data_1CD0
# 
_entry.id   1CD0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1CD0         
RCSB  RCSB000588   
WWPDB D_1000000588 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1CD0 
_pdbx_database_status.recvd_initial_deposition_date   1999-03-05 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pokkuluri, P.R.' 1 
'Solomon, A.'     2 
'Weiss, D.T.'     3 
'Stevens, F.J.'   4 
'Schiffer, M.'    5 
# 
_citation.id                        primary 
_citation.title                     'Tertiary structure of human lambda 6 light chains.' 
_citation.journal_abbrev            Amyloid 
_citation.journal_volume            6 
_citation.page_first                165 
_citation.page_last                 171 
_citation.year                      1999 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1350-6129 
_citation.journal_id_CSD            9999 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10524280 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pokkuluri, P.R.' 1 
primary 'Solomon, A.'     2 
primary 'Weiss, D.T.'     3 
primary 'Stevens, F.J.'   4 
primary 'Schiffer, M.'    5 
# 
_cell.entry_id           1CD0 
_cell.length_a           42.900 
_cell.length_b           60.500 
_cell.length_c           73.400 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1CD0 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'PROTEIN (JTO, A VARIABLE DOMAIN FROM LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN)' 12097.149 2   ? ? 
'IMMUNOGLOBULIN VARIABLE DOMAIN' ? 
2 water   nat water                                                                            18.015    247 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;NFMLNQPHSVSESPGKTVTISCTRSSGNIDSNYVQWYQQRPGSAPITVIYEDNQRPSGVPDRFAGSIDRSSNSASLTISG
LKTEDEADYYCQSYDARNVVFGGGTRLTVLG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;NFMLNQPHSVSESPGKTVTISCTRSSGNIDSNYVQWYQQRPGSAPITVIYEDNQRPSGVPDRFAGSIDRSSNSASLTISG
LKTEDEADYYCQSYDARNVVFGGGTRLTVLG
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASN n 
1 2   PHE n 
1 3   MET n 
1 4   LEU n 
1 5   ASN n 
1 6   GLN n 
1 7   PRO n 
1 8   HIS n 
1 9   SER n 
1 10  VAL n 
1 11  SER n 
1 12  GLU n 
1 13  SER n 
1 14  PRO n 
1 15  GLY n 
1 16  LYS n 
1 17  THR n 
1 18  VAL n 
1 19  THR n 
1 20  ILE n 
1 21  SER n 
1 22  CYS n 
1 23  THR n 
1 24  ARG n 
1 25  SER n 
1 26  SER n 
1 27  GLY n 
1 28  ASN n 
1 29  ILE n 
1 30  ASP n 
1 31  SER n 
1 32  ASN n 
1 33  TYR n 
1 34  VAL n 
1 35  GLN n 
1 36  TRP n 
1 37  TYR n 
1 38  GLN n 
1 39  GLN n 
1 40  ARG n 
1 41  PRO n 
1 42  GLY n 
1 43  SER n 
1 44  ALA n 
1 45  PRO n 
1 46  ILE n 
1 47  THR n 
1 48  VAL n 
1 49  ILE n 
1 50  TYR n 
1 51  GLU n 
1 52  ASP n 
1 53  ASN n 
1 54  GLN n 
1 55  ARG n 
1 56  PRO n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  PRO n 
1 61  ASP n 
1 62  ARG n 
1 63  PHE n 
1 64  ALA n 
1 65  GLY n 
1 66  SER n 
1 67  ILE n 
1 68  ASP n 
1 69  ARG n 
1 70  SER n 
1 71  SER n 
1 72  ASN n 
1 73  SER n 
1 74  ALA n 
1 75  SER n 
1 76  LEU n 
1 77  THR n 
1 78  ILE n 
1 79  SER n 
1 80  GLY n 
1 81  LEU n 
1 82  LYS n 
1 83  THR n 
1 84  GLU n 
1 85  ASP n 
1 86  GLU n 
1 87  ALA n 
1 88  ASP n 
1 89  TYR n 
1 90  TYR n 
1 91  CYS n 
1 92  GLN n 
1 93  SER n 
1 94  TYR n 
1 95  ASP n 
1 96  ALA n 
1 97  ARG n 
1 98  ASN n 
1 99  VAL n 
1 100 VAL n 
1 101 PHE n 
1 102 GLY n 
1 103 GLY n 
1 104 GLY n 
1 105 THR n 
1 106 ARG n 
1 107 LEU n 
1 108 THR n 
1 109 VAL n 
1 110 LEU n 
1 111 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LV6C_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P06317 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1CD0 A 1 ? 111 ? P06317 1 ? 111 ? 1 108 
2 1 1CD0 B 1 ? 111 ? P06317 1 ? 111 ? 1 108 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1CD0 ASN A 5   ? UNP P06317 THR 5   CONFLICT 5   1  
2 1CD0 ASN B 5   ? UNP P06317 THR 5   CONFLICT 5   2  
1 1CD0 ASN A 28  B UNP P06317 SER 28  CONFLICT 27  3  
2 1CD0 ASN B 28  B UNP P06317 SER 28  CONFLICT 27  4  
1 1CD0 ASP A 30  ? UNP P06317 ALA 30  CONFLICT 29  5  
2 1CD0 ASP B 30  ? UNP P06317 ALA 30  CONFLICT 29  6  
1 1CD0 ILE A 46  ? UNP P06317 THR 46  CONFLICT 45  7  
2 1CD0 ILE B 46  ? UNP P06317 THR 46  CONFLICT 45  8  
1 1CD0 ALA A 64  ? UNP P06317 SER 64  CONFLICT 63  9  
2 1CD0 ALA B 64  ? UNP P06317 SER 64  CONFLICT 63  10 
1 1CD0 ARG A 69  B UNP P06317 SER 69  CONFLICT 66  11 
2 1CD0 ARG B 69  B UNP P06317 SER 69  CONFLICT 66  12 
1 1CD0 ALA A 96  ? UNP P06317 SER 96  CONFLICT 93  13 
2 1CD0 ALA B 96  ? UNP P06317 SER 96  CONFLICT 93  14 
1 1CD0 ARG A 97  ? UNP P06317 SER 97  CONFLICT 94  15 
2 1CD0 ARG B 97  ? UNP P06317 SER 97  CONFLICT 94  16 
1 1CD0 VAL A 99  ? UNP P06317 GLN 99  CONFLICT 96  17 
2 1CD0 VAL B 99  ? UNP P06317 GLN 99  CONFLICT 96  18 
1 1CD0 ARG A 106 ? UNP P06317 LYS 106 CONFLICT 103 19 
2 1CD0 ARG B 106 ? UNP P06317 LYS 106 CONFLICT 103 20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1CD0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.97 
_exptl_crystal.density_percent_sol   38 
_exptl_crystal.description           'CONSTANT DOMAINS WERE ALSO DELETED FROM THE STARTING MODEL.' 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    '27.5% PEG6000, 0.08 M SODIUM CACODYLATE PH 6.5, 0.1 M SODIUM ACETATE' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   RIGAKU 
_diffrn_detector.pdbx_collection_date   1997-10 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'NI FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1CD0 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            1.90 
_reflns.number_obs                   15655 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95. 
_reflns.pdbx_Rmerge_I_obs            0.076 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.5 
_reflns.B_iso_Wilson_estimate        8.4 
_reflns.pdbx_redundancy              4.87 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.94 
_reflns_shell.percent_possible_all   89.8 
_reflns_shell.Rmerge_I_obs           0.311 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.3 
_reflns_shell.pdbx_redundancy        3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1CD0 
_refine.ls_number_reflns_obs                     12188 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          3.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           362162.81 
_refine.ls_d_res_low                             8.00 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    79.2 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.184 
_refine.ls_R_factor_R_free                       0.24 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.2 
_refine.ls_number_reflns_R_free                  1247 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               16.8 
_refine.aniso_B[1][1]                            -0.98 
_refine.aniso_B[2][2]                            0.40 
_refine.aniso_B[3][3]                            0.57 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.46 
_refine.solvent_model_param_bsol                 72.6 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      'MCG(PDBCODE:1DCL): VL DIMER WITH WITH CDR LOOPS DELETED.' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1CD0 
_refine_analyze.Luzzati_coordinate_error_obs    0.19 
_refine_analyze.Luzzati_sigma_a_obs             0.13 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.27 
_refine_analyze.Luzzati_sigma_a_free            0.23 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1670 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             247 
_refine_hist.number_atoms_total               1917 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        8.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.4   ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      26.3  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      0.72  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             0.78  1.50 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            1.35  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             1.04  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            1.49  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   24 
_refine_ls_shell.d_res_high                       1.90 
_refine_ls_shell.d_res_low                        1.93 
_refine_ls_shell.number_reflns_R_work             253 
_refine_ls_shell.R_factor_R_work                  0.205 
_refine_ls_shell.percent_reflns_obs               46.7 
_refine_ls_shell.R_factor_R_free                  0.233 
_refine_ls_shell.R_factor_R_free_error            0.044 
_refine_ls_shell.percent_reflns_R_free            10.0 
_refine_ls_shell.number_reflns_R_free             28 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1CD0 
_struct.title                     'STRUCTURE OF HUMAN LAMDA-6 LIGHT CHAIN DIMER JTO' 
_struct.pdbx_descriptor           'JTO, A VARIABLE DOMAIN FROM LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1CD0 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'IMMUNOGLOBULIN, BENCE-JONES PROTEIN, LAMDA-6, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;BIOLOGICALLY ACTIVE MOLECULE IS A HOMODIMER. ASYMMETRIC
UNIT CONTAINS BOTH MONOMERS, CHAINS A AND B. BOTH MONOMERS
REFINED INDEPENDENTLY.
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ILE A 29 ? SER A 31 ? ILE A 28 SER A 30 5 ? 3 
HELX_P HELX_P2 2 THR A 83 ? ASP A 85 ? THR A 80 ASP A 82 5 ? 3 
HELX_P HELX_P3 3 ILE B 29 ? SER B 31 ? ILE B 28 SER B 30 5 ? 3 
HELX_P HELX_P4 4 THR B 83 ? ASP B 85 ? THR B 80 ASP B 82 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 91 SG ? ? A CYS 23 A CYS 88 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf2 disulf ? ? B CYS 22 SG ? ? ? 1_555 B CYS 91 SG ? ? B CYS 23 B CYS 88 1_555 ? ? ? ? ? ? ? 2.035 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 2 ? 
D ? 5 ? 
E ? 3 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 9   ? GLU A 12  ? SER A 9   GLU A 13  
A 2 THR A 105 ? VAL A 109 ? THR A 102 VAL A 106 
A 3 ALA A 87  ? GLN A 92  ? ALA A 84  GLN A 89  
A 4 GLN A 35  ? GLN A 39  ? GLN A 34  GLN A 38  
A 5 ILE A 46  ? ILE A 49  ? ILE A 45  ILE A 48  
B 1 VAL A 18  ? THR A 23  ? VAL A 19  THR A 24  
B 2 SER A 73  ? ILE A 78  ? SER A 70  ILE A 75  
B 3 PHE A 63  ? ASP A 68  A PHE A 62  ASP A 66  
C 1 GLN A 92  ? ASP A 95  ? GLN A 89  ASP A 92  
C 2 ASN A 98  ? PHE A 101 ? ASN A 95  PHE A 98  
D 1 SER B 9   ? GLU B 12  ? SER B 9   GLU B 13  
D 2 THR B 105 ? VAL B 109 ? THR B 102 VAL B 106 
D 3 ALA B 87  ? SER B 93  ? ALA B 84  SER B 90  
D 4 VAL B 34  ? GLN B 39  ? VAL B 33  GLN B 38  
D 5 ILE B 46  ? ILE B 49  ? ILE B 45  ILE B 48  
E 1 VAL B 18  ? THR B 23  ? VAL B 19  THR B 24  
E 2 SER B 73  ? ILE B 78  ? SER B 70  ILE B 75  
E 3 PHE B 63  ? ASP B 68  A PHE B 62  ASP B 66  
F 1 GLN B 92  ? TYR B 94  ? GLN B 89  TYR B 91  
F 2 VAL B 99  ? PHE B 101 ? VAL B 96  PHE B 98  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 10  ? O VAL A 11  N ARG A 106 ? N ARG A 103 
A 2 3 O THR A 105 ? O THR A 102 N TYR A 89  ? N TYR A 86  
A 3 4 O ASP A 88  ? O ASP A 85  N GLN A 39  ? N GLN A 38  
A 4 5 O TRP A 36  ? O TRP A 35  N ILE A 49  ? N ILE A 48  
B 1 2 O VAL A 18  ? O VAL A 19  N ILE A 78  ? N ILE A 75  
B 2 3 O SER A 73  ? O SER A 70  N ASP A 68  A N ASP A 66  
C 1 2 O SER A 93  ? O SER A 90  N VAL A 100 ? N VAL A 97  
D 1 2 O VAL B 10  ? O VAL B 11  N ARG B 106 ? N ARG B 103 
D 2 3 O THR B 105 ? O THR B 102 N TYR B 89  ? N TYR B 86  
D 3 4 O ASP B 88  ? O ASP B 85  N GLN B 39  ? N GLN B 38  
D 4 5 O TRP B 36  ? O TRP B 35  N ILE B 49  ? N ILE B 48  
E 1 2 O VAL B 18  ? O VAL B 19  N ILE B 78  ? N ILE B 75  
E 2 3 O SER B 73  ? O SER B 70  N ASP B 68  A N ASP B 66  
F 1 2 O SER B 93  ? O SER B 90  N VAL B 100 ? N VAL B 97  
# 
_database_PDB_matrix.entry_id          1CD0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1CD0 
_atom_sites.fract_transf_matrix[1][1]   0.023310 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016529 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013624 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASN A 1 1   ? 12.550  10.609  21.364  1.00 24.44 ? 1   ASN A N   1 
ATOM   2    C CA  . ASN A 1 1   ? 13.155  10.863  20.025  1.00 23.76 ? 1   ASN A CA  1 
ATOM   3    C C   . ASN A 1 1   ? 14.251  9.846   19.722  1.00 23.07 ? 1   ASN A C   1 
ATOM   4    O O   . ASN A 1 1   ? 15.341  9.908   20.295  1.00 22.89 ? 1   ASN A O   1 
ATOM   5    C CB  . ASN A 1 1   ? 13.751  12.269  19.980  1.00 24.84 ? 1   ASN A CB  1 
ATOM   6    C CG  . ASN A 1 1   ? 14.314  12.624  18.613  1.00 25.85 ? 1   ASN A CG  1 
ATOM   7    O OD1 . ASN A 1 1   ? 14.889  13.697  18.429  1.00 26.38 ? 1   ASN A OD1 1 
ATOM   8    N ND2 . ASN A 1 1   ? 14.143  11.726  17.645  1.00 25.76 ? 1   ASN A ND2 1 
ATOM   9    N N   . PHE A 1 2   ? 13.972  8.908   18.825  1.00 21.65 ? 2   PHE A N   1 
ATOM   10   C CA  . PHE A 1 2   ? 14.980  7.918   18.481  1.00 20.40 ? 2   PHE A CA  1 
ATOM   11   C C   . PHE A 1 2   ? 14.807  7.377   17.074  1.00 19.78 ? 2   PHE A C   1 
ATOM   12   O O   . PHE A 1 2   ? 13.771  7.570   16.444  1.00 19.61 ? 2   PHE A O   1 
ATOM   13   C CB  . PHE A 1 2   ? 14.973  6.776   19.508  1.00 19.77 ? 2   PHE A CB  1 
ATOM   14   C CG  . PHE A 1 2   ? 13.737  5.923   19.477  1.00 19.45 ? 2   PHE A CG  1 
ATOM   15   C CD1 . PHE A 1 2   ? 13.548  4.978   18.469  1.00 19.11 ? 2   PHE A CD1 1 
ATOM   16   C CD2 . PHE A 1 2   ? 12.762  6.054   20.463  1.00 19.40 ? 2   PHE A CD2 1 
ATOM   17   C CE1 . PHE A 1 2   ? 12.410  4.175   18.447  1.00 18.94 ? 2   PHE A CE1 1 
ATOM   18   C CE2 . PHE A 1 2   ? 11.620  5.256   20.450  1.00 18.59 ? 2   PHE A CE2 1 
ATOM   19   C CZ  . PHE A 1 2   ? 11.443  4.315   19.442  1.00 18.97 ? 2   PHE A CZ  1 
ATOM   20   N N   . MET A 1 3   ? 15.844  6.711   16.584  1.00 19.35 ? 3   MET A N   1 
ATOM   21   C CA  . MET A 1 3   ? 15.829  6.136   15.251  1.00 18.74 ? 3   MET A CA  1 
ATOM   22   C C   . MET A 1 3   ? 16.012  4.635   15.376  1.00 16.91 ? 3   MET A C   1 
ATOM   23   O O   . MET A 1 3   ? 16.547  4.150   16.369  1.00 16.50 ? 3   MET A O   1 
ATOM   24   C CB  . MET A 1 3   ? 16.978  6.702   14.413  1.00 21.11 ? 3   MET A CB  1 
ATOM   25   C CG  . MET A 1 3   ? 17.089  8.219   14.412  1.00 23.89 ? 3   MET A CG  1 
ATOM   26   S SD  . MET A 1 3   ? 15.622  9.060   13.824  1.00 28.28 ? 3   MET A SD  1 
ATOM   27   C CE  . MET A 1 3   ? 15.471  8.400   12.163  1.00 26.60 ? 3   MET A CE  1 
ATOM   28   N N   . LEU A 1 4   ? 15.555  3.906   14.367  1.00 15.56 ? 4   LEU A N   1 
ATOM   29   C CA  . LEU A 1 4   ? 15.703  2.460   14.333  1.00 14.79 ? 4   LEU A CA  1 
ATOM   30   C C   . LEU A 1 4   ? 16.575  2.158   13.113  1.00 14.63 ? 4   LEU A C   1 
ATOM   31   O O   . LEU A 1 4   ? 16.132  2.246   11.965  1.00 14.48 ? 4   LEU A O   1 
ATOM   32   C CB  . LEU A 1 4   ? 14.333  1.784   14.229  1.00 13.38 ? 4   LEU A CB  1 
ATOM   33   C CG  . LEU A 1 4   ? 13.457  1.980   15.477  1.00 14.65 ? 4   LEU A CG  1 
ATOM   34   C CD1 . LEU A 1 4   ? 12.104  1.304   15.291  1.00 14.01 ? 4   LEU A CD1 1 
ATOM   35   C CD2 . LEU A 1 4   ? 14.177  1.404   16.694  1.00 14.02 ? 4   LEU A CD2 1 
ATOM   36   N N   . ASN A 1 5   ? 17.832  1.833   13.376  1.00 14.03 ? 5   ASN A N   1 
ATOM   37   C CA  . ASN A 1 5   ? 18.778  1.561   12.310  1.00 14.26 ? 5   ASN A CA  1 
ATOM   38   C C   . ASN A 1 5   ? 18.908  0.079   11.963  1.00 14.16 ? 5   ASN A C   1 
ATOM   39   O O   . ASN A 1 5   ? 19.063  -0.773  12.847  1.00 14.20 ? 5   ASN A O   1 
ATOM   40   C CB  . ASN A 1 5   ? 20.143  2.149   12.688  1.00 13.83 ? 5   ASN A CB  1 
ATOM   41   C CG  . ASN A 1 5   ? 20.072  3.647   12.973  1.00 13.91 ? 5   ASN A CG  1 
ATOM   42   O OD1 . ASN A 1 5   ? 19.568  4.418   12.157  1.00 13.61 ? 5   ASN A OD1 1 
ATOM   43   N ND2 . ASN A 1 5   ? 20.586  4.061   14.126  1.00 11.93 ? 5   ASN A ND2 1 
ATOM   44   N N   . GLN A 1 6   ? 18.840  -0.214  10.665  1.00 13.36 ? 6   GLN A N   1 
ATOM   45   C CA  . GLN A 1 6   ? 18.946  -1.580  10.163  1.00 13.12 ? 6   GLN A CA  1 
ATOM   46   C C   . GLN A 1 6   ? 19.969  -1.585  9.037   1.00 13.34 ? 6   GLN A C   1 
ATOM   47   O O   . GLN A 1 6   ? 20.229  -0.551  8.429   1.00 12.85 ? 6   GLN A O   1 
ATOM   48   C CB  . GLN A 1 6   ? 17.619  -2.054  9.559   1.00 12.33 ? 6   GLN A CB  1 
ATOM   49   C CG  . GLN A 1 6   ? 16.365  -1.765  10.355  1.00 10.77 ? 6   GLN A CG  1 
ATOM   50   C CD  . GLN A 1 6   ? 15.123  -2.240  9.615   1.00 11.15 ? 6   GLN A CD  1 
ATOM   51   O OE1 . GLN A 1 6   ? 14.038  -1.672  9.758   1.00 10.37 ? 6   GLN A OE1 1 
ATOM   52   N NE2 . GLN A 1 6   ? 15.277  -3.300  8.827   1.00 10.34 ? 6   GLN A NE2 1 
ATOM   53   N N   . PRO A 1 7   ? 20.560  -2.752  8.742   1.00 14.59 ? 7   PRO A N   1 
ATOM   54   C CA  . PRO A 1 7   ? 21.547  -2.850  7.664   1.00 15.51 ? 7   PRO A CA  1 
ATOM   55   C C   . PRO A 1 7   ? 20.788  -2.624  6.358   1.00 17.25 ? 7   PRO A C   1 
ATOM   56   O O   . PRO A 1 7   ? 19.677  -3.136  6.190   1.00 16.98 ? 7   PRO A O   1 
ATOM   57   C CB  . PRO A 1 7   ? 22.040  -4.286  7.800   1.00 15.38 ? 7   PRO A CB  1 
ATOM   58   C CG  . PRO A 1 7   ? 20.772  -4.999  8.265   1.00 14.52 ? 7   PRO A CG  1 
ATOM   59   C CD  . PRO A 1 7   ? 20.389  -4.063  9.388   1.00 14.47 ? 7   PRO A CD  1 
ATOM   60   N N   . HIS A 1 8   ? 21.371  -1.858  5.443   1.00 18.37 ? 8   HIS A N   1 
ATOM   61   C CA  . HIS A 1 8   ? 20.717  -1.581  4.171   1.00 20.29 ? 8   HIS A CA  1 
ATOM   62   C C   . HIS A 1 8   ? 20.462  -2.848  3.355   1.00 21.23 ? 8   HIS A C   1 
ATOM   63   O O   . HIS A 1 8   ? 19.395  -3.010  2.759   1.00 20.47 ? 8   HIS A O   1 
ATOM   64   C CB  . HIS A 1 8   ? 21.547  -0.579  3.359   1.00 21.30 ? 8   HIS A CB  1 
ATOM   65   C CG  . HIS A 1 8   ? 21.037  -0.358  1.970   1.00 23.54 ? 8   HIS A CG  1 
ATOM   66   N ND1 . HIS A 1 8   ? 21.177  -1.297  0.970   1.00 24.13 ? 8   HIS A ND1 1 
ATOM   67   C CD2 . HIS A 1 8   ? 20.359  0.679   1.422   1.00 23.85 ? 8   HIS A CD2 1 
ATOM   68   C CE1 . HIS A 1 8   ? 20.609  -0.848  -0.135  1.00 24.53 ? 8   HIS A CE1 1 
ATOM   69   N NE2 . HIS A 1 8   ? 20.105  0.349   0.112   1.00 24.89 ? 8   HIS A NE2 1 
ATOM   70   N N   . SER A 1 9   ? 21.433  -3.753  3.340   1.00 22.54 ? 9   SER A N   1 
ATOM   71   C CA  . SER A 1 9   ? 21.290  -4.996  2.592   1.00 24.16 ? 9   SER A CA  1 
ATOM   72   C C   . SER A 1 9   ? 21.828  -6.192  3.352   1.00 24.82 ? 9   SER A C   1 
ATOM   73   O O   . SER A 1 9   ? 22.761  -6.072  4.140   1.00 25.47 ? 9   SER A O   1 
ATOM   74   C CB  . SER A 1 9   ? 22.021  -4.902  1.251   1.00 24.20 ? 9   SER A CB  1 
ATOM   75   O OG  . SER A 1 9   ? 21.441  -3.916  0.423   1.00 26.65 ? 9   SER A OG  1 
ATOM   76   N N   . VAL A 1 10  ? 21.221  -7.346  3.105   1.00 25.73 ? 11  VAL A N   1 
ATOM   77   C CA  . VAL A 1 10  ? 21.630  -8.598  3.722   1.00 26.84 ? 11  VAL A CA  1 
ATOM   78   C C   . VAL A 1 10  ? 21.359  -9.703  2.709   1.00 27.52 ? 11  VAL A C   1 
ATOM   79   O O   . VAL A 1 10  ? 20.302  -9.737  2.082   1.00 27.09 ? 11  VAL A O   1 
ATOM   80   C CB  . VAL A 1 10  ? 20.840  -8.898  5.016   1.00 26.95 ? 11  VAL A CB  1 
ATOM   81   C CG1 . VAL A 1 10  ? 21.276  -10.240 5.583   1.00 26.91 ? 11  VAL A CG1 1 
ATOM   82   C CG2 . VAL A 1 10  ? 21.080  -7.805  6.048   1.00 26.92 ? 11  VAL A CG2 1 
ATOM   83   N N   . SER A 1 11  ? 22.323  -10.597 2.535   1.00 28.80 ? 12  SER A N   1 
ATOM   84   C CA  . SER A 1 11  ? 22.165  -11.690 1.588   1.00 30.34 ? 12  SER A CA  1 
ATOM   85   C C   . SER A 1 11  ? 22.597  -13.010 2.206   1.00 30.92 ? 12  SER A C   1 
ATOM   86   O O   . SER A 1 11  ? 23.469  -13.050 3.075   1.00 31.32 ? 12  SER A O   1 
ATOM   87   C CB  . SER A 1 11  ? 22.972  -11.414 0.317   1.00 30.38 ? 12  SER A CB  1 
ATOM   88   O OG  . SER A 1 11  ? 24.350  -11.274 0.608   1.00 32.08 ? 12  SER A OG  1 
ATOM   89   N N   . GLU A 1 12  ? 21.972  -14.089 1.754   1.00 31.69 ? 13  GLU A N   1 
ATOM   90   C CA  . GLU A 1 12  ? 22.278  -15.415 2.260   1.00 32.28 ? 13  GLU A CA  1 
ATOM   91   C C   . GLU A 1 12  ? 21.770  -16.464 1.282   1.00 32.22 ? 13  GLU A C   1 
ATOM   92   O O   . GLU A 1 12  ? 20.852  -16.207 0.504   1.00 32.08 ? 13  GLU A O   1 
ATOM   93   C CB  . GLU A 1 12  ? 21.624  -15.609 3.631   1.00 33.05 ? 13  GLU A CB  1 
ATOM   94   C CG  . GLU A 1 12  ? 21.858  -16.975 4.251   1.00 34.32 ? 13  GLU A CG  1 
ATOM   95   C CD  . GLU A 1 12  ? 23.329  -17.283 4.447   1.00 35.29 ? 13  GLU A CD  1 
ATOM   96   O OE1 . GLU A 1 12  ? 24.003  -16.529 5.182   1.00 35.74 ? 13  GLU A OE1 1 
ATOM   97   O OE2 . GLU A 1 12  ? 23.808  -18.282 3.867   1.00 35.83 ? 13  GLU A OE2 1 
ATOM   98   N N   . SER A 1 13  ? 22.377  -17.644 1.319   1.00 32.14 ? 14  SER A N   1 
ATOM   99   C CA  . SER A 1 13  ? 21.981  -18.729 0.434   1.00 32.33 ? 14  SER A CA  1 
ATOM   100  C C   . SER A 1 13  ? 20.708  -19.385 0.954   1.00 31.82 ? 14  SER A C   1 
ATOM   101  O O   . SER A 1 13  ? 20.416  -19.325 2.146   1.00 31.82 ? 14  SER A O   1 
ATOM   102  C CB  . SER A 1 13  ? 23.108  -19.762 0.336   1.00 32.73 ? 14  SER A CB  1 
ATOM   103  N N   . PRO A 1 14  ? 19.927  -20.011 0.061   1.00 31.67 ? 15  PRO A N   1 
ATOM   104  C CA  . PRO A 1 14  ? 18.682  -20.679 0.440   1.00 31.46 ? 15  PRO A CA  1 
ATOM   105  C C   . PRO A 1 14  ? 18.956  -21.839 1.387   1.00 31.30 ? 15  PRO A C   1 
ATOM   106  O O   . PRO A 1 14  ? 19.950  -22.551 1.236   1.00 31.55 ? 15  PRO A O   1 
ATOM   107  C CB  . PRO A 1 14  ? 18.131  -21.142 -0.906  1.00 31.66 ? 15  PRO A CB  1 
ATOM   108  C CG  . PRO A 1 14  ? 19.394  -21.430 -1.672  1.00 32.00 ? 15  PRO A CG  1 
ATOM   109  C CD  . PRO A 1 14  ? 20.132  -20.142 -1.389  1.00 32.08 ? 15  PRO A CD  1 
ATOM   110  N N   . GLY A 1 15  ? 18.074  -22.022 2.363   1.00 30.88 ? 16  GLY A N   1 
ATOM   111  C CA  . GLY A 1 15  ? 18.250  -23.097 3.322   1.00 30.26 ? 16  GLY A CA  1 
ATOM   112  C C   . GLY A 1 15  ? 18.934  -22.619 4.589   1.00 29.45 ? 16  GLY A C   1 
ATOM   113  O O   . GLY A 1 15  ? 18.701  -23.152 5.674   1.00 29.64 ? 16  GLY A O   1 
ATOM   114  N N   . LYS A 1 16  ? 19.779  -21.605 4.451   1.00 28.71 ? 17  LYS A N   1 
ATOM   115  C CA  . LYS A 1 16  ? 20.498  -21.059 5.591   1.00 27.60 ? 17  LYS A CA  1 
ATOM   116  C C   . LYS A 1 16  ? 19.591  -20.165 6.432   1.00 27.04 ? 17  LYS A C   1 
ATOM   117  O O   . LYS A 1 16  ? 18.435  -19.924 6.082   1.00 26.84 ? 17  LYS A O   1 
ATOM   118  C CB  . LYS A 1 16  ? 21.713  -20.275 5.109   1.00 28.08 ? 17  LYS A CB  1 
ATOM   119  N N   . THR A 1 17  ? 20.123  -19.683 7.550   1.00 26.03 ? 18  THR A N   1 
ATOM   120  C CA  . THR A 1 17  ? 19.378  -18.806 8.440   1.00 24.79 ? 18  THR A CA  1 
ATOM   121  C C   . THR A 1 17  ? 19.949  -17.398 8.359   1.00 24.51 ? 18  THR A C   1 
ATOM   122  O O   . THR A 1 17  ? 21.155  -17.195 8.497   1.00 24.29 ? 18  THR A O   1 
ATOM   123  C CB  . THR A 1 17  ? 19.446  -19.295 9.903   1.00 24.75 ? 18  THR A CB  1 
ATOM   124  O OG1 . THR A 1 17  ? 18.750  -20.541 10.022  1.00 23.68 ? 18  THR A OG1 1 
ATOM   125  C CG2 . THR A 1 17  ? 18.820  -18.275 10.840  1.00 23.74 ? 18  THR A CG2 1 
ATOM   126  N N   . VAL A 1 18  ? 19.080  -16.426 8.124   1.00 23.35 ? 19  VAL A N   1 
ATOM   127  C CA  . VAL A 1 18  ? 19.525  -15.047 8.026   1.00 22.77 ? 19  VAL A CA  1 
ATOM   128  C C   . VAL A 1 18  ? 18.960  -14.229 9.182   1.00 21.89 ? 19  VAL A C   1 
ATOM   129  O O   . VAL A 1 18  ? 17.824  -14.434 9.608   1.00 21.97 ? 19  VAL A O   1 
ATOM   130  C CB  . VAL A 1 18  ? 19.089  -14.420 6.682   1.00 22.89 ? 19  VAL A CB  1 
ATOM   131  C CG1 . VAL A 1 18  ? 17.575  -14.378 6.592   1.00 22.95 ? 19  VAL A CG1 1 
ATOM   132  C CG2 . VAL A 1 18  ? 19.675  -13.028 6.543   1.00 23.70 ? 19  VAL A CG2 1 
ATOM   133  N N   . THR A 1 19  ? 19.769  -13.313 9.699   1.00 21.05 ? 20  THR A N   1 
ATOM   134  C CA  . THR A 1 19  ? 19.345  -12.470 10.798  1.00 19.90 ? 20  THR A CA  1 
ATOM   135  C C   . THR A 1 19  ? 19.407  -11.009 10.385  1.00 19.14 ? 20  THR A C   1 
ATOM   136  O O   . THR A 1 19  ? 20.396  -10.555 9.820   1.00 18.29 ? 20  THR A O   1 
ATOM   137  C CB  . THR A 1 19  ? 20.234  -12.684 12.036  1.00 21.06 ? 20  THR A CB  1 
ATOM   138  O OG1 . THR A 1 19  ? 20.149  -14.055 12.444  1.00 21.64 ? 20  THR A OG1 1 
ATOM   139  C CG2 . THR A 1 19  ? 19.776  -11.787 13.189  1.00 21.25 ? 20  THR A CG2 1 
ATOM   140  N N   . ILE A 1 20  ? 18.331  -10.284 10.664  1.00 18.06 ? 21  ILE A N   1 
ATOM   141  C CA  . ILE A 1 20  ? 18.247  -8.871  10.336  1.00 16.81 ? 21  ILE A CA  1 
ATOM   142  C C   . ILE A 1 20  ? 18.130  -8.097  11.641  1.00 16.28 ? 21  ILE A C   1 
ATOM   143  O O   . ILE A 1 20  ? 17.223  -8.346  12.433  1.00 16.36 ? 21  ILE A O   1 
ATOM   144  C CB  . ILE A 1 20  ? 17.016  -8.598  9.454   1.00 16.11 ? 21  ILE A CB  1 
ATOM   145  C CG1 . ILE A 1 20  ? 17.117  -9.429  8.170   1.00 16.03 ? 21  ILE A CG1 1 
ATOM   146  C CG2 . ILE A 1 20  ? 16.915  -7.120  9.145   1.00 16.51 ? 21  ILE A CG2 1 
ATOM   147  C CD1 . ILE A 1 20  ? 15.934  -9.286  7.232   1.00 14.93 ? 21  ILE A CD1 1 
