data_1CD9
# 
_entry.id   1CD9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1CD9         
RCSB  RCSB000600   
WWPDB D_1000000600 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1CD9 
_pdbx_database_status.recvd_initial_deposition_date   1999-03-08 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Aritomi, M.'   1 
'Kunishima, N.' 2 
'Okamoto, T.'   3 
'Kuroki, R.'    4 
'Ota, Y.'       5 
'Morikawa, K.'  6 
# 
_citation.id                        primary 
_citation.title                     
'Atomic structure of the GCSF-receptor complex showing a new cytokine-receptor recognition scheme.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            401 
_citation.page_first                713 
_citation.page_last                 717 
_citation.year                      1999 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10537111 
_citation.pdbx_database_id_DOI      10.1038/44394 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Aritomi, M.'   1 ? 
primary 'Kunishima, N.' 2 ? 
primary 'Okamoto, T.'   3 ? 
primary 'Kuroki, R.'    4 ? 
primary 'Ota, Y.'       5 ? 
primary 'Morikawa, K.'  6 ? 
# 
_cell.entry_id           1CD9 
_cell.length_a           125.467 
_cell.length_b           125.467 
_cell.length_c           372.771 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1CD9 
_symmetry.space_group_name_H-M             'I 41 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                98 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN (GRANULOCYTE COLONY-STIMULATING FACTOR)' 18816.760 2   ? ? ? ?                               
2 polymer     man 'PROTEIN (G-CSF RECEPTOR)'                        24460.264 2   ? ? 
'CRH REGION (BN DOMAIN:D1-108, BC DOMAIN:D109-215)' 'N-LINKED GLYCOSYLATION AT B10' 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose          221.208   2   ? ? ? ?                               
4 water       nat water                                             18.015    260 ? ? ? ?                               
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 G-CSF   
2 G-CSF-R 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLH
SGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQS
FLEVSYRVLRHLAQP
;
;MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLH
SGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQS
FLEVSYRVLRHLAQP
;
A,C ? 
2 'polypeptide(L)' no no 
;AGYPPASPSNLSCLMHLTTNSLVCQWEPGPETHLPTSFILKSFRSRADCQYQGDTIPDCVAKKRQNNCSIPRKNLLLYQY
MAIWVQAENMLGSSESPKLCLDPMDVVKLEPPMLQALDIGPDVVSHQPGCLWLSWKPWKPSEYMEQECELRYQPQLKGAN
WTLVFHLPSSKDQFELCGLHQAPVYTLQMRCIRSSLPGFWSPWSPGLQLRPTMKA
;
;AGYPPASPSNLSCLMHLTTNSLVCQWEPGPETHLPTSFILKSFRSRADCQYQGDTIPDCVAKKRQNNCSIPRKNLLLYQY
MAIWVQAENMLGSSESPKLCLDPMDVVKLEPPMLQALDIGPDVVSHQPGCLWLSWKPWKPSEYMEQECELRYQPQLKGAN
WTLVFHLPSSKDQFELCGLHQAPVYTLQMRCIRSSLPGFWSPWSPGLQLRPTMKA
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   PRO n 
1 4   LEU n 
1 5   GLY n 
1 6   PRO n 
1 7   ALA n 
1 8   SER n 
1 9   SER n 
1 10  LEU n 
1 11  PRO n 
1 12  GLN n 
1 13  SER n 
1 14  PHE n 
1 15  LEU n 
1 16  LEU n 
1 17  LYS n 
1 18  CYS n 
1 19  LEU n 
1 20  GLU n 
1 21  GLN n 
1 22  VAL n 
1 23  ARG n 
1 24  LYS n 
1 25  ILE n 
1 26  GLN n 
1 27  GLY n 
1 28  ASP n 
1 29  GLY n 
1 30  ALA n 
1 31  ALA n 
1 32  LEU n 
1 33  GLN n 
1 34  GLU n 
1 35  LYS n 
1 36  LEU n 
1 37  CYS n 
1 38  ALA n 
1 39  THR n 
1 40  TYR n 
1 41  LYS n 
1 42  LEU n 
1 43  CYS n 
1 44  HIS n 
1 45  PRO n 
1 46  GLU n 
1 47  GLU n 
1 48  LEU n 
1 49  VAL n 
1 50  LEU n 
1 51  LEU n 
1 52  GLY n 
1 53  HIS n 
1 54  SER n 
1 55  LEU n 
1 56  GLY n 
1 57  ILE n 
1 58  PRO n 
1 59  TRP n 
1 60  ALA n 
1 61  PRO n 
1 62  LEU n 
1 63  SER n 
1 64  SER n 
1 65  CYS n 
1 66  PRO n 
1 67  SER n 
1 68  GLN n 
1 69  ALA n 
1 70  LEU n 
1 71  GLN n 
1 72  LEU n 
1 73  ALA n 
1 74  GLY n 
1 75  CYS n 
1 76  LEU n 
1 77  SER n 
1 78  GLN n 
1 79  LEU n 
1 80  HIS n 
1 81  SER n 
1 82  GLY n 
1 83  LEU n 
1 84  PHE n 
1 85  LEU n 
1 86  TYR n 
1 87  GLN n 
1 88  GLY n 
1 89  LEU n 
1 90  LEU n 
1 91  GLN n 
1 92  ALA n 
1 93  LEU n 
1 94  GLU n 
1 95  GLY n 
1 96  ILE n 
1 97  SER n 
1 98  PRO n 
1 99  GLU n 
1 100 LEU n 
1 101 GLY n 
1 102 PRO n 
1 103 THR n 
1 104 LEU n 
1 105 ASP n 
1 106 THR n 
1 107 LEU n 
1 108 GLN n 
1 109 LEU n 
1 110 ASP n 
1 111 VAL n 
1 112 ALA n 
1 113 ASP n 
1 114 PHE n 
1 115 ALA n 
1 116 THR n 
1 117 THR n 
1 118 ILE n 
1 119 TRP n 
1 120 GLN n 
1 121 GLN n 
1 122 MET n 
1 123 GLU n 
1 124 GLU n 
1 125 LEU n 
1 126 GLY n 
1 127 MET n 
1 128 ALA n 
1 129 PRO n 
1 130 ALA n 
1 131 LEU n 
1 132 GLN n 
1 133 PRO n 
1 134 THR n 
1 135 GLN n 
1 136 GLY n 
1 137 ALA n 
1 138 MET n 
1 139 PRO n 
1 140 ALA n 
1 141 PHE n 
1 142 ALA n 
1 143 SER n 
1 144 ALA n 
1 145 PHE n 
1 146 GLN n 
1 147 ARG n 
1 148 ARG n 
1 149 ALA n 
1 150 GLY n 
1 151 GLY n 
1 152 VAL n 
1 153 LEU n 
1 154 VAL n 
1 155 ALA n 
1 156 SER n 
1 157 HIS n 
1 158 LEU n 
1 159 GLN n 
1 160 SER n 
1 161 PHE n 
1 162 LEU n 
1 163 GLU n 
1 164 VAL n 
1 165 SER n 
1 166 TYR n 
1 167 ARG n 
1 168 VAL n 
1 169 LEU n 
1 170 ARG n 
1 171 HIS n 
1 172 LEU n 
1 173 ALA n 
1 174 GLN n 
1 175 PRO n 
2 1   ALA n 
2 2   GLY n 
2 3   TYR n 
2 4   PRO n 
2 5   PRO n 
2 6   ALA n 
2 7   SER n 
2 8   PRO n 
2 9   SER n 
2 10  ASN n 
2 11  LEU n 
2 12  SER n 
2 13  CYS n 
2 14  LEU n 
2 15  MET n 
2 16  HIS n 
2 17  LEU n 
2 18  THR n 
2 19  THR n 
2 20  ASN n 
2 21  SER n 
2 22  LEU n 
2 23  VAL n 
2 24  CYS n 
2 25  GLN n 
2 26  TRP n 
2 27  GLU n 
2 28  PRO n 
2 29  GLY n 
2 30  PRO n 
2 31  GLU n 
2 32  THR n 
2 33  HIS n 
2 34  LEU n 
2 35  PRO n 
2 36  THR n 
2 37  SER n 
2 38  PHE n 
2 39  ILE n 
2 40  LEU n 
2 41  LYS n 
2 42  SER n 
2 43  PHE n 
2 44  ARG n 
2 45  SER n 
2 46  ARG n 
2 47  ALA n 
2 48  ASP n 
2 49  CYS n 
2 50  GLN n 
2 51  TYR n 
2 52  GLN n 
2 53  GLY n 
2 54  ASP n 
2 55  THR n 
2 56  ILE n 
2 57  PRO n 
2 58  ASP n 
2 59  CYS n 
2 60  VAL n 
2 61  ALA n 
2 62  LYS n 
2 63  LYS n 
2 64  ARG n 
2 65  GLN n 
2 66  ASN n 
2 67  ASN n 
2 68  CYS n 
2 69  SER n 
2 70  ILE n 
2 71  PRO n 
2 72  ARG n 
2 73  LYS n 
2 74  ASN n 
2 75  LEU n 
2 76  LEU n 
2 77  LEU n 
2 78  TYR n 
2 79  GLN n 
2 80  TYR n 
2 81  MET n 
2 82  ALA n 
2 83  ILE n 
2 84  TRP n 
2 85  VAL n 
2 86  GLN n 
2 87  ALA n 
2 88  GLU n 
2 89  ASN n 
2 90  MET n 
2 91  LEU n 
2 92  GLY n 
2 93  SER n 
2 94  SER n 
2 95  GLU n 
2 96  SER n 
2 97  PRO n 
2 98  LYS n 
2 99  LEU n 
2 100 CYS n 
2 101 LEU n 
2 102 ASP n 
2 103 PRO n 
2 104 MET n 
2 105 ASP n 
2 106 VAL n 
2 107 VAL n 
2 108 LYS n 
2 109 LEU n 
2 110 GLU n 
2 111 PRO n 
2 112 PRO n 
2 113 MET n 
2 114 LEU n 
2 115 GLN n 
2 116 ALA n 
2 117 LEU n 
2 118 ASP n 
2 119 ILE n 
2 120 GLY n 
2 121 PRO n 
2 122 ASP n 
2 123 VAL n 
2 124 VAL n 
2 125 SER n 
2 126 HIS n 
2 127 GLN n 
2 128 PRO n 
2 129 GLY n 
2 130 CYS n 
2 131 LEU n 
2 132 TRP n 
2 133 LEU n 
2 134 SER n 
2 135 TRP n 
2 136 LYS n 
2 137 PRO n 
2 138 TRP n 
2 139 LYS n 
2 140 PRO n 
2 141 SER n 
2 142 GLU n 
2 143 TYR n 
2 144 MET n 
2 145 GLU n 
2 146 GLN n 
2 147 GLU n 
2 148 CYS n 
2 149 GLU n 
2 150 LEU n 
2 151 ARG n 
2 152 TYR n 
2 153 GLN n 
2 154 PRO n 
2 155 GLN n 
2 156 LEU n 
2 157 LYS n 
2 158 GLY n 
2 159 ALA n 
2 160 ASN n 
2 161 TRP n 
2 162 THR n 
2 163 LEU n 
2 164 VAL n 
2 165 PHE n 
2 166 HIS n 
2 167 LEU n 
2 168 PRO n 
2 169 SER n 
2 170 SER n 
2 171 LYS n 
2 172 ASP n 
2 173 GLN n 
2 174 PHE n 
2 175 GLU n 
2 176 LEU n 
2 177 CYS n 
2 178 GLY n 
2 179 LEU n 
2 180 HIS n 
2 181 GLN n 
2 182 ALA n 
2 183 PRO n 
2 184 VAL n 
2 185 TYR n 
2 186 THR n 
2 187 LEU n 
2 188 GLN n 
2 189 MET n 
2 190 ARG n 
2 191 CYS n 
2 192 ILE n 
2 193 ARG n 
2 194 SER n 
2 195 SER n 
2 196 LEU n 
2 197 PRO n 
2 198 GLY n 
2 199 PHE n 
2 200 TRP n 
2 201 SER n 
2 202 PRO n 
2 203 TRP n 
2 204 SER n 
2 205 PRO n 
2 206 GLY n 
2 207 LEU n 
2 208 GLN n 
2 209 LEU n 
2 210 ARG n 
2 211 PRO n 
2 212 THR n 
2 213 MET n 
2 214 LYS n 
2 215 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human         Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606  ? ? ? ? ? ? EXTRACELLULAR       ?               
'Escherichia coli'      562  Escherichia ? ? ? ? ? ? ? ?    ? ? ? ? ?       PLASMID ? ? ? ? ? ? 
2 1 sample ? ? ? 'house mouse' Mus  ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? 'CELLULAR MEMBRANE' 'fall armyworm' 
'Spodoptera frugiperda' 7108 Spodoptera  ? ? ? ? ? ? ? SF-9 ? ? ? ? NUCLEUS VIRUS   
'AUTOGRAPHA CALIFORNICA NUCLEAR POLYHEDROSIS VIRUS' ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP CSF3_HUMAN  1 ? ? P09919 ? 
2 UNP CSF3R_MOUSE 2 ? ? P40223 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1CD9 A 2 ? 175 ? P09919 13  ? 186 ? 2 175 
2 2 1CD9 B 1 ? 215 ? P40223 120 ? 334 ? 1 215 
3 1 1CD9 C 2 ? 175 ? P09919 13  ? 186 ? 2 175 
4 2 1CD9 D 1 ? 215 ? P40223 120 ? 334 ? 1 215 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1CD9 MET A 1 ? UNP P09919 ALA 12 'cloning artifact' 1 1 
3 1CD9 MET C 1 ? UNP P09919 ALA 12 'cloning artifact' 1 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1CD9 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.10 
_exptl_crystal.density_percent_sol   70.0 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_details    'pH 7.50' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   RIGAKU 
_diffrn_detector.pdbx_collection_date   1999-06-15 
_diffrn_detector.details                'BENT MIRROR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SILICON CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL41XU' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL41XU 
_diffrn_source.pdbx_wavelength             1.00 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1CD9 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.800 
_reflns.number_obs                   35565 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.4 
_reflns.pdbx_Rmerge_I_obs            0.057 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        58.90 
_reflns.pdbx_redundancy              4.800 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 1CD9 
_refine.ls_number_reflns_obs                     35277 
_refine.ls_number_reflns_all                     35277 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             15.0 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    95.7 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.237 
_refine.ls_R_factor_R_free                       0.319 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 1.400 
_refine.ls_number_reflns_R_free                  510 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               42.20 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'X-PLOR WAS ALSO USED' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIRAS 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5792 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         28 
_refine_hist.number_atoms_solvent             260 
_refine_hist.number_atoms_total               6080 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        15.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.012  0.020 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           0.033  0.040 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          0.041  0.050 ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         2.000  ?     ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        3.000  ?     ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         2.000  ?     ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        3.000  ?     ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       0.300  ?     ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       0.300  ?     ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       0.300  ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        7.000  ?     ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     15.000 ?     ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    20.000 ?     ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       15.000 ?     ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 0.786910 0.611410 0.083360 0.613010 -0.790040 0.007790 0.070620 0.044970 -0.996490 -22.31002 32.99520 251.97295 
2 given ? 0.863480 0.480970 0.151900 0.481780 -0.875640 0.033900 0.149310 0.043910 -0.987810 -31.65583 38.74764 247.10971 
# 
_struct.entry_id                  1CD9 
_struct.title                     '2:2 COMPLEX OF G-CSF WITH ITS RECEPTOR' 
_struct.pdbx_descriptor           'GRANULOCYTE COLONY-STIMULATING FACTOR/G-CSF RECEPTOR COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1CD9 
_struct_keywords.pdbx_keywords   CYTOKINE 
_struct_keywords.text            'CLASS1 CYTOKINE, HEMATOPOIETIC RECEPTOR, SIGNAL TRANSDUCTION, CYTOKINE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 11  ? TYR A 40  ? PRO A 11  TYR A 40  1 ? 30 
HELX_P HELX_P2  2  HIS A 44  ? VAL A 49  ? HIS A 44  VAL A 49  5 ? 6  
HELX_P HELX_P3  3  LEU A 50  ? GLY A 56  ? LEU A 50  GLY A 56  1 ? 7  
HELX_P HELX_P4  4  LEU A 72  ? LEU A 93  ? LEU A 72  LEU A 93  1 ? 22 
HELX_P HELX_P5  5  LEU A 100 ? LEU A 125 ? LEU A 100 LEU A 125 1 ? 26 
HELX_P HELX_P6  6  SER A 143 ? GLN A 174 ? SER A 143 GLN A 174 1 ? 32 
HELX_P HELX_P7  7  ARG B 46  ? GLN B 50  ? ARG B 46  GLN B 50  5 ? 5  
HELX_P HELX_P8  8  LYS B 73  ? LEU B 75  ? LYS B 73  LEU B 75  5 ? 3  
HELX_P HELX_P9  9  ASP B 102 ? VAL B 106 ? ASP B 102 VAL B 106 5 ? 5  
HELX_P HELX_P10 10 TRP B 138 ? GLU B 142 ? TRP B 138 GLU B 142 5 ? 5  
HELX_P HELX_P11 11 PRO C 11  ? LYS C 41  ? PRO C 11  LYS C 41  1 ? 31 
HELX_P HELX_P12 12 HIS C 44  ? GLY C 56  ? HIS C 44  GLY C 56  1 ? 13 
HELX_P HELX_P13 13 GLN C 71  ? LEU C 93  ? GLN C 71  LEU C 93  1 ? 23 
HELX_P HELX_P14 14 LEU C 100 ? LEU C 125 ? LEU C 100 LEU C 125 1 ? 26 
HELX_P HELX_P15 15 SER C 143 ? ALA C 173 ? SER C 143 ALA C 173 1 ? 31 
HELX_P HELX_P16 16 ARG D 46  ? GLN D 50  ? ARG D 46  GLN D 50  5 ? 5  
HELX_P HELX_P17 17 LYS D 73  ? LEU D 75  ? LYS D 73  LEU D 75  5 ? 3  
HELX_P HELX_P18 18 ASP D 102 ? VAL D 106 ? ASP D 102 VAL D 106 5 ? 5  
HELX_P HELX_P19 19 TRP D 138 ? GLU D 142 ? TRP D 138 GLU D 142 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?   ? A CYS 37  SG  ? ? ? 1_555 A CYS 43  SG ? ? A CYS 37  A CYS 43  1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf2  disulf ?   ? A CYS 65  SG  ? ? ? 1_555 A CYS 75  SG ? ? A CYS 65  A CYS 75  1_555 ? ? ? ? ? ? ? 2.059 ? ?               
disulf3  disulf ?   ? B CYS 13  SG  ? ? ? 1_555 B CYS 24  SG ? ? B CYS 13  B CYS 24  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf4  disulf ?   ? B CYS 49  SG  ? ? ? 1_555 B CYS 100 SG ? ? B CYS 49  B CYS 100 1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf5  disulf ?   ? B CYS 59  SG  ? ? ? 1_555 B CYS 68  SG ? ? B CYS 59  B CYS 68  1_555 ? ? ? ? ? ? ? 2.052 ? ?               
disulf6  disulf ?   ? B CYS 130 SG  ? ? ? 1_555 B CYS 177 SG ? ? B CYS 130 B CYS 177 1_555 ? ? ? ? ? ? ? 2.060 ? ?               
disulf7  disulf ?   ? B CYS 148 SG  ? ? ? 1_555 B CYS 191 SG ? ? B CYS 148 B CYS 191 1_555 ? ? ? ? ? ? ? 2.054 ? ?               
disulf8  disulf ?   ? C CYS 37  SG  ? ? ? 1_555 C CYS 43  SG ? ? C CYS 37  C CYS 43  1_555 ? ? ? ? ? ? ? 2.052 ? ?               
disulf9  disulf ?   ? C CYS 65  SG  ? ? ? 1_555 C CYS 75  SG ? ? C CYS 65  C CYS 75  1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf10 disulf ?   ? D CYS 13  SG  ? ? ? 1_555 D CYS 24  SG ? ? D CYS 13  D CYS 24  1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf11 disulf ?   ? D CYS 49  SG  ? ? ? 1_555 D CYS 100 SG ? ? D CYS 49  D CYS 100 1_555 ? ? ? ? ? ? ? 2.043 ? ?               
disulf12 disulf ?   ? D CYS 59  SG  ? ? ? 1_555 D CYS 68  SG ? ? D CYS 59  D CYS 68  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf13 disulf ?   ? D CYS 130 SG  ? ? ? 1_555 D CYS 177 SG ? ? D CYS 130 D CYS 177 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf14 disulf ?   ? D CYS 148 SG  ? ? ? 1_555 D CYS 191 SG ? ? D CYS 148 D CYS 191 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
covale1  covale one ? B ASN 10  ND2 ? ? ? 1_555 E NAG .   C1 ? ? B ASN 10  B NAG 323 1_555 ? ? ? ? ? ? ? 1.484 ? N-Glycosylation 
covale2  covale one ? D ASN 10  ND2 ? ? ? 1_555 F NAG .   C1 ? ? D ASN 10  D NAG 923 1_555 ? ? ? ? ? ? ? 1.458 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 4 ? 
D ? 3 ? 
E ? 4 ? 
F ? 3 ? 
G ? 4 ? 
H ? 4 ? 
I ? 3 ? 
J ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER B 9   ? HIS B 16  ? SER B 9   HIS B 16  
A 2 SER B 21  ? GLU B 27  ? SER B 21  GLU B 27  
A 3 ASN B 67  ? PRO B 71  ? ASN B 67  PRO B 71  
B 1 THR B 55  ? VAL B 60  ? THR B 55  VAL B 60  
B 2 SER B 37  ? ARG B 44  ? SER B 37  ARG B 44  
B 3 MET B 81  ? ASN B 89  ? MET B 81  ASN B 89  
B 4 GLY B 92  ? GLU B 95  ? GLY B 92  GLU B 95  
C 1 THR B 55  ? VAL B 60  ? THR B 55  VAL B 60  
C 2 SER B 37  ? ARG B 44  ? SER B 37  ARG B 44  
C 3 MET B 81  ? ASN B 89  ? MET B 81  ASN B 89  
C 4 LEU B 99  ? LEU B 101 ? LEU B 99  LEU B 101 
D 1 MET B 113 ? LEU B 117 ? MET B 113 LEU B 117 
D 2 LEU B 131 ? LYS B 136 ? LEU B 131 LYS B 136 
D 3 LYS B 171 ? LEU B 176 ? LYS B 171 LEU B 176 
E 1 THR B 162 ? PRO B 168 ? THR B 162 PRO B 168 
E 2 GLN B 146 ? PRO B 154 ? GLN B 146 PRO B 154 
E 3 TYR B 185 ? ARG B 193 ? TYR B 185 ARG B 193 
E 4 LEU B 207 ? LEU B 209 ? LEU B 207 LEU B 209 
F 1 SER D 9   ? HIS D 16  ? SER D 9   HIS D 16  
F 2 SER D 21  ? GLU D 27  ? SER D 21  GLU D 27  
F 3 ILE D 70  ? PRO D 71  ? ILE D 70  PRO D 71  
G 1 THR D 55  ? VAL D 60  ? THR D 55  VAL D 60  
G 2 PHE D 38  ? ARG D 44  ? PHE D 38  ARG D 44  
G 3 MET D 81  ? ASN D 89  ? MET D 81  ASN D 89  
G 4 GLY D 92  ? GLU D 95  ? GLY D 92  GLU D 95  
H 1 THR D 55  ? VAL D 60  ? THR D 55  VAL D 60  
H 2 PHE D 38  ? ARG D 44  ? PHE D 38  ARG D 44  
H 3 MET D 81  ? ASN D 89  ? MET D 81  ASN D 89  
H 4 LEU D 99  ? LEU D 101 ? LEU D 99  LEU D 101 
I 1 MET D 113 ? ALA D 116 ? MET D 113 ALA D 116 
I 2 CYS D 130 ? LYS D 136 ? CYS D 130 LYS D 136 
I 3 LYS D 171 ? CYS D 177 ? LYS D 171 CYS D 177 
J 1 THR D 162 ? PRO D 168 ? THR D 162 PRO D 168 
J 2 GLN D 146 ? PRO D 154 ? GLN D 146 PRO D 154 
J 3 TYR D 185 ? ARG D 193 ? TYR D 185 ARG D 193 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N HIS B 16  ? N HIS B 16  O SER B 21  ? O SER B 21  
A 2 3 N CYS B 24  ? N CYS B 24  O CYS B 68  ? O CYS B 68  
B 1 2 O CYS B 59  ? O CYS B 59  N LEU B 40  ? N LEU B 40  
B 2 3 O PHE B 43  ? O PHE B 43  N ALA B 82  ? N ALA B 82  
B 3 4 O ASN B 89  ? O ASN B 89  N GLY B 92  ? N GLY B 92  
C 1 2 O CYS B 59  ? O CYS B 59  N LEU B 40  ? N LEU B 40  
C 2 3 O PHE B 43  ? O PHE B 43  N ALA B 82  ? N ALA B 82  
C 3 4 O ILE B 83  ? O ILE B 83  N LEU B 99  ? N LEU B 99  
D 1 2 N LEU B 117 ? N LEU B 117 O TRP B 132 ? O TRP B 132 
D 2 3 O TRP B 135 ? O TRP B 135 N LYS B 171 ? N LYS B 171 
E 1 2 N LEU B 167 ? N LEU B 167 O CYS B 148 ? O CYS B 148 
E 2 3 O GLN B 153 ? O GLN B 153 N THR B 186 ? N THR B 186 
E 3 4 O LEU B 187 ? O LEU B 187 N LEU B 207 ? N LEU B 207 
F 1 2 N HIS D 16  ? N HIS D 16  O SER D 21  ? O SER D 21  
F 2 3 O LEU D 22  ? O LEU D 22  N ILE D 70  ? N ILE D 70  
G 1 2 O CYS D 59  ? O CYS D 59  N LEU D 40  ? N LEU D 40  
G 2 3 O PHE D 43  ? O PHE D 43  N ALA D 82  ? N ALA D 82  
G 3 4 N ASN D 89  ? N ASN D 89  O GLY D 92  ? O GLY D 92  
H 1 2 O CYS D 59  ? O CYS D 59  N LEU D 40  ? N LEU D 40  
H 2 3 O PHE D 43  ? O PHE D 43  N ALA D 82  ? N ALA D 82  
H 3 4 O ILE D 83  ? O ILE D 83  N LEU D 99  ? N LEU D 99  
I 1 2 N GLN D 115 ? N GLN D 115 O SER D 134 ? O SER D 134 
I 2 3 O TRP D 135 ? O TRP D 135 N LYS D 171 ? N LYS D 171 
J 1 2 O LEU D 167 ? O LEU D 167 N CYS D 148 ? N CYS D 148 
J 2 3 O GLN D 153 ? O GLN D 153 N THR D 186 ? N THR D 186 
# 
_database_PDB_matrix.entry_id          1CD9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1CD9 
_atom_sites.fract_transf_matrix[1][1]   0.007970 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007970 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002683 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 5   ? 42.132  17.880 130.316 1.00 133.67 ? 5   GLY A N   1 
ATOM   2    C CA  . GLY A 1 5   ? 42.499  19.310 130.545 1.00 128.23 ? 5   GLY A CA  1 
ATOM   3    C C   . GLY A 1 5   ? 42.600  20.009 129.205 1.00 124.12 ? 5   GLY A C   1 
ATOM   4    O O   . GLY A 1 5   ? 42.468  19.336 128.180 1.00 126.65 ? 5   GLY A O   1 
ATOM   5    N N   . PRO A 1 6   ? 42.826  21.337 129.172 1.00 116.53 ? 6   PRO A N   1 
ATOM   6    C CA  . PRO A 1 6   ? 42.941  22.107 127.925 1.00 103.69 ? 6   PRO A CA  1 
ATOM   7    C C   . PRO A 1 6   ? 44.270  21.826 127.220 1.00 87.76  ? 6   PRO A C   1 
ATOM   8    O O   . PRO A 1 6   ? 44.982  22.745 126.807 1.00 87.46  ? 6   PRO A O   1 
ATOM   9    C CB  . PRO A 1 6   ? 42.844  23.555 128.416 1.00 106.53 ? 6   PRO A CB  1 
ATOM   10   C CG  . PRO A 1 6   ? 43.539  23.495 129.739 1.00 114.75 ? 6   PRO A CG  1 
ATOM   11   C CD  . PRO A 1 6   ? 42.974  22.220 130.346 1.00 117.42 ? 6   PRO A CD  1 
ATOM   12   N N   . ALA A 1 7   ? 44.589  20.543 127.085 1.00 68.32  ? 7   ALA A N   1 
ATOM   13   C CA  . ALA A 1 7   ? 45.826  20.096 126.464 1.00 50.41  ? 7   ALA A CA  1 
ATOM   14   C C   . ALA A 1 7   ? 45.768  20.281 124.953 1.00 42.66  ? 7   ALA A C   1 
ATOM   15   O O   . ALA A 1 7   ? 44.692  20.413 124.384 1.00 49.20  ? 7   ALA A O   1 
ATOM   16   C CB  . ALA A 1 7   ? 46.070  18.630 126.807 1.00 34.60  ? 7   ALA A CB  1 
ATOM   17   N N   . SER A 1 8   ? 46.929  20.310 124.310 1.00 26.14  ? 8   SER A N   1 
ATOM   18   C CA  . SER A 1 8   ? 47.000  20.455 122.869 1.00 23.56  ? 8   SER A CA  1 
ATOM   19   C C   . SER A 1 8   ? 48.415  20.138 122.441 1.00 24.35  ? 8   SER A C   1 
ATOM   20   O O   . SER A 1 8   ? 49.373  20.412 123.160 1.00 26.74  ? 8   SER A O   1 
ATOM   21   C CB  . SER A 1 8   ? 46.622  21.879 122.430 1.00 31.02  ? 8   SER A CB  1 
ATOM   22   O OG  . SER A 1 8   ? 46.685  22.047 121.018 1.00 33.65  ? 8   SER A OG  1 
ATOM   23   N N   . SER A 1 9   ? 48.543  19.566 121.256 1.00 19.45  ? 9   SER A N   1 
ATOM   24   C CA  . SER A 1 9   ? 49.837  19.201 120.716 1.00 16.68  ? 9   SER A CA  1 
ATOM   25   C C   . SER A 1 9   ? 50.538  20.399 120.116 1.00 15.32  ? 9   SER A C   1 
ATOM   26   O O   . SER A 1 9   ? 51.678  20.290 119.657 1.00 25.03  ? 9   SER A O   1 
ATOM   27   C CB  . SER A 1 9   ? 49.655  18.124 119.662 1.00 20.38  ? 9   SER A CB  1 
ATOM   28   O OG  . SER A 1 9   ? 48.488  18.395 118.902 1.00 44.06  ? 9   SER A OG  1 
ATOM   29   N N   . LEU A 1 10  ? 49.858  21.540 120.108 1.00 13.59  ? 10  LEU A N   1 
ATOM   30   C CA  . LEU A 1 10  ? 50.434  22.758 119.559 1.00 9.55   ? 10  LEU A CA  1 
ATOM   31   C C   . LEU A 1 10  ? 50.544  23.811 120.636 1.00 15.50  ? 10  LEU A C   1 
ATOM   32   O O   . LEU A 1 10  ? 49.646  23.962 121.471 1.00 25.23  ? 10  LEU A O   1 
ATOM   33   C CB  . LEU A 1 10  ? 49.571  23.283 118.428 1.00 12.92  ? 10  LEU A CB  1 
ATOM   34   C CG  . LEU A 1 10  ? 49.573  22.402 117.184 1.00 13.89  ? 10  LEU A CG  1 
ATOM   35   C CD1 . LEU A 1 10  ? 48.555  22.905 116.195 1.00 16.88  ? 10  LEU A CD1 1 
ATOM   36   C CD2 . LEU A 1 10  ? 50.963  22.400 116.576 1.00 2.04   ? 10  LEU A CD2 1 
ATOM   37   N N   . PRO A 1 11  ? 51.670  24.530 120.660 1.00 4.23   ? 11  PRO A N   1 
ATOM   38   C CA  . PRO A 1 11  ? 51.928  25.584 121.633 1.00 4.92   ? 11  PRO A CA  1 
ATOM   39   C C   . PRO A 1 11  ? 50.957  26.703 121.327 1.00 14.03  ? 11  PRO A C   1 
ATOM   40   O O   . PRO A 1 11  ? 50.599  26.900 120.167 1.00 24.97  ? 11  PRO A O   1 
ATOM   41   C CB  . PRO A 1 11  ? 53.343  26.038 121.279 1.00 3.09   ? 11  PRO A CB  1 
ATOM   42   C CG  . PRO A 1 11  ? 53.906  24.919 120.538 1.00 5.33   ? 11  PRO A CG  1 
ATOM   43   C CD  . PRO A 1 11  ? 52.779  24.431 119.710 1.00 5.00   ? 11  PRO A CD  1 
ATOM   44   N N   . GLN A 1 12  ? 50.603  27.497 122.330 1.00 18.31  ? 12  GLN A N   1 
ATOM   45   C CA  . GLN A 1 12  ? 49.685  28.596 122.088 1.00 7.39   ? 12  GLN A CA  1 
ATOM   46   C C   . GLN A 1 12  ? 50.375  29.782 121.406 1.00 10.42  ? 12  GLN A C   1 
ATOM   47   O O   . GLN A 1 12  ? 49.754  30.434 120.578 1.00 23.97  ? 12  GLN A O   1 
ATOM   48   C CB  . GLN A 1 12  ? 49.042  29.055 123.365 1.00 5.51   ? 12  GLN A CB  1 
ATOM   49   C CG  . GLN A 1 12  ? 47.997  30.069 123.142 1.00 18.59  ? 12  GLN A CG  1 
ATOM   50   C CD  . GLN A 1 12  ? 46.640  29.448 123.201 1.00 28.14  ? 12  GLN A CD  1 
ATOM   51   O OE1 . GLN A 1 12  ? 46.503  28.242 123.006 1.00 44.17  ? 12  GLN A OE1 1 
ATOM   52   N NE2 . GLN A 1 12  ? 45.625  30.251 123.511 1.00 40.81  ? 12  GLN A NE2 1 
ATOM   53   N N   . SER A 1 13  ? 51.641  30.063 121.723 1.00 6.40   ? 13  SER A N   1 
ATOM   54   C CA  . SER A 1 13  ? 52.322  31.180 121.077 1.00 3.03   ? 13  SER A CA  1 
ATOM   55   C C   . SER A 1 13  ? 52.330  30.958 119.560 1.00 8.16   ? 13  SER A C   1 
ATOM   56   O O   . SER A 1 13  ? 52.097  31.876 118.780 1.00 14.00  ? 13  SER A O   1 
ATOM   57   C CB  . SER A 1 13  ? 53.747  31.341 121.606 1.00 5.17   ? 13  SER A CB  1 
ATOM   58   O OG  . SER A 1 13  ? 54.544  30.193 121.342 1.00 27.64  ? 13  SER A OG  1 
ATOM   59   N N   . PHE A 1 14  ? 52.558  29.722 119.150 1.00 5.23   ? 14  PHE A N   1 
ATOM   60   C CA  . PHE A 1 14  ? 52.604  29.395 117.749 1.00 2.00   ? 14  PHE A CA  1 
ATOM   61   C C   . PHE A 1 14  ? 51.252  29.638 117.110 1.00 2.00   ? 14  PHE A C   1 
ATOM   62   O O   . PHE A 1 14  ? 51.154  30.308 116.097 1.00 20.77  ? 14  PHE A O   1 
ATOM   63   C CB  . PHE A 1 14  ? 53.009  27.956 117.591 1.00 4.64   ? 14  PHE A CB  1 
ATOM   64   C CG  . PHE A 1 14  ? 52.732  27.402 116.234 1.00 18.63  ? 14  PHE A CG  1 
ATOM   65   C CD1 . PHE A 1 14  ? 53.495  27.798 115.138 1.00 17.96  ? 14  PHE A CD1 1 
ATOM   66   C CD2 . PHE A 1 14  ? 51.690  26.494 116.041 1.00 7.70   ? 14  PHE A CD2 1 
ATOM   67   C CE1 . PHE A 1 14  ? 53.220  27.298 113.870 1.00 2.00   ? 14  PHE A CE1 1 
ATOM   68   C CE2 . PHE A 1 14  ? 51.412  25.993 114.779 1.00 2.00   ? 14  PHE A CE2 1 
ATOM   69   C CZ  . PHE A 1 14  ? 52.178  26.398 113.691 1.00 2.00   ? 14  PHE A CZ  1 
ATOM   70   N N   . LEU A 1 15  ? 50.201  29.093 117.693 1.00 2.00   ? 15  LEU A N   1 
ATOM   71   C CA  . LEU A 1 15  ? 48.857  29.308 117.167 1.00 2.00   ? 15  LEU A CA  1 
ATOM   72   C C   . LEU A 1 15  ? 48.435  30.766 117.066 1.00 6.79   ? 15  LEU A C   1 
ATOM   73   O O   . LEU A 1 15  ? 47.645  31.111 116.202 1.00 10.90  ? 15  LEU A O   1 
ATOM   74   C CB  . LEU A 1 15  ? 47.833  28.615 118.033 1.00 2.00   ? 15  LEU A CB  1 
ATOM   75   C CG  . LEU A 1 15  ? 47.738  27.103 117.968 1.00 13.48  ? 15  LEU A CG  1 
ATOM   76   C CD1 . LEU A 1 15  ? 46.635  26.664 118.904 1.00 16.85  ? 15  LEU A CD1 1 
ATOM   77   C CD2 . LEU A 1 15  ? 47.433  26.671 116.540 1.00 4.76   ? 15  LEU A CD2 1 
ATOM   78   N N   . LEU A 1 16  ? 48.863  31.609 117.997 1.00 7.93   ? 16  LEU A N   1 
ATOM   79   C CA  . LEU A 1 16  ? 48.497  33.014 117.928 1.00 2.00   ? 16  LEU A CA  1 
ATOM   80   C C   . LEU A 1 16  ? 49.269  33.698 116.813 1.00 2.00   ? 16  LEU A C   1 
ATOM   81   O O   . LEU A 1 16  ? 48.746  34.589 116.175 1.00 14.40  ? 16  LEU A O   1 
ATOM   82   C CB  . LEU A 1 16  ? 48.717  33.727 119.266 1.00 2.00   ? 16  LEU A CB  1 
ATOM   83   C CG  . LEU A 1 16  ? 47.845  33.264 120.433 1.00 2.00   ? 16  LEU A CG  1 
ATOM   84   C CD1 . LEU A 1 16  ? 48.102  34.098 121.620 1.00 2.00   ? 16  LEU A CD1 1 
ATOM   85   C CD2 . LEU A 1 16  ? 46.403  33.357 120.084 1.00 2.00   ? 16  LEU A CD2 1 
ATOM   86   N N   . LYS A 1 17  ? 50.512  33.302 116.580 1.00 2.00   ? 17  LYS A N   1 
ATOM   87   C CA  . LYS A 1 17  ? 51.301  33.879 115.498 1.00 2.00   ? 17  LYS A CA  1 
ATOM   88   C C   . LYS A 1 17  ? 50.679  33.445 114.184 1.00 2.05   ? 17  LYS A C   1 
ATOM   89   O O   . LYS A 1 17  ? 50.614  34.220 113.254 1.00 7.75   ? 17  LYS A O   1 
ATOM   90   C CB  . LYS A 1 17  ? 52.734  33.386 115.543 1.00 2.00   ? 17  LYS A CB  1 
ATOM   91   C CG  . LYS A 1 17  ? 53.501  33.854 116.746 1.00 5.66   ? 17  LYS A CG  1 
ATOM   92   C CD  . LYS A 1 17  ? 54.949  33.433 116.664 1.00 12.18  ? 17  LYS A CD  1 
ATOM   93   C CE  . LYS A 1 17  ? 55.803  34.027 117.782 1.00 3.91   ? 17  LYS A CE  1 
ATOM   94   N NZ  . LYS A 1 17  ? 57.203  33.482 117.834 1.00 29.52  ? 17  LYS A NZ  1 
ATOM   95   N N   . CYS A 1 18  ? 50.204  32.203 114.099 1.00 9.92   ? 18  CYS A N   1 
ATOM   96   C CA  . CYS A 1 18  ? 49.551  31.732 112.872 1.00 2.00   ? 18  CYS A CA  1 
ATOM   97   C C   . CYS A 1 18  ? 48.329  32.597 112.584 1.00 2.00   ? 18  CYS A C   1 
ATOM   98   O O   . CYS A 1 18  ? 48.148  33.078 111.474 1.00 8.70   ? 18  CYS A O   1 
ATOM   99   C CB  . CYS A 1 18  ? 49.135  30.264 112.962 1.00 2.00   ? 18  CYS A CB  1 
ATOM   100  S SG  . CYS A 1 18  ? 50.445  29.103 112.805 1.00 16.63  ? 18  CYS A SG  1 
ATOM   101  N N   . LEU A 1 19  ? 47.535  32.870 113.607 1.00 2.22   ? 19  LEU A N   1 
ATOM   102  C CA  . LEU A 1 19  ? 46.339  33.691 113.440 1.00 2.28   ? 19  LEU A CA  1 
ATOM   103  C C   . LEU A 1 19  ? 46.668  35.110 113.015 1.00 6.32   ? 19  LEU A C   1 
ATOM   104  O O   . LEU A 1 19  ? 45.875  35.785 112.363 1.00 17.02  ? 19  LEU A O   1 
ATOM   105  C CB  . LEU A 1 19  ? 45.546  33.732 114.727 1.00 2.00   ? 19  LEU A CB  1 
ATOM   106  C CG  . LEU A 1 19  ? 44.848  32.451 115.127 1.00 2.00   ? 19  LEU A CG  1 
ATOM   107  C CD1 . LEU A 1 19  ? 44.379  32.607 116.516 1.00 5.37   ? 19  LEU A CD1 1 
ATOM   108  C CD2 . LEU A 1 19  ? 43.693  32.170 114.208 1.00 12.41  ? 19  LEU A CD2 1 
ATOM   109  N N   . GLU A 1 20  ? 47.839  35.575 113.394 1.00 3.14   ? 20  GLU A N   1 
ATOM   110  C CA  . GLU A 1 20  ? 48.235  36.916 113.032 1.00 2.00   ? 20  GLU A CA  1 
ATOM   111  C C   . GLU A 1 20  ? 48.731  36.930 111.599 1.00 11.32  ? 20  GLU A C   1 
ATOM   112  O O   . GLU A 1 20  ? 48.558  37.908 110.887 1.00 17.00  ? 20  GLU A O   1 
ATOM   113  C CB  . GLU A 1 20  ? 49.309  37.389 113.988 1.00 2.00   ? 20  GLU A CB  1 
ATOM   114  C CG  . GLU A 1 20  ? 49.676  38.791 113.798 1.00 2.00   ? 20  GLU A CG  1 
ATOM   115  C CD  . GLU A 1 20  ? 50.630  39.244 114.853 1.00 13.13  ? 20  GLU A CD  1 
ATOM   116  O OE1 . GLU A 1 20  ? 50.238  39.464 115.984 1.00 8.48   ? 20  GLU A OE1 1 
ATOM   117  O OE2 . GLU A 1 20  ? 51.810  39.372 114.592 1.00 2.00   ? 20  GLU A OE2 1 
ATOM   118  N N   . GLN A 1 21  ? 49.373  35.844 111.182 1.00 8.92   ? 21  GLN A N   1 
ATOM   119  C CA  . GLN A 1 21  ? 49.859  35.748 109.827 1.00 2.00   ? 21  GLN A CA  1 
ATOM   120  C C   . GLN A 1 21  ? 48.650  35.632 108.924 1.00 2.00   ? 21  GLN A C   1 
ATOM   121  O O   . GLN A 1 21  ? 48.593  36.267 107.882 1.00 8.11   ? 21  GLN A O   1 
ATOM   122  C CB  . GLN A 1 21  ? 50.778  34.561 109.677 1.00 2.00   ? 21  GLN A CB  1 
ATOM   123  C CG  . GLN A 1 21  ? 52.120  34.811 110.278 1.00 5.85   ? 21  GLN A CG  1 
ATOM   124  C CD  . GLN A 1 21  ? 53.164  33.786 109.902 1.00 11.84  ? 21  GLN A CD  1 
ATOM   125  O OE1 . GLN A 1 21  ? 53.356  32.790 110.608 1.00 7.38   ? 21  GLN A OE1 1 
ATOM   126  N NE2 . GLN A 1 21  ? 53.876  34.036 108.809 1.00 15.03  ? 21  GLN A NE2 1 
ATOM   127  N N   . VAL A 1 22  ? 47.639  34.895 109.361 1.00 2.00   ? 22  VAL A N   1 
ATOM   128  C CA  . VAL A 1 22  ? 46.446  34.789 108.549 1.00 2.00   ? 22  VAL A CA  1 
ATOM   129  C C   . VAL A 1 22  ? 45.851  36.169 108.329 1.00 5.97   ? 22  VAL A C   1 
ATOM   130  O O   . VAL A 1 22  ? 45.522  36.532 107.216 1.00 23.03  ? 22  VAL A O   1 
ATOM   131  C CB  . VAL A 1 22  ? 45.404  33.844 109.136 1.00 2.00   ? 22  VAL A CB  1 
ATOM   132  C CG1 . VAL A 1 22  ? 44.074  34.082 108.500 1.00 2.00   ? 22  VAL A CG1 1 
ATOM   133  C CG2 . VAL A 1 22  ? 45.832  32.415 108.887 1.00 2.00   ? 22  VAL A CG2 1 
ATOM   134  N N   . ARG A 1 23  ? 45.740  36.975 109.365 1.00 8.79   ? 23  ARG A N   1 
ATOM   135  C CA  . ARG A 1 23  ? 45.173  38.305 109.175 1.00 2.00   ? 23  ARG A CA  1 
ATOM   136  C C   . ARG A 1 23  ? 46.008  39.213 108.311 1.00 7.44   ? 23  ARG A C   1 
ATOM   137  O O   . ARG A 1 23  ? 45.460  40.020 107.565 1.00 19.96  ? 23  ARG A O   1 
ATOM   138  C CB  . ARG A 1 23  ? 44.990  39.024 110.483 1.00 2.20   ? 23  ARG A CB  1 
ATOM   139  C CG  . ARG A 1 23  ? 43.807  38.608 111.257 1.00 14.68  ? 23  ARG A CG  1 
ATOM   140  C CD  . ARG A 1 23  ? 43.804  39.370 112.563 1.00 15.70  ? 23  ARG A CD  1 
ATOM   141  N NE  . ARG A 1 23  ? 43.467  38.429 113.614 1.00 37.32  ? 23  ARG A NE  1 
ATOM   142  C CZ  . ARG A 1 23  ? 44.240  38.167 114.652 1.00 20.72  ? 23  ARG A CZ  1 
ATOM   143  N NH1 . ARG A 1 23  ? 45.398  38.803 114.792 1.00 2.00   ? 23  ARG A NH1 1 
ATOM   144  N NH2 . ARG A 1 23  ? 43.873  37.219 115.501 1.00 22.91  ? 23  ARG A NH2 1 
