS H NE2 1 
ATOM   10395 N N   . GLY H 2 40  ? 12.842  15.941  88.404  1.00 22.65 ? 40  GLY H N   1 
ATOM   10396 C CA  . GLY H 2 40  ? 12.428  14.718  87.741  1.00 16.63 ? 40  GLY H CA  1 
ATOM   10397 C C   . GLY H 2 40  ? 11.130  14.931  86.993  1.00 12.86 ? 40  GLY H C   1 
ATOM   10398 O O   . GLY H 2 40  ? 10.518  15.988  87.099  1.00 13.22 ? 40  GLY H O   1 
ATOM   10399 N N   . PHE H 2 41  ? 10.724  13.950  86.206  1.00 10.33 ? 41  PHE H N   1 
ATOM   10400 C CA  . PHE H 2 41  ? 9.499   14.070  85.454  1.00 10.50 ? 41  PHE H CA  1 
ATOM   10401 C C   . PHE H 2 41  ? 8.232   14.000  86.320  1.00 13.52 ? 41  PHE H C   1 
ATOM   10402 O O   . PHE H 2 41  ? 8.179   13.296  87.331  1.00 16.03 ? 41  PHE H O   1 
ATOM   10403 C CB  . PHE H 2 41  ? 9.485   13.036  84.344  1.00 7.23  ? 41  PHE H CB  1 
ATOM   10404 C CG  . PHE H 2 41  ? 10.436  13.346  83.238  1.00 8.64  ? 41  PHE H CG  1 
ATOM   10405 C CD1 . PHE H 2 41  ? 11.735  12.877  83.271  1.00 11.28 ? 41  PHE H CD1 1 
ATOM   10406 C CD2 . PHE H 2 41  ? 10.030  14.106  82.152  1.00 11.94 ? 41  PHE H CD2 1 
ATOM   10407 C CE1 . PHE H 2 41  ? 12.617  13.157  82.236  1.00 12.32 ? 41  PHE H CE1 1 
ATOM   10408 C CE2 . PHE H 2 41  ? 10.904  14.393  81.111  1.00 13.92 ? 41  PHE H CE2 1 
ATOM   10409 C CZ  . PHE H 2 41  ? 12.197  13.917  81.155  1.00 14.40 ? 41  PHE H CZ  1 
ATOM   10410 N N   . LYS H 2 42  ? 7.237   14.783  85.926  1.00 14.87 ? 42  LYS H N   1 
ATOM   10411 C CA  . LYS H 2 42  ? 5.950   14.884  86.602  1.00 13.98 ? 42  LYS H CA  1 
ATOM   10412 C C   . LYS H 2 42  ? 5.174   13.578  86.502  1.00 14.66 ? 42  LYS H C   1 
ATOM   10413 O O   . LYS H 2 42  ? 5.123   12.970  85.439  1.00 12.39 ? 42  LYS H O   1 
ATOM   10414 C CB  . LYS H 2 42  ? 5.184   16.045  85.967  1.00 12.01 ? 42  LYS H CB  1 
ATOM   10415 C CG  . LYS H 2 42  ? 3.702   16.033  86.123  1.00 11.39 ? 42  LYS H CG  1 
ATOM   10416 C CD  . LYS H 2 42  ? 3.170   17.425  85.855  1.00 14.67 ? 42  LYS H CD  1 
ATOM   10417 C CE  . LYS H 2 42  ? 3.719   18.410  86.878  0.00 14.05 ? 42  LYS H CE  1 
ATOM   10418 N NZ  . LYS H 2 42  ? 3.221   19.792  86.673  0.00 14.81 ? 42  LYS H NZ  1 
ATOM   10419 N N   . LYS H 2 43  ? 4.608   13.131  87.619  1.00 18.65 ? 43  LYS H N   1 
ATOM   10420 C CA  . LYS H 2 43  ? 3.839   11.889  87.636  1.00 23.35 ? 43  LYS H CA  1 
ATOM   10421 C C   . LYS H 2 43  ? 2.355   12.111  87.846  1.00 26.28 ? 43  LYS H C   1 
ATOM   10422 O O   . LYS H 2 43  ? 1.957   12.955  88.652  1.00 28.84 ? 43  LYS H O   1 
ATOM   10423 C CB  . LYS H 2 43  ? 4.339   10.951  88.726  1.00 25.06 ? 43  LYS H CB  1 
ATOM   10424 C CG  . LYS H 2 43  ? 5.567   10.171  88.368  1.00 27.41 ? 43  LYS H CG  1 
ATOM   10425 C CD  . LYS H 2 43  ? 5.882   9.166   89.448  1.00 33.38 ? 43  LYS H CD  1 
ATOM   10426 C CE  . LYS H 2 43  ? 7.271   8.605   89.268  1.00 39.30 ? 43  LYS H CE  1 
ATOM   10427 N NZ  . LYS H 2 43  ? 8.282   9.714   89.226  1.00 44.25 ? 43  LYS H NZ  1 
ATOM   10428 N N   . ASP H 2 44  ? 1.532   11.342  87.142  1.00 28.61 ? 44  ASP H N   1 
ATOM   10429 C CA  . ASP H 2 44  ? 0.089   11.471  87.295  1.00 33.12 ? 44  ASP H CA  1 
ATOM   10430 C C   . ASP H 2 44  ? -0.413  10.585  88.437  1.00 37.25 ? 44  ASP H C   1 
ATOM   10431 O O   . ASP H 2 44  ? 0.336   9.756   88.964  1.00 37.06 ? 44  ASP H O   1 
ATOM   10432 C CB  . ASP H 2 44  ? -0.653  11.185  85.986  1.00 31.64 ? 44  ASP H CB  1 
ATOM   10433 C CG  . ASP H 2 44  ? -0.340  9.823   85.415  1.00 32.08 ? 44  ASP H CG  1 
ATOM   10434 O OD1 . ASP H 2 44  ? 0.476   9.076   85.995  1.00 32.97 ? 44  ASP H OD1 1 
ATOM   10435 O OD2 . ASP H 2 44  ? -0.925  9.499   84.368  1.00 31.08 ? 44  ASP H OD2 1 
ATOM   10436 N N   . ASP H 2 45  ? -1.689  10.738  88.782  1.00 40.74 ? 45  ASP H N   1 
ATOM   10437 C CA  . ASP H 2 45  ? -2.302  9.993   89.881  1.00 43.70 ? 45  ASP H CA  1 
ATOM   10438 C C   . ASP H 2 45  ? -2.134  8.480   89.800  1.00 48.22 ? 45  ASP H C   1 
ATOM   10439 O O   . ASP H 2 45  ? -2.212  7.772   90.800  1.00 48.78 ? 45  ASP H O   1 
ATOM   10440 C CB  . ASP H 2 45  ? -3.792  10.335  89.979  0.00 39.53 ? 45  ASP H CB  1 
ATOM   10441 C CG  . ASP H 2 45  ? -4.038  11.812  90.218  0.00 36.49 ? 45  ASP H CG  1 
ATOM   10442 O OD1 . ASP H 2 45  ? -4.123  12.220  91.395  0.00 34.65 ? 45  ASP H OD1 1 
ATOM   10443 O OD2 . ASP H 2 45  ? -4.147  12.566  89.228  0.00 34.63 ? 45  ASP H OD2 1 
ATOM   10444 N N   . ASN H 2 46  ? -1.854  7.997   88.607  1.00 53.41 ? 46  ASN H N   1 
ATOM   10445 C CA  . ASN H 2 46  ? -1.708  6.576   88.365  1.00 59.95 ? 46  ASN H CA  1 
ATOM   10446 C C   . ASN H 2 46  ? -0.274  6.083   88.617  1.00 59.46 ? 46  ASN H C   1 
ATOM   10447 O O   . ASN H 2 46  ? -0.014  4.872   88.602  1.00 60.56 ? 46  ASN H O   1 
ATOM   10448 C CB  . ASN H 2 46  ? -2.129  6.286   86.916  1.00 68.55 ? 46  ASN H CB  1 
ATOM   10449 C CG  . ASN H 2 46  ? -3.296  7.183   86.434  1.00 77.54 ? 46  ASN H CG  1 
ATOM   10450 O OD1 . ASN H 2 46  ? -3.534  8.292   86.954  1.00 79.99 ? 46  ASN H OD1 1 
ATOM   10451 N ND2 . ASN H 2 46  ? -4.002  6.715   85.411  1.00 81.91 ? 46  ASN H ND2 1 
ATOM   10452 N N   . GLY H 2 47  ? 0.654   7.021   88.820  1.00 57.05 ? 47  GLY H N   1 
ATOM   10453 C CA  . GLY H 2 47  ? 2.044   6.666   89.064  1.00 53.41 ? 47  GLY H CA  1 
ATOM   10454 C C   . GLY H 2 47  ? 2.961   6.826   87.860  1.00 50.84 ? 47  GLY H C   1 
ATOM   10455 O O   . GLY H 2 47  ? 4.184   6.796   88.009  1.00 50.51 ? 47  GLY H O   1 
ATOM   10456 N N   . CYS H 2 48  ? 2.383   6.951   86.665  1.00 48.35 ? 48  CYS H N   1 
ATOM   10457 C CA  . CYS H 2 48  ? 3.170   7.123   85.444  1.00 46.36 ? 48  CYS H CA  1 
ATOM   10458 C C   . CYS H 2 48  ? 3.781   8.515   85.446  1.00 45.98 ? 48  CYS H C   1 
ATOM   10459 O O   . CYS H 2 48  ? 3.246   9.432   86.071  1.00 45.65 ? 48  CYS H O   1 
ATOM   10460 C CB  . CYS H 2 48  ? 2.297   6.998   84.184  1.00 46.75 ? 48  CYS H CB  1 
ATOM   10461 S SG  . CYS H 2 48  ? 1.366   5.446   83.959  1.00 45.74 ? 48  CYS H SG  1 
ATOM   10462 N N   . GLU H 2 49  ? 4.879   8.681   84.720  1.00 45.79 ? 49  GLU H N   1 
ATOM   10463 C CA  . GLU H 2 49  ? 5.541   9.977   84.633  1.00 43.68 ? 49  GLU H CA  1 
ATOM   10464 C C   . GLU H 2 49  ? 5.247   10.492  83.238  1.00 39.95 ? 49  GLU H C   1 
ATOM   10465 O O   . GLU H 2 49  ? 5.227   9.705   82.290  1.00 43.49 ? 49  GLU H O   1 
ATOM   10466 C CB  . GLU H 2 49  ? 7.057   9.824   84.818  1.00 48.62 ? 49  GLU H CB  1 
ATOM   10467 C CG  . GLU H 2 49  ? 7.473   8.952   86.007  1.00 52.95 ? 49  GLU H CG  1 
ATOM   10468 C CD  . GLU H 2 49  ? 8.978   8.946   86.268  1.00 56.60 ? 49  GLU H CD  1 
ATOM   10469 O OE1 . GLU H 2 49  ? 9.563   7.837   86.291  1.00 59.71 ? 49  GLU H OE1 1 
ATOM   10470 O OE2 . GLU H 2 49  ? 9.568   10.038  86.474  1.00 56.49 ? 49  GLU H OE2 1 
ATOM   10471 N N   . TYR H 2 50  ? 4.979   11.784  83.103  1.00 34.40 ? 50  TYR H N   1 
ATOM   10472 C CA  . TYR H 2 50  ? 4.711   12.353  81.785  1.00 31.61 ? 50  TYR H CA  1 
ATOM   10473 C C   . TYR H 2 50  ? 5.992   12.381  80.952  1.00 29.09 ? 50  TYR H C   1 
ATOM   10474 O O   . TYR H 2 50  ? 7.047   12.793  81.437  1.00 31.98 ? 50  TYR H O   1 
ATOM   10475 C CB  . TYR H 2 50  ? 4.164   13.769  81.895  1.00 32.89 ? 50  TYR H CB  1 
ATOM   10476 C CG  . TYR H 2 50  ? 2.771   13.858  82.445  1.00 30.01 ? 50  TYR H CG  1 
ATOM   10477 C CD1 . TYR H 2 50  ? 2.540   13.661  83.797  1.00 29.76 ? 50  TYR H CD1 1 
ATOM   10478 C CD2 . TYR H 2 50  ? 1.693   14.180  81.621  1.00 26.39 ? 50  TYR H CD2 1 
ATOM   10479 C CE1 . TYR H 2 50  ? 1.295   13.782  84.322  1.00 31.32 ? 50  TYR H CE1 1 
ATOM   10480 C CE2 . TYR H 2 50  ? 0.436   14.304  82.135  1.00 29.19 ? 50  TYR H CE2 1 
ATOM   10481 C CZ  . TYR H 2 50  ? 0.241   14.101  83.496  1.00 33.44 ? 50  TYR H CZ  1 
ATOM   10482 O OH  . TYR H 2 50  ? -1.010  14.183  84.063  1.00 39.42 ? 50  TYR H OH  1 
ATOM   10483 N N   . ALA H 2 51  ? 5.888   11.976  79.692  1.00 24.01 ? 51  ALA H N   1 
ATOM   10484 C CA  . ALA H 2 51  ? 7.034   11.939  78.797  1.00 19.32 ? 51  ALA H CA  1 
ATOM   10485 C C   . ALA H 2 51  ? 7.942   13.155  78.832  1.00 19.33 ? 51  ALA H C   1 
ATOM   10486 O O   . ALA H 2 51  ? 9.152   13.006  79.015  1.00 21.67 ? 51  ALA H O   1 
ATOM   10487 C CB  . ALA H 2 51  ? 6.594   11.686  77.372  1.00 17.36 ? 51  ALA H CB  1 
ATOM   10488 N N   . CYS H 2 52  ? 7.370   14.350  78.697  1.00 16.80 ? 52  CYS H N   1 
ATOM   10489 C CA  . CYS H 2 52  ? 8.176   15.554  78.649  1.00 13.59 ? 52  CYS H CA  1 
ATOM   10490 C C   . CYS H 2 52  ? 7.640   16.684  79.502  1.00 10.46 ? 52  CYS H C   1 