ATOM   148  N N   . SER A 1 21  ? 19.048  -7.162  11.866  1.00 15.47 ? 22  SER A N   1 
ATOM   149  C CA  . SER A 1 21  ? 19.045  -6.373  13.094  1.00 14.91 ? 22  SER A CA  1 
ATOM   150  C C   . SER A 1 21  ? 18.293  -5.052  12.987  1.00 14.31 ? 22  SER A C   1 
ATOM   151  O O   . SER A 1 21  ? 18.141  -4.482  11.905  1.00 13.52 ? 22  SER A O   1 
ATOM   152  C CB  . SER A 1 21  ? 20.483  -6.100  13.547  1.00 14.82 ? 22  SER A CB  1 
ATOM   153  O OG  . SER A 1 21  ? 21.199  -5.385  12.549  1.00 16.65 ? 22  SER A OG  1 
ATOM   154  N N   . CYS A 1 22  ? 17.840  -4.577  14.141  1.00 13.39 ? 23  CYS A N   1 
ATOM   155  C CA  . CYS A 1 22  ? 17.092  -3.331  14.273  1.00 12.81 ? 23  CYS A CA  1 
ATOM   156  C C   . CYS A 1 22  ? 17.622  -2.682  15.549  1.00 12.66 ? 23  CYS A C   1 
ATOM   157  O O   . CYS A 1 22  ? 17.273  -3.100  16.655  1.00 12.97 ? 23  CYS A O   1 
ATOM   158  C CB  . CYS A 1 22  ? 15.610  -3.649  14.427  1.00 12.00 ? 23  CYS A CB  1 
ATOM   159  S SG  . CYS A 1 22  ? 14.541  -2.222  14.738  1.00 11.03 ? 23  CYS A SG  1 
ATOM   160  N N   . THR A 1 23  ? 18.463  -1.664  15.395  1.00 12.14 ? 24  THR A N   1 
ATOM   161  C CA  . THR A 1 23  ? 19.080  -1.006  16.543  1.00 11.51 ? 24  THR A CA  1 
ATOM   162  C C   . THR A 1 23  ? 18.497  0.362   16.905  1.00 11.92 ? 24  THR A C   1 
ATOM   163  O O   . THR A 1 23  ? 18.504  1.286   16.093  1.00 12.44 ? 24  THR A O   1 
ATOM   164  C CB  . THR A 1 23  ? 20.597  -0.845  16.300  1.00 11.80 ? 24  THR A CB  1 
ATOM   165  O OG1 . THR A 1 23  ? 21.166  -2.120  15.969  1.00 10.58 ? 24  THR A OG1 1 
ATOM   166  C CG2 . THR A 1 23  ? 21.287  -0.294  17.540  1.00 10.28 ? 24  THR A CG2 1 
ATOM   167  N N   . ARG A 1 24  ? 18.010  0.488   18.137  1.00 11.71 ? 25  ARG A N   1 
ATOM   168  C CA  . ARG A 1 24  ? 17.434  1.743   18.611  1.00 11.71 ? 25  ARG A CA  1 
ATOM   169  C C   . ARG A 1 24  ? 18.546  2.713   19.006  1.00 12.40 ? 25  ARG A C   1 
ATOM   170  O O   . ARG A 1 24  ? 19.358  2.412   19.883  1.00 12.27 ? 25  ARG A O   1 
ATOM   171  C CB  . ARG A 1 24  ? 16.496  1.469   19.792  1.00 10.80 ? 25  ARG A CB  1 
ATOM   172  C CG  . ARG A 1 24  ? 15.876  2.714   20.432  1.00 11.26 ? 25  ARG A CG  1 
ATOM   173  C CD  . ARG A 1 24  ? 14.631  2.357   21.251  1.00 9.77  ? 25  ARG A CD  1 
ATOM   174  N NE  . ARG A 1 24  ? 14.157  3.475   22.067  1.00 10.96 ? 25  ARG A NE  1 
ATOM   175  C CZ  . ARG A 1 24  ? 12.982  3.499   22.686  1.00 11.53 ? 25  ARG A CZ  1 
ATOM   176  N NH1 . ARG A 1 24  ? 12.155  2.469   22.581  1.00 12.77 ? 25  ARG A NH1 1 
ATOM   177  N NH2 . ARG A 1 24  ? 12.635  4.546   23.422  1.00 12.62 ? 25  ARG A NH2 1 
ATOM   178  N N   . SER A 1 25  ? 18.575  3.873   18.350  1.00 12.52 ? 26  SER A N   1 
ATOM   179  C CA  . SER A 1 25  ? 19.604  4.884   18.599  1.00 14.31 ? 26  SER A CA  1 
ATOM   180  C C   . SER A 1 25  ? 19.692  5.374   20.039  1.00 14.38 ? 26  SER A C   1 
ATOM   181  O O   . SER A 1 25  ? 20.785  5.626   20.536  1.00 15.21 ? 26  SER A O   1 
ATOM   182  C CB  . SER A 1 25  ? 19.413  6.082   17.663  1.00 13.60 ? 26  SER A CB  1 
ATOM   183  O OG  . SER A 1 25  ? 18.171  6.713   17.890  1.00 14.66 ? 26  SER A OG  1 
ATOM   184  N N   . SER A 1 26  ? 18.552  5.522   20.705  1.00 15.22 ? 27  SER A N   1 
ATOM   185  C CA  . SER A 1 26  ? 18.537  5.968   22.098  1.00 16.47 ? 27  SER A CA  1 
ATOM   186  C C   . SER A 1 26  ? 17.305  5.427   22.815  1.00 16.56 ? 27  SER A C   1 
ATOM   187  O O   . SER A 1 26  ? 16.225  5.325   22.226  1.00 16.86 ? 27  SER A O   1 
ATOM   188  C CB  . SER A 1 26  ? 18.574  7.497   22.184  1.00 17.06 ? 27  SER A CB  1 
ATOM   189  O OG  . SER A 1 26  ? 17.486  8.073   21.492  1.00 19.63 ? 27  SER A OG  1 
ATOM   190  N N   . GLY A 1 27  A 17.478  5.084   24.089  1.00 15.68 ? 27  GLY A N   1 
ATOM   191  C CA  . GLY A 1 27  A 16.388  4.520   24.863  1.00 15.39 ? 27  GLY A CA  1 
ATOM   192  C C   . GLY A 1 27  A 16.471  3.010   24.737  1.00 15.35 ? 27  GLY A C   1 
ATOM   193  O O   . GLY A 1 27  A 16.884  2.507   23.696  1.00 14.85 ? 27  GLY A O   1 
ATOM   194  N N   . ASN A 1 28  B 16.097  2.283   25.785  1.00 15.10 ? 27  ASN A N   1 
ATOM   195  C CA  . ASN A 1 28  B 16.153  0.826   25.755  1.00 15.06 ? 27  ASN A CA  1 
ATOM   196  C C   . ASN A 1 28  B 15.256  0.211   24.687  1.00 14.59 ? 27  ASN A C   1 
ATOM   197  O O   . ASN A 1 28  B 14.075  0.537   24.587  1.00 14.19 ? 27  ASN A O   1 
ATOM   198  C CB  . ASN A 1 28  B 15.776  0.248   27.121  1.00 15.26 ? 27  ASN A CB  1 
ATOM   199  C CG  . ASN A 1 28  B 16.852  0.469   28.165  1.00 16.48 ? 27  ASN A CG  1 
ATOM   200  O OD1 . ASN A 1 28  B 16.677  0.118   29.336  1.00 16.84 ? 27  ASN A OD1 1 
ATOM   201  N ND2 . ASN A 1 28  B 17.975  1.041   27.749  1.00 15.79 ? 27  ASN A ND2 1 
ATOM   202  N N   . ILE A 1 29  ? 15.832  -0.690  23.901  1.00 15.01 ? 28  ILE A N   1 
ATOM   203  C CA  . ILE A 1 29  ? 15.107  -1.374  22.837  1.00 15.20 ? 28  ILE A CA  1 
ATOM   204  C C   . ILE A 1 29  ? 13.901  -2.117  23.414  1.00 15.77 ? 28  ILE A C   1 
ATOM   205  O O   . ILE A 1 29  ? 12.846  -2.190  22.788  1.00 15.19 ? 28  ILE A O   1 
ATOM   206  C CB  . ILE A 1 29  ? 16.030  -2.393  22.122  1.00 15.65 ? 28  ILE A CB  1 
ATOM   207  C CG1 . ILE A 1 29  ? 15.290  -3.075  20.968  1.00 15.84 ? 28  ILE A CG1 1 
ATOM   208  C CG2 . ILE A 1 29  ? 16.528  -3.427  23.117  1.00 14.49 ? 28  ILE A CG2 1 
ATOM   209  C CD1 . ILE A 1 29  ? 14.961  -2.151  19.814  1.00 16.39 ? 28  ILE A CD1 1 
ATOM   210  N N   . ASP A 1 30  ? 14.063  -2.652  24.620  1.00 16.17 ? 29  ASP A N   1 
ATOM   211  C CA  . ASP A 1 30  ? 12.998  -3.411  25.271  1.00 17.13 ? 29  ASP A CA  1 
ATOM   212  C C   . ASP A 1 30  ? 11.924  -2.585  25.965  1.00 16.75 ? 29  ASP A C   1 
ATOM   213  O O   . ASP A 1 30  ? 11.031  -3.154  26.589  1.00 17.11 ? 29  ASP A O   1 
ATOM   214  C CB  . ASP A 1 30  ? 13.598  -4.403  26.283  1.00 18.30 ? 29  ASP A CB  1 
ATOM   215  C CG  . ASP A 1 30  ? 14.425  -3.714  27.361  1.00 19.18 ? 29  ASP A CG  1 
ATOM   216  O OD1 . ASP A 1 30  ? 15.377  -2.987  27.008  1.00 19.03 ? 29  ASP A OD1 1 
ATOM   217  O OD2 . ASP A 1 30  ? 14.128  -3.904  28.560  1.00 19.38 ? 29  ASP A OD2 1 
ATOM   218  N N   . SER A 1 31  ? 11.990  -1.259  25.858  1.00 16.63 ? 30  SER A N   1 
ATOM   219  C CA  . SER A 1 31  ? 10.991  -0.414  26.515  1.00 16.63 ? 30  SER A CA  1 
ATOM   220  C C   . SER A 1 31  ? 9.702   -0.228  25.711  1.00 16.46 ? 30  SER A C   1 
ATOM   221  O O   . SER A 1 31  ? 8.721   0.308   26.223  1.00 15.88 ? 30  SER A O   1 
ATOM   222  C CB  . SER A 1 31  ? 11.587  0.954   26.859  1.00 16.89 ? 30  SER A CB  1 
ATOM   223  O OG  . SER A 1 31  ? 11.954  1.667   25.694  1.00 18.07 ? 30  SER A OG  1 
ATOM   224  N N   . ASN A 1 32  ? 9.712   -0.648  24.448  1.00 15.68 ? 31  ASN A N   1 
ATOM   225  C CA  . ASN A 1 32  ? 8.522   -0.552  23.601  1.00 15.15 ? 31  ASN A CA  1 
ATOM   226  C C   . ASN A 1 32  ? 8.511   -1.732  22.642  1.00 14.13 ? 31  ASN A C   1 
ATOM   227  O O   . ASN A 1 32  ? 9.560   -2.159  22.174  1.00 14.81 ? 31  ASN A O   1 
ATOM   228  C CB  . ASN A 1 32  ? 8.495   0.747   22.785  1.00 15.26 ? 31  ASN A CB  1 
ATOM   229  C CG  . ASN A 1 32  ? 8.500   1.987   23.650  1.00 15.97 ? 31  ASN A CG  1 
ATOM   230  O OD1 . ASN A 1 32  ? 9.555   2.443   24.105  1.00 16.71 ? 31  ASN A OD1 1 
ATOM   231  N ND2 . ASN A 1 32  ? 7.317   2.530   23.903  1.00 15.42 ? 31  ASN A ND2 1 
ATOM   232  N N   . TYR A 1 33  ? 7.326   -2.256  22.354  1.00 13.36 ? 32  TYR A N   1 
ATOM   233  C CA  . TYR A 1 33  ? 7.199   -3.396  21.454  1.00 12.79 ? 32  TYR A CA  1 
ATOM   234  C C   . TYR A 1 33  ? 7.767   -3.144  20.066  1.00 11.53 ? 32  TYR A C   1 
ATOM   235  O O   . TYR A 1 33  ? 7.647   -2.046  19.518  1.00 10.58 ? 32  TYR A O   1 
ATOM   236  C CB  . TYR A 1 33  ? 5.731   -3.817  21.328  1.00 13.47 ? 32  TYR A CB  1 
ATOM   237  C CG  . TYR A 1 33  ? 5.181   -4.516  22.547  1.00 15.12 ? 32  TYR A CG  1 
ATOM   238  C CD1 . TYR A 1 33  ? 5.796   -5.661  23.045  1.00 15.14 ? 32  TYR A CD1 1 
ATOM   239  C CD2 . TYR A 1 33  ? 4.010   -4.075  23.165  1.00 16.30 ? 32  TYR A CD2 1 
ATOM   240  C CE1 . TYR A 1 33  ? 5.264   -6.359  24.123  1.00 17.11 ? 32  TYR A CE1 1 
ATOM   241  C CE2 . TYR A 1 33  ? 3.465   -4.771  24.251  1.00 17.03 ? 32  TYR A CE2 1 
ATOM   242  C CZ  . TYR A 1 33  ? 4.099   -5.912  24.721  1.00 17.57 ? 32  TYR A CZ  1 
ATOM   243  O OH  . TYR A 1 33  ? 3.575   -6.621  25.783  1.00 19.63 ? 32  TYR A OH  1 
ATOM   244  N N   . VAL A 1 34  ? 8.391   -4.178  19.507  1.00 11.41 ? 33  VAL A N   1 
ATOM   245  C CA  . VAL A 1 34  ? 8.971   -4.103  18.175  1.00 9.98  ? 33  VAL A CA  1 
ATOM   246  C C   . VAL A 1 34  ? 8.217   -5.045  17.238  1.00 9.57  ? 33  VAL A C   1 
ATOM   247  O O   . VAL A 1 34  ? 7.985   -6.214  17.557  1.00 9.39  ? 33  VAL A O   1 
ATOM   248  C CB  . VAL A 1 34  ? 10.469  -4.497  18.186  1.00 11.08 ? 33  VAL A CB  1 
ATOM   249  C CG1 . VAL A 1 34  ? 11.050  -4.401  16.775  1.00 9.26  ? 33  VAL A CG1 1 
ATOM   250  C CG2 . VAL A 1 34  ? 11.244  -3.580  19.142  1.00 9.90  ? 33  VAL A CG2 1 
ATOM   251  N N   . GLN A 1 35  ? 7.820   -4.515  16.087  1.00 8.78  ? 34  GLN A N   1 
ATOM   252  C CA  . GLN A 1 35  ? 7.111   -5.277  15.070  1.00 8.30  ? 34  GLN A CA  1 
ATOM   253  C C   . GLN A 1 35  ? 8.021   -5.447  13.861  1.00 8.23  ? 34  GLN A C   1 
ATOM   254  O O   . GLN A 1 35  ? 8.950   -4.667  13.660  1.00 8.32  ? 34  GLN A O   1 
ATOM   255  C CB  . GLN A 1 35  ? 5.837   -4.541  14.617  1.00 8.61  ? 34  GLN A CB  1 
ATOM   256  C CG  . GLN A 1 35  ? 4.649   -4.569  15.578  1.00 8.39  ? 34  GLN A CG  1 
ATOM   257  C CD  . GLN A 1 35  ? 4.973   -4.002  16.946  1.00 11.23 ? 34  GLN A CD  1 
ATOM   258  O OE1 . GLN A 1 35  ? 5.177   -4.743  17.911  1.00 10.93 ? 34  GLN A OE1 1 
ATOM   259  N NE2 . GLN A 1 35  ? 5.049   -2.680  17.031  1.00 11.71 ? 34  GLN A NE2 1 
ATOM   260  N N   . TRP A 1 36  ? 7.754   -6.476  13.064  1.00 8.40  ? 35  TRP A N   1 
ATOM   261  C CA  . TRP A 1 36  ? 8.517   -6.719  11.851  1.00 9.17  ? 35  TRP A CA  1 
ATOM   262  C C   . TRP A 1 36  ? 7.557   -6.897  10.689  1.00 8.70  ? 35  TRP A C   1 
ATOM   263  O O   . TRP A 1 36  ? 6.656   -7.738  10.723  1.00 8.83  ? 35  TRP A O   1 
ATOM   264  C CB  . TRP A 1 36  ? 9.413   -7.957  11.970  1.00 8.78  ? 35  TRP A CB  1 
ATOM   265  C CG  . TRP A 1 36  ? 10.586  -7.771  12.871  1.00 8.74  ? 35  TRP A CG  1 
ATOM   266  C CD1 . TRP A 1 36  ? 10.658  -8.054  14.204  1.00 8.58  ? 35  TRP A CD1 1 
ATOM   267  C CD2 . TRP A 1 36  ? 11.858  -7.223  12.503  1.00 8.12  ? 35  TRP A CD2 1 
ATOM   268  N NE1 . TRP A 1 36  ? 11.903  -7.719  14.692  1.00 9.16  ? 35  TRP A NE1 1 
ATOM   269  C CE2 . TRP A 1 36  ? 12.658  -7.208  13.668  1.00 8.09  ? 35  TRP A CE2 1 
ATOM   270  C CE3 . TRP A 1 36  ? 12.399  -6.747  11.302  1.00 8.20  ? 35  TRP A CE3 1 
ATOM   271  C CZ2 . TRP A 1 36  ? 13.974  -6.731  13.665  1.00 9.35  ? 35  TRP A CZ2 1 
ATOM   272  C CZ3 . TRP A 1 36  ? 13.709  -6.273  11.297  1.00 9.01  ? 35  TRP A CZ3 1 
ATOM   273  C CH2 . TRP A 1 36  ? 14.481  -6.269  12.472  1.00 8.58  ? 35  TRP A CH2 1 
ATOM   274  N N   . TYR A 1 37  ? 7.762   -6.090  9.660   1.00 9.25  ? 36  TYR A N   1 
ATOM   275  C CA  . TYR A 1 37  ? 6.922   -6.130  8.484   1.00 8.58  ? 36  TYR A CA  1 
ATOM   276  C C   . TYR A 1 37  ? 7.720   -6.633  7.288   1.00 9.04  ? 36  TYR A C   1 
ATOM   277  O O   . TYR A 1 37  ? 8.911   -6.338  7.153   1.00 9.48  ? 36  TYR A O   1 
ATOM   278  C CB  . TYR A 1 37  ? 6.359   -4.728  8.220   1.00 8.74  ? 36  TYR A CB  1 
ATOM   279  C CG  . TYR A 1 37  ? 5.640   -4.135  9.424   1.00 8.12  ? 36  TYR A CG  1 
ATOM   280  C CD1 . TYR A 1 37  ? 4.620   -4.839  10.056  1.00 7.87  ? 36  TYR A CD1 1 
ATOM   281  C CD2 . TYR A 1 37  ? 5.974   -2.870  9.921   1.00 8.54  ? 36  TYR A CD2 1 
ATOM   282  C CE1 . TYR A 1 37  ? 3.946   -4.311  11.156  1.00 8.31  ? 36  TYR A CE1 1 
ATOM   283  C CE2 . TYR A 1 37  ? 5.300   -2.326  11.031  1.00 8.32  ? 36  TYR A CE2 1 
ATOM   284  C CZ  . TYR A 1 37  ? 4.287   -3.062  11.638  1.00 8.17  ? 36  TYR A CZ  1 
ATOM   285  O OH  . TYR A 1 37  ? 3.611   -2.571  12.727  1.00 9.46  ? 36  TYR A OH  1 
ATOM   286  N N   . GLN A 1 38  ? 7.064   -7.425  6.447   1.00 9.15  ? 37  GLN A N   1 
ATOM   287  C CA  . GLN A 1 38  ? 7.675   -7.967  5.238   1.00 9.94  ? 37  GLN A CA  1 
ATOM   288  C C   . GLN A 1 38  ? 7.012   -7.274  4.056   1.00 10.04 ? 37  GLN A C   1 
ATOM   289  O O   . GLN A 1 38  ? 5.791   -7.284  3.947   1.00 9.34  ? 37  GLN A O   1 
ATOM   290  C CB  . GLN A 1 38  ? 7.419   -9.473  5.119   1.00 11.04 ? 37  GLN A CB  1 
ATOM   291  C CG  . GLN A 1 38  ? 7.968   -10.086 3.828   1.00 12.27 ? 37  GLN A CG  1 
ATOM   292  C CD  . GLN A 1 38  ? 7.469   -11.499 3.579   1.00 13.79 ? 37  GLN A CD  1 
ATOM   293  O OE1 . GLN A 1 38  ? 6.278   -11.722 3.342   1.00 15.39 ? 37  GLN A OE1 1 
ATOM   294  N NE2 . GLN A 1 38  ? 8.375   -12.460 3.633   1.00 13.80 ? 37  GLN A NE2 1 
ATOM   295  N N   . GLN A 1 39  ? 7.799   -6.664  3.180   1.00 11.32 ? 38  GLN A N   1 
ATOM   296  C CA  . GLN A 1 39  ? 7.207   -6.008  2.021   1.00 12.86 ? 38  GLN A CA  1 
ATOM   297  C C   . GLN A 1 39  ? 7.811   -6.497  0.709   1.00 14.14 ? 38  GLN A C   1 
ATOM   298  O O   . GLN A 1 39  ? 8.982   -6.258  0.411   1.00 14.05 ? 38  GLN A O   1 
ATOM   299  C CB  . GLN A 1 39  ? 7.327   -4.481  2.129   1.00 12.21 ? 38  GLN A CB  1 
ATOM   300  C CG  . GLN A 1 39  ? 6.695   -3.754  0.949   1.00 11.68 ? 38  GLN A CG  1 
ATOM   301  C CD  . GLN A 1 39  ? 6.626   -2.256  1.135   1.00 11.70 ? 38  GLN A CD  1 
ATOM   302  O OE1 . GLN A 1 39  ? 7.612   -1.619  1.507   1.00 11.96 ? 38  GLN A OE1 1 
ATOM   303  N NE2 . GLN A 1 39  ? 5.457   -1.677  0.859   1.00 10.95 ? 38  GLN A NE2 1 
ATOM   304  N N   . ARG A 1 40  ? 6.993   -7.201  -0.063  1.00 16.22 ? 39  ARG A N   1 
ATOM   305  C CA  . ARG A 1 40  ? 7.412   -7.735  -1.350  1.00 18.48 ? 39  ARG A CA  1 
ATOM   306  C C   . ARG A 1 40  ? 7.172   -6.660  -2.403  1.00 20.36 ? 39  ARG A C   1 
ATOM   307  O O   . ARG A 1 40  ? 6.382   -5.740  -2.191  1.00 20.75 ? 39  ARG A O   1 
ATOM   308  C CB  . ARG A 1 40  ? 6.616   -9.002  -1.675  1.00 18.46 ? 39  ARG A CB  1 
ATOM   309  N N   . PRO A 1 41  ? 7.829   -6.778  -3.569  1.00 22.25 ? 40  PRO A N   1 
ATOM   310  C CA  . PRO A 1 41  ? 7.705   -5.813  -4.667  1.00 22.72 ? 40  PRO A CA  1 
ATOM   311  C C   . PRO A 1 41  ? 6.292   -5.447  -5.100  1.00 23.57 ? 40  PRO A C   1 
ATOM   312  O O   . PRO A 1 41  ? 5.453   -6.316  -5.358  1.00 24.40 ? 40  PRO A O   1 
ATOM   313  C CB  . PRO A 1 41  ? 8.512   -6.475  -5.789  1.00 23.06 ? 40  PRO A CB  1 
ATOM   314  C CG  . PRO A 1 41  ? 8.402   -7.955  -5.451  1.00 23.14 ? 40  PRO A CG  1 
ATOM   315  C CD  . PRO A 1 41  ? 8.718   -7.876  -3.977  1.00 22.33 ? 40  PRO A CD  1 
ATOM   316  N N   . GLY A 1 42  ? 6.041   -4.144  -5.175  1.00 23.68 ? 41  GLY A N   1 
ATOM   317  C CA  . GLY A 1 42  ? 4.745   -3.647  -5.596  1.00 24.14 ? 41  GLY A CA  1 
ATOM   318  C C   . GLY A 1 42  ? 3.549   -4.108  -4.786  1.00 23.99 ? 41  GLY A C   1 
ATOM   319  O O   . GLY A 1 42  ? 2.427   -4.104  -5.285  1.00 25.17 ? 41  GLY A O   1 
ATOM   320  N N   . SER A 1 43  ? 3.769   -4.502  -3.539  1.00 23.44 ? 42  SER A N   1 
ATOM   321  C CA  . SER A 1 43  ? 2.661   -4.949  -2.710  1.00 22.22 ? 42  SER A CA  1 
ATOM   322  C C   . SER A 1 43  ? 2.698   -4.317  -1.327  1.00 20.60 ? 42  SER A C   1 
ATOM   323  O O   . SER A 1 43  ? 3.669   -3.652  -0.961  1.00 19.52 ? 42  SER A O   1 
ATOM   324  C CB  . SER A 1 43  ? 2.675   -6.472  -2.596  1.00 23.12 ? 42  SER A CB  1 
ATOM   325  O OG  . SER A 1 43  ? 3.906   -6.923  -2.074  1.00 26.12 ? 42  SER A OG  1 
ATOM   326  N N   . ALA A 1 44  ? 1.628   -4.530  -0.568  1.00 18.48 ? 43  ALA A N   1 
ATOM   327  C CA  . ALA A 1 44  ? 1.501   -3.983  0.774   1.00 16.86 ? 43  ALA A CA  1 
ATOM   328  C C   . ALA A 1 44  ? 2.282   -4.779  1.811   1.00 15.79 ? 43  ALA A C   1 
ATOM   329  O O   . ALA A 1 44  ? 2.540   -5.967  1.638   1.00 15.55 ? 43  ALA A O   1 
ATOM   330  C CB  . ALA A 1 44  ? 0.030   -3.931  1.169   1.00 16.99 ? 43  ALA A CB  1 
ATOM   331  N N   . PRO A 1 45  ? 2.674   -4.125  2.910   1.00 14.65 ? 44  PRO A N   1 
ATOM   332  C CA  . PRO A 1 45  ? 3.426   -4.806  3.965   1.00 13.51 ? 44  PRO A CA  1 
ATOM   333  C C   . PRO A 1 45  ? 2.547   -5.808  4.707   1.00 13.36 ? 44  PRO A C   1 
ATOM   334  O O   . PRO A 1 45  ? 1.325   -5.668  4.744   1.00 12.47 ? 44  PRO A O   1 
ATOM   335  C CB  . PRO A 1 45  ? 3.842   -3.653  4.884   1.00 13.61 ? 44  PRO A CB  1 
ATOM   336  C CG  . PRO A 1 45  ? 3.798   -2.421  3.947   1.00 14.57 ? 44  PRO A CG  1 
ATOM   337  C CD  . PRO A 1 45  ? 2.491   -2.707  3.260   1.00 13.93 ? 44  PRO A CD  1 
ATOM   338  N N   . ILE A 1 46  ? 3.173   -6.828  5.281   1.00 12.81 ? 45  ILE A N   1 
ATOM   339  C CA  . ILE A 1 46  ? 2.446   -7.799  6.081   1.00 13.21 ? 45  ILE A CA  1 
ATOM   340  C C   . ILE A 1 46  ? 3.251   -7.984  7.362   1.00 13.19 ? 45  ILE A C   1 
ATOM   341  O O   . ILE A 1 46  ? 4.480   -7.869  7.362   1.00 12.28 ? 45  ILE A O   1 
ATOM   342  C CB  . ILE A 1 46  ? 2.285   -9.171  5.385   1.00 14.39 ? 45  ILE A CB  1 
ATOM   343  C CG1 . ILE A 1 46  ? 3.650   -9.821  5.171   1.00 14.28 ? 45  ILE A CG1 1 
ATOM   344  C CG2 . ILE A 1 46  ? 1.530   -9.001  4.073   1.00 14.13 ? 45  ILE A CG2 1 
ATOM   345  C CD1 . ILE A 1 46  ? 3.563   -11.245 4.678   1.00 16.68 ? 45  ILE A CD1 1 
ATOM   346  N N   . THR A 1 47  ? 2.554   -8.258  8.455   1.00 12.72 ? 46  THR A N   1 
ATOM   347  C CA  . THR A 1 47  ? 3.209   -8.446  9.735   1.00 12.40 ? 46  THR A CA  1 
ATOM   348  C C   . THR A 1 47  ? 3.687   -9.884  9.876   1.00 12.90 ? 46  THR A C   1 
ATOM   349  O O   . THR A 1 47  ? 2.908   -10.820 9.706   1.00 14.19 ? 46  THR A O   1 
ATOM   350  C CB  . THR A 1 47  ? 2.245   -8.133  10.889  1.00 11.89 ? 46  THR A CB  1 
ATOM   351  O OG1 . THR A 1 47  ? 1.755   -6.795  10.744  1.00 11.50 ? 46  THR A OG1 1 
ATOM   352  C CG2 . THR A 1 47  ? 2.948   -8.273  12.230  1.00 11.40 ? 46  THR A CG2 1 
ATOM   353  N N   . VAL A 1 48  ? 4.974   -10.056 10.158  1.00 13.16 ? 47  VAL A N   1 
ATOM   354  C CA  . VAL A 1 48  ? 5.528   -11.383 10.362  1.00 12.80 ? 47  VAL A CA  1 
ATOM   355  C C   . VAL A 1 48  ? 5.790   -11.563 11.851  1.00 12.57 ? 47  VAL A C   1 
ATOM   356  O O   . VAL A 1 48  ? 5.835   -12.690 12.351  1.00 12.22 ? 47  VAL A O   1 
ATOM   357  C CB  . VAL A 1 48  ? 6.837   -11.599 9.558   1.00 13.34 ? 47  VAL A CB  1 
ATOM   358  C CG1 . VAL A 1 48  ? 6.523   -11.634 8.064   1.00 13.83 ? 47  VAL A CG1 1 
ATOM   359  C CG2 . VAL A 1 48  ? 7.833   -10.498 9.859   1.00 13.36 ? 47  VAL A CG2 1 
ATOM   360  N N   . ILE A 1 49  ? 5.950   -10.440 12.549  1.00 11.71 ? 48  ILE A N   1 
ATOM   361  C CA  . ILE A 1 49  ? 6.193   -10.421 13.992  1.00 11.09 ? 48  ILE A CA  1 
ATOM   362  C C   . ILE A 1 49  ? 5.619   -9.151  14.619  1.00 11.12 ? 48  ILE A C   1 
ATOM   363  O O   . ILE A 1 49  ? 5.724   -8.061  14.051  1.00 10.54 ? 48  ILE A O   1 
ATOM   364  C CB  . ILE A 1 49  ? 7.710   -10.423 14.340  1.00 10.31 ? 48  ILE A CB  1 
ATOM   365  C CG1 . ILE A 1 49  ? 8.366   -11.735 13.917  1.00 9.77  ? 48  ILE A CG1 1 
ATOM   366  C CG2 . ILE A 1 49  ? 7.899   -10.171 15.841  1.00 10.40 ? 48  ILE A CG2 1 
ATOM   367  C CD1 . ILE A 1 49  ? 7.885   -12.947 14.679  1.00 9.25  ? 48  ILE A CD1 1 
ATOM   368  N N   . TYR A 1 50  ? 5.005   -9.297  15.786  1.00 11.37 ? 49  TYR A N   1 
ATOM   369  C CA  . TYR A 1 50  ? 4.480   -8.146  16.507  1.00 11.50 ? 49  TYR A CA  1 
ATOM   370  C C   . TYR A 1 50  ? 4.763   -8.393  17.986  1.00 11.97 ? 49  TYR A C   1 
ATOM   371  O O   . TYR A 1 50  ? 4.958   -9.538  18.397  1.00 12.10 ? 49  TYR A O   1 
ATOM   372  C CB  . TYR A 1 50  ? 2.986   -7.956  16.222  1.00 12.54 ? 49  TYR A CB  1 
ATOM   373  C CG  . TYR A 1 50  ? 2.069   -9.026  16.766  1.00 12.20 ? 49  TYR A CG  1 
ATOM   374  C CD1 . TYR A 1 50  ? 1.615   -8.977  18.082  1.00 13.35 ? 49  TYR A CD1 1 
ATOM   375  C CD2 . TYR A 1 50  ? 1.645   -10.080 15.959  1.00 13.23 ? 49  TYR A CD2 1 
ATOM   376  C CE1 . TYR A 1 50  ? 0.756   -9.952  18.582  1.00 13.88 ? 49  TYR A CE1 1 
ATOM   377  C CE2 . TYR A 1 50  ? 0.788   -11.061 16.448  1.00 14.03 ? 49  TYR A CE2 1 
ATOM   378  C CZ  . TYR A 1 50  ? 0.349   -10.990 17.757  1.00 14.08 ? 49  TYR A CZ  1 
ATOM   379  O OH  . TYR A 1 50  ? -0.487  -11.963 18.245  1.00 15.26 ? 49  TYR A OH  1 
ATOM   380  N N   . GLU A 1 51  ? 4.822   -7.330  18.782  1.00 12.02 ? 50  GLU A N   1 
ATOM   381  C CA  . GLU A 1 51  ? 5.115   -7.486  20.203  1.00 12.93 ? 50  GLU A CA  1 
ATOM   382  C C   . GLU A 1 51  ? 6.375   -8.322  20.455  1.00 12.43 ? 50  GLU A C   1 
ATOM   383  O O   . GLU A 1 51  ? 6.377   -9.280  21.233  1.00 12.37 ? 50  GLU A O   1 
ATOM   384  C CB  . GLU A 1 51  ? 3.897   -8.069  20.933  1.00 13.41 ? 50  GLU A CB  1 
ATOM   385  C CG  . GLU A 1 51  ? 2.830   -7.005  21.209  1.00 14.93 ? 50  GLU A CG  1 
ATOM   386  C CD  . GLU A 1 51  ? 1.496   -7.567  21.675  1.00 16.69 ? 50  GLU A CD  1 
ATOM   387  O OE1 . GLU A 1 51  ? 1.483   -8.440  22.566  1.00 17.01 ? 50  GLU A OE1 1 
ATOM   388  O OE2 . GLU A 1 51  ? 0.453   -7.111  21.157  1.00 18.02 ? 50  GLU A OE2 1 
ATOM   389  N N   . ASP A 1 52  ? 7.443   -7.937  19.764  1.00 11.62 ? 51  ASP A N   1 
ATOM   390  C CA  . ASP A 1 52  ? 8.760   -8.562  19.874  1.00 11.81 ? 51  ASP A CA  1 
ATOM   391  C C   . ASP A 1 52  ? 8.950   -9.957  19.300  1.00 11.46 ? 51  ASP A C   1 
ATOM   392  O O   . ASP A 1 52  ? 9.937   -10.200 18.605  1.00 10.80 ? 51  ASP A O   1 
ATOM   393  C CB  . ASP A 1 52  ? 9.222   -8.577  21.334  1.00 11.86 ? 51  ASP A CB  1 
ATOM   394  C CG  . ASP A 1 52  ? 9.104   -7.222  21.989  1.00 12.60 ? 51  ASP A CG  1 
ATOM   395  O OD1 . ASP A 1 52  ? 9.339   -6.209  21.300  1.00 11.79 ? 51  ASP A OD1 1 
ATOM   396  O OD2 . ASP A 1 52  ? 8.796   -7.168  23.195  1.00 13.74 ? 51  ASP A OD2 1 
ATOM   397  N N   . ASN A 1 53  ? 8.028   -10.875 19.589  1.00 11.80 ? 52  ASN A N   1 
ATOM   398  C CA  . ASN A 1 53  ? 8.171   -12.241 19.099  1.00 12.22 ? 52  ASN A CA  1 
ATOM   399  C C   . ASN A 1 53  ? 6.871   -12.980 18.785  1.00 12.63 ? 52  ASN A C   1 
ATOM   400  O O   . ASN A 1 53  ? 6.867   -14.209 18.704  1.00 12.28 ? 52  ASN A O   1 
ATOM   401  C CB  . ASN A 1 53  ? 8.971   -13.072 20.108  1.00 12.99 ? 52  ASN A CB  1 
ATOM   402  C CG  . ASN A 1 53  ? 8.304   -13.137 21.477  1.00 13.42 ? 52  ASN A CG  1 
ATOM   403  O OD1 . ASN A 1 53  ? 7.201   -12.629 21.672  1.00 13.08 ? 52  ASN A OD1 1 
ATOM   404  N ND2 . ASN A 1 53  ? 8.976   -13.775 22.431  1.00 14.76 ? 52  ASN A ND2 1 
ATOM   405  N N   . GLN A 1 54  ? 5.777   -12.248 18.605  1.00 12.83 ? 53  GLN A N   1 
ATOM   406  C CA  . GLN A 1 54  ? 4.497   -12.883 18.304  1.00 13.07 ? 53  GLN A CA  1 
ATOM   407  C C   . GLN A 1 54  ? 4.265   -13.030 16.803  1.00 14.01 ? 53  GLN A C   1 
ATOM   408  O O   . GLN A 1 54  ? 4.416   -12.070 16.049  1.00 13.78 ? 53  GLN A O   1 
ATOM   409  C CB  . GLN A 1 54  ? 3.343   -12.082 18.924  1.00 12.00 ? 53  GLN A CB  1 
ATOM   410  C CG  . GLN A 1 54  ? 3.398   -11.986 20.442  1.00 10.10 ? 53  GLN A CG  1 
ATOM   411  C CD  . GLN A 1 54  ? 3.369   -13.345 21.106  1.00 9.86  ? 53  GLN A CD  1 
ATOM   412  O OE1 . GLN A 1 54  ? 2.372   -14.062 21.035  1.00 9.47  ? 53  GLN A OE1 1 
ATOM   413  N NE2 . GLN A 1 54  ? 4.472   -13.712 21.747  1.00 8.99  ? 53  GLN A NE2 1 
ATOM   414  N N   . ARG A 1 55  ? 3.895   -14.240 16.381  1.00 14.71 ? 54  ARG A N   1 
ATOM   415  C CA  . ARG A 1 55  ? 3.622   -14.536 14.975  1.00 15.55 ? 54  ARG A CA  1 
ATOM   416  C C   . ARG A 1 55  ? 2.140   -14.680 14.694  1.00 16.04 ? 54  ARG A C   1 
ATOM   417  O O   . ARG A 1 55  ? 1.475   -15.513 15.303  1.00 16.42 ? 54  ARG A O   1 
ATOM   418  C CB  . ARG A 1 55  ? 4.279   -15.851 14.537  1.00 15.38 ? 54  ARG A CB  1 
ATOM   419  C CG  . ARG A 1 55  ? 5.756   -15.801 14.263  1.00 15.50 ? 54  ARG A CG  1 
ATOM   420  C CD  . ARG A 1 55  ? 6.284   -17.165 13.808  1.00 15.87 ? 54  ARG A CD  1 
ATOM   421  N NE  . ARG A 1 55  ? 6.193   -18.189 14.850  1.00 16.14 ? 54  ARG A NE  1 
ATOM   422  C CZ  . ARG A 1 55  ? 5.251   -19.127 14.918  1.00 17.18 ? 54  ARG A CZ  1 
ATOM   423  N NH1 . ARG A 1 55  ? 4.295   -19.191 13.999  1.00 16.42 ? 54  ARG A NH1 1 
ATOM   424  N NH2 . ARG A 1 55  ? 5.268   -20.011 15.910  1.00 17.18 ? 54  ARG A NH2 1 
ATOM   425  N N   . PRO A 1 56  ? 1.593   -13.855 13.788  1.00 17.00 ? 55  PRO A N   1 
ATOM   426  C CA  . PRO A 1 56  ? 0.168   -13.999 13.490  1.00 17.97 ? 55  PRO A CA  1 
ATOM   427  C C   . PRO A 1 56  ? 0.026   -15.349 12.784  1.00 19.40 ? 55  PRO A C   1 
ATOM   428  O O   . PRO A 1 56  ? 1.005   -15.861 12.228  1.00 18.79 ? 55  PRO A O   1 
ATOM   429  C CB  . PRO A 1 56  ? -0.099  -12.808 12.567  1.00 18.33 ? 55  PRO A CB  1 
ATOM   430  C CG  . PRO A 1 56  ? 1.219   -12.658 11.848  1.00 18.24 ? 55  PRO A CG  1 
ATOM   431  C CD  . PRO A 1 56  ? 2.156   -12.721 13.035  1.00 17.13 ? 55  PRO A CD  1 