ATOM   145  N N   . LYS A 1 24  ? 47.325  39.141 108.467 1.00 7.44   ? 24  LYS A N   1 
ATOM   146  C CA  . LYS A 1 24  ? 48.252  39.967 107.705 1.00 2.00   ? 24  LYS A CA  1 
ATOM   147  C C   . LYS A 1 24  ? 48.085  39.665 106.217 1.00 4.50   ? 24  LYS A C   1 
ATOM   148  O O   . LYS A 1 24  ? 47.879  40.577 105.408 1.00 2.37   ? 24  LYS A O   1 
ATOM   149  C CB  . LYS A 1 24  ? 49.674  39.681 108.190 1.00 2.00   ? 24  LYS A CB  1 
ATOM   150  C CG  . LYS A 1 24  ? 50.765  40.494 107.571 1.00 3.27   ? 24  LYS A CG  1 
ATOM   151  C CD  . LYS A 1 24  ? 52.109  40.059 108.134 1.00 16.83  ? 24  LYS A CD  1 
ATOM   152  C CE  . LYS A 1 24  ? 53.262  40.899 107.586 1.00 31.71  ? 24  LYS A CE  1 
ATOM   153  N NZ  . LYS A 1 24  ? 53.033  42.376 107.692 1.00 62.96  ? 24  LYS A NZ  1 
ATOM   154  N N   . ILE A 1 25  ? 48.103  38.378 105.874 1.00 2.00   ? 25  ILE A N   1 
ATOM   155  C CA  . ILE A 1 25  ? 47.929  37.937 104.501 1.00 2.00   ? 25  ILE A CA  1 
ATOM   156  C C   . ILE A 1 25  ? 46.532  38.302 104.008 1.00 4.09   ? 25  ILE A C   1 
ATOM   157  O O   . ILE A 1 25  ? 46.368  38.688 102.877 1.00 17.62  ? 25  ILE A O   1 
ATOM   158  C CB  . ILE A 1 25  ? 48.143  36.438 104.384 1.00 2.00   ? 25  ILE A CB  1 
ATOM   159  C CG1 . ILE A 1 25  ? 49.588  36.112 104.704 1.00 2.00   ? 25  ILE A CG1 1 
ATOM   160  C CG2 . ILE A 1 25  ? 47.801  35.951 103.000 1.00 2.00   ? 25  ILE A CG2 1 
ATOM   161  C CD1 . ILE A 1 25  ? 49.831  34.663 104.981 1.00 2.00   ? 25  ILE A CD1 1 
ATOM   162  N N   . GLN A 1 26  ? 45.514  38.167 104.845 1.00 8.91   ? 26  GLN A N   1 
ATOM   163  C CA  . GLN A 1 26  ? 44.158  38.525 104.442 1.00 2.00   ? 26  GLN A CA  1 
ATOM   164  C C   . GLN A 1 26  ? 44.106  39.993 104.106 1.00 2.00   ? 26  GLN A C   1 
ATOM   165  O O   . GLN A 1 26  ? 43.253  40.434 103.376 1.00 17.66  ? 26  GLN A O   1 
ATOM   166  C CB  . GLN A 1 26  ? 43.177  38.305 105.567 1.00 2.00   ? 26  GLN A CB  1 
ATOM   167  C CG  . GLN A 1 26  ? 42.840  36.913 105.840 1.00 3.33   ? 26  GLN A CG  1 
ATOM   168  C CD  . GLN A 1 26  ? 41.854  36.822 106.961 1.00 16.82  ? 26  GLN A CD  1 
ATOM   169  O OE1 . GLN A 1 26  ? 40.807  36.206 106.822 1.00 18.45  ? 26  GLN A OE1 1 
ATOM   170  N NE2 . GLN A 1 26  ? 42.163  37.461 108.077 1.00 19.32  ? 26  GLN A NE2 1 
ATOM   171  N N   . GLY A 1 27  ? 44.963  40.769 104.732 1.00 4.78   ? 27  GLY A N   1 
ATOM   172  C CA  . GLY A 1 27  ? 44.981  42.181 104.461 1.00 2.00   ? 27  GLY A CA  1 
ATOM   173  C C   . GLY A 1 27  ? 45.795  42.445 103.220 1.00 6.03   ? 27  GLY A C   1 
ATOM   174  O O   . GLY A 1 27  ? 45.575  43.440 102.546 1.00 14.60  ? 27  GLY A O   1 
ATOM   175  N N   . ASP A 1 28  ? 46.760  41.581 102.932 1.00 10.64  ? 28  ASP A N   1 
ATOM   176  C CA  . ASP A 1 28  ? 47.578  41.748 101.732 1.00 10.89  ? 28  ASP A CA  1 
ATOM   177  C C   . ASP A 1 28  ? 46.744  41.417 100.484 1.00 7.36   ? 28  ASP A C   1 
ATOM   178  O O   . ASP A 1 28  ? 46.784  42.133 99.500  1.00 20.08  ? 28  ASP A O   1 
ATOM   179  C CB  . ASP A 1 28  ? 48.835  40.845 101.760 1.00 14.07  ? 28  ASP A CB  1 
ATOM   180  C CG  . ASP A 1 28  ? 49.852  41.249 102.826 1.00 16.51  ? 28  ASP A CG  1 
ATOM   181  O OD1 . ASP A 1 28  ? 49.823  42.408 103.288 1.00 42.78  ? 28  ASP A OD1 1 
ATOM   182  O OD2 . ASP A 1 28  ? 50.703  40.411 103.194 1.00 8.82   ? 28  ASP A OD2 1 
ATOM   183  N N   . GLY A 1 29  ? 45.988  40.332 100.527 1.00 6.18   ? 29  GLY A N   1 
ATOM   184  C CA  . GLY A 1 29  ? 45.174  39.951 99.392  1.00 2.00   ? 29  GLY A CA  1 
ATOM   185  C C   . GLY A 1 29  ? 44.106  40.990 99.125  1.00 3.89   ? 29  GLY A C   1 
ATOM   186  O O   . GLY A 1 29  ? 43.721  41.208 97.983  1.00 13.54  ? 29  GLY A O   1 
ATOM   187  N N   . ALA A 1 30  ? 43.609  41.625 100.182 1.00 7.47   ? 30  ALA A N   1 
ATOM   188  C CA  . ALA A 1 30  ? 42.591  42.657 100.047 1.00 5.49   ? 30  ALA A CA  1 
ATOM   189  C C   . ALA A 1 30  ? 43.174  43.827 99.273  1.00 7.85   ? 30  ALA A C   1 
ATOM   190  O O   . ALA A 1 30  ? 42.509  44.402 98.414  1.00 29.54  ? 30  ALA A O   1 
ATOM   191  C CB  . ALA A 1 30  ? 42.125  43.109 101.386 1.00 2.00   ? 30  ALA A CB  1 
ATOM   192  N N   . ALA A 1 31  ? 44.414  44.178 99.587  1.00 12.61  ? 31  ALA A N   1 
ATOM   193  C CA  . ALA A 1 31  ? 45.108  45.262 98.901  1.00 14.83  ? 31  ALA A CA  1 
ATOM   194  C C   . ALA A 1 31  ? 45.260  44.908 97.420  1.00 17.18  ? 31  ALA A C   1 
ATOM   195  O O   . ALA A 1 31  ? 44.995  45.732 96.549  1.00 20.51  ? 31  ALA A O   1 
ATOM   196  C CB  . ALA A 1 31  ? 46.465  45.487 99.519  1.00 2.00   ? 31  ALA A CB  1 
ATOM   197  N N   . LEU A 1 32  ? 45.678  43.674 97.146  1.00 19.42  ? 32  LEU A N   1 
ATOM   198  C CA  . LEU A 1 32  ? 45.844  43.189 95.781  1.00 3.57   ? 32  LEU A CA  1 
ATOM   199  C C   . LEU A 1 32  ? 44.498  43.263 95.056  1.00 17.23  ? 32  LEU A C   1 
ATOM   200  O O   . LEU A 1 32  ? 44.395  43.859 93.998  1.00 16.07  ? 32  LEU A O   1 
ATOM   201  C CB  . LEU A 1 32  ? 46.356  41.764 95.796  1.00 2.00   ? 32  LEU A CB  1 
ATOM   202  C CG  . LEU A 1 32  ? 46.411  41.079 94.441  1.00 2.38   ? 32  LEU A CG  1 
ATOM   203  C CD1 . LEU A 1 32  ? 47.283  41.871 93.559  1.00 2.00   ? 32  LEU A CD1 1 
ATOM   204  C CD2 . LEU A 1 32  ? 46.916  39.647 94.532  1.00 2.00   ? 32  LEU A CD2 1 
ATOM   205  N N   . GLN A 1 33  ? 43.454  42.717 95.661  1.00 14.17  ? 33  GLN A N   1 
ATOM   206  C CA  . GLN A 1 33  ? 42.148  42.757 95.054  1.00 5.26   ? 33  GLN A CA  1 
ATOM   207  C C   . GLN A 1 33  ? 41.635  44.170 94.842  1.00 4.24   ? 33  GLN A C   1 
ATOM   208  O O   . GLN A 1 33  ? 40.891  44.441 93.907  1.00 22.71  ? 33  GLN A O   1 
ATOM   209  C CB  . GLN A 1 33  ? 41.181  41.947 95.875  1.00 2.00   ? 33  GLN A CB  1 
ATOM   210  C CG  . GLN A 1 33  ? 41.299  40.471 95.613  1.00 11.29  ? 33  GLN A CG  1 
ATOM   211  C CD  . GLN A 1 33  ? 40.517  39.661 96.617  1.00 27.32  ? 33  GLN A CD  1 
ATOM   212  O OE1 . GLN A 1 33  ? 39.824  38.703 96.269  1.00 54.16  ? 33  GLN A OE1 1 
ATOM   213  N NE2 . GLN A 1 33  ? 40.621  40.042 97.877  1.00 19.76  ? 33  GLN A NE2 1 
ATOM   214  N N   . GLU A 1 34  ? 42.043  45.082 95.693  1.00 6.32   ? 34  GLU A N   1 
ATOM   215  C CA  . GLU A 1 34  ? 41.620  46.453 95.533  1.00 11.86  ? 34  GLU A CA  1 
ATOM   216  C C   . GLU A 1 34  ? 42.364  47.005 94.332  1.00 14.61  ? 34  GLU A C   1 
ATOM   217  O O   . GLU A 1 34  ? 41.770  47.567 93.420  1.00 23.83  ? 34  GLU A O   1 
ATOM   218  C CB  . GLU A 1 34  ? 41.977  47.276 96.753  1.00 18.27  ? 34  GLU A CB  1 
ATOM   219  C CG  . GLU A 1 34  ? 41.130  48.525 96.916  1.00 59.53  ? 34  GLU A CG  1 
ATOM   220  C CD  . GLU A 1 34  ? 41.219  49.484 95.729  1.00 79.47  ? 34  GLU A CD  1 
ATOM   221  O OE1 . GLU A 1 34  ? 42.332  49.983 95.451  1.00 82.63  ? 34  GLU A OE1 1 
ATOM   222  O OE2 . GLU A 1 34  ? 40.176  49.737 95.079  1.00 86.29  ? 34  GLU A OE2 1 
ATOM   223  N N   . LYS A 1 35  ? 43.667  46.818 94.309  1.00 5.50   ? 35  LYS A N   1 
ATOM   224  C CA  . LYS A 1 35  ? 44.458  47.310 93.197  1.00 8.29   ? 35  LYS A CA  1 
ATOM   225  C C   . LYS A 1 35  ? 43.912  46.826 91.833  1.00 18.82  ? 35  LYS A C   1 
ATOM   226  O O   . LYS A 1 35  ? 43.666  47.632 90.942  1.00 21.49  ? 35  LYS A O   1 
ATOM   227  C CB  . LYS A 1 35  ? 45.903  46.867 93.371  1.00 11.50  ? 35  LYS A CB  1 
ATOM   228  C CG  . LYS A 1 35  ? 46.914  47.649 92.575  1.00 27.07  ? 35  LYS A CG  1 
ATOM   229  C CD  . LYS A 1 35  ? 47.132  49.047 93.140  1.00 41.60  ? 35  LYS A CD  1 
ATOM   230  C CE  . LYS A 1 35  ? 48.180  49.802 92.322  1.00 51.41  ? 35  LYS A CE  1 
ATOM   231  N NZ  . LYS A 1 35  ? 48.353  51.231 92.720  1.00 67.30  ? 35  LYS A NZ  1 
ATOM   232  N N   . LEU A 1 36  ? 43.700  45.521 91.684  1.00 17.04  ? 36  LEU A N   1 
ATOM   233  C CA  . LEU A 1 36  ? 43.181  44.950 90.447  1.00 2.00   ? 36  LEU A CA  1 
ATOM   234  C C   . LEU A 1 36  ? 41.840  45.565 90.080  1.00 7.30   ? 36  LEU A C   1 
ATOM   235  O O   . LEU A 1 36  ? 41.539  45.755 88.908  1.00 27.03  ? 36  LEU A O   1 
ATOM   236  C CB  . LEU A 1 36  ? 43.005  43.445 90.582  1.00 2.00   ? 36  LEU A CB  1 
ATOM   237  C CG  . LEU A 1 36  ? 44.268  42.605 90.665  1.00 2.00   ? 36  LEU A CG  1 
ATOM   238  C CD1 . LEU A 1 36  ? 43.969  41.292 91.277  1.00 7.99   ? 36  LEU A CD1 1 
ATOM   239  C CD2 . LEU A 1 36  ? 44.815  42.390 89.325  1.00 2.00   ? 36  LEU A CD2 1 
ATOM   240  N N   . CYS A 1 37  ? 41.008  45.854 91.061  1.00 3.69   ? 37  CYS A N   1 
ATOM   241  C CA  . CYS A 1 37  ? 39.743  46.459 90.729  1.00 13.52  ? 37  CYS A CA  1 
ATOM   242  C C   . CYS A 1 37  ? 39.916  47.929 90.370  1.00 11.90  ? 37  CYS A C   1 
ATOM   243  O O   . CYS A 1 37  ? 39.259  48.432 89.482  1.00 25.18  ? 37  CYS A O   1 
ATOM   244  C CB  . CYS A 1 37  ? 38.741  46.292 91.860  1.00 5.69   ? 37  CYS A CB  1 
ATOM   245  S SG  . CYS A 1 37  ? 37.206  47.274 91.689  1.00 48.92  ? 37  CYS A SG  1 
ATOM   246  N N   . ALA A 1 38  ? 40.855  48.605 90.997  1.00 16.45  ? 38  ALA A N   1 
ATOM   247  C CA  . ALA A 1 38  ? 41.053  50.018 90.711  1.00 22.15  ? 38  ALA A CA  1 
ATOM   248  C C   . ALA A 1 38  ? 41.743  50.234 89.383  1.00 28.29  ? 38  ALA A C   1 
ATOM   249  O O   . ALA A 1 38  ? 41.367  51.080 88.568  1.00 42.34  ? 38  ALA A O   1 
ATOM   250  C CB  . ALA A 1 38  ? 41.875  50.645 91.802  1.00 26.96  ? 38  ALA A CB  1 
ATOM   251  N N   . THR A 1 39  ? 42.781  49.459 89.186  1.00 24.09  ? 39  THR A N   1 
ATOM   252  C CA  . THR A 1 39  ? 43.599  49.548 88.010  1.00 19.84  ? 39  THR A CA  1 
ATOM   253  C C   . THR A 1 39  ? 43.006  48.922 86.745  1.00 20.80  ? 39  THR A C   1 
ATOM   254  O O   . THR A 1 39  ? 43.226  49.428 85.654  1.00 39.12  ? 39  THR A O   1 
ATOM   255  C CB  . THR A 1 39  ? 44.960  48.918 88.350  1.00 24.38  ? 39  THR A CB  1 
ATOM   256  O OG1 . THR A 1 39  ? 45.398  49.425 89.618  1.00 31.36  ? 39  THR A OG1 1 
ATOM   257  C CG2 . THR A 1 39  ? 46.006  49.236 87.296  1.00 26.80  ? 39  THR A CG2 1 
ATOM   258  N N   . TYR A 1 40  ? 42.220  47.865 86.888  1.00 9.34   ? 40  TYR A N   1 
ATOM   259  C CA  . TYR A 1 40  ? 41.674  47.177 85.737  1.00 6.17   ? 40  TYR A CA  1 
ATOM   260  C C   . TYR A 1 40  ? 40.190  46.889 85.826  1.00 17.01  ? 40  TYR A C   1 
ATOM   261  O O   . TYR A 1 40  ? 39.704  45.968 85.178  1.00 21.76  ? 40  TYR A O   1 
ATOM   262  C CB  . TYR A 1 40  ? 42.367  45.833 85.580  1.00 2.00   ? 40  TYR A CB  1 
ATOM   263  C CG  . TYR A 1 40  ? 43.851  45.930 85.471  1.00 13.86  ? 40  TYR A CG  1 
ATOM   264  C CD1 . TYR A 1 40  ? 44.442  46.850 84.624  1.00 17.74  ? 40  TYR A CD1 1 
ATOM   265  C CD2 . TYR A 1 40  ? 44.669  45.099 86.208  1.00 9.73   ? 40  TYR A CD2 1 
ATOM   266  C CE1 . TYR A 1 40  ? 45.823  46.948 84.515  1.00 32.96  ? 40  TYR A CE1 1 
ATOM   267  C CE2 . TYR A 1 40  ? 46.052  45.184 86.113  1.00 21.23  ? 40  TYR A CE2 1 
ATOM   268  C CZ  . TYR A 1 40  ? 46.630  46.120 85.265  1.00 28.30  ? 40  TYR A CZ  1 
ATOM   269  O OH  . TYR A 1 40  ? 48.006  46.289 85.196  1.00 29.15  ? 40  TYR A OH  1 
ATOM   270  N N   . LYS A 1 41  ? 39.469  47.637 86.644  1.00 19.52  ? 41  LYS A N   1 
ATOM   271  C CA  . LYS A 1 41  ? 38.036  47.421 86.817  1.00 13.69  ? 41  LYS A CA  1 
ATOM   272  C C   . LYS A 1 41  ? 37.566  45.960 86.786  1.00 8.72   ? 41  LYS A C   1 
ATOM   273  O O   . LYS A 1 41  ? 36.448  45.658 86.373  1.00 20.52  ? 41  LYS A O   1 
ATOM   274  C CB  . LYS A 1 41  ? 37.231  48.312 85.880  1.00 16.90  ? 41  LYS A CB  1 
ATOM   275  C CG  . LYS A 1 41  ? 37.357  49.802 86.207  1.00 38.99  ? 41  LYS A CG  1 
ATOM   276  C CD  . LYS A 1 41  ? 35.986  50.481 86.245  1.00 61.97  ? 41  LYS A CD  1 
ATOM   277  C CE  . LYS A 1 41  ? 35.074  49.849 87.304  1.00 73.98  ? 41  LYS A CE  1 
ATOM   278  N NZ  . LYS A 1 41  ? 33.673  50.381 87.273  1.00 90.30  ? 41  LYS A NZ  1 
ATOM   279  N N   . LEU A 1 42  ? 38.442  45.068 87.248  1.00 15.38  ? 42  LEU A N   1 
ATOM   280  C CA  . LEU A 1 42  ? 38.192  43.619 87.387  1.00 19.38  ? 42  LEU A CA  1 
ATOM   281  C C   . LEU A 1 42  ? 37.804  43.466 88.872  1.00 20.54  ? 42  LEU A C   1 
ATOM   282  O O   . LEU A 1 42  ? 38.618  43.102 89.704  1.00 27.27  ? 42  LEU A O   1 
ATOM   283  C CB  . LEU A 1 42  ? 39.489  42.858 87.125  1.00 6.50   ? 42  LEU A CB  1 
ATOM   284  C CG  . LEU A 1 42  ? 39.819  42.375 85.725  1.00 17.34  ? 42  LEU A CG  1 
ATOM   285  C CD1 . LEU A 1 42  ? 41.279  42.027 85.626  1.00 25.39  ? 42  LEU A CD1 1 
ATOM   286  C CD2 . LEU A 1 42  ? 38.971  41.164 85.442  1.00 21.04  ? 42  LEU A CD2 1 
ATOM   287  N N   . CYS A 1 43  ? 36.548  43.715 89.195  1.00 15.38  ? 43  CYS A N   1 
ATOM   288  C CA  . CYS A 1 43  ? 36.143  43.721 90.581  1.00 13.29  ? 43  CYS A CA  1 
ATOM   289  C C   . CYS A 1 43  ? 35.354  42.579 91.184  1.00 26.70  ? 43  CYS A C   1 
ATOM   290  O O   . CYS A 1 43  ? 35.243  42.497 92.400  1.00 43.57  ? 43  CYS A O   1 
ATOM   291  C CB  . CYS A 1 43  ? 35.366  45.006 90.831  1.00 16.45  ? 43  CYS A CB  1 
ATOM   292  S SG  . CYS A 1 43  ? 36.166  46.468 90.127  1.00 46.16  ? 43  CYS A SG  1 
ATOM   293  N N   . HIS A 1 44  ? 34.789  41.708 90.365  1.00 31.16  ? 44  HIS A N   1 
ATOM   294  C CA  . HIS A 1 44  ? 33.955  40.638 90.903  1.00 25.40  ? 44  HIS A CA  1 
ATOM   295  C C   . HIS A 1 44  ? 34.453  39.279 90.436  1.00 24.70  ? 44  HIS A C   1 
ATOM   296  O O   . HIS A 1 44  ? 34.165  38.860 89.318  1.00 33.30  ? 44  HIS A O   1 
ATOM   297  C CB  . HIS A 1 44  ? 32.478  40.836 90.464  1.00 28.77  ? 44  HIS A CB  1 
ATOM   298  C CG  . HIS A 1 44  ? 32.008  42.269 90.466  1.00 46.08  ? 44  HIS A CG  1 
ATOM   299  N ND1 . HIS A 1 44  ? 32.585  43.252 89.686  1.00 63.77  ? 44  HIS A ND1 1 
ATOM   300  C CD2 . HIS A 1 44  ? 30.995  42.873 91.133  1.00 48.07  ? 44  HIS A CD2 1 
ATOM   301  C CE1 . HIS A 1 44  ? 31.951  44.397 89.874  1.00 62.21  ? 44  HIS A CE1 1 
ATOM   302  N NE2 . HIS A 1 44  ? 30.982  44.194 90.747  1.00 58.50  ? 44  HIS A NE2 1 
ATOM   303  N N   . PRO A 1 45  ? 35.164  38.545 91.301  1.00 20.62  ? 45  PRO A N   1 
ATOM   304  C CA  . PRO A 1 45  ? 35.694  37.220 90.950  1.00 17.21  ? 45  PRO A CA  1 
ATOM   305  C C   . PRO A 1 45  ? 34.668  36.258 90.405  1.00 17.94  ? 45  PRO A C   1 
ATOM   306  O O   . PRO A 1 45  ? 34.999  35.378 89.626  1.00 17.47  ? 45  PRO A O   1 
ATOM   307  C CB  . PRO A 1 45  ? 36.265  36.706 92.277  1.00 15.61  ? 45  PRO A CB  1 
ATOM   308  C CG  . PRO A 1 45  ? 35.534  37.463 93.304  1.00 21.64  ? 45  PRO A CG  1 
ATOM   309  C CD  . PRO A 1 45  ? 35.456  38.855 92.704  1.00 19.87  ? 45  PRO A CD  1 
ATOM   310  N N   . GLU A 1 46  ? 33.423  36.422 90.838  1.00 29.35  ? 46  GLU A N   1 
ATOM   311  C CA  . GLU A 1 46  ? 32.321  35.566 90.415  1.00 36.06  ? 46  GLU A CA  1 
ATOM   312  C C   . GLU A 1 46  ? 32.235  35.564 88.906  1.00 38.35  ? 46  GLU A C   1 
ATOM   313  O O   . GLU A 1 46  ? 32.067  34.523 88.277  1.00 39.50  ? 46  GLU A O   1 
ATOM   314  C CB  . GLU A 1 46  ? 31.007  36.074 90.994  1.00 49.95  ? 46  GLU A CB  1 
ATOM   315  C CG  . GLU A 1 46  ? 30.913  36.001 92.522  1.00 92.51  ? 46  GLU A CG  1 
ATOM   316  C CD  . GLU A 1 46  ? 31.906  36.913 93.249  1.00 106.11 ? 46  GLU A CD  1 
ATOM   317  O OE1 . GLU A 1 46  ? 31.993  38.118 92.899  1.00 109.39 ? 46  GLU A OE1 1 
ATOM   318  O OE2 . GLU A 1 46  ? 32.594  36.413 94.174  1.00 115.01 ? 46  GLU A OE2 1 
ATOM   319  N N   . GLU A 1 47  ? 32.410  36.743 88.328  1.00 33.59  ? 47  GLU A N   1 
ATOM   320  C CA  . GLU A 1 47  ? 32.358  36.903 86.891  1.00 19.05  ? 47  GLU A CA  1 
ATOM   321  C C   . GLU A 1 47  ? 33.416  36.043 86.231  1.00 18.53  ? 47  GLU A C   1 
ATOM   322  O O   . GLU A 1 47  ? 33.218  35.552 85.142  1.00 30.04  ? 47  GLU A O   1 
ATOM   323  C CB  . GLU A 1 47  ? 32.541  38.384 86.512  1.00 5.80   ? 47  GLU A CB  1 
ATOM   324  C CG  . GLU A 1 47  ? 31.470  39.287 87.133  1.00 27.98  ? 47  GLU A CG  1 
ATOM   325  C CD  . GLU A 1 47  ? 31.614  40.777 86.811  1.00 37.90  ? 47  GLU A CD  1 
ATOM   326  O OE1 . GLU A 1 47  ? 32.728  41.261 86.486  1.00 34.28  ? 47  GLU A OE1 1 
ATOM   327  O OE2 . GLU A 1 47  ? 30.586  41.477 86.925  1.00 43.15  ? 47  GLU A OE2 1 
ATOM   328  N N   . LEU A 1 48  ? 34.518  35.797 86.919  1.00 28.75  ? 48  LEU A N   1 