ATOM   10491 O O   . CYS H 2 52  ? 7.403   17.791  79.001  1.00 9.77  ? 52  CYS H O   1 
ATOM   10492 C CB  . CYS H 2 52  ? 8.245   16.010  77.196  1.00 20.39 ? 52  CYS H CB  1 
ATOM   10493 S SG  . CYS H 2 52  ? 9.712   16.992  76.803  1.00 26.80 ? 52  CYS H SG  1 
ATOM   10494 N N   . ILE H 2 53  ? 7.434   16.414  80.786  1.00 7.72  ? 53  ILE H N   1 
ATOM   10495 C CA  . ILE H 2 53  ? 6.914   17.424  81.714  1.00 6.52  ? 53  ILE H CA  1 
ATOM   10496 C C   . ILE H 2 53  ? 7.618   17.214  83.037  1.00 6.23  ? 53  ILE H C   1 
ATOM   10497 O O   . ILE H 2 53  ? 7.650   16.106  83.549  1.00 5.00  ? 53  ILE H O   1 
ATOM   10498 C CB  . ILE H 2 53  ? 5.368   17.275  81.938  1.00 5.00  ? 53  ILE H CB  1 
ATOM   10499 C CG1 . ILE H 2 53  ? 4.611   17.455  80.629  1.00 5.00  ? 53  ILE H CG1 1 
ATOM   10500 C CG2 . ILE H 2 53  ? 4.864   18.310  82.924  1.00 5.01  ? 53  ILE H CG2 1 
ATOM   10501 C CD1 . ILE H 2 53  ? 3.169   17.212  80.744  1.00 5.00  ? 53  ILE H CD1 1 
ATOM   10502 N N   . CYS H 2 54  ? 8.174   18.275  83.599  1.00 9.60  ? 54  CYS H N   1 
ATOM   10503 C CA  . CYS H 2 54  ? 8.883   18.149  84.864  1.00 13.15 ? 54  CYS H CA  1 
ATOM   10504 C C   . CYS H 2 54  ? 8.048   18.444  86.109  1.00 13.08 ? 54  CYS H C   1 
ATOM   10505 O O   . CYS H 2 54  ? 7.128   19.260  86.092  1.00 13.12 ? 54  CYS H O   1 
ATOM   10506 C CB  . CYS H 2 54  ? 10.143  19.019  84.854  1.00 14.76 ? 54  CYS H CB  1 
ATOM   10507 S SG  . CYS H 2 54  ? 11.245  18.728  83.423  1.00 16.33 ? 54  CYS H SG  1 
ATOM   10508 N N   . ALA H 2 55  ? 8.383   17.746  87.185  1.00 12.15 ? 55  ALA H N   1 
ATOM   10509 C CA  . ALA H 2 55  ? 7.719   17.906  88.455  1.00 13.52 ? 55  ALA H CA  1 
ATOM   10510 C C   . ALA H 2 55  ? 8.160   19.198  89.131  1.00 20.92 ? 55  ALA H C   1 
ATOM   10511 O O   . ALA H 2 55  ? 9.353   19.530  89.143  1.00 27.43 ? 55  ALA H O   1 
ATOM   10512 C CB  . ALA H 2 55  ? 8.033   16.757  89.311  1.00 10.69 ? 55  ALA H CB  1 
ATOM   10513 N N   . ASP H 2 56  ? 7.184   19.905  89.704  1.00 25.60 ? 56  ASP H N   1 
ATOM   10514 C CA  . ASP H 2 56  ? 7.357   21.190  90.404  1.00 25.50 ? 56  ASP H CA  1 
ATOM   10515 C C   . ASP H 2 56  ? 8.149   21.088  91.700  1.00 21.10 ? 56  ASP H C   1 
ATOM   10516 O O   . ASP H 2 56  ? 8.746   22.069  92.159  1.00 19.83 ? 56  ASP H O   1 
ATOM   10517 C CB  . ASP H 2 56  ? 5.990   21.757  90.790  1.00 29.80 ? 56  ASP H CB  1 
ATOM   10518 C CG  . ASP H 2 56  ? 5.235   22.340  89.629  1.00 35.18 ? 56  ASP H CG  1 
ATOM   10519 O OD1 . ASP H 2 56  ? 5.117   23.580  89.612  1.00 43.09 ? 56  ASP H OD1 1 
ATOM   10520 O OD2 . ASP H 2 56  ? 4.727   21.580  88.770  1.00 36.14 ? 56  ASP H OD2 1 
ATOM   10521 N N   . ALA H 2 57  ? 8.110   19.915  92.314  1.00 16.16 ? 57  ALA H N   1 
ATOM   10522 C CA  . ALA H 2 57  ? 8.802   19.724  93.565  1.00 17.21 ? 57  ALA H CA  1 
ATOM   10523 C C   . ALA H 2 57  ? 9.102   18.263  93.733  1.00 18.66 ? 57  ALA H C   1 
ATOM   10524 O O   . ALA H 2 57  ? 8.489   17.425  93.091  1.00 17.54 ? 57  ALA H O   1 
ATOM   10525 C CB  . ALA H 2 57  ? 7.947   20.210  94.700  1.00 20.88 ? 57  ALA H CB  1 
ATOM   10526 N N   . PRO H 2 58  ? 10.092  17.942  94.567  1.00 23.60 ? 58  PRO H N   1 
ATOM   10527 C CA  . PRO H 2 58  ? 10.501  16.559  94.834  1.00 30.57 ? 58  PRO H CA  1 
ATOM   10528 C C   . PRO H 2 58  ? 9.353   15.711  95.359  1.00 38.10 ? 58  PRO H C   1 
ATOM   10529 O O   . PRO H 2 58  ? 8.578   16.169  96.208  1.00 40.27 ? 58  PRO H O   1 
ATOM   10530 C CB  . PRO H 2 58  ? 11.604  16.723  95.884  1.00 28.92 ? 58  PRO H CB  1 
ATOM   10531 C CG  . PRO H 2 58  ? 11.253  18.030  96.545  1.00 28.35 ? 58  PRO H CG  1 
ATOM   10532 C CD  . PRO H 2 58  ? 10.886  18.884  95.365  1.00 26.00 ? 58  PRO H CD  1 
ATOM   10533 N N   . GLN H 2 59  ? 9.252   14.487  94.838  1.00 43.20 ? 59  GLN H N   1 
ATOM   10534 C CA  . GLN H 2 59  ? 8.199   13.547  95.216  1.00 48.74 ? 59  GLN H CA  1 
ATOM   10535 C C   . GLN H 2 59  ? 8.438   13.008  96.628  1.00 53.55 ? 59  GLN H C   1 
ATOM   10536 O O   . GLN H 2 59  ? 7.503   12.441  97.244  1.00 57.68 ? 59  GLN H O   1 
ATOM   10537 C CB  . GLN H 2 59  ? 8.148   12.394  94.206  0.00 48.20 ? 59  GLN H CB  1 
ATOM   10538 C CG  . GLN H 2 59  ? 6.952   11.463  94.353  0.00 47.65 ? 59  GLN H CG  1 
ATOM   10539 C CD  . GLN H 2 59  ? 7.358   10.041  94.690  0.00 47.27 ? 59  GLN H CD  1 
ATOM   10540 O OE1 . GLN H 2 59  ? 7.254   9.140   93.857  0.00 46.80 ? 59  GLN H OE1 1 
ATOM   10541 N NE2 . GLN H 2 59  ? 7.823   9.831   95.912  0.00 46.85 ? 59  GLN H NE2 1 
ATOM   10542 O OXT . GLN H 2 59  ? 9.568   13.197  97.121  1.00 56.85 ? 59  GLN H OXT 1 
ATOM   10543 N N   . THR I 2 7   ? 26.683  83.729  49.508  0.00 24.96 ? 7   THR I N   1 
ATOM   10544 C CA  . THR I 2 7   ? 26.978  83.732  48.047  0.00 24.83 ? 7   THR I CA  1 
ATOM   10545 C C   . THR I 2 7   ? 25.757  84.214  47.261  0.00 24.71 ? 7   THR I C   1 
ATOM   10546 O O   . THR I 2 7   ? 24.670  83.659  47.414  0.00 24.68 ? 7   THR I O   1 
ATOM   10547 C CB  . THR I 2 7   ? 27.378  82.319  47.577  0.00 24.24 ? 7   THR I CB  1 
ATOM   10548 O OG1 . THR I 2 7   ? 28.324  81.771  48.503  0.00 24.05 ? 7   THR I OG1 1 
ATOM   10549 C CG2 . THR I 2 7   ? 28.002  82.366  46.190  0.00 24.05 ? 7   THR I CG2 1 
ATOM   10550 N N   . THR I 2 8   ? 25.939  85.250  46.440  0.00 24.26 ? 8   THR I N   1 
ATOM   10551 C CA  . THR I 2 8   ? 24.854  85.815  45.629  0.00 23.66 ? 8   THR I CA  1 
ATOM   10552 C C   . THR I 2 8   ? 25.324  87.020  44.805  0.00 23.93 ? 8   THR I C   1 
ATOM   10553 O O   . THR I 2 8   ? 26.175  87.791  45.252  0.00 23.61 ? 8   THR I O   1 
ATOM   10554 C CB  . THR I 2 8   ? 23.642  86.248  46.512  0.00 22.84 ? 8   THR I CB  1 
ATOM   10555 O OG1 . THR I 2 8   ? 22.593  86.770  45.684  0.00 22.34 ? 8   THR I OG1 1 
ATOM   10556 C CG2 . THR I 2 8   ? 24.056  87.306  47.527  0.00 22.34 ? 8   THR I CG2 1 
ATOM   10557 N N   . PRO I 2 9   ? 24.817  87.165  43.564  0.00 24.73 ? 9   PRO I N   1 
ATOM   10558 C CA  . PRO I 2 9   ? 25.206  88.297  42.712  0.00 25.42 ? 9   PRO I CA  1 
ATOM   10559 C C   . PRO I 2 9   ? 24.766  89.582  43.413  0.00 27.10 ? 9   PRO I C   1 
ATOM   10560 O O   . PRO I 2 9   ? 23.641  89.660  43.911  0.00 26.25 ? 9   PRO I O   1 
ATOM   10561 C CB  . PRO I 2 9   ? 24.419  88.042  41.424  0.00 24.70 ? 9   PRO I CB  1 
ATOM   10562 C CG  . PRO I 2 9   ? 23.227  87.252  41.891  0.00 24.43 ? 9   PRO I CG  1 
ATOM   10563 C CD  . PRO I 2 9   ? 23.850  86.298  42.870  0.00 24.11 ? 9   PRO I CD  1 
ATOM   10564 N N   . CYS I 2 10  ? 25.630  90.590  43.427  0.00 29.64 ? 10  CYS I N   1 
ATOM   10565 C CA  . CYS I 2 10  ? 25.329  91.828  44.138  0.00 31.84 ? 10  CYS I CA  1 
ATOM   10566 C C   . CYS I 2 10  ? 25.823  93.083  43.433  0.00 29.40 ? 10  CYS I C   1 
ATOM   10567 O O   . CYS I 2 10  ? 27.020  93.366  43.440  0.00 28.30 ? 10  CYS I O   1 
ATOM   10568 C CB  . CYS I 2 10  ? 25.991  91.748  45.513  0.00 38.34 ? 10  CYS I CB  1 
ATOM   10569 S SG  . CYS I 2 10  ? 25.573  93.069  46.685  0.00 40.92 ? 10  CYS I SG  1 
ATOM   10570 N N   . GLY I 2 11  ? 24.900  93.866  42.880  0.00 26.86 ? 11  GLY I N   1 
ATOM   10571 C CA  . GLY I 2 11  ? 25.283  95.088  42.193  0.00 24.37 ? 11  GLY I CA  1 
ATOM   10572 C C   . GLY I 2 11  ? 26.415  94.857  41.208  0.00 23.06 ? 11  GLY I C   1 
ATOM   10573 O O   . GLY I 2 11  ? 26.303  93.995  40.338  0.00 22.75 ? 11  GLY I O   1 
ATOM   10574 N N   . PRO I 2 12  ? 27.517  95.615  41.318  0.00 22.09 ? 12  PRO I N   1 
ATOM   10575 C CA  . PRO I 2 12  ? 28.674  95.483  40.428  0.00 22.22 ? 12  PRO I CA  1 
ATOM   10576 C C   . PRO I 2 12  ? 29.596  94.323  40.813  0.00 22.25 ? 12  PRO I C   1 
ATOM   10577 O O   . PRO I 2 12  ? 30.532  93.996  40.081  0.00 22.08 ? 12  PRO I O   1 
ATOM   10578 C CB  . PRO I 2 12  ? 29.377  96.825  40.603  0.00 21.65 ? 12  PRO I CB  1 
ATOM   10579 C CG  . PRO I 2 12  ? 29.141  97.121  42.049  0.00 21.69 ? 12  PRO I CG  1 
ATOM   10580 C CD  . PRO I 2 12  ? 27.677  96.774  42.216  0.00 21.84 ? 12  PRO I CD  1 
ATOM   10581 N N   . VAL I 2 13  ? 29.342  93.718  41.969  0.00 22.78 ? 13  VAL I N   1 
ATOM   10582 C CA  . VAL I 2 13  ? 30.157  92.607  42.448  0.00 23.45 ? 13  VAL I CA  1 
ATOM   10583 C C   . VAL I 2 13  ? 29.327  91.342  42.663  0.00 24.85 ? 13  VAL I C   1 
ATOM   10584 O O   . VAL I 2 13  ? 28.140  91.300  42.335  0.00 24.77 ? 13  VAL I O   1 
ATOM   10585 C CB  . VAL I 2 13  ? 30.897  92.967  43.764  0.00 22.65 ? 13  VAL I CB  1 
ATOM   10586 C CG1 . VAL I 2 13  ? 31.898  94.088  43.519  0.00 22.23 ? 13  VAL I CG1 1 
ATOM   10587 C CG2 . VAL I 2 13  ? 29.903  93.366  44.846  0.00 22.23 ? 13  VAL I CG2 1 