ATOM   432  N N   . SER A 1 57  ? -1.165  -15.939 12.816  1.00 20.71 ? 56  SER A N   1 
ATOM   433  C CA  . SER A 1 57  ? -1.361  -17.231 12.165  1.00 23.00 ? 56  SER A CA  1 
ATOM   434  C C   . SER A 1 57  ? -1.125  -17.031 10.673  1.00 23.68 ? 56  SER A C   1 
ATOM   435  O O   . SER A 1 57  ? -1.436  -15.973 10.124  1.00 24.69 ? 56  SER A O   1 
ATOM   436  C CB  . SER A 1 57  ? -2.783  -17.761 12.403  1.00 23.67 ? 56  SER A CB  1 
ATOM   437  O OG  . SER A 1 57  ? -3.735  -17.027 11.651  1.00 24.92 ? 56  SER A OG  1 
ATOM   438  N N   . GLY A 1 58  ? -0.569  -18.042 10.019  1.00 24.32 ? 57  GLY A N   1 
ATOM   439  C CA  . GLY A 1 58  ? -0.293  -17.925 8.600   1.00 24.81 ? 57  GLY A CA  1 
ATOM   440  C C   . GLY A 1 58  ? 1.196   -17.771 8.369   1.00 24.85 ? 57  GLY A C   1 
ATOM   441  O O   . GLY A 1 58  ? 1.740   -18.281 7.389   1.00 25.96 ? 57  GLY A O   1 
ATOM   442  N N   . VAL A 1 59  ? 1.858   -17.064 9.281   1.00 24.26 ? 58  VAL A N   1 
ATOM   443  C CA  . VAL A 1 59  ? 3.296   -16.851 9.192   1.00 23.61 ? 58  VAL A CA  1 
ATOM   444  C C   . VAL A 1 59  ? 4.011   -18.110 9.689   1.00 23.62 ? 58  VAL A C   1 
ATOM   445  O O   . VAL A 1 59  ? 3.767   -18.569 10.805  1.00 23.26 ? 58  VAL A O   1 
ATOM   446  C CB  . VAL A 1 59  ? 3.727   -15.636 10.052  1.00 23.35 ? 58  VAL A CB  1 
ATOM   447  C CG1 . VAL A 1 59  ? 5.222   -15.396 9.914   1.00 22.79 ? 58  VAL A CG1 1 
ATOM   448  C CG2 . VAL A 1 59  ? 2.952   -14.405 9.626   1.00 22.67 ? 58  VAL A CG2 1 
ATOM   449  N N   . PRO A 1 60  ? 4.899   -18.687 8.862   1.00 24.10 ? 59  PRO A N   1 
ATOM   450  C CA  . PRO A 1 60  ? 5.654   -19.898 9.210   1.00 24.25 ? 59  PRO A CA  1 
ATOM   451  C C   . PRO A 1 60  ? 6.534   -19.662 10.435  1.00 24.31 ? 59  PRO A C   1 
ATOM   452  O O   . PRO A 1 60  ? 7.064   -18.564 10.610  1.00 23.50 ? 59  PRO A O   1 
ATOM   453  C CB  . PRO A 1 60  ? 6.487   -20.148 7.950   1.00 24.51 ? 59  PRO A CB  1 
ATOM   454  C CG  . PRO A 1 60  ? 5.624   -19.533 6.853   1.00 24.81 ? 59  PRO A CG  1 
ATOM   455  C CD  . PRO A 1 60  ? 5.296   -18.225 7.522   1.00 24.03 ? 59  PRO A CD  1 
ATOM   456  N N   . ASP A 1 61  ? 6.699   -20.684 11.275  1.00 24.15 ? 60  ASP A N   1 
ATOM   457  C CA  . ASP A 1 61  ? 7.527   -20.534 12.466  1.00 24.50 ? 60  ASP A CA  1 
ATOM   458  C C   . ASP A 1 61  ? 8.984   -20.327 12.065  1.00 23.79 ? 60  ASP A C   1 
ATOM   459  O O   . ASP A 1 61  ? 9.866   -20.220 12.916  1.00 23.59 ? 60  ASP A O   1 
ATOM   460  C CB  . ASP A 1 61  ? 7.389   -21.751 13.398  1.00 25.98 ? 60  ASP A CB  1 
ATOM   461  C CG  . ASP A 1 61  ? 7.858   -23.042 12.761  1.00 27.25 ? 60  ASP A CG  1 
ATOM   462  O OD1 . ASP A 1 61  ? 7.312   -23.426 11.706  1.00 28.42 ? 60  ASP A OD1 1 
ATOM   463  O OD2 . ASP A 1 61  ? 8.770   -23.682 13.324  1.00 28.39 ? 60  ASP A OD2 1 
ATOM   464  N N   . ARG A 1 62  ? 9.222   -20.272 10.757  1.00 23.43 ? 61  ARG A N   1 
ATOM   465  C CA  . ARG A 1 62  ? 10.557  -20.043 10.217  1.00 22.85 ? 61  ARG A CA  1 
ATOM   466  C C   . ARG A 1 62  ? 10.994  -18.621 10.556  1.00 21.78 ? 61  ARG A C   1 
ATOM   467  O O   . ARG A 1 62  ? 12.186  -18.303 10.543  1.00 22.16 ? 61  ARG A O   1 
ATOM   468  C CB  . ARG A 1 62  ? 10.551  -20.250 8.699   1.00 24.20 ? 61  ARG A CB  1 
ATOM   469  C CG  . ARG A 1 62  ? 10.493  -21.714 8.281   1.00 26.22 ? 61  ARG A CG  1 
ATOM   470  C CD  . ARG A 1 62  ? 10.252  -21.905 6.785   1.00 27.62 ? 61  ARG A CD  1 
ATOM   471  N NE  . ARG A 1 62  ? 11.052  -21.008 5.958   1.00 28.92 ? 61  ARG A NE  1 
ATOM   472  C CZ  . ARG A 1 62  ? 10.670  -19.787 5.594   1.00 28.58 ? 61  ARG A CZ  1 
ATOM   473  N NH1 . ARG A 1 62  ? 9.495   -19.314 5.980   1.00 29.54 ? 61  ARG A NH1 1 
ATOM   474  N NH2 . ARG A 1 62  ? 11.466  -19.037 4.850   1.00 28.79 ? 61  ARG A NH2 1 
ATOM   475  N N   . PHE A 1 63  ? 10.019  -17.767 10.856  1.00 20.17 ? 62  PHE A N   1 
ATOM   476  C CA  . PHE A 1 63  ? 10.301  -16.386 11.226  1.00 19.10 ? 62  PHE A CA  1 
ATOM   477  C C   . PHE A 1 63  ? 10.267  -16.286 12.743  1.00 17.49 ? 62  PHE A C   1 
ATOM   478  O O   . PHE A 1 63  ? 9.372   -16.831 13.380  1.00 18.09 ? 62  PHE A O   1 
ATOM   479  C CB  . PHE A 1 63  ? 9.262   -15.424 10.632  1.00 19.17 ? 62  PHE A CB  1 
ATOM   480  C CG  . PHE A 1 63  ? 9.240   -15.398 9.131   1.00 19.65 ? 62  PHE A CG  1 
ATOM   481  C CD1 . PHE A 1 63  ? 8.660   -16.437 8.409   1.00 19.98 ? 62  PHE A CD1 1 
ATOM   482  C CD2 . PHE A 1 63  ? 9.830   -14.345 8.436   1.00 19.53 ? 62  PHE A CD2 1 
ATOM   483  C CE1 . PHE A 1 63  ? 8.667   -16.428 7.016   1.00 20.14 ? 62  PHE A CE1 1 
ATOM   484  C CE2 . PHE A 1 63  ? 9.844   -14.326 7.039   1.00 20.00 ? 62  PHE A CE2 1 
ATOM   485  C CZ  . PHE A 1 63  ? 9.262   -15.370 6.330   1.00 20.04 ? 62  PHE A CZ  1 
ATOM   486  N N   . ALA A 1 64  ? 11.244  -15.596 13.319  1.00 15.74 ? 63  ALA A N   1 
ATOM   487  C CA  . ALA A 1 64  ? 11.305  -15.448 14.766  1.00 14.69 ? 63  ALA A CA  1 
ATOM   488  C C   . ALA A 1 64  ? 11.837  -14.086 15.182  1.00 13.88 ? 63  ALA A C   1 
ATOM   489  O O   . ALA A 1 64  ? 12.805  -13.589 14.614  1.00 12.57 ? 63  ALA A O   1 
ATOM   490  C CB  . ALA A 1 64  ? 12.179  -16.543 15.362  1.00 14.54 ? 63  ALA A CB  1 
ATOM   491  N N   . GLY A 1 65  ? 11.192  -13.491 16.180  1.00 13.10 ? 64  GLY A N   1 
ATOM   492  C CA  . GLY A 1 65  ? 11.631  -12.202 16.679  1.00 12.52 ? 64  GLY A CA  1 
ATOM   493  C C   . GLY A 1 65  ? 12.336  -12.384 18.010  1.00 12.10 ? 64  GLY A C   1 
ATOM   494  O O   . GLY A 1 65  ? 11.976  -13.263 18.794  1.00 11.26 ? 64  GLY A O   1 
ATOM   495  N N   . SER A 1 66  ? 13.349  -11.563 18.260  1.00 12.19 ? 65  SER A N   1 
ATOM   496  C CA  . SER A 1 66  ? 14.101  -11.628 19.507  1.00 13.14 ? 65  SER A CA  1 
ATOM   497  C C   . SER A 1 66  ? 14.609  -10.241 19.867  1.00 13.12 ? 65  SER A C   1 
ATOM   498  O O   . SER A 1 66  ? 14.525  -9.301  19.065  1.00 12.44 ? 65  SER A O   1 
ATOM   499  C CB  . SER A 1 66  ? 15.287  -12.594 19.386  1.00 12.88 ? 65  SER A CB  1 
ATOM   500  O OG  . SER A 1 66  ? 16.210  -12.154 18.405  1.00 13.67 ? 65  SER A OG  1 
ATOM   501  N N   . ILE A 1 67  ? 15.155  -10.125 21.070  1.00 13.60 ? 66  ILE A N   1 
ATOM   502  C CA  . ILE A 1 67  ? 15.658  -8.854  21.566  1.00 13.09 ? 66  ILE A CA  1 
ATOM   503  C C   . ILE A 1 67  ? 17.032  -9.049  22.213  1.00 13.96 ? 66  ILE A C   1 
ATOM   504  O O   . ILE A 1 67  ? 17.207  -9.931  23.055  1.00 13.47 ? 66  ILE A O   1 
ATOM   505  C CB  . ILE A 1 67  ? 14.674  -8.269  22.619  1.00 13.06 ? 66  ILE A CB  1 
ATOM   506  C CG1 . ILE A 1 67  ? 13.281  -8.083  21.998  1.00 12.83 ? 66  ILE A CG1 1 
ATOM   507  C CG2 . ILE A 1 67  ? 15.207  -6.952  23.171  1.00 11.52 ? 66  ILE A CG2 1 
ATOM   508  C CD1 . ILE A 1 67  ? 13.211  -7.065  20.857  1.00 12.53 ? 66  ILE A CD1 1 
ATOM   509  N N   . ASP A 1 68  A 18.007  -8.241  21.806  1.00 13.98 ? 66  ASP A N   1 
ATOM   510  C CA  . ASP A 1 68  A 19.348  -8.322  22.381  1.00 15.44 ? 66  ASP A CA  1 
ATOM   511  C C   . ASP A 1 68  A 19.618  -6.990  23.064  1.00 15.89 ? 66  ASP A C   1 
ATOM   512  O O   . ASP A 1 68  A 19.949  -6.002  22.410  1.00 15.56 ? 66  ASP A O   1 
ATOM   513  C CB  . ASP A 1 68  A 20.421  -8.545  21.309  1.00 15.45 ? 66  ASP A CB  1 
ATOM   514  C CG  . ASP A 1 68  A 21.805  -8.765  21.913  1.00 16.61 ? 66  ASP A CG  1 
ATOM   515  O OD1 . ASP A 1 68  A 22.055  -8.244  23.019  1.00 15.54 ? 66  ASP A OD1 1 
ATOM   516  O OD2 . ASP A 1 68  A 22.647  -9.441  21.284  1.00 17.27 ? 66  ASP A OD2 1 
ATOM   517  N N   . ARG A 1 69  B 19.474  -6.965  24.381  1.00 16.73 ? 66  ARG A N   1 
ATOM   518  C CA  . ARG A 1 69  B 19.696  -5.745  25.131  1.00 18.04 ? 66  ARG A CA  1 
ATOM   519  C C   . ARG A 1 69  B 21.153  -5.299  25.231  1.00 18.31 ? 66  ARG A C   1 
ATOM   520  O O   . ARG A 1 69  B 21.418  -4.140  25.545  1.00 18.93 ? 66  ARG A O   1 
ATOM   521  C CB  . ARG A 1 69  B 19.035  -5.880  26.509  1.00 19.02 ? 66  ARG A CB  1 
ATOM   522  C CG  . ARG A 1 69  B 17.522  -5.692  26.389  1.00 20.98 ? 66  ARG A CG  1 
ATOM   523  C CD  . ARG A 1 69  B 16.647  -6.670  27.163  1.00 21.99 ? 66  ARG A CD  1 
ATOM   524  N NE  . ARG A 1 69  B 16.757  -6.553  28.607  1.00 22.52 ? 66  ARG A NE  1 
ATOM   525  C CZ  . ARG A 1 69  B 15.839  -7.006  29.457  1.00 23.13 ? 66  ARG A CZ  1 
ATOM   526  N NH1 . ARG A 1 69  B 14.741  -7.602  29.008  1.00 22.64 ? 66  ARG A NH1 1 
ATOM   527  N NH2 . ARG A 1 69  B 16.024  -6.874  30.760  1.00 22.74 ? 66  ARG A NH2 1 
ATOM   528  N N   . SER A 1 70  ? 22.096  -6.192  24.937  1.00 18.58 ? 67  SER A N   1 
ATOM   529  C CA  . SER A 1 70  ? 23.510  -5.821  25.002  1.00 18.48 ? 67  SER A CA  1 
ATOM   530  C C   . SER A 1 70  ? 23.875  -4.964  23.792  1.00 18.65 ? 67  SER A C   1 
ATOM   531  O O   . SER A 1 70  ? 24.795  -4.150  23.848  1.00 19.45 ? 67  SER A O   1 
ATOM   532  C CB  . SER A 1 70  ? 24.408  -7.062  25.046  1.00 18.46 ? 67  SER A CB  1 
ATOM   533  O OG  . SER A 1 70  ? 24.389  -7.776  23.820  1.00 18.20 ? 67  SER A OG  1 
ATOM   534  N N   . SER A 1 71  ? 23.145  -5.148  22.696  1.00 18.13 ? 68  SER A N   1 
ATOM   535  C CA  . SER A 1 71  ? 23.384  -4.372  21.485  1.00 17.27 ? 68  SER A CA  1 
ATOM   536  C C   . SER A 1 71  ? 22.186  -3.443  21.237  1.00 16.51 ? 68  SER A C   1 
ATOM   537  O O   . SER A 1 71  ? 22.046  -2.871  20.156  1.00 16.77 ? 68  SER A O   1 
ATOM   538  C CB  . SER A 1 71  ? 23.570  -5.309  20.288  1.00 16.83 ? 68  SER A CB  1 
ATOM   539  O OG  . SER A 1 71  ? 22.385  -6.040  20.020  1.00 18.37 ? 68  SER A OG  1 
ATOM   540  N N   . ASN A 1 72  ? 21.340  -3.305  22.256  1.00 15.39 ? 69  ASN A N   1 
ATOM   541  C CA  . ASN A 1 72  ? 20.130  -2.476  22.210  1.00 14.45 ? 69  ASN A CA  1 
ATOM   542  C C   . ASN A 1 72  ? 19.414  -2.626  20.873  1.00 13.79 ? 69  ASN A C   1 
ATOM   543  O O   . ASN A 1 72  ? 19.091  -1.641  20.208  1.00 13.84 ? 69  ASN A O   1 
ATOM   544  C CB  . ASN A 1 72  ? 20.470  -1.001  22.451  1.00 13.57 ? 69  ASN A CB  1 
ATOM   545  C CG  . ASN A 1 72  ? 19.266  -0.198  22.918  1.00 12.87 ? 69  ASN A CG  1 
ATOM   546  O OD1 . ASN A 1 72  ? 18.592  -0.581  23.873  1.00 13.26 ? 69  ASN A OD1 1 
ATOM   547  N ND2 . ASN A 1 72  ? 19.002  0.925   22.263  1.00 12.36 ? 69  ASN A ND2 1 
ATOM   548  N N   . SER A 1 73  ? 19.151  -3.866  20.486  1.00 13.03 ? 70  SER A N   1 
ATOM   549  C CA  . SER A 1 73  ? 18.500  -4.097  19.209  1.00 12.92 ? 70  SER A CA  1 
ATOM   550  C C   . SER A 1 73  ? 17.522  -5.259  19.216  1.00 12.34 ? 70  SER A C   1 
ATOM   551  O O   . SER A 1 73  ? 17.518  -6.092  20.121  1.00 12.02 ? 70  SER A O   1 
ATOM   552  C CB  . SER A 1 73  ? 19.554  -4.370  18.144  1.00 12.63 ? 70  SER A CB  1 
ATOM   553  O OG  . SER A 1 73  ? 20.223  -5.580  18.436  1.00 14.31 ? 70  SER A OG  1 
ATOM   554  N N   . ALA A 1 74  ? 16.693  -5.298  18.182  1.00 11.44 ? 71  ALA A N   1 
ATOM   555  C CA  . ALA A 1 74  ? 15.734  -6.374  18.011  1.00 10.88 ? 71  ALA A CA  1 
ATOM   556  C C   . ALA A 1 74  ? 16.223  -7.093  16.762  1.00 11.03 ? 71  ALA A C   1 
ATOM   557  O O   . ALA A 1 74  ? 16.893  -6.492  15.913  1.00 10.21 ? 71  ALA A O   1 
ATOM   558  C CB  . ALA A 1 74  ? 14.334  -5.819  17.793  1.00 10.49 ? 71  ALA A CB  1 
ATOM   559  N N   . SER A 1 75  ? 15.918  -8.377  16.650  1.00 10.72 ? 72  SER A N   1 
ATOM   560  C CA  . SER A 1 75  ? 16.340  -9.115  15.478  1.00 11.10 ? 72  SER A CA  1 
ATOM   561  C C   . SER A 1 75  ? 15.250  -10.002 14.919  1.00 11.51 ? 72  SER A C   1 
ATOM   562  O O   . SER A 1 75  ? 14.456  -10.588 15.663  1.00 11.91 ? 72  SER A O   1 
ATOM   563  C CB  . SER A 1 75  ? 17.572  -9.973  15.789  1.00 11.90 ? 72  SER A CB  1 
ATOM   564  O OG  . SER A 1 75  ? 18.716  -9.172  16.036  1.00 12.74 ? 72  SER A OG  1 
ATOM   565  N N   . LEU A 1 76  ? 15.208  -10.071 13.596  1.00 11.64 ? 73  LEU A N   1 
ATOM   566  C CA  . LEU A 1 76  ? 14.271  -10.928 12.897  1.00 12.20 ? 73  LEU A CA  1 
ATOM   567  C C   . LEU A 1 76  ? 15.157  -12.014 12.318  1.00 12.84 ? 73  LEU A C   1 
ATOM   568  O O   . LEU A 1 76  ? 16.085  -11.726 11.561  1.00 12.70 ? 73  LEU A O   1 
ATOM   569  C CB  . LEU A 1 76  ? 13.576  -10.195 11.754  1.00 11.92 ? 73  LEU A CB  1 
ATOM   570  C CG  . LEU A 1 76  ? 12.655  -11.124 10.949  1.00 13.05 ? 73  LEU A CG  1 
ATOM   571  C CD1 . LEU A 1 76  ? 11.479  -11.553 11.836  1.00 12.31 ? 73  LEU A CD1 1 
ATOM   572  C CD2 . LEU A 1 76  ? 12.154  -10.419 9.696   1.00 12.41 ? 73  LEU A CD2 1 
ATOM   573  N N   . THR A 1 77  ? 14.892  -13.256 12.699  1.00 13.45 ? 74  THR A N   1 
ATOM   574  C CA  . THR A 1 77  ? 15.667  -14.382 12.201  1.00 14.50 ? 74  THR A CA  1 
ATOM   575  C C   . THR A 1 77  ? 14.788  -15.219 11.284  1.00 14.90 ? 74  THR A C   1 
ATOM   576  O O   . THR A 1 77  ? 13.670  -15.587 11.648  1.00 14.99 ? 74  THR A O   1 
ATOM   577  C CB  . THR A 1 77  ? 16.175  -15.270 13.351  1.00 14.90 ? 74  THR A CB  1 
ATOM   578  O OG1 . THR A 1 77  ? 17.053  -14.513 14.191  1.00 15.40 ? 74  THR A OG1 1 
ATOM   579  C CG2 . THR A 1 77  ? 16.921  -16.469 12.801  1.00 15.40 ? 74  THR A CG2 1 
ATOM   580  N N   . ILE A 1 78  ? 15.295  -15.510 10.091  1.00 15.74 ? 75  ILE A N   1 
ATOM   581  C CA  . ILE A 1 78  ? 14.555  -16.304 9.120   1.00 16.52 ? 75  ILE A CA  1 
ATOM   582  C C   . ILE A 1 78  ? 15.378  -17.539 8.756   1.00 17.97 ? 75  ILE A C   1 
ATOM   583  O O   . ILE A 1 78  ? 16.471  -17.432 8.202   1.00 18.74 ? 75  ILE A O   1 
ATOM   584  C CB  . ILE A 1 78  ? 14.271  -15.493 7.840   1.00 15.47 ? 75  ILE A CB  1 
ATOM   585  C CG1 . ILE A 1 78  ? 13.605  -14.162 8.201   1.00 15.57 ? 75  ILE A CG1 1 
ATOM   586  C CG2 . ILE A 1 78  ? 13.341  -16.278 6.921   1.00 16.07 ? 75  ILE A CG2 1 
ATOM   587  C CD1 . ILE A 1 78  ? 13.385  -13.240 7.017   1.00 14.15 ? 75  ILE A CD1 1 
ATOM   588  N N   . SER A 1 79  ? 14.853  -18.712 9.088   1.00 19.53 ? 76  SER A N   1 
ATOM   589  C CA  . SER A 1 79  ? 15.535  -19.966 8.801   1.00 21.02 ? 76  SER A CA  1 
ATOM   590  C C   . SER A 1 79  ? 14.885  -20.624 7.586   1.00 21.59 ? 76  SER A C   1 
ATOM   591  O O   . SER A 1 79  ? 13.867  -20.138 7.092   1.00 21.79 ? 76  SER A O   1 
ATOM   592  C CB  . SER A 1 79  ? 15.455  -20.883 10.023  1.00 20.99 ? 76  SER A CB  1 
ATOM   593  O OG  . SER A 1 79  ? 14.106  -21.091 10.406  1.00 22.39 ? 76  SER A OG  1 
ATOM   594  N N   . GLY A 1 80  ? 15.474  -21.716 7.101   1.00 22.58 ? 77  GLY A N   1 
ATOM   595  C CA  . GLY A 1 80  ? 14.919  -22.394 5.939   1.00 23.47 ? 77  GLY A CA  1 
ATOM   596  C C   . GLY A 1 80  ? 14.641  -21.385 4.843   1.00 24.12 ? 77  GLY A C   1 
ATOM   597  O O   . GLY A 1 80  ? 13.625  -21.447 4.149   1.00 24.51 ? 77  GLY A O   1 
ATOM   598  N N   . LEU A 1 81  ? 15.567  -20.444 4.704   1.00 24.85 ? 78  LEU A N   1 
ATOM   599  C CA  . LEU A 1 81  ? 15.474  -19.367 3.730   1.00 25.42 ? 78  LEU A CA  1 
ATOM   600  C C   . LEU A 1 81  ? 15.115  -19.822 2.320   1.00 26.31 ? 78  LEU A C   1 
ATOM   601  O O   . LEU A 1 81  ? 15.757  -20.709 1.755   1.00 26.69 ? 78  LEU A O   1 
ATOM   602  C CB  . LEU A 1 81  ? 16.799  -18.602 3.700   1.00 25.27 ? 78  LEU A CB  1 
ATOM   603  C CG  . LEU A 1 81  ? 16.874  -17.343 2.840   1.00 24.83 ? 78  LEU A CG  1 
ATOM   604  C CD1 . LEU A 1 81  ? 15.862  -16.325 3.337   1.00 24.81 ? 78  LEU A CD1 1 
ATOM   605  C CD2 . LEU A 1 81  ? 18.283  -16.774 2.909   1.00 24.64 ? 78  LEU A CD2 1 
ATOM   606  N N   . LYS A 1 82  ? 14.077  -19.208 1.761   1.00 26.71 ? 79  LYS A N   1 
ATOM   607  C CA  . LYS A 1 82  ? 13.637  -19.520 0.409   1.00 27.49 ? 79  LYS A CA  1 
ATOM   608  C C   . LYS A 1 82  ? 13.639  -18.241 -0.420  1.00 27.57 ? 79  LYS A C   1 
ATOM   609  O O   . LYS A 1 82  ? 13.456  -17.147 0.114   1.00 27.82 ? 79  LYS A O   1 
ATOM   610  C CB  . LYS A 1 82  ? 12.232  -20.119 0.420   1.00 28.21 ? 79  LYS A CB  1 
ATOM   611  C CG  . LYS A 1 82  ? 12.110  -21.409 1.215   1.00 29.86 ? 79  LYS A CG  1 
ATOM   612  C CD  . LYS A 1 82  ? 10.727  -22.021 1.063   1.00 30.15 ? 79  LYS A CD  1 
ATOM   613  C CE  . LYS A 1 82  ? 9.636   -21.069 1.523   1.00 30.83 ? 79  LYS A CE  1 
ATOM   614  N NZ  . LYS A 1 82  ? 8.278   -21.655 1.328   1.00 31.82 ? 79  LYS A NZ  1 
ATOM   615  N N   . THR A 1 83  ? 13.847  -18.385 -1.724  1.00 27.81 ? 80  THR A N   1 
ATOM   616  C CA  . THR A 1 83  ? 13.878  -17.249 -2.641  1.00 27.66 ? 80  THR A CA  1 
ATOM   617  C C   . THR A 1 83  ? 12.620  -16.393 -2.507  1.00 27.46 ? 80  THR A C   1 
ATOM   618  O O   . THR A 1 83  ? 12.609  -15.212 -2.865  1.00 27.84 ? 80  THR A O   1 
ATOM   619  C CB  . THR A 1 83  ? 13.992  -17.730 -4.094  1.00 27.62 ? 80  THR A CB  1 
ATOM   620  O OG1 . THR A 1 83  ? 12.842  -18.518 -4.424  1.00 27.91 ? 80  THR A OG1 1 
ATOM   621  C CG2 . THR A 1 83  ? 15.246  -18.576 -4.271  1.00 27.46 ? 80  THR A CG2 1 
ATOM   622  N N   . GLU A 1 84  ? 11.559  -17.002 -1.993  1.00 26.70 ? 81  GLU A N   1 
ATOM   623  C CA  . GLU A 1 84  ? 10.297  -16.312 -1.798  1.00 25.86 ? 81  GLU A CA  1 
ATOM   624  C C   . GLU A 1 84  ? 10.392  -15.300 -0.659  1.00 24.81 ? 81  GLU A C   1 
ATOM   625  O O   . GLU A 1 84  ? 9.596   -14.366 -0.579  1.00 24.24 ? 81  GLU A O   1 
ATOM   626  C CB  . GLU A 1 84  ? 9.199   -17.327 -1.487  1.00 27.20 ? 81  GLU A CB  1 
ATOM   627  C CG  . GLU A 1 84  ? 7.854   -16.709 -1.181  1.00 30.07 ? 81  GLU A CG  1 
ATOM   628  C CD  . GLU A 1 84  ? 6.812   -17.748 -0.824  1.00 31.23 ? 81  GLU A CD  1 
ATOM   629  O OE1 . GLU A 1 84  ? 7.049   -18.519 0.133   1.00 32.26 ? 81  GLU A OE1 1 
ATOM   630  O OE2 . GLU A 1 84  ? 5.760   -17.792 -1.497  1.00 32.23 ? 81  GLU A OE2 1 
ATOM   631  N N   . ASP A 1 85  ? 11.364  -15.488 0.226   1.00 23.13 ? 82  ASP A N   1 
ATOM   632  C CA  . ASP A 1 85  ? 11.526  -14.578 1.352   1.00 22.18 ? 82  ASP A CA  1 
ATOM   633  C C   . ASP A 1 85  ? 12.140  -13.252 0.929   1.00 21.55 ? 82  ASP A C   1 
ATOM   634  O O   . ASP A 1 85  ? 12.108  -12.282 1.686   1.00 21.63 ? 82  ASP A O   1 
ATOM   635  C CB  . ASP A 1 85  ? 12.382  -15.217 2.449   1.00 21.53 ? 82  ASP A CB  1 
ATOM   636  C CG  . ASP A 1 85  ? 11.773  -16.493 2.987   1.00 20.72 ? 82  ASP A CG  1 
ATOM   637  O OD1 . ASP A 1 85  ? 10.565  -16.484 3.296   1.00 21.08 ? 82  ASP A OD1 1 
ATOM   638  O OD2 . ASP A 1 85  ? 12.502  -17.496 3.114   1.00 20.02 ? 82  ASP A OD2 1 
ATOM   639  N N   . GLU A 1 86  ? 12.707  -13.209 -0.273  1.00 21.20 ? 83  GLU A N   1 
ATOM   640  C CA  . GLU A 1 86  ? 13.297  -11.971 -0.757  1.00 20.40 ? 83  GLU A CA  1 
ATOM   641  C C   . GLU A 1 86  ? 12.264  -10.861 -0.699  1.00 19.03 ? 83  GLU A C   1 
ATOM   642  O O   . GLU A 1 86  ? 11.149  -10.999 -1.207  1.00 18.42 ? 83  GLU A O   1 
ATOM   643  C CB  . GLU A 1 86  ? 13.824  -12.121 -2.188  1.00 21.88 ? 83  GLU A CB  1 
ATOM   644  C CG  . GLU A 1 86  ? 15.246  -12.668 -2.267  1.00 24.15 ? 83  GLU A CG  1 
ATOM   645  C CD  . GLU A 1 86  ? 15.826  -12.602 -3.671  1.00 24.85 ? 83  GLU A CD  1 
ATOM   646  O OE1 . GLU A 1 86  ? 15.054  -12.401 -4.634  1.00 26.00 ? 83  GLU A OE1 1 
ATOM   647  O OE2 . GLU A 1 86  ? 17.056  -12.759 -3.814  1.00 25.70 ? 83  GLU A OE2 1 
ATOM   648  N N   . ALA A 1 87  ? 12.645  -9.765  -0.057  1.00 17.56 ? 84  ALA A N   1 
ATOM   649  C CA  . ALA A 1 87  ? 11.772  -8.612  0.092   1.00 15.85 ? 84  ALA A CA  1 
ATOM   650  C C   . ALA A 1 87  ? 12.440  -7.619  1.019   1.00 14.99 ? 84  ALA A C   1 
ATOM   651  O O   . ALA A 1 87  ? 13.566  -7.821  1.471   1.00 14.90 ? 84  ALA A O   1 
ATOM   652  C CB  . ALA A 1 87  ? 10.426  -9.035  0.683   1.00 16.38 ? 84  ALA A CB  1 
ATOM   653  N N   . ASP A 1 88  ? 11.731  -6.537  1.294   1.00 13.69 ? 85  ASP A N   1 
ATOM   654  C CA  . ASP A 1 88  ? 12.219  -5.515  2.194   1.00 12.62 ? 85  ASP A CA  1 
ATOM   655  C C   . ASP A 1 88  ? 11.580  -5.788  3.542   1.00 11.43 ? 85  ASP A C   1 
ATOM   656  O O   . ASP A 1 88  ? 10.394  -6.129  3.610   1.00 10.44 ? 85  ASP A O   1 
ATOM   657  C CB  . ASP A 1 88  ? 11.807  -4.141  1.671   1.00 13.63 ? 85  ASP A CB  1 
ATOM   658  C CG  . ASP A 1 88  ? 12.567  -3.757  0.421   1.00 13.70 ? 85  ASP A CG  1 
ATOM   659  O OD1 . ASP A 1 88  ? 13.719  -4.210  0.282   1.00 13.55 ? 85  ASP A OD1 1 
ATOM   660  O OD2 . ASP A 1 88  ? 12.033  -2.999  -0.406  1.00 14.55 ? 85  ASP A OD2 1 
ATOM   661  N N   . TYR A 1 89  ? 12.373  -5.675  4.603   1.00 10.13 ? 86  TYR A N   1 
ATOM   662  C CA  . TYR A 1 89  ? 11.863  -5.887  5.947   1.00 9.56  ? 86  TYR A CA  1 
ATOM   663  C C   . TYR A 1 89  ? 12.040  -4.635  6.778   1.00 8.89  ? 86  TYR A C   1 
ATOM   664  O O   . TYR A 1 89  ? 13.105  -4.023  6.792   1.00 7.32  ? 86  TYR A O   1 
ATOM   665  C CB  . TYR A 1 89  ? 12.560  -7.057  6.642   1.00 9.55  ? 86  TYR A CB  1 
ATOM   666  C CG  . TYR A 1 89  ? 12.262  -8.397  6.015   1.00 10.58 ? 86  TYR A CG  1 
ATOM   667  C CD1 . TYR A 1 89  ? 12.862  -8.779  4.814   1.00 10.86 ? 86  TYR A CD1 1 
ATOM   668  C CD2 . TYR A 1 89  ? 11.336  -9.261  6.596   1.00 9.61  ? 86  TYR A CD2 1 
ATOM   669  C CE1 . TYR A 1 89  ? 12.544  -9.993  4.208   1.00 10.49 ? 86  TYR A CE1 1 
ATOM   670  C CE2 . TYR A 1 89  ? 11.010  -10.468 6.004   1.00 10.51 ? 86  TYR A CE2 1 
ATOM   671  C CZ  . TYR A 1 89  ? 11.615  -10.829 4.809   1.00 11.05 ? 86  TYR A CZ  1 
ATOM   672  O OH  . TYR A 1 89  ? 11.273  -12.020 4.218   1.00 11.95 ? 86  TYR A OH  1 
ATOM   673  N N   . TYR A 1 90  ? 10.979  -4.260  7.474   1.00 8.89  ? 87  TYR A N   1 
ATOM   674  C CA  . TYR A 1 90  ? 11.021  -3.077  8.305   1.00 9.14  ? 87  TYR A CA  1 
ATOM   675  C C   . TYR A 1 90  ? 10.667  -3.392  9.749   1.00 9.45  ? 87  TYR A C   1 
ATOM   676  O O   . TYR A 1 90  ? 9.682   -4.088  10.014  1.00 9.15  ? 87  TYR A O   1 
ATOM   677  C CB  . TYR A 1 90  ? 10.032  -2.028  7.794   1.00 9.09  ? 87  TYR A CB  1 
ATOM   678  C CG  . TYR A 1 90  ? 10.253  -1.565  6.370   1.00 8.79  ? 87  TYR A CG  1 
ATOM   679  C CD1 . TYR A 1 90  ? 11.208  -0.595  6.080   1.00 8.26  ? 87  TYR A CD1 1 
ATOM   680  C CD2 . TYR A 1 90  ? 9.487   -2.072  5.316   1.00 8.70  ? 87  TYR A CD2 1 
ATOM   681  C CE1 . TYR A 1 90  ? 11.401  -0.133  4.781   1.00 8.41  ? 87  TYR A CE1 1 
ATOM   682  C CE2 . TYR A 1 90  ? 9.673   -1.608  4.002   1.00 7.83  ? 87  TYR A CE2 1 
ATOM   683  C CZ  . TYR A 1 90  ? 10.631  -0.639  3.749   1.00 8.42  ? 87  TYR A CZ  1 
ATOM   684  O OH  . TYR A 1 90  ? 10.830  -0.154  2.474   1.00 8.26  ? 87  TYR A OH  1 
ATOM   685  N N   . CYS A 1 91  ? 11.469  -2.893  10.685  1.00 9.76  ? 88  CYS A N   1 
ATOM   686  C CA  . CYS A 1 91  ? 11.129  -3.087  12.081  1.00 9.61  ? 88  CYS A CA  1 
ATOM   687  C C   . CYS A 1 91  ? 10.374  -1.822  12.461  1.00 9.53  ? 88  CYS A C   1 
ATOM   688  O O   . CYS A 1 91  ? 10.481  -0.799  11.779  1.00 9.39  ? 88  CYS A O   1 
ATOM   689  C CB  . CYS A 1 91  ? 12.360  -3.265  12.966  1.00 10.32 ? 88  CYS A CB  1 
ATOM   690  S SG  . CYS A 1 91  ? 13.567  -1.907  12.982  1.00 10.76 ? 88  CYS A SG  1 
ATOM   691  N N   . GLN A 1 92  ? 9.606   -1.884  13.538  1.00 8.91  ? 89  GLN A N   1 
ATOM   692  C CA  . GLN A 1 92  ? 8.815   -0.733  13.946  1.00 9.33  ? 89  GLN A CA  1 
ATOM   693  C C   . GLN A 1 92  ? 8.532   -0.724  15.435  1.00 9.62  ? 89  GLN A C   1 
ATOM   694  O O   . GLN A 1 92  ? 8.292   -1.773  16.042  1.00 8.83  ? 89  GLN A O   1 
ATOM   695  C CB  . GLN A 1 92  ? 7.507   -0.725  13.141  1.00 9.46  ? 89  GLN A CB  1 
ATOM   696  C CG  . GLN A 1 92  ? 6.467   0.314   13.534  1.00 8.03  ? 89  GLN A CG  1 
ATOM   697  C CD  . GLN A 1 92  ? 5.602   -0.121  14.704  1.00 8.59  ? 89  GLN A CD  1 
ATOM   698  O OE1 . GLN A 1 92  ? 4.988   -1.190  14.670  1.00 8.48  ? 89  GLN A OE1 1 
ATOM   699  N NE2 . GLN A 1 92  ? 5.532   0.718   15.739  1.00 8.41  ? 89  GLN A NE2 1 
ATOM   700  N N   . SER A 1 93  ? 8.578   0.467   16.024  1.00 10.60 ? 90  SER A N   1 
ATOM   701  C CA  . SER A 1 93  ? 8.323   0.605   17.444  1.00 11.48 ? 90  SER A CA  1 
ATOM   702  C C   . SER A 1 93  ? 7.621   1.928   17.717  1.00 12.44 ? 90  SER A C   1 
ATOM   703  O O   . SER A 1 93  ? 7.177   2.617   16.788  1.00 11.91 ? 90  SER A O   1 
ATOM   704  C CB  . SER A 1 93  ? 9.629   0.507   18.239  1.00 11.64 ? 90  SER A CB  1 
ATOM   705  O OG  . SER A 1 93  ? 9.370   0.335   19.625  1.00 11.10 ? 90  SER A OG  1 
ATOM   706  N N   . TYR A 1 94  ? 7.547   2.292   18.988  1.00 13.12 ? 91  TYR A N   1 
ATOM   707  C CA  . TYR A 1 94  ? 6.842   3.495   19.395  1.00 14.76 ? 91  TYR A CA  1 
ATOM   708  C C   . TYR A 1 94  ? 7.689   4.520   20.139  1.00 15.79 ? 91  TYR A C   1 
ATOM   709  O O   . TYR A 1 94  ? 8.425   4.177   21.061  1.00 15.32 ? 91  TYR A O   1 
ATOM   710  C CB  . TYR A 1 94  ? 5.670   3.072   20.276  1.00 14.14 ? 91  TYR A CB  1 
ATOM   711  C CG  . TYR A 1 94  ? 4.760   2.066   19.609  1.00 15.34 ? 91  TYR A CG  1 
ATOM   712  C CD1 . TYR A 1 94  ? 3.790   2.474   18.694  1.00 15.46 ? 91  TYR A CD1 1 
ATOM   713  C CD2 . TYR A 1 94  ? 4.885   0.701   19.872  1.00 15.50 ? 91  TYR A CD2 1 
ATOM   714  C CE1 . TYR A 1 94  ? 2.964   1.551   18.061  1.00 16.67 ? 91  TYR A CE1 1 
ATOM   715  C CE2 . TYR A 1 94  ? 4.059   -0.234  19.237  1.00 16.01 ? 91  TYR A CE2 1 