ATOM   329  C CA  . LEU A 1 48  ? 35.607  35.027 86.341  1.00 21.13  ? 48  LEU A CA  1 
ATOM   330  C C   . LEU A 1 48  ? 35.562  33.558 86.686  1.00 20.94  ? 48  LEU A C   1 
ATOM   331  O O   . LEU A 1 48  ? 36.396  32.766 86.229  1.00 18.06  ? 48  LEU A O   1 
ATOM   332  C CB  . LEU A 1 48  ? 36.931  35.627 86.799  1.00 17.33  ? 48  LEU A CB  1 
ATOM   333  C CG  . LEU A 1 48  ? 37.072  37.062 86.311  1.00 11.53  ? 48  LEU A CG  1 
ATOM   334  C CD1 . LEU A 1 48  ? 38.391  37.683 86.745  1.00 14.76  ? 48  LEU A CD1 1 
ATOM   335  C CD2 . LEU A 1 48  ? 36.959  37.018 84.807  1.00 2.00   ? 48  LEU A CD2 1 
ATOM   336  N N   . VAL A 1 49  ? 34.568  33.183 87.472  1.00 25.83  ? 49  VAL A N   1 
ATOM   337  C CA  . VAL A 1 49  ? 34.432  31.799 87.910  1.00 35.17  ? 49  VAL A CA  1 
ATOM   338  C C   . VAL A 1 49  ? 34.852  30.712 86.912  1.00 26.48  ? 49  VAL A C   1 
ATOM   339  O O   . VAL A 1 49  ? 35.731  29.906 87.199  1.00 32.51  ? 49  VAL A O   1 
ATOM   340  C CB  . VAL A 1 49  ? 33.013  31.531 88.450  1.00 46.86  ? 49  VAL A CB  1 
ATOM   341  C CG1 . VAL A 1 49  ? 32.695  30.034 88.421  1.00 41.99  ? 49  VAL A CG1 1 
ATOM   342  C CG2 . VAL A 1 49  ? 32.905  32.081 89.887  1.00 57.06  ? 49  VAL A CG2 1 
ATOM   343  N N   . LEU A 1 50  ? 34.263  30.705 85.731  1.00 30.16  ? 50  LEU A N   1 
ATOM   344  C CA  . LEU A 1 50  ? 34.598  29.687 84.734  1.00 28.74  ? 50  LEU A CA  1 
ATOM   345  C C   . LEU A 1 50  ? 36.053  29.587 84.296  1.00 36.05  ? 50  LEU A C   1 
ATOM   346  O O   . LEU A 1 50  ? 36.475  28.532 83.829  1.00 29.59  ? 50  LEU A O   1 
ATOM   347  C CB  . LEU A 1 50  ? 33.743  29.838 83.480  1.00 32.92  ? 50  LEU A CB  1 
ATOM   348  C CG  . LEU A 1 50  ? 32.268  29.477 83.604  1.00 39.47  ? 50  LEU A CG  1 
ATOM   349  C CD1 . LEU A 1 50  ? 31.599  29.592 82.249  1.00 35.23  ? 50  LEU A CD1 1 
ATOM   350  C CD2 . LEU A 1 50  ? 32.138  28.072 84.123  1.00 28.10  ? 50  LEU A CD2 1 
ATOM   351  N N   . LEU A 1 51  ? 36.827  30.663 84.424  1.00 38.15  ? 51  LEU A N   1 
ATOM   352  C CA  . LEU A 1 51  ? 38.221  30.612 83.993  1.00 31.85  ? 51  LEU A CA  1 
ATOM   353  C C   . LEU A 1 51  ? 39.126  29.804 84.913  1.00 28.13  ? 51  LEU A C   1 
ATOM   354  O O   . LEU A 1 51  ? 40.254  29.476 84.552  1.00 28.88  ? 51  LEU A O   1 
ATOM   355  C CB  . LEU A 1 51  ? 38.770  32.012 83.732  1.00 39.15  ? 51  LEU A CB  1 
ATOM   356  C CG  . LEU A 1 51  ? 38.558  32.594 82.318  1.00 44.14  ? 51  LEU A CG  1 
ATOM   357  C CD1 . LEU A 1 51  ? 37.139  32.379 81.804  1.00 51.53  ? 51  LEU A CD1 1 
ATOM   358  C CD2 . LEU A 1 51  ? 38.872  34.077 82.336  1.00 48.78  ? 51  LEU A CD2 1 
ATOM   359  N N   . GLY A 1 52  ? 38.606  29.426 86.076  1.00 23.23  ? 52  GLY A N   1 
ATOM   360  C CA  . GLY A 1 52  ? 39.380  28.629 87.008  1.00 15.54  ? 52  GLY A CA  1 
ATOM   361  C C   . GLY A 1 52  ? 39.655  27.257 86.425  1.00 31.04  ? 52  GLY A C   1 
ATOM   362  O O   . GLY A 1 52  ? 40.760  26.722 86.548  1.00 40.58  ? 52  GLY A O   1 
ATOM   363  N N   . HIS A 1 53  ? 38.634  26.667 85.810  1.00 25.79  ? 53  HIS A N   1 
ATOM   364  C CA  . HIS A 1 53  ? 38.788  25.358 85.211  1.00 17.29  ? 53  HIS A CA  1 
ATOM   365  C C   . HIS A 1 53  ? 39.614  25.554 83.947  1.00 23.31  ? 53  HIS A C   1 
ATOM   366  O O   . HIS A 1 53  ? 40.591  24.856 83.719  1.00 28.12  ? 53  HIS A O   1 
ATOM   367  C CB  . HIS A 1 53  ? 37.426  24.759 84.867  1.00 14.91  ? 53  HIS A CB  1 
ATOM   368  C CG  . HIS A 1 53  ? 36.637  24.299 86.052  1.00 21.66  ? 53  HIS A CG  1 
ATOM   369  N ND1 . HIS A 1 53  ? 35.547  24.989 86.538  1.00 39.51  ? 53  HIS A ND1 1 
ATOM   370  C CD2 . HIS A 1 53  ? 36.786  23.222 86.861  1.00 46.93  ? 53  HIS A CD2 1 
ATOM   371  C CE1 . HIS A 1 53  ? 35.065  24.365 87.600  1.00 42.29  ? 53  HIS A CE1 1 
ATOM   372  N NE2 . HIS A 1 53  ? 35.799  23.289 87.817  1.00 53.46  ? 53  HIS A NE2 1 
ATOM   373  N N   . SER A 1 54  ? 39.252  26.564 83.166  1.00 28.83  ? 54  SER A N   1 
ATOM   374  C CA  . SER A 1 54  ? 39.928  26.869 81.910  1.00 31.06  ? 54  SER A CA  1 
ATOM   375  C C   . SER A 1 54  ? 41.426  27.090 82.083  1.00 38.63  ? 54  SER A C   1 
ATOM   376  O O   . SER A 1 54  ? 42.221  26.650 81.254  1.00 53.06  ? 54  SER A O   1 
ATOM   377  C CB  . SER A 1 54  ? 39.285  28.107 81.267  1.00 31.64  ? 54  SER A CB  1 
ATOM   378  O OG  . SER A 1 54  ? 39.910  28.496 80.049  1.00 53.46  ? 54  SER A OG  1 
ATOM   379  N N   . LEU A 1 55  ? 41.813  27.764 83.161  1.00 38.86  ? 55  LEU A N   1 
ATOM   380  C CA  . LEU A 1 55  ? 43.218  28.061 83.404  1.00 31.47  ? 55  LEU A CA  1 
ATOM   381  C C   . LEU A 1 55  ? 43.897  27.032 84.247  1.00 32.20  ? 55  LEU A C   1 
ATOM   382  O O   . LEU A 1 55  ? 45.126  26.972 84.277  1.00 31.05  ? 55  LEU A O   1 
ATOM   383  C CB  . LEU A 1 55  ? 43.365  29.422 84.041  1.00 19.96  ? 55  LEU A CB  1 
ATOM   384  C CG  . LEU A 1 55  ? 42.944  30.496 83.057  1.00 13.59  ? 55  LEU A CG  1 
ATOM   385  C CD1 . LEU A 1 55  ? 42.867  31.813 83.749  1.00 5.95   ? 55  LEU A CD1 1 
ATOM   386  C CD2 . LEU A 1 55  ? 43.931  30.543 81.926  1.00 16.66  ? 55  LEU A CD2 1 
ATOM   387  N N   . GLY A 1 56  ? 43.085  26.243 84.942  1.00 27.91  ? 56  GLY A N   1 
ATOM   388  C CA  . GLY A 1 56  ? 43.599  25.182 85.779  1.00 28.44  ? 56  GLY A CA  1 
ATOM   389  C C   . GLY A 1 56  ? 43.994  25.615 87.162  1.00 34.24  ? 56  GLY A C   1 
ATOM   390  O O   . GLY A 1 56  ? 44.847  24.990 87.779  1.00 45.42  ? 56  GLY A O   1 
ATOM   391  N N   . ILE A 1 57  ? 43.373  26.680 87.649  1.00 30.04  ? 57  ILE A N   1 
ATOM   392  C CA  . ILE A 1 57  ? 43.658  27.191 88.981  1.00 25.34  ? 57  ILE A CA  1 
ATOM   393  C C   . ILE A 1 57  ? 43.349  26.125 90.007  1.00 35.35  ? 57  ILE A C   1 
ATOM   394  O O   . ILE A 1 57  ? 42.177  25.785 90.219  1.00 42.20  ? 57  ILE A O   1 
ATOM   395  C CB  . ILE A 1 57  ? 42.795  28.420 89.315  1.00 16.42  ? 57  ILE A CB  1 
ATOM   396  C CG1 . ILE A 1 57  ? 43.420  29.660 88.721  1.00 18.49  ? 57  ILE A CG1 1 
ATOM   397  C CG2 . ILE A 1 57  ? 42.681  28.615 90.810  1.00 10.15  ? 57  ILE A CG2 1 
ATOM   398  C CD1 . ILE A 1 57  ? 43.855  29.467 87.298  1.00 42.53  ? 57  ILE A CD1 1 
ATOM   399  N N   . PRO A 1 58  ? 44.391  25.565 90.643  1.00 37.39  ? 58  PRO A N   1 
ATOM   400  C CA  . PRO A 1 58  ? 44.185  24.531 91.661  1.00 43.95  ? 58  PRO A CA  1 
ATOM   401  C C   . PRO A 1 58  ? 43.362  25.000 92.884  1.00 48.88  ? 58  PRO A C   1 
ATOM   402  O O   . PRO A 1 58  ? 43.137  26.198 93.118  1.00 52.13  ? 58  PRO A O   1 
ATOM   403  C CB  . PRO A 1 58  ? 45.620  24.129 92.043  1.00 35.39  ? 58  PRO A CB  1 
ATOM   404  C CG  . PRO A 1 58  ? 46.398  24.384 90.786  1.00 36.96  ? 58  PRO A CG  1 
ATOM   405  C CD  . PRO A 1 58  ? 45.824  25.711 90.328  1.00 33.46  ? 58  PRO A CD  1 
ATOM   406  N N   . TRP A 1 59  ? 42.866  24.026 93.629  1.00 56.58  ? 59  TRP A N   1 
ATOM   407  C CA  . TRP A 1 59  ? 42.089  24.297 94.814  1.00 61.02  ? 59  TRP A CA  1 
ATOM   408  C C   . TRP A 1 59  ? 42.852  23.585 95.940  1.00 56.39  ? 59  TRP A C   1 
ATOM   409  O O   . TRP A 1 59  ? 43.514  22.562 95.710  1.00 53.30  ? 59  TRP A O   1 
ATOM   410  C CB  . TRP A 1 59  ? 40.639  23.779 94.619  1.00 76.54  ? 59  TRP A CB  1 
ATOM   411  C CG  . TRP A 1 59  ? 40.194  22.653 95.535  1.00 88.89  ? 59  TRP A CG  1 
ATOM   412  C CD1 . TRP A 1 59  ? 39.278  22.737 96.552  1.00 92.13  ? 59  TRP A CD1 1 
ATOM   413  C CD2 . TRP A 1 59  ? 40.703  21.306 95.566  1.00 93.14  ? 59  TRP A CD2 1 
ATOM   414  N NE1 . TRP A 1 59  ? 39.201  21.535 97.222  1.00 95.62  ? 59  TRP A NE1 1 
ATOM   415  C CE2 . TRP A 1 59  ? 40.065  20.642 96.642  1.00 96.11  ? 59  TRP A CE2 1 
ATOM   416  C CE3 . TRP A 1 59  ? 41.642  20.602 94.796  1.00 90.05  ? 59  TRP A CE3 1 
ATOM   417  C CZ2 . TRP A 1 59  ? 40.342  19.305 96.970  1.00 91.47  ? 59  TRP A CZ2 1 
ATOM   418  C CZ3 . TRP A 1 59  ? 41.917  19.274 95.120  1.00 91.44  ? 59  TRP A CZ3 1 
ATOM   419  C CH2 . TRP A 1 59  ? 41.268  18.641 96.202  1.00 89.89  ? 59  TRP A CH2 1 
ATOM   420  N N   . ALA A 1 60  ? 42.870  24.204 97.115  1.00 48.35  ? 60  ALA A N   1 
ATOM   421  C CA  . ALA A 1 60  ? 43.532  23.628 98.275  1.00 22.16  ? 60  ALA A CA  1 
ATOM   422  C C   . ALA A 1 60  ? 42.436  23.307 99.278  1.00 21.99  ? 60  ALA A C   1 
ATOM   423  O O   . ALA A 1 60  ? 41.688  24.187 99.725  1.00 22.31  ? 60  ALA A O   1 
ATOM   424  C CB  . ALA A 1 60  ? 44.504  24.597 98.857  1.00 29.42  ? 60  ALA A CB  1 
ATOM   425  N N   . PRO A 1 61  ? 42.297  22.026 99.607  1.00 18.06  ? 61  PRO A N   1 
ATOM   426  C CA  . PRO A 1 61  ? 41.315  21.469 100.540 1.00 21.43  ? 61  PRO A CA  1 
ATOM   427  C C   . PRO A 1 61  ? 41.728  21.607 102.009 1.00 24.57  ? 61  PRO A C   1 
ATOM   428  O O   . PRO A 1 61  ? 42.900  21.820 102.302 1.00 39.23  ? 61  PRO A O   1 
ATOM   429  C CB  . PRO A 1 61  ? 41.323  20.003 100.149 1.00 14.13  ? 61  PRO A CB  1 
ATOM   430  C CG  . PRO A 1 61  ? 42.799  19.770 99.905  1.00 2.00   ? 61  PRO A CG  1 
ATOM   431  C CD  . PRO A 1 61  ? 43.189  20.974 99.083  1.00 7.49   ? 61  PRO A CD  1 
ATOM   432  N N   . LEU A 1 62  ? 40.779  21.446 102.928 1.00 29.07  ? 62  LEU A N   1 
ATOM   433  C CA  . LEU A 1 62  ? 41.079  21.493 104.366 1.00 23.05  ? 62  LEU A CA  1 
ATOM   434  C C   . LEU A 1 62  ? 40.263  20.439 105.131 1.00 29.09  ? 62  LEU A C   1 
ATOM   435  O O   . LEU A 1 62  ? 40.020  20.564 106.333 1.00 41.91  ? 62  LEU A O   1 
ATOM   436  C CB  . LEU A 1 62  ? 40.833  22.887 104.944 1.00 17.82  ? 62  LEU A CB  1 
ATOM   437  C CG  . LEU A 1 62  ? 41.843  23.998 104.630 1.00 12.17  ? 62  LEU A CG  1 
ATOM   438  C CD1 . LEU A 1 62  ? 41.177  25.315 104.821 1.00 27.81  ? 62  LEU A CD1 1 
ATOM   439  C CD2 . LEU A 1 62  ? 43.056  23.932 105.501 1.00 12.60  ? 62  LEU A CD2 1 
ATOM   440  N N   . SER A 1 63  ? 39.926  19.364 104.424 1.00 36.76  ? 63  SER A N   1 
ATOM   441  C CA  . SER A 1 63  ? 39.140  18.236 104.920 1.00 41.52  ? 63  SER A CA  1 
ATOM   442  C C   . SER A 1 63  ? 39.489  17.692 106.306 1.00 42.74  ? 63  SER A C   1 
ATOM   443  O O   . SER A 1 63  ? 38.615  17.168 107.025 1.00 44.38  ? 63  SER A O   1 
ATOM   444  C CB  . SER A 1 63  ? 39.249  17.090 103.914 1.00 48.53  ? 63  SER A CB  1 
ATOM   445  O OG  . SER A 1 63  ? 38.880  17.523 102.616 1.00 60.31  ? 63  SER A OG  1 
ATOM   446  N N   . SER A 1 64  ? 40.741  17.872 106.706 1.00 31.30  ? 64  SER A N   1 
ATOM   447  C CA  . SER A 1 64  ? 41.197  17.340 107.969 1.00 26.18  ? 64  SER A CA  1 
ATOM   448  C C   . SER A 1 64  ? 41.278  18.265 109.158 1.00 32.55  ? 64  SER A C   1 
ATOM   449  O O   . SER A 1 64  ? 42.061  17.996 110.063 1.00 29.03  ? 64  SER A O   1 
ATOM   450  C CB  . SER A 1 64  ? 42.548  16.700 107.746 1.00 18.42  ? 64  SER A CB  1 
ATOM   451  O OG  . SER A 1 64  ? 42.546  16.054 106.490 1.00 29.62  ? 64  SER A OG  1 
ATOM   452  N N   . CYS A 1 65  ? 40.439  19.296 109.223 1.00 39.81  ? 65  CYS A N   1 
ATOM   453  C CA  . CYS A 1 65  ? 40.534  20.203 110.356 1.00 52.00  ? 65  CYS A CA  1 
ATOM   454  C C   . CYS A 1 65  ? 39.394  20.342 111.401 1.00 65.87  ? 65  CYS A C   1 
ATOM   455  O O   . CYS A 1 65  ? 39.669  20.624 112.579 1.00 69.44  ? 65  CYS A O   1 
ATOM   456  C CB  . CYS A 1 65  ? 41.107  21.548 109.887 1.00 45.07  ? 65  CYS A CB  1 
ATOM   457  S SG  . CYS A 1 65  ? 42.820  21.443 109.195 1.00 46.86  ? 65  CYS A SG  1 
ATOM   458  N N   . PRO A 1 66  ? 38.119  20.097 111.018 1.00 73.86  ? 66  PRO A N   1 
ATOM   459  C CA  . PRO A 1 66  ? 37.062  20.229 112.031 1.00 85.31  ? 66  PRO A CA  1 
ATOM   460  C C   . PRO A 1 66  ? 36.882  18.938 112.829 1.00 100.19 ? 66  PRO A C   1 
ATOM   461  O O   . PRO A 1 66  ? 36.050  18.877 113.747 1.00 103.21 ? 66  PRO A O   1 
ATOM   462  C CB  . PRO A 1 66  ? 35.824  20.498 111.183 1.00 77.88  ? 66  PRO A CB  1 
ATOM   463  C CG  . PRO A 1 66  ? 36.063  19.612 110.009 1.00 77.01  ? 66  PRO A CG  1 
ATOM   464  C CD  . PRO A 1 66  ? 37.525  19.891 109.683 1.00 75.74  ? 66  PRO A CD  1 
ATOM   465  N N   . SER A 1 67  ? 37.683  17.925 112.487 1.00 113.37 ? 67  SER A N   1 
ATOM   466  C CA  . SER A 1 67  ? 37.600  16.608 113.115 1.00 123.55 ? 67  SER A CA  1 
ATOM   467  C C   . SER A 1 67  ? 38.798  16.056 113.922 1.00 124.38 ? 67  SER A C   1 
ATOM   468  O O   . SER A 1 67  ? 39.022  14.841 113.936 1.00 121.42 ? 67  SER A O   1 
ATOM   469  C CB  . SER A 1 67  ? 37.151  15.578 112.062 1.00 126.65 ? 67  SER A CB  1 
ATOM   470  O OG  . SER A 1 67  ? 35.870  15.903 111.531 1.00 132.02 ? 67  SER A OG  1 
ATOM   471  N N   . GLN A 1 68  ? 39.554  16.927 114.596 1.00 124.77 ? 68  GLN A N   1 
ATOM   472  C CA  . GLN A 1 68  ? 40.682  16.489 115.436 1.00 123.01 ? 68  GLN A CA  1 
ATOM   473  C C   . GLN A 1 68  ? 41.299  17.596 116.308 1.00 125.15 ? 68  GLN A C   1 
ATOM   474  O O   . GLN A 1 68  ? 41.362  18.750 115.874 1.00 126.33 ? 68  GLN A O   1 
ATOM   475  C CB  . GLN A 1 68  ? 41.745  15.768 114.611 1.00 113.67 ? 68  GLN A CB  1 
ATOM   476  C CG  . GLN A 1 68  ? 42.245  16.502 113.400 1.00 103.59 ? 68  GLN A CG  1 
ATOM   477  C CD  . GLN A 1 68  ? 43.068  15.580 112.509 1.00 103.06 ? 68  GLN A CD  1 
ATOM   478  O OE1 . GLN A 1 68  ? 44.280  15.767 112.334 1.00 95.94  ? 68  GLN A OE1 1 
ATOM   479  N NE2 . GLN A 1 68  ? 42.415  14.562 111.953 1.00 99.83  ? 68  GLN A NE2 1 
ATOM   480  N N   . ALA A 1 69  ? 41.740  17.230 117.527 1.00 121.73 ? 69  ALA A N   1 
ATOM   481  C CA  . ALA A 1 69  ? 42.317  18.175 118.520 1.00 112.59 ? 69  ALA A CA  1 
ATOM   482  C C   . ALA A 1 69  ? 43.745  17.944 119.073 1.00 104.91 ? 69  ALA A C   1 
ATOM   483  O O   . ALA A 1 69  ? 44.554  18.876 119.128 1.00 92.14  ? 69  ALA A O   1 
ATOM   484  C CB  . ALA A 1 69  ? 41.344  18.343 119.691 1.00 112.55 ? 69  ALA A CB  1 
ATOM   485  N N   . LEU A 1 70  ? 44.021  16.746 119.584 1.00 103.67 ? 70  LEU A N   1 
ATOM   486  C CA  . LEU A 1 70  ? 45.354  16.443 120.122 1.00 101.75 ? 70  LEU A CA  1 
ATOM   487  C C   . LEU A 1 70  ? 46.186  15.714 119.059 1.00 102.65 ? 70  LEU A C   1 
ATOM   488  O O   . LEU A 1 70  ? 47.395  15.529 119.210 1.00 100.37 ? 70  LEU A O   1 
ATOM   489  C CB  . LEU A 1 70  ? 45.243  15.607 121.407 1.00 97.53  ? 70  LEU A CB  1 
ATOM   490  C CG  . LEU A 1 70  ? 46.383  15.616 122.441 1.00 89.44  ? 70  LEU A CG  1 
ATOM   491  C CD1 . LEU A 1 70  ? 45.831  15.207 123.804 1.00 83.07  ? 70  LEU A CD1 1 
ATOM   492  C CD2 . LEU A 1 70  ? 47.531  14.700 122.029 1.00 86.74  ? 70  LEU A CD2 1 
ATOM   493  N N   . GLN A 1 71  ? 45.512  15.304 117.987 1.00 104.84 ? 71  GLN A N   1 
ATOM   494  C CA  . GLN A 1 71  ? 46.127  14.623 116.845 1.00 100.42 ? 71  GLN A CA  1 
ATOM   495  C C   . GLN A 1 71  ? 45.804  15.531 115.653 1.00 95.55  ? 71  GLN A C   1 
ATOM   496  O O   . GLN A 1 71  ? 44.677  15.512 115.151 1.00 95.79  ? 71  GLN A O   1 
ATOM   497  C CB  . GLN A 1 71  ? 45.499  13.246 116.652 1.00 102.03 ? 71  GLN A CB  1 
ATOM   498  N N   . LEU A 1 72  ? 46.783  16.334 115.226 1.00 82.03  ? 72  LEU A N   1 
ATOM   499  C CA  . LEU A 1 72  ? 46.597  17.300 114.133 1.00 59.18  ? 72  LEU A CA  1 
ATOM   500  C C   . LEU A 1 72  ? 47.680  17.371 113.044 1.00 46.84  ? 72  LEU A C   1 
ATOM   501  O O   . LEU A 1 72  ? 47.749  18.340 112.291 1.00 52.43  ? 72  LEU A O   1 
ATOM   502  C CB  . LEU A 1 72  ? 46.365  18.693 114.733 1.00 41.15  ? 72  LEU A CB  1 
ATOM   503  C CG  . LEU A 1 72  ? 47.151  18.983 116.011 1.00 26.44  ? 72  LEU A CG  1 
ATOM   504  C CD1 . LEU A 1 72  ? 48.613  19.169 115.717 1.00 39.87  ? 72  LEU A CD1 1 
ATOM   505  C CD2 . LEU A 1 72  ? 46.590  20.183 116.701 1.00 33.76  ? 72  LEU A CD2 1 
ATOM   506  N N   . ALA A 1 73  ? 48.497  16.331 112.945 1.00 37.83  ? 73  ALA A N   1 
ATOM   507  C CA  . ALA A 1 73  ? 49.561  16.257 111.955 1.00 30.52  ? 73  ALA A CA  1 
ATOM   508  C C   . ALA A 1 73  ? 48.994  16.470 110.556 1.00 36.09  ? 73  ALA A C   1 
ATOM   509  O O   . ALA A 1 73  ? 49.587  17.147 109.716 1.00 41.76  ? 73  ALA A O   1 
ATOM   510  C CB  . ALA A 1 73  ? 50.230  14.901 112.039 1.00 38.39  ? 73  ALA A CB  1 
ATOM   511  N N   . GLY A 1 74  ? 47.830  15.888 110.314 1.00 38.95  ? 74  GLY A N   1 
ATOM   512  C CA  . GLY A 1 74  ? 47.201  16.023 109.018 1.00 34.46  ? 74  GLY A CA  1 