ATOM   10588 N N   . THR I 2 14  ? 29.961  90.306  43.201  0.00 27.30 ? 14  THR I N   1 
ATOM   10589 C CA  . THR I 2 14  ? 29.290  89.038  43.463  0.00 30.43 ? 14  THR I CA  1 
ATOM   10590 C C   . THR I 2 14  ? 29.741  88.440  44.796  0.00 34.83 ? 14  THR I C   1 
ATOM   10591 O O   . THR I 2 14  ? 30.929  88.176  44.992  0.00 33.86 ? 14  THR I O   1 
ATOM   10592 C CB  . THR I 2 14  ? 29.580  88.012  42.341  0.00 27.56 ? 14  THR I CB  1 
ATOM   10593 O OG1 . THR I 2 14  ? 30.985  87.994  42.057  0.00 26.29 ? 14  THR I OG1 1 
ATOM   10594 C CG2 . THR I 2 14  ? 28.808  88.359  41.076  0.00 26.29 ? 14  THR I CG2 1 
ATOM   10595 N N   . CYS I 2 15  ? 28.793  88.254  45.713  0.00 40.67 ? 15  CYS I N   1 
ATOM   10596 C CA  . CYS I 2 15  ? 29.067  87.675  47.031  0.00 47.76 ? 15  CYS I CA  1 
ATOM   10597 C C   . CYS I 2 15  ? 29.530  86.237  46.890  0.00 51.41 ? 15  CYS I C   1 
ATOM   10598 O O   . CYS I 2 15  ? 28.845  85.425  46.261  0.00 49.70 ? 15  CYS I O   1 
ATOM   10599 C CB  . CYS I 2 15  ? 27.793  87.614  47.887  0.00 53.19 ? 15  CYS I CB  1 
ATOM   10600 S SG  . CYS I 2 15  ? 27.144  89.142  48.623  0.00 52.07 ? 15  CYS I SG  1 
ATOM   10601 N N   . SER I 2 16  ? 30.646  85.912  47.531  1.00 54.20 ? 16  SER I N   1 
ATOM   10602 C CA  . SER I 2 16  ? 31.182  84.544  47.517  1.00 54.50 ? 16  SER I CA  1 
ATOM   10603 C C   . SER I 2 16  ? 30.915  83.902  48.899  1.00 49.99 ? 16  SER I C   1 
ATOM   10604 O O   . SER I 2 16  ? 30.520  84.607  49.844  1.00 50.32 ? 16  SER I O   1 
ATOM   10605 C CB  . SER I 2 16  ? 32.694  84.574  47.226  1.00 55.09 ? 16  SER I CB  1 
ATOM   10606 O OG  . SER I 2 16  ? 32.961  85.178  45.969  0.00 61.36 ? 16  SER I OG  1 
ATOM   10607 N N   . GLY I 2 17  ? 31.071  82.583  48.999  1.00 43.51 ? 17  GLY I N   1 
ATOM   10608 C CA  . GLY I 2 17  ? 30.869  81.881  50.259  1.00 42.38 ? 17  GLY I CA  1 
ATOM   10609 C C   . GLY I 2 17  ? 30.025  82.492  51.378  1.00 40.73 ? 17  GLY I C   1 
ATOM   10610 O O   . GLY I 2 17  ? 28.786  82.552  51.283  1.00 45.44 ? 17  GLY I O   1 
ATOM   10611 N N   . ALA I 2 18  ? 30.698  82.993  52.416  1.00 35.62 ? 18  ALA I N   1 
ATOM   10612 C CA  . ALA I 2 18  ? 30.024  83.559  53.592  1.00 31.62 ? 18  ALA I CA  1 
ATOM   10613 C C   . ALA I 2 18  ? 29.671  85.051  53.555  1.00 29.30 ? 18  ALA I C   1 
ATOM   10614 O O   . ALA I 2 18  ? 29.427  85.677  54.601  1.00 27.87 ? 18  ALA I O   1 
ATOM   10615 C CB  . ALA I 2 18  ? 30.833  83.229  54.866  1.00 31.22 ? 18  ALA I CB  1 
ATOM   10616 N N   . GLN I 2 19  ? 29.639  85.624  52.361  0.00 27.61 ? 19  GLN I N   1 
ATOM   10617 C CA  . GLN I 2 19  ? 29.316  87.034  52.220  0.00 26.75 ? 19  GLN I CA  1 
ATOM   10618 C C   . GLN I 2 19  ? 27.836  87.279  51.967  0.00 27.97 ? 19  GLN I C   1 
ATOM   10619 O O   . GLN I 2 19  ? 27.185  86.546  51.209  0.00 27.89 ? 19  GLN I O   1 
ATOM   10620 C CB  . GLN I 2 19  ? 30.128  87.658  51.084  0.00 23.65 ? 19  GLN I CB  1 
ATOM   10621 C CG  . GLN I 2 19  ? 31.629  87.646  51.297  0.00 20.61 ? 19  GLN I CG  1 
ATOM   10622 C CD  . GLN I 2 19  ? 32.374  88.271  50.138  0.00 19.26 ? 19  GLN I CD  1 
ATOM   10623 O OE1 . GLN I 2 19  ? 32.263  87.818  48.999  0.00 18.50 ? 19  GLN I OE1 1 
ATOM   10624 N NE2 . GLN I 2 19  ? 33.129  89.323  50.416  0.00 18.45 ? 19  GLN I NE2 1 
ATOM   10625 N N   . MET I 2 20  ? 27.318  88.314  52.617  0.00 29.37 ? 20  MET I N   1 
ATOM   10626 C CA  . MET I 2 20  ? 25.935  88.726  52.468  0.00 31.73 ? 20  MET I CA  1 
ATOM   10627 C C   . MET I 2 20  ? 25.998  90.014  51.658  0.00 35.64 ? 20  MET I C   1 
ATOM   10628 O O   . MET I 2 20  ? 26.886  90.848  51.858  0.00 36.29 ? 20  MET I O   1 
ATOM   10629 C CB  . MET I 2 20  ? 25.274  88.953  53.837  0.00 30.27 ? 20  MET I CB  1 
ATOM   10630 C CG  . MET I 2 20  ? 25.802  90.135  54.646  0.00 27.17 ? 20  MET I CG  1 
ATOM   10631 S SD  . MET I 2 20  ? 25.248  91.736  54.018  0.00 23.66 ? 20  MET I SD  1 
ATOM   10632 C CE  . MET I 2 20  ? 23.717  91.946  54.917  0.00 21.54 ? 20  MET I CE  1 
ATOM   10633 N N   . CYS I 2 21  ? 25.099  90.136  50.697  1.00 36.64 ? 21  CYS I N   1 
ATOM   10634 C CA  . CYS I 2 21  ? 25.055  91.302  49.831  1.00 39.27 ? 21  CYS I CA  1 
ATOM   10635 C C   . CYS I 2 21  ? 24.297  92.463  50.445  1.00 38.28 ? 21  CYS I C   1 
ATOM   10636 O O   . CYS I 2 21  ? 23.157  92.300  50.894  1.00 42.93 ? 21  CYS I O   1 
ATOM   10637 C CB  . CYS I 2 21  ? 24.405  90.934  48.500  1.00 40.00 ? 21  CYS I CB  1 
ATOM   10638 S SG  . CYS I 2 21  ? 23.862  92.369  47.512  1.00 48.22 ? 21  CYS I SG  1 
ATOM   10639 N N   . GLU I 2 22  ? 24.915  93.639  50.419  0.00 33.89 ? 22  GLU I N   1 
ATOM   10640 C CA  . GLU I 2 22  ? 24.325  94.859  50.949  0.00 31.02 ? 22  GLU I CA  1 
ATOM   10641 C C   . GLU I 2 22  ? 24.195  95.870  49.809  0.00 30.14 ? 22  GLU I C   1 
ATOM   10642 O O   . GLU I 2 22  ? 25.125  96.628  49.519  0.00 31.35 ? 22  GLU I O   1 
ATOM   10643 C CB  . GLU I 2 22  ? 25.194  95.426  52.076  0.00 31.25 ? 22  GLU I CB  1 
ATOM   10644 C CG  . GLU I 2 22  ? 24.547  96.568  52.849  0.00 25.64 ? 22  GLU I CG  1 
ATOM   10645 C CD  . GLU I 2 22  ? 25.412  97.074  53.990  0.00 21.12 ? 22  GLU I CD  1 
ATOM   10646 O OE1 . GLU I 2 22  ? 25.900  96.246  54.789  0.00 19.09 ? 22  GLU I OE1 1 
ATOM   10647 O OE2 . GLU I 2 22  ? 25.599  98.304  54.092  0.00 19.08 ? 22  GLU I OE2 1 
ATOM   10648 N N   . VAL I 2 23  ? 23.045  95.834  49.140  0.00 28.01 ? 23  VAL I N   1 
ATOM   10649 C CA  . VAL I 2 23  ? 22.734  96.725  48.022  0.00 23.97 ? 23  VAL I CA  1 
ATOM   10650 C C   . VAL I 2 23  ? 23.692  96.560  46.838  0.00 22.84 ? 23  VAL I C   1 
ATOM   10651 O O   . VAL I 2 23  ? 23.343  95.932  45.837  0.00 21.90 ? 23  VAL I O   1 
ATOM   10652 C CB  . VAL I 2 23  ? 22.694  98.214  48.465  0.00 21.85 ? 23  VAL I CB  1 
ATOM   10653 C CG1 . VAL I 2 23  ? 22.297  99.106  47.295  0.00 20.60 ? 23  VAL I CG1 1 
ATOM   10654 C CG2 . VAL I 2 23  ? 21.718  98.395  49.620  0.00 20.60 ? 23  VAL I CG2 1 
ATOM   10655 N N   . ASP I 2 24  ? 24.900  97.101  46.966  0.00 22.72 ? 24  ASP I N   1 
ATOM   10656 C CA  . ASP I 2 24  ? 25.891  97.026  45.897  0.00 23.87 ? 24  ASP I CA  1 
ATOM   10657 C C   . ASP I 2 24  ? 27.248  96.491  46.352  0.00 26.03 ? 24  ASP I C   1 
ATOM   10658 O O   . ASP I 2 24  ? 28.171  96.368  45.545  0.00 25.51 ? 24  ASP I O   1 
ATOM   10659 C CB  . ASP I 2 24  ? 26.068  98.404  45.249  0.00 21.34 ? 24  ASP I CB  1 
ATOM   10660 C CG  . ASP I 2 24  ? 26.563  99.454  46.230  0.00 19.60 ? 24  ASP I CG  1 
ATOM   10661 O OD1 . ASP I 2 24  ? 25.739  99.980  47.009  0.00 19.16 ? 24  ASP I OD1 1 
ATOM   10662 O OD2 . ASP I 2 24  ? 27.775  99.753  46.222  0.00 19.12 ? 24  ASP I OD2 1 
ATOM   10663 N N   . LYS I 2 25  ? 27.376  96.184  47.638  0.00 28.98 ? 25  LYS I N   1 
ATOM   10664 C CA  . LYS I 2 25  ? 28.632  95.670  48.171  0.00 34.12 ? 25  LYS I CA  1 
ATOM   10665 C C   . LYS I 2 25  ? 28.397  94.409  48.988  0.00 41.27 ? 25  LYS I C   1 
ATOM   10666 O O   . LYS I 2 25  ? 27.353  94.248  49.598  0.00 41.61 ? 25  LYS I O   1 
ATOM   10667 C CB  . LYS I 2 25  ? 29.322  96.735  49.028  0.00 30.89 ? 25  LYS I CB  1 
ATOM   10668 C CG  . LYS I 2 25  ? 28.481  97.250  50.187  0.00 25.93 ? 25  LYS I CG  1 
ATOM   10669 C CD  . LYS I 2 25  ? 29.203  98.343  50.954  0.00 21.46 ? 25  LYS I CD  1 
ATOM   10670 C CE  . LYS I 2 25  ? 28.352  98.866  52.098  0.00 19.06 ? 25  LYS I CE  1 
ATOM   10671 N NZ  . LYS I 2 25  ? 27.065  99.448  51.620  0.00 17.97 ? 25  LYS I NZ  1 
ATOM   10672 N N   . CYS I 2 26  ? 29.348  93.491  48.964  1.00 47.11 ? 26  CYS I N   1 
ATOM   10673 C CA  . CYS I 2 26  ? 29.209  92.263  49.736  1.00 50.13 ? 26  CYS I CA  1 
ATOM   10674 C C   . CYS I 2 26  ? 30.072  92.334  51.001  1.00 52.17 ? 26  CYS I C   1 
ATOM   10675 O O   . CYS I 2 26  ? 31.280  92.658  50.954  1.00 51.62 ? 26  CYS I O   1 
ATOM   10676 C CB  . CYS I 2 26  ? 29.517  91.020  48.883  1.00 48.13 ? 26  CYS I CB  1 
ATOM   10677 S SG  . CYS I 2 26  ? 28.190  90.598  47.689  1.00 57.44 ? 26  CYS I SG  1 
ATOM   10678 N N   . VAL I 2 27  ? 29.416  92.106  52.140  1.00 54.45 ? 27  VAL I N   1 
ATOM   10679 C CA  . VAL I 2 27  ? 30.081  92.142  53.445  1.00 54.15 ? 27  VAL I CA  1 
ATOM   10680 C C   . VAL I 2 27  ? 29.860  90.862  54.263  1.00 49.15 ? 27  VAL I C   1 
ATOM   10681 O O   . VAL I 2 27  ? 29.010  90.023  53.922  1.00 48.28 ? 27  VAL I O   1 
ATOM   10682 C CB  . VAL I 2 27  ? 29.623  93.363  54.287  0.00 58.93 ? 27  VAL I CB  1 
ATOM   10683 C CG1 . VAL I 2 27  ? 30.028  94.661  53.603  0.00 60.86 ? 27  VAL I CG1 1 
ATOM   10684 C CG2 . VAL I 2 27  ? 28.118  93.325  54.510  0.00 60.85 ? 27  VAL I CG2 1 