ATOM   716  C CZ  . TYR A 1 94  ? 3.102   0.204   18.336  1.00 16.69 ? 91  TYR A CZ  1 
ATOM   717  O OH  . TYR A 1 94  ? 2.274   -0.702  17.713  1.00 17.82 ? 91  TYR A OH  1 
ATOM   718  N N   . ASP A 1 95  ? 7.583   5.777   19.717  1.00 17.88 ? 92  ASP A N   1 
ATOM   719  C CA  . ASP A 1 95  ? 8.293   6.879   20.363  1.00 19.66 ? 92  ASP A CA  1 
ATOM   720  C C   . ASP A 1 95  ? 7.164   7.749   20.876  1.00 20.18 ? 92  ASP A C   1 
ATOM   721  O O   . ASP A 1 95  ? 6.498   8.445   20.103  1.00 20.30 ? 92  ASP A O   1 
ATOM   722  C CB  . ASP A 1 95  ? 9.150   7.660   19.370  1.00 19.98 ? 92  ASP A CB  1 
ATOM   723  C CG  . ASP A 1 95  ? 9.955   8.756   20.047  1.00 21.07 ? 92  ASP A CG  1 
ATOM   724  O OD1 . ASP A 1 95  ? 9.778   8.956   21.268  1.00 20.81 ? 92  ASP A OD1 1 
ATOM   725  O OD2 . ASP A 1 95  ? 10.762  9.418   19.363  1.00 21.30 ? 92  ASP A OD2 1 
ATOM   726  N N   . ALA A 1 96  ? 6.964   7.711   22.186  1.00 21.14 ? 93  ALA A N   1 
ATOM   727  C CA  . ALA A 1 96  ? 5.858   8.419   22.803  1.00 21.80 ? 93  ALA A CA  1 
ATOM   728  C C   . ALA A 1 96  ? 4.698   7.546   22.324  1.00 22.24 ? 93  ALA A C   1 
ATOM   729  O O   . ALA A 1 96  ? 4.567   6.395   22.755  1.00 23.31 ? 93  ALA A O   1 
ATOM   730  C CB  . ALA A 1 96  ? 5.739   9.843   22.255  1.00 22.29 ? 93  ALA A CB  1 
ATOM   731  N N   . ARG A 1 97  ? 3.893   8.066   21.405  1.00 21.52 ? 94  ARG A N   1 
ATOM   732  C CA  . ARG A 1 97  ? 2.771   7.304   20.867  1.00 20.55 ? 94  ARG A CA  1 
ATOM   733  C C   . ARG A 1 97  ? 2.902   7.182   19.350  1.00 19.71 ? 94  ARG A C   1 
ATOM   734  O O   . ARG A 1 97  ? 2.123   6.481   18.703  1.00 19.44 ? 94  ARG A O   1 
ATOM   735  C CB  . ARG A 1 97  ? 1.455   7.987   21.225  1.00 21.21 ? 94  ARG A CB  1 
ATOM   736  N N   . ASN A 1 98  ? 3.898   7.863   18.789  1.00 19.27 ? 95  ASN A N   1 
ATOM   737  C CA  . ASN A 1 98  ? 4.118   7.843   17.346  1.00 18.35 ? 95  ASN A CA  1 
ATOM   738  C C   . ASN A 1 98  ? 4.721   6.518   16.896  1.00 17.56 ? 95  ASN A C   1 
ATOM   739  O O   . ASN A 1 98  ? 5.374   5.827   17.677  1.00 17.66 ? 95  ASN A O   1 
ATOM   740  C CB  . ASN A 1 98  ? 5.058   8.976   16.920  1.00 18.70 ? 95  ASN A CB  1 
ATOM   741  C CG  . ASN A 1 98  ? 5.148   9.113   15.409  1.00 19.40 ? 95  ASN A CG  1 
ATOM   742  O OD1 . ASN A 1 98  ? 6.119   9.656   14.867  1.00 19.37 ? 95  ASN A OD1 1 
ATOM   743  N ND2 . ASN A 1 98  ? 4.122   8.637   14.719  1.00 19.19 ? 95  ASN A ND2 1 
ATOM   744  N N   . VAL A 1 99  ? 4.500   6.172   15.631  1.00 15.84 ? 96  VAL A N   1 
ATOM   745  C CA  . VAL A 1 99  ? 5.032   4.937   15.073  1.00 13.70 ? 96  VAL A CA  1 
ATOM   746  C C   . VAL A 1 99  ? 6.320   5.258   14.324  1.00 12.65 ? 96  VAL A C   1 
ATOM   747  O O   . VAL A 1 99  ? 6.315   6.022   13.356  1.00 11.58 ? 96  VAL A O   1 
ATOM   748  C CB  . VAL A 1 99  ? 4.024   4.278   14.108  1.00 13.63 ? 96  VAL A CB  1 
ATOM   749  C CG1 . VAL A 1 99  ? 4.612   3.014   13.517  1.00 13.54 ? 96  VAL A CG1 1 
ATOM   750  C CG2 . VAL A 1 99  ? 2.741   3.951   14.852  1.00 14.23 ? 96  VAL A CG2 1 
ATOM   751  N N   . VAL A 1 100 ? 7.420   4.676   14.792  1.00 11.00 ? 97  VAL A N   1 
ATOM   752  C CA  . VAL A 1 100 ? 8.736   4.881   14.192  1.00 10.59 ? 97  VAL A CA  1 
ATOM   753  C C   . VAL A 1 100 ? 9.143   3.626   13.421  1.00 9.41  ? 97  VAL A C   1 
ATOM   754  O O   . VAL A 1 100 ? 9.034   2.518   13.945  1.00 8.51  ? 97  VAL A O   1 
ATOM   755  C CB  . VAL A 1 100 ? 9.787   5.171   15.294  1.00 11.34 ? 97  VAL A CB  1 
ATOM   756  C CG1 . VAL A 1 100 ? 11.183  5.284   14.693  1.00 11.97 ? 97  VAL A CG1 1 
ATOM   757  C CG2 . VAL A 1 100 ? 9.424   6.450   16.018  1.00 11.75 ? 97  VAL A CG2 1 
ATOM   758  N N   . PHE A 1 101 ? 9.596   3.803   12.179  1.00 8.60  ? 98  PHE A N   1 
ATOM   759  C CA  . PHE A 1 101 ? 10.028  2.682   11.345  1.00 8.57  ? 98  PHE A CA  1 
ATOM   760  C C   . PHE A 1 101 ? 11.540  2.630   11.187  1.00 8.22  ? 98  PHE A C   1 
ATOM   761  O O   . PHE A 1 101 ? 12.207  3.658   11.202  1.00 8.05  ? 98  PHE A O   1 
ATOM   762  C CB  . PHE A 1 101 ? 9.447   2.757   9.924   1.00 8.56  ? 98  PHE A CB  1 
ATOM   763  C CG  . PHE A 1 101 ? 7.975   2.476   9.832   1.00 8.72  ? 98  PHE A CG  1 
ATOM   764  C CD1 . PHE A 1 101 ? 7.043   3.488   10.025  1.00 9.47  ? 98  PHE A CD1 1 
ATOM   765  C CD2 . PHE A 1 101 ? 7.522   1.191   9.550   1.00 8.51  ? 98  PHE A CD2 1 
ATOM   766  C CE1 . PHE A 1 101 ? 5.670   3.226   9.937   1.00 9.34  ? 98  PHE A CE1 1 
ATOM   767  C CE2 . PHE A 1 101 ? 6.155   0.912   9.462   1.00 9.27  ? 98  PHE A CE2 1 
ATOM   768  C CZ  . PHE A 1 101 ? 5.226   1.938   9.657   1.00 9.24  ? 98  PHE A CZ  1 
ATOM   769  N N   . GLY A 1 102 ? 12.068  1.425   11.007  1.00 8.55  ? 99  GLY A N   1 
ATOM   770  C CA  . GLY A 1 102 ? 13.493  1.278   10.787  1.00 8.81  ? 99  GLY A CA  1 
ATOM   771  C C   . GLY A 1 102 ? 13.768  1.669   9.345   1.00 8.59  ? 99  GLY A C   1 
ATOM   772  O O   . GLY A 1 102 ? 12.831  1.759   8.551   1.00 8.40  ? 99  GLY A O   1 
ATOM   773  N N   . GLY A 1 103 ? 15.034  1.905   9.006   1.00 8.60  ? 100 GLY A N   1 
ATOM   774  C CA  . GLY A 1 103 ? 15.393  2.289   7.652   1.00 9.24  ? 100 GLY A CA  1 
ATOM   775  C C   . GLY A 1 103 ? 15.074  1.224   6.618   1.00 10.17 ? 100 GLY A C   1 
ATOM   776  O O   . GLY A 1 103 ? 14.971  1.518   5.427   1.00 10.45 ? 100 GLY A O   1 
ATOM   777  N N   . GLY A 1 104 ? 14.922  -0.016  7.069   1.00 10.38 ? 101 GLY A N   1 
ATOM   778  C CA  . GLY A 1 104 ? 14.595  -1.100  6.157   1.00 11.24 ? 101 GLY A CA  1 
ATOM   779  C C   . GLY A 1 104 ? 15.800  -1.881  5.677   1.00 12.35 ? 101 GLY A C   1 
ATOM   780  O O   . GLY A 1 104 ? 16.897  -1.333  5.554   1.00 11.97 ? 101 GLY A O   1 
ATOM   781  N N   . THR A 1 105 ? 15.596  -3.170  5.412   1.00 12.90 ? 102 THR A N   1 
ATOM   782  C CA  . THR A 1 105 ? 16.666  -4.039  4.937   1.00 14.35 ? 102 THR A CA  1 
ATOM   783  C C   . THR A 1 105 ? 16.209  -4.859  3.737   1.00 15.59 ? 102 THR A C   1 
ATOM   784  O O   . THR A 1 105 ? 15.198  -5.564  3.807   1.00 14.31 ? 102 THR A O   1 
ATOM   785  C CB  . THR A 1 105 ? 17.131  -5.034  6.027   1.00 14.57 ? 102 THR A CB  1 
ATOM   786  O OG1 . THR A 1 105 ? 17.644  -4.318  7.156   1.00 15.30 ? 102 THR A OG1 1 
ATOM   787  C CG2 . THR A 1 105 ? 18.218  -5.954  5.473   1.00 14.35 ? 102 THR A CG2 1 
ATOM   788  N N   . ARG A 1 106 ? 16.965  -4.762  2.645   1.00 17.20 ? 103 ARG A N   1 
ATOM   789  C CA  . ARG A 1 106 ? 16.677  -5.498  1.415   1.00 19.57 ? 103 ARG A CA  1 
ATOM   790  C C   . ARG A 1 106 ? 17.274  -6.894  1.592   1.00 20.34 ? 103 ARG A C   1 
ATOM   791  O O   . ARG A 1 106 ? 18.494  -7.037  1.664   1.00 20.15 ? 103 ARG A O   1 
ATOM   792  C CB  . ARG A 1 106 ? 17.362  -4.813  0.229   1.00 20.93 ? 103 ARG A CB  1 
ATOM   793  C CG  . ARG A 1 106 ? 16.978  -5.337  -1.152  1.00 23.12 ? 103 ARG A CG  1 
ATOM   794  C CD  . ARG A 1 106 ? 15.633  -4.782  -1.577  1.00 25.55 ? 103 ARG A CD  1 
ATOM   795  N NE  . ARG A 1 106 ? 15.324  -5.053  -2.976  1.00 27.51 ? 103 ARG A NE  1 
ATOM   796  C CZ  . ARG A 1 106 ? 14.312  -4.497  -3.634  1.00 28.75 ? 103 ARG A CZ  1 
ATOM   797  N NH1 . ARG A 1 106 ? 13.510  -3.635  -3.018  1.00 29.56 ? 103 ARG A NH1 1 
ATOM   798  N NH2 . ARG A 1 106 ? 14.102  -4.796  -4.910  1.00 29.94 ? 103 ARG A NH2 1 
ATOM   799  N N   . LEU A 1 107 ? 16.427  -7.916  1.673   1.00 21.52 ? 104 LEU A N   1 
ATOM   800  C CA  . LEU A 1 107 ? 16.916  -9.283  1.838   1.00 22.58 ? 104 LEU A CA  1 
ATOM   801  C C   . LEU A 1 107 ? 16.986  -10.010 0.501   1.00 23.70 ? 104 LEU A C   1 
ATOM   802  O O   . LEU A 1 107 ? 15.961  -10.290 -0.125  1.00 23.82 ? 104 LEU A O   1 
ATOM   803  C CB  . LEU A 1 107 ? 16.023  -10.071 2.803   1.00 22.30 ? 104 LEU A CB  1 
ATOM   804  C CG  . LEU A 1 107 ? 16.386  -11.555 2.961   1.00 22.67 ? 104 LEU A CG  1 
ATOM   805  C CD1 . LEU A 1 107 ? 17.827  -11.689 3.437   1.00 22.48 ? 104 LEU A CD1 1 
ATOM   806  C CD2 . LEU A 1 107 ? 15.437  -12.224 3.940   1.00 22.48 ? 104 LEU A CD2 1 
ATOM   807  N N   . THR A 1 108 ? 18.207  -10.302 0.067   1.00 25.00 ? 105 THR A N   1 
ATOM   808  C CA  . THR A 1 108 ? 18.433  -11.006 -1.190  1.00 26.74 ? 105 THR A CA  1 
ATOM   809  C C   . THR A 1 108 ? 18.898  -12.428 -0.919  1.00 27.81 ? 105 THR A C   1 
ATOM   810  O O   . THR A 1 108 ? 19.887  -12.646 -0.216  1.00 28.03 ? 105 THR A O   1 
ATOM   811  C CB  . THR A 1 108 ? 19.508  -10.306 -2.056  1.00 26.85 ? 105 THR A CB  1 
ATOM   812  O OG1 . THR A 1 108 ? 19.044  -9.007  -2.445  1.00 26.70 ? 105 THR A OG1 1 
ATOM   813  C CG2 . THR A 1 108 ? 19.812  -11.130 -3.310  1.00 26.30 ? 105 THR A CG2 1 
ATOM   814  N N   . VAL A 1 109 ? 18.170  -13.392 -1.467  1.00 29.38 ? 106 VAL A N   1 
ATOM   815  C CA  . VAL A 1 109 ? 18.523  -14.793 -1.311  1.00 31.41 ? 106 VAL A CA  1 
ATOM   816  C C   . VAL A 1 109 ? 19.402  -15.139 -2.507  1.00 32.98 ? 106 VAL A C   1 
ATOM   817  O O   . VAL A 1 109 ? 18.904  -15.498 -3.574  1.00 33.57 ? 106 VAL A O   1 
ATOM   818  C CB  . VAL A 1 109 ? 17.270  -15.654 -1.301  1.00 31.40 ? 106 VAL A CB  1 
ATOM   819  N N   . LEU A 1 110 ? 20.711  -15.006 -2.318  1.00 34.81 ? 107 LEU A N   1 
ATOM   820  C CA  . LEU A 1 110 ? 21.695  -15.273 -3.363  1.00 36.38 ? 107 LEU A CA  1 
ATOM   821  C C   . LEU A 1 110 ? 21.418  -16.532 -4.178  1.00 37.40 ? 107 LEU A C   1 
ATOM   822  O O   . LEU A 1 110 ? 21.893  -16.658 -5.307  1.00 37.85 ? 107 LEU A O   1 
ATOM   823  C CB  . LEU A 1 110 ? 23.093  -15.352 -2.743  1.00 36.63 ? 107 LEU A CB  1 
ATOM   824  C CG  . LEU A 1 110 ? 23.541  -14.070 -2.036  1.00 37.22 ? 107 LEU A CG  1 
ATOM   825  C CD1 . LEU A 1 110 ? 24.886  -14.285 -1.373  1.00 37.64 ? 107 LEU A CD1 1 
ATOM   826  C CD2 . LEU A 1 110 ? 23.610  -12.927 -3.042  1.00 37.08 ? 107 LEU A CD2 1 
ATOM   827  N N   . GLY A 1 111 ? 20.650  -17.452 -3.600  1.00 38.16 ? 108 GLY A N   1 
ATOM   828  C CA  . GLY A 1 111 ? 20.312  -18.698 -4.267  1.00 38.98 ? 108 GLY A CA  1 
ATOM   829  C C   . GLY A 1 111 ? 19.955  -18.591 -5.736  1.00 39.53 ? 108 GLY A C   1 
ATOM   830  O O   . GLY A 1 111 ? 18.780  -18.847 -6.084  1.00 39.93 ? 108 GLY A O   1 
ATOM   831  O OXT . GLY A 1 111 ? 20.847  -18.255 -6.545  1.00 39.91 ? 108 GLY A OXT 1 
ATOM   832  N N   . ASN B 1 1   ? -10.214 -12.012 12.568  1.00 25.28 ? 1   ASN B N   1 
ATOM   833  C CA  . ASN B 1 1   ? -9.433  -11.352 11.482  1.00 24.76 ? 1   ASN B CA  1 
ATOM   834  C C   . ASN B 1 1   ? -10.330 -10.447 10.649  1.00 24.20 ? 1   ASN B C   1 
ATOM   835  O O   . ASN B 1 1   ? -11.553 -10.588 10.660  1.00 24.56 ? 1   ASN B O   1 
ATOM   836  C CB  . ASN B 1 1   ? -8.782  -12.413 10.586  1.00 25.19 ? 1   ASN B CB  1 
ATOM   837  N N   . PHE B 1 2   ? -9.722  -9.508  9.935   1.00 22.95 ? 2   PHE B N   1 
ATOM   838  C CA  . PHE B 1 2   ? -10.485 -8.606  9.086   1.00 21.72 ? 2   PHE B CA  1 
ATOM   839  C C   . PHE B 1 2   ? -9.602  -8.026  7.996   1.00 20.91 ? 2   PHE B C   1 
ATOM   840  O O   . PHE B 1 2   ? -8.381  -8.160  8.036   1.00 20.79 ? 2   PHE B O   1 
ATOM   841  C CB  . PHE B 1 2   ? -11.124 -7.489  9.922   1.00 21.03 ? 2   PHE B CB  1 
ATOM   842  C CG  . PHE B 1 2   ? -10.140 -6.541  10.544  1.00 21.01 ? 2   PHE B CG  1 
ATOM   843  C CD1 . PHE B 1 2   ? -9.529  -5.554  9.784   1.00 20.83 ? 2   PHE B CD1 1 
ATOM   844  C CD2 . PHE B 1 2   ? -9.836  -6.627  11.898  1.00 20.96 ? 2   PHE B CD2 1 
ATOM   845  C CE1 . PHE B 1 2   ? -8.636  -4.664  10.363  1.00 20.62 ? 2   PHE B CE1 1 
ATOM   846  C CE2 . PHE B 1 2   ? -8.942  -5.744  12.486  1.00 20.55 ? 2   PHE B CE2 1 
ATOM   847  C CZ  . PHE B 1 2   ? -8.340  -4.758  11.716  1.00 20.75 ? 2   PHE B CZ  1 
ATOM   848  N N   . MET B 1 3   ? -10.234 -7.389  7.017   1.00 20.45 ? 3   MET B N   1 
ATOM   849  C CA  . MET B 1 3   ? -9.522  -6.788  5.901   1.00 20.11 ? 3   MET B CA  1 
ATOM   850  C C   . MET B 1 3   ? -9.745  -5.283  5.885   1.00 18.61 ? 3   MET B C   1 
ATOM   851  O O   . MET B 1 3   ? -10.784 -4.799  6.335   1.00 17.50 ? 3   MET B O   1 
ATOM   852  C CB  . MET B 1 3   ? -10.031 -7.378  4.582   1.00 21.76 ? 3   MET B CB  1 
ATOM   853  C CG  . MET B 1 3   ? -9.903  -8.893  4.480   1.00 24.62 ? 3   MET B CG  1 
ATOM   854  S SD  . MET B 1 3   ? -10.630 -9.593  2.962   1.00 27.36 ? 3   MET B SD  1 
ATOM   855  C CE  . MET B 1 3   ? -12.373 -9.213  3.196   1.00 26.46 ? 3   MET B CE  1 
ATOM   856  N N   . LEU B 1 4   ? -8.753  -4.555  5.376   1.00 17.02 ? 4   LEU B N   1 
ATOM   857  C CA  . LEU B 1 4   ? -8.820  -3.103  5.237   1.00 15.81 ? 4   LEU B CA  1 
ATOM   858  C C   . LEU B 1 4   ? -8.735  -2.873  3.731   1.00 15.63 ? 4   LEU B C   1 
ATOM   859  O O   . LEU B 1 4   ? -7.688  -3.077  3.118   1.00 14.67 ? 4   LEU B O   1 
ATOM   860  C CB  . LEU B 1 4   ? -7.648  -2.419  5.951   1.00 14.91 ? 4   LEU B CB  1 
ATOM   861  C CG  . LEU B 1 4   ? -7.648  -2.523  7.478   1.00 14.32 ? 4   LEU B CG  1 
ATOM   862  C CD1 . LEU B 1 4   ? -6.395  -1.878  8.051   1.00 14.44 ? 4   LEU B CD1 1 
ATOM   863  C CD2 . LEU B 1 4   ? -8.894  -1.848  8.027   1.00 13.09 ? 4   LEU B CD2 1 
ATOM   864  N N   . ASN B 1 5   ? -9.852  -2.461  3.144   1.00 15.62 ? 5   ASN B N   1 
ATOM   865  C CA  . ASN B 1 5   ? -9.937  -2.252  1.711   1.00 16.25 ? 5   ASN B CA  1 
ATOM   866  C C   . ASN B 1 5   ? -9.851  -0.796  1.283   1.00 15.86 ? 5   ASN B C   1 
ATOM   867  O O   . ASN B 1 5   ? -10.610 0.052   1.752   1.00 15.82 ? 5   ASN B O   1 
ATOM   868  C CB  . ASN B 1 5   ? -11.239 -2.876  1.200   1.00 17.85 ? 5   ASN B CB  1 
ATOM   869  C CG  . ASN B 1 5   ? -11.271 -4.389  1.381   1.00 19.62 ? 5   ASN B CG  1 
ATOM   870  O OD1 . ASN B 1 5   ? -12.339 -4.997  1.424   1.00 22.77 ? 5   ASN B OD1 1 
ATOM   871  N ND2 . ASN B 1 5   ? -10.097 -5.005  1.462   1.00 20.47 ? 5   ASN B ND2 1 
ATOM   872  N N   . GLN B 1 6   ? -8.910  -0.521  0.386   1.00 15.46 ? 6   GLN B N   1 
ATOM   873  C CA  . GLN B 1 6   ? -8.707  0.821   -0.154  1.00 15.60 ? 6   GLN B CA  1 
ATOM   874  C C   . GLN B 1 6   ? -8.406  0.748   -1.651  1.00 15.21 ? 6   GLN B C   1 
ATOM   875  O O   . GLN B 1 6   ? -7.889  -0.256  -2.137  1.00 15.19 ? 6   GLN B O   1 
ATOM   876  C CB  . GLN B 1 6   ? -7.571  1.538   0.591   1.00 15.82 ? 6   GLN B CB  1 
ATOM   877  C CG  . GLN B 1 6   ? -6.347  0.676   0.865   1.00 15.94 ? 6   GLN B CG  1 
ATOM   878  C CD  . GLN B 1 6   ? -5.238  1.439   1.586   1.00 16.22 ? 6   GLN B CD  1 
ATOM   879  O OE1 . GLN B 1 6   ? -4.342  0.839   2.174   1.00 16.03 ? 6   GLN B OE1 1 
ATOM   880  N NE2 . GLN B 1 6   ? -5.288  2.766   1.521   1.00 14.92 ? 6   GLN B NE2 1 
ATOM   881  N N   . PRO B 1 7   ? -8.722  1.821   -2.395  1.00 15.82 ? 7   PRO B N   1 
ATOM   882  C CA  . PRO B 1 7   ? -8.511  1.932   -3.842  1.00 15.90 ? 7   PRO B CA  1 
ATOM   883  C C   . PRO B 1 7   ? -7.059  1.718   -4.243  1.00 16.41 ? 7   PRO B C   1 
ATOM   884  O O   . PRO B 1 7   ? -6.140  2.168   -3.548  1.00 15.66 ? 7   PRO B O   1 
ATOM   885  C CB  . PRO B 1 7   ? -8.980  3.356   -4.140  1.00 16.74 ? 7   PRO B CB  1 
ATOM   886  C CG  . PRO B 1 7   ? -10.045 3.571   -3.093  1.00 16.81 ? 7   PRO B CG  1 
ATOM   887  C CD  . PRO B 1 7   ? -9.286  3.081   -1.885  1.00 16.09 ? 7   PRO B CD  1 
ATOM   888  N N   . HIS B 1 8   ? -6.851  1.047   -5.371  1.00 16.29 ? 8   HIS B N   1 
ATOM   889  C CA  . HIS B 1 8   ? -5.497  0.792   -5.828  1.00 17.63 ? 8   HIS B CA  1 
ATOM   890  C C   . HIS B 1 8   ? -4.758  2.094   -6.096  1.00 17.51 ? 8   HIS B C   1 
ATOM   891  O O   . HIS B 1 8   ? -3.581  2.224   -5.766  1.00 17.79 ? 8   HIS B O   1 
ATOM   892  C CB  . HIS B 1 8   ? -5.484  -0.058  -7.099  1.00 17.96 ? 8   HIS B CB  1 
ATOM   893  C CG  . HIS B 1 8   ? -4.102  -0.379  -7.578  1.00 20.14 ? 8   HIS B CG  1 
ATOM   894  N ND1 . HIS B 1 8   ? -3.225  -1.153  -6.845  1.00 20.72 ? 8   HIS B ND1 1 
ATOM   895  C CD2 . HIS B 1 8   ? -3.420  0.024   -8.675  1.00 20.59 ? 8   HIS B CD2 1 
ATOM   896  C CE1 . HIS B 1 8   ? -2.063  -1.210  -7.472  1.00 20.64 ? 8   HIS B CE1 1 
ATOM   897  N NE2 . HIS B 1 8   ? -2.155  -0.504  -8.586  1.00 20.88 ? 8   HIS B NE2 1 
ATOM   898  N N   . SER B 1 9   ? -5.449  3.061   -6.689  1.00 17.54 ? 9   SER B N   1 
ATOM   899  C CA  . SER B 1 9   ? -4.817  4.335   -6.993  1.00 17.79 ? 9   SER B CA  1 
ATOM   900  C C   . SER B 1 9   ? -5.806  5.476   -7.167  1.00 17.53 ? 9   SER B C   1 
ATOM   901  O O   . SER B 1 9   ? -7.011  5.268   -7.338  1.00 16.63 ? 9   SER B O   1 
ATOM   902  C CB  . SER B 1 9   ? -3.977  4.214   -8.265  1.00 19.12 ? 9   SER B CB  1 
ATOM   903  O OG  . SER B 1 9   ? -4.799  3.984   -9.392  1.00 19.64 ? 9   SER B OG  1 
ATOM   904  N N   . VAL B 1 10  ? -5.274  6.688   -7.115  1.00 17.13 ? 11  VAL B N   1 
ATOM   905  C CA  . VAL B 1 10  ? -6.071  7.890   -7.276  1.00 16.83 ? 11  VAL B CA  1 
ATOM   906  C C   . VAL B 1 10  ? -5.158  8.989   -7.795  1.00 16.54 ? 11  VAL B C   1 
ATOM   907  O O   . VAL B 1 10  ? -3.969  9.028   -7.467  1.00 15.69 ? 11  VAL B O   1 
ATOM   908  C CB  . VAL B 1 10  ? -6.709  8.329   -5.934  1.00 16.69 ? 11  VAL B CB  1 
ATOM   909  C CG1 . VAL B 1 10  ? -5.627  8.640   -4.913  1.00 16.92 ? 11  VAL B CG1 1 
ATOM   910  C CG2 . VAL B 1 10  ? -7.607  9.541   -6.156  1.00 17.25 ? 11  VAL B CG2 1 
ATOM   911  N N   . SER B 1 11  ? -5.715  9.873   -8.614  1.00 16.73 ? 12  SER B N   1 
ATOM   912  C CA  . SER B 1 11  ? -4.948  10.971  -9.185  1.00 16.90 ? 12  SER B CA  1 
ATOM   913  C C   . SER B 1 11  ? -5.608  12.307  -8.903  1.00 16.37 ? 12  SER B C   1 
ATOM   914  O O   . SER B 1 11  ? -6.830  12.434  -8.962  1.00 16.60 ? 12  SER B O   1 
ATOM   915  C CB  . SER B 1 11  ? -4.816  10.795  -10.697 1.00 16.87 ? 12  SER B CB  1 
ATOM   916  O OG  . SER B 1 11  ? -4.155  9.585   -11.011 1.00 18.09 ? 12  SER B OG  1 
ATOM   917  N N   . GLU B 1 12  ? -4.799  13.315  -8.606  1.00 15.80 ? 13  GLU B N   1 
ATOM   918  C CA  . GLU B 1 12  ? -5.355  14.627  -8.343  1.00 15.12 ? 13  GLU B CA  1 
ATOM   919  C C   . GLU B 1 12  ? -4.353  15.721  -8.699  1.00 14.66 ? 13  GLU B C   1 
ATOM   920  O O   . GLU B 1 12  ? -3.148  15.484  -8.744  1.00 14.73 ? 13  GLU B O   1 
ATOM   921  C CB  . GLU B 1 12  ? -5.793  14.734  -6.877  1.00 16.03 ? 13  GLU B CB  1 
ATOM   922  C CG  . GLU B 1 12  ? -6.543  16.012  -6.602  1.00 17.77 ? 13  GLU B CG  1 
ATOM   923  C CD  . GLU B 1 12  ? -7.720  16.174  -7.538  1.00 18.13 ? 13  GLU B CD  1 
ATOM   924  O OE1 . GLU B 1 12  ? -8.723  15.448  -7.378  1.00 18.98 ? 13  GLU B OE1 1 
ATOM   925  O OE2 . GLU B 1 12  ? -7.632  17.016  -8.453  1.00 19.87 ? 13  GLU B OE2 1 
ATOM   926  N N   . SER B 1 13  ? -4.857  16.920  -8.963  1.00 13.96 ? 14  SER B N   1 
ATOM   927  C CA  . SER B 1 13  ? -4.001  18.036  -9.348  1.00 13.96 ? 14  SER B CA  1 
ATOM   928  C C   . SER B 1 13  ? -3.366  18.726  -8.154  1.00 13.29 ? 14  SER B C   1 
ATOM   929  O O   . SER B 1 13  ? -3.916  18.705  -7.053  1.00 12.19 ? 14  SER B O   1 
ATOM   930  C CB  . SER B 1 13  ? -4.813  19.063  -10.140 1.00 14.67 ? 14  SER B CB  1 
ATOM   931  O OG  . SER B 1 13  ? -5.387  18.472  -11.288 1.00 16.65 ? 14  SER B OG  1 
ATOM   932  N N   . PRO B 1 14  ? -2.203  19.369  -8.363  1.00 12.98 ? 15  PRO B N   1 
ATOM   933  C CA  . PRO B 1 14  ? -1.537  20.061  -7.261  1.00 12.25 ? 15  PRO B CA  1 
ATOM   934  C C   . PRO B 1 14  ? -2.461  21.152  -6.759  1.00 11.50 ? 15  PRO B C   1 
ATOM   935  O O   . PRO B 1 14  ? -3.238  21.710  -7.534  1.00 11.40 ? 15  PRO B O   1 
ATOM   936  C CB  . PRO B 1 14  ? -0.288  20.640  -7.930  1.00 12.90 ? 15  PRO B CB  1 
ATOM   937  C CG  . PRO B 1 14  ? -0.028  19.662  -9.057  1.00 13.38 ? 15  PRO B CG  1 
ATOM   938  C CD  . PRO B 1 14  ? -1.428  19.547  -9.603  1.00 13.38 ? 15  PRO B CD  1 
ATOM   939  N N   . GLY B 1 15  ? -2.388  21.449  -5.466  1.00 10.73 ? 16  GLY B N   1 
ATOM   940  C CA  . GLY B 1 15  ? -3.226  22.496  -4.911  1.00 9.58  ? 16  GLY B CA  1 
ATOM   941  C C   . GLY B 1 15  ? -4.612  22.040  -4.504  1.00 9.07  ? 16  GLY B C   1 
ATOM   942  O O   . GLY B 1 15  ? -5.291  22.712  -3.724  1.00 8.20  ? 16  GLY B O   1 
ATOM   943  N N   . LYS B 1 16  ? -5.052  20.905  -5.027  1.00 8.28  ? 17  LYS B N   1 
ATOM   944  C CA  . LYS B 1 16  ? -6.373  20.429  -4.667  1.00 9.13  ? 17  LYS B CA  1 
ATOM   945  C C   . LYS B 1 16  ? -6.344  19.480  -3.473  1.00 8.96  ? 17  LYS B C   1 
ATOM   946  O O   . LYS B 1 16  ? -5.282  19.203  -2.910  1.00 8.47  ? 17  LYS B O   1 
ATOM   947  C CB  . LYS B 1 16  ? -7.043  19.788  -5.885  1.00 9.26  ? 17  LYS B CB  1 
ATOM   948  C CG  . LYS B 1 16  ? -7.274  20.806  -7.010  1.00 10.22 ? 17  LYS B CG  1 
ATOM   949  C CD  . LYS B 1 16  ? -8.054  20.240  -8.175  1.00 12.42 ? 17  LYS B CD  1 
ATOM   950  C CE  . LYS B 1 16  ? -8.206  21.285  -9.278  1.00 12.09 ? 17  LYS B CE  1 
ATOM   951  N NZ  . LYS B 1 16  ? -8.953  20.742  -10.443 1.00 13.56 ? 17  LYS B NZ  1 
ATOM   952  N N   . THR B 1 17  ? -7.524  19.009  -3.079  1.00 10.22 ? 18  THR B N   1 
ATOM   953  C CA  . THR B 1 17  ? -7.668  18.101  -1.947  1.00 10.30 ? 18  THR B CA  1 
ATOM   954  C C   . THR B 1 17  ? -8.065  16.703  -2.408  1.00 10.80 ? 18  THR B C   1 
ATOM   955  O O   . THR B 1 17  ? -8.814  16.539  -3.370  1.00 10.56 ? 18  THR B O   1 
ATOM   956  C CB  . THR B 1 17  ? -8.739  18.615  -0.972  1.00 10.53 ? 18  THR B CB  1 
ATOM   957  O OG1 . THR B 1 17  ? -8.385  19.930  -0.540  1.00 10.98 ? 18  THR B OG1 1 
ATOM   958  C CG2 . THR B 1 17  ? -8.857  17.693  0.249   1.00 10.51 ? 18  THR B CG2 1 
ATOM   959  N N   . VAL B 1 18  ? -7.558  15.698  -1.709  1.00 10.64 ? 19  VAL B N   1 
ATOM   960  C CA  . VAL B 1 18  ? -7.859  14.318  -2.042  1.00 10.20 ? 19  VAL B CA  1 
ATOM   961  C C   . VAL B 1 18  ? -8.121  13.570  -0.739  1.00 10.03 ? 19  VAL B C   1 
ATOM   962  O O   . VAL B 1 18  ? -7.543  13.894  0.302   1.00 8.94  ? 19  VAL B O   1 
ATOM   963  C CB  . VAL B 1 18  ? -6.666  13.655  -2.773  1.00 10.27 ? 19  VAL B CB  1 
ATOM   964  C CG1 . VAL B 1 18  ? -5.458  13.603  -1.847  1.00 10.28 ? 19  VAL B CG1 1 
ATOM   965  C CG2 . VAL B 1 18  ? -7.041  12.260  -3.239  1.00 12.03 ? 19  VAL B CG2 1 
ATOM   966  N N   . THR B 1 19  ? -9.016  12.593  -0.798  1.00 9.46  ? 20  THR B N   1 
ATOM   967  C CA  . THR B 1 19  ? -9.320  11.780  0.364   1.00 9.89  ? 20  THR B CA  1 
ATOM   968  C C   . THR B 1 19  ? -9.173  10.323  -0.010  1.00 10.64 ? 20  THR B C   1 
ATOM   969  O O   . THR B 1 19  ? -9.760  9.861   -0.985  1.00 11.31 ? 20  THR B O   1 
ATOM   970  C CB  . THR B 1 19  ? -10.750 12.008  0.883   1.00 9.70  ? 20  THR B CB  1 
ATOM   971  O OG1 . THR B 1 19  ? -10.871 13.341  1.387   1.00 9.84  ? 20  THR B OG1 1 
ATOM   972  C CG2 . THR B 1 19  ? -11.063 11.028  1.998   1.00 9.69  ? 20  THR B CG2 1 
ATOM   973  N N   . ILE B 1 20  ? -8.372  9.607   0.770   1.00 10.89 ? 21  ILE B N   1 
ATOM   974  C CA  . ILE B 1 20  ? -8.134  8.190   0.559   1.00 11.42 ? 21  ILE B CA  1 
ATOM   975  C C   . ILE B 1 20  ? -8.839  7.469   1.702   1.00 11.40 ? 21  ILE B C   1 
ATOM   976  O O   . ILE B 1 20  ? -8.585  7.764   2.870   1.00 11.42 ? 21  ILE B O   1 
ATOM   977  C CB  . ILE B 1 20  ? -6.627  7.875   0.622   1.00 11.66 ? 21  ILE B CB  1 
ATOM   978  C CG1 . ILE B 1 20  ? -5.893  8.661   -0.468  1.00 12.05 ? 21  ILE B CG1 1 
ATOM   979  C CG2 . ILE B 1 20  ? -6.400  6.383   0.480   1.00 12.30 ? 21  ILE B CG2 1 
ATOM   980  C CD1 . ILE B 1 20  ? -4.391  8.460   -0.475  1.00 12.25 ? 21  ILE B CD1 1 
ATOM   981  N N   . SER B 1 21  ? -9.709  6.521   1.376   1.00 10.90 ? 22  SER B N   1 
ATOM   982  C CA  . SER B 1 21  ? -10.434 5.819   2.420   1.00 11.72 ? 22  SER B CA  1 
ATOM   983  C C   . SER B 1 21  ? -10.129 4.348   2.585   1.00 11.95 ? 22  SER B C   1 
ATOM   984  O O   . SER B 1 21  ? -9.844  3.624   1.632   1.00 11.92 ? 22  SER B O   1 
ATOM   985  C CB  . SER B 1 21  ? -11.932 6.024   2.242   1.00 11.85 ? 22  SER B CB  1 
ATOM   986  O OG  . SER B 1 21  ? -12.232 7.405   2.333   1.00 12.66 ? 22  SER B OG  1 
ATOM   987  N N   . CYS B 1 22  ? -10.217 3.924   3.835   1.00 12.86 ? 23  CYS B N   1 
ATOM   988  C CA  . CYS B 1 22  ? -9.935  2.563   4.243   1.00 13.13 ? 23  CYS B CA  1 
ATOM   989  C C   . CYS B 1 22  ? -11.144 1.958   4.970   1.00 12.76 ? 23  CYS B C   1 
ATOM   990  O O   . CYS B 1 22  ? -11.499 2.390   6.066   1.00 11.73 ? 23  CYS B O   1 
ATOM   991  C CB  . CYS B 1 22  ? -8.699  2.630   5.139   1.00 14.66 ? 23  CYS B CB  1 
ATOM   992  S SG  . CYS B 1 22  ? -8.168  1.125   5.985   1.00 18.73 ? 23  CYS B SG  1 
ATOM   993  N N   . THR B 1 23  ? -11.770 0.962   4.347   1.00 11.98 ? 24  THR B N   1 
ATOM   994  C CA  . THR B 1 23  ? -12.941 0.304   4.917   1.00 12.52 ? 24  THR B CA  1 
ATOM   995  C C   . THR B 1 23  ? -12.615 -1.018  5.605   1.00 12.80 ? 24  THR B C   1 
ATOM   996  O O   . THR B 1 23  ? -11.983 -1.892  5.020   1.00 12.85 ? 24  THR B O   1 
ATOM   997  C CB  . THR B 1 23  ? -14.005 0.028   3.828   1.00 12.82 ? 24  THR B CB  1 
ATOM   998  O OG1 . THR B 1 23  ? -14.439 1.270   3.258   1.00 10.37 ? 24  THR B OG1 1 