ATOM   513  C C   . GLY A 1 74  ? 46.727  17.438 108.772 1.00 35.49  ? 74  GLY A C   1 
ATOM   514  O O   . GLY A 1 74  ? 46.928  17.951 107.677 1.00 42.54  ? 74  GLY A O   1 
ATOM   515  N N   . CYS A 1 75  ? 46.161  18.087 109.797 1.00 33.51  ? 75  CYS A N   1 
ATOM   516  C CA  . CYS A 1 75  ? 45.640  19.455 109.668 1.00 19.50  ? 75  CYS A CA  1 
ATOM   517  C C   . CYS A 1 75  ? 46.736  20.469 109.342 1.00 27.18  ? 75  CYS A C   1 
ATOM   518  O O   . CYS A 1 75  ? 46.636  21.203 108.366 1.00 31.14  ? 75  CYS A O   1 
ATOM   519  C CB  . CYS A 1 75  ? 44.858  19.856 110.912 1.00 14.47  ? 75  CYS A CB  1 
ATOM   520  S SG  . CYS A 1 75  ? 44.089  21.491 110.816 1.00 40.22  ? 75  CYS A SG  1 
ATOM   521  N N   . LEU A 1 76  ? 47.806  20.503 110.122 1.00 24.63  ? 76  LEU A N   1 
ATOM   522  C CA  . LEU A 1 76  ? 48.878  21.409 109.790 1.00 18.22  ? 76  LEU A CA  1 
ATOM   523  C C   . LEU A 1 76  ? 49.430  21.066 108.410 1.00 19.55  ? 76  LEU A C   1 
ATOM   524  O O   . LEU A 1 76  ? 49.702  21.953 107.600 1.00 23.21  ? 76  LEU A O   1 
ATOM   525  C CB  . LEU A 1 76  ? 49.975  21.310 110.806 1.00 15.77  ? 76  LEU A CB  1 
ATOM   526  C CG  . LEU A 1 76  ? 49.642  21.938 112.134 1.00 18.16  ? 76  LEU A CG  1 
ATOM   527  C CD1 . LEU A 1 76  ? 50.970  22.201 112.784 1.00 20.32  ? 76  LEU A CD1 1 
ATOM   528  C CD2 . LEU A 1 76  ? 48.875  23.247 111.968 1.00 19.08  ? 76  LEU A CD2 1 
ATOM   529  N N   . SER A 1 77  ? 49.582  19.774 108.143 1.00 22.15  ? 77  SER A N   1 
ATOM   530  C CA  . SER A 1 77  ? 50.081  19.293 106.854 1.00 18.81  ? 77  SER A CA  1 
ATOM   531  C C   . SER A 1 77  ? 49.317  19.903 105.668 1.00 17.77  ? 77  SER A C   1 
ATOM   532  O O   . SER A 1 77  ? 49.928  20.345 104.696 1.00 28.34  ? 77  SER A O   1 
ATOM   533  C CB  . SER A 1 77  ? 50.009  17.774 106.812 1.00 20.51  ? 77  SER A CB  1 
ATOM   534  O OG  . SER A 1 77  ? 50.610  17.270 105.638 1.00 58.20  ? 77  SER A OG  1 
ATOM   535  N N   . GLN A 1 78  ? 47.991  19.981 105.773 1.00 19.99  ? 78  GLN A N   1 
ATOM   536  C CA  . GLN A 1 78  ? 47.155  20.566 104.709 1.00 15.78  ? 78  GLN A CA  1 
ATOM   537  C C   . GLN A 1 78  ? 47.288  22.076 104.639 1.00 12.81  ? 78  GLN A C   1 
ATOM   538  O O   . GLN A 1 78  ? 47.363  22.643 103.548 1.00 16.37  ? 78  GLN A O   1 
ATOM   539  C CB  . GLN A 1 78  ? 45.672  20.251 104.898 1.00 9.54   ? 78  GLN A CB  1 
ATOM   540  C CG  . GLN A 1 78  ? 45.303  18.808 104.730 1.00 26.91  ? 78  GLN A CG  1 
ATOM   541  C CD  . GLN A 1 78  ? 43.857  18.635 104.313 1.00 31.88  ? 78  GLN A CD  1 
ATOM   542  O OE1 . GLN A 1 78  ? 42.925  18.750 105.127 1.00 20.53  ? 78  GLN A OE1 1 
ATOM   543  N NE2 . GLN A 1 78  ? 43.657  18.339 103.031 1.00 59.85  ? 78  GLN A NE2 1 
ATOM   544  N N   . LEU A 1 79  ? 47.266  22.722 105.802 1.00 3.72   ? 79  LEU A N   1 
ATOM   545  C CA  . LEU A 1 79  ? 47.408  24.151 105.878 1.00 2.00   ? 79  LEU A CA  1 
ATOM   546  C C   . LEU A 1 79  ? 48.667  24.460 105.117 1.00 2.00   ? 79  LEU A C   1 
ATOM   547  O O   . LEU A 1 79  ? 48.671  25.293 104.221 1.00 25.66  ? 79  LEU A O   1 
ATOM   548  C CB  . LEU A 1 79  ? 47.560  24.595 107.320 1.00 2.76   ? 79  LEU A CB  1 
ATOM   549  C CG  . LEU A 1 79  ? 46.622  25.692 107.837 1.00 21.27  ? 79  LEU A CG  1 
ATOM   550  C CD1 . LEU A 1 79  ? 47.009  25.960 109.269 1.00 37.50  ? 79  LEU A CD1 1 
ATOM   551  C CD2 . LEU A 1 79  ? 46.717  27.007 107.034 1.00 26.17  ? 79  LEU A CD2 1 
ATOM   552  N N   . HIS A 1 80  ? 49.725  23.725 105.394 1.00 2.00   ? 80  HIS A N   1 
ATOM   553  C CA  . HIS A 1 80  ? 50.956  23.974 104.681 1.00 2.80   ? 80  HIS A CA  1 
ATOM   554  C C   . HIS A 1 80  ? 50.851  23.739 103.198 1.00 12.79  ? 80  HIS A C   1 
ATOM   555  O O   . HIS A 1 80  ? 51.308  24.576 102.429 1.00 25.47  ? 80  HIS A O   1 
ATOM   556  C CB  . HIS A 1 80  ? 52.108  23.139 105.213 1.00 4.57   ? 80  HIS A CB  1 
ATOM   557  C CG  . HIS A 1 80  ? 53.346  23.264 104.389 1.00 2.00   ? 80  HIS A CG  1 
ATOM   558  N ND1 . HIS A 1 80  ? 53.609  22.437 103.321 1.00 21.69  ? 80  HIS A ND1 1 
ATOM   559  C CD2 . HIS A 1 80  ? 54.346  24.174 104.414 1.00 14.43  ? 80  HIS A CD2 1 
ATOM   560  C CE1 . HIS A 1 80  ? 54.716  22.837 102.719 1.00 13.51  ? 80  HIS A CE1 1 
ATOM   561  N NE2 . HIS A 1 80  ? 55.184  23.890 103.363 1.00 10.28  ? 80  HIS A NE2 1 
ATOM   562  N N   . SER A 1 81  ? 50.319  22.591 102.781 1.00 10.72  ? 81  SER A N   1 
ATOM   563  C CA  . SER A 1 81  ? 50.218  22.317 101.344 1.00 13.26  ? 81  SER A CA  1 
ATOM   564  C C   . SER A 1 81  ? 49.484  23.422 100.630 1.00 13.09  ? 81  SER A C   1 
ATOM   565  O O   . SER A 1 81  ? 49.908  23.851 99.554  1.00 24.02  ? 81  SER A O   1 
ATOM   566  C CB  . SER A 1 81  ? 49.523  20.989 101.044 1.00 14.11  ? 81  SER A CB  1 
ATOM   567  O OG  . SER A 1 81  ? 50.328  19.887 101.432 1.00 46.29  ? 81  SER A OG  1 
ATOM   568  N N   . GLY A 1 82  ? 48.416  23.909 101.256 1.00 6.60   ? 82  GLY A N   1 
ATOM   569  C CA  . GLY A 1 82  ? 47.622  24.967 100.664 1.00 3.27   ? 82  GLY A CA  1 
ATOM   570  C C   . GLY A 1 82  ? 48.419  26.236 100.476 1.00 9.36   ? 82  GLY A C   1 
ATOM   571  O O   . GLY A 1 82  ? 48.542  26.742 99.359  1.00 14.89  ? 82  GLY A O   1 
ATOM   572  N N   . LEU A 1 83  ? 49.018  26.720 101.559 1.00 2.00   ? 83  LEU A N   1 
ATOM   573  C CA  . LEU A 1 83  ? 49.783  27.948 101.513 1.00 2.00   ? 83  LEU A CA  1 
ATOM   574  C C   . LEU A 1 83  ? 50.901  27.796 100.558 1.00 2.00   ? 83  LEU A C   1 
ATOM   575  O O   . LEU A 1 83  ? 51.259  28.737 99.860  1.00 8.25   ? 83  LEU A O   1 
ATOM   576  C CB  . LEU A 1 83  ? 50.310  28.314 102.886 1.00 4.74   ? 83  LEU A CB  1 
ATOM   577  C CG  . LEU A 1 83  ? 49.209  28.782 103.821 1.00 3.10   ? 83  LEU A CG  1 
ATOM   578  C CD1 . LEU A 1 83  ? 49.749  28.763 105.185 1.00 10.76  ? 83  LEU A CD1 1 
ATOM   579  C CD2 . LEU A 1 83  ? 48.689  30.158 103.452 1.00 2.00   ? 83  LEU A CD2 1 
ATOM   580  N N   . PHE A 1 84  ? 51.404  26.578 100.476 1.00 2.00   ? 84  PHE A N   1 
ATOM   581  C CA  . PHE A 1 84  ? 52.487  26.267 99.560  1.00 10.01  ? 84  PHE A CA  1 
ATOM   582  C C   . PHE A 1 84  ? 52.033  26.384 98.100  1.00 9.20   ? 84  PHE A C   1 
ATOM   583  O O   . PHE A 1 84  ? 52.758  26.872 97.231  1.00 16.83  ? 84  PHE A O   1 
ATOM   584  C CB  . PHE A 1 84  ? 52.987  24.865 99.846  1.00 10.98  ? 84  PHE A CB  1 
ATOM   585  C CG  . PHE A 1 84  ? 54.173  24.497 99.053  1.00 8.39   ? 84  PHE A CG  1 
ATOM   586  C CD1 . PHE A 1 84  ? 55.292  25.304 99.065  1.00 14.52  ? 84  PHE A CD1 1 
ATOM   587  C CD2 . PHE A 1 84  ? 54.155  23.369 98.242  1.00 26.11  ? 84  PHE A CD2 1 
ATOM   588  C CE1 . PHE A 1 84  ? 56.376  25.007 98.276  1.00 5.75   ? 84  PHE A CE1 1 
ATOM   589  C CE2 . PHE A 1 84  ? 55.238  23.060 97.448  1.00 13.91  ? 84  PHE A CE2 1 
ATOM   590  C CZ  . PHE A 1 84  ? 56.349  23.883 97.461  1.00 6.41   ? 84  PHE A CZ  1 
ATOM   591  N N   . LEU A 1 85  ? 50.802  25.978 97.858  1.00 12.30  ? 85  LEU A N   1 
ATOM   592  C CA  . LEU A 1 85  ? 50.225  26.011 96.540  1.00 6.39   ? 85  LEU A CA  1 
ATOM   593  C C   . LEU A 1 85  ? 50.009  27.436 96.085  1.00 9.56   ? 85  LEU A C   1 
ATOM   594  O O   . LEU A 1 85  ? 50.380  27.821 94.976  1.00 19.26  ? 85  LEU A O   1 
ATOM   595  C CB  . LEU A 1 85  ? 48.906  25.278 96.583  1.00 5.85   ? 85  LEU A CB  1 
ATOM   596  C CG  . LEU A 1 85  ? 48.165  25.268 95.280  1.00 6.06   ? 85  LEU A CG  1 
ATOM   597  C CD1 . LEU A 1 85  ? 48.972  24.466 94.270  1.00 15.37  ? 85  LEU A CD1 1 
ATOM   598  C CD2 . LEU A 1 85  ? 46.825  24.645 95.553  1.00 10.87  ? 85  LEU A CD2 1 
ATOM   599  N N   . TYR A 1 86  ? 49.401  28.235 96.945  1.00 16.52  ? 86  TYR A N   1 
ATOM   600  C CA  . TYR A 1 86  ? 49.131  29.616 96.586  1.00 3.15   ? 86  TYR A CA  1 
ATOM   601  C C   . TYR A 1 86  ? 50.420  30.374 96.478  1.00 2.62   ? 86  TYR A C   1 
ATOM   602  O O   . TYR A 1 86  ? 50.515  31.363 95.777  1.00 16.04  ? 86  TYR A O   1 
ATOM   603  C CB  . TYR A 1 86  ? 48.164  30.261 97.571  1.00 4.75   ? 86  TYR A CB  1 
ATOM   604  C CG  . TYR A 1 86  ? 46.762  29.665 97.517  1.00 7.88   ? 86  TYR A CG  1 
ATOM   605  C CD1 . TYR A 1 86  ? 45.963  29.801 96.397  1.00 2.00   ? 86  TYR A CD1 1 
ATOM   606  C CD2 . TYR A 1 86  ? 46.255  28.943 98.582  1.00 2.90   ? 86  TYR A CD2 1 
ATOM   607  C CE1 . TYR A 1 86  ? 44.704  29.227 96.343  1.00 6.60   ? 86  TYR A CE1 1 
ATOM   608  C CE2 . TYR A 1 86  ? 45.008  28.376 98.535  1.00 9.74   ? 86  TYR A CE2 1 
ATOM   609  C CZ  . TYR A 1 86  ? 44.233  28.513 97.419  1.00 9.30   ? 86  TYR A CZ  1 
ATOM   610  O OH  . TYR A 1 86  ? 42.989  27.906 97.400  1.00 24.47  ? 86  TYR A OH  1 
ATOM   611  N N   . GLN A 1 87  ? 51.445  29.885 97.141  1.00 11.83  ? 87  GLN A N   1 
ATOM   612  C CA  . GLN A 1 87  ? 52.738  30.527 97.033  1.00 14.35  ? 87  GLN A CA  1 
ATOM   613  C C   . GLN A 1 87  ? 53.186  30.332 95.581  1.00 21.56  ? 87  GLN A C   1 
ATOM   614  O O   . GLN A 1 87  ? 53.777  31.224 94.988  1.00 26.92  ? 87  GLN A O   1 
ATOM   615  C CB  . GLN A 1 87  ? 53.721  29.858 97.966  1.00 12.64  ? 87  GLN A CB  1 
ATOM   616  C CG  . GLN A 1 87  ? 55.072  30.399 97.852  1.00 14.50  ? 87  GLN A CG  1 
ATOM   617  C CD  . GLN A 1 87  ? 56.094  29.481 98.448  1.00 35.82  ? 87  GLN A CD  1 
ATOM   618  O OE1 . GLN A 1 87  ? 57.132  29.227 97.840  1.00 53.89  ? 87  GLN A OE1 1 
ATOM   619  N NE2 . GLN A 1 87  ? 55.824  28.979 99.649  1.00 42.41  ? 87  GLN A NE2 1 
ATOM   620  N N   . GLY A 1 88  ? 52.881  29.165 95.015  1.00 19.53  ? 88  GLY A N   1 
ATOM   621  C CA  . GLY A 1 88  ? 53.236  28.875 93.636  1.00 11.97  ? 88  GLY A CA  1 
ATOM   622  C C   . GLY A 1 88  ? 52.368  29.606 92.627  1.00 15.68  ? 88  GLY A C   1 
ATOM   623  O O   . GLY A 1 88  ? 52.860  30.172 91.647  1.00 12.15  ? 88  GLY A O   1 
ATOM   624  N N   . LEU A 1 89  ? 51.061  29.607 92.843  1.00 13.61  ? 89  LEU A N   1 
ATOM   625  C CA  . LEU A 1 89  ? 50.178  30.303 91.919  1.00 2.25   ? 89  LEU A CA  1 
ATOM   626  C C   . LEU A 1 89  ? 50.537  31.779 91.797  1.00 5.89   ? 89  LEU A C   1 
ATOM   627  O O   . LEU A 1 89  ? 50.624  32.305 90.705  1.00 11.26  ? 89  LEU A O   1 
ATOM   628  C CB  . LEU A 1 89  ? 48.723  30.135 92.341  1.00 6.44   ? 89  LEU A CB  1 
ATOM   629  C CG  . LEU A 1 89  ? 48.188  28.708 92.244  1.00 6.00   ? 89  LEU A CG  1 
ATOM   630  C CD1 . LEU A 1 89  ? 46.754  28.691 92.696  1.00 6.92   ? 89  LEU A CD1 1 
ATOM   631  C CD2 . LEU A 1 89  ? 48.285  28.213 90.823  1.00 2.00   ? 89  LEU A CD2 1 
ATOM   632  N N   . LEU A 1 90  ? 50.772  32.441 92.921  1.00 8.29   ? 90  LEU A N   1 
ATOM   633  C CA  . LEU A 1 90  ? 51.127  33.852 92.912  1.00 2.00   ? 90  LEU A CA  1 
ATOM   634  C C   . LEU A 1 90  ? 52.449  34.066 92.173  1.00 4.21   ? 90  LEU A C   1 
ATOM   635  O O   . LEU A 1 90  ? 52.668  35.104 91.566  1.00 15.58  ? 90  LEU A O   1 
ATOM   636  C CB  . LEU A 1 90  ? 51.208  34.403 94.346  1.00 2.00   ? 90  LEU A CB  1 
ATOM   637  C CG  . LEU A 1 90  ? 49.945  34.308 95.217  1.00 2.00   ? 90  LEU A CG  1 
ATOM   638  C CD1 . LEU A 1 90  ? 50.264  34.611 96.637  1.00 2.00   ? 90  LEU A CD1 1 
ATOM   639  C CD2 . LEU A 1 90  ? 48.875  35.244 94.751  1.00 2.00   ? 90  LEU A CD2 1 
ATOM   640  N N   . GLN A 1 91  ? 53.342  33.091 92.234  1.00 10.18  ? 91  GLN A N   1 
ATOM   641  C CA  . GLN A 1 91  ? 54.615  33.216 91.547  1.00 19.84  ? 91  GLN A CA  1 
ATOM   642  C C   . GLN A 1 91  ? 54.389  33.099 90.041  1.00 26.03  ? 91  GLN A C   1 
ATOM   643  O O   . GLN A 1 91  ? 55.013  33.802 89.255  1.00 33.17  ? 91  GLN A O   1 
ATOM   644  C CB  . GLN A 1 91  ? 55.606  32.134 92.004  1.00 38.30  ? 91  GLN A CB  1 
ATOM   645  C CG  . GLN A 1 91  ? 56.382  32.439 93.287  1.00 71.50  ? 91  GLN A CG  1 
ATOM   646  C CD  . GLN A 1 91  ? 57.448  31.386 93.606  1.00 87.37  ? 91  GLN A CD  1 
ATOM   647  O OE1 . GLN A 1 91  ? 58.261  31.029 92.754  1.00 100.53 ? 91  GLN A OE1 1 
ATOM   648  N NE2 . GLN A 1 91  ? 57.447  30.896 94.839  1.00 92.49  ? 91  GLN A NE2 1 
ATOM   649  N N   . ALA A 1 92  ? 53.471  32.224 89.653  1.00 22.12  ? 92  ALA A N   1 
ATOM   650  C CA  . ALA A 1 92  ? 53.161  31.987 88.254  1.00 7.97   ? 92  ALA A CA  1 
ATOM   651  C C   . ALA A 1 92  ? 52.625  33.188 87.540  1.00 4.50   ? 92  ALA A C   1 
ATOM   652  O O   . ALA A 1 92  ? 52.716  33.277 86.320  1.00 20.13  ? 92  ALA A O   1 
ATOM   653  C CB  . ALA A 1 92  ? 52.172  30.868 88.140  1.00 7.82   ? 92  ALA A CB  1 
ATOM   654  N N   . LEU A 1 93  ? 52.027  34.103 88.292  1.00 11.36  ? 93  LEU A N   1 
ATOM   655  C CA  . LEU A 1 93  ? 51.433  35.314 87.722  1.00 3.76   ? 93  LEU A CA  1 
ATOM   656  C C   . LEU A 1 93  ? 52.497  36.283 87.253  1.00 11.28  ? 93  LEU A C   1 
ATOM   657  O O   . LEU A 1 93  ? 52.188  37.408 86.873  1.00 18.09  ? 93  LEU A O   1 
ATOM   658  C CB  . LEU A 1 93  ? 50.534  36.016 88.753  1.00 2.00   ? 93  LEU A CB  1 
ATOM   659  C CG  . LEU A 1 93  ? 49.233  35.347 89.162  1.00 6.58   ? 93  LEU A CG  1 
ATOM   660  C CD1 . LEU A 1 93  ? 48.597  36.146 90.261  1.00 18.98  ? 93  LEU A CD1 1 
ATOM   661  C CD2 . LEU A 1 93  ? 48.303  35.256 87.971  1.00 6.92   ? 93  LEU A CD2 1 
ATOM   662  N N   . GLU A 1 94  ? 53.755  35.882 87.372  1.00 17.10  ? 94  GLU A N   1 
ATOM   663  C CA  . GLU A 1 94  ? 54.878  36.707 86.971  1.00 13.56  ? 94  GLU A CA  1 
ATOM   664  C C   . GLU A 1 94  ? 54.674  38.222 87.250  1.00 12.98  ? 94  GLU A C   1 
ATOM   665  O O   . GLU A 1 94  ? 54.886  39.076 86.380  1.00 24.86  ? 94  GLU A O   1 
ATOM   666  C CB  . GLU A 1 94  ? 55.248  36.376 85.527  1.00 15.50  ? 94  GLU A CB  1 
ATOM   667  C CG  . GLU A 1 94  ? 55.785  34.946 85.367  1.00 59.66  ? 94  GLU A CG  1 
ATOM   668  C CD  . GLU A 1 94  ? 55.327  34.252 84.080  1.00 87.89  ? 94  GLU A CD  1 
ATOM   669  O OE1 . GLU A 1 94  ? 55.101  33.018 84.119  1.00 101.14 ? 94  GLU A OE1 1 
ATOM   670  O OE2 . GLU A 1 94  ? 55.197  34.929 83.032  1.00 97.88  ? 94  GLU A OE2 1 
ATOM   671  N N   . GLY A 1 95  ? 54.209  38.528 88.470  1.00 13.88  ? 95  GLY A N   1 
ATOM   672  C CA  . GLY A 1 95  ? 54.007  39.905 88.914  1.00 2.00   ? 95  GLY A CA  1 
ATOM   673  C C   . GLY A 1 95  ? 52.813  40.637 88.354  1.00 11.38  ? 95  GLY A C   1 
ATOM   674  O O   . GLY A 1 95  ? 52.521  41.764 88.763  1.00 6.35   ? 95  GLY A O   1 
ATOM   675  N N   . ILE A 1 96  ? 52.100  39.977 87.444  1.00 9.97   ? 96  ILE A N   1 
ATOM   676  C CA  . ILE A 1 96  ? 50.928  40.531 86.778  1.00 11.04  ? 96  ILE A CA  1 
ATOM   677  C C   . ILE A 1 96  ? 51.334  41.703 85.874  1.00 18.54  ? 96  ILE A C   1 
ATOM   678  O O   . ILE A 1 96  ? 51.176  41.624 84.664  1.00 29.88  ? 96  ILE A O   1 
ATOM   679  C CB  . ILE A 1 96  ? 49.801  40.956 87.771  1.00 4.87   ? 96  ILE A CB  1 
ATOM   680  C CG1 . ILE A 1 96  ? 49.292  39.754 88.554  1.00 2.00   ? 96  ILE A CG1 1 
ATOM   681  C CG2 . ILE A 1 96  ? 48.604  41.493 87.008  1.00 2.00   ? 96  ILE A CG2 1 
ATOM   682  C CD1 . ILE A 1 96  ? 48.092  40.109 89.430  1.00 4.14   ? 96  ILE A CD1 1 
ATOM   683  N N   . SER A 1 97  ? 51.860  42.778 86.450  1.00 21.02  ? 97  SER A N   1 
ATOM   684  C CA  . SER A 1 97  ? 52.295  43.920 85.664  1.00 15.52  ? 97  SER A CA  1 
ATOM   685  C C   . SER A 1 97  ? 53.083  44.856 86.562  1.00 25.78  ? 97  SER A C   1 
ATOM   686  O O   . SER A 1 97  ? 53.066  44.723 87.786  1.00 30.90  ? 97  SER A O   1 
ATOM   687  C CB  . SER A 1 97  ? 51.084  44.653 85.098  1.00 16.03  ? 97  SER A CB  1 
ATOM   688  O OG  . SER A 1 97  ? 50.488  45.480 86.072  1.00 15.09  ? 97  SER A OG  1 
ATOM   689  N N   . PRO A 1 98  ? 53.810  45.803 85.969  1.00 34.26  ? 98  PRO A N   1 
ATOM   690  C CA  . PRO A 1 98  ? 54.593  46.751 86.766  1.00 35.39  ? 98  PRO A CA  1 
ATOM   691  C C   . PRO A 1 98  ? 53.809  47.464 87.874  1.00 32.27  ? 98  PRO A C   1 
ATOM   692  O O   . PRO A 1 98  ? 54.311  47.645 88.990  1.00 34.22  ? 98  PRO A O   1 
ATOM   693  C CB  . PRO A 1 98  ? 55.107  47.708 85.703  1.00 25.12  ? 98  PRO A CB  1 
ATOM   694  C CG  . PRO A 1 98  ? 55.452  46.718 84.593  1.00 38.70  ? 98  PRO A CG  1 
ATOM   695  C CD  . PRO A 1 98  ? 54.217  45.844 84.550  1.00 37.21  ? 98  PRO A CD  1 
ATOM   696  N N   . GLU A 1 99  ? 52.567  47.835 87.575  1.00 37.10  ? 99  GLU A N   1 
ATOM   697  C CA  . GLU A 1 99  ? 51.724  48.539 88.542  1.00 41.54  ? 99  GLU A CA  1 