ATOM   10685 N N   . CYS I 2 28  ? 30.680  90.702  55.300  1.00 45.43 ? 28  CYS I N   1 
ATOM   10686 C CA  . CYS I 2 28  ? 30.588  89.562  56.198  1.00 45.99 ? 28  CYS I CA  1 
ATOM   10687 C C   . CYS I 2 28  ? 29.483  89.846  57.206  1.00 46.47 ? 28  CYS I C   1 
ATOM   10688 O O   . CYS I 2 28  ? 29.091  91.002  57.380  1.00 49.14 ? 28  CYS I O   1 
ATOM   10689 C CB  . CYS I 2 28  ? 31.899  89.387  56.960  1.00 49.26 ? 28  CYS I CB  1 
ATOM   10690 S SG  . CYS I 2 28  ? 33.410  89.268  55.949  1.00 48.37 ? 28  CYS I SG  1 
ATOM   10691 N N   . SER I 2 29  ? 28.981  88.811  57.874  1.00 46.43 ? 29  SER I N   1 
ATOM   10692 C CA  . SER I 2 29  ? 27.931  89.015  58.879  1.00 44.34 ? 29  SER I CA  1 
ATOM   10693 C C   . SER I 2 29  ? 28.333  88.451  60.243  1.00 38.52 ? 29  SER I C   1 
ATOM   10694 O O   . SER I 2 29  ? 29.279  87.664  60.352  1.00 37.16 ? 29  SER I O   1 
ATOM   10695 C CB  . SER I 2 29  ? 26.559  88.470  58.413  1.00 45.91 ? 29  SER I CB  1 
ATOM   10696 O OG  . SER I 2 29  ? 26.598  87.088  58.086  1.00 52.99 ? 29  SER I OG  1 
ATOM   10697 N N   . ASP I 2 30  ? 27.665  88.935  61.283  1.00 33.64 ? 30  ASP I N   1 
ATOM   10698 C CA  . ASP I 2 30  ? 27.922  88.495  62.646  1.00 30.41 ? 30  ASP I CA  1 
ATOM   10699 C C   . ASP I 2 30  ? 26.889  87.416  63.005  1.00 27.79 ? 30  ASP I C   1 
ATOM   10700 O O   . ASP I 2 30  ? 26.960  86.772  64.052  1.00 29.27 ? 30  ASP I O   1 
ATOM   10701 C CB  . ASP I 2 30  ? 27.807  89.692  63.598  1.00 31.10 ? 30  ASP I CB  1 
ATOM   10702 C CG  . ASP I 2 30  ? 28.813  90.784  63.287  0.00 30.05 ? 30  ASP I CG  1 
ATOM   10703 O OD1 . ASP I 2 30  ? 29.938  90.728  63.825  0.00 29.55 ? 30  ASP I OD1 1 
ATOM   10704 O OD2 . ASP I 2 30  ? 28.476  91.699  62.506  0.00 29.51 ? 30  ASP I OD2 1 
ATOM   10705 N N   . LEU I 2 31  ? 25.949  87.206  62.097  1.00 22.93 ? 31  LEU I N   1 
ATOM   10706 C CA  . LEU I 2 31  ? 24.892  86.241  62.265  1.00 18.71 ? 31  LEU I CA  1 
ATOM   10707 C C   . LEU I 2 31  ? 25.461  84.831  62.388  1.00 20.31 ? 31  LEU I C   1 
ATOM   10708 O O   . LEU I 2 31  ? 26.190  84.366  61.522  1.00 22.35 ? 31  LEU I O   1 
ATOM   10709 C CB  . LEU I 2 31  ? 23.958  86.351  61.062  1.00 14.67 ? 31  LEU I CB  1 
ATOM   10710 C CG  . LEU I 2 31  ? 22.761  85.419  60.909  1.00 15.62 ? 31  LEU I CG  1 
ATOM   10711 C CD1 . LEU I 2 31  ? 21.813  86.037  59.912  1.00 14.38 ? 31  LEU I CD1 1 
ATOM   10712 C CD2 . LEU I 2 31  ? 23.170  84.009  60.473  1.00 13.62 ? 31  LEU I CD2 1 
ATOM   10713 N N   . HIS I 2 32  ? 25.164  84.166  63.491  1.00 22.00 ? 32  HIS I N   1 
ATOM   10714 C CA  . HIS I 2 32  ? 25.623  82.803  63.708  1.00 21.87 ? 32  HIS I CA  1 
ATOM   10715 C C   . HIS I 2 32  ? 24.682  82.015  64.607  1.00 18.55 ? 32  HIS I C   1 
ATOM   10716 O O   . HIS I 2 32  ? 23.942  82.579  65.432  1.00 13.60 ? 32  HIS I O   1 
ATOM   10717 C CB  . HIS I 2 32  ? 27.049  82.777  64.278  1.00 25.59 ? 32  HIS I CB  1 
ATOM   10718 C CG  . HIS I 2 32  ? 28.071  83.261  63.308  1.00 31.55 ? 32  HIS I CG  1 
ATOM   10719 N ND1 . HIS I 2 32  ? 28.313  84.601  63.103  1.00 35.92 ? 32  HIS I ND1 1 
ATOM   10720 C CD2 . HIS I 2 32  ? 28.787  82.605  62.367  1.00 35.07 ? 32  HIS I CD2 1 
ATOM   10721 C CE1 . HIS I 2 32  ? 29.114  84.753  62.064  1.00 38.00 ? 32  HIS I CE1 1 
ATOM   10722 N NE2 . HIS I 2 32  ? 29.415  83.555  61.598  1.00 37.64 ? 32  HIS I NE2 1 
ATOM   10723 N N   . CYS I 2 33  ? 24.642  80.714  64.357  1.00 15.38 ? 33  CYS I N   1 
ATOM   10724 C CA  . CYS I 2 33  ? 23.837  79.820  65.157  1.00 15.52 ? 33  CYS I CA  1 
ATOM   10725 C C   . CYS I 2 33  ? 24.646  79.679  66.458  1.00 17.19 ? 33  CYS I C   1 
ATOM   10726 O O   . CYS I 2 33  ? 25.860  79.908  66.447  1.00 22.48 ? 33  CYS I O   1 
ATOM   10727 C CB  . CYS I 2 33  ? 23.732  78.495  64.445  1.00 13.31 ? 33  CYS I CB  1 
ATOM   10728 S SG  . CYS I 2 33  ? 25.366  77.834  64.099  1.00 8.01  ? 33  CYS I SG  1 
ATOM   10729 N N   . LYS I 2 34  ? 24.021  79.276  67.561  1.00 12.23 ? 34  LYS I N   1 
ATOM   10730 C CA  . LYS I 2 34  ? 24.759  79.205  68.815  1.00 5.00  ? 34  LYS I CA  1 
ATOM   10731 C C   . LYS I 2 34  ? 25.386  77.896  69.219  1.00 5.00  ? 34  LYS I C   1 
ATOM   10732 O O   . LYS I 2 34  ? 25.232  77.460  70.361  1.00 5.00  ? 34  LYS I O   1 
ATOM   10733 C CB  . LYS I 2 34  ? 23.911  79.770  69.937  1.00 5.00  ? 34  LYS I CB  1 
ATOM   10734 C CG  . LYS I 2 34  ? 23.534  81.199  69.656  1.00 5.00  ? 34  LYS I CG  1 
ATOM   10735 C CD  . LYS I 2 34  ? 22.840  81.881  70.812  1.00 5.81  ? 34  LYS I CD  1 
ATOM   10736 C CE  . LYS I 2 34  ? 22.743  83.374  70.548  1.00 5.01  ? 34  LYS I CE  1 
ATOM   10737 N NZ  . LYS I 2 34  ? 21.742  84.047  71.411  1.00 6.92  ? 34  LYS I NZ  1 
ATOM   10738 N N   . VAL I 2 35  ? 26.116  77.285  68.291  1.00 5.90  ? 35  VAL I N   1 
ATOM   10739 C CA  . VAL I 2 35  ? 26.801  76.007  68.529  1.00 7.39  ? 35  VAL I CA  1 
ATOM   10740 C C   . VAL I 2 35  ? 28.115  76.275  69.246  1.00 9.12  ? 35  VAL I C   1 
ATOM   10741 O O   . VAL I 2 35  ? 28.454  77.425  69.522  1.00 14.21 ? 35  VAL I O   1 
ATOM   10742 C CB  . VAL I 2 35  ? 27.207  75.325  67.209  1.00 5.80  ? 35  VAL I CB  1 
ATOM   10743 C CG1 . VAL I 2 35  ? 27.045  73.842  67.321  1.00 5.48  ? 35  VAL I CG1 1 
ATOM   10744 C CG2 . VAL I 2 35  ? 26.428  75.872  66.044  1.00 7.54  ? 35  VAL I CG2 1 
ATOM   10745 N N   . LYS I 2 36  ? 28.876  75.232  69.535  1.00 8.40  ? 36  LYS I N   1 
ATOM   10746 C CA  . LYS I 2 36  ? 30.152  75.456  70.172  1.00 9.53  ? 36  LYS I CA  1 
ATOM   10747 C C   . LYS I 2 36  ? 31.204  74.794  69.328  1.00 13.43 ? 36  LYS I C   1 
ATOM   10748 O O   . LYS I 2 36  ? 31.446  73.591  69.475  1.00 14.82 ? 36  LYS I O   1 
ATOM   10749 C CB  . LYS I 2 36  ? 30.192  74.868  71.568  1.00 7.37  ? 36  LYS I CB  1 
ATOM   10750 C CG  . LYS I 2 36  ? 31.256  75.511  72.417  1.00 5.28  ? 36  LYS I CG  1 
ATOM   10751 C CD  . LYS I 2 36  ? 31.939  74.476  73.244  1.00 9.30  ? 36  LYS I CD  1 
ATOM   10752 C CE  . LYS I 2 36  ? 32.604  75.101  74.444  1.00 13.85 ? 36  LYS I CE  1 
ATOM   10753 N NZ  . LYS I 2 36  ? 32.806  74.036  75.486  1.00 21.59 ? 36  LYS I NZ  1 
ATOM   10754 N N   . CYS I 2 37  ? 31.778  75.564  68.405  1.00 14.82 ? 37  CYS I N   1 
ATOM   10755 C CA  . CYS I 2 37  ? 32.830  75.074  67.531  1.00 17.53 ? 37  CYS I CA  1 
ATOM   10756 C C   . CYS I 2 37  ? 34.116  74.938  68.313  1.00 21.52 ? 37  CYS I C   1 
ATOM   10757 O O   . CYS I 2 37  ? 34.553  75.904  68.945  1.00 18.85 ? 37  CYS I O   1 
ATOM   10758 C CB  . CYS I 2 37  ? 33.073  76.064  66.423  1.00 15.10 ? 37  CYS I CB  1 
ATOM   10759 S SG  . CYS I 2 37  ? 31.661  76.207  65.317  1.00 14.62 ? 37  CYS I SG  1 
ATOM   10760 N N   . GLU I 2 38  ? 34.717  73.752  68.265  1.00 24.39 ? 38  GLU I N   1 
ATOM   10761 C CA  . GLU I 2 38  ? 35.967  73.507  68.948  1.00 27.49 ? 38  GLU I CA  1 
ATOM   10762 C C   . GLU I 2 38  ? 36.996  74.541  68.472  1.00 28.68 ? 38  GLU I C   1 
ATOM   10763 O O   . GLU I 2 38  ? 37.683  75.165  69.281  1.00 30.94 ? 38  GLU I O   1 
ATOM   10764 C CB  . GLU I 2 38  ? 36.444  72.094  68.622  1.00 30.04 ? 38  GLU I CB  1 
ATOM   10765 C CG  . GLU I 2 38  ? 37.827  71.757  69.164  1.00 37.19 ? 38  GLU I CG  1 
ATOM   10766 C CD  . GLU I 2 38  ? 38.216  70.293  68.960  1.00 42.32 ? 38  GLU I CD  1 
ATOM   10767 O OE1 . GLU I 2 38  ? 38.627  69.905  67.835  1.00 41.93 ? 38  GLU I OE1 1 
ATOM   10768 O OE2 . GLU I 2 38  ? 38.119  69.531  69.946  1.00 46.21 ? 38  GLU I OE2 1 
ATOM   10769 N N   . HIS I 2 39  ? 37.048  74.765  67.160  1.00 25.80 ? 39  HIS I N   1 
ATOM   10770 C CA  . HIS I 2 39  ? 38.004  75.702  66.586  1.00 24.05 ? 39  HIS I CA  1 
ATOM   10771 C C   . HIS I 2 39  ? 37.443  77.040  66.128  1.00 27.65 ? 39  HIS I C   1 
ATOM   10772 O O   . HIS I 2 39  ? 38.178  77.856  65.557  1.00 32.54 ? 39  HIS I O   1 
ATOM   10773 C CB  . HIS I 2 39  ? 38.689  75.052  65.392  1.00 19.14 ? 39  HIS I CB  1 
ATOM   10774 C CG  . HIS I 2 39  ? 39.491  73.850  65.748  1.00 16.50 ? 39  HIS I CG  1 
ATOM   10775 N ND1 . HIS I 2 39  ? 39.547  72.731  64.946  1.00 17.04 ? 39  HIS I ND1 1 
ATOM   10776 C CD2 . HIS I 2 39  ? 40.252  73.577  66.833  1.00 16.69 ? 39  HIS I CD2 1 
ATOM   10777 C CE1 . HIS I 2 39  ? 40.307  71.818  65.523  1.00 18.77 ? 39  HIS I CE1 1 
ATOM   10778 N NE2 . HIS I 2 39  ? 40.747  72.306  66.669  1.00 18.41 ? 39  HIS I NE2 1 
ATOM   10779 N N   . GLY I 2 40  ? 36.156  77.283  66.357  1.00 26.12 ? 40  GLY I N   1 
ATOM   10780 C CA  . GLY I 2 40  ? 35.549  78.533  65.891  1.00 18.73 ? 40  GLY I CA  1 