ATOM   999  C CG2 . THR B 1 23  ? -15.205 -0.705  4.426   1.00 12.76 ? 24  THR B CG2 1 
ATOM   1000 N N   . ARG B 1 24  ? -13.048 -1.162  6.851   1.00 13.25 ? 25  ARG B N   1 
ATOM   1001 C CA  . ARG B 1 24  ? -12.803 -2.394  7.588   1.00 14.10 ? 25  ARG B CA  1 
ATOM   1002 C C   . ARG B 1 24  ? -13.935 -3.373  7.304   1.00 14.54 ? 25  ARG B C   1 
ATOM   1003 O O   . ARG B 1 24  ? -15.104 -3.070  7.546   1.00 14.17 ? 25  ARG B O   1 
ATOM   1004 C CB  . ARG B 1 24  ? -12.689 -2.098  9.084   1.00 13.97 ? 25  ARG B CB  1 
ATOM   1005 C CG  . ARG B 1 24  ? -12.526 -3.332  9.956   1.00 14.18 ? 25  ARG B CG  1 
ATOM   1006 C CD  . ARG B 1 24  ? -12.047 -2.944  11.344  1.00 15.39 ? 25  ARG B CD  1 
ATOM   1007 N NE  . ARG B 1 24  ? -12.116 -4.063  12.277  1.00 16.00 ? 25  ARG B NE  1 
ATOM   1008 C CZ  . ARG B 1 24  ? -11.609 -4.050  13.506  1.00 16.55 ? 25  ARG B CZ  1 
ATOM   1009 N NH1 . ARG B 1 24  ? -10.984 -2.969  13.962  1.00 14.69 ? 25  ARG B NH1 1 
ATOM   1010 N NH2 . ARG B 1 24  ? -11.757 -5.112  14.291  1.00 15.87 ? 25  ARG B NH2 1 
ATOM   1011 N N   . SER B 1 25  ? -13.570 -4.546  6.792   1.00 15.34 ? 26  SER B N   1 
ATOM   1012 C CA  . SER B 1 25  ? -14.528 -5.585  6.418   1.00 16.64 ? 26  SER B CA  1 
ATOM   1013 C C   . SER B 1 25  ? -15.336 -6.205  7.556   1.00 17.18 ? 26  SER B C   1 
ATOM   1014 O O   . SER B 1 25  ? -16.513 -6.502  7.380   1.00 17.64 ? 26  SER B O   1 
ATOM   1015 C CB  . SER B 1 25  ? -13.814 -6.698  5.640   1.00 16.06 ? 26  SER B CB  1 
ATOM   1016 O OG  . SER B 1 25  ? -12.859 -7.361  6.446   1.00 15.55 ? 26  SER B OG  1 
ATOM   1017 N N   . SER B 1 26  ? -14.714 -6.416  8.710   1.00 17.97 ? 27  SER B N   1 
ATOM   1018 C CA  . SER B 1 26  ? -15.423 -7.000  9.846   1.00 18.61 ? 27  SER B CA  1 
ATOM   1019 C C   . SER B 1 26  ? -14.946 -6.379  11.152  1.00 19.13 ? 27  SER B C   1 
ATOM   1020 O O   . SER B 1 26  ? -13.789 -5.964  11.270  1.00 19.48 ? 27  SER B O   1 
ATOM   1021 C CB  . SER B 1 26  ? -15.241 -8.522  9.871   1.00 19.14 ? 27  SER B CB  1 
ATOM   1022 O OG  . SER B 1 26  ? -13.874 -8.889  9.878   1.00 20.80 ? 27  SER B OG  1 
ATOM   1023 N N   . GLY B 1 27  A -15.842 -6.316  12.133  1.00 19.18 ? 27  GLY B N   1 
ATOM   1024 C CA  . GLY B 1 27  A -15.494 -5.707  13.403  1.00 19.04 ? 27  GLY B CA  1 
ATOM   1025 C C   . GLY B 1 27  A -15.637 -4.207  13.225  1.00 18.86 ? 27  GLY B C   1 
ATOM   1026 O O   . GLY B 1 27  A -15.593 -3.708  12.099  1.00 19.48 ? 27  GLY B O   1 
ATOM   1027 N N   . ASN B 1 28  B -15.804 -3.479  14.322  1.00 18.18 ? 27  ASN B N   1 
ATOM   1028 C CA  . ASN B 1 28  B -15.972 -2.033  14.247  1.00 17.09 ? 27  ASN B CA  1 
ATOM   1029 C C   . ASN B 1 28  B -14.668 -1.265  14.071  1.00 16.15 ? 27  ASN B C   1 
ATOM   1030 O O   . ASN B 1 28  B -13.674 -1.520  14.753  1.00 15.10 ? 27  ASN B O   1 
ATOM   1031 C CB  . ASN B 1 28  B -16.731 -1.545  15.481  1.00 17.44 ? 27  ASN B CB  1 
ATOM   1032 C CG  . ASN B 1 28  B -18.182 -1.991  15.479  1.00 17.97 ? 27  ASN B CG  1 
ATOM   1033 O OD1 . ASN B 1 28  B -18.887 -1.850  16.473  1.00 19.25 ? 27  ASN B OD1 1 
ATOM   1034 N ND2 . ASN B 1 28  B -18.640 -2.518  14.346  1.00 18.45 ? 27  ASN B ND2 1 
ATOM   1035 N N   . ILE B 1 29  ? -14.685 -0.321  13.135  1.00 14.94 ? 28  ILE B N   1 
ATOM   1036 C CA  . ILE B 1 29  ? -13.511 0.489   12.835  1.00 14.28 ? 28  ILE B CA  1 
ATOM   1037 C C   . ILE B 1 29  ? -13.005 1.212   14.087  1.00 14.14 ? 28  ILE B C   1 
ATOM   1038 O O   . ILE B 1 29  ? -11.802 1.356   14.291  1.00 13.49 ? 28  ILE B O   1 
ATOM   1039 C CB  . ILE B 1 29  ? -13.838 1.517   11.719  1.00 13.73 ? 28  ILE B CB  1 
ATOM   1040 C CG1 . ILE B 1 29  ? -12.569 2.256   11.290  1.00 14.84 ? 28  ILE B CG1 1 
ATOM   1041 C CG2 . ILE B 1 29  ? -14.908 2.478   12.195  1.00 12.94 ? 28  ILE B CG2 1 
ATOM   1042 C CD1 . ILE B 1 29  ? -11.552 1.366   10.591  1.00 13.71 ? 28  ILE B CD1 1 
ATOM   1043 N N   . ASP B 1 30  ? -13.923 1.645   14.943  1.00 14.19 ? 29  ASP B N   1 
ATOM   1044 C CA  . ASP B 1 30  ? -13.526 2.349   16.152  1.00 15.01 ? 29  ASP B CA  1 
ATOM   1045 C C   . ASP B 1 30  ? -13.018 1.417   17.258  1.00 14.73 ? 29  ASP B C   1 
ATOM   1046 O O   . ASP B 1 30  ? -12.664 1.867   18.345  1.00 14.25 ? 29  ASP B O   1 
ATOM   1047 C CB  . ASP B 1 30  ? -14.687 3.221   16.651  1.00 17.48 ? 29  ASP B CB  1 
ATOM   1048 C CG  . ASP B 1 30  ? -15.931 2.417   16.985  1.00 19.67 ? 29  ASP B CG  1 
ATOM   1049 O OD1 . ASP B 1 30  ? -16.372 1.596   16.146  1.00 21.91 ? 29  ASP B OD1 1 
ATOM   1050 O OD2 . ASP B 1 30  ? -16.481 2.624   18.082  1.00 20.86 ? 29  ASP B OD2 1 
ATOM   1051 N N   . SER B 1 31  ? -12.949 0.122   16.960  1.00 14.90 ? 30  SER B N   1 
ATOM   1052 C CA  . SER B 1 31  ? -12.478 -0.879  17.925  1.00 15.65 ? 30  SER B CA  1 
ATOM   1053 C C   . SER B 1 31  ? -10.995 -0.736  18.241  1.00 15.49 ? 30  SER B C   1 
ATOM   1054 O O   . SER B 1 31  ? -10.545 -1.102  19.331  1.00 14.95 ? 30  SER B O   1 
ATOM   1055 C CB  . SER B 1 31  ? -12.723 -2.294  17.391  1.00 16.02 ? 30  SER B CB  1 
ATOM   1056 O OG  . SER B 1 31  ? -14.106 -2.536  17.206  1.00 19.10 ? 30  SER B OG  1 
ATOM   1057 N N   . ASN B 1 32  ? -10.241 -0.211  17.281  1.00 14.54 ? 31  ASN B N   1 
ATOM   1058 C CA  . ASN B 1 32  ? -8.807  -0.037  17.459  1.00 14.95 ? 31  ASN B CA  1 
ATOM   1059 C C   . ASN B 1 32  ? -8.302  1.143   16.642  1.00 14.02 ? 31  ASN B C   1 
ATOM   1060 O O   . ASN B 1 32  ? -8.917  1.532   15.657  1.00 13.99 ? 31  ASN B O   1 
ATOM   1061 C CB  . ASN B 1 32  ? -8.055  -1.297  17.016  1.00 15.50 ? 31  ASN B CB  1 
ATOM   1062 C CG  . ASN B 1 32  ? -8.606  -2.557  17.647  1.00 16.58 ? 31  ASN B CG  1 
ATOM   1063 O OD1 . ASN B 1 32  ? -9.637  -3.088  17.220  1.00 17.05 ? 31  ASN B OD1 1 
ATOM   1064 N ND2 . ASN B 1 32  ? -7.934  -3.031  18.682  1.00 16.41 ? 31  ASN B ND2 1 
ATOM   1065 N N   . TYR B 1 33  ? -7.166  1.691   17.057  1.00 13.12 ? 32  TYR B N   1 
ATOM   1066 C CA  . TYR B 1 33  ? -6.548  2.822   16.379  1.00 12.73 ? 32  TYR B CA  1 
ATOM   1067 C C   . TYR B 1 33  ? -6.238  2.519   14.919  1.00 11.47 ? 32  TYR B C   1 
ATOM   1068 O O   . TYR B 1 33  ? -5.890  1.393   14.567  1.00 11.53 ? 32  TYR B O   1 
ATOM   1069 C CB  . TYR B 1 33  ? -5.238  3.196   17.077  1.00 14.27 ? 32  TYR B CB  1 
ATOM   1070 C CG  . TYR B 1 33  ? -5.397  3.704   18.489  1.00 16.13 ? 32  TYR B CG  1 
ATOM   1071 C CD1 . TYR B 1 33  ? -6.397  4.617   18.815  1.00 17.14 ? 32  TYR B CD1 1 
ATOM   1072 C CD2 . TYR B 1 33  ? -4.518  3.300   19.494  1.00 16.97 ? 32  TYR B CD2 1 
ATOM   1073 C CE1 . TYR B 1 33  ? -6.522  5.119   20.111  1.00 18.41 ? 32  TYR B CE1 1 
ATOM   1074 C CE2 . TYR B 1 33  ? -4.633  3.794   20.792  1.00 18.57 ? 32  TYR B CE2 1 
ATOM   1075 C CZ  . TYR B 1 33  ? -5.635  4.703   21.093  1.00 18.88 ? 32  TYR B CZ  1 
ATOM   1076 O OH  . TYR B 1 33  ? -5.749  5.203   22.373  1.00 20.56 ? 32  TYR B OH  1 
ATOM   1077 N N   . VAL B 1 34  ? -6.366  3.540   14.080  1.00 10.70 ? 33  VAL B N   1 
ATOM   1078 C CA  . VAL B 1 34  ? -6.062  3.420   12.661  1.00 9.87  ? 33  VAL B CA  1 
ATOM   1079 C C   . VAL B 1 34  ? -4.881  4.347   12.363  1.00 10.04 ? 33  VAL B C   1 
ATOM   1080 O O   . VAL B 1 34  ? -4.893  5.521   12.738  1.00 11.39 ? 33  VAL B O   1 
ATOM   1081 C CB  . VAL B 1 34  ? -7.273  3.829   11.783  1.00 9.19  ? 33  VAL B CB  1 
ATOM   1082 C CG1 . VAL B 1 34  ? -6.888  3.797   10.301  1.00 9.52  ? 33  VAL B CG1 1 
ATOM   1083 C CG2 . VAL B 1 34  ? -8.439  2.882   12.033  1.00 6.93  ? 33  VAL B CG2 1 
ATOM   1084 N N   . GLN B 1 35  ? -3.847  3.811   11.724  1.00 9.75  ? 34  GLN B N   1 
ATOM   1085 C CA  . GLN B 1 35  ? -2.682  4.611   11.368  1.00 9.79  ? 34  GLN B CA  1 
ATOM   1086 C C   . GLN B 1 35  ? -2.633  4.777   9.854   1.00 9.59  ? 34  GLN B C   1 
ATOM   1087 O O   . GLN B 1 35  ? -3.176  3.954   9.106   1.00 10.01 ? 34  GLN B O   1 
ATOM   1088 C CB  . GLN B 1 35  ? -1.373  3.937   11.815  1.00 10.22 ? 34  GLN B CB  1 
ATOM   1089 C CG  . GLN B 1 35  ? -1.022  4.024   13.299  1.00 10.21 ? 34  GLN B CG  1 
ATOM   1090 C CD  . GLN B 1 35  ? -2.091  3.463   14.206  1.00 10.77 ? 34  GLN B CD  1 
ATOM   1091 O OE1 . GLN B 1 35  ? -2.749  4.204   14.937  1.00 12.17 ? 34  GLN B OE1 1 
ATOM   1092 N NE2 . GLN B 1 35  ? -2.276  2.148   14.164  1.00 10.26 ? 34  GLN B NE2 1 
ATOM   1093 N N   . TRP B 1 36  ? -1.975  5.845   9.415   1.00 9.35  ? 35  TRP B N   1 
ATOM   1094 C CA  . TRP B 1 36  ? -1.791  6.110   7.998   1.00 8.50  ? 35  TRP B CA  1 
ATOM   1095 C C   . TRP B 1 36  ? -0.307  6.273   7.727   1.00 8.36  ? 35  TRP B C   1 
ATOM   1096 O O   . TRP B 1 36  ? 0.368   7.085   8.363   1.00 8.58  ? 35  TRP B O   1 
ATOM   1097 C CB  . TRP B 1 36  ? -2.547  7.364   7.562   1.00 9.37  ? 35  TRP B CB  1 
ATOM   1098 C CG  . TRP B 1 36  ? -4.023  7.143   7.465   1.00 9.10  ? 35  TRP B CG  1 
ATOM   1099 C CD1 . TRP B 1 36  ? -4.952  7.331   8.444   1.00 9.06  ? 35  TRP B CD1 1 
ATOM   1100 C CD2 . TRP B 1 36  ? -4.729  6.633   6.331   1.00 9.10  ? 35  TRP B CD2 1 
ATOM   1101 N NE1 . TRP B 1 36  ? -6.200  6.971   7.988   1.00 8.73  ? 35  TRP B NE1 1 
ATOM   1102 C CE2 . TRP B 1 36  ? -6.090  6.537   6.693   1.00 8.37  ? 35  TRP B CE2 1 
ATOM   1103 C CE3 . TRP B 1 36  ? -4.341  6.246   5.040   1.00 9.23  ? 35  TRP B CE3 1 
ATOM   1104 C CZ2 . TRP B 1 36  ? -7.070  6.072   5.812   1.00 9.21  ? 35  TRP B CZ2 1 
ATOM   1105 C CZ3 . TRP B 1 36  ? -5.318  5.782   4.161   1.00 9.78  ? 35  TRP B CZ3 1 
ATOM   1106 C CH2 . TRP B 1 36  ? -6.668  5.700   4.554   1.00 9.06  ? 35  TRP B CH2 1 
ATOM   1107 N N   . TYR B 1 37  ? 0.195   5.500   6.774   1.00 7.34  ? 36  TYR B N   1 
ATOM   1108 C CA  . TYR B 1 37  ? 1.602   5.539   6.435   1.00 8.04  ? 36  TYR B CA  1 
ATOM   1109 C C   . TYR B 1 37  ? 1.835   6.023   5.009   1.00 7.86  ? 36  TYR B C   1 
ATOM   1110 O O   . TYR B 1 37  ? 1.103   5.671   4.076   1.00 7.95  ? 36  TYR B O   1 
ATOM   1111 C CB  . TYR B 1 37  ? 2.215   4.144   6.619   1.00 7.68  ? 36  TYR B CB  1 
ATOM   1112 C CG  . TYR B 1 37  ? 2.055   3.587   8.019   1.00 8.35  ? 36  TYR B CG  1 
ATOM   1113 C CD1 . TYR B 1 37  ? 2.480   4.312   9.128   1.00 8.56  ? 36  TYR B CD1 1 
ATOM   1114 C CD2 . TYR B 1 37  ? 1.463   2.336   8.234   1.00 9.64  ? 36  TYR B CD2 1 
ATOM   1115 C CE1 . TYR B 1 37  ? 2.320   3.815   10.422  1.00 9.26  ? 36  TYR B CE1 1 
ATOM   1116 C CE2 . TYR B 1 37  ? 1.297   1.829   9.531   1.00 9.32  ? 36  TYR B CE2 1 
ATOM   1117 C CZ  . TYR B 1 37  ? 1.728   2.577   10.616  1.00 8.75  ? 36  TYR B CZ  1 
ATOM   1118 O OH  . TYR B 1 37  ? 1.567   2.096   11.892  1.00 8.62  ? 36  TYR B OH  1 
ATOM   1119 N N   . GLN B 1 38  ? 2.864   6.841   4.861   1.00 7.05  ? 37  GLN B N   1 
ATOM   1120 C CA  . GLN B 1 38  ? 3.249   7.383   3.571   1.00 7.23  ? 37  GLN B CA  1 
ATOM   1121 C C   . GLN B 1 38  ? 4.560   6.709   3.188   1.00 7.44  ? 37  GLN B C   1 
ATOM   1122 O O   . GLN B 1 38  ? 5.507   6.702   3.982   1.00 7.06  ? 37  GLN B O   1 
ATOM   1123 C CB  . GLN B 1 38  ? 3.471   8.895   3.687   1.00 7.57  ? 37  GLN B CB  1 
ATOM   1124 C CG  . GLN B 1 38  ? 3.940   9.580   2.405   1.00 6.80  ? 37  GLN B CG  1 
ATOM   1125 C CD  . GLN B 1 38  ? 4.384   11.012  2.649   1.00 7.74  ? 37  GLN B CD  1 
ATOM   1126 O OE1 . GLN B 1 38  ? 5.316   11.261  3.417   1.00 8.29  ? 37  GLN B OE1 1 
ATOM   1127 N NE2 . GLN B 1 38  ? 3.717   11.959  2.005   1.00 7.64  ? 37  GLN B NE2 1 
ATOM   1128 N N   . GLN B 1 39  ? 4.616   6.134   1.990   1.00 7.69  ? 38  GLN B N   1 
ATOM   1129 C CA  . GLN B 1 39  ? 5.839   5.490   1.526   1.00 8.86  ? 38  GLN B CA  1 
ATOM   1130 C C   . GLN B 1 39  ? 6.186   5.836   0.079   1.00 9.11  ? 38  GLN B C   1 
ATOM   1131 O O   . GLN B 1 39  ? 5.404   5.594   -0.843  1.00 9.82  ? 38  GLN B O   1 
ATOM   1132 C CB  . GLN B 1 39  ? 5.751   3.958   1.665   1.00 9.58  ? 38  GLN B CB  1 
ATOM   1133 C CG  . GLN B 1 39  ? 6.979   3.218   1.105   1.00 9.66  ? 38  GLN B CG  1 
ATOM   1134 C CD  . GLN B 1 39  ? 6.911   1.703   1.261   1.00 10.33 ? 38  GLN B CD  1 
ATOM   1135 O OE1 . GLN B 1 39  ? 5.921   1.070   0.897   1.00 9.40  ? 38  GLN B OE1 1 
ATOM   1136 N NE2 . GLN B 1 39  ? 7.986   1.113   1.782   1.00 9.73  ? 38  GLN B NE2 1 
ATOM   1137 N N   . ARG B 1 40  ? 7.357   6.424   -0.114  1.00 9.18  ? 39  ARG B N   1 
ATOM   1138 C CA  . ARG B 1 40  ? 7.822   6.734   -1.458  1.00 9.02  ? 39  ARG B CA  1 
ATOM   1139 C C   . ARG B 1 40  ? 8.684   5.521   -1.777  1.00 9.08  ? 39  ARG B C   1 
ATOM   1140 O O   . ARG B 1 40  ? 9.656   5.241   -1.072  1.00 9.30  ? 39  ARG B O   1 
ATOM   1141 C CB  . ARG B 1 40  ? 8.653   8.021   -1.475  1.00 10.20 ? 39  ARG B CB  1 
ATOM   1142 C CG  . ARG B 1 40  ? 7.889   9.225   -0.937  1.00 11.04 ? 39  ARG B CG  1 
ATOM   1143 C CD  . ARG B 1 40  ? 8.524   10.553  -1.315  1.00 13.28 ? 39  ARG B CD  1 
ATOM   1144 N NE  . ARG B 1 40  ? 7.781   11.662  -0.716  1.00 14.05 ? 39  ARG B NE  1 
ATOM   1145 C CZ  . ARG B 1 40  ? 7.777   11.937  0.584   1.00 15.03 ? 39  ARG B CZ  1 
ATOM   1146 N NH1 . ARG B 1 40  ? 8.505   11.208  1.421   1.00 16.06 ? 39  ARG B NH1 1 
ATOM   1147 N NH2 . ARG B 1 40  ? 7.071   12.960  1.048   1.00 15.81 ? 39  ARG B NH2 1 
ATOM   1148 N N   . PRO B 1 41  ? 8.341   4.783   -2.841  1.00 9.30  ? 40  PRO B N   1 
ATOM   1149 C CA  . PRO B 1 41  ? 9.116   3.594   -3.201  1.00 9.68  ? 40  PRO B CA  1 
ATOM   1150 C C   . PRO B 1 41  ? 10.624  3.768   -3.057  1.00 10.07 ? 40  PRO B C   1 
ATOM   1151 O O   . PRO B 1 41  ? 11.187  4.786   -3.465  1.00 9.63  ? 40  PRO B O   1 
ATOM   1152 C CB  . PRO B 1 41  ? 8.667   3.336   -4.630  1.00 9.50  ? 40  PRO B CB  1 
ATOM   1153 C CG  . PRO B 1 41  ? 7.187   3.670   -4.519  1.00 9.80  ? 40  PRO B CG  1 
ATOM   1154 C CD  . PRO B 1 41  ? 7.284   5.024   -3.841  1.00 8.74  ? 40  PRO B CD  1 
ATOM   1155 N N   . GLY B 1 42  ? 11.260  2.768   -2.452  1.00 10.36 ? 41  GLY B N   1 
ATOM   1156 C CA  . GLY B 1 42  ? 12.697  2.798   -2.249  1.00 10.78 ? 41  GLY B CA  1 
ATOM   1157 C C   . GLY B 1 42  ? 13.092  3.267   -0.861  1.00 11.10 ? 41  GLY B C   1 
ATOM   1158 O O   . GLY B 1 42  ? 14.264  3.212   -0.494  1.00 11.68 ? 41  GLY B O   1 
ATOM   1159 N N   . SER B 1 43  ? 12.112  3.731   -0.089  1.00 10.50 ? 42  SER B N   1 
ATOM   1160 C CA  . SER B 1 43  ? 12.360  4.221   1.257   1.00 10.35 ? 42  SER B CA  1 
ATOM   1161 C C   . SER B 1 43  ? 11.346  3.668   2.247   1.00 9.92  ? 42  SER B C   1 
ATOM   1162 O O   . SER B 1 43  ? 10.255  3.241   1.865   1.00 9.80  ? 42  SER B O   1 
ATOM   1163 C CB  . SER B 1 43  ? 12.303  5.750   1.283   1.00 11.16 ? 42  SER B CB  1 
ATOM   1164 O OG  . SER B 1 43  ? 13.285  6.302   0.431   1.00 14.10 ? 42  SER B OG  1 
ATOM   1165 N N   . ALA B 1 44  ? 11.715  3.686   3.524   1.00 8.30  ? 43  ALA B N   1 
ATOM   1166 C CA  . ALA B 1 44  ? 10.845  3.194   4.579   1.00 8.77  ? 43  ALA B CA  1 
ATOM   1167 C C   . ALA B 1 44  ? 9.599   4.062   4.699   1.00 8.20  ? 43  ALA B C   1 
ATOM   1168 O O   . ALA B 1 44  ? 9.612   5.236   4.327   1.00 8.98  ? 43  ALA B O   1 
ATOM   1169 C CB  . ALA B 1 44  ? 11.597  3.185   5.900   1.00 9.17  ? 43  ALA B CB  1 
ATOM   1170 N N   . PRO B 1 45  ? 8.496   3.487   5.204   1.00 8.69  ? 44  PRO B N   1 
ATOM   1171 C CA  . PRO B 1 45  ? 7.250   4.236   5.367   1.00 8.57  ? 44  PRO B CA  1 
ATOM   1172 C C   . PRO B 1 45  ? 7.436   5.337   6.411   1.00 9.19  ? 44  PRO B C   1 
ATOM   1173 O O   . PRO B 1 45  ? 8.329   5.265   7.257   1.00 8.49  ? 44  PRO B O   1 
ATOM   1174 C CB  . PRO B 1 45  ? 6.269   3.157   5.840   1.00 8.30  ? 44  PRO B CB  1 
ATOM   1175 C CG  . PRO B 1 45  ? 6.863   1.881   5.214   1.00 9.33  ? 44  PRO B CG  1 
ATOM   1176 C CD  . PRO B 1 45  ? 8.294   2.095   5.631   1.00 8.70  ? 44  PRO B CD  1 
ATOM   1177 N N   . ILE B 1 46  ? 6.583   6.348   6.341   1.00 9.78  ? 45  ILE B N   1 
ATOM   1178 C CA  . ILE B 1 46  ? 6.610   7.457   7.275   1.00 11.31 ? 45  ILE B CA  1 
ATOM   1179 C C   . ILE B 1 46  ? 5.206   7.625   7.837   1.00 11.25 ? 45  ILE B C   1 
ATOM   1180 O O   . ILE B 1 46  ? 4.233   7.646   7.085   1.00 11.45 ? 45  ILE B O   1 
ATOM   1181 C CB  . ILE B 1 46  ? 7.023   8.770   6.569   1.00 12.75 ? 45  ILE B CB  1 
ATOM   1182 C CG1 . ILE B 1 46  ? 8.488   8.687   6.144   1.00 13.48 ? 45  ILE B CG1 1 
ATOM   1183 C CG2 . ILE B 1 46  ? 6.766   9.968   7.484   1.00 13.36 ? 45  ILE B CG2 1 
ATOM   1184 C CD1 . ILE B 1 46  ? 8.978   9.918   5.410   1.00 15.73 ? 45  ILE B CD1 1 
ATOM   1185 N N   . THR B 1 47  ? 5.092   7.738   9.155   1.00 11.18 ? 46  THR B N   1 
ATOM   1186 C CA  . THR B 1 47  ? 3.779   7.917   9.765   1.00 11.12 ? 46  THR B CA  1 
ATOM   1187 C C   . THR B 1 47  ? 3.286   9.348   9.550   1.00 11.23 ? 46  THR B C   1 
ATOM   1188 O O   . THR B 1 47  ? 3.997   10.304  9.869   1.00 11.41 ? 46  THR B O   1 
ATOM   1189 C CB  . THR B 1 47  ? 3.817   7.667   11.290  1.00 11.39 ? 46  THR B CB  1 
ATOM   1190 O OG1 . THR B 1 47  ? 4.295   6.342   11.550  1.00 12.86 ? 46  THR B OG1 1 
ATOM   1191 C CG2 . THR B 1 47  ? 2.417   7.820   11.892  1.00 10.43 ? 46  THR B CG2 1 
ATOM   1192 N N   . VAL B 1 48  ? 2.088   9.497   8.988   1.00 10.24 ? 47  VAL B N   1 
ATOM   1193 C CA  . VAL B 1 48  ? 1.508   10.821  8.803   1.00 9.96  ? 47  VAL B CA  1 
ATOM   1194 C C   . VAL B 1 48  ? 0.312   10.979  9.751   1.00 9.40  ? 47  VAL B C   1 
ATOM   1195 O O   . VAL B 1 48  ? -0.094  12.096  10.072  1.00 8.39  ? 47  VAL B O   1 
ATOM   1196 C CB  . VAL B 1 48  ? 1.055   11.068  7.346   1.00 9.98  ? 47  VAL B CB  1 
ATOM   1197 C CG1 . VAL B 1 48  ? 2.266   11.103  6.430   1.00 10.27 ? 47  VAL B CG1 1 
ATOM   1198 C CG2 . VAL B 1 48  ? 0.085   9.998   6.911   1.00 10.67 ? 47  VAL B CG2 1 
ATOM   1199 N N   . ILE B 1 49  ? -0.239  9.853   10.201  1.00 8.87  ? 48  ILE B N   1 
ATOM   1200 C CA  . ILE B 1 49  ? -1.362  9.857   11.143  1.00 8.34  ? 48  ILE B CA  1 
ATOM   1201 C C   . ILE B 1 49  ? -1.309  8.596   12.017  1.00 8.82  ? 48  ILE B C   1 
ATOM   1202 O O   . ILE B 1 49  ? -1.052  7.500   11.521  1.00 9.10  ? 48  ILE B O   1 
ATOM   1203 C CB  . ILE B 1 49  ? -2.739  9.869   10.412  1.00 8.07  ? 48  ILE B CB  1 
ATOM   1204 C CG1 . ILE B 1 49  ? -2.947  11.187  9.659   1.00 7.50  ? 48  ILE B CG1 1 
ATOM   1205 C CG2 . ILE B 1 49  ? -3.871  9.666   11.418  1.00 6.33  ? 48  ILE B CG2 1 
ATOM   1206 C CD1 . ILE B 1 49  ? -3.102  12.403  10.575  1.00 7.86  ? 48  ILE B CD1 1 
ATOM   1207 N N   . TYR B 1 50  ? -1.533  8.761   13.316  1.00 8.33  ? 49  TYR B N   1 
ATOM   1208 C CA  . TYR B 1 50  ? -1.562  7.629   14.238  1.00 9.31  ? 49  TYR B CA  1 
ATOM   1209 C C   . TYR B 1 50  ? -2.756  7.876   15.157  1.00 9.01  ? 49  TYR B C   1 
ATOM   1210 O O   . TYR B 1 50  ? -3.222  9.013   15.273  1.00 9.17  ? 49  TYR B O   1 
ATOM   1211 C CB  . TYR B 1 50  ? -0.244  7.536   15.027  1.00 8.42  ? 49  TYR B CB  1 
ATOM   1212 C CG  . TYR B 1 50  ? 0.018   8.662   16.008  1.00 8.63  ? 49  TYR B CG  1 
ATOM   1213 C CD1 . TYR B 1 50  ? -0.511  8.632   17.300  1.00 8.72  ? 49  TYR B CD1 1 
ATOM   1214 C CD2 . TYR B 1 50  ? 0.795   9.760   15.641  1.00 8.84  ? 49  TYR B CD2 1 
ATOM   1215 C CE1 . TYR B 1 50  ? -0.268  9.671   18.201  1.00 10.00 ? 49  TYR B CE1 1 
ATOM   1216 C CE2 . TYR B 1 50  ? 1.044   10.807  16.534  1.00 9.44  ? 49  TYR B CE2 1 
ATOM   1217 C CZ  . TYR B 1 50  ? 0.511   10.756  17.807  1.00 10.21 ? 49  TYR B CZ  1 
ATOM   1218 O OH  . TYR B 1 50  ? 0.759   11.792  18.680  1.00 11.99 ? 49  TYR B OH  1 
ATOM   1219 N N   . GLU B 1 51  ? -3.274  6.823   15.782  1.00 9.63  ? 50  GLU B N   1 
ATOM   1220 C CA  . GLU B 1 51  ? -4.421  6.981   16.671  1.00 10.05 ? 50  GLU B CA  1 
ATOM   1221 C C   . GLU B 1 51  ? -5.568  7.763   16.029  1.00 10.06 ? 50  GLU B C   1 
ATOM   1222 O O   . GLU B 1 51  ? -6.116  8.707   16.610  1.00 9.06  ? 50  GLU B O   1 
ATOM   1223 C CB  . GLU B 1 51  ? -3.977  7.635   17.985  1.00 11.11 ? 50  GLU B CB  1 
ATOM   1224 C CG  . GLU B 1 51  ? -3.278  6.639   18.913  1.00 13.17 ? 50  GLU B CG  1 
ATOM   1225 C CD  . GLU B 1 51  ? -2.766  7.264   20.191  1.00 14.79 ? 50  GLU B CD  1 
ATOM   1226 O OE1 . GLU B 1 51  ? -3.497  8.074   20.798  1.00 15.49 ? 50  GLU B OE1 1 
ATOM   1227 O OE2 . GLU B 1 51  ? -1.640  6.922   20.605  1.00 17.00 ? 50  GLU B OE2 1 
ATOM   1228 N N   . ASP B 1 52  ? -5.898  7.351   14.809  1.00 9.25  ? 51  ASP B N   1 
ATOM   1229 C CA  . ASP B 1 52  ? -6.983  7.902   14.009  1.00 10.44 ? 51  ASP B CA  1 
ATOM   1230 C C   . ASP B 1 52  ? -6.839  9.281   13.392  1.00 10.46 ? 51  ASP B C   1 
ATOM   1231 O O   . ASP B 1 52  ? -7.158  9.456   12.215  1.00 10.11 ? 51  ASP B O   1 
ATOM   1232 C CB  . ASP B 1 52  ? -8.290  7.886   14.798  1.00 10.73 ? 51  ASP B CB  1 
ATOM   1233 C CG  . ASP B 1 52  ? -8.571  6.546   15.425  1.00 11.20 ? 51  ASP B CG  1 
ATOM   1234 O OD1 . ASP B 1 52  ? -8.396  5.510   14.740  1.00 10.33 ? 51  ASP B OD1 1 
ATOM   1235 O OD2 . ASP B 1 52  ? -8.984  6.537   16.605  1.00 11.66 ? 51  ASP B OD2 1 
ATOM   1236 N N   . ASN B 1 53  ? -6.381  10.263  14.167  1.00 10.31 ? 52  ASN B N   1 
ATOM   1237 C CA  . ASN B 1 53  ? -6.273  11.617  13.636  1.00 10.73 ? 52  ASN B CA  1 
ATOM   1238 C C   . ASN B 1 53  ? -5.171  12.488  14.232  1.00 10.00 ? 52  ASN B C   1 
ATOM   1239 O O   . ASN B 1 53  ? -5.269  13.713  14.185  1.00 9.06  ? 52  ASN B O   1 
ATOM   1240 C CB  . ASN B 1 53  ? -7.609  12.340  13.814  1.00 10.88 ? 52  ASN B CB  1 
ATOM   1241 C CG  . ASN B 1 53  ? -7.996  12.502  15.275  1.00 12.57 ? 52  ASN B CG  1 
ATOM   1242 O OD1 . ASN B 1 53  ? -9.075  13.014  15.587  1.00 14.83 ? 52  ASN B OD1 1 
ATOM   1243 N ND2 . ASN B 1 53  ? -7.120  12.068  16.179  1.00 10.86 ? 52  ASN B ND2 1 
ATOM   1244 N N   . GLN B 1 54  ? -4.139  11.866  14.793  1.00 10.66 ? 53  GLN B N   1 
ATOM   1245 C CA  . GLN B 1 54  ? -3.029  12.608  15.389  1.00 11.06 ? 53  GLN B CA  1 
ATOM   1246 C C   . GLN B 1 54  ? -1.846  12.700  14.433  1.00 11.59 ? 53  GLN B C   1 
ATOM   1247 O O   . GLN B 1 54  ? -1.370  11.679  13.941  1.00 10.97 ? 53  GLN B O   1 
ATOM   1248 C CB  . GLN B 1 54  ? -2.573  11.924  16.678  1.00 12.39 ? 53  GLN B CB  1 
ATOM   1249 C CG  . GLN B 1 54  ? -3.657  11.791  17.730  1.00 12.27 ? 53  GLN B CG  1 
ATOM   1250 C CD  . GLN B 1 54  ? -4.225  13.133  18.132  1.00 13.31 ? 53  GLN B CD  1 
ATOM   1251 O OE1 . GLN B 1 54  ? -5.409  13.404  17.932  1.00 14.93 ? 53  GLN B OE1 1 
ATOM   1252 N NE2 . GLN B 1 54  ? -3.380  13.986  18.695  1.00 12.86 ? 53  GLN B NE2 1 
ATOM   1253 N N   . ARG B 1 55  ? -1.367  13.914  14.163  1.00 12.08 ? 54  ARG B N   1 
ATOM   1254 C CA  . ARG B 1 55  ? -0.221  14.063  13.269  1.00 13.10 ? 54  ARG B CA  1 
ATOM   1255 C C   . ARG B 1 55  ? 1.057   14.154  14.083  1.00 13.19 ? 54  ARG B C   1 
ATOM   1256 O O   . ARG B 1 55  ? 1.170   14.988  14.982  1.00 12.69 ? 54  ARG B O   1 
ATOM   1257 C CB  . ARG B 1 55  ? -0.315  15.330  12.412  1.00 14.43 ? 54  ARG B CB  1 
ATOM   1258 C CG  . ARG B 1 55  ? -1.571  15.485  11.592  1.00 16.44 ? 54  ARG B CG  1 
ATOM   1259 C CD  . ARG B 1 55  ? -1.359  16.571  10.548  1.00 18.72 ? 54  ARG B CD  1 
ATOM   1260 N NE  . ARG B 1 55  ? -0.752  17.771  11.112  1.00 21.65 ? 54  ARG B NE  1 
ATOM   1261 C CZ  . ARG B 1 55  ? -1.341  18.585  11.979  1.00 22.00 ? 54  ARG B CZ  1 
ATOM   1262 N NH1 . ARG B 1 55  ? -2.573  18.340  12.396  1.00 23.56 ? 54  ARG B NH1 1 
ATOM   1263 N NH2 . ARG B 1 55  ? -0.682  19.635  12.450  1.00 23.19 ? 54  ARG B NH2 1 
ATOM   1264 N N   . PRO B 1 56  ? 2.032   13.284  13.799  1.00 13.77 ? 55  PRO B N   1 
ATOM   1265 C CA  . PRO B 1 56  ? 3.285   13.340  14.551  1.00 14.61 ? 55  PRO B CA  1 
ATOM   1266 C C   . PRO B 1 56  ? 4.018   14.647  14.259  1.00 15.10 ? 55  PRO B C   1 
ATOM   1267 O O   . PRO B 1 56  ? 3.657   15.385  13.335  1.00 14.70 ? 55  PRO B O   1 
ATOM   1268 C CB  . PRO B 1 56  ? 4.041   12.115  14.036  1.00 15.08 ? 55  PRO B CB  1 
ATOM   1269 C CG  . PRO B 1 56  ? 3.561   12.025  12.610  1.00 15.21 ? 55  PRO B CG  1 
ATOM   1270 C CD  . PRO B 1 56  ? 2.069   12.169  12.838  1.00 14.71 ? 55  PRO B CD  1 
ATOM   1271 N N   . SER B 1 57  ? 5.042   14.934  15.054  1.00 15.10 ? 56  SER B N   1 
ATOM   1272 C CA  . SER B 1 57  ? 5.824   16.147  14.868  1.00 15.44 ? 56  SER B CA  1 
ATOM   1273 C C   . SER B 1 57  ? 6.455   16.150  13.481  1.00 15.10 ? 56  SER B C   1 
ATOM   1274 O O   . SER B 1 57  ? 6.921   15.116  13.003  1.00 14.43 ? 56  SER B O   1 
ATOM   1275 C CB  . SER B 1 57  ? 6.924   16.226  15.927  1.00 16.36 ? 56  SER B CB  1 
ATOM   1276 O OG  . SER B 1 57  ? 7.721   17.378  15.747  1.00 19.41 ? 56  SER B OG  1 
ATOM   1277 N N   . GLY B 1 58  ? 6.456   17.309  12.833  1.00 14.96 ? 57  GLY B N   1 
ATOM   1278 C CA  . GLY B 1 58  ? 7.062   17.414  11.517  1.00 15.39 ? 57  GLY B CA  1 
ATOM   1279 C C   . GLY B 1 58  ? 6.185   17.069  10.325  1.00 15.74 ? 57  GLY B C   1 
ATOM   1280 O O   . GLY B 1 58  ? 6.630   17.163  9.180   1.00 16.15 ? 57  GLY B O   1 
ATOM   1281 N N   . VAL B 1 59  ? 4.954   16.645  10.579  1.00 14.87 ? 58  VAL B N   1 
ATOM   1282 C CA  . VAL B 1 59  ? 4.036   16.315  9.492   1.00 13.96 ? 58  VAL B CA  1 