ATOM   698  C C   . GLU A 1 99  ? 51.409  47.650 89.739  1.00 32.94  ? 99  GLU A C   1 
ATOM   699  O O   . GLU A 1 99  ? 51.333  48.116 90.871  1.00 42.78  ? 99  GLU A O   1 
ATOM   700  C CB  . GLU A 1 99  ? 50.412  49.005 87.883  1.00 60.85  ? 99  GLU A CB  1 
ATOM   701  C CG  . GLU A 1 99  ? 50.567  49.954 86.678  1.00 95.43  ? 99  GLU A CG  1 
ATOM   702  C CD  . GLU A 1 99  ? 50.820  51.410 87.071  1.00 114.93 ? 99  GLU A CD  1 
ATOM   703  O OE1 . GLU A 1 99  ? 50.017  51.972 87.854  1.00 126.83 ? 99  GLU A OE1 1 
ATOM   704  O OE2 . GLU A 1 99  ? 51.814  51.996 86.581  1.00 119.04 ? 99  GLU A OE2 1 
ATOM   705  N N   . LEU A 1 100 ? 51.274  46.358 89.487  1.00 21.33  ? 100 LEU A N   1 
ATOM   706  C CA  . LEU A 1 100 ? 50.947  45.409 90.533  1.00 17.31  ? 100 LEU A CA  1 
ATOM   707  C C   . LEU A 1 100 ? 52.069  44.608 91.147  1.00 11.87  ? 100 LEU A C   1 
ATOM   708  O O   . LEU A 1 100 ? 51.902  44.040 92.224  1.00 17.10  ? 100 LEU A O   1 
ATOM   709  C CB  . LEU A 1 100 ? 49.847  44.465 90.068  1.00 11.03  ? 100 LEU A CB  1 
ATOM   710  C CG  . LEU A 1 100 ? 48.509  45.086 90.452  1.00 13.31  ? 100 LEU A CG  1 
ATOM   711  C CD1 . LEU A 1 100 ? 48.120  46.117 89.438  1.00 12.26  ? 100 LEU A CD1 1 
ATOM   712  C CD2 . LEU A 1 100 ? 47.458  44.044 90.558  1.00 24.96  ? 100 LEU A CD2 1 
ATOM   713  N N   . GLY A 1 101 ? 53.221  44.598 90.496  1.00 14.64  ? 101 GLY A N   1 
ATOM   714  C CA  . GLY A 1 101 ? 54.354  43.847 91.009  1.00 20.71  ? 101 GLY A CA  1 
ATOM   715  C C   . GLY A 1 101 ? 54.593  44.012 92.493  1.00 17.63  ? 101 GLY A C   1 
ATOM   716  O O   . GLY A 1 101 ? 54.721  43.021 93.202  1.00 28.22  ? 101 GLY A O   1 
ATOM   717  N N   . PRO A 1 102 ? 54.641  45.252 92.995  1.00 15.83  ? 102 PRO A N   1 
ATOM   718  C CA  . PRO A 1 102 ? 54.868  45.492 94.417  1.00 6.80   ? 102 PRO A CA  1 
ATOM   719  C C   . PRO A 1 102 ? 53.795  44.899 95.302  1.00 8.17   ? 102 PRO A C   1 
ATOM   720  O O   . PRO A 1 102 ? 54.076  44.129 96.214  1.00 24.79  ? 102 PRO A O   1 
ATOM   721  C CB  . PRO A 1 102 ? 54.882  47.013 94.499  1.00 11.16  ? 102 PRO A CB  1 
ATOM   722  C CG  . PRO A 1 102 ? 55.459  47.407 93.159  1.00 11.95  ? 102 PRO A CG  1 
ATOM   723  C CD  . PRO A 1 102 ? 54.674  46.519 92.239  1.00 12.52  ? 102 PRO A CD  1 
ATOM   724  N N   . THR A 1 103 ? 52.552  45.225 95.023  1.00 7.97   ? 103 THR A N   1 
ATOM   725  C CA  . THR A 1 103 ? 51.474  44.712 95.849  1.00 8.59   ? 103 THR A CA  1 
ATOM   726  C C   . THR A 1 103 ? 51.433  43.201 95.908  1.00 3.15   ? 103 THR A C   1 
ATOM   727  O O   . THR A 1 103 ? 51.232  42.613 96.968  1.00 10.69  ? 103 THR A O   1 
ATOM   728  C CB  . THR A 1 103 ? 50.137  45.214 95.367  1.00 11.91  ? 103 THR A CB  1 
ATOM   729  O OG1 . THR A 1 103 ? 50.146  46.651 95.340  1.00 23.78  ? 103 THR A OG1 1 
ATOM   730  C CG2 . THR A 1 103 ? 49.062  44.728 96.296  1.00 18.15  ? 103 THR A CG2 1 
ATOM   731  N N   . LEU A 1 104 ? 51.667  42.569 94.773  1.00 7.20   ? 104 LEU A N   1 
ATOM   732  C CA  . LEU A 1 104 ? 51.635  41.123 94.708  1.00 5.36   ? 104 LEU A CA  1 
ATOM   733  C C   . LEU A 1 104 ? 52.839  40.504 95.380  1.00 15.45  ? 104 LEU A C   1 
ATOM   734  O O   . LEU A 1 104 ? 52.708  39.459 96.022  1.00 23.36  ? 104 LEU A O   1 
ATOM   735  C CB  . LEU A 1 104 ? 51.538  40.679 93.261  1.00 4.11   ? 104 LEU A CB  1 
ATOM   736  C CG  . LEU A 1 104 ? 51.540  39.194 92.992  1.00 2.00   ? 104 LEU A CG  1 
ATOM   737  C CD1 . LEU A 1 104 ? 50.344  38.592 93.600  1.00 19.58  ? 104 LEU A CD1 1 
ATOM   738  C CD2 . LEU A 1 104 ? 51.575  38.939 91.523  1.00 17.98  ? 104 LEU A CD2 1 
ATOM   739  N N   . ASP A 1 105 ? 54.004  41.146 95.249  1.00 22.24  ? 105 ASP A N   1 
ATOM   740  C CA  . ASP A 1 105 ? 55.225  40.639 95.876  1.00 16.63  ? 105 ASP A CA  1 
ATOM   741  C C   . ASP A 1 105 ? 55.040  40.609 97.392  1.00 14.51  ? 105 ASP A C   1 
ATOM   742  O O   . ASP A 1 105 ? 55.420  39.643 98.039  1.00 26.79  ? 105 ASP A O   1 
ATOM   743  C CB  . ASP A 1 105 ? 56.454  41.457 95.478  1.00 21.93  ? 105 ASP A CB  1 
ATOM   744  C CG  . ASP A 1 105 ? 57.767  40.817 95.937  1.00 58.56  ? 105 ASP A CG  1 
ATOM   745  O OD1 . ASP A 1 105 ? 58.061  39.672 95.523  1.00 68.73  ? 105 ASP A OD1 1 
ATOM   746  O OD2 . ASP A 1 105 ? 58.515  41.461 96.708  1.00 68.61  ? 105 ASP A OD2 1 
ATOM   747  N N   . THR A 1 106 ? 54.391  41.618 97.956  1.00 7.23   ? 106 THR A N   1 
ATOM   748  C CA  . THR A 1 106 ? 54.160  41.622 99.392  1.00 2.00   ? 106 THR A CA  1 
ATOM   749  C C   . THR A 1 106 ? 53.327  40.405 99.734  1.00 5.12   ? 106 THR A C   1 
ATOM   750  O O   . THR A 1 106 ? 53.677  39.622 100.616 1.00 12.67  ? 106 THR A O   1 
ATOM   751  C CB  . THR A 1 106 ? 53.389  42.850 99.826  1.00 6.59   ? 106 THR A CB  1 
ATOM   752  O OG1 . THR A 1 106 ? 54.187  44.016 99.633  1.00 12.01  ? 106 THR A OG1 1 
ATOM   753  C CG2 . THR A 1 106 ? 53.030  42.742 101.269 1.00 21.80  ? 106 THR A CG2 1 
ATOM   754  N N   . LEU A 1 107 ? 52.229  40.241 99.012  1.00 6.15   ? 107 LEU A N   1 
ATOM   755  C CA  . LEU A 1 107 ? 51.369  39.115 99.253  1.00 5.33   ? 107 LEU A CA  1 
ATOM   756  C C   . LEU A 1 107 ? 52.112  37.797 99.161  1.00 4.09   ? 107 LEU A C   1 
ATOM   757  O O   . LEU A 1 107 ? 51.944  36.938 100.033 1.00 14.54  ? 107 LEU A O   1 
ATOM   758  C CB  . LEU A 1 107 ? 50.189  39.108 98.292  1.00 2.00   ? 107 LEU A CB  1 
ATOM   759  C CG  . LEU A 1 107 ? 49.258  37.913 98.504  1.00 2.00   ? 107 LEU A CG  1 
ATOM   760  C CD1 . LEU A 1 107 ? 48.845  37.753 99.969  1.00 2.00   ? 107 LEU A CD1 1 
ATOM   761  C CD2 . LEU A 1 107 ? 48.052  38.071 97.655  1.00 3.90   ? 107 LEU A CD2 1 
ATOM   762  N N   . GLN A 1 108 ? 52.981  37.647 98.163  1.00 3.95   ? 108 GLN A N   1 
ATOM   763  C CA  . GLN A 1 108 ? 53.690  36.366 97.996  1.00 5.90   ? 108 GLN A CA  1 
ATOM   764  C C   . GLN A 1 108 ? 54.765  36.050 99.006  1.00 7.20   ? 108 GLN A C   1 
ATOM   765  O O   . GLN A 1 108 ? 54.910  34.902 99.406  1.00 15.70  ? 108 GLN A O   1 
ATOM   766  C CB  . GLN A 1 108 ? 54.093  36.116 96.537  1.00 2.00   ? 108 GLN A CB  1 
ATOM   767  C CG  . GLN A 1 108 ? 55.534  35.885 96.214  1.00 16.05  ? 108 GLN A CG  1 
ATOM   768  C CD  . GLN A 1 108 ? 56.061  34.531 96.586  1.00 30.17  ? 108 GLN A CD  1 
ATOM   769  O OE1 . GLN A 1 108 ? 57.209  34.416 97.010  1.00 46.90  ? 108 GLN A OE1 1 
ATOM   770  N NE2 . GLN A 1 108 ? 55.263  33.490 96.390  1.00 31.27  ? 108 GLN A NE2 1 
ATOM   771  N N   . LEU A 1 109 ? 55.455  37.063 99.505  1.00 10.10  ? 109 LEU A N   1 
ATOM   772  C CA  . LEU A 1 109 ? 56.462  36.816 100.530 1.00 2.00   ? 109 LEU A CA  1 
ATOM   773  C C   . LEU A 1 109 ? 55.726  36.445 101.803 1.00 6.86   ? 109 LEU A C   1 
ATOM   774  O O   . LEU A 1 109 ? 56.064  35.456 102.446 1.00 7.81   ? 109 LEU A O   1 
ATOM   775  C CB  . LEU A 1 109 ? 57.303  38.039 100.786 1.00 7.95   ? 109 LEU A CB  1 
ATOM   776  C CG  . LEU A 1 109 ? 58.462  38.301 99.850  1.00 18.82  ? 109 LEU A CG  1 
ATOM   777  C CD1 . LEU A 1 109 ? 58.987  39.702 100.150 1.00 19.31  ? 109 LEU A CD1 1 
ATOM   778  C CD2 . LEU A 1 109 ? 59.526  37.235 100.065 1.00 15.79  ? 109 LEU A CD2 1 
ATOM   779  N N   . ASP A 1 110 ? 54.678  37.190 102.134 1.00 6.74   ? 110 ASP A N   1 
ATOM   780  C CA  . ASP A 1 110 ? 53.917  36.881 103.331 1.00 2.00   ? 110 ASP A CA  1 
ATOM   781  C C   . ASP A 1 110 ? 53.356  35.477 103.323 1.00 2.74   ? 110 ASP A C   1 
ATOM   782  O O   . ASP A 1 110 ? 53.384  34.816 104.362 1.00 2.16   ? 110 ASP A O   1 
ATOM   783  C CB  . ASP A 1 110 ? 52.835  37.926 103.575 1.00 2.00   ? 110 ASP A CB  1 
ATOM   784  C CG  . ASP A 1 110 ? 53.405  39.214 104.136 1.00 18.29  ? 110 ASP A CG  1 
ATOM   785  O OD1 . ASP A 1 110 ? 53.993  39.166 105.232 1.00 42.51  ? 110 ASP A OD1 1 
ATOM   786  O OD2 . ASP A 1 110 ? 53.295  40.268 103.490 1.00 25.36  ? 110 ASP A OD2 1 
ATOM   787  N N   . VAL A 1 111 ? 52.913  35.001 102.153 1.00 5.96   ? 111 VAL A N   1 
ATOM   788  C CA  . VAL A 1 111 ? 52.368  33.649 102.037 1.00 2.00   ? 111 VAL A CA  1 
ATOM   789  C C   . VAL A 1 111 ? 53.470  32.617 102.122 1.00 2.00   ? 111 VAL A C   1 
ATOM   790  O O   . VAL A 1 111 ? 53.333  31.618 102.813 1.00 2.00   ? 111 VAL A O   1 
ATOM   791  C CB  . VAL A 1 111 ? 51.588  33.441 100.768 1.00 2.00   ? 111 VAL A CB  1 
ATOM   792  C CG1 . VAL A 1 111 ? 51.155  32.017 100.691 1.00 2.00   ? 111 VAL A CG1 1 
ATOM   793  C CG2 . VAL A 1 111 ? 50.366  34.317 100.765 1.00 2.00   ? 111 VAL A CG2 1 
ATOM   794  N N   . ALA A 1 112 ? 54.608  32.905 101.510 1.00 2.00   ? 112 ALA A N   1 
ATOM   795  C CA  . ALA A 1 112 ? 55.728  31.981 101.559 1.00 2.00   ? 112 ALA A CA  1 
ATOM   796  C C   . ALA A 1 112 ? 56.214  31.746 102.995 1.00 10.03  ? 112 ALA A C   1 
ATOM   797  O O   . ALA A 1 112 ? 56.323  30.608 103.442 1.00 12.49  ? 112 ALA A O   1 
ATOM   798  C CB  . ALA A 1 112 ? 56.855  32.484 100.690 1.00 2.00   ? 112 ALA A CB  1 
ATOM   799  N N   . ASP A 1 113 ? 56.452  32.819 103.737 1.00 20.90  ? 113 ASP A N   1 
ATOM   800  C CA  . ASP A 1 113 ? 56.919  32.698 105.118 1.00 13.95  ? 113 ASP A CA  1 
ATOM   801  C C   . ASP A 1 113 ? 55.916  32.035 106.023 1.00 11.76  ? 113 ASP A C   1 
ATOM   802  O O   . ASP A 1 113 ? 56.287  31.323 106.922 1.00 16.76  ? 113 ASP A O   1 
ATOM   803  C CB  . ASP A 1 113 ? 57.266  34.056 105.682 1.00 26.72  ? 113 ASP A CB  1 
ATOM   804  C CG  . ASP A 1 113 ? 58.423  34.713 104.953 1.00 36.51  ? 113 ASP A CG  1 
ATOM   805  O OD1 . ASP A 1 113 ? 58.753  34.322 103.809 1.00 35.13  ? 113 ASP A OD1 1 
ATOM   806  O OD2 . ASP A 1 113 ? 59.009  35.635 105.543 1.00 46.00  ? 113 ASP A OD2 1 
ATOM   807  N N   . PHE A 1 114 ? 54.638  32.276 105.808 1.00 11.20  ? 114 PHE A N   1 
ATOM   808  C CA  . PHE A 1 114 ? 53.660  31.629 106.640 1.00 2.00   ? 114 PHE A CA  1 
ATOM   809  C C   . PHE A 1 114 ? 53.772  30.147 106.372 1.00 6.88   ? 114 PHE A C   1 
ATOM   810  O O   . PHE A 1 114 ? 53.700  29.340 107.281 1.00 23.20  ? 114 PHE A O   1 
ATOM   811  C CB  . PHE A 1 114 ? 52.276  32.117 106.276 1.00 2.00   ? 114 PHE A CB  1 
ATOM   812  C CG  . PHE A 1 114 ? 51.193  31.596 107.166 1.00 2.00   ? 114 PHE A CG  1 
ATOM   813  C CD1 . PHE A 1 114 ? 51.491  30.950 108.344 1.00 2.00   ? 114 PHE A CD1 1 
ATOM   814  C CD2 . PHE A 1 114 ? 49.860  31.737 106.812 1.00 6.04   ? 114 PHE A CD2 1 
ATOM   815  C CE1 . PHE A 1 114 ? 50.493  30.450 109.157 1.00 2.00   ? 114 PHE A CE1 1 
ATOM   816  C CE2 . PHE A 1 114 ? 48.843  31.231 107.636 1.00 9.12   ? 114 PHE A CE2 1 
ATOM   817  C CZ  . PHE A 1 114 ? 49.173  30.588 108.807 1.00 2.00   ? 114 PHE A CZ  1 
ATOM   818  N N   . ALA A 1 115 ? 53.953  29.775 105.117 1.00 5.66   ? 115 ALA A N   1 
ATOM   819  C CA  . ALA A 1 115 ? 54.064  28.372 104.811 1.00 2.00   ? 115 ALA A CA  1 
ATOM   820  C C   . ALA A 1 115 ? 55.330  27.825 105.447 1.00 4.79   ? 115 ALA A C   1 
ATOM   821  O O   . ALA A 1 115 ? 55.306  26.779 106.071 1.00 8.68   ? 115 ALA A O   1 
ATOM   822  C CB  . ALA A 1 115 ? 54.097  28.177 103.346 1.00 2.00   ? 115 ALA A CB  1 
ATOM   823  N N   . THR A 1 116 ? 56.426  28.574 105.365 1.00 10.63  ? 116 THR A N   1 
ATOM   824  C CA  . THR A 1 116 ? 57.713  28.132 105.918 1.00 2.00   ? 116 THR A CA  1 
ATOM   825  C C   . THR A 1 116 ? 57.621  27.937 107.428 1.00 2.00   ? 116 THR A C   1 
ATOM   826  O O   . THR A 1 116 ? 58.071  26.953 107.980 1.00 14.69  ? 116 THR A O   1 
ATOM   827  C CB  . THR A 1 116 ? 58.826  29.154 105.592 1.00 7.55   ? 116 THR A CB  1 
ATOM   828  O OG1 . THR A 1 116 ? 58.918  29.381 104.177 1.00 19.15  ? 116 THR A OG1 1 
ATOM   829  C CG2 . THR A 1 116 ? 60.135  28.661 106.079 1.00 2.00   ? 116 THR A CG2 1 
ATOM   830  N N   . THR A 1 117 ? 57.030  28.918 108.071 1.00 8.73   ? 117 THR A N   1 
ATOM   831  C CA  . THR A 1 117 ? 56.805  28.967 109.490 1.00 2.00   ? 117 THR A CA  1 
ATOM   832  C C   . THR A 1 117 ? 56.101  27.716 109.964 1.00 2.00   ? 117 THR A C   1 
ATOM   833  O O   . THR A 1 117 ? 56.492  27.103 110.950 1.00 22.51  ? 117 THR A O   1 
ATOM   834  C CB  . THR A 1 117 ? 55.965  30.201 109.724 1.00 2.89   ? 117 THR A CB  1 
ATOM   835  O OG1 . THR A 1 117 ? 56.848  31.308 109.870 1.00 29.13  ? 117 THR A OG1 1 
ATOM   836  C CG2 . THR A 1 117 ? 55.005  30.064 110.878 1.00 3.79   ? 117 THR A CG2 1 
ATOM   837  N N   . ILE A 1 118 ? 55.063  27.336 109.237 1.00 12.72  ? 118 ILE A N   1 
ATOM   838  C CA  . ILE A 1 118 ? 54.276  26.152 109.565 1.00 10.65  ? 118 ILE A CA  1 
ATOM   839  C C   . ILE A 1 118 ? 55.118  24.890 109.381 1.00 11.73  ? 118 ILE A C   1 
ATOM   840  O O   . ILE A 1 118 ? 55.053  23.955 110.176 1.00 15.78  ? 118 ILE A O   1 
ATOM   841  C CB  . ILE A 1 118 ? 52.981  26.054 108.698 1.00 2.00   ? 118 ILE A CB  1 
ATOM   842  C CG1 . ILE A 1 118 ? 52.020  27.205 109.021 1.00 2.20   ? 118 ILE A CG1 1 
ATOM   843  C CG2 . ILE A 1 118 ? 52.296  24.742 108.938 1.00 3.23   ? 118 ILE A CG2 1 
ATOM   844  C CD1 . ILE A 1 118 ? 50.581  26.949 108.610 1.00 10.30  ? 118 ILE A CD1 1 
ATOM   845  N N   . TRP A 1 119 ? 55.955  24.878 108.364 1.00 10.40  ? 119 TRP A N   1 
ATOM   846  C CA  . TRP A 1 119 ? 56.780  23.706 108.149 1.00 16.55  ? 119 TRP A CA  1 
ATOM   847  C C   . TRP A 1 119 ? 57.732  23.512 109.325 1.00 14.84  ? 119 TRP A C   1 
ATOM   848  O O   . TRP A 1 119 ? 57.701  22.491 109.999 1.00 19.66  ? 119 TRP A O   1 
ATOM   849  C CB  . TRP A 1 119 ? 57.553  23.837 106.834 1.00 21.44  ? 119 TRP A CB  1 
ATOM   850  C CG  . TRP A 1 119 ? 58.348  22.613 106.438 1.00 26.59  ? 119 TRP A CG  1 
ATOM   851  C CD1 . TRP A 1 119 ? 59.698  22.461 106.511 1.00 32.13  ? 119 TRP A CD1 1 
ATOM   852  C CD2 . TRP A 1 119 ? 57.836  21.374 105.928 1.00 24.63  ? 119 TRP A CD2 1 
ATOM   853  N NE1 . TRP A 1 119 ? 60.059  21.208 106.093 1.00 31.50  ? 119 TRP A NE1 1 
ATOM   854  C CE2 . TRP A 1 119 ? 58.937  20.518 105.728 1.00 23.35  ? 119 TRP A CE2 1 
ATOM   855  C CE3 . TRP A 1 119 ? 56.556  20.904 105.624 1.00 25.88  ? 119 TRP A CE3 1 
ATOM   856  C CZ2 . TRP A 1 119 ? 58.799  19.223 105.242 1.00 21.30  ? 119 TRP A CZ2 1 
ATOM   857  C CZ3 . TRP A 1 119 ? 56.422  19.612 105.140 1.00 30.18  ? 119 TRP A CZ3 1 
ATOM   858  C CH2 . TRP A 1 119 ? 57.539  18.788 104.956 1.00 26.99  ? 119 TRP A CH2 1 
ATOM   859  N N   . GLN A 1 120 ? 58.516  24.534 109.619 1.00 13.94  ? 120 GLN A N   1 
ATOM   860  C CA  . GLN A 1 120 ? 59.485  24.464 110.693 1.00 4.83   ? 120 GLN A CA  1 
ATOM   861  C C   . GLN A 1 120 ? 58.886  24.120 112.027 1.00 9.74   ? 120 GLN A C   1 
ATOM   862  O O   . GLN A 1 120 ? 59.549  23.503 112.848 1.00 21.70  ? 120 GLN A O   1 
ATOM   863  C CB  . GLN A 1 120 ? 60.273  25.754 110.758 1.00 3.11   ? 120 GLN A CB  1 
ATOM   864  C CG  . GLN A 1 120 ? 60.922  26.086 109.405 1.00 8.81   ? 120 GLN A CG  1 
ATOM   865  C CD  . GLN A 1 120 ? 61.793  27.321 109.437 1.00 9.72   ? 120 GLN A CD  1 
ATOM   866  O OE1 . GLN A 1 120 ? 61.692  28.147 110.348 1.00 24.10  ? 120 GLN A OE1 1 
ATOM   867  N NE2 . GLN A 1 120 ? 62.651  27.460 108.440 1.00 3.75   ? 120 GLN A NE2 1 
ATOM   868  N N   . GLN A 1 121 ? 57.639  24.509 112.256 1.00 10.83  ? 121 GLN A N   1 
ATOM   869  C CA  . GLN A 1 121 ? 57.000  24.165 113.508 1.00 10.77  ? 121 GLN A CA  1 
ATOM   870  C C   . GLN A 1 121 ? 56.763  22.670 113.472 1.00 19.38  ? 121 GLN A C   1 
ATOM   871  O O   . GLN A 1 121 ? 57.123  21.965 114.410 1.00 30.71  ? 121 GLN A O   1 
ATOM   872  C CB  . GLN A 1 121 ? 55.680  24.896 113.696 1.00 11.16  ? 121 GLN A CB  1 
ATOM   873  C CG  . GLN A 1 121 ? 55.069  24.708 115.098 1.00 25.86  ? 121 GLN A CG  1 
ATOM   874  C CD  . GLN A 1 121 ? 55.927  25.267 116.247 1.00 24.02  ? 121 GLN A CD  1 
ATOM   875  O OE1 . GLN A 1 121 ? 55.822  24.801 117.376 1.00 24.06  ? 121 GLN A OE1 1 
ATOM   876  N NE2 . GLN A 1 121 ? 56.751  26.283 115.963 1.00 23.56  ? 121 GLN A NE2 1 
ATOM   877  N N   . MET A 1 122 ? 56.211  22.174 112.364 1.00 25.12  ? 122 MET A N   1 
ATOM   878  C CA  . MET A 1 122 ? 55.948  20.737 112.216 1.00 16.60  ? 122 MET A CA  1 
ATOM   879  C C   . MET A 1 122 ? 57.215  19.933 112.463 1.00 20.42  ? 122 MET A C   1 
ATOM   880  O O   . MET A 1 122 ? 57.160  18.897 113.109 1.00 32.08  ? 122 MET A O   1 
ATOM   881  C CB  . MET A 1 122 ? 55.386  20.386 110.832 1.00 11.50  ? 122 MET A CB  1 