ATOM   10781 C C   . GLY I 2 40  ? 34.885  78.368  64.525  1.00 11.40 ? 40  GLY I C   1 
ATOM   10782 O O   . GLY I 2 40  ? 35.023  77.331  63.875  1.00 12.33 ? 40  GLY I O   1 
ATOM   10783 N N   . PHE I 2 41  ? 34.133  79.358  64.087  1.00 5.00  ? 41  PHE I N   1 
ATOM   10784 C CA  . PHE I 2 41  ? 33.475  79.257  62.797  1.00 7.77  ? 41  PHE I CA  1 
ATOM   10785 C C   . PHE I 2 41  ? 34.388  79.293  61.573  1.00 10.41 ? 41  PHE I C   1 
ATOM   10786 O O   . PHE I 2 41  ? 35.322  80.086  61.504  1.00 13.51 ? 41  PHE I O   1 
ATOM   10787 C CB  . PHE I 2 41  ? 32.426  80.341  62.674  1.00 8.64  ? 41  PHE I CB  1 
ATOM   10788 C CG  . PHE I 2 41  ? 31.159  80.033  63.402  1.00 12.52 ? 41  PHE I CG  1 
ATOM   10789 C CD1 . PHE I 2 41  ? 30.801  80.750  64.534  1.00 15.43 ? 41  PHE I CD1 1 
ATOM   10790 C CD2 . PHE I 2 41  ? 30.309  79.034  62.940  1.00 14.42 ? 41  PHE I CD2 1 
ATOM   10791 C CE1 . PHE I 2 41  ? 29.619  80.479  65.193  1.00 18.27 ? 41  PHE I CE1 1 
ATOM   10792 C CE2 . PHE I 2 41  ? 29.129  78.753  63.590  1.00 16.76 ? 41  PHE I CE2 1 
ATOM   10793 C CZ  . PHE I 2 41  ? 28.779  79.476  64.720  1.00 19.11 ? 41  PHE I CZ  1 
ATOM   10794 N N   . LYS I 2 42  ? 34.096  78.438  60.603  1.00 10.40 ? 42  LYS I N   1 
ATOM   10795 C CA  . LYS I 2 42  ? 34.850  78.348  59.367  1.00 15.30 ? 42  LYS I CA  1 
ATOM   10796 C C   . LYS I 2 42  ? 34.833  79.675  58.599  1.00 19.42 ? 42  LYS I C   1 
ATOM   10797 O O   . LYS I 2 42  ? 33.790  80.294  58.472  1.00 16.26 ? 42  LYS I O   1 
ATOM   10798 C CB  . LYS I 2 42  ? 34.270  77.223  58.515  1.00 17.26 ? 42  LYS I CB  1 
ATOM   10799 C CG  . LYS I 2 42  ? 34.816  77.160  57.099  1.00 23.00 ? 42  LYS I CG  1 
ATOM   10800 C CD  . LYS I 2 42  ? 34.484  75.834  56.443  1.00 25.59 ? 42  LYS I CD  1 
ATOM   10801 C CE  . LYS I 2 42  ? 35.153  74.670  57.162  1.00 27.02 ? 42  LYS I CE  1 
ATOM   10802 N NZ  . LYS I 2 42  ? 36.642  74.676  56.981  1.00 31.99 ? 42  LYS I NZ  1 
ATOM   10803 N N   . LYS I 2 43  ? 35.995  80.113  58.106  1.00 25.90 ? 43  LYS I N   1 
ATOM   10804 C CA  . LYS I 2 43  ? 36.106  81.379  57.365  1.00 28.53 ? 43  LYS I CA  1 
ATOM   10805 C C   . LYS I 2 43  ? 36.395  81.131  55.890  1.00 31.48 ? 43  LYS I C   1 
ATOM   10806 O O   . LYS I 2 43  ? 37.157  80.219  55.546  1.00 33.14 ? 43  LYS I O   1 
ATOM   10807 C CB  . LYS I 2 43  ? 37.226  82.269  57.934  1.00 25.34 ? 43  LYS I CB  1 
ATOM   10808 C CG  . LYS I 2 43  ? 37.091  82.627  59.396  1.00 27.33 ? 43  LYS I CG  1 
ATOM   10809 C CD  . LYS I 2 43  ? 38.016  83.761  59.797  1.00 28.75 ? 43  LYS I CD  1 
ATOM   10810 C CE  . LYS I 2 43  ? 39.477  83.382  59.609  0.00 31.15 ? 43  LYS I CE  1 
ATOM   10811 N NZ  . LYS I 2 43  ? 40.396  84.478  60.023  0.00 32.17 ? 43  LYS I NZ  1 
ATOM   10812 N N   . ASP I 2 44  ? 35.799  81.937  55.016  1.00 32.95 ? 44  ASP I N   1 
ATOM   10813 C CA  . ASP I 2 44  ? 36.056  81.768  53.598  1.00 35.93 ? 44  ASP I CA  1 
ATOM   10814 C C   . ASP I 2 44  ? 37.245  82.639  53.142  1.00 40.47 ? 44  ASP I C   1 
ATOM   10815 O O   . ASP I 2 44  ? 37.784  83.431  53.922  1.00 40.01 ? 44  ASP I O   1 
ATOM   10816 C CB  . ASP I 2 44  ? 34.782  81.959  52.767  1.00 32.86 ? 44  ASP I CB  1 
ATOM   10817 C CG  . ASP I 2 44  ? 34.295  83.373  52.753  1.00 31.56 ? 44  ASP I CG  1 
ATOM   10818 O OD1 . ASP I 2 44  ? 33.858  83.807  51.671  1.00 33.48 ? 44  ASP I OD1 1 
ATOM   10819 O OD2 . ASP I 2 44  ? 34.339  84.045  53.800  1.00 27.93 ? 44  ASP I OD2 1 
ATOM   10820 N N   . ASP I 2 45  ? 37.662  82.470  51.890  1.00 44.40 ? 45  ASP I N   1 
ATOM   10821 C CA  . ASP I 2 45  ? 38.805  83.188  51.338  1.00 46.86 ? 45  ASP I CA  1 
ATOM   10822 C C   . ASP I 2 45  ? 38.765  84.701  51.515  1.00 52.16 ? 45  ASP I C   1 
ATOM   10823 O O   . ASP I 2 45  ? 39.796  85.374  51.480  1.00 53.11 ? 45  ASP I O   1 
ATOM   10824 C CB  . ASP I 2 45  ? 38.966  82.854  49.852  0.00 43.08 ? 45  ASP I CB  1 
ATOM   10825 C CG  . ASP I 2 45  ? 39.203  81.375  49.608  0.00 40.34 ? 45  ASP I CG  1 
ATOM   10826 O OD1 . ASP I 2 45  ? 40.379  80.957  49.584  0.00 39.04 ? 45  ASP I OD1 1 
ATOM   10827 O OD2 . ASP I 2 45  ? 38.213  80.633  49.440  0.00 39.10 ? 45  ASP I OD2 1 
ATOM   10828 N N   . ASN I 2 46  ? 37.575  85.231  51.732  1.00 57.52 ? 46  ASN I N   1 
ATOM   10829 C CA  . ASN I 2 46  ? 37.398  86.668  51.878  1.00 62.09 ? 46  ASN I CA  1 
ATOM   10830 C C   . ASN I 2 46  ? 37.508  87.161  53.328  1.00 59.47 ? 46  ASN I C   1 
ATOM   10831 O O   . ASN I 2 46  ? 37.444  88.365  53.582  1.00 60.20 ? 46  ASN I O   1 
ATOM   10832 C CB  . ASN I 2 46  ? 36.060  87.069  51.232  1.00 70.42 ? 46  ASN I CB  1 
ATOM   10833 C CG  . ASN I 2 46  ? 35.820  86.364  49.876  1.00 79.14 ? 46  ASN I CG  1 
ATOM   10834 O OD1 . ASN I 2 46  ? 35.865  85.126  49.783  1.00 84.05 ? 46  ASN I OD1 1 
ATOM   10835 N ND2 . ASN I 2 46  ? 35.568  87.146  48.831  1.00 82.51 ? 46  ASN I ND2 1 
ATOM   10836 N N   . GLY I 2 47  ? 37.697  86.235  54.269  1.00 56.44 ? 47  GLY I N   1 
ATOM   10837 C CA  . GLY I 2 47  ? 37.821  86.607  55.674  1.00 52.51 ? 47  GLY I CA  1 
ATOM   10838 C C   . GLY I 2 47  ? 36.552  86.447  56.501  1.00 48.40 ? 47  GLY I C   1 
ATOM   10839 O O   . GLY I 2 47  ? 36.598  86.452  57.738  1.00 47.72 ? 47  GLY I O   1 
ATOM   10840 N N   . CYS I 2 48  ? 35.418  86.323  55.819  1.00 44.27 ? 48  CYS I N   1 
ATOM   10841 C CA  . CYS I 2 48  ? 34.135  86.147  56.482  1.00 42.38 ? 48  CYS I CA  1 
ATOM   10842 C C   . CYS I 2 48  ? 34.034  84.757  57.126  1.00 39.94 ? 48  CYS I C   1 
ATOM   10843 O O   . CYS I 2 48  ? 34.672  83.804  56.677  1.00 37.98 ? 48  CYS I O   1 
ATOM   10844 C CB  . CYS I 2 48  ? 33.005  86.297  55.463  1.00 44.72 ? 48  CYS I CB  1 
ATOM   10845 S SG  . CYS I 2 48  ? 32.985  87.862  54.537  1.00 51.52 ? 48  CYS I SG  1 
ATOM   10846 N N   . GLU I 2 49  ? 33.198  84.643  58.150  1.00 38.17 ? 49  GLU I N   1 
ATOM   10847 C CA  . GLU I 2 49  ? 32.992  83.377  58.831  1.00 34.18 ? 49  GLU I CA  1 
ATOM   10848 C C   . GLU I 2 49  ? 31.623  82.867  58.412  1.00 32.63 ? 49  GLU I C   1 
ATOM   10849 O O   . GLU I 2 49  ? 30.669  83.641  58.379  1.00 35.97 ? 49  GLU I O   1 
ATOM   10850 C CB  . GLU I 2 49  ? 32.958  83.591  60.340  1.00 32.09 ? 49  GLU I CB  1 
ATOM   10851 C CG  . GLU I 2 49  ? 33.834  84.699  60.870  1.00 31.03 ? 49  GLU I CG  1 
ATOM   10852 C CD  . GLU I 2 49  ? 33.985  84.606  62.372  1.00 34.33 ? 49  GLU I CD  1 
ATOM   10853 O OE1 . GLU I 2 49  ? 33.691  85.612  63.063  1.00 37.14 ? 49  GLU I OE1 1 
ATOM   10854 O OE2 . GLU I 2 49  ? 34.389  83.516  62.861  1.00 32.51 ? 49  GLU I OE2 1 
ATOM   10855 N N   . TYR I 2 50  ? 31.515  81.581  58.113  1.00 29.24 ? 50  TYR I N   1 
ATOM   10856 C CA  . TYR I 2 50  ? 30.241  80.973  57.748  1.00 29.46 ? 50  TYR I CA  1 
ATOM   10857 C C   . TYR I 2 50  ? 29.312  80.983  58.982  1.00 31.88 ? 50  TYR I C   1 
ATOM   10858 O O   . TYR I 2 50  ? 29.702  80.515  60.066  1.00 34.30 ? 50  TYR I O   1 
ATOM   10859 C CB  . TYR I 2 50  ? 30.446  79.516  57.306  1.00 29.31 ? 50  TYR I CB  1 
ATOM   10860 C CG  . TYR I 2 50  ? 31.137  79.329  55.969  1.00 27.50 ? 50  TYR I CG  1 
ATOM   10861 C CD1 . TYR I 2 50  ? 32.516  79.151  55.890  1.00 25.23 ? 50  TYR I CD1 1 
ATOM   10862 C CD2 . TYR I 2 50  ? 30.406  79.343  54.782  1.00 25.96 ? 50  TYR I CD2 1 
ATOM   10863 C CE1 . TYR I 2 50  ? 33.141  79.002  54.671  1.00 25.35 ? 50  TYR I CE1 1 
ATOM   10864 C CE2 . TYR I 2 50  ? 31.021  79.195  53.557  1.00 23.77 ? 50  TYR I CE2 1 
ATOM   10865 C CZ  . TYR I 2 50  ? 32.382  79.029  53.507  1.00 25.63 ? 50  TYR I CZ  1 
ATOM   10866 O OH  . TYR I 2 50  ? 32.990  78.904  52.287  1.00 27.98 ? 50  TYR I OH  1 
ATOM   10867 N N   . ALA I 2 51  ? 28.078  81.471  58.806  1.00 29.62 ? 51  ALA I N   1 
ATOM   10868 C CA  . ALA I 2 51  ? 27.089  81.544  59.885  1.00 21.92 ? 51  ALA I CA  1 
ATOM   10869 C C   . ALA I 2 51  ? 27.027  80.316  60.794  1.00 17.55 ? 51  ALA I C   1 
ATOM   10870 O O   . ALA I 2 51  ? 27.158  80.447  62.013  1.00 14.18 ? 51  ALA I O   1 
ATOM   10871 C CB  . ALA I 2 51  ? 25.725  81.847  59.325  1.00 19.73 ? 51  ALA I CB  1 
ATOM   10872 N N   . CYS I 2 52  ? 26.860  79.133  60.210  1.00 14.02 ? 52  CYS I N   1 
ATOM   10873 C CA  . CYS I 2 52  ? 26.769  77.932  61.010  1.00 13.55 ? 52  CYS I CA  1 
ATOM   10874 C C   . CYS I 2 52  ? 27.629  76.780  60.524  1.00 15.34 ? 52  CYS I C   1 
ATOM   10875 O O   . CYS I 2 52  ? 27.108  75.696  60.242  1.00 17.10 ? 52  CYS I O   1 
ATOM   10876 C CB  . CYS I 2 52  ? 25.318  77.484  61.103  1.00 12.59 ? 52  CYS I CB  1 
ATOM   10877 S SG  . CYS I 2 52  ? 25.013  76.510  62.609  1.00 12.16 ? 52  CYS I SG  1 