ATOM   1283 C C   . VAL B 1 59  ? 3.159   17.540  9.253   1.00 14.80 ? 58  VAL B C   1 
ATOM   1284 O O   . VAL B 1 59  ? 2.525   18.048  10.179  1.00 14.94 ? 58  VAL B O   1 
ATOM   1285 C CB  . VAL B 1 59  ? 3.165   15.090  9.854   1.00 13.20 ? 58  VAL B CB  1 
ATOM   1286 C CG1 . VAL B 1 59  ? 2.067   14.882  8.811   1.00 10.26 ? 58  VAL B CG1 1 
ATOM   1287 C CG2 . VAL B 1 59  ? 4.052   13.848  9.933   1.00 11.90 ? 58  VAL B CG2 1 
ATOM   1288 N N   . PRO B 1 60  ? 3.095   18.016  8.001   1.00 15.44 ? 59  PRO B N   1 
ATOM   1289 C CA  . PRO B 1 60  ? 2.294   19.192  7.656   1.00 16.55 ? 59  PRO B CA  1 
ATOM   1290 C C   . PRO B 1 60  ? 0.841   19.040  8.080   1.00 16.71 ? 59  PRO B C   1 
ATOM   1291 O O   . PRO B 1 60  ? 0.318   17.929  8.114   1.00 17.03 ? 59  PRO B O   1 
ATOM   1292 C CB  . PRO B 1 60  ? 2.449   19.266  6.138   1.00 16.09 ? 59  PRO B CB  1 
ATOM   1293 C CG  . PRO B 1 60  ? 3.825   18.693  5.927   1.00 16.90 ? 59  PRO B CG  1 
ATOM   1294 C CD  . PRO B 1 60  ? 3.697   17.456  6.782   1.00 16.13 ? 59  PRO B CD  1 
ATOM   1295 N N   . ASP B 1 61  ? 0.192   20.155  8.400   1.00 17.61 ? 60  ASP B N   1 
ATOM   1296 C CA  . ASP B 1 61  ? -1.206  20.119  8.798   1.00 18.17 ? 60  ASP B CA  1 
ATOM   1297 C C   . ASP B 1 61  ? -2.108  19.865  7.596   1.00 17.19 ? 60  ASP B C   1 
ATOM   1298 O O   . ASP B 1 61  ? -3.333  19.849  7.728   1.00 17.17 ? 60  ASP B O   1 
ATOM   1299 C CB  . ASP B 1 61  ? -1.615  21.427  9.483   1.00 20.34 ? 60  ASP B CB  1 
ATOM   1300 C CG  . ASP B 1 61  ? -1.267  22.652  8.659   1.00 22.80 ? 60  ASP B CG  1 
ATOM   1301 O OD1 . ASP B 1 61  ? -1.589  22.677  7.452   1.00 23.26 ? 60  ASP B OD1 1 
ATOM   1302 O OD2 . ASP B 1 61  ? -0.681  23.598  9.230   1.00 24.14 ? 60  ASP B OD2 1 
ATOM   1303 N N   . ARG B 1 62  ? -1.501  19.675  6.425   1.00 15.44 ? 61  ARG B N   1 
ATOM   1304 C CA  . ARG B 1 62  ? -2.261  19.396  5.208   1.00 14.52 ? 61  ARG B CA  1 
ATOM   1305 C C   . ARG B 1 62  ? -2.779  17.966  5.266   1.00 13.67 ? 61  ARG B C   1 
ATOM   1306 O O   . ARG B 1 62  ? -3.599  17.549  4.447   1.00 13.04 ? 61  ARG B O   1 
ATOM   1307 C CB  . ARG B 1 62  ? -1.386  19.587  3.959   1.00 13.90 ? 61  ARG B CB  1 
ATOM   1308 C CG  . ARG B 1 62  ? -0.875  21.006  3.815   1.00 14.31 ? 61  ARG B CG  1 
ATOM   1309 C CD  . ARG B 1 62  ? -0.087  21.275  2.530   1.00 13.66 ? 61  ARG B CD  1 
ATOM   1310 N NE  . ARG B 1 62  ? 1.112   20.448  2.390   1.00 14.00 ? 61  ARG B NE  1 
ATOM   1311 C CZ  . ARG B 1 62  ? 1.140   19.254  1.812   1.00 12.52 ? 61  ARG B CZ  1 
ATOM   1312 N NH1 . ARG B 1 62  ? 0.030   18.733  1.311   1.00 11.74 ? 61  ARG B NH1 1 
ATOM   1313 N NH2 . ARG B 1 62  ? 2.287   18.590  1.717   1.00 13.02 ? 61  ARG B NH2 1 
ATOM   1314 N N   . PHE B 1 63  ? -2.290  17.211  6.242   1.00 13.23 ? 62  PHE B N   1 
ATOM   1315 C CA  . PHE B 1 63  ? -2.726  15.836  6.407   1.00 13.38 ? 62  PHE B CA  1 
ATOM   1316 C C   . PHE B 1 63  ? -3.654  15.737  7.603   1.00 13.64 ? 62  PHE B C   1 
ATOM   1317 O O   . PHE B 1 63  ? -3.357  16.269  8.671   1.00 13.69 ? 62  PHE B O   1 
ATOM   1318 C CB  . PHE B 1 63  ? -1.533  14.898  6.614   1.00 13.26 ? 62  PHE B CB  1 
ATOM   1319 C CG  . PHE B 1 63  ? -0.606  14.819  5.435   1.00 13.33 ? 62  PHE B CG  1 
ATOM   1320 C CD1 . PHE B 1 63  ? 0.250   15.870  5.131   1.00 13.27 ? 62  PHE B CD1 1 
ATOM   1321 C CD2 . PHE B 1 63  ? -0.596  13.692  4.620   1.00 13.93 ? 62  PHE B CD2 1 
ATOM   1322 C CE1 . PHE B 1 63  ? 1.107   15.800  4.034   1.00 13.51 ? 62  PHE B CE1 1 
ATOM   1323 C CE2 . PHE B 1 63  ? 0.260   13.613  3.517   1.00 13.83 ? 62  PHE B CE2 1 
ATOM   1324 C CZ  . PHE B 1 63  ? 1.112   14.673  3.227   1.00 13.91 ? 62  PHE B CZ  1 
ATOM   1325 N N   . ALA B 1 64  ? -4.783  15.062  7.426   1.00 13.60 ? 63  ALA B N   1 
ATOM   1326 C CA  . ALA B 1 64  ? -5.725  14.903  8.524   1.00 13.80 ? 63  ALA B CA  1 
ATOM   1327 C C   . ALA B 1 64  ? -6.422  13.555  8.426   1.00 13.08 ? 63  ALA B C   1 
ATOM   1328 O O   . ALA B 1 64  ? -6.812  13.127  7.336   1.00 12.79 ? 63  ALA B O   1 
ATOM   1329 C CB  . ALA B 1 64  ? -6.771  16.024  8.505   1.00 14.34 ? 63  ALA B CB  1 
ATOM   1330 N N   . GLY B 1 65  ? -6.568  12.894  9.571   1.00 11.71 ? 64  GLY B N   1 
ATOM   1331 C CA  . GLY B 1 65  ? -7.221  11.600  9.608   1.00 11.37 ? 64  GLY B CA  1 
ATOM   1332 C C   . GLY B 1 65  ? -8.603  11.708  10.221  1.00 11.13 ? 64  GLY B C   1 
ATOM   1333 O O   . GLY B 1 65  ? -8.842  12.565  11.066  1.00 10.88 ? 64  GLY B O   1 
ATOM   1334 N N   . SER B 1 66  ? -9.518  10.849  9.785   1.00 11.44 ? 65  SER B N   1 
ATOM   1335 C CA  . SER B 1 66  ? -10.875 10.863  10.312  1.00 11.54 ? 65  SER B CA  1 
ATOM   1336 C C   . SER B 1 66  ? -11.493 9.472   10.266  1.00 12.05 ? 65  SER B C   1 
ATOM   1337 O O   . SER B 1 66  ? -11.079 8.620   9.473   1.00 11.30 ? 65  SER B O   1 
ATOM   1338 C CB  . SER B 1 66  ? -11.746 11.857  9.530   1.00 11.87 ? 65  SER B CB  1 
ATOM   1339 O OG  . SER B 1 66  ? -11.847 11.508  8.159   1.00 13.09 ? 65  SER B OG  1 
ATOM   1340 N N   . ILE B 1 67  ? -12.476 9.247   11.133  1.00 11.90 ? 66  ILE B N   1 
ATOM   1341 C CA  . ILE B 1 67  ? -13.158 7.963   11.204  1.00 12.30 ? 66  ILE B CA  1 
ATOM   1342 C C   . ILE B 1 67  ? -14.654 8.139   10.966  1.00 12.51 ? 66  ILE B C   1 
ATOM   1343 O O   . ILE B 1 67  ? -15.277 9.061   11.499  1.00 12.24 ? 66  ILE B O   1 
ATOM   1344 C CB  . ILE B 1 67  ? -12.965 7.295   12.592  1.00 13.06 ? 66  ILE B CB  1 
ATOM   1345 C CG1 . ILE B 1 67  ? -11.477 7.044   12.859  1.00 13.37 ? 66  ILE B CG1 1 
ATOM   1346 C CG2 . ILE B 1 67  ? -13.742 5.980   12.651  1.00 13.41 ? 66  ILE B CG2 1 
ATOM   1347 C CD1 . ILE B 1 67  ? -10.820 6.079   11.896  1.00 13.23 ? 66  ILE B CD1 1 
ATOM   1348 N N   . ASP B 1 68  A -15.221 7.262   10.149  1.00 11.83 ? 66  ASP B N   1 
ATOM   1349 C CA  . ASP B 1 68  A -16.643 7.308   9.856   1.00 11.86 ? 66  ASP B CA  1 
ATOM   1350 C C   . ASP B 1 68  A -17.298 5.982   10.229  1.00 11.95 ? 66  ASP B C   1 
ATOM   1351 O O   . ASP B 1 68  A -17.279 5.018   9.467   1.00 11.76 ? 66  ASP B O   1 
ATOM   1352 C CB  . ASP B 1 68  A -16.870 7.642   8.379   1.00 10.83 ? 66  ASP B CB  1 
ATOM   1353 C CG  . ASP B 1 68  A -18.323 7.498   7.964   1.00 11.80 ? 66  ASP B CG  1 
ATOM   1354 O OD1 . ASP B 1 68  A -19.204 7.488   8.853   1.00 10.37 ? 66  ASP B OD1 1 
ATOM   1355 O OD2 . ASP B 1 68  A -18.581 7.416   6.743   1.00 11.18 ? 66  ASP B OD2 1 
ATOM   1356 N N   . ARG B 1 69  B -17.883 5.951   11.420  1.00 12.55 ? 66  ARG B N   1 
ATOM   1357 C CA  . ARG B 1 69  B -18.531 4.752   11.928  1.00 12.98 ? 66  ARG B CA  1 
ATOM   1358 C C   . ARG B 1 69  B -19.697 4.262   11.075  1.00 12.51 ? 66  ARG B C   1 
ATOM   1359 O O   . ARG B 1 69  B -19.977 3.068   11.048  1.00 13.01 ? 66  ARG B O   1 
ATOM   1360 C CB  . ARG B 1 69  B -18.984 4.983   13.374  1.00 14.23 ? 66  ARG B CB  1 
ATOM   1361 C CG  . ARG B 1 69  B -17.829 5.199   14.368  1.00 16.66 ? 66  ARG B CG  1 
ATOM   1362 C CD  . ARG B 1 69  B -18.353 5.492   15.769  1.00 18.60 ? 66  ARG B CD  1 
ATOM   1363 N NE  . ARG B 1 69  B -17.293 5.564   16.775  1.00 22.37 ? 66  ARG B NE  1 
ATOM   1364 C CZ  . ARG B 1 69  B -16.303 6.458   16.777  1.00 23.84 ? 66  ARG B CZ  1 
ATOM   1365 N NH1 . ARG B 1 69  B -16.224 7.377   15.822  1.00 24.75 ? 66  ARG B NH1 1 
ATOM   1366 N NH2 . ARG B 1 69  B -15.388 6.436   17.741  1.00 24.17 ? 66  ARG B NH2 1 
ATOM   1367 N N   . SER B 1 70  ? -20.372 5.166   10.368  1.00 12.07 ? 67  SER B N   1 
ATOM   1368 C CA  . SER B 1 70  ? -21.502 4.754   9.536   1.00 11.98 ? 67  SER B CA  1 
ATOM   1369 C C   . SER B 1 70  ? -21.062 3.830   8.406   1.00 12.25 ? 67  SER B C   1 
ATOM   1370 O O   . SER B 1 70  ? -21.784 2.901   8.037   1.00 12.30 ? 67  SER B O   1 
ATOM   1371 C CB  . SER B 1 70  ? -22.226 5.969   8.940   1.00 12.39 ? 67  SER B CB  1 
ATOM   1372 O OG  . SER B 1 70  ? -21.429 6.638   7.979   1.00 12.52 ? 67  SER B OG  1 
ATOM   1373 N N   . SER B 1 71  ? -19.881 4.084   7.855   1.00 11.84 ? 68  SER B N   1 
ATOM   1374 C CA  . SER B 1 71  ? -19.358 3.261   6.764   1.00 11.49 ? 68  SER B CA  1 
ATOM   1375 C C   . SER B 1 71  ? -18.233 2.332   7.220   1.00 11.06 ? 68  SER B C   1 
ATOM   1376 O O   . SER B 1 71  ? -17.658 1.604   6.410   1.00 9.34  ? 68  SER B O   1 
ATOM   1377 C CB  . SER B 1 71  ? -18.842 4.153   5.636   1.00 11.52 ? 68  SER B CB  1 
ATOM   1378 O OG  . SER B 1 71  ? -17.807 4.992   6.106   1.00 13.30 ? 68  SER B OG  1 
ATOM   1379 N N   . ASN B 1 72  ? -17.928 2.373   8.513   1.00 9.82  ? 69  ASN B N   1 
ATOM   1380 C CA  . ASN B 1 72  ? -16.885 1.549   9.111   1.00 10.23 ? 69  ASN B CA  1 
ATOM   1381 C C   . ASN B 1 72  ? -15.559 1.726   8.374   1.00 10.53 ? 69  ASN B C   1 
ATOM   1382 O O   . ASN B 1 72  ? -14.871 0.755   8.063   1.00 10.91 ? 69  ASN B O   1 
ATOM   1383 C CB  . ASN B 1 72  ? -17.297 0.074   9.102   1.00 10.95 ? 69  ASN B CB  1 
ATOM   1384 C CG  . ASN B 1 72  ? -16.628 -0.719  10.216  1.00 11.62 ? 69  ASN B CG  1 
ATOM   1385 O OD1 . ASN B 1 72  ? -16.732 -0.357  11.383  1.00 12.22 ? 69  ASN B OD1 1 
ATOM   1386 N ND2 . ASN B 1 72  ? -15.945 -1.796  9.861   1.00 12.48 ? 69  ASN B ND2 1 
ATOM   1387 N N   . SER B 1 73  ? -15.210 2.978   8.105   1.00 10.03 ? 70  SER B N   1 
ATOM   1388 C CA  . SER B 1 73  ? -13.978 3.295   7.399   1.00 10.03 ? 70  SER B CA  1 
ATOM   1389 C C   . SER B 1 73  ? -13.216 4.434   8.058   1.00 9.70  ? 70  SER B C   1 
ATOM   1390 O O   . SER B 1 73  ? -13.737 5.151   8.921   1.00 10.07 ? 70  SER B O   1 
ATOM   1391 C CB  . SER B 1 73  ? -14.284 3.696   5.954   1.00 9.90  ? 70  SER B CB  1 
ATOM   1392 O OG  . SER B 1 73  ? -15.052 4.890   5.922   1.00 11.38 ? 70  SER B OG  1 
ATOM   1393 N N   . ALA B 1 74  ? -11.971 4.589   7.626   1.00 9.58  ? 71  ALA B N   1 
ATOM   1394 C CA  . ALA B 1 74  ? -11.085 5.644   8.101   1.00 9.23  ? 71  ALA B CA  1 
ATOM   1395 C C   . ALA B 1 74  ? -10.655 6.374   6.836   1.00 8.86  ? 71  ALA B C   1 
ATOM   1396 O O   . ALA B 1 74  ? -10.546 5.762   5.771   1.00 9.37  ? 71  ALA B O   1 
ATOM   1397 C CB  . ALA B 1 74  ? -9.874  5.050   8.790   1.00 8.08  ? 71  ALA B CB  1 
ATOM   1398 N N   . SER B 1 75  ? -10.409 7.672   6.944   1.00 8.73  ? 72  SER B N   1 
ATOM   1399 C CA  . SER B 1 75  ? -10.003 8.442   5.780   1.00 8.55  ? 72  SER B CA  1 
ATOM   1400 C C   . SER B 1 75  ? -8.809  9.336   6.035   1.00 8.84  ? 72  SER B C   1 
ATOM   1401 O O   . SER B 1 75  ? -8.632  9.876   7.135   1.00 8.78  ? 72  SER B O   1 
ATOM   1402 C CB  . SER B 1 75  ? -11.161 9.316   5.274   1.00 9.54  ? 72  SER B CB  1 
ATOM   1403 O OG  . SER B 1 75  ? -12.279 8.541   4.876   1.00 9.58  ? 72  SER B OG  1 
ATOM   1404 N N   . LEU B 1 76  ? -7.983  9.471   5.002   1.00 8.44  ? 73  LEU B N   1 
ATOM   1405 C CA  . LEU B 1 76  ? -6.824  10.343  5.045   1.00 6.92  ? 73  LEU B CA  1 
ATOM   1406 C C   . LEU B 1 76  ? -7.118  11.422  4.014   1.00 7.16  ? 73  LEU B C   1 
ATOM   1407 O O   . LEU B 1 76  ? -7.331  11.127  2.838   1.00 6.64  ? 73  LEU B O   1 
ATOM   1408 C CB  . LEU B 1 76  ? -5.545  9.600   4.655   1.00 7.16  ? 73  LEU B CB  1 
ATOM   1409 C CG  . LEU B 1 76  ? -4.307  10.499  4.598   1.00 5.47  ? 73  LEU B CG  1 
ATOM   1410 C CD1 . LEU B 1 76  ? -3.998  11.032  5.999   1.00 5.43  ? 73  LEU B CD1 1 
ATOM   1411 C CD2 . LEU B 1 76  ? -3.126  9.723   4.047   1.00 4.02  ? 73  LEU B CD2 1 
ATOM   1412 N N   . THR B 1 77  ? -7.150  12.669  4.465   1.00 6.84  ? 74  THR B N   1 
ATOM   1413 C CA  . THR B 1 77  ? -7.418  13.790  3.582   1.00 7.08  ? 74  THR B CA  1 
ATOM   1414 C C   . THR B 1 77  ? -6.160  14.643  3.484   1.00 8.10  ? 74  THR B C   1 
ATOM   1415 O O   . THR B 1 77  ? -5.574  15.024  4.500   1.00 7.11  ? 74  THR B O   1 
ATOM   1416 C CB  . THR B 1 77  ? -8.588  14.629  4.121   1.00 6.92  ? 74  THR B CB  1 
ATOM   1417 O OG1 . THR B 1 77  ? -9.755  13.807  4.177   1.00 7.21  ? 74  THR B OG1 1 
ATOM   1418 C CG2 . THR B 1 77  ? -8.870  15.832  3.225   1.00 7.64  ? 74  THR B CG2 1 
ATOM   1419 N N   . ILE B 1 78  ? -5.734  14.915  2.253   1.00 8.70  ? 75  ILE B N   1 
ATOM   1420 C CA  . ILE B 1 78  ? -4.546  15.730  2.021   1.00 9.65  ? 75  ILE B CA  1 
ATOM   1421 C C   . ILE B 1 78  ? -4.959  16.967  1.231   1.00 9.50  ? 75  ILE B C   1 
ATOM   1422 O O   . ILE B 1 78  ? -5.362  16.865  0.074   1.00 9.59  ? 75  ILE B O   1 
ATOM   1423 C CB  . ILE B 1 78  ? -3.490  14.954  1.215   1.00 9.97  ? 75  ILE B CB  1 
ATOM   1424 C CG1 . ILE B 1 78  ? -3.201  13.617  1.900   1.00 11.49 ? 75  ILE B CG1 1 
ATOM   1425 C CG2 . ILE B 1 78  ? -2.201  15.784  1.115   1.00 11.10 ? 75  ILE B CG2 1 
ATOM   1426 C CD1 . ILE B 1 78  ? -2.287  12.697  1.104   1.00 12.97 ? 75  ILE B CD1 1 
ATOM   1427 N N   . SER B 1 79  ? -4.862  18.134  1.855   1.00 9.67  ? 76  SER B N   1 
ATOM   1428 C CA  . SER B 1 79  ? -5.245  19.364  1.180   1.00 9.47  ? 76  SER B CA  1 
ATOM   1429 C C   . SER B 1 79  ? -4.036  20.072  0.571   1.00 9.33  ? 76  SER B C   1 
ATOM   1430 O O   . SER B 1 79  ? -2.895  19.823  0.957   1.00 7.80  ? 76  SER B O   1 
ATOM   1431 C CB  . SER B 1 79  ? -5.954  20.297  2.159   1.00 10.24 ? 76  SER B CB  1 
ATOM   1432 O OG  . SER B 1 79  ? -5.077  20.691  3.193   1.00 11.68 ? 76  SER B OG  1 
ATOM   1433 N N   . GLY B 1 80  ? -4.297  20.961  -0.380  1.00 9.33  ? 77  GLY B N   1 
ATOM   1434 C CA  . GLY B 1 80  ? -3.214  21.689  -1.022  1.00 9.78  ? 77  GLY B CA  1 
ATOM   1435 C C   . GLY B 1 80  ? -2.109  20.772  -1.517  1.00 9.06  ? 77  GLY B C   1 
ATOM   1436 O O   . GLY B 1 80  ? -0.933  21.032  -1.283  1.00 9.00  ? 77  GLY B O   1 
ATOM   1437 N N   . LEU B 1 81  ? -2.487  19.703  -2.209  1.00 8.94  ? 78  LEU B N   1 
ATOM   1438 C CA  . LEU B 1 81  ? -1.517  18.738  -2.726  1.00 8.91  ? 78  LEU B CA  1 
ATOM   1439 C C   . LEU B 1 81  ? -0.248  19.295  -3.351  1.00 8.71  ? 78  LEU B C   1 
ATOM   1440 O O   . LEU B 1 81  ? -0.289  20.161  -4.228  1.00 7.54  ? 78  LEU B O   1 
ATOM   1441 C CB  . LEU B 1 81  ? -2.172  17.805  -3.748  1.00 10.02 ? 78  LEU B CB  1 
ATOM   1442 C CG  . LEU B 1 81  ? -3.114  16.736  -3.201  1.00 11.07 ? 78  LEU B CG  1 
ATOM   1443 C CD1 . LEU B 1 81  ? -3.771  15.997  -4.357  1.00 10.89 ? 78  LEU B CD1 1 
ATOM   1444 C CD2 . LEU B 1 81  ? -2.333  15.780  -2.315  1.00 11.26 ? 78  LEU B CD2 1 
ATOM   1445 N N   . LYS B 1 82  ? 0.880   18.766  -2.890  1.00 9.45  ? 79  LYS B N   1 
ATOM   1446 C CA  . LYS B 1 82  ? 2.186   19.141  -3.407  1.00 9.48  ? 79  LYS B CA  1 
ATOM   1447 C C   . LYS B 1 82  ? 2.738   17.925  -4.139  1.00 9.76  ? 79  LYS B C   1 
ATOM   1448 O O   . LYS B 1 82  ? 2.371   16.786  -3.839  1.00 9.08  ? 79  LYS B O   1 
ATOM   1449 C CB  . LYS B 1 82  ? 3.130   19.542  -2.270  1.00 10.68 ? 79  LYS B CB  1 
ATOM   1450 C CG  . LYS B 1 82  ? 2.725   20.811  -1.549  1.00 11.49 ? 79  LYS B CG  1 
ATOM   1451 C CD  . LYS B 1 82  ? 3.732   21.174  -0.465  1.00 12.90 ? 79  LYS B CD  1 
ATOM   1452 C CE  . LYS B 1 82  ? 3.373   22.493  0.204   1.00 13.56 ? 79  LYS B CE  1 
ATOM   1453 N NZ  . LYS B 1 82  ? 4.367   22.845  1.253   1.00 15.01 ? 79  LYS B NZ  1 
ATOM   1454 N N   . THR B 1 83  ? 3.615   18.159  -5.105  1.00 10.03 ? 80  THR B N   1 
ATOM   1455 C CA  . THR B 1 83  ? 4.181   17.057  -5.861  1.00 10.89 ? 80  THR B CA  1 
ATOM   1456 C C   . THR B 1 83  ? 4.838   16.043  -4.917  1.00 10.98 ? 80  THR B C   1 
ATOM   1457 O O   . THR B 1 83  ? 4.719   14.841  -5.121  1.00 12.10 ? 80  THR B O   1 
ATOM   1458 C CB  . THR B 1 83  ? 5.195   17.574  -6.905  1.00 10.76 ? 80  THR B CB  1 
ATOM   1459 O OG1 . THR B 1 83  ? 6.207   18.343  -6.252  1.00 13.98 ? 80  THR B OG1 1 
ATOM   1460 C CG2 . THR B 1 83  ? 4.501   18.464  -7.918  1.00 12.11 ? 80  THR B CG2 1 
ATOM   1461 N N   . GLU B 1 84  ? 5.496   16.537  -3.870  1.00 10.70 ? 81  GLU B N   1 
ATOM   1462 C CA  . GLU B 1 84  ? 6.175   15.687  -2.887  1.00 10.37 ? 81  GLU B CA  1 
ATOM   1463 C C   . GLU B 1 84  ? 5.221   14.723  -2.178  1.00 10.03 ? 81  GLU B C   1 
ATOM   1464 O O   . GLU B 1 84  ? 5.664   13.758  -1.543  1.00 8.74  ? 81  GLU B O   1 
ATOM   1465 C CB  . GLU B 1 84  ? 6.884   16.562  -1.840  1.00 11.23 ? 81  GLU B CB  1 
ATOM   1466 C CG  . GLU B 1 84  ? 5.940   17.360  -0.938  1.00 13.37 ? 81  GLU B CG  1 
ATOM   1467 C CD  . GLU B 1 84  ? 6.631   18.517  -0.222  1.00 14.90 ? 81  GLU B CD  1 
ATOM   1468 O OE1 . GLU B 1 84  ? 7.168   19.395  -0.925  1.00 14.76 ? 81  GLU B OE1 1 
ATOM   1469 O OE2 . GLU B 1 84  ? 6.636   18.555  1.032   1.00 15.88 ? 81  GLU B OE2 1 
ATOM   1470 N N   . ASP B 1 85  ? 3.919   14.992  -2.271  1.00 9.87  ? 82  ASP B N   1 
ATOM   1471 C CA  . ASP B 1 85  ? 2.925   14.134  -1.630  1.00 10.36 ? 82  ASP B CA  1 
ATOM   1472 C C   . ASP B 1 85  ? 2.690   12.844  -2.417  1.00 10.41 ? 82  ASP B C   1 
ATOM   1473 O O   . ASP B 1 85  ? 2.099   11.892  -1.898  1.00 9.84  ? 82  ASP B O   1 
ATOM   1474 C CB  . ASP B 1 85  ? 1.587   14.868  -1.450  1.00 10.13 ? 82  ASP B CB  1 
ATOM   1475 C CG  . ASP B 1 85  ? 1.691   16.063  -0.523  1.00 10.42 ? 82  ASP B CG  1 
ATOM   1476 O OD1 . ASP B 1 85  ? 2.416   15.972  0.489   1.00 9.55  ? 82  ASP B OD1 1 
ATOM   1477 O OD2 . ASP B 1 85  ? 1.022   17.089  -0.786  1.00 11.68 ? 82  ASP B OD2 1 
ATOM   1478 N N   . GLU B 1 86  ? 3.129   12.818  -3.674  1.00 10.13 ? 83  GLU B N   1 
ATOM   1479 C CA  . GLU B 1 86  ? 2.967   11.611  -4.475  1.00 9.80  ? 83  GLU B CA  1 
ATOM   1480 C C   . GLU B 1 86  ? 3.702   10.504  -3.739  1.00 9.03  ? 83  GLU B C   1 
ATOM   1481 O O   . GLU B 1 86  ? 4.875   10.640  -3.401  1.00 9.07  ? 83  GLU B O   1 
ATOM   1482 C CB  . GLU B 1 86  ? 3.550   11.785  -5.880  1.00 11.64 ? 83  GLU B CB  1 
ATOM   1483 C CG  . GLU B 1 86  ? 3.437   10.523  -6.736  1.00 13.94 ? 83  GLU B CG  1 
ATOM   1484 C CD  . GLU B 1 86  ? 3.728   10.786  -8.198  1.00 16.17 ? 83  GLU B CD  1 
ATOM   1485 O OE1 . GLU B 1 86  ? 3.024   11.628  -8.799  1.00 16.08 ? 83  GLU B OE1 1 
ATOM   1486 O OE2 . GLU B 1 86  ? 4.654   10.150  -8.747  1.00 19.21 ? 83  GLU B OE2 1 
ATOM   1487 N N   . ALA B 1 87  ? 2.996   9.412   -3.486  1.00 9.01  ? 84  ALA B N   1 
ATOM   1488 C CA  . ALA B 1 87  ? 3.555   8.285   -2.756  1.00 9.12  ? 84  ALA B CA  1 
ATOM   1489 C C   . ALA B 1 87  ? 2.446   7.259   -2.556  1.00 8.92  ? 84  ALA B C   1 
ATOM   1490 O O   . ALA B 1 87  ? 1.313   7.472   -2.992  1.00 9.16  ? 84  ALA B O   1 
ATOM   1491 C CB  . ALA B 1 87  ? 4.069   8.767   -1.398  1.00 9.70  ? 84  ALA B CB  1 
ATOM   1492 N N   . ASP B 1 88  ? 2.767   6.145   -1.907  1.00 8.23  ? 85  ASP B N   1 
ATOM   1493 C CA  . ASP B 1 88  ? 1.754   5.128   -1.640  1.00 8.47  ? 85  ASP B CA  1 
ATOM   1494 C C   . ASP B 1 88  ? 1.298   5.257   -0.200  1.00 8.62  ? 85  ASP B C   1 
ATOM   1495 O O   . ASP B 1 88  ? 2.117   5.372   0.708   1.00 9.07  ? 85  ASP B O   1 
ATOM   1496 C CB  . ASP B 1 88  ? 2.296   3.717   -1.875  1.00 8.54  ? 85  ASP B CB  1 
ATOM   1497 C CG  . ASP B 1 88  ? 2.789   3.519   -3.283  1.00 7.94  ? 85  ASP B CG  1 
ATOM   1498 O OD1 . ASP B 1 88  ? 2.183   4.113   -4.201  1.00 8.22  ? 85  ASP B OD1 1 
ATOM   1499 O OD2 . ASP B 1 88  ? 3.764   2.761   -3.472  1.00 8.38  ? 85  ASP B OD2 1 
ATOM   1500 N N   . TYR B 1 89  ? -0.012  5.253   0.007   1.00 8.07  ? 86  TYR B N   1 
ATOM   1501 C CA  . TYR B 1 89  ? -0.545  5.377   1.352   1.00 8.27  ? 86  TYR B CA  1 
ATOM   1502 C C   . TYR B 1 89  ? -1.215  4.107   1.835   1.00 8.34  ? 86  TYR B C   1 
ATOM   1503 O O   . TYR B 1 89  ? -2.069  3.542   1.151   1.00 7.84  ? 86  TYR B O   1 
ATOM   1504 C CB  . TYR B 1 89  ? -1.526  6.550   1.431   1.00 8.04  ? 86  TYR B CB  1 
ATOM   1505 C CG  . TYR B 1 89  ? -0.862  7.880   1.172   1.00 7.87  ? 86  TYR B CG  1 
ATOM   1506 C CD1 . TYR B 1 89  ? -0.546  8.293   -0.125  1.00 8.53  ? 86  TYR B CD1 1 
ATOM   1507 C CD2 . TYR B 1 89  ? -0.483  8.699   2.233   1.00 9.17  ? 86  TYR B CD2 1 
ATOM   1508 C CE1 . TYR B 1 89  ? 0.137   9.499   -0.353  1.00 7.87  ? 86  TYR B CE1 1 
ATOM   1509 C CE2 . TYR B 1 89  ? 0.195   9.893   2.018   1.00 9.12  ? 86  TYR B CE2 1 
ATOM   1510 C CZ  . TYR B 1 89  ? 0.504   10.289  0.731   1.00 8.02  ? 86  TYR B CZ  1 
ATOM   1511 O OH  . TYR B 1 89  ? 1.204   11.462  0.549   1.00 8.99  ? 86  TYR B OH  1 
ATOM   1512 N N   . TYR B 1 90  ? -0.815  3.664   3.023   1.00 8.59  ? 87  TYR B N   1 
ATOM   1513 C CA  . TYR B 1 90  ? -1.378  2.462   3.624   1.00 8.11  ? 87  TYR B CA  1 
ATOM   1514 C C   . TYR B 1 90  ? -2.040  2.754   4.966   1.00 8.54  ? 87  TYR B C   1 
ATOM   1515 O O   . TYR B 1 90  ? -1.437  3.386   5.816   1.00 7.60  ? 87  TYR B O   1 
ATOM   1516 C CB  . TYR B 1 90  ? -0.294  1.410   3.880   1.00 8.01  ? 87  TYR B CB  1 
ATOM   1517 C CG  . TYR B 1 90  ? 0.493   0.968   2.674   1.00 8.25  ? 87  TYR B CG  1 
ATOM   1518 C CD1 . TYR B 1 90  ? 1.638   1.653   2.274   1.00 8.30  ? 87  TYR B CD1 1 
ATOM   1519 C CD2 . TYR B 1 90  ? 0.095   -0.146  1.933   1.00 8.29  ? 87  TYR B CD2 1 
ATOM   1520 C CE1 . TYR B 1 90  ? 2.373   1.232   1.169   1.00 9.14  ? 87  TYR B CE1 1 
ATOM   1521 C CE2 . TYR B 1 90  ? 0.822   -0.573  0.824   1.00 9.54  ? 87  TYR B CE2 1 
ATOM   1522 C CZ  . TYR B 1 90  ? 1.960   0.119   0.450   1.00 9.39  ? 87  TYR B CZ  1 
ATOM   1523 O OH  . TYR B 1 90  ? 2.698   -0.311  -0.632  1.00 10.74 ? 87  TYR B OH  1 
ATOM   1524 N N   . CYS B 1 91  ? -3.276  2.297   5.155   1.00 9.45  ? 88  CYS B N   1 
ATOM   1525 C CA  . CYS B 1 91  ? -3.944  2.468   6.442   1.00 10.81 ? 88  CYS B CA  1 
ATOM   1526 C C   . CYS B 1 91  ? -3.584  1.182   7.175   1.00 10.89 ? 88  CYS B C   1 
ATOM   1527 O O   . CYS B 1 91  ? -3.249  0.176   6.540   1.00 10.73 ? 88  CYS B O   1 
ATOM   1528 C CB  . CYS B 1 91  ? -5.463  2.545   6.305   1.00 11.97 ? 88  CYS B CB  1 
ATOM   1529 S SG  . CYS B 1 91  ? -6.173  1.037   5.591   1.00 13.49 ? 88  CYS B SG  1 
ATOM   1530 N N   . GLN B 1 92  ? -3.648  1.216   8.500   1.00 11.07 ? 89  GLN B N   1 
ATOM   1531 C CA  . GLN B 1 92  ? -3.309  0.052   9.317   1.00 11.56 ? 89  GLN B CA  1 
ATOM   1532 C C   . GLN B 1 92  ? -4.012  0.105   10.661  1.00 11.52 ? 89  GLN B C   1 
ATOM   1533 O O   . GLN B 1 92  ? -4.193  1.180   11.237  1.00 11.27 ? 89  GLN B O   1 
ATOM   1534 C CB  . GLN B 1 92  ? -1.786  -0.011  9.518   1.00 10.92 ? 89  GLN B CB  1 
ATOM   1535 C CG  . GLN B 1 92  ? -1.276  -1.056  10.519  1.00 13.04 ? 89  GLN B CG  1 
ATOM   1536 C CD  . GLN B 1 92  ? -1.272  -0.553  11.965  1.00 13.51 ? 89  GLN B CD  1 
ATOM   1537 O OE1 . GLN B 1 92  ? -0.669  0.478   12.271  1.00 14.88 ? 89  GLN B OE1 1 
ATOM   1538 N NE2 . GLN B 1 92  ? -1.932  -1.284  12.855  1.00 13.23 ? 89  GLN B NE2 1 
ATOM   1539 N N   . SER B 1 93  ? -4.431  -1.056  11.148  1.00 12.45 ? 90  SER B N   1 
ATOM   1540 C CA  . SER B 1 93  ? -5.089  -1.129  12.441  1.00 13.51 ? 90  SER B CA  1 
ATOM   1541 C C   . SER B 1 93  ? -4.771  -2.463  13.104  1.00 15.80 ? 90  SER B C   1 
ATOM   1542 O O   . SER B 1 93  ? -4.097  -3.309  12.517  1.00 16.20 ? 90  SER B O   1 
ATOM   1543 C CB  . SER B 1 93  ? -6.599  -0.949  12.297  1.00 12.60 ? 90  SER B CB  1 
ATOM   1544 O OG  . SER B 1 93  ? -7.208  -0.856  13.574  1.00 10.19 ? 90  SER B OG  1 
ATOM   1545 N N   . TYR B 1 94  ? -5.253  -2.647  14.328  1.00 18.57 ? 91  TYR B N   1 
ATOM   1546 C CA  . TYR B 1 94  ? -4.981  -3.871  15.076  1.00 20.66 ? 91  TYR B CA  1 
ATOM   1547 C C   . TYR B 1 94  ? -6.203  -4.769  15.169  1.00 22.32 ? 91  TYR B C   1 
ATOM   1548 O O   . TYR B 1 94  ? -7.332  -4.291  15.290  1.00 21.85 ? 91  TYR B O   1 
ATOM   1549 C CB  . TYR B 1 94  ? -4.493  -3.528  16.482  1.00 20.98 ? 91  TYR B CB  1 
ATOM   1550 C CG  . TYR B 1 94  ? -3.402  -2.485  16.512  1.00 21.96 ? 91  TYR B CG  1 
ATOM   1551 C CD1 . TYR B 1 94  ? -3.699  -1.128  16.348  1.00 22.10 ? 91  TYR B CD1 1 
ATOM   1552 C CD2 . TYR B 1 94  ? -2.063  -2.855  16.665  1.00 21.95 ? 91  TYR B CD2 1 
ATOM   1553 C CE1 . TYR B 1 94  ? -2.687  -0.166  16.335  1.00 22.13 ? 91  TYR B CE1 1 
ATOM   1554 C CE2 . TYR B 1 94  ? -1.044  -1.903  16.652  1.00 22.45 ? 91  TYR B CE2 1 
ATOM   1555 C CZ  . TYR B 1 94  ? -1.361  -0.562  16.488  1.00 22.85 ? 91  TYR B CZ  1 
ATOM   1556 O OH  . TYR B 1 94  ? -0.353  0.380   16.486  1.00 22.03 ? 91  TYR B OH  1 
ATOM   1557 N N   . ASP B 1 95  ? -5.962  -6.076  15.129  1.00 24.34 ? 92  ASP B N   1 
ATOM   1558 C CA  . ASP B 1 95  ? -7.031  -7.060  15.195  1.00 26.73 ? 92  ASP B CA  1 
ATOM   1559 C C   . ASP B 1 95  ? -7.070  -7.787  16.540  1.00 27.74 ? 92  ASP B C   1 
ATOM   1560 O O   . ASP B 1 95  ? -7.762  -7.363  17.468  1.00 29.43 ? 92  ASP B O   1 
ATOM   1561 C CB  . ASP B 1 95  ? -6.849  -8.079  14.076  1.00 27.42 ? 92  ASP B CB  1 
ATOM   1562 C CG  . ASP B 1 95  ? -7.980  -9.072  14.010  1.00 27.87 ? 92  ASP B CG  1 
ATOM   1563 O OD1 . ASP B 1 95  ? -8.978  -8.903  14.742  1.00 28.46 ? 92  ASP B OD1 1 
ATOM   1564 O OD2 . ASP B 1 95  ? -7.871  -10.020 13.212  1.00 29.23 ? 92  ASP B OD2 1 
ATOM   1565 N N   . ALA B 1 96  ? -6.333  -8.891  16.631  1.00 27.87 ? 93  ALA B N   1 
ATOM   1566 C CA  . ALA B 1 96  ? -6.271  -9.695  17.851  1.00 27.16 ? 93  ALA B CA  1 