ATOM   882  C CG  . MET A 1 122 ? 53.945  20.799 110.602 1.00 2.00   ? 122 MET A CG  1 
ATOM   883  S SD  . MET A 1 122 ? 53.137  20.033 109.150 1.00 28.29  ? 122 MET A SD  1 
ATOM   884  C CE  . MET A 1 122 ? 54.063  20.574 107.951 1.00 2.72   ? 122 MET A CE  1 
ATOM   885  N N   . GLU A 1 123 ? 58.352  20.403 111.954 1.00 20.68  ? 123 GLU A N   1 
ATOM   886  C CA  . GLU A 1 123 ? 59.624  19.716 112.162 1.00 11.72  ? 123 GLU A CA  1 
ATOM   887  C C   . GLU A 1 123 ? 59.967  19.681 113.655 1.00 13.94  ? 123 GLU A C   1 
ATOM   888  O O   . GLU A 1 123 ? 60.129  18.613 114.239 1.00 27.69  ? 123 GLU A O   1 
ATOM   889  C CB  . GLU A 1 123 ? 60.748  20.384 111.354 1.00 8.30   ? 123 GLU A CB  1 
ATOM   890  C CG  . GLU A 1 123 ? 60.447  20.471 109.855 1.00 36.37  ? 123 GLU A CG  1 
ATOM   891  C CD  . GLU A 1 123 ? 61.688  20.536 108.963 1.00 50.92  ? 123 GLU A CD  1 
ATOM   892  O OE1 . GLU A 1 123 ? 62.373  21.584 108.930 1.00 48.95  ? 123 GLU A OE1 1 
ATOM   893  O OE2 . GLU A 1 123 ? 61.960  19.533 108.260 1.00 75.83  ? 123 GLU A OE2 1 
ATOM   894  N N   . GLU A 1 124 ? 59.983  20.846 114.289 1.00 20.84  ? 124 GLU A N   1 
ATOM   895  C CA  . GLU A 1 124 ? 60.296  20.965 115.707 1.00 14.61  ? 124 GLU A CA  1 
ATOM   896  C C   . GLU A 1 124 ? 59.494  19.997 116.605 1.00 12.97  ? 124 GLU A C   1 
ATOM   897  O O   . GLU A 1 124 ? 60.043  19.358 117.497 1.00 37.61  ? 124 GLU A O   1 
ATOM   898  C CB  . GLU A 1 124 ? 60.091  22.418 116.135 1.00 12.36  ? 124 GLU A CB  1 
ATOM   899  C CG  . GLU A 1 124 ? 60.550  22.751 117.552 1.00 58.43  ? 124 GLU A CG  1 
ATOM   900  C CD  . GLU A 1 124 ? 60.254  24.193 117.954 1.00 71.94  ? 124 GLU A CD  1 
ATOM   901  O OE1 . GLU A 1 124 ? 60.720  25.124 117.257 1.00 73.82  ? 124 GLU A OE1 1 
ATOM   902  O OE2 . GLU A 1 124 ? 59.560  24.390 118.980 1.00 81.64  ? 124 GLU A OE2 1 
ATOM   903  N N   . LEU A 1 125 ? 58.204  19.869 116.356 1.00 10.08  ? 125 LEU A N   1 
ATOM   904  C CA  . LEU A 1 125 ? 57.359  18.988 117.159 1.00 27.44  ? 125 LEU A CA  1 
ATOM   905  C C   . LEU A 1 125 ? 57.421  17.546 116.711 1.00 28.14  ? 125 LEU A C   1 
ATOM   906  O O   . LEU A 1 125 ? 56.805  16.677 117.335 1.00 38.63  ? 125 LEU A O   1 
ATOM   907  C CB  . LEU A 1 125 ? 55.895  19.451 117.109 1.00 31.49  ? 125 LEU A CB  1 
ATOM   908  C CG  . LEU A 1 125 ? 55.522  20.829 117.679 1.00 29.26  ? 125 LEU A CG  1 
ATOM   909  C CD1 . LEU A 1 125 ? 54.087  21.122 117.330 1.00 18.63  ? 125 LEU A CD1 1 
ATOM   910  C CD2 . LEU A 1 125 ? 55.733  20.894 119.195 1.00 31.12  ? 125 LEU A CD2 1 
ATOM   911  N N   . GLY A 1 126 ? 58.122  17.314 115.605 1.00 30.62  ? 126 GLY A N   1 
ATOM   912  C CA  . GLY A 1 126 ? 58.258  15.979 115.041 1.00 33.30  ? 126 GLY A CA  1 
ATOM   913  C C   . GLY A 1 126 ? 57.055  15.503 114.236 1.00 33.92  ? 126 GLY A C   1 
ATOM   914  O O   . GLY A 1 126 ? 56.511  14.439 114.513 1.00 44.33  ? 126 GLY A O   1 
ATOM   915  N N   . MET A 1 127 ? 56.665  16.262 113.215 1.00 33.66  ? 127 MET A N   1 
ATOM   916  C CA  . MET A 1 127 ? 55.516  15.920 112.378 1.00 31.22  ? 127 MET A CA  1 
ATOM   917  C C   . MET A 1 127 ? 55.816  15.949 110.874 1.00 45.58  ? 127 MET A C   1 
ATOM   918  O O   . MET A 1 127 ? 55.103  15.320 110.083 1.00 53.84  ? 127 MET A O   1 
ATOM   919  C CB  . MET A 1 127 ? 54.375  16.905 112.615 1.00 26.47  ? 127 MET A CB  1 
ATOM   920  C CG  . MET A 1 127 ? 53.927  17.117 114.043 1.00 17.06  ? 127 MET A CG  1 
ATOM   921  S SD  . MET A 1 127 ? 52.205  17.744 114.081 1.00 51.35  ? 127 MET A SD  1 
ATOM   922  C CE  . MET A 1 127 ? 52.237  18.825 115.432 1.00 18.31  ? 127 MET A CE  1 
ATOM   923  N N   . ALA A 1 128 ? 56.836  16.718 110.492 1.00 50.44  ? 128 ALA A N   1 
ATOM   924  C CA  . ALA A 1 128 ? 57.233  16.904 109.097 1.00 62.49  ? 128 ALA A CA  1 
ATOM   925  C C   . ALA A 1 128 ? 57.355  15.638 108.277 1.00 80.73  ? 128 ALA A C   1 
ATOM   926  O O   . ALA A 1 128 ? 58.297  14.861 108.469 1.00 85.51  ? 128 ALA A O   1 
ATOM   927  C CB  . ALA A 1 128 ? 58.523  17.667 109.030 1.00 63.32  ? 128 ALA A CB  1 
ATOM   928  N N   . PRO A 1 129 ? 56.425  15.429 107.322 1.00 92.10  ? 129 PRO A N   1 
ATOM   929  C CA  . PRO A 1 129 ? 56.488  14.225 106.493 1.00 99.87  ? 129 PRO A CA  1 
ATOM   930  C C   . PRO A 1 129 ? 57.786  14.157 105.688 1.00 105.38 ? 129 PRO A C   1 
ATOM   931  O O   . PRO A 1 129 ? 58.395  15.187 105.381 1.00 104.10 ? 129 PRO A O   1 
ATOM   932  C CB  . PRO A 1 129 ? 55.243  14.352 105.597 1.00 99.91  ? 129 PRO A CB  1 
ATOM   933  C CG  . PRO A 1 129 ? 54.992  15.819 105.537 1.00 93.41  ? 129 PRO A CG  1 
ATOM   934  C CD  . PRO A 1 129 ? 55.258  16.253 106.955 1.00 94.41  ? 129 PRO A CD  1 
ATOM   935  N N   . ALA A 1 130 ? 58.241  12.933 105.423 1.00 112.90 ? 130 ALA A N   1 
ATOM   936  C CA  . ALA A 1 130 ? 59.456  12.719 104.644 1.00 116.46 ? 130 ALA A CA  1 
ATOM   937  C C   . ALA A 1 130 ? 59.189  13.300 103.263 1.00 120.64 ? 130 ALA A C   1 
ATOM   938  O O   . ALA A 1 130 ? 60.102  13.811 102.601 1.00 115.91 ? 130 ALA A O   1 
ATOM   939  C CB  . ALA A 1 130 ? 59.770  11.231 104.543 1.00 110.28 ? 130 ALA A CB  1 
ATOM   940  N N   . LEU A 1 131 ? 57.921  13.228 102.848 1.00 119.12 ? 131 LEU A N   1 
ATOM   941  C CA  . LEU A 1 131 ? 57.494  13.769 101.538 1.00 127.23 ? 131 LEU A CA  1 
ATOM   942  C C   . LEU A 1 131 ? 57.175  15.296 101.560 1.00 131.67 ? 131 LEU A C   1 
ATOM   943  O O   . LEU A 1 131 ? 56.136  15.758 102.134 1.00 128.18 ? 131 LEU A O   1 
ATOM   944  C CB  . LEU A 1 131 ? 56.263  12.967 100.968 1.00 134.86 ? 131 LEU A CB  1 
ATOM   945  N N   . GLN A 1 132 ? 58.080  16.069 100.960 1.00 145.96 ? 132 GLN A N   1 
ATOM   946  C CA  . GLN A 1 132 ? 57.880  17.503 100.851 1.00 149.49 ? 132 GLN A CA  1 
ATOM   947  C C   . GLN A 1 132 ? 56.790  17.617 99.795  1.00 150.80 ? 132 GLN A C   1 
ATOM   948  O O   . GLN A 1 132 ? 56.782  16.866 98.813  1.00 146.22 ? 132 GLN A O   1 
ATOM   949  C CB  . GLN A 1 132 ? 59.159  18.214 100.407 1.00 148.93 ? 132 GLN A CB  1 
ATOM   950  C CG  . GLN A 1 132 ? 60.240  18.229 101.469 1.00 166.71 ? 132 GLN A CG  1 
ATOM   951  C CD  . GLN A 1 132 ? 61.252  19.325 101.244 1.00 180.08 ? 132 GLN A CD  1 
ATOM   952  O OE1 . GLN A 1 132 ? 60.921  20.509 101.294 1.00 187.64 ? 132 GLN A OE1 1 
ATOM   953  N NE2 . GLN A 1 132 ? 62.493  18.942 100.997 1.00 189.77 ? 132 GLN A NE2 1 
ATOM   954  N N   . PRO A 1 133 ? 55.836  18.531 99.999  1.00 153.09 ? 133 PRO A N   1 
ATOM   955  C CA  . PRO A 1 133 ? 54.742  18.710 99.048  1.00 158.62 ? 133 PRO A CA  1 
ATOM   956  C C   . PRO A 1 133 ? 55.240  18.851 97.625  1.00 164.29 ? 133 PRO A C   1 
ATOM   957  O O   . PRO A 1 133 ? 55.924  19.820 97.279  1.00 164.96 ? 133 PRO A O   1 
ATOM   958  C CB  . PRO A 1 133 ? 54.069  19.989 99.544  1.00 157.83 ? 133 PRO A CB  1 
ATOM   959  C CG  . PRO A 1 133 ? 55.197  20.735 100.170 1.00 156.22 ? 133 PRO A CG  1 
ATOM   960  C CD  . PRO A 1 133 ? 55.884  19.653 100.946 1.00 154.95 ? 133 PRO A CD  1 
ATOM   961  N N   . THR A 1 134 ? 54.982  17.820 96.830  1.00 169.77 ? 134 THR A N   1 
ATOM   962  C CA  . THR A 1 134 ? 55.366  17.834 95.434  1.00 172.45 ? 134 THR A CA  1 
ATOM   963  C C   . THR A 1 134 ? 54.606  19.035 94.895  1.00 163.60 ? 134 THR A C   1 
ATOM   964  O O   . THR A 1 134 ? 53.379  18.985 94.779  1.00 164.57 ? 134 THR A O   1 
ATOM   965  C CB  . THR A 1 134 ? 54.902  16.541 94.731  1.00 181.43 ? 134 THR A CB  1 
ATOM   966  O OG1 . THR A 1 134 ? 53.536  16.273 95.073  1.00 188.51 ? 134 THR A OG1 1 
ATOM   967  C CG2 . THR A 1 134 ? 55.758  15.361 95.172  1.00 188.31 ? 134 THR A CG2 1 
ATOM   968  N N   . GLN A 1 135 ? 55.319  20.146 94.718  1.00 150.68 ? 135 GLN A N   1 
ATOM   969  C CA  . GLN A 1 135 ? 54.721  21.386 94.231  1.00 138.33 ? 135 GLN A CA  1 
ATOM   970  C C   . GLN A 1 135 ? 53.604  21.111 93.231  1.00 139.82 ? 135 GLN A C   1 
ATOM   971  O O   . GLN A 1 135 ? 53.802  20.382 92.255  1.00 142.54 ? 135 GLN A O   1 
ATOM   972  C CB  . GLN A 1 135 ? 55.790  22.300 93.620  1.00 119.30 ? 135 GLN A CB  1 
ATOM   973  C CG  . GLN A 1 135 ? 55.247  23.612 93.046  1.00 90.55  ? 135 GLN A CG  1 
ATOM   974  C CD  . GLN A 1 135 ? 54.513  24.479 94.070  1.00 75.84  ? 135 GLN A CD  1 
ATOM   975  O OE1 . GLN A 1 135 ? 53.348  24.222 94.425  1.00 51.96  ? 135 GLN A OE1 1 
ATOM   976  N NE2 . GLN A 1 135 ? 55.183  25.528 94.529  1.00 64.33  ? 135 GLN A NE2 1 
ATOM   977  N N   . GLY A 1 136 ? 52.419  21.646 93.527  1.00 135.41 ? 136 GLY A N   1 
ATOM   978  C CA  . GLY A 1 136 ? 51.261  21.450 92.671  1.00 127.45 ? 136 GLY A CA  1 
ATOM   979  C C   . GLY A 1 136 ? 51.494  21.835 91.219  1.00 121.82 ? 136 GLY A C   1 
ATOM   980  O O   . GLY A 1 136 ? 52.475  22.507 90.897  1.00 121.96 ? 136 GLY A O   1 
ATOM   981  N N   . ALA A 1 137 ? 50.592  21.402 90.338  1.00 115.54 ? 137 ALA A N   1 
ATOM   982  C CA  . ALA A 1 137 ? 50.691  21.703 88.906  1.00 102.92 ? 137 ALA A CA  1 
ATOM   983  C C   . ALA A 1 137 ? 50.432  23.189 88.680  1.00 90.63  ? 137 ALA A C   1 
ATOM   984  O O   . ALA A 1 137 ? 49.341  23.696 88.977  1.00 84.52  ? 137 ALA A O   1 
ATOM   985  C CB  . ALA A 1 137 ? 49.692  20.858 88.114  1.00 109.21 ? 137 ALA A CB  1 
ATOM   986  N N   . MET A 1 138 ? 51.430  23.885 88.148  1.00 73.26  ? 138 MET A N   1 
ATOM   987  C CA  . MET A 1 138 ? 51.290  25.314 87.941  1.00 61.15  ? 138 MET A CA  1 
ATOM   988  C C   . MET A 1 138 ? 50.730  25.749 86.612  1.00 50.20  ? 138 MET A C   1 
ATOM   989  O O   . MET A 1 138 ? 51.223  25.345 85.567  1.00 49.68  ? 138 MET A O   1 
ATOM   990  C CB  . MET A 1 138 ? 52.600  26.052 88.226  1.00 62.93  ? 138 MET A CB  1 
ATOM   991  C CG  . MET A 1 138 ? 52.975  26.123 89.714  1.00 60.98  ? 138 MET A CG  1 
ATOM   992  S SD  . MET A 1 138 ? 51.689  26.822 90.782  1.00 58.64  ? 138 MET A SD  1 
ATOM   993  C CE  . MET A 1 138 ? 51.119  25.390 91.675  1.00 51.84  ? 138 MET A CE  1 
ATOM   994  N N   . PRO A 1 139 ? 49.667  26.577 86.655  1.00 45.40  ? 139 PRO A N   1 
ATOM   995  C CA  . PRO A 1 139 ? 48.900  27.186 85.572  1.00 40.27  ? 139 PRO A CA  1 
ATOM   996  C C   . PRO A 1 139 ? 49.768  28.008 84.626  1.00 42.98  ? 139 PRO A C   1 
ATOM   997  O O   . PRO A 1 139 ? 50.866  28.443 84.980  1.00 43.13  ? 139 PRO A O   1 
ATOM   998  C CB  . PRO A 1 139 ? 47.916  28.069 86.326  1.00 34.80  ? 139 PRO A CB  1 
ATOM   999  C CG  . PRO A 1 139 ? 47.628  27.272 87.504  1.00 44.01  ? 139 PRO A CG  1 
ATOM   1000 C CD  . PRO A 1 139 ? 49.004  26.861 87.940  1.00 49.39  ? 139 PRO A CD  1 
ATOM   1001 N N   . ALA A 1 140 ? 49.214  28.277 83.450  1.00 43.98  ? 140 ALA A N   1 
ATOM   1002 C CA  . ALA A 1 140 ? 49.901  28.999 82.400  1.00 42.85  ? 140 ALA A CA  1 
ATOM   1003 C C   . ALA A 1 140 ? 49.924  30.525 82.453  1.00 45.34  ? 140 ALA A C   1 
ATOM   1004 O O   . ALA A 1 140 ? 51.001  31.122 82.457  1.00 44.52  ? 140 ALA A O   1 
ATOM   1005 C CB  . ALA A 1 140 ? 49.366  28.541 81.060  1.00 59.81  ? 140 ALA A CB  1 
ATOM   1006 N N   . PHE A 1 141 ? 48.743  31.148 82.420  1.00 39.95  ? 141 PHE A N   1 
ATOM   1007 C CA  . PHE A 1 141 ? 48.611  32.613 82.414  1.00 34.95  ? 141 PHE A CA  1 
ATOM   1008 C C   . PHE A 1 141 ? 49.445  33.167 81.266  1.00 39.66  ? 141 PHE A C   1 
ATOM   1009 O O   . PHE A 1 141 ? 50.458  33.819 81.488  1.00 44.82  ? 141 PHE A O   1 
ATOM   1010 C CB  . PHE A 1 141 ? 49.090  33.230 83.724  1.00 23.93  ? 141 PHE A CB  1 
ATOM   1011 C CG  . PHE A 1 141 ? 48.519  32.580 84.953  1.00 26.19  ? 141 PHE A CG  1 
ATOM   1012 C CD1 . PHE A 1 141 ? 47.144  32.486 85.139  1.00 18.03  ? 141 PHE A CD1 1 
ATOM   1013 C CD2 . PHE A 1 141 ? 49.360  32.068 85.937  1.00 29.80  ? 141 PHE A CD2 1 
ATOM   1014 C CE1 . PHE A 1 141 ? 46.618  31.894 86.286  1.00 17.32  ? 141 PHE A CE1 1 
ATOM   1015 C CE2 . PHE A 1 141 ? 48.842  31.476 87.087  1.00 31.06  ? 141 PHE A CE2 1 
ATOM   1016 C CZ  . PHE A 1 141 ? 47.472  31.390 87.262  1.00 15.76  ? 141 PHE A CZ  1 
ATOM   1017 N N   . ALA A 1 142 ? 48.994  32.895 80.042  1.00 45.71  ? 142 ALA A N   1 
ATOM   1018 C CA  . ALA A 1 142 ? 49.667  33.293 78.801  1.00 42.47  ? 142 ALA A CA  1 
ATOM   1019 C C   . ALA A 1 142 ? 49.542  34.742 78.300  1.00 38.39  ? 142 ALA A C   1 
ATOM   1020 O O   . ALA A 1 142 ? 50.328  35.177 77.461  1.00 52.80  ? 142 ALA A O   1 
ATOM   1021 C CB  . ALA A 1 142 ? 49.281  32.311 77.674  1.00 49.99  ? 142 ALA A CB  1 
ATOM   1022 N N   . SER A 1 143 ? 48.571  35.494 78.784  1.00 27.65  ? 143 SER A N   1 
ATOM   1023 C CA  . SER A 1 143 ? 48.420  36.864 78.322  1.00 16.40  ? 143 SER A CA  1 
ATOM   1024 C C   . SER A 1 143 ? 48.240  37.809 79.483  1.00 18.30  ? 143 SER A C   1 
ATOM   1025 O O   . SER A 1 143 ? 48.027  37.403 80.632  1.00 11.06  ? 143 SER A O   1 
ATOM   1026 C CB  . SER A 1 143 ? 47.186  36.990 77.446  1.00 23.64  ? 143 SER A CB  1 
ATOM   1027 O OG  . SER A 1 143 ? 46.004  37.038 78.242  1.00 28.60  ? 143 SER A OG  1 
ATOM   1028 N N   . ALA A 1 144 ? 48.214  39.086 79.157  1.00 10.74  ? 144 ALA A N   1 
ATOM   1029 C CA  . ALA A 1 144 ? 48.026  40.095 80.175  1.00 9.30   ? 144 ALA A CA  1 
ATOM   1030 C C   . ALA A 1 144 ? 46.740  39.803 80.890  1.00 20.56  ? 144 ALA A C   1 
ATOM   1031 O O   . ALA A 1 144 ? 46.683  39.728 82.113  1.00 31.27  ? 144 ALA A O   1 
ATOM   1032 C CB  . ALA A 1 144 ? 47.938  41.452 79.547  1.00 15.68  ? 144 ALA A CB  1 
ATOM   1033 N N   . PHE A 1 145 ? 45.699  39.608 80.104  1.00 23.83  ? 145 PHE A N   1 
ATOM   1034 C CA  . PHE A 1 145 ? 44.407  39.352 80.671  1.00 15.28  ? 145 PHE A CA  1 
ATOM   1035 C C   . PHE A 1 145 ? 44.427  38.097 81.525  1.00 18.99  ? 145 PHE A C   1 
ATOM   1036 O O   . PHE A 1 145 ? 43.890  38.086 82.639  1.00 15.98  ? 145 PHE A O   1 
ATOM   1037 C CB  . PHE A 1 145 ? 43.360  39.221 79.578  1.00 18.93  ? 145 PHE A CB  1 
ATOM   1038 C CG  . PHE A 1 145 ? 42.000  38.943 80.107  1.00 13.62  ? 145 PHE A CG  1 
ATOM   1039 C CD1 . PHE A 1 145 ? 41.334  39.910 80.844  1.00 19.07  ? 145 PHE A CD1 1 
ATOM   1040 C CD2 . PHE A 1 145 ? 41.427  37.684 79.960  1.00 11.10  ? 145 PHE A CD2 1 
ATOM   1041 C CE1 . PHE A 1 145 ? 40.118  39.636 81.441  1.00 2.00   ? 145 PHE A CE1 1 
ATOM   1042 C CE2 . PHE A 1 145 ? 40.211  37.386 80.553  1.00 2.25   ? 145 PHE A CE2 1 
ATOM   1043 C CZ  . PHE A 1 145 ? 39.554  38.369 81.297  1.00 13.07  ? 145 PHE A CZ  1 
ATOM   1044 N N   . GLN A 1 146 ? 45.059  37.041 81.030  1.00 3.45   ? 146 GLN A N   1 
ATOM   1045 C CA  . GLN A 1 146 ? 45.084  35.814 81.816  1.00 5.09   ? 146 GLN A CA  1 
ATOM   1046 C C   . GLN A 1 146 ? 45.738  36.065 83.176  1.00 6.55   ? 146 GLN A C   1 
ATOM   1047 O O   . GLN A 1 146 ? 45.242  35.624 84.193  1.00 25.77  ? 146 GLN A O   1 
ATOM   1048 C CB  . GLN A 1 146 ? 45.757  34.662 81.049  1.00 15.66  ? 146 GLN A CB  1 
ATOM   1049 C CG  . GLN A 1 146 ? 44.947  34.141 79.839  1.00 7.34   ? 146 GLN A CG  1 
ATOM   1050 C CD  . GLN A 1 146 ? 45.525  32.874 79.253  1.00 19.85  ? 146 GLN A CD  1 
ATOM   1051 O OE1 . GLN A 1 146 ? 46.721  32.777 79.048  1.00 30.09  ? 146 GLN A OE1 1 
ATOM   1052 N NE2 . GLN A 1 146 ? 44.677  31.899 78.973  1.00 24.58  ? 146 GLN A NE2 1 
ATOM   1053 N N   . ARG A 1 147 ? 46.794  36.858 83.200  1.00 17.77  ? 147 ARG A N   1 
ATOM   1054 C CA  . ARG A 1 147 ? 47.470  37.173 84.443  1.00 2.00   ? 147 ARG A CA  1 
ATOM   1055 C C   . ARG A 1 147 ? 46.578  38.021 85.347  1.00 11.43  ? 147 ARG A C   1 
ATOM   1056 O O   . ARG A 1 147 ? 46.521  37.788 86.551  1.00 25.56  ? 147 ARG A O   1 
ATOM   1057 C CB  . ARG A 1 147 ? 48.769  37.911 84.137  1.00 2.00   ? 147 ARG A CB  1 
ATOM   1058 C CG  . ARG A 1 147 ? 49.878  37.019 83.586  1.00 12.59  ? 147 ARG A CG  1 
ATOM   1059 C CD  . ARG A 1 147 ? 51.117  37.821 83.208  1.00 18.50  ? 147 ARG A CD  1 
ATOM   1060 N NE  . ARG A 1 147 ? 50.969  38.443 81.895  1.00 42.05  ? 147 ARG A NE  1 
ATOM   1061 C CZ  . ARG A 1 147 ? 51.580  39.561 81.521  1.00 44.42  ? 147 ARG A CZ  1 
ATOM   1062 N NH1 . ARG A 1 147 ? 52.384  40.193 82.367  1.00 63.98  ? 147 ARG A NH1 1 
ATOM   1063 N NH2 . ARG A 1 147 ? 51.423  40.027 80.289  1.00 44.39  ? 147 ARG A NH2 1 
ATOM   1064 N N   . ARG A 1 148 ? 45.869  38.988 84.767  1.00 13.59  ? 148 ARG A N   1 
ATOM   1065 C CA  . ARG A 1 148 ? 44.984  39.879 85.528  1.00 8.15   ? 148 ARG A CA  1 