ATOM   10878 N N   . ILE I 2 53  ? 28.940  77.014  60.415  1.00 14.41 ? 53  ILE I N   1 
ATOM   10879 C CA  . ILE I 2 53  ? 29.883  75.980  59.968  1.00 10.20 ? 53  ILE I CA  1 
ATOM   10880 C C   . ILE I 2 53  ? 31.168  76.129  60.756  1.00 10.35 ? 53  ILE I C   1 
ATOM   10881 O O   . ILE I 2 53  ? 31.727  77.211  60.795  1.00 13.32 ? 53  ILE I O   1 
ATOM   10882 C CB  . ILE I 2 53  ? 30.225  76.127  58.485  1.00 5.00  ? 53  ILE I CB  1 
ATOM   10883 C CG1 . ILE I 2 53  ? 28.958  76.035  57.651  1.00 5.00  ? 53  ILE I CG1 1 
ATOM   10884 C CG2 . ILE I 2 53  ? 31.211  75.065  58.083  1.00 5.00  ? 53  ILE I CG2 1 
ATOM   10885 C CD1 . ILE I 2 53  ? 29.210  75.838  56.209  1.00 7.39  ? 53  ILE I CD1 1 
ATOM   10886 N N   . CYS I 2 54  ? 31.644  75.054  61.371  1.00 11.26 ? 54  CYS I N   1 
ATOM   10887 C CA  . CYS I 2 54  ? 32.868  75.132  62.156  1.00 14.94 ? 54  CYS I CA  1 
ATOM   10888 C C   . CYS I 2 54  ? 34.150  74.856  61.376  1.00 16.60 ? 54  CYS I C   1 
ATOM   10889 O O   . CYS I 2 54  ? 34.177  74.075  60.424  1.00 15.56 ? 54  CYS I O   1 
ATOM   10890 C CB  . CYS I 2 54  ? 32.845  74.164  63.349  1.00 15.07 ? 54  CYS I CB  1 
ATOM   10891 S SG  . CYS I 2 54  ? 31.522  74.328  64.598  1.00 14.21 ? 54  CYS I SG  1 
ATOM   10892 N N   . ALA I 2 55  ? 35.223  75.466  61.860  1.00 17.30 ? 55  ALA I N   1 
ATOM   10893 C CA  . ALA I 2 55  ? 36.559  75.326  61.319  1.00 19.74 ? 55  ALA I CA  1 
ATOM   10894 C C   . ALA I 2 55  ? 37.117  73.970  61.697  1.00 22.66 ? 55  ALA I C   1 
ATOM   10895 O O   . ALA I 2 55  ? 37.026  73.591  62.861  1.00 26.06 ? 55  ALA I O   1 
ATOM   10896 C CB  . ALA I 2 55  ? 37.443  76.391  61.920  1.00 21.30 ? 55  ALA I CB  1 
ATOM   10897 N N   . ASP I 2 56  ? 37.781  73.299  60.749  1.00 26.39 ? 56  ASP I N   1 
ATOM   10898 C CA  . ASP I 2 56  ? 38.379  71.964  60.976  1.00 27.71 ? 56  ASP I CA  1 
ATOM   10899 C C   . ASP I 2 56  ? 39.617  72.047  61.872  1.00 23.40 ? 56  ASP I C   1 
ATOM   10900 O O   . ASP I 2 56  ? 39.942  71.084  62.563  1.00 23.85 ? 56  ASP I O   1 
ATOM   10901 C CB  . ASP I 2 56  ? 38.840  71.279  59.657  1.00 33.20 ? 56  ASP I CB  1 
ATOM   10902 C CG  . ASP I 2 56  ? 37.739  71.156  58.589  1.00 39.84 ? 56  ASP I CG  1 
ATOM   10903 O OD1 . ASP I 2 56  ? 36.559  70.908  58.927  1.00 43.87 ? 56  ASP I OD1 1 
ATOM   10904 O OD2 . ASP I 2 56  ? 38.081  71.272  57.387  1.00 41.84 ? 56  ASP I OD2 1 
ATOM   10905 N N   . ALA I 2 57  ? 40.303  73.190  61.855  1.00 18.96 ? 57  ALA I N   1 
ATOM   10906 C CA  . ALA I 2 57  ? 41.523  73.370  62.634  1.00 14.90 ? 57  ALA I CA  1 
ATOM   10907 C C   . ALA I 2 57  ? 41.705  74.838  62.980  1.00 14.88 ? 57  ALA I C   1 
ATOM   10908 O O   . ALA I 2 57  ? 41.106  75.698  62.341  1.00 16.84 ? 57  ALA I O   1 
ATOM   10909 C CB  . ALA I 2 57  ? 42.693  72.876  61.844  1.00 17.36 ? 57  ALA I CB  1 
ATOM   10910 N N   . PRO I 2 58  ? 42.522  75.145  64.004  1.00 13.81 ? 58  PRO I N   1 
ATOM   10911 C CA  . PRO I 2 58  ? 42.773  76.523  64.435  1.00 16.47 ? 58  PRO I CA  1 
ATOM   10912 C C   . PRO I 2 58  ? 43.323  77.331  63.292  1.00 25.33 ? 58  PRO I C   1 
ATOM   10913 O O   . PRO I 2 58  ? 44.173  76.840  62.551  1.00 28.52 ? 58  PRO I O   1 
ATOM   10914 C CB  . PRO I 2 58  ? 43.853  76.364  65.492  1.00 10.78 ? 58  PRO I CB  1 
ATOM   10915 C CG  . PRO I 2 58  ? 43.632  75.047  66.005  1.00 11.40 ? 58  PRO I CG  1 
ATOM   10916 C CD  . PRO I 2 58  ? 43.358  74.225  64.781  1.00 13.02 ? 58  PRO I CD  1 
ATOM   10917 N N   . GLN I 2 59  ? 42.869  78.577  63.181  1.00 31.82 ? 59  GLN I N   1 
ATOM   10918 C CA  . GLN I 2 59  ? 43.296  79.485  62.119  1.00 35.76 ? 59  GLN I CA  1 
ATOM   10919 C C   . GLN I 2 59  ? 44.686  80.052  62.365  1.00 40.04 ? 59  GLN I C   1 
ATOM   10920 O O   . GLN I 2 59  ? 45.239  80.714  61.448  1.00 41.03 ? 59  GLN I O   1 
ATOM   10921 C CB  . GLN I 2 59  ? 42.297  80.637  61.962  0.00 35.00 ? 59  GLN I CB  1 
ATOM   10922 C CG  . GLN I 2 59  ? 42.195  81.544  63.180  0.00 35.27 ? 59  GLN I CG  1 
ATOM   10923 C CD  . GLN I 2 59  ? 41.575  82.887  62.854  0.00 35.78 ? 59  GLN I CD  1 
ATOM   10924 O OE1 . GLN I 2 59  ? 40.439  83.169  63.230  0.00 35.86 ? 59  GLN I OE1 1 
ATOM   10925 N NE2 . GLN I 2 59  ? 42.323  83.726  62.152  0.00 35.86 ? 59  GLN I NE2 1 
ATOM   10926 O OXT . GLN I 2 59  ? 45.213  79.793  63.463  1.00 44.96 ? 59  GLN I OXT 1 
ATOM   10927 N N   . THR J 2 7   ? 71.018  68.674  89.233  1.00 54.99 ? 7   THR J N   1 
ATOM   10928 C CA  . THR J 2 7   ? 71.170  67.234  89.619  1.00 58.27 ? 7   THR J CA  1 
ATOM   10929 C C   . THR J 2 7   ? 69.956  66.430  89.116  1.00 53.16 ? 7   THR J C   1 
ATOM   10930 O O   . THR J 2 7   ? 68.825  66.771  89.472  1.00 59.28 ? 7   THR J O   1 
ATOM   10931 C CB  . THR J 2 7   ? 71.244  67.115  91.139  0.00 63.58 ? 7   THR J CB  1 
ATOM   10932 O OG1 . THR J 2 7   ? 71.943  68.256  91.651  0.00 66.27 ? 7   THR J OG1 1 
ATOM   10933 C CG2 . THR J 2 7   ? 71.971  65.841  91.545  0.00 66.26 ? 7   THR J CG2 1 
ATOM   10934 N N   . THR J 2 8   ? 70.182  65.355  88.349  1.00 45.31 ? 8   THR J N   1 
ATOM   10935 C CA  . THR J 2 8   ? 69.092  64.548  87.778  1.00 38.80 ? 8   THR J CA  1 
ATOM   10936 C C   . THR J 2 8   ? 69.622  63.389  86.922  1.00 36.08 ? 8   THR J C   1 
ATOM   10937 O O   . THR J 2 8   ? 70.565  63.572  86.157  1.00 36.75 ? 8   THR J O   1 
ATOM   10938 C CB  . THR J 2 8   ? 68.210  65.420  86.804  1.00 41.80 ? 8   THR J CB  1 
ATOM   10939 O OG1 . THR J 2 8   ? 68.886  66.657  86.477  1.00 38.95 ? 8   THR J OG1 1 
ATOM   10940 C CG2 . THR J 2 8   ? 66.805  65.694  87.393  1.00 41.40 ? 8   THR J CG2 1 
ATOM   10941 N N   . PRO J 2 9   ? 69.062  62.171  87.065  1.00 34.82 ? 9   PRO J N   1 
ATOM   10942 C CA  . PRO J 2 9   ? 69.574  61.078  86.220  1.00 31.71 ? 9   PRO J CA  1 
ATOM   10943 C C   . PRO J 2 9   ? 69.260  61.398  84.770  1.00 30.69 ? 9   PRO J C   1 
ATOM   10944 O O   . PRO J 2 9   ? 68.183  61.902  84.452  1.00 31.72 ? 9   PRO J O   1 
ATOM   10945 C CB  . PRO J 2 9   ? 68.819  59.857  86.720  1.00 29.39 ? 9   PRO J CB  1 
ATOM   10946 C CG  . PRO J 2 9   ? 68.689  60.144  88.178  1.00 31.53 ? 9   PRO J CG  1 
ATOM   10947 C CD  . PRO J 2 9   ? 68.290  61.627  88.197  1.00 36.44 ? 9   PRO J CD  1 
ATOM   10948 N N   . CYS J 2 10  ? 70.201  61.106  83.890  1.00 28.49 ? 10  CYS J N   1 
ATOM   10949 C CA  . CYS J 2 10  ? 70.020  61.451  82.502  1.00 27.62 ? 10  CYS J CA  1 
ATOM   10950 C C   . CYS J 2 10  ? 70.668  60.497  81.525  1.00 26.72 ? 10  CYS J C   1 
ATOM   10951 O O   . CYS J 2 10  ? 71.880  60.362  81.479  1.00 28.73 ? 10  CYS J O   1 
ATOM   10952 C CB  . CYS J 2 10  ? 70.566  62.847  82.285  1.00 28.00 ? 10  CYS J CB  1 
ATOM   10953 S SG  . CYS J 2 10  ? 70.342  63.421  80.589  1.00 28.37 ? 10  CYS J SG  1 
ATOM   10954 N N   . GLY J 2 11  ? 69.859  59.879  80.690  1.00 26.54 ? 11  GLY J N   1 
ATOM   10955 C CA  . GLY J 2 11  ? 70.407  58.953  79.730  1.00 26.31 ? 11  GLY J CA  1 
ATOM   10956 C C   . GLY J 2 11  ? 71.313  57.951  80.416  1.00 29.85 ? 11  GLY J C   1 
ATOM   10957 O O   . GLY J 2 11  ? 70.956  57.384  81.462  1.00 30.72 ? 11  GLY J O   1 
ATOM   10958 N N   . PRO J 2 12  ? 72.508  57.716  79.851  1.00 31.19 ? 12  PRO J N   1 
ATOM   10959 C CA  . PRO J 2 12  ? 73.484  56.769  80.408  1.00 32.27 ? 12  PRO J CA  1 
ATOM   10960 C C   . PRO J 2 12  ? 74.328  57.387  81.532  1.00 32.88 ? 12  PRO J C   1 
ATOM   10961 O O   . PRO J 2 12  ? 75.122  56.711  82.194  1.00 33.03 ? 12  PRO J O   1 
ATOM   10962 C CB  . PRO J 2 12  ? 74.323  56.408  79.185  1.00 29.71 ? 12  PRO J CB  1 
ATOM   10963 C CG  . PRO J 2 12  ? 74.366  57.705  78.453  1.00 29.97 ? 12  PRO J CG  1 
ATOM   10964 C CD  . PRO J 2 12  ? 72.949  58.211  78.536  1.00 30.79 ? 12  PRO J CD  1 
ATOM   10965 N N   . VAL J 2 13  ? 74.090  58.658  81.791  1.00 32.65 ? 13  VAL J N   1 
ATOM   10966 C CA  . VAL J 2 13  ? 74.832  59.371  82.801  1.00 35.38 ? 13  VAL J CA  1 
ATOM   10967 C C   . VAL J 2 13  ? 73.904  59.959  83.894  1.00 35.32 ? 13  VAL J C   1 
ATOM   10968 O O   . VAL J 2 13  ? 72.693  59.755  83.848  1.00 39.70 ? 13  VAL J O   1 
ATOM   10969 C CB  . VAL J 2 13  ? 75.709  60.429  82.074  1.00 36.84 ? 13  VAL J CB  1 
ATOM   10970 C CG1 . VAL J 2 13  ? 76.749  59.716  81.222  1.00 37.63 ? 13  VAL J CG1 1 
ATOM   10971 C CG2 . VAL J 2 13  ? 74.867  61.264  81.131  1.00 37.60 ? 13  VAL J CG2 1 
ATOM   10972 N N   . THR J 2 14  ? 74.462  60.613  84.908  1.00 32.47 ? 14  THR J N   1 
ATOM   10973 C CA  . THR J 2 14  ? 73.660  61.205  85.972  1.00 34.81 ? 14  THR J CA  1 