ATOM   1567 C C   . ALA B 1 96  ? -4.851  -10.234 17.980  1.00 27.32 ? 93  ALA B C   1 
ATOM   1568 O O   . ALA B 1 96  ? -4.160  -9.966  18.967  1.00 27.24 ? 93  ALA B O   1 
ATOM   1569 C CB  . ALA B 1 96  ? -7.266  -10.841 17.773  1.00 28.25 ? 93  ALA B CB  1 
ATOM   1570 N N   . ARG B 1 97  ? -4.429  -11.015 16.991  1.00 26.35 ? 94  ARG B N   1 
ATOM   1571 C CA  . ARG B 1 97  ? -3.070  -11.537 16.974  1.00 25.90 ? 94  ARG B CA  1 
ATOM   1572 C C   . ARG B 1 97  ? -2.418  -11.126 15.665  1.00 25.91 ? 94  ARG B C   1 
ATOM   1573 O O   . ARG B 1 97  ? -1.884  -11.965 14.938  1.00 26.43 ? 94  ARG B O   1 
ATOM   1574 C CB  . ARG B 1 97  ? -3.027  -13.064 17.100  1.00 24.54 ? 94  ARG B CB  1 
ATOM   1575 C CG  . ARG B 1 97  ? -3.575  -13.601 18.396  1.00 23.25 ? 94  ARG B CG  1 
ATOM   1576 C CD  . ARG B 1 97  ? -3.186  -15.057 18.641  1.00 21.63 ? 94  ARG B CD  1 
ATOM   1577 N NE  . ARG B 1 97  ? -1.773  -15.232 18.991  1.00 19.76 ? 94  ARG B NE  1 
ATOM   1578 C CZ  . ARG B 1 97  ? -0.768  -15.334 18.124  1.00 19.38 ? 94  ARG B CZ  1 
ATOM   1579 N NH1 . ARG B 1 97  ? -0.989  -15.284 16.815  1.00 16.87 ? 94  ARG B NH1 1 
ATOM   1580 N NH2 . ARG B 1 97  ? 0.471   -15.488 18.575  1.00 17.21 ? 94  ARG B NH2 1 
ATOM   1581 N N   . ASN B 1 98  ? -2.473  -9.833  15.358  1.00 25.44 ? 95  ASN B N   1 
ATOM   1582 C CA  . ASN B 1 98  ? -1.864  -9.340  14.133  1.00 24.91 ? 95  ASN B CA  1 
ATOM   1583 C C   . ASN B 1 98  ? -2.104  -7.856  13.887  1.00 24.06 ? 95  ASN B C   1 
ATOM   1584 O O   . ASN B 1 98  ? -2.980  -7.234  14.493  1.00 24.58 ? 95  ASN B O   1 
ATOM   1585 C CB  . ASN B 1 98  ? -2.368  -10.155 12.933  1.00 25.90 ? 95  ASN B CB  1 
ATOM   1586 C CG  . ASN B 1 98  ? -1.717  -9.739  11.627  1.00 26.52 ? 95  ASN B CG  1 
ATOM   1587 O OD1 . ASN B 1 98  ? -0.494  -9.622  11.537  1.00 27.89 ? 95  ASN B OD1 1 
ATOM   1588 N ND2 . ASN B 1 98  ? -2.532  -9.532  10.601  1.00 27.54 ? 95  ASN B ND2 1 
ATOM   1589 N N   . VAL B 1 99  ? -1.282  -7.298  13.010  1.00 22.51 ? 96  VAL B N   1 
ATOM   1590 C CA  . VAL B 1 99  ? -1.378  -5.907  12.614  1.00 20.42 ? 96  VAL B CA  1 
ATOM   1591 C C   . VAL B 1 99  ? -1.719  -6.022  11.135  1.00 18.49 ? 96  VAL B C   1 
ATOM   1592 O O   . VAL B 1 99  ? -0.958  -6.602  10.366  1.00 17.59 ? 96  VAL B O   1 
ATOM   1593 C CB  . VAL B 1 99  ? -0.033  -5.187  12.798  1.00 20.61 ? 96  VAL B CB  1 
ATOM   1594 C CG1 . VAL B 1 99  ? -0.135  -3.757  12.321  1.00 21.26 ? 96  VAL B CG1 1 
ATOM   1595 C CG2 . VAL B 1 99  ? 0.369   -5.227  14.265  1.00 21.33 ? 96  VAL B CG2 1 
ATOM   1596 N N   . VAL B 1 100 ? -2.871  -5.492  10.740  1.00 16.84 ? 97  VAL B N   1 
ATOM   1597 C CA  . VAL B 1 100 ? -3.307  -5.586  9.352   1.00 14.82 ? 97  VAL B CA  1 
ATOM   1598 C C   . VAL B 1 100 ? -3.167  -4.279  8.585   1.00 13.78 ? 97  VAL B C   1 
ATOM   1599 O O   . VAL B 1 100 ? -3.522  -3.218  9.094   1.00 13.69 ? 97  VAL B O   1 
ATOM   1600 C CB  . VAL B 1 100 ? -4.774  -6.044  9.285   1.00 15.94 ? 97  VAL B CB  1 
ATOM   1601 C CG1 . VAL B 1 100 ? -5.621  -5.120  10.103  1.00 16.91 ? 97  VAL B CG1 1 
ATOM   1602 C CG2 . VAL B 1 100 ? -5.269  -6.052  7.846   1.00 15.77 ? 97  VAL B CG2 1 
ATOM   1603 N N   . PHE B 1 101 ? -2.644  -4.371  7.362   1.00 12.29 ? 98  PHE B N   1 
ATOM   1604 C CA  . PHE B 1 101 ? -2.468  -3.213  6.491   1.00 11.46 ? 98  PHE B CA  1 
ATOM   1605 C C   . PHE B 1 101 ? -3.463  -3.223  5.337   1.00 11.00 ? 98  PHE B C   1 
ATOM   1606 O O   . PHE B 1 101 ? -3.892  -4.284  4.874   1.00 11.03 ? 98  PHE B O   1 
ATOM   1607 C CB  . PHE B 1 101 ? -1.067  -3.179  5.861   1.00 10.92 ? 98  PHE B CB  1 
ATOM   1608 C CG  . PHE B 1 101 ? 0.055   -3.029  6.843   1.00 10.97 ? 98  PHE B CG  1 
ATOM   1609 C CD1 . PHE B 1 101 ? 0.433   -4.087  7.663   1.00 10.95 ? 98  PHE B CD1 1 
ATOM   1610 C CD2 . PHE B 1 101 ? 0.749   -1.826  6.939   1.00 10.46 ? 98  PHE B CD2 1 
ATOM   1611 C CE1 . PHE B 1 101 ? 1.488   -3.950  8.563   1.00 11.31 ? 98  PHE B CE1 1 
ATOM   1612 C CE2 . PHE B 1 101 ? 1.801   -1.683  7.833   1.00 11.43 ? 98  PHE B CE2 1 
ATOM   1613 C CZ  . PHE B 1 101 ? 2.173   -2.750  8.649   1.00 11.02 ? 98  PHE B CZ  1 
ATOM   1614 N N   . GLY B 1 102 ? -3.811  -2.030  4.864   1.00 11.47 ? 99  GLY B N   1 
ATOM   1615 C CA  . GLY B 1 102 ? -4.691  -1.931  3.719   1.00 10.64 ? 99  GLY B CA  1 
ATOM   1616 C C   . GLY B 1 102 ? -3.812  -2.271  2.526   1.00 10.39 ? 99  GLY B C   1 
ATOM   1617 O O   . GLY B 1 102 ? -2.588  -2.361  2.670   1.00 8.92  ? 99  GLY B O   1 
ATOM   1618 N N   . GLY B 1 103 ? -4.419  -2.465  1.358   1.00 9.61  ? 100 GLY B N   1 
ATOM   1619 C CA  . GLY B 1 103 ? -3.651  -2.803  0.170   1.00 9.46  ? 100 GLY B CA  1 
ATOM   1620 C C   . GLY B 1 103 ? -2.793  -1.650  -0.306  1.00 9.41  ? 100 GLY B C   1 
ATOM   1621 O O   . GLY B 1 103 ? -1.893  -1.825  -1.131  1.00 9.12  ? 100 GLY B O   1 
ATOM   1622 N N   . GLY B 1 104 ? -3.066  -0.465  0.224   1.00 8.81  ? 101 GLY B N   1 
ATOM   1623 C CA  . GLY B 1 104 ? -2.307  0.708   -0.167  1.00 8.54  ? 101 GLY B CA  1 
ATOM   1624 C C   . GLY B 1 104 ? -2.915  1.386   -1.379  1.00 8.02  ? 101 GLY B C   1 
ATOM   1625 O O   . GLY B 1 104 ? -3.428  0.721   -2.279  1.00 7.22  ? 101 GLY B O   1 
ATOM   1626 N N   . THR B 1 105 ? -2.866  2.713   -1.387  1.00 7.50  ? 102 THR B N   1 
ATOM   1627 C CA  . THR B 1 105 ? -3.395  3.512   -2.486  1.00 7.48  ? 102 THR B CA  1 
ATOM   1628 C C   . THR B 1 105 ? -2.256  4.336   -3.079  1.00 8.11  ? 102 THR B C   1 
ATOM   1629 O O   . THR B 1 105 ? -1.620  5.133   -2.373  1.00 7.01  ? 102 THR B O   1 
ATOM   1630 C CB  . THR B 1 105 ? -4.494  4.491   -1.999  1.00 8.09  ? 102 THR B CB  1 
ATOM   1631 O OG1 . THR B 1 105 ? -5.606  3.750   -1.477  1.00 5.99  ? 102 THR B OG1 1 
ATOM   1632 C CG2 . THR B 1 105 ? -4.967  5.387   -3.150  1.00 6.65  ? 102 THR B CG2 1 
ATOM   1633 N N   . ARG B 1 106 ? -1.992  4.140   -4.367  1.00 8.11  ? 103 ARG B N   1 
ATOM   1634 C CA  . ARG B 1 106 ? -0.939  4.894   -5.028  1.00 9.41  ? 103 ARG B CA  1 
ATOM   1635 C C   . ARG B 1 106 ? -1.498  6.268   -5.367  1.00 9.84  ? 103 ARG B C   1 
ATOM   1636 O O   . ARG B 1 106 ? -2.441  6.377   -6.143  1.00 10.27 ? 103 ARG B O   1 
ATOM   1637 C CB  . ARG B 1 106 ? -0.493  4.207   -6.328  1.00 9.66  ? 103 ARG B CB  1 
ATOM   1638 C CG  . ARG B 1 106 ? -0.124  2.736   -6.191  1.00 10.26 ? 103 ARG B CG  1 
ATOM   1639 C CD  . ARG B 1 106 ? 1.042   2.389   -7.107  1.00 11.03 ? 103 ARG B CD  1 
ATOM   1640 N NE  . ARG B 1 106 ? 2.306   2.953   -6.618  1.00 10.75 ? 103 ARG B NE  1 
ATOM   1641 C CZ  . ARG B 1 106 ? 3.463   2.885   -7.275  1.00 12.56 ? 103 ARG B CZ  1 
ATOM   1642 N NH1 . ARG B 1 106 ? 3.521   2.301   -8.469  1.00 12.41 ? 103 ARG B NH1 1 
ATOM   1643 N NH2 . ARG B 1 106 ? 4.565   3.420   -6.754  1.00 11.28 ? 103 ARG B NH2 1 
ATOM   1644 N N   . LEU B 1 107 ? -0.932  7.315   -4.777  1.00 10.29 ? 104 LEU B N   1 
ATOM   1645 C CA  . LEU B 1 107 ? -1.395  8.664   -5.065  1.00 11.26 ? 104 LEU B CA  1 
ATOM   1646 C C   . LEU B 1 107 ? -0.496  9.316   -6.096  1.00 11.67 ? 104 LEU B C   1 
ATOM   1647 O O   . LEU B 1 107 ? 0.698   9.494   -5.865  1.00 11.64 ? 104 LEU B O   1 
ATOM   1648 C CB  . LEU B 1 107 ? -1.411  9.539   -3.805  1.00 11.51 ? 104 LEU B CB  1 
ATOM   1649 C CG  . LEU B 1 107 ? -1.758  11.013  -4.066  1.00 12.55 ? 104 LEU B CG  1 
ATOM   1650 C CD1 . LEU B 1 107 ? -3.155  11.118  -4.703  1.00 12.64 ? 104 LEU B CD1 1 
ATOM   1651 C CD2 . LEU B 1 107 ? -1.700  11.810  -2.753  1.00 13.24 ? 104 LEU B CD2 1 
ATOM   1652 N N   . THR B 1 108 ? -1.082  9.663   -7.236  1.00 12.67 ? 105 THR B N   1 
ATOM   1653 C CA  . THR B 1 108 ? -0.361  10.323  -8.311  1.00 14.16 ? 105 THR B CA  1 
ATOM   1654 C C   . THR B 1 108 ? -0.773  11.792  -8.343  1.00 15.08 ? 105 THR B C   1 
ATOM   1655 O O   . THR B 1 108 ? -1.962  12.107  -8.380  1.00 14.80 ? 105 THR B O   1 
ATOM   1656 C CB  . THR B 1 108 ? -0.690  9.684   -9.681  1.00 14.26 ? 105 THR B CB  1 
ATOM   1657 O OG1 . THR B 1 108 ? -0.075  8.395   -9.765  1.00 14.30 ? 105 THR B OG1 1 
ATOM   1658 C CG2 . THR B 1 108 ? -0.199  10.567  -10.825 1.00 15.10 ? 105 THR B CG2 1 
ATOM   1659 N N   . VAL B 1 109 ? 0.207   12.687  -8.303  1.00 15.74 ? 106 VAL B N   1 
ATOM   1660 C CA  . VAL B 1 109 ? -0.081  14.116  -8.364  1.00 17.22 ? 106 VAL B CA  1 
ATOM   1661 C C   . VAL B 1 109 ? 0.134   14.526  -9.821  1.00 18.27 ? 106 VAL B C   1 
ATOM   1662 O O   . VAL B 1 109 ? 1.268   14.655  -10.279 1.00 18.39 ? 106 VAL B O   1 
ATOM   1663 C CB  . VAL B 1 109 ? 0.861   14.924  -7.431  1.00 16.63 ? 106 VAL B CB  1 
ATOM   1664 C CG1 . VAL B 1 109 ? 0.535   16.409  -7.506  1.00 16.37 ? 106 VAL B CG1 1 
ATOM   1665 C CG2 . VAL B 1 109 ? 0.715   14.429  -5.999  1.00 17.52 ? 106 VAL B CG2 1 
ATOM   1666 N N   . LEU B 1 110 ? -0.969  14.699  -10.545 1.00 20.06 ? 107 LEU B N   1 
ATOM   1667 C CA  . LEU B 1 110 ? -0.938  15.066  -11.958 1.00 21.08 ? 107 LEU B CA  1 
ATOM   1668 C C   . LEU B 1 110 ? 0.006   16.222  -12.252 1.00 21.55 ? 107 LEU B C   1 
ATOM   1669 O O   . LEU B 1 110 ? 0.955   16.016  -13.037 1.00 22.55 ? 107 LEU B O   1 
ATOM   1670 C CB  . LEU B 1 110 ? -2.347  15.411  -12.435 1.00 21.35 ? 107 LEU B CB  1 
HETATM 1671 O O   . HOH C 2 .   ? 18.234  0.840   6.248   1.00 15.55 ? 501 HOH A O   1 
HETATM 1672 O O   . HOH C 2 .   ? 22.324  0.511   9.810   1.00 14.95 ? 502 HOH A O   1 
HETATM 1673 O O   . HOH C 2 .   ? 22.810  -1.311  11.610  1.00 24.66 ? 503 HOH A O   1 
HETATM 1674 O O   . HOH C 2 .   ? 18.336  2.177   8.995   1.00 17.85 ? 504 HOH A O   1 
HETATM 1675 O O   . HOH C 2 .   ? 17.676  4.735   10.293  1.00 15.96 ? 505 HOH A O   1 
HETATM 1676 O O   . HOH C 2 .   ? 13.991  5.487   12.267  1.00 14.39 ? 506 HOH A O   1 
HETATM 1677 O O   . HOH C 2 .   ? 9.807   6.506   11.180  1.00 14.28 ? 507 HOH A O   1 
HETATM 1678 O O   . HOH C 2 .   ? 7.138   7.535   11.283  1.00 13.97 ? 508 HOH A O   1 
HETATM 1679 O O   . HOH C 2 .   ? 21.479  -8.084  10.411  1.00 29.74 ? 509 HOH A O   1 
HETATM 1680 O O   . HOH C 2 .   ? 11.837  -0.196  21.155  1.00 15.52 ? 510 HOH A O   1 
HETATM 1681 O O   . HOH C 2 .   ? 22.147  2.201   20.370  1.00 20.18 ? 511 HOH A O   1 
HETATM 1682 O O   . HOH C 2 .   ? 23.720  -0.052  20.420  1.00 17.04 ? 512 HOH A O   1 
HETATM 1683 O O   . HOH C 2 .   ? 19.878  -2.163  26.116  1.00 16.77 ? 513 HOH A O   1 
HETATM 1684 O O   . HOH C 2 .   ? 11.169  -4.810  22.977  1.00 11.59 ? 514 HOH A O   1 
HETATM 1685 O O   . HOH C 2 .   ? 8.630   -4.874  24.603  1.00 30.32 ? 515 HOH A O   1 
HETATM 1686 O O   . HOH C 2 .   ? 2.465   -3.824  18.973  1.00 23.56 ? 516 HOH A O   1 
HETATM 1687 O O   . HOH C 2 .   ? 12.043  -8.592  17.511  1.00 3.76  ? 517 HOH A O   1 
HETATM 1688 O O   . HOH C 2 .   ? 8.057   -15.114 2.704   1.00 17.33 ? 518 HOH A O   1 
HETATM 1689 O O   . HOH C 2 .   ? 4.408   -7.677  0.734   1.00 21.23 ? 519 HOH A O   1 
HETATM 1690 O O   . HOH C 2 .   ? 9.858   -1.566  0.257   1.00 29.42 ? 520 HOH A O   1 
HETATM 1691 O O   . HOH C 2 .   ? 0.810   -0.961  -5.186  1.00 19.34 ? 524 HOH A O   1 
HETATM 1692 O O   . HOH C 2 .   ? 6.021   -10.734 23.589  1.00 18.98 ? 525 HOH A O   1 
HETATM 1693 O O   . HOH C 2 .   ? 1.094   -17.962 16.362  1.00 23.83 ? 526 HOH A O   1 
HETATM 1694 O O   . HOH C 2 .   ? 14.165  -18.293 12.843  1.00 10.21 ? 527 HOH A O   1 
HETATM 1695 O O   . HOH C 2 .   ? 15.438  -18.493 15.319  1.00 14.93 ? 528 HOH A O   1 
HETATM 1696 O O   . HOH C 2 .   ? 18.500  -8.361  18.387  1.00 26.50 ? 529 HOH A O   1 
HETATM 1697 O O   . HOH C 2 .   ? -0.084  4.887   19.407  1.00 9.85  ? 530 HOH A O   1 
HETATM 1698 O O   . HOH C 2 .   ? 12.369  7.576   12.151  1.00 23.47 ? 572 HOH A O   1 
HETATM 1699 O O   . HOH C 2 .   ? 12.258  8.967   14.769  1.00 17.76 ? 574 HOH A O   1 
HETATM 1700 O O   . HOH C 2 .   ? 12.633  11.526  14.105  1.00 34.37 ? 575 HOH A O   1 
HETATM 1701 O O   . HOH C 2 .   ? 20.809  -2.848  13.295  1.00 13.83 ? 579 HOH A O   1 
HETATM 1702 O O   . HOH C 2 .   ? 24.266  -2.919  3.593   1.00 14.36 ? 580 HOH A O   1 
HETATM 1703 O O   . HOH C 2 .   ? 24.349  -6.162  6.098   1.00 30.75 ? 581 HOH A O   1 
HETATM 1704 O O   . HOH C 2 .   ? 23.708  -7.472  8.579   1.00 30.57 ? 582 HOH A O   1 
HETATM 1705 O O   . HOH C 2 .   ? 22.290  -9.107  12.752  1.00 21.66 ? 583 HOH A O   1 
HETATM 1706 O O   . HOH C 2 .   ? 17.520  -1.551  1.706   1.00 20.88 ? 584 HOH A O   1 
HETATM 1707 O O   . HOH C 2 .   ? 6.581   4.573   25.257  1.00 24.87 ? 585 HOH A O   1 
HETATM 1708 O O   . HOH C 2 .   ? 19.223  9.038   18.860  1.00 30.52 ? 586 HOH A O   1 
HETATM 1709 O O   . HOH C 2 .   ? 21.365  9.352   20.059  1.00 21.34 ? 587 HOH A O   1 
HETATM 1710 O O   . HOH C 2 .   ? 9.912   -3.166  30.025  1.00 28.37 ? 588 HOH A O   1 
HETATM 1711 O O   . HOH C 2 .   ? 15.398  -16.110 16.836  1.00 18.31 ? 591 HOH A O   1 
HETATM 1712 O O   . HOH C 2 .   ? 14.997  -13.341 16.319  1.00 14.61 ? 592 HOH A O   1 
HETATM 1713 O O   . HOH C 2 .   ? 11.789  -15.046 21.605  1.00 46.81 ? 593 HOH A O   1 
HETATM 1714 O O   . HOH C 2 .   ? 14.693  -15.608 21.874  1.00 31.51 ? 595 HOH A O   1 
HETATM 1715 O O   . HOH C 2 .   ? 13.304  0.431   1.811   1.00 23.45 ? 596 HOH A O   1 
HETATM 1716 O O   . HOH C 2 .   ? 10.398  7.846   23.280  1.00 26.98 ? 597 HOH A O   1 
HETATM 1717 O O   . HOH C 2 .   ? 13.676  6.982   23.882  1.00 13.75 ? 598 HOH A O   1 
HETATM 1718 O O   . HOH C 2 .   ? 0.193   -10.762 8.981   1.00 15.90 ? 634 HOH A O   1 
HETATM 1719 O O   . HOH C 2 .   ? 8.128   -9.157  24.730  1.00 35.80 ? 635 HOH A O   1 
HETATM 1720 O O   . HOH C 2 .   ? 13.692  -0.521  -0.683  1.00 39.94 ? 637 HOH A O   1 
HETATM 1721 O O   . HOH C 2 .   ? 24.772  -0.950  1.668   1.00 18.57 ? 644 HOH A O   1 
HETATM 1722 O O   . HOH C 2 .   ? -0.131  -12.378 21.028  1.00 11.60 ? 646 HOH A O   1 
HETATM 1723 O O   . HOH C 2 .   ? 0.285   -5.301  18.924  1.00 23.56 ? 648 HOH A O   1 
HETATM 1724 O O   . HOH C 2 .   ? -1.088  -13.434 8.509   1.00 25.80 ? 649 HOH A O   1 
HETATM 1725 O O   . HOH C 2 .   ? -0.934  -6.690  3.553   1.00 16.59 ? 650 HOH A O   1 
HETATM 1726 O O   . HOH C 2 .   ? 0.574   -7.676  1.007   1.00 16.63 ? 651 HOH A O   1 
HETATM 1727 O O   . HOH C 2 .   ? 12.872  5.068   8.606   1.00 18.17 ? 653 HOH A O   1 
HETATM 1728 O O   . HOH C 2 .   ? 19.128  7.619   12.378  1.00 31.47 ? 654 HOH A O   1 
HETATM 1729 O O   . HOH C 2 .   ? 20.724  7.013   14.446  1.00 16.90 ? 655 HOH A O   1 
HETATM 1730 O O   . HOH C 2 .   ? 24.194  -14.222 6.507   1.00 33.13 ? 656 HOH A O   1 
HETATM 1731 O O   . HOH C 2 .   ? 22.282  -12.936 8.182   1.00 45.50 ? 657 HOH A O   1 
HETATM 1732 O O   . HOH C 2 .   ? 12.919  7.313   27.142  1.00 44.15 ? 658 HOH A O   1 
HETATM 1733 O O   . HOH C 2 .   ? 11.075  4.754   26.548  1.00 34.46 ? 659 HOH A O   1 
HETATM 1734 O O   . HOH C 2 .   ? 19.421  3.464   26.085  1.00 35.88 ? 660 HOH A O   1 
HETATM 1735 O O   . HOH C 2 .   ? 11.946  -5.024  29.215  1.00 18.70 ? 661 HOH A O   1 
HETATM 1736 O O   . HOH C 2 .   ? 13.988  -7.903  26.123  1.00 15.34 ? 662 HOH A O   1 
HETATM 1737 O O   . HOH C 2 .   ? 11.682  -6.745  25.001  1.00 20.36 ? 663 HOH A O   1 
HETATM 1738 O O   . HOH C 2 .   ? 10.821  -9.542  24.919  1.00 30.01 ? 664 HOH A O   1 
HETATM 1739 O O   . HOH C 2 .   ? 9.989   -6.106  27.106  1.00 31.68 ? 665 HOH A O   1 
HETATM 1740 O O   . HOH C 2 .   ? 8.278   -2.795  27.811  1.00 19.43 ? 666 HOH A O   1 
HETATM 1741 O O   . HOH C 2 .   ? 9.218   -15.326 17.324  1.00 9.11  ? 667 HOH A O   1 
HETATM 1742 O O   . HOH C 2 .   ? 10.179  -18.286 18.154  1.00 29.09 ? 668 HOH A O   1 
HETATM 1743 O O   . HOH C 2 .   ? 1.634   -19.739 12.245  1.00 47.45 ? 669 HOH A O   1 
HETATM 1744 O O   . HOH C 2 .   ? 3.133   -22.376 13.335  1.00 42.12 ? 670 HOH A O   1 
HETATM 1745 O O   . HOH C 2 .   ? 18.223  -10.916 19.344  1.00 18.16 ? 671 HOH A O   1 
HETATM 1746 O O   . HOH C 2 .   ? 14.497  -12.304 22.454  1.00 22.72 ? 672 HOH A O   1 
HETATM 1747 O O   . HOH C 2 .   ? 18.554  -12.552 24.996  1.00 34.61 ? 673 HOH A O   1 
HETATM 1748 O O   . HOH C 2 .   ? 14.945  -1.856  2.364   1.00 23.77 ? 674 HOH A O   1 
HETATM 1749 O O   . HOH C 2 .   ? 22.025  2.692   15.890  1.00 28.88 ? 690 HOH A O   1 
HETATM 1750 O O   . HOH C 2 .   ? 14.694  2.942   28.668  1.00 27.43 ? 693 HOH A O   1 
HETATM 1751 O O   . HOH C 2 .   ? 11.988  -23.617 4.475   1.00 42.97 ? 701 HOH A O   1 
HETATM 1752 O O   . HOH C 2 .   ? 5.409   -0.310  23.282  1.00 19.07 ? 708 HOH A O   1 
HETATM 1753 O O   . HOH C 2 .   ? 3.788   -10.672 1.911   1.00 24.97 ? 710 HOH A O   1 
HETATM 1754 O O   . HOH C 2 .   ? 24.604  -0.617  23.246  1.00 32.62 ? 713 HOH A O   1 
HETATM 1755 O O   . HOH C 2 .   ? 12.982  -23.739 9.874   1.00 37.16 ? 715 HOH A O   1 
HETATM 1756 O O   . HOH C 2 .   ? 15.630  -11.140 25.008  1.00 39.06 ? 718 HOH A O   1 
HETATM 1757 O O   . HOH C 2 .   ? 20.162  5.826   25.495  1.00 33.11 ? 719 HOH A O   1 
HETATM 1758 O O   . HOH C 2 .   ? 1.100   -1.942  -7.599  1.00 34.60 ? 721 HOH A O   1 
HETATM 1759 O O   . HOH C 2 .   ? 12.474  -20.546 12.750  1.00 37.39 ? 722 HOH A O   1 
HETATM 1760 O O   . HOH C 2 .   ? 16.877  14.009  16.477  1.00 31.01 ? 723 HOH A O   1 
HETATM 1761 O O   . HOH C 2 .   ? 23.716  -2.810  -0.887  1.00 44.76 ? 724 HOH A O   1 
HETATM 1762 O O   . HOH C 2 .   ? 16.416  10.779  22.607  1.00 47.77 ? 725 HOH A O   1 
HETATM 1763 O O   . HOH C 2 .   ? 4.824   -23.004 10.963  1.00 38.28 ? 726 HOH A O   1 
HETATM 1764 O O   . HOH C 2 .   ? 16.907  0.839   3.494   1.00 31.12 ? 727 HOH A O   1 
HETATM 1765 O O   . HOH C 2 .   ? 20.047  -7.429  -0.405  1.00 30.88 ? 728 HOH A O   1 
HETATM 1766 O O   . HOH C 2 .   ? 12.822  -6.535  -6.289  1.00 40.17 ? 731 HOH A O   1 
HETATM 1767 O O   . HOH C 2 .   ? 12.558  -17.924 19.193  1.00 28.28 ? 733 HOH A O   1 
HETATM 1768 O O   . HOH C 2 .   ? 8.013   5.740   23.355  1.00 29.38 ? 736 HOH A O   1 
HETATM 1769 O O   . HOH C 2 .   ? 8.454   -17.593 15.897  1.00 28.80 ? 738 HOH A O   1 
HETATM 1770 O O   . HOH C 2 .   ? 22.688  -8.784  18.884  1.00 42.41 ? 740 HOH A O   1 
HETATM 1771 O O   . HOH C 2 .   ? 21.201  -9.208  15.202  1.00 19.96 ? 741 HOH A O   1 
HETATM 1772 O O   . HOH C 2 .   ? 17.012  -20.538 14.315  1.00 43.59 ? 742 HOH A O   1 
HETATM 1773 O O   . HOH D 2 .   ? 0.749   -1.453  -2.313  1.00 25.72 ? 521 HOH B O   1 
HETATM 1774 O O   . HOH D 2 .   ? 3.375   0.102   -4.576  1.00 22.36 ? 522 HOH B O   1 
HETATM 1775 O O   . HOH D 2 .   ? 5.087   1.330   -1.779  1.00 27.61 ? 523 HOH B O   1 
HETATM 1776 O O   . HOH D 2 .   ? -1.162  3.451   17.400  1.00 16.26 ? 531 HOH B O   1 
HETATM 1777 O O   . HOH D 2 .   ? 3.548   12.255  18.877  1.00 23.33 ? 532 HOH B O   1 
HETATM 1778 O O   . HOH D 2 .   ? 5.515   12.904  17.374  1.00 19.14 ? 533 HOH B O   1 
HETATM 1779 O O   . HOH D 2 .   ? -12.762 2.020   1.229   1.00 14.71 ? 534 HOH B O   1 
HETATM 1780 O O   . HOH D 2 .   ? -7.812  2.285   -8.084  1.00 13.13 ? 535 HOH B O   1 
HETATM 1781 O O   . HOH D 2 .   ? 0.990   22.602  -4.894  1.00 9.88  ? 536 HOH B O   1 
HETATM 1782 O O   . HOH D 2 .   ? -1.014  24.877  -5.365  1.00 11.10 ? 537 HOH B O   1 
HETATM 1783 O O   . HOH D 2 .   ? -11.262 21.085  -1.566  1.00 10.04 ? 538 HOH B O   1 
HETATM 1784 O O   . HOH D 2 .   ? 8.863   6.804   2.212   1.00 9.34  ? 539 HOH B O   1 
HETATM 1785 O O   . HOH D 2 .   ? -9.716  20.507  -3.999  1.00 17.14 ? 540 HOH B O   1 
HETATM 1786 O O   . HOH D 2 .   ? 11.684  7.042   4.947   1.00 14.58 ? 541 HOH B O   1 
HETATM 1787 O O   . HOH D 2 .   ? -10.971 12.821  -3.145  1.00 7.90  ? 542 HOH B O   1 
HETATM 1788 O O   . HOH D 2 .   ? -14.828 9.355   3.780   1.00 27.31 ? 543 HOH B O   1 
HETATM 1789 O O   . HOH D 2 .   ? -10.904 6.471   -1.369  1.00 16.48 ? 544 HOH B O   1 
HETATM 1790 O O   . HOH D 2 .   ? -12.735 4.030   -0.460  1.00 37.52 ? 545 HOH B O   1 
HETATM 1791 O O   . HOH D 2 .   ? -10.015 -0.510  13.233  1.00 9.72  ? 546 HOH B O   1 
HETATM 1792 O O   . HOH D 2 .   ? -13.625 -10.073 7.208   1.00 23.87 ? 547 HOH B O   1 
HETATM 1793 O O   . HOH D 2 .   ? -12.358 5.812   16.390  1.00 21.51 ? 548 HOH B O   1 
HETATM 1794 O O   . HOH D 2 .   ? -7.257  10.241  18.707  1.00 12.79 ? 549 HOH B O   1 
HETATM 1795 O O   . HOH D 2 .   ? -8.170  7.997   10.093  1.00 8.35  ? 550 HOH B O   1 
HETATM 1796 O O   . HOH D 2 .   ? -18.587 1.249   12.746  1.00 12.41 ? 551 HOH B O   1 
HETATM 1797 O O   . HOH D 2 .   ? -19.129 0.953   15.261  1.00 43.94 ? 552 HOH B O   1 
HETATM 1798 O O   . HOH D 2 .   ? 4.452   14.882  1.797   1.00 9.26  ? 553 HOH B O   1 
HETATM 1799 O O   . HOH D 2 .   ? 6.731   8.530   -4.160  1.00 11.28 ? 554 HOH B O   1 
HETATM 1800 O O   . HOH D 2 .   ? 8.994   9.248   -5.202  1.00 8.61  ? 555 HOH B O   1 
HETATM 1801 O O   . HOH D 2 .   ? 10.338  6.717   -5.349  1.00 13.62 ? 556 HOH B O   1 
HETATM 1802 O O   . HOH D 2 .   ? 10.680  11.123  -4.068  1.00 24.78 ? 557 HOH B O   1 
HETATM 1803 O O   . HOH D 2 .   ? 12.403  6.602   -2.102  1.00 12.95 ? 558 HOH B O   1 
HETATM 1804 O O   . HOH D 2 .   ? 6.882   12.298  -4.047  1.00 17.36 ? 559 HOH B O   1 
HETATM 1805 O O   . HOH D 2 .   ? 9.240   13.145  -2.972  1.00 13.23 ? 560 HOH B O   1 
HETATM 1806 O O   . HOH D 2 .   ? -6.076  14.874  11.805  1.00 7.29  ? 561 HOH B O   1 
HETATM 1807 O O   . HOH D 2 .   ? -4.413  17.378  10.801  1.00 18.94 ? 562 HOH B O   1 
HETATM 1808 O O   . HOH D 2 .   ? -6.690  17.746  5.113   1.00 12.08 ? 563 HOH B O   1 
HETATM 1809 O O   . HOH D 2 .   ? -9.865  12.734  6.716   1.00 5.78  ? 564 HOH B O   1 
HETATM 1810 O O   . HOH D 2 .   ? -13.958 9.784   8.012   1.00 16.86 ? 565 HOH B O   1 
HETATM 1811 O O   . HOH D 2 .   ? -13.094 12.556  5.533   1.00 16.53 ? 566 HOH B O   1 
HETATM 1812 O O   . HOH D 2 .   ? 4.714   20.334  2.838   1.00 16.79 ? 567 HOH B O   1 
HETATM 1813 O O   . HOH D 2 .   ? -12.716 11.124  13.102  1.00 16.18 ? 568 HOH B O   1 
HETATM 1814 O O   . HOH D 2 .   ? -18.813 -0.981  5.955   1.00 15.21 ? 569 HOH B O   1 
HETATM 1815 O O   . HOH D 2 .   ? 2.694   9.315   -10.969 1.00 26.39 ? 570 HOH B O   1 
HETATM 1816 O O   . HOH D 2 .   ? 2.453   6.687   -5.644  1.00 11.28 ? 571 HOH B O   1 
HETATM 1817 O O   . HOH D 2 .   ? 10.434  6.369   8.545   1.00 15.42 ? 573 HOH B O   1 
HETATM 1818 O O   . HOH D 2 .   ? -4.753  24.209  -7.476  1.00 15.84 ? 576 HOH B O   1 
HETATM 1819 O O   . HOH D 2 .   ? 13.969  5.643   6.291   1.00 11.00 ? 577 HOH B O   1 
HETATM 1820 O O   . HOH D 2 .   ? 14.503  4.145   4.224   1.00 10.45 ? 578 HOH B O   1 
HETATM 1821 O O   . HOH D 2 .   ? -0.280  -8.160  8.212   1.00 8.89  ? 589 HOH B O   1 
HETATM 1822 O O   . HOH D 2 .   ? -2.136  -7.013  6.697   1.00 21.32 ? 590 HOH B O   1 
HETATM 1823 O O   . HOH D 2 .   ? -10.791 13.191  13.006  1.00 27.00 ? 594 HOH B O   1 
HETATM 1824 O O   . HOH D 2 .   ? -6.455  -5.785  4.373   1.00 15.21 ? 599 HOH B O   1 
HETATM 1825 O O   . HOH D 2 .   ? -8.172  -6.663  2.165   1.00 29.93 ? 600 HOH B O   1 
HETATM 1826 O O   . HOH D 2 .   ? -6.355  -4.382  -1.381  1.00 31.78 ? 601 HOH B O   1 
HETATM 1827 O O   . HOH D 2 .   ? -7.029  -2.646  0.368   1.00 20.94 ? 602 HOH B O   1 
HETATM 1828 O O   . HOH D 2 .   ? -5.381  -1.418  -2.597  1.00 10.09 ? 603 HOH B O   1 
HETATM 1829 O O   . HOH D 2 .   ? -4.474  -2.740  -4.604  1.00 37.72 ? 604 HOH B O   1 
HETATM 1830 O O   . HOH D 2 .   ? -2.043  0.306   -4.810  1.00 33.49 ? 605 HOH B O   1 
HETATM 1831 O O   . HOH D 2 .   ? -13.569 0.084   -0.041  1.00 23.24 ? 606 HOH B O   1 
HETATM 1832 O O   . HOH D 2 .   ? -15.298 -2.000  1.028   1.00 29.39 ? 607 HOH B O   1 
HETATM 1833 O O   . HOH D 2 .   ? -12.591 10.742  -3.118  1.00 11.49 ? 608 HOH B O   1 
HETATM 1834 O O   . HOH D 2 .   ? -6.860  21.822  -1.381  1.00 9.06  ? 609 HOH B O   1 
HETATM 1835 O O   . HOH D 2 .   ? -9.548  21.219  1.427   1.00 18.67 ? 610 HOH B O   1 
HETATM 1836 O O   . HOH D 2 .   ? -11.553 15.656  0.517   1.00 21.03 ? 611 HOH B O   1 
HETATM 1837 O O   . HOH D 2 .   ? -9.560  3.958   17.653  1.00 29.45 ? 612 HOH B O   1 
HETATM 1838 O O   . HOH D 2 .   ? -9.139  2.731   20.225  1.00 12.85 ? 613 HOH B O   1 
HETATM 1839 O O   . HOH D 2 .   ? -10.605 4.041   15.169  1.00 9.64  ? 614 HOH B O   1 
HETATM 1840 O O   . HOH D 2 .   ? -12.256 4.874   19.096  1.00 32.23 ? 615 HOH B O   1 
HETATM 1841 O O   . HOH D 2 .   ? 6.374   13.080  5.093   1.00 29.17 ? 616 HOH B O   1 
HETATM 1842 O O   . HOH D 2 .   ? 8.675   12.884  3.599   1.00 20.83 ? 617 HOH B O   1 
HETATM 1843 O O   . HOH D 2 .   ? 10.922  12.164  4.799   1.00 18.84 ? 618 HOH B O   1 
HETATM 1844 O O   . HOH D 2 .   ? 14.975  6.307   -3.832  1.00 20.44 ? 619 HOH B O   1 
HETATM 1845 O O   . HOH D 2 .   ? -9.264  17.809  6.152   1.00 22.45 ? 620 HOH B O   1 
HETATM 1846 O O   . HOH D 2 .   ? -9.374  15.366  10.982  1.00 44.85 ? 621 HOH B O   1 
HETATM 1847 O O   . HOH D 2 .   ? -12.321 15.162  5.047   1.00 26.55 ? 622 HOH B O   1 
HETATM 1848 O O   . HOH D 2 .   ? -10.703 15.254  7.062   1.00 30.43 ? 623 HOH B O   1 
HETATM 1849 O O   . HOH D 2 .   ? -13.742 7.598   6.710   1.00 17.93 ? 624 HOH B O   1 
HETATM 1850 O O   . HOH D 2 .   ? -17.140 9.391   5.266   1.00 23.22 ? 625 HOH B O   1 