ATOM   10974 C C   . THR J 2 14  ? 74.167  62.623  86.282  1.00 39.06 ? 14  THR J C   1 
ATOM   10975 O O   . THR J 2 14  ? 75.315  62.779  86.696  1.00 43.84 ? 14  THR J O   1 
ATOM   10976 C CB  . THR J 2 14  ? 73.730  60.353  87.262  0.00 34.86 ? 14  THR J CB  1 
ATOM   10977 O OG1 . THR J 2 14  ? 75.096  60.013  87.541  0.00 34.20 ? 14  THR J OG1 1 
ATOM   10978 C CG2 . THR J 2 14  ? 72.911  59.078  87.113  0.00 34.19 ? 14  THR J CG2 1 
ATOM   10979 N N   . CYS J 2 15  ? 73.351  63.656  86.069  1.00 37.54 ? 15  CYS J N   1 
ATOM   10980 C CA  . CYS J 2 15  ? 73.802  65.015  86.366  1.00 35.14 ? 15  CYS J CA  1 
ATOM   10981 C C   . CYS J 2 15  ? 73.881  65.249  87.858  1.00 35.44 ? 15  CYS J C   1 
ATOM   10982 O O   . CYS J 2 15  ? 72.982  64.863  88.607  1.00 37.54 ? 15  CYS J O   1 
ATOM   10983 C CB  . CYS J 2 15  ? 72.875  66.048  85.752  1.00 32.03 ? 15  CYS J CB  1 
ATOM   10984 S SG  . CYS J 2 15  ? 72.552  65.649  84.023  1.00 32.44 ? 15  CYS J SG  1 
ATOM   10985 N N   . SER J 2 16  ? 74.979  65.850  88.292  1.00 35.32 ? 16  SER J N   1 
ATOM   10986 C CA  . SER J 2 16  ? 75.156  66.149  89.699  1.00 34.39 ? 16  SER J CA  1 
ATOM   10987 C C   . SER J 2 16  ? 75.076  67.657  89.860  1.00 31.40 ? 16  SER J C   1 
ATOM   10988 O O   . SER J 2 16  ? 74.940  68.389  88.871  1.00 26.85 ? 16  SER J O   1 
ATOM   10989 C CB  . SER J 2 16  ? 76.484  65.584  90.244  1.00 38.48 ? 16  SER J CB  1 
ATOM   10990 O OG  . SER J 2 16  ? 77.613  66.373  89.901  1.00 42.14 ? 16  SER J OG  1 
ATOM   10991 N N   . GLY J 2 17  ? 75.026  68.083  91.118  1.00 32.35 ? 17  GLY J N   1 
ATOM   10992 C CA  . GLY J 2 17  ? 74.967  69.490  91.489  1.00 32.34 ? 17  GLY J CA  1 
ATOM   10993 C C   . GLY J 2 17  ? 74.384  70.510  90.529  1.00 29.66 ? 17  GLY J C   1 
ATOM   10994 O O   . GLY J 2 17  ? 73.161  70.572  90.337  1.00 31.71 ? 17  GLY J O   1 
ATOM   10995 N N   . ALA J 2 18  ? 75.278  71.268  89.895  1.00 25.93 ? 18  ALA J N   1 
ATOM   10996 C CA  . ALA J 2 18  ? 74.923  72.330  88.962  1.00 24.49 ? 18  ALA J CA  1 
ATOM   10997 C C   . ALA J 2 18  ? 74.712  71.944  87.496  1.00 23.16 ? 18  ALA J C   1 
ATOM   10998 O O   . ALA J 2 18  ? 74.660  72.832  86.636  1.00 26.65 ? 18  ALA J O   1 
ATOM   10999 C CB  . ALA J 2 18  ? 75.963  73.432  89.051  1.00 26.12 ? 18  ALA J CB  1 
ATOM   11000 N N   . GLN J 2 19  ? 74.605  70.652  87.197  1.00 19.82 ? 19  GLN J N   1 
ATOM   11001 C CA  . GLN J 2 19  ? 74.412  70.220  85.817  1.00 17.86 ? 19  GLN J CA  1 
ATOM   11002 C C   . GLN J 2 19  ? 72.968  70.036  85.427  1.00 20.82 ? 19  GLN J C   1 
ATOM   11003 O O   . GLN J 2 19  ? 72.177  69.465  86.186  1.00 25.01 ? 19  GLN J O   1 
ATOM   11004 C CB  . GLN J 2 19  ? 75.113  68.900  85.548  1.00 13.83 ? 19  GLN J CB  1 
ATOM   11005 C CG  . GLN J 2 19  ? 76.597  68.908  85.710  1.00 10.33 ? 19  GLN J CG  1 
ATOM   11006 C CD  . GLN J 2 19  ? 77.184  67.552  85.416  1.00 9.94  ? 19  GLN J CD  1 
ATOM   11007 O OE1 . GLN J 2 19  ? 77.017  66.618  86.183  1.00 9.77  ? 19  GLN J OE1 1 
ATOM   11008 N NE2 . GLN J 2 19  ? 77.839  67.424  84.279  1.00 12.63 ? 19  GLN J NE2 1 
ATOM   11009 N N   . MET J 2 20  ? 72.660  70.459  84.209  1.00 21.33 ? 20  MET J N   1 
ATOM   11010 C CA  . MET J 2 20  ? 71.339  70.336  83.623  1.00 21.08 ? 20  MET J CA  1 
ATOM   11011 C C   . MET J 2 20  ? 71.498  69.196  82.619  1.00 23.37 ? 20  MET J C   1 
ATOM   11012 O O   . MET J 2 20  ? 72.537  69.085  81.970  1.00 27.03 ? 20  MET J O   1 
ATOM   11013 C CB  . MET J 2 20  ? 70.952  71.631  82.904  0.00 19.37 ? 20  MET J CB  1 
ATOM   11014 C CG  . MET J 2 20  ? 69.569  71.610  82.274  0.00 17.45 ? 20  MET J CG  1 
ATOM   11015 S SD  . MET J 2 20  ? 69.153  73.168  81.470  0.00 16.57 ? 20  MET J SD  1 
ATOM   11016 C CE  . MET J 2 20  ? 69.880  72.920  79.852  0.00 15.86 ? 20  MET J CE  1 
ATOM   11017 N N   . CYS J 2 21  ? 70.504  68.322  82.522  1.00 23.67 ? 21  CYS J N   1 
ATOM   11018 C CA  . CYS J 2 21  ? 70.575  67.205  81.590  1.00 23.02 ? 21  CYS J CA  1 
ATOM   11019 C C   . CYS J 2 21  ? 70.003  67.520  80.222  1.00 20.06 ? 21  CYS J C   1 
ATOM   11020 O O   . CYS J 2 21  ? 68.905  68.042  80.114  1.00 19.56 ? 21  CYS J O   1 
ATOM   11021 C CB  . CYS J 2 21  ? 69.863  65.987  82.153  1.00 24.93 ? 21  CYS J CB  1 
ATOM   11022 S SG  . CYS J 2 21  ? 69.108  65.001  80.833  1.00 30.50 ? 21  CYS J SG  1 
ATOM   11023 N N   . GLU J 2 22  ? 70.766  67.210  79.183  1.00 20.07 ? 22  GLU J N   1 
ATOM   11024 C CA  . GLU J 2 22  ? 70.340  67.427  77.819  1.00 20.52 ? 22  GLU J CA  1 
ATOM   11025 C C   . GLU J 2 22  ? 70.249  66.085  77.099  1.00 21.20 ? 22  GLU J C   1 
ATOM   11026 O O   . GLU J 2 22  ? 71.249  65.540  76.603  1.00 17.30 ? 22  GLU J O   1 
ATOM   11027 C CB  . GLU J 2 22  ? 71.272  68.387  77.114  1.00 21.71 ? 22  GLU J CB  1 
ATOM   11028 C CG  . GLU J 2 22  ? 71.141  69.784  77.642  1.00 27.95 ? 22  GLU J CG  1 
ATOM   11029 C CD  . GLU J 2 22  ? 72.167  70.739  77.060  1.00 36.24 ? 22  GLU J CD  1 
ATOM   11030 O OE1 . GLU J 2 22  ? 71.890  71.968  77.012  1.00 38.32 ? 22  GLU J OE1 1 
ATOM   11031 O OE2 . GLU J 2 22  ? 73.257  70.262  76.659  1.00 39.58 ? 22  GLU J OE2 1 
ATOM   11032 N N   . VAL J 2 23  ? 69.026  65.547  77.105  1.00 20.86 ? 23  VAL J N   1 
ATOM   11033 C CA  . VAL J 2 23  ? 68.666  64.273  76.496  1.00 19.17 ? 23  VAL J CA  1 
ATOM   11034 C C   . VAL J 2 23  ? 69.467  63.115  77.098  1.00 21.09 ? 23  VAL J C   1 
ATOM   11035 O O   . VAL J 2 23  ? 68.930  62.357  77.923  1.00 19.38 ? 23  VAL J O   1 
ATOM   11036 C CB  . VAL J 2 23  ? 68.828  64.286  74.967  0.00 18.93 ? 23  VAL J CB  1 
ATOM   11037 C CG1 . VAL J 2 23  ? 68.314  62.984  74.401  0.00 18.55 ? 23  VAL J CG1 1 
ATOM   11038 C CG2 . VAL J 2 23  ? 68.067  65.459  74.361  0.00 18.54 ? 23  VAL J CG2 1 
ATOM   11039 N N   . ASP J 2 24  ? 70.747  63.000  76.708  1.00 20.38 ? 24  ASP J N   1 
ATOM   11040 C CA  . ASP J 2 24  ? 71.643  61.932  77.187  1.00 17.53 ? 24  ASP J CA  1 
ATOM   11041 C C   . ASP J 2 24  ? 72.966  62.399  77.796  1.00 16.98 ? 24  ASP J C   1 
ATOM   11042 O O   . ASP J 2 24  ? 73.778  61.575  78.228  1.00 17.21 ? 24  ASP J O   1 
ATOM   11043 C CB  . ASP J 2 24  ? 71.934  60.905  76.076  1.00 13.82 ? 24  ASP J CB  1 
ATOM   11044 C CG  . ASP J 2 24  ? 72.185  61.543  74.691  1.00 14.22 ? 24  ASP J CG  1 
ATOM   11045 O OD1 . ASP J 2 24  ? 72.089  60.757  73.709  1.00 17.64 ? 24  ASP J OD1 1 
ATOM   11046 O OD2 . ASP J 2 24  ? 72.464  62.777  74.561  1.00 5.00  ? 24  ASP J OD2 1 
ATOM   11047 N N   . LYS J 2 25  ? 73.160  63.714  77.864  1.00 16.18 ? 25  LYS J N   1 
ATOM   11048 C CA  . LYS J 2 25  ? 74.386  64.302  78.397  1.00 13.75 ? 25  LYS J CA  1 
ATOM   11049 C C   . LYS J 2 25  ? 74.100  65.356  79.456  1.00 12.72 ? 25  LYS J C   1 
ATOM   11050 O O   . LYS J 2 25  ? 73.153  66.108  79.338  1.00 11.67 ? 25  LYS J O   1 
ATOM   11051 C CB  . LYS J 2 25  ? 75.159  64.983  77.257  1.00 13.94 ? 25  LYS J CB  1 
ATOM   11052 C CG  . LYS J 2 25  ? 74.501  66.287  76.751  1.00 15.48 ? 25  LYS J CG  1 
ATOM   11053 C CD  . LYS J 2 25  ? 75.161  66.851  75.500  1.00 16.12 ? 25  LYS J CD  1 
ATOM   11054 C CE  . LYS J 2 25  ? 75.022  65.882  74.340  1.00 18.50 ? 25  LYS J CE  1 
ATOM   11055 N NZ  . LYS J 2 25  ? 73.595  65.527  74.058  1.00 22.15 ? 25  LYS J NZ  1 
ATOM   11056 N N   . CYS J 2 26  ? 74.961  65.448  80.456  1.00 14.01 ? 26  CYS J N   1 
ATOM   11057 C CA  . CYS J 2 26  ? 74.824  66.455  81.502  1.00 15.46 ? 26  CYS J CA  1 
ATOM   11058 C C   . CYS J 2 26  ? 75.727  67.662  81.196  1.00 15.68 ? 26  CYS J C   1 
ATOM   11059 O O   . CYS J 2 26  ? 76.944  67.505  81.123  1.00 19.51 ? 26  CYS J O   1 
ATOM   11060 C CB  . CYS J 2 26  ? 75.264  65.872  82.841  1.00 17.16 ? 26  CYS J CB  1 
ATOM   11061 S SG  . CYS J 2 26  ? 74.187  64.584  83.519  1.00 18.34 ? 26  CYS J SG  1 
ATOM   11062 N N   . VAL J 2 27  ? 75.162  68.858  81.047  1.00 11.58 ? 27  VAL J N   1 
ATOM   11063 C CA  . VAL J 2 27  ? 75.974  70.042  80.764  1.00 10.43 ? 27  VAL J CA  1 
ATOM   11064 C C   . VAL J 2 27  ? 75.703  71.165  81.745  1.00 11.84 ? 27  VAL J C   1 
ATOM   11065 O O   . VAL J 2 27  ? 74.755  71.099  82.501  1.00 13.16 ? 27  VAL J O   1 
ATOM   11066 C CB  . VAL J 2 27  ? 75.709  70.603  79.376  1.00 9.04  ? 27  VAL J CB  1 
ATOM   11067 C CG1 . VAL J 2 27  ? 75.680  69.494  78.352  1.00 10.68 ? 27  VAL J CG1 1 
ATOM   11068 C CG2 . VAL J 2 27  ? 74.442  71.417  79.381  1.00 5.04  ? 27  VAL J CG2 1 
ATOM   11069 N N   . CYS J 2 28  ? 76.559  72.182  81.749  1.00 13.75 ? 28  CYS J N   1 
ATOM   11070 C CA  . CYS J 2 28  ? 76.382  73.338  82.627  1.00 14.67 ? 28  CYS J CA  1 