HETATM 1851 O O   . HOH D 2 .   ? 1.595   24.269  -2.628  1.00 15.60 ? 626 HOH B O   1 
HETATM 1852 O O   . HOH D 2 .   ? 0.041   23.553  -0.767  1.00 13.48 ? 627 HOH B O   1 
HETATM 1853 O O   . HOH D 2 .   ? 6.719   16.257  2.278   1.00 13.73 ? 628 HOH B O   1 
HETATM 1854 O O   . HOH D 2 .   ? 6.433   16.744  4.775   1.00 26.98 ? 629 HOH B O   1 
HETATM 1855 O O   . HOH D 2 .   ? 6.892   19.437  5.625   1.00 47.16 ? 630 HOH B O   1 
HETATM 1856 O O   . HOH D 2 .   ? 5.299   20.417  8.631   1.00 33.81 ? 631 HOH B O   1 
HETATM 1857 O O   . HOH D 2 .   ? -1.818  6.634   -8.804  1.00 21.37 ? 632 HOH B O   1 
HETATM 1858 O O   . HOH D 2 .   ? -15.541 12.046  11.696  1.00 26.76 ? 633 HOH B O   1 
HETATM 1859 O O   . HOH D 2 .   ? 9.568   0.169   -1.769  1.00 25.98 ? 636 HOH B O   1 
HETATM 1860 O O   . HOH D 2 .   ? -2.066  24.849  -2.202  1.00 28.04 ? 638 HOH B O   1 
HETATM 1861 O O   . HOH D 2 .   ? -4.974  25.085  -2.758  1.00 24.25 ? 639 HOH B O   1 
HETATM 1862 O O   . HOH D 2 .   ? -13.379 8.421   0.271   1.00 28.56 ? 640 HOH B O   1 
HETATM 1863 O O   . HOH D 2 .   ? -11.719 -8.459  13.812  1.00 40.38 ? 641 HOH B O   1 
HETATM 1864 O O   . HOH D 2 .   ? -8.632  19.178  8.263   1.00 34.57 ? 642 HOH B O   1 
HETATM 1865 O O   . HOH D 2 .   ? 5.089   21.306  5.110   1.00 23.93 ? 643 HOH B O   1 
HETATM 1866 O O   . HOH D 2 .   ? -8.398  18.044  -11.568 1.00 31.93 ? 645 HOH B O   1 
HETATM 1867 O O   . HOH D 2 .   ? 2.345   17.529  14.812  1.00 19.12 ? 647 HOH B O   1 
HETATM 1868 O O   . HOH D 2 .   ? -3.057  -5.571  2.482   1.00 17.34 ? 652 HOH B O   1 
HETATM 1869 O O   . HOH D 2 .   ? 6.271   10.238  11.395  1.00 26.72 ? 675 HOH B O   1 
HETATM 1870 O O   . HOH D 2 .   ? 7.817   13.700  10.566  1.00 25.07 ? 676 HOH B O   1 
HETATM 1871 O O   . HOH D 2 .   ? 7.499   13.383  7.942   1.00 30.85 ? 677 HOH B O   1 
HETATM 1872 O O   . HOH D 2 .   ? 9.288   17.933  8.773   1.00 37.33 ? 678 HOH B O   1 
HETATM 1873 O O   . HOH D 2 .   ? -10.897 14.577  -8.525  1.00 34.76 ? 679 HOH B O   1 
HETATM 1874 O O   . HOH D 2 .   ? -8.968  7.276   -3.042  1.00 21.96 ? 680 HOH B O   1 
HETATM 1875 O O   . HOH D 2 .   ? -9.170  12.205  -7.941  1.00 37.44 ? 681 HOH B O   1 
HETATM 1876 O O   . HOH D 2 .   ? -12.422 13.948  -5.498  1.00 30.54 ? 682 HOH B O   1 
HETATM 1877 O O   . HOH D 2 .   ? -3.832  22.222  -10.182 1.00 27.06 ? 683 HOH B O   1 
HETATM 1878 O O   . HOH D 2 .   ? -5.991  24.589  -9.852  1.00 23.66 ? 684 HOH B O   1 
HETATM 1879 O O   . HOH D 2 .   ? -3.580  26.593  -5.799  1.00 39.68 ? 685 HOH B O   1 
HETATM 1880 O O   . HOH D 2 .   ? -5.149  24.454  0.011   1.00 30.09 ? 686 HOH B O   1 
HETATM 1881 O O   . HOH D 2 .   ? -3.801  23.297  2.498   1.00 24.53 ? 687 HOH B O   1 
HETATM 1882 O O   . HOH D 2 .   ? 0.796   25.190  1.527   1.00 37.52 ? 688 HOH B O   1 
HETATM 1883 O O   . HOH D 2 .   ? -17.875 -3.114  7.029   1.00 30.85 ? 689 HOH B O   1 
HETATM 1884 O O   . HOH D 2 .   ? -15.251 -4.693  16.759  1.00 35.75 ? 691 HOH B O   1 
HETATM 1885 O O   . HOH D 2 .   ? 0.326   2.429   20.798  1.00 39.44 ? 692 HOH B O   1 
HETATM 1886 O O   . HOH D 2 .   ? -13.117 7.642   19.551  1.00 40.72 ? 694 HOH B O   1 
HETATM 1887 O O   . HOH D 2 .   ? -13.088 3.026   -3.536  1.00 33.20 ? 695 HOH B O   1 
HETATM 1888 O O   . HOH D 2 .   ? -1.618  19.321  -13.507 1.00 38.87 ? 696 HOH B O   1 
HETATM 1889 O O   . HOH D 2 .   ? 10.263  12.399  7.476   1.00 30.30 ? 697 HOH B O   1 
HETATM 1890 O O   . HOH D 2 .   ? 2.378   22.334  4.037   1.00 35.65 ? 698 HOH B O   1 
HETATM 1891 O O   . HOH D 2 .   ? 2.120   18.052  -15.649 1.00 33.91 ? 699 HOH B O   1 
HETATM 1892 O O   . HOH D 2 .   ? -1.967  -6.084  17.604  1.00 36.60 ? 700 HOH B O   1 
HETATM 1893 O O   . HOH D 2 .   ? -16.382 -8.680  13.857  1.00 48.28 ? 702 HOH B O   1 
HETATM 1894 O O   . HOH D 2 .   ? 7.670   12.271  -6.618  1.00 45.46 ? 703 HOH B O   1 
HETATM 1895 O O   . HOH D 2 .   ? -0.381  0.158   19.251  1.00 31.06 ? 704 HOH B O   1 
HETATM 1896 O O   . HOH D 2 .   ? -1.743  -4.030  -2.722  1.00 22.08 ? 705 HOH B O   1 
HETATM 1897 O O   . HOH D 2 .   ? -19.844 7.947   11.850  1.00 38.54 ? 706 HOH B O   1 
HETATM 1898 O O   . HOH D 2 .   ? -8.935  -0.693  -6.622  1.00 25.16 ? 707 HOH B O   1 
HETATM 1899 O O   . HOH D 2 .   ? 0.265   23.376  12.178  1.00 24.73 ? 709 HOH B O   1 
HETATM 1900 O O   . HOH D 2 .   ? -1.617  4.643   23.468  1.00 31.37 ? 711 HOH B O   1 
HETATM 1901 O O   . HOH D 2 .   ? -0.926  24.366  5.545   1.00 32.39 ? 712 HOH B O   1 
HETATM 1902 O O   . HOH D 2 .   ? 9.583   17.236  13.950  1.00 38.14 ? 714 HOH B O   1 
HETATM 1903 O O   . HOH D 2 .   ? -16.996 2.656   3.094   1.00 33.54 ? 716 HOH B O   1 
HETATM 1904 O O   . HOH D 2 .   ? -16.905 -2.922  19.391  1.00 34.83 ? 720 HOH B O   1 
HETATM 1905 O O   . HOH D 2 .   ? -11.500 18.925  -11.870 1.00 30.45 ? 729 HOH B O   1 
HETATM 1906 O O   . HOH D 2 .   ? 10.120  19.097  11.932  1.00 35.18 ? 730 HOH B O   1 
HETATM 1907 O O   . HOH D 2 .   ? -2.480  26.457  0.250   1.00 27.81 ? 732 HOH B O   1 
HETATM 1908 O O   . HOH D 2 .   ? 6.015   24.111  -0.971  1.00 34.74 ? 734 HOH B O   1 
HETATM 1909 O O   . HOH D 2 .   ? -1.022  -3.555  -5.831  1.00 36.35 ? 735 HOH B O   1 
HETATM 1910 O O   . HOH D 2 .   ? 7.384   0.189   -3.043  1.00 42.67 ? 737 HOH B O   1 
HETATM 1911 O O   . HOH D 2 .   ? -3.090  -14.285 14.194  1.00 38.98 ? 739 HOH B O   1 
HETATM 1912 O O   . HOH D 2 .   ? -14.169 -4.124  2.996   1.00 38.54 ? 743 HOH B O   1 
HETATM 1913 O O   . HOH D 2 .   ? -19.337 3.244   18.235  1.00 19.26 ? 744 HOH B O   1 
HETATM 1914 O O   . HOH D 2 .   ? -7.170  1.218   21.097  1.00 38.27 ? 745 HOH B O   1 
HETATM 1915 O O   . HOH D 2 .   ? -5.686  1.353   23.312  1.00 25.06 ? 746 HOH B O   1 
HETATM 1916 O O   . HOH D 2 .   ? -5.744  0.356   19.112  1.00 25.31 ? 747 HOH B O   1 
HETATM 1917 O O   . HOH D 2 .   ? 3.858   25.080  2.592   1.00 38.43 ? 748 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASN 1   1   1   ASN ASN A . n 
A 1 2   PHE 2   2   2   PHE PHE A . n 
A 1 3   MET 3   3   3   MET MET A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   ASN 5   5   5   ASN ASN A . n 
A 1 6   GLN 6   6   6   GLN GLN A . n 
A 1 7   PRO 7   7   7   PRO PRO A . n 
A 1 8   HIS 8   8   8   HIS HIS A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  VAL 10  11  11  VAL VAL A . n 
A 1 11  SER 11  12  12  SER SER A . n 
A 1 12  GLU 12  13  13  GLU GLU A . n 
A 1 13  SER 13  14  14  SER SER A . n 
A 1 14  PRO 14  15  15  PRO PRO A . n 
A 1 15  GLY 15  16  16  GLY GLY A . n 
A 1 16  LYS 16  17  17  LYS LYS A . n 
A 1 17  THR 17  18  18  THR THR A . n 
A 1 18  VAL 18  19  19  VAL VAL A . n 
A 1 19  THR 19  20  20  THR THR A . n 
A 1 20  ILE 20  21  21  ILE ILE A . n 
A 1 21  SER 21  22  22  SER SER A . n 
A 1 22  CYS 22  23  23  CYS CYS A . n 
A 1 23  THR 23  24  24  THR THR A . n 
A 1 24  ARG 24  25  25  ARG ARG A . n 
A 1 25  SER 25  26  26  SER SER A . n 
A 1 26  SER 26  27  27  SER SER A . n 
A 1 27  GLY 27  27  27  GLY GLY A A n 
A 1 28  ASN 28  27  27  ASN ASN A B n 
A 1 29  ILE 29  28  28  ILE ILE A . n 
A 1 30  ASP 30  29  29  ASP ASP A . n 
A 1 31  SER 31  30  30  SER SER A . n 
A 1 32  ASN 32  31  31  ASN ASN A . n 
A 1 33  TYR 33  32  32  TYR TYR A . n 
A 1 34  VAL 34  33  33  VAL VAL A . n 
A 1 35  GLN 35  34  34  GLN GLN A . n 
A 1 36  TRP 36  35  35  TRP TRP A . n 
A 1 37  TYR 37  36  36  TYR TYR A . n 
A 1 38  GLN 38  37  37  GLN GLN A . n 
A 1 39  GLN 39  38  38  GLN GLN A . n 
A 1 40  ARG 40  39  39  ARG ARG A . n 
A 1 41  PRO 41  40  40  PRO PRO A . n 
A 1 42  GLY 42  41  41  GLY GLY A . n 
A 1 43  SER 43  42  42  SER SER A . n 
A 1 44  ALA 44  43  43  ALA ALA A . n 
A 1 45  PRO 45  44  44  PRO PRO A . n 
A 1 46  ILE 46  45  45  ILE ILE A . n 
A 1 47  THR 47  46  46  THR THR A . n 
A 1 48  VAL 48  47  47  VAL VAL A . n 
A 1 49  ILE 49  48  48  ILE ILE A . n 
A 1 50  TYR 50  49  49  TYR TYR A . n 
A 1 51  GLU 51  50  50  GLU GLU A . n 
A 1 52  ASP 52  51  51  ASP ASP A . n 
A 1 53  ASN 53  52  52  ASN ASN A . n 
A 1 54  GLN 54  53  53  GLN GLN A . n 
A 1 55  ARG 55  54  54  ARG ARG A . n 
A 1 56  PRO 56  55  55  PRO PRO A . n 
A 1 57  SER 57  56  56  SER SER A . n 
A 1 58  GLY 58  57  57  GLY GLY A . n 
A 1 59  VAL 59  58  58  VAL VAL A . n 
A 1 60  PRO 60  59  59  PRO PRO A . n 
A 1 61  ASP 61  60  60  ASP ASP A . n 
A 1 62  ARG 62  61  61  ARG ARG A . n 
A 1 63  PHE 63  62  62  PHE PHE A . n 
A 1 64  ALA 64  63  63  ALA ALA A . n 
A 1 65  GLY 65  64  64  GLY GLY A . n 
A 1 66  SER 66  65  65  SER SER A . n 
A 1 67  ILE 67  66  66  ILE ILE A . n 
A 1 68  ASP 68  66  66  ASP ASP A A n 
A 1 69  ARG 69  66  66  ARG ARG A B n 
A 1 70  SER 70  67  67  SER SER A . n 
A 1 71  SER 71  68  68  SER SER A . n 
A 1 72  ASN 72  69  69  ASN ASN A . n 
A 1 73  SER 73  70  70  SER SER A . n 
A 1 74  ALA 74  71  71  ALA ALA A . n 
A 1 75  SER 75  72  72  SER SER A . n 
A 1 76  LEU 76  73  73  LEU LEU A . n 
A 1 77  THR 77  74  74  THR THR A . n 
A 1 78  ILE 78  75  75  ILE ILE A . n 
A 1 79  SER 79  76  76  SER SER A . n 
A 1 80  GLY 80  77  77  GLY GLY A . n 
A 1 81  LEU 81  78  78  LEU LEU A . n 
A 1 82  LYS 82  79  79  LYS LYS A . n 
A 1 83  THR 83  80  80  THR THR A . n 
A 1 84  GLU 84  81  81  GLU GLU A . n 
A 1 85  ASP 85  82  82  ASP ASP A . n 
A 1 86  GLU 86  83  83  GLU GLU A . n 
A 1 87  ALA 87  84  84  ALA ALA A . n 
A 1 88  ASP 88  85  85  ASP ASP A . n 
A 1 89  TYR 89  86  86  TYR TYR A . n 
A 1 90  TYR 90  87  87  TYR TYR A . n 
A 1 91  CYS 91  88  88  CYS CYS A . n 
A 1 92  GLN 92  89  89  GLN GLN A . n 
A 1 93  SER 93  90  90  SER SER A . n 
A 1 94  TYR 94  91  91  TYR TYR A . n 
A 1 95  ASP 95  92  92  ASP ASP A . n 
A 1 96  ALA 96  93  93  ALA ALA A . n 
A 1 97  ARG 97  94  94  ARG ARG A . n 
A 1 98  ASN 98  95  95  ASN ASN A . n 
A 1 99  VAL 99  96  96  VAL VAL A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 PHE 101 98  98  PHE PHE A . n 
A 1 102 GLY 102 99  99  GLY GLY A . n 
A 1 103 GLY 103 100 100 GLY GLY A . n 
A 1 104 GLY 104 101 101 GLY GLY A . n 
A 1 105 THR 105 102 102 THR THR A . n 
A 1 106 ARG 106 103 103 ARG ARG A . n 
A 1 107 LEU 107 104 104 LEU LEU A . n 
A 1 108 THR 108 105 105 THR THR A . n 
A 1 109 VAL 109 106 106 VAL VAL A . n 
A 1 110 LEU 110 107 107 LEU LEU A . n 
A 1 111 GLY 111 108 108 GLY GLY A . n 
B 1 1   ASN 1   1   1   ASN ASN B . n 
B 1 2   PHE 2   2   2   PHE PHE B . n 
B 1 3   MET 3   3   3   MET MET B . n 
B 1 4   LEU 4   4   4   LEU LEU B . n 
B 1 5   ASN 5   5   5   ASN ASN B . n 
B 1 6   GLN 6   6   6   GLN GLN B . n 
B 1 7   PRO 7   7   7   PRO PRO B . n 
B 1 8   HIS 8   8   8   HIS HIS B . n 
B 1 9   SER 9   9   9   SER SER B . n 
B 1 10  VAL 10  11  11  VAL VAL B . n 
B 1 11  SER 11  12  12  SER SER B . n 
B 1 12  GLU 12  13  13  GLU GLU B . n 
B 1 13  SER 13  14  14  SER SER B . n 
B 1 14  PRO 14  15  15  PRO PRO B . n 
B 1 15  GLY 15  16  16  GLY GLY B . n 
B 1 16  LYS 16  17  17  LYS LYS B . n 
B 1 17  THR 17  18  18  THR THR B . n 
B 1 18  VAL 18  19  19  VAL VAL B . n 
B 1 19  THR 19  20  20  THR THR B . n 
B 1 20  ILE 20  21  21  ILE ILE B . n 
B 1 21  SER 21  22  22  SER SER B . n 
B 1 22  CYS 22  23  23  CYS CYS B . n 
B 1 23  THR 23  24  24  THR THR B . n 
B 1 24  ARG 24  25  25  ARG ARG B . n 
B 1 25  SER 25  26  26  SER SER B . n 
B 1 26  SER 26  27  27  SER SER B . n 
B 1 27  GLY 27  27  27  GLY GLY B A n 
B 1 28  ASN 28  27  27  ASN ASN B B n 
B 1 29  ILE 29  28  28  ILE ILE B . n 
B 1 30  ASP 30  29  29  ASP ASP B . n 
B 1 31  SER 31  30  30  SER SER B . n 
B 1 32  ASN 32  31  31  ASN ASN B . n 
B 1 33  TYR 33  32  32  TYR TYR B . n 
B 1 34  VAL 34  33  33  VAL VAL B . n 
B 1 35  GLN 35  34  34  GLN GLN B . n 
B 1 36  TRP 36  35  35  TRP TRP B . n 
B 1 37  TYR 37  36  36  TYR TYR B . n 
B 1 38  GLN 38  37  37  GLN GLN B . n 
B 1 39  GLN 39  38  38  GLN GLN B . n 
B 1 40  ARG 40  39  39  ARG ARG B . n 
B 1 41  PRO 41  40  40  PRO PRO B . n 
B 1 42  GLY 42  41  41  GLY GLY B . n 
B 1 43  SER 43  42  42  SER SER B . n 
B 1 44  ALA 44  43  43  ALA ALA B . n 
B 1 45  PRO 45  44  44  PRO PRO B . n 
B 1 46  ILE 46  45  45  ILE ILE B . n 
B 1 47  THR 47  46  46  THR THR B . n 
B 1 48  VAL 48  47  47  VAL VAL B . n 
B 1 49  ILE 49  48  48  ILE ILE B . n 
B 1 50  TYR 50  49  49  TYR TYR B . n 
B 1 51  GLU 51  50  50  GLU GLU B . n 
B 1 52  ASP 52  51  51  ASP ASP B . n 
B 1 53  ASN 53  52  52  ASN ASN B . n 
B 1 54  GLN 54  53  53  GLN GLN B . n 
B 1 55  ARG 55  54  54  ARG ARG B . n 
B 1 56  PRO 56  55  55  PRO PRO B . n 
B 1 57  SER 57  56  56  SER SER B . n 
B 1 58  GLY 58  57  57  GLY GLY B . n 
B 1 59  VAL 59  58  58  VAL VAL B . n 
B 1 60  PRO 60  59  59  PRO PRO B . n 
B 1 61  ASP 61  60  60  ASP ASP B . n 
B 1 62  ARG 62  61  61  ARG ARG B . n 
B 1 63  PHE 63  62  62  PHE PHE B . n 
B 1 64  ALA 64  63  63  ALA ALA B . n 
B 1 65  GLY 65  64  64  GLY GLY B . n 
B 1 66  SER 66  65  65  SER SER B . n 
B 1 67  ILE 67  66  66  ILE ILE B . n 
B 1 68  ASP 68  66  66  ASP ASP B A n 
B 1 69  ARG 69  66  66  ARG ARG B B n 
B 1 70  SER 70  67  67  SER SER B . n 
B 1 71  SER 71  68  68  SER SER B . n 
B 1 72  ASN 72  69  69  ASN ASN B . n 
B 1 73  SER 73  70  70  SER SER B . n 
B 1 74  ALA 74  71  71  ALA ALA B . n 
B 1 75  SER 75  72  72  SER SER B . n 
B 1 76  LEU 76  73  73  LEU LEU B . n 
B 1 77  THR 77  74  74  THR THR B . n 
B 1 78  ILE 78  75  75  ILE ILE B . n 
B 1 79  SER 79  76  76  SER SER B . n 
B 1 80  GLY 80  77  77  GLY GLY B . n 
B 1 81  LEU 81  78  78  LEU LEU B . n 
B 1 82  LYS 82  79  79  LYS LYS B . n 
B 1 83  THR 83  80  80  THR THR B . n 
B 1 84  GLU 84  81  81  GLU GLU B . n 
B 1 85  ASP 85  82  82  ASP ASP B . n 
B 1 86  GLU 86  83  83  GLU GLU B . n 
B 1 87  ALA 87  84  84  ALA ALA B . n 
B 1 88  ASP 88  85  85  ASP ASP B . n 
B 1 89  TYR 89  86  86  TYR TYR B . n 
B 1 90  TYR 90  87  87  TYR TYR B . n 
B 1 91  CYS 91  88  88  CYS CYS B . n 
B 1 92  GLN 92  89  89  GLN GLN B . n 
B 1 93  SER 93  90  90  SER SER B . n 
B 1 94  TYR 94  91  91  TYR TYR B . n 
B 1 95  ASP 95  92  92  ASP ASP B . n 
B 1 96  ALA 96  93  93  ALA ALA B . n 
B 1 97  ARG 97  94  94  ARG ARG B . n 
B 1 98  ASN 98  95  95  ASN ASN B . n 
B 1 99  VAL 99  96  96  VAL VAL B . n 
B 1 100 VAL 100 97  97  VAL VAL B . n 
B 1 101 PHE 101 98  98  PHE PHE B . n 
B 1 102 GLY 102 99  99  GLY GLY B . n 
B 1 103 GLY 103 100 100 GLY GLY B . n 
B 1 104 GLY 104 101 101 GLY GLY B . n 
B 1 105 THR 105 102 102 THR THR B . n 
B 1 106 ARG 106 103 103 ARG ARG B . n 
B 1 107 LEU 107 104 104 LEU LEU B . n 
B 1 108 THR 108 105 105 THR THR B . n 
B 1 109 VAL 109 106 106 VAL VAL B . n 
B 1 110 LEU 110 107 107 LEU LEU B . n 
B 1 111 GLY 111 108 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1500  ? 
1 MORE         -6    ? 
1 'SSA (A^2)'  10250 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-03-06 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
AMoRE     phasing          .   ? 3 
CNS       refinement       0.3 ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 51 ? ? 71.05   -46.79  
2  1 ASN A 52 ? ? -147.70 18.91   
3  1 ASP A 60 ? ? -66.42  2.34    
4  1 ALA A 84 ? ? 172.74  -177.25 
5  1 ALA A 93 ? ? 71.61   -108.81 
6  1 ASP B 51 ? ? 72.35   -46.56  
7  1 ASN B 52 ? ? -150.39 23.21   
8  1 ALA B 84 ? ? 175.76  179.75  
9  1 ASP B 92 ? ? -107.40 -89.30  
10 1 ALA B 93 ? ? -144.19 -60.70  
11 1 ASN B 95 ? ? 175.89  162.21  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A SER 14  ? OG  ? A SER 13  OG  
2  1 Y 1 A LYS 17  ? CG  ? A LYS 16  CG  
3  1 Y 1 A LYS 17  ? CD  ? A LYS 16  CD  
4  1 Y 1 A LYS 17  ? CE  ? A LYS 16  CE  
5  1 Y 1 A LYS 17  ? NZ  ? A LYS 16  NZ  
6  1 Y 1 A ARG 39  ? CG  ? A ARG 40  CG  
7  1 Y 1 A ARG 39  ? CD  ? A ARG 40  CD  
8  1 Y 1 A ARG 39  ? NE  ? A ARG 40  NE  
9  1 Y 1 A ARG 39  ? CZ  ? A ARG 40  CZ  
10 1 Y 1 A ARG 39  ? NH1 ? A ARG 40  NH1 
11 1 Y 1 A ARG 39  ? NH2 ? A ARG 40  NH2 
12 1 Y 1 A ARG 94  ? CG  ? A ARG 97  CG  
13 1 Y 1 A ARG 94  ? CD  ? A ARG 97  CD  
14 1 Y 1 A ARG 94  ? NE  ? A ARG 97  NE  
15 1 Y 1 A ARG 94  ? CZ  ? A ARG 97  CZ  
16 1 Y 1 A ARG 94  ? NH1 ? A ARG 97  NH1 
17 1 Y 1 A ARG 94  ? NH2 ? A ARG 97  NH2 
18 1 Y 1 A VAL 106 ? CG1 ? A VAL 109 CG1 
19 1 Y 1 A VAL 106 ? CG2 ? A VAL 109 CG2 
20 1 Y 1 B ASN 1   ? CG  ? B ASN 1   CG  
21 1 Y 1 B ASN 1   ? OD1 ? B ASN 1   OD1 
22 1 Y 1 B ASN 1   ? ND2 ? B ASN 1   ND2 
23 1 Y 1 B LEU 107 ? CG  ? B LEU 110 CG  
24 1 Y 1 B LEU 107 ? CD1 ? B LEU 110 CD1 
25 1 Y 1 B LEU 107 ? CD2 ? B LEU 110 CD2 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     B 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     GLY 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      108 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    B 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    GLY 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     111 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1   501 501 HOH HOH A . 
C 2 HOH 2   502 502 HOH HOH A . 
C 2 HOH 3   503 503 HOH HOH A . 
C 2 HOH 4   504 504 HOH HOH A . 
C 2 HOH 5   505 505 HOH HOH A . 
C 2 HOH 6   506 506 HOH HOH A . 
C 2 HOH 7   507 507 HOH HOH A . 
C 2 HOH 8   508 508 HOH HOH A . 
C 2 HOH 9   509 509 HOH HOH A . 
C 2 HOH 10  510 510 HOH HOH A . 
C 2 HOH 11  511 511 HOH HOH A . 
C 2 HOH 12  512 512 HOH HOH A . 
C 2 HOH 13  513 513 HOH HOH A . 
C 2 HOH 14  514 514 HOH HOH A . 
C 2 HOH 15  515 515 HOH HOH A . 
C 2 HOH 16  516 516 HOH HOH A . 
C 2 HOH 17  517 517 HOH HOH A . 
C 2 HOH 18  518 518 HOH HOH A . 
C 2 HOH 19  519 519 HOH HOH A . 
C 2 HOH 20  520 520 HOH HOH A . 
C 2 HOH 21  524 524 HOH HOH A . 
C 2 HOH 22  525 525 HOH HOH A . 
C 2 HOH 23  526 526 HOH HOH A . 
C 2 HOH 24  527 527 HOH HOH A . 
C 2 HOH 25  528 528 HOH HOH A . 
C 2 HOH 26  529 529 HOH HOH A . 
C 2 HOH 27  530 530 HOH HOH A . 
C 2 HOH 28  572 572 HOH HOH A . 
C 2 HOH 29  574 574 HOH HOH A . 
C 2 HOH 30  575 575 HOH HOH A . 
C 2 HOH 31  579 579 HOH HOH A . 
C 2 HOH 32  580 580 HOH HOH A . 
C 2 HOH 33  581 581 HOH HOH A . 
C 2 HOH 34  582 582 HOH HOH A . 
C 2 HOH 35  583 583 HOH HOH A . 
C 2 HOH 36  584 584 HOH HOH A . 
C 2 HOH 37  585 585 HOH HOH A . 
C 2 HOH 38  586 586 HOH HOH A . 
C 2 HOH 39  587 587 HOH HOH A . 
C 2 HOH 40  588 588 HOH HOH A . 
C 2 HOH 41  591 591 HOH HOH A . 
C 2 HOH 42  592 592 HOH HOH A . 
C 2 HOH 43  593 593 HOH HOH A . 
C 2 HOH 44  595 595 HOH HOH A . 
C 2 HOH 45  596 596 HOH HOH A . 
C 2 HOH 46  597 597 HOH HOH A . 
C 2 HOH 47  598 598 HOH HOH A . 
C 2 HOH 48  634 634 HOH HOH A . 
C 2 HOH 49  635 635 HOH HOH A . 
C 2 HOH 50  637 637 HOH HOH A . 
C 2 HOH 51  644 644 HOH HOH A . 
C 2 HOH 52  646 646 HOH HOH A . 
C 2 HOH 53  648 648 HOH HOH A . 
C 2 HOH 54  649 649 HOH HOH A . 
C 2 HOH 55  650 650 HOH HOH A . 
C 2 HOH 56  651 651 HOH HOH A . 
C 2 HOH 57  653 653 HOH HOH A . 
C 2 HOH 58  654 654 HOH HOH A . 
C 2 HOH 59  655 655 HOH HOH A . 
C 2 HOH 60  656 656 HOH HOH A . 
C 2 HOH 61  657 657 HOH HOH A . 
C 2 HOH 62  658 658 HOH HOH A . 
C 2 HOH 63  659 659 HOH HOH A . 
C 2 HOH 64  660 660 HOH HOH A . 
C 2 HOH 65  661 661 HOH HOH A . 
C 2 HOH 66  662 662 HOH HOH A . 
C 2 HOH 67  663 663 HOH HOH A . 
C 2 HOH 68  664 664 HOH HOH A . 
C 2 HOH 69  665 665 HOH HOH A . 
C 2 HOH 70  666 666 HOH HOH A . 
C 2 HOH 71  667 667 HOH HOH A . 
C 2 HOH 72  668 668 HOH HOH A . 
C 2 HOH 73  669 669 HOH HOH A . 
C 2 HOH 74  670 670 HOH HOH A . 
C 2 HOH 75  671 671 HOH HOH A . 
C 2 HOH 76  672 672 HOH HOH A . 
C 2 HOH 77  673 673 HOH HOH A . 
C 2 HOH 78  674 674 HOH HOH A . 
C 2 HOH 79  690 690 HOH HOH A . 
C 2 HOH 80  693 693 HOH HOH A . 
C 2 HOH 81  701 701 HOH HOH A . 
C 2 HOH 82  708 708 HOH HOH A . 
C 2 HOH 83  710 710 HOH HOH A . 
C 2 HOH 84  713 713 HOH HOH A . 
C 2 HOH 85  715 715 HOH HOH A . 
C 2 HOH 86  718 718 HOH HOH A . 
C 2 HOH 87  719 719 HOH HOH A . 
C 2 HOH 88  721 721 HOH HOH A . 
C 2 HOH 89  722 722 HOH HOH A . 
C 2 HOH 90  723 723 HOH HOH A . 
C 2 HOH 91  724 724 HOH HOH A . 
C 2 HOH 92  725 725 HOH HOH A . 
C 2 HOH 93  726 726 HOH HOH A . 
C 2 HOH 94  727 727 HOH HOH A . 
C 2 HOH 95  728 728 HOH HOH A . 
C 2 HOH 96  731 731 HOH HOH A . 
C 2 HOH 97  733 733 HOH HOH A . 
C 2 HOH 98  736 736 HOH HOH A . 
C 2 HOH 99  738 738 HOH HOH A . 
C 2 HOH 100 740 740 HOH HOH A . 
C 2 HOH 101 741 741 HOH HOH A . 
C 2 HOH 102 742 742 HOH HOH A . 
D 2 HOH 1   521 521 HOH HOH B . 
D 2 HOH 2   522 522 HOH HOH B . 
D 2 HOH 3   523 523 HOH HOH B . 
D 2 HOH 4   531 531 HOH HOH B . 
D 2 HOH 5   532 532 HOH HOH B . 
D 2 HOH 6   533 533 HOH HOH B . 
D 2 HOH 7   534 534 HOH HOH B . 
D 2 HOH 8   535 535 HOH HOH B . 
D 2 HOH 9   536 536 HOH HOH B . 
D 2 HOH 10  537 537 HOH HOH B . 
D 2 HOH 11  538 538 HOH HOH B . 
D 2 HOH 12  539 539 HOH HOH B . 
D 2 HOH 13  540 540 HOH HOH B . 
D 2 HOH 14  541 541 HOH HOH B . 
D 2 HOH 15  542 542 HOH HOH B . 
D 2 HOH 16  543 543 HOH HOH B . 
D 2 HOH 17  544 544 HOH HOH B . 
D 2 HOH 18  545 545 HOH HOH B . 
D 2 HOH 19  546 546 HOH HOH B . 
D 2 HOH 20  547 547 HOH HOH B . 
D 2 HOH 21  548 548 HOH HOH B . 
D 2 HOH 22  549 549 HOH HOH B . 
D 2 HOH 23  550 550 HOH HOH B . 
D 2 HOH 24  551 551 HOH HOH B . 
D 2 HOH 25  552 552 HOH HOH B . 
D 2 HOH 26  553 553 HOH HOH B . 
D 2 HOH 27  554 554 HOH HOH B . 
D 2 HOH 28  555 555 HOH HOH B . 
D 2 HOH 29  556 556 HOH HOH B . 
D 2 HOH 30  557 557 HOH HOH B . 
D 2 HOH 31  558 558 HOH HOH B . 
D 2 HOH 32  559 559 HOH HOH B . 
D 2 HOH 33  560 560 HOH HOH B . 
D 2 HOH 34  561 561 HOH HOH B . 
D 2 HOH 35  562 562 HOH HOH B . 
D 2 HOH 36  563 563 HOH HOH B . 
D 2 HOH 37  564 564 HOH HOH B . 
D 2 HOH 38  565 565 HOH HOH B . 
D 2 HOH 39  566 566 HOH HOH B . 
D 2 HOH 40  567 567 HOH HOH B . 
D 2 HOH 41  568 568 HOH HOH B . 
D 2 HOH 42  569 569 HOH HOH B . 
D 2 HOH 43  570 570 HOH HOH B . 
D 2 HOH 44  571 571 HOH HOH B . 
D 2 HOH 45  573 573 HOH HOH B . 
D 2 HOH 46  576 576 HOH HOH B . 
D 2 HOH 47  577 577 HOH HOH B . 
D 2 HOH 48  578 578 HOH HOH B . 
D 2 HOH 49  589 589 HOH HOH B . 
D 2 HOH 50  590 590 HOH HOH B . 
D 2 HOH 51  594 594 HOH HOH B . 
D 2 HOH 52  599 599 HOH HOH B . 
D 2 HOH 53  600 600 HOH HOH B . 
D 2 HOH 54  601 601 HOH HOH B . 
D 2 HOH 55  602 602 HOH HOH B . 
D 2 HOH 56  603 603 HOH HOH B . 
D 2 HOH 57  604 604 HOH HOH B . 
D 2 HOH 58  605 605 HOH HOH B . 
D 2 HOH 59  606 606 HOH HOH B . 
D 2 HOH 60  607 607 HOH HOH B . 
D 2 HOH 61  608 608 HOH HOH B . 
D 2 HOH 62  609 609 HOH HOH B . 
D 2 HOH 63  610 610 HOH HOH B . 
D 2 HOH 64  611 611 HOH HOH B . 
D 2 HOH 65  612 612 HOH HOH B . 
D 2 HOH 66  613 613 HOH HOH B . 
D 2 HOH 67  614 614 HOH HOH B . 
D 2 HOH 68  615 615 HOH HOH B . 
D 2 HOH 69  616 616 HOH HOH B . 
D 2 HOH 70  617 617 HOH HOH B . 
D 2 HOH 71  618 618 HOH HOH B . 
D 2 HOH 72  619 619 HOH HOH B . 
D 2 HOH 73  620 620 HOH HOH B . 
D 2 HOH 74  621 621 HOH HOH B . 
D 2 HOH 75  622 622 HOH HOH B . 
D 2 HOH 76  623 623 HOH HOH B . 
D 2 HOH 77  624 624 HOH HOH B . 
D 2 HOH 78  625 625 HOH HOH B . 
D 2 HOH 79  626 626 HOH HOH B . 
D 2 HOH 80  627 627 HOH HOH B . 
D 2 HOH 81  628 628 HOH HOH B . 
D 2 HOH 82  629 629 HOH HOH B . 
D 2 HOH 83  630 630 HOH HOH B . 
D 2 HOH 84  631 631 HOH HOH B . 
D 2 HOH 85  632 632 HOH HOH B . 
D 2 HOH 86  633 633 HOH HOH B . 
D 2 HOH 87  636 636 HOH HOH B . 
D 2 HOH 88  638 638 HOH HOH B . 
D 2 HOH 89  639 639 HOH HOH B . 
D 2 HOH 90  640 640 HOH HOH B . 
D 2 HOH 91  641 641 HOH HOH B . 
D 2 HOH 92  642 642 HOH HOH B . 
D 2 HOH 93  643 643 HOH HOH B . 
D 2 HOH 94  645 645 HOH HOH B . 
D 2 HOH 95  647 647 HOH HOH B . 
D 2 HOH 96  652 652 HOH HOH B . 
D 2 HOH 97  675 675 HOH HOH B . 
D 2 HOH 98  676 676 HOH HOH B . 
D 2 HOH 99  677 677 HOH HOH B . 
D 2 HOH 100 678 678 HOH HOH B . 
D 2 HOH 101 679 679 HOH HOH B . 
D 2 HOH 102 680 680 HOH HOH B . 
D 2 HOH 103 681 681 HOH HOH B . 
D 2 HOH 104 682 682 HOH HOH B . 
D 2 HOH 105 683 683 HOH HOH B . 
D 2 HOH 106 684 684 HOH HOH B . 
D 2 HOH 107 685 685 HOH HOH B . 
D 2 HOH 108 686 686 HOH HOH B . 
D 2 HOH 109 687 687 HOH HOH B . 
D 2 HOH 110 688 688 HOH HOH B . 
D 2 HOH 111 689 689 HOH HOH B . 
D 2 HOH 112 691 691 HOH HOH B . 
D 2 HOH 113 692 692 HOH HOH B . 
D 2 HOH 114 694 694 HOH HOH B . 
D 2 HOH 115 695 695 HOH HOH B . 
D 2 HOH 116 696 696 HOH HOH B . 
D 2 HOH 117 697 697 HOH HOH B . 
D 2 HOH 118 698 698 HOH HOH B . 
D 2 HOH 119 699 699 HOH HOH B . 
D 2 HOH 120 700 700 HOH HOH B . 
D 2 HOH 121 702 702 HOH HOH B . 
D 2 HOH 122 703 703 HOH HOH B . 
D 2 HOH 123 704 704 HOH HOH B . 
D 2 HOH 124 705 705 HOH HOH B . 
D 2 HOH 125 706 706 HOH HOH B . 
D 2 HOH 126 707 707 HOH HOH B . 
D 2 HOH 127 709 709 HOH HOH B . 
D 2 HOH 128 711 711 HOH HOH B . 
D 2 HOH 129 712 712 HOH HOH B . 
D 2 HOH 130 714 714 HOH HOH B . 
D 2 HOH 131 716 716 HOH HOH B . 
D 2 HOH 132 720 720 HOH HOH B . 
D 2 HOH 133 729 729 HOH HOH B . 
D 2 HOH 134 730 730 HOH HOH B . 
D 2 HOH 135 732 732 HOH HOH B . 
D 2 HOH 136 734 734 HOH HOH B . 
D 2 HOH 137 735 735 HOH HOH B . 
D 2 HOH 138 737 737 HOH HOH B . 
D 2 HOH 139 739 739 HOH HOH B . 
D 2 HOH 140 743 743 HOH HOH B . 
D 2 HOH 141 744 744 HOH HOH B . 
D 2 HOH 142 745 745 HOH HOH B . 
D 2 HOH 143 746 746 HOH HOH B . 
D 2 HOH 144 747 747 HOH HOH B . 
D 2 HOH 145 748 748 HOH HOH B . 
#