ATOM   11071 C C   . CYS J 2 28  ? 75.427  74.284  81.942  1.00 15.01 ? 28  CYS J C   1 
ATOM   11072 O O   . CYS J 2 28  ? 75.186  74.154  80.745  1.00 15.83 ? 28  CYS J O   1 
ATOM   11073 C CB  . CYS J 2 28  ? 77.668  74.138  82.788  1.00 13.33 ? 28  CYS J CB  1 
ATOM   11074 S SG  . CYS J 2 28  ? 79.115  73.273  83.406  1.00 7.91  ? 28  CYS J SG  1 
ATOM   11075 N N   . SER J 2 29  ? 74.971  75.298  82.670  1.00 14.61 ? 29  SER J N   1 
ATOM   11076 C CA  . SER J 2 29  ? 74.068  76.285  82.095  1.00 17.48 ? 29  SER J CA  1 
ATOM   11077 C C   . SER J 2 29  ? 74.620  77.649  82.366  1.00 21.57 ? 29  SER J C   1 
ATOM   11078 O O   . SER J 2 29  ? 75.471  77.801  83.232  1.00 23.41 ? 29  SER J O   1 
ATOM   11079 C CB  . SER J 2 29  ? 72.674  76.209  82.713  1.00 16.12 ? 29  SER J CB  1 
ATOM   11080 O OG  . SER J 2 29  ? 71.779  77.106  82.076  0.00 15.46 ? 29  SER J OG  1 
ATOM   11081 N N   . ASP J 2 30  ? 74.153  78.628  81.597  1.00 26.01 ? 30  ASP J N   1 
ATOM   11082 C CA  . ASP J 2 30  ? 74.550  80.034  81.752  1.00 27.58 ? 30  ASP J CA  1 
ATOM   11083 C C   . ASP J 2 30  ? 73.424  80.753  82.535  1.00 26.87 ? 30  ASP J C   1 
ATOM   11084 O O   . ASP J 2 30  ? 73.514  81.950  82.846  1.00 24.51 ? 30  ASP J O   1 
ATOM   11085 C CB  . ASP J 2 30  ? 74.727  80.692  80.381  0.00 27.91 ? 30  ASP J CB  1 
ATOM   11086 C CG  . ASP J 2 30  ? 75.795  80.019  79.542  0.00 31.07 ? 30  ASP J CG  1 
ATOM   11087 O OD1 . ASP J 2 30  ? 75.461  79.074  78.796  0.00 33.82 ? 30  ASP J OD1 1 
ATOM   11088 O OD2 . ASP J 2 30  ? 76.970  80.435  79.627  0.00 33.79 ? 30  ASP J OD2 1 
ATOM   11089 N N   . LEU J 2 31  ? 72.370  79.998  82.843  1.00 24.39 ? 31  LEU J N   1 
ATOM   11090 C CA  . LEU J 2 31  ? 71.216  80.494  83.580  1.00 21.02 ? 31  LEU J CA  1 
ATOM   11091 C C   . LEU J 2 31  ? 71.611  80.909  84.989  1.00 20.45 ? 31  LEU J C   1 
ATOM   11092 O O   . LEU J 2 31  ? 72.171  80.114  85.756  1.00 19.54 ? 31  LEU J O   1 
ATOM   11093 C CB  . LEU J 2 31  ? 70.128  79.412  83.632  1.00 17.12 ? 31  LEU J CB  1 
ATOM   11094 C CG  . LEU J 2 31  ? 68.754  79.946  83.260  1.00 9.83  ? 31  LEU J CG  1 
ATOM   11095 C CD1 . LEU J 2 31  ? 67.817  78.843  82.912  1.00 5.00  ? 31  LEU J CD1 1 
ATOM   11096 C CD2 . LEU J 2 31  ? 68.272  80.760  84.417  1.00 8.60  ? 31  LEU J CD2 1 
ATOM   11097 N N   . HIS J 2 32  ? 71.321  82.160  85.316  1.00 20.76 ? 32  HIS J N   1 
ATOM   11098 C CA  . HIS J 2 32  ? 71.641  82.712  86.626  1.00 21.26 ? 32  HIS J CA  1 
ATOM   11099 C C   . HIS J 2 32  ? 70.671  83.791  87.021  1.00 22.21 ? 32  HIS J C   1 
ATOM   11100 O O   . HIS J 2 32  ? 70.143  84.510  86.163  1.00 26.12 ? 32  HIS J O   1 
ATOM   11101 C CB  . HIS J 2 32  ? 72.985  83.411  86.600  1.00 23.43 ? 32  HIS J CB  1 
ATOM   11102 C CG  . HIS J 2 32  ? 74.148  82.493  86.686  1.00 24.95 ? 32  HIS J CG  1 
ATOM   11103 N ND1 . HIS J 2 32  ? 74.983  82.254  85.617  1.00 23.25 ? 32  HIS J ND1 1 
ATOM   11104 C CD2 . HIS J 2 32  ? 74.638  81.778  87.724  1.00 26.22 ? 32  HIS J CD2 1 
ATOM   11105 C CE1 . HIS J 2 32  ? 75.942  81.434  85.998  1.00 27.51 ? 32  HIS J CE1 1 
ATOM   11106 N NE2 . HIS J 2 32  ? 75.755  81.132  87.271  1.00 28.51 ? 32  HIS J NE2 1 
ATOM   11107 N N   . CYS J 2 33  ? 70.475  83.948  88.323  1.00 18.58 ? 33  CYS J N   1 
ATOM   11108 C CA  . CYS J 2 33  ? 69.608  85.003  88.813  1.00 16.12 ? 33  CYS J CA  1 
ATOM   11109 C C   . CYS J 2 33  ? 70.553  86.188  88.727  1.00 16.26 ? 33  CYS J C   1 
ATOM   11110 O O   . CYS J 2 33  ? 71.760  85.994  88.617  1.00 21.95 ? 33  CYS J O   1 
ATOM   11111 C CB  . CYS J 2 33  ? 69.255  84.751  90.258  1.00 17.51 ? 33  CYS J CB  1 
ATOM   11112 S SG  . CYS J 2 33  ? 70.754  84.554  91.258  1.00 20.89 ? 33  CYS J SG  1 
ATOM   11113 N N   . LYS J 2 34  ? 70.049  87.410  88.805  1.00 13.95 ? 34  LYS J N   1 
ATOM   11114 C CA  . LYS J 2 34  ? 70.941  88.560  88.696  1.00 9.01  ? 34  LYS J CA  1 
ATOM   11115 C C   . LYS J 2 34  ? 71.429  89.239  89.969  1.00 7.74  ? 34  LYS J C   1 
ATOM   11116 O O   . LYS J 2 34  ? 71.304  90.461  90.096  1.00 6.51  ? 34  LYS J O   1 
ATOM   11117 C CB  . LYS J 2 34  ? 70.346  89.583  87.742  1.00 6.73  ? 34  LYS J CB  1 
ATOM   11118 C CG  . LYS J 2 34  ? 70.248  89.036  86.339  1.00 7.69  ? 34  LYS J CG  1 
ATOM   11119 C CD  . LYS J 2 34  ? 69.663  90.040  85.388  1.00 7.49  ? 34  LYS J CD  1 
ATOM   11120 C CE  . LYS J 2 34  ? 69.309  89.357  84.105  1.00 8.91  ? 34  LYS J CE  1 
ATOM   11121 N NZ  . LYS J 2 34  ? 68.843  90.312  83.077  1.00 11.74 ? 34  LYS J NZ  1 
ATOM   11122 N N   . VAL J 2 35  ? 71.995  88.467  90.899  1.00 6.35  ? 35  VAL J N   1 
ATOM   11123 C CA  . VAL J 2 35  ? 72.495  89.047  92.151  1.00 6.93  ? 35  VAL J CA  1 
ATOM   11124 C C   . VAL J 2 35  ? 73.869  89.577  91.896  1.00 10.23 ? 35  VAL J C   1 
ATOM   11125 O O   . VAL J 2 35  ? 74.310  89.627  90.760  1.00 13.95 ? 35  VAL J O   1 
ATOM   11126 C CB  . VAL J 2 35  ? 72.705  88.028  93.271  1.00 6.32  ? 35  VAL J CB  1 
ATOM   11127 C CG1 . VAL J 2 35  ? 72.100  88.565  94.565  1.00 5.00  ? 35  VAL J CG1 1 
ATOM   11128 C CG2 . VAL J 2 35  ? 72.205  86.658  92.883  1.00 5.00  ? 35  VAL J CG2 1 
ATOM   11129 N N   . LYS J 2 36  ? 74.563  89.953  92.962  1.00 13.02 ? 36  LYS J N   1 
ATOM   11130 C CA  . LYS J 2 36  ? 75.936  90.437  92.862  1.00 13.88 ? 36  LYS J CA  1 
ATOM   11131 C C   . LYS J 2 36  ? 76.779  89.624  93.858  1.00 16.64 ? 36  LYS J C   1 
ATOM   11132 O O   . LYS J 2 36  ? 76.868  89.968  95.038  1.00 14.74 ? 36  LYS J O   1 
ATOM   11133 C CB  . LYS J 2 36  ? 75.976  91.923  93.217  1.00 11.26 ? 36  LYS J CB  1 
ATOM   11134 C CG  . LYS J 2 36  ? 77.118  92.701  92.608  1.00 11.65 ? 36  LYS J CG  1 
ATOM   11135 C CD  . LYS J 2 36  ? 78.439  92.425  93.286  1.00 14.06 ? 36  LYS J CD  1 
ATOM   11136 C CE  . LYS J 2 36  ? 79.430  93.557  93.023  1.00 14.93 ? 36  LYS J CE  1 
ATOM   11137 N NZ  . LYS J 2 36  ? 78.934  94.894  93.477  1.00 15.64 ? 36  LYS J NZ  1 
ATOM   11138 N N   . CYS J 2 37  ? 77.305  88.488  93.411  1.00 20.50 ? 37  CYS J N   1 
ATOM   11139 C CA  . CYS J 2 37  ? 78.146  87.651  94.261  1.00 24.03 ? 37  CYS J CA  1 
ATOM   11140 C C   . CYS J 2 37  ? 79.487  88.357  94.424  1.00 28.90 ? 37  CYS J C   1 
ATOM   11141 O O   . CYS J 2 37  ? 80.107  88.747  93.426  1.00 26.07 ? 37  CYS J O   1 
ATOM   11142 C CB  . CYS J 2 37  ? 78.417  86.317  93.580  1.00 22.15 ? 37  CYS J CB  1 
ATOM   11143 S SG  . CYS J 2 37  ? 76.992  85.209  93.427  1.00 19.13 ? 37  CYS J SG  1 
ATOM   11144 N N   . GLU J 2 38  ? 79.944  88.521  95.662  1.00 33.56 ? 38  GLU J N   1 
ATOM   11145 C CA  . GLU J 2 38  ? 81.232  89.161  95.879  1.00 36.58 ? 38  GLU J CA  1 
ATOM   11146 C C   . GLU J 2 38  ? 82.291  88.353  95.129  1.00 35.71 ? 38  GLU J C   1 
ATOM   11147 O O   . GLU J 2 38  ? 83.080  88.897  94.365  1.00 36.74 ? 38  GLU J O   1 
ATOM   11148 C CB  . GLU J 2 38  ? 81.590  89.212  97.364  1.00 40.98 ? 38  GLU J CB  1 
ATOM   11149 C CG  . GLU J 2 38  ? 82.990  89.758  97.585  1.00 50.94 ? 38  GLU J CG  1 
ATOM   11150 C CD  . GLU J 2 38  ? 83.281  90.117  99.019  1.00 58.26 ? 38  GLU J CD  1 
ATOM   11151 O OE1 . GLU J 2 38  ? 83.809  91.235  99.242  1.00 58.79 ? 38  GLU J OE1 1 
ATOM   11152 O OE2 . GLU J 2 38  ? 82.990  89.285  99.913  1.00 63.08 ? 38  GLU J OE2 1 
ATOM   11153 N N   . HIS J 2 39  ? 82.276  87.038  95.313  1.00 33.73 ? 39  HIS J N   1 
ATOM   11154 C CA  . HIS J 2 39  ? 83.258  86.203  94.651  1.00 27.84 ? 39  HIS J CA  1 
ATOM   11155 C C   . HIS J 2 39  ? 82.757  85.402  93.470  1.00 25.54 ? 39  HIS J C   1 
ATOM   11156 O O   . HIS J 2 39  ? 83.443  84.490  93.030  1.00 30.67 ? 39  HIS J O   1 
ATOM   11157 C CB  . HIS J 2 39  ? 83.941  85.289  95.656  1.00 27.51 ? 39  HIS J CB  1 
ATOM   11158 C CG  . HIS J 2 39  ? 84.783  86.025  96.644  1.00 28.83 ? 39  HIS J CG  1 
ATOM   11159 N ND1 . HIS J 2 39  ? 84.613  85.905  98.006  1.00 28.63 ? 39  HIS J ND1 1 
ATOM   11160 C CD2 . HIS J 2 39  ? 85.785  86.918  96.466  1.00 29.29 ? 39  HIS J CD2 1 
ATOM   11161 C CE1 . HIS J 2 39  ? 85.472  86.693  98.626  1.00 28.07 ? 39  HIS J CE1 1 
ATOM   11162 N NE2 . HIS J 2 39  ? 86.194  87.319  97.713  1.00 28.52 ? 39  HIS J NE2 1 
ATOM   11163 N N   . GLY J 2 40  ? 81.599  85.752  92.921  1.00 20.30 ? 40  GLY J N   1 
ATOM   11164 C CA  . GLY J 2 40  ? 81.098  85.006  91.778  1.00 15.11 ? 40  GLY J CA  1 
ATOM   11165 C C   . GLY J 2 40  ? 80.280  83.801  92.198  1.00 11.74 ? 40  GLY J C   1 
ATOM   11166 O O   . GLY J 2 40  ? 80.245  83.462  93.385  1.00 10.30 ? 40  GLY J O   1 
ATOM   11167 N N   . PHE J 2 41  ? 79.634  83.147