ATOM   1066 C C   . ARG A 1 148 ? 43.800  39.134 86.101  1.00 8.68   ? 148 ARG A C   1 
ATOM   1067 O O   . ARG A 1 148 ? 43.413  39.359 87.237  1.00 19.46  ? 148 ARG A O   1 
ATOM   1068 C CB  . ARG A 1 148 ? 44.485  41.027 84.653  1.00 4.34   ? 148 ARG A CB  1 
ATOM   1069 C CG  . ARG A 1 148 ? 45.591  41.742 83.934  1.00 3.11   ? 148 ARG A CG  1 
ATOM   1070 C CD  . ARG A 1 148 ? 45.135  42.893 83.072  1.00 22.23  ? 148 ARG A CD  1 
ATOM   1071 N NE  . ARG A 1 148 ? 46.283  43.610 82.511  1.00 27.59  ? 148 ARG A NE  1 
ATOM   1072 C CZ  . ARG A 1 148 ? 46.200  44.687 81.742  1.00 23.17  ? 148 ARG A CZ  1 
ATOM   1073 N NH1 . ARG A 1 148 ? 45.021  45.194 81.414  1.00 33.46  ? 148 ARG A NH1 1 
ATOM   1074 N NH2 . ARG A 1 148 ? 47.309  45.291 81.348  1.00 35.81  ? 148 ARG A NH2 1 
ATOM   1075 N N   . ALA A 1 149 ? 43.210  38.249 85.316  1.00 12.08  ? 149 ALA A N   1 
ATOM   1076 C CA  . ALA A 1 149 ? 42.075  37.484 85.800  1.00 12.64  ? 149 ALA A CA  1 
ATOM   1077 C C   . ALA A 1 149 ? 42.592  36.481 86.806  1.00 12.35  ? 149 ALA A C   1 
ATOM   1078 O O   . ALA A 1 149 ? 42.067  36.385 87.912  1.00 27.45  ? 149 ALA A O   1 
ATOM   1079 C CB  . ALA A 1 149 ? 41.404  36.770 84.678  1.00 5.93   ? 149 ALA A CB  1 
ATOM   1080 N N   . GLY A 1 150 ? 43.639  35.757 86.423  1.00 6.79   ? 150 GLY A N   1 
ATOM   1081 C CA  . GLY A 1 150 ? 44.248  34.766 87.295  1.00 2.00   ? 150 GLY A CA  1 
ATOM   1082 C C   . GLY A 1 150 ? 44.486  35.364 88.668  1.00 14.74  ? 150 GLY A C   1 
ATOM   1083 O O   . GLY A 1 150 ? 44.182  34.756 89.690  1.00 27.91  ? 150 GLY A O   1 
ATOM   1084 N N   . GLY A 1 151 ? 44.970  36.594 88.686  1.00 11.32  ? 151 GLY A N   1 
ATOM   1085 C CA  . GLY A 1 151 ? 45.212  37.270 89.938  1.00 5.73   ? 151 GLY A CA  1 
ATOM   1086 C C   . GLY A 1 151 ? 43.946  37.391 90.745  1.00 5.77   ? 151 GLY A C   1 
ATOM   1087 O O   . GLY A 1 151 ? 43.936  37.038 91.919  1.00 15.43  ? 151 GLY A O   1 
ATOM   1088 N N   . VAL A 1 152 ? 42.871  37.854 90.120  1.00 4.35   ? 152 VAL A N   1 
ATOM   1089 C CA  . VAL A 1 152 ? 41.615  38.009 90.824  1.00 2.06   ? 152 VAL A CA  1 
ATOM   1090 C C   . VAL A 1 152 ? 41.106  36.691 91.367  1.00 5.21   ? 152 VAL A C   1 
ATOM   1091 O O   . VAL A 1 152 ? 40.554  36.631 92.469  1.00 15.36  ? 152 VAL A O   1 
ATOM   1092 C CB  . VAL A 1 152 ? 40.571  38.605 89.933  1.00 2.00   ? 152 VAL A CB  1 
ATOM   1093 C CG1 . VAL A 1 152 ? 39.218  38.544 90.607  1.00 9.35   ? 152 VAL A CG1 1 
ATOM   1094 C CG2 . VAL A 1 152 ? 40.923  40.028 89.664  1.00 7.60   ? 152 VAL A CG2 1 
ATOM   1095 N N   . LEU A 1 153 ? 41.310  35.634 90.596  1.00 3.72   ? 153 LEU A N   1 
ATOM   1096 C CA  . LEU A 1 153 ? 40.889  34.304 91.003  1.00 3.58   ? 153 LEU A CA  1 
ATOM   1097 C C   . LEU A 1 153 ? 41.728  33.761 92.133  1.00 7.42   ? 153 LEU A C   1 
ATOM   1098 O O   . LEU A 1 153 ? 41.188  33.323 93.151  1.00 17.63  ? 153 LEU A O   1 
ATOM   1099 C CB  . LEU A 1 153 ? 40.944  33.337 89.838  1.00 5.60   ? 153 LEU A CB  1 
ATOM   1100 C CG  . LEU A 1 153 ? 39.783  33.577 88.903  1.00 15.20  ? 153 LEU A CG  1 
ATOM   1101 C CD1 . LEU A 1 153 ? 39.858  32.700 87.677  1.00 10.85  ? 153 LEU A CD1 1 
ATOM   1102 C CD2 . LEU A 1 153 ? 38.539  33.333 89.691  1.00 7.86   ? 153 LEU A CD2 1 
ATOM   1103 N N   . VAL A 1 154 ? 43.041  33.754 91.947  1.00 10.83  ? 154 VAL A N   1 
ATOM   1104 C CA  . VAL A 1 154 ? 43.958  33.263 92.980  1.00 15.98  ? 154 VAL A CA  1 
ATOM   1105 C C   . VAL A 1 154 ? 43.738  34.013 94.293  1.00 6.33   ? 154 VAL A C   1 
ATOM   1106 O O   . VAL A 1 154 ? 43.612  33.416 95.348  1.00 20.00  ? 154 VAL A O   1 
ATOM   1107 C CB  . VAL A 1 154 ? 45.431  33.374 92.546  1.00 12.42  ? 154 VAL A CB  1 
ATOM   1108 C CG1 . VAL A 1 154 ? 46.325  32.955 93.660  1.00 3.98   ? 154 VAL A CG1 1 
ATOM   1109 C CG2 . VAL A 1 154 ? 45.683  32.519 91.336  1.00 2.00   ? 154 VAL A CG2 1 
ATOM   1110 N N   . ALA A 1 155 ? 43.601  35.315 94.212  1.00 2.00   ? 155 ALA A N   1 
ATOM   1111 C CA  . ALA A 1 155 ? 43.347  36.088 95.397  1.00 2.00   ? 155 ALA A CA  1 
ATOM   1112 C C   . ALA A 1 155 ? 42.043  35.662 96.036  1.00 5.28   ? 155 ALA A C   1 
ATOM   1113 O O   . ALA A 1 155 ? 41.923  35.628 97.253  1.00 20.59  ? 155 ALA A O   1 
ATOM   1114 C CB  . ALA A 1 155 ? 43.256  37.511 95.036  1.00 8.07   ? 155 ALA A CB  1 
ATOM   1115 N N   . SER A 1 156 ? 41.050  35.366 95.213  1.00 8.01   ? 156 SER A N   1 
ATOM   1116 C CA  . SER A 1 156 ? 39.749  34.985 95.721  1.00 2.28   ? 156 SER A CA  1 
ATOM   1117 C C   . SER A 1 156 ? 39.811  33.638 96.408  1.00 5.37   ? 156 SER A C   1 
ATOM   1118 O O   . SER A 1 156 ? 39.143  33.430 97.411  1.00 12.72  ? 156 SER A O   1 
ATOM   1119 C CB  . SER A 1 156 ? 38.736  34.960 94.588  1.00 2.00   ? 156 SER A CB  1 
ATOM   1120 O OG  . SER A 1 156 ? 37.412  35.050 95.086  1.00 46.36  ? 156 SER A OG  1 
ATOM   1121 N N   . HIS A 1 157 ? 40.622  32.727 95.880  1.00 5.37   ? 157 HIS A N   1 
ATOM   1122 C CA  . HIS A 1 157 ? 40.747  31.392 96.455  1.00 5.03   ? 157 HIS A CA  1 
ATOM   1123 C C   . HIS A 1 157 ? 41.569  31.433 97.719  1.00 9.12   ? 157 HIS A C   1 
ATOM   1124 O O   . HIS A 1 157 ? 41.279  30.732 98.691  1.00 13.03  ? 157 HIS A O   1 
ATOM   1125 C CB  . HIS A 1 157 ? 41.398  30.421 95.481  1.00 3.02   ? 157 HIS A CB  1 
ATOM   1126 C CG  . HIS A 1 157 ? 40.517  30.024 94.342  1.00 21.35  ? 157 HIS A CG  1 
ATOM   1127 N ND1 . HIS A 1 157 ? 40.868  29.046 93.437  1.00 29.70  ? 157 HIS A ND1 1 
ATOM   1128 C CD2 . HIS A 1 157 ? 39.314  30.497 93.941  1.00 19.82  ? 157 HIS A CD2 1 
ATOM   1129 C CE1 . HIS A 1 157 ? 39.921  28.939 92.523  1.00 27.64  ? 157 HIS A CE1 1 
ATOM   1130 N NE2 . HIS A 1 157 ? 38.967  29.808 92.807  1.00 15.97  ? 157 HIS A NE2 1 
ATOM   1131 N N   . LEU A 1 158 ? 42.620  32.235 97.694  1.00 10.33  ? 158 LEU A N   1 
ATOM   1132 C CA  . LEU A 1 158 ? 43.475  32.385 98.851  1.00 5.20   ? 158 LEU A CA  1 
ATOM   1133 C C   . LEU A 1 158 ? 42.602  32.883 99.965  1.00 2.00   ? 158 LEU A C   1 
ATOM   1134 O O   . LEU A 1 158 ? 42.634  32.365 101.052 1.00 13.61  ? 158 LEU A O   1 
ATOM   1135 C CB  . LEU A 1 158 ? 44.553  33.415 98.597  1.00 2.00   ? 158 LEU A CB  1 
ATOM   1136 C CG  . LEU A 1 158 ? 45.522  33.581 99.751  1.00 5.32   ? 158 LEU A CG  1 
ATOM   1137 C CD1 . LEU A 1 158 ? 46.182  32.273 100.079 1.00 2.00   ? 158 LEU A CD1 1 
ATOM   1138 C CD2 . LEU A 1 158 ? 46.560  34.558 99.326  1.00 9.58   ? 158 LEU A CD2 1 
ATOM   1139 N N   . GLN A 1 159 ? 41.785  33.872 99.662  1.00 4.25   ? 159 GLN A N   1 
ATOM   1140 C CA  . GLN A 1 159 ? 40.867  34.463 100.622 1.00 2.75   ? 159 GLN A CA  1 
ATOM   1141 C C   . GLN A 1 159 ? 39.954  33.431 101.261 1.00 4.94   ? 159 GLN A C   1 
ATOM   1142 O O   . GLN A 1 159 ? 39.830  33.387 102.477 1.00 19.19  ? 159 GLN A O   1 
ATOM   1143 C CB  . GLN A 1 159 ? 40.003  35.519 99.932  1.00 28.14  ? 159 GLN A CB  1 
ATOM   1144 C CG  . GLN A 1 159 ? 39.821  36.787 100.726 1.00 54.88  ? 159 GLN A CG  1 
ATOM   1145 C CD  . GLN A 1 159 ? 41.157  37.484 101.008 1.00 61.13  ? 159 GLN A CD  1 
ATOM   1146 O OE1 . GLN A 1 159 ? 41.462  37.831 102.151 1.00 68.29  ? 159 GLN A OE1 1 
ATOM   1147 N NE2 . GLN A 1 159 ? 41.959  37.678 99.968  1.00 58.08  ? 159 GLN A NE2 1 
ATOM   1148 N N   . SER A 1 160 ? 39.294  32.616 100.449 1.00 4.79   ? 160 SER A N   1 
ATOM   1149 C CA  . SER A 1 160 ? 38.396  31.599 100.981 1.00 9.49   ? 160 SER A CA  1 
ATOM   1150 C C   . SER A 1 160 ? 39.168  30.622 101.863 1.00 11.81  ? 160 SER A C   1 
ATOM   1151 O O   . SER A 1 160 ? 38.721  30.236 102.941 1.00 20.25  ? 160 SER A O   1 
ATOM   1152 C CB  . SER A 1 160 ? 37.689  30.863 99.836  1.00 2.00   ? 160 SER A CB  1 
ATOM   1153 O OG  . SER A 1 160 ? 36.984  31.788 99.018  1.00 36.41  ? 160 SER A OG  1 
ATOM   1154 N N   . PHE A 1 161 ? 40.356  30.255 101.413 1.00 9.10   ? 161 PHE A N   1 
ATOM   1155 C CA  . PHE A 1 161 ? 41.204  29.331 102.146 1.00 2.00   ? 161 PHE A CA  1 
ATOM   1156 C C   . PHE A 1 161 ? 41.564  29.877 103.519 1.00 14.61  ? 161 PHE A C   1 
ATOM   1157 O O   . PHE A 1 161 ? 41.570  29.146 104.504 1.00 21.27  ? 161 PHE A O   1 
ATOM   1158 C CB  . PHE A 1 161 ? 42.472  29.110 101.352 1.00 2.34   ? 161 PHE A CB  1 
ATOM   1159 C CG  . PHE A 1 161 ? 43.439  28.195 101.998 1.00 2.40   ? 161 PHE A CG  1 
ATOM   1160 C CD1 . PHE A 1 161 ? 43.230  26.826 101.975 1.00 5.05   ? 161 PHE A CD1 1 
ATOM   1161 C CD2 . PHE A 1 161 ? 44.587  28.691 102.586 1.00 2.36   ? 161 PHE A CD2 1 
ATOM   1162 C CE1 . PHE A 1 161 ? 44.157  25.972 102.526 1.00 2.00   ? 161 PHE A CE1 1 
ATOM   1163 C CE2 . PHE A 1 161 ? 45.523  27.828 103.142 1.00 9.44   ? 161 PHE A CE2 1 
ATOM   1164 C CZ  . PHE A 1 161 ? 45.307  26.475 103.111 1.00 2.00   ? 161 PHE A CZ  1 
ATOM   1165 N N   . LEU A 1 162 ? 41.873  31.163 103.588 1.00 12.73  ? 162 LEU A N   1 
ATOM   1166 C CA  . LEU A 1 162 ? 42.234  31.761 104.852 1.00 2.79   ? 162 LEU A CA  1 
ATOM   1167 C C   . LEU A 1 162 ? 41.041  31.988 105.782 1.00 2.00   ? 162 LEU A C   1 
ATOM   1168 O O   . LEU A 1 162 ? 41.215  32.002 106.988 1.00 12.03  ? 162 LEU A O   1 
ATOM   1169 C CB  . LEU A 1 162 ? 43.028  33.042 104.637 1.00 2.00   ? 162 LEU A CB  1 
ATOM   1170 C CG  . LEU A 1 162 ? 44.374  32.971 103.912 1.00 2.00   ? 162 LEU A CG  1 
ATOM   1171 C CD1 . LEU A 1 162 ? 44.885  34.371 103.769 1.00 7.23   ? 162 LEU A CD1 1 
ATOM   1172 C CD2 . LEU A 1 162 ? 45.386  32.109 104.632 1.00 2.00   ? 162 LEU A CD2 1 
ATOM   1173 N N   . GLU A 1 163 ? 39.833  32.147 105.255 1.00 2.00   ? 163 GLU A N   1 
ATOM   1174 C CA  . GLU A 1 163 ? 38.683  32.323 106.145 1.00 7.42   ? 163 GLU A CA  1 
ATOM   1175 C C   . GLU A 1 163 ? 38.445  31.039 106.908 1.00 11.65  ? 163 GLU A C   1 
ATOM   1176 O O   . GLU A 1 163 ? 38.180  31.076 108.100 1.00 26.49  ? 163 GLU A O   1 
ATOM   1177 C CB  . GLU A 1 163 ? 37.404  32.760 105.411 1.00 2.47   ? 163 GLU A CB  1 
ATOM   1178 C CG  . GLU A 1 163 ? 37.470  34.199 104.875 1.00 64.66  ? 163 GLU A CG  1 
ATOM   1179 C CD  . GLU A 1 163 ? 36.165  34.688 104.236 1.00 91.84  ? 163 GLU A CD  1 
ATOM   1180 O OE1 . GLU A 1 163 ? 35.899  34.366 103.050 1.00 109.71 ? 163 GLU A OE1 1 
ATOM   1181 O OE2 . GLU A 1 163 ? 35.414  35.423 104.915 1.00 109.51 ? 163 GLU A OE2 1 
ATOM   1182 N N   . VAL A 1 164 ? 38.576  29.899 106.228 1.00 14.64  ? 164 VAL A N   1 
ATOM   1183 C CA  . VAL A 1 164 ? 38.384  28.588 106.869 1.00 3.30   ? 164 VAL A CA  1 
ATOM   1184 C C   . VAL A 1 164 ? 39.522  28.367 107.850 1.00 11.13  ? 164 VAL A C   1 
ATOM   1185 O O   . VAL A 1 164 ? 39.292  27.978 108.982 1.00 29.02  ? 164 VAL A O   1 
ATOM   1186 C CB  . VAL A 1 164 ? 38.400  27.415 105.861 1.00 2.00   ? 164 VAL A CB  1 
ATOM   1187 C CG1 . VAL A 1 164 ? 38.029  26.128 106.566 1.00 4.68   ? 164 VAL A CG1 1 
ATOM   1188 C CG2 . VAL A 1 164 ? 37.473  27.678 104.703 1.00 2.00   ? 164 VAL A CG2 1 
ATOM   1189 N N   . SER A 1 165 ? 40.753  28.588 107.400 1.00 12.92  ? 165 SER A N   1 
ATOM   1190 C CA  . SER A 1 165 ? 41.929  28.445 108.255 1.00 8.74   ? 165 SER A CA  1 
ATOM   1191 C C   . SER A 1 165 ? 41.767  29.257 109.548 1.00 9.69   ? 165 SER A C   1 
ATOM   1192 O O   . SER A 1 165 ? 42.047  28.774 110.643 1.00 13.67  ? 165 SER A O   1 
ATOM   1193 C CB  . SER A 1 165 ? 43.184  28.928 107.519 1.00 2.00   ? 165 SER A CB  1 
ATOM   1194 O OG  . SER A 1 165 ? 43.474  28.117 106.407 1.00 15.63  ? 165 SER A OG  1 
ATOM   1195 N N   . TYR A 1 166 ? 41.310  30.493 109.417 1.00 9.41   ? 166 TYR A N   1 
ATOM   1196 C CA  . TYR A 1 166 ? 41.103  31.342 110.569 1.00 2.00   ? 166 TYR A CA  1 
ATOM   1197 C C   . TYR A 1 166 ? 40.191  30.628 111.565 1.00 4.05   ? 166 TYR A C   1 
ATOM   1198 O O   . TYR A 1 166 ? 40.519  30.546 112.728 1.00 16.58  ? 166 TYR A O   1 
ATOM   1199 C CB  . TYR A 1 166 ? 40.482  32.664 110.139 1.00 3.13   ? 166 TYR A CB  1 
ATOM   1200 C CG  . TYR A 1 166 ? 40.613  33.708 111.179 1.00 11.65  ? 166 TYR A CG  1 
ATOM   1201 C CD1 . TYR A 1 166 ? 41.823  34.351 111.373 1.00 12.35  ? 166 TYR A CD1 1 
ATOM   1202 C CD2 . TYR A 1 166 ? 39.559  34.003 112.030 1.00 19.59  ? 166 TYR A CD2 1 
ATOM   1203 C CE1 . TYR A 1 166 ? 41.992  35.255 112.389 1.00 20.73  ? 166 TYR A CE1 1 
ATOM   1204 C CE2 . TYR A 1 166 ? 39.714  34.908 113.057 1.00 18.33  ? 166 TYR A CE2 1 
ATOM   1205 C CZ  . TYR A 1 166 ? 40.940  35.532 113.237 1.00 24.45  ? 166 TYR A CZ  1 
ATOM   1206 O OH  . TYR A 1 166 ? 41.147  36.395 114.295 1.00 36.48  ? 166 TYR A OH  1 
ATOM   1207 N N   . ARG A 1 167 ? 39.074  30.072 111.108 1.00 11.88  ? 167 ARG A N   1 
ATOM   1208 C CA  . ARG A 1 167 ? 38.164  29.371 112.019 1.00 15.53  ? 167 ARG A CA  1 
ATOM   1209 C C   . ARG A 1 167 ? 38.815  28.148 112.640 1.00 16.86  ? 167 ARG A C   1 
ATOM   1210 O O   . ARG A 1 167 ? 38.691  27.924 113.844 1.00 42.14  ? 167 ARG A O   1 
ATOM   1211 C CB  . ARG A 1 167 ? 36.822  28.973 111.375 1.00 21.47  ? 167 ARG A CB  1 
ATOM   1212 C CG  . ARG A 1 167 ? 35.951  30.136 110.835 1.00 54.06  ? 167 ARG A CG  1 
ATOM   1213 C CD  . ARG A 1 167 ? 35.909  31.395 111.712 1.00 81.51  ? 167 ARG A CD  1 
ATOM   1214 N NE  . ARG A 1 167 ? 35.248  31.209 113.006 1.00 105.26 ? 167 ARG A NE  1 
ATOM   1215 C CZ  . ARG A 1 167 ? 34.932  32.204 113.839 1.00 116.88 ? 167 ARG A CZ  1 
ATOM   1216 N NH1 . ARG A 1 167 ? 35.206  33.465 113.518 1.00 128.12 ? 167 ARG A NH1 1 
ATOM   1217 N NH2 . ARG A 1 167 ? 34.354  31.939 115.006 1.00 121.01 ? 167 ARG A NH2 1 
ATOM   1218 N N   . VAL A 1 168 ? 39.528  27.369 111.844 1.00 11.68  ? 168 VAL A N   1 
ATOM   1219 C CA  . VAL A 1 168 ? 40.202  26.184 112.357 1.00 12.24  ? 168 VAL A CA  1 
ATOM   1220 C C   . VAL A 1 168 ? 41.196  26.588 113.447 1.00 16.61  ? 168 VAL A C   1 
ATOM   1221 O O   . VAL A 1 168 ? 41.123  26.097 114.574 1.00 29.91  ? 168 VAL A O   1 
ATOM   1222 C CB  . VAL A 1 168 ? 40.933  25.442 111.225 1.00 12.63  ? 168 VAL A CB  1 
ATOM   1223 C CG1 . VAL A 1 168 ? 41.788  24.335 111.777 1.00 15.93  ? 168 VAL A CG1 1 
ATOM   1224 C CG2 . VAL A 1 168 ? 39.919  24.888 110.229 1.00 22.37  ? 168 VAL A CG2 1 
ATOM   1225 N N   . LEU A 1 169 ? 42.091  27.515 113.129 1.00 17.10  ? 169 LEU A N   1 
ATOM   1226 C CA  . LEU A 1 169 ? 43.090  27.973 114.096 1.00 19.03  ? 169 LEU A CA  1 
ATOM   1227 C C   . LEU A 1 169 ? 42.453  28.617 115.331 1.00 20.48  ? 169 LEU A C   1 
ATOM   1228 O O   . LEU A 1 169 ? 42.791  28.258 116.451 1.00 38.55  ? 169 LEU A O   1 
ATOM   1229 C CB  . LEU A 1 169 ? 44.091  28.937 113.436 1.00 5.52   ? 169 LEU A CB  1 
ATOM   1230 C CG  . LEU A 1 169 ? 44.952  28.345 112.308 1.00 7.29   ? 169 LEU A CG  1 
ATOM   1231 C CD1 . LEU A 1 169 ? 45.766  29.422 111.604 1.00 2.00   ? 169 LEU A CD1 1 
ATOM   1232 C CD2 . LEU A 1 169 ? 45.864  27.283 112.877 1.00 2.88   ? 169 LEU A CD2 1 
ATOM   1233 N N   . ARG A 1 170 ? 41.473  29.495 115.134 1.00 22.56  ? 170 ARG A N   1 
ATOM   1234 C CA  . ARG A 1 170 ? 40.805  30.176 116.253 1.00 16.37  ? 170 ARG A CA  1 
ATOM   1235 C C   . ARG A 1 170 ? 40.302  29.155 117.257 1.00 18.60  ? 170 ARG A C   1 
ATOM   1236 O O   . ARG A 1 170 ? 40.367  29.363 118.460 1.00 40.52  ? 170 ARG A O   1 
ATOM   1237 C CB  . ARG A 1 170 ? 39.626  31.046 115.766 1.00 10.05  ? 170 ARG A CB  1 
ATOM   1238 C CG  . ARG A 1 170 ? 39.344  32.279 116.649 1.00 46.09  ? 170 ARG A CG  1 
ATOM   1239 C CD  . ARG A 1 170 ? 38.295  33.229 116.047 1.00 75.33  ? 170 ARG A CD  1 
ATOM   1240 N NE  . ARG A 1 170 ? 38.314  34.542 116.703 1.00 103.96 ? 170 ARG A NE  1 
ATOM   1241 C CZ  . ARG A 1 170 ? 37.627  35.611 116.296 1.00 115.73 ? 170 ARG A CZ  1 
ATOM   1242 N NH1 . ARG A 1 170 ? 36.845  35.547 115.224 1.00 122.72 ? 170 ARG A NH1 1 
ATOM   1243 N NH2 . ARG A 1 170 ? 37.736  36.761 116.953 1.00 122.26 ? 170 ARG A NH2 1 
ATOM   1244 N N   . HIS A 1 171 ? 39.814  28.042 116.744 1.00 20.76  ? 171 HIS A N   1 
ATOM   1245 C CA  . HIS A 1 171 ? 39.290  26.964 117.551 1.00 23.29  ? 171 HIS A CA  1 
ATOM   1246 C C   . HIS A 1 171 ? 40.418  26.302 118.343 1.00 27.02  ? 171 HIS A C   1 
ATOM   1247 O O   . HIS A 1 171 ? 40.344  26.193 119.561 1.00 44.87  ? 171 HIS A O   1 
ATOM   1248 C CB  . HIS A 1 171 ? 38.570  25.974 116.627 1.00 25.78  ? 171 HIS A CB  1 
ATOM   1249 C CG  . HIS A 1 171 ? 38.233  24.668 117.268 1.00 58.64  ? 171 HIS A CG  1 
ATOM   1250 N ND1 . HIS A 1 171 ? 37.225  24.533 118.197 1.00 75.10  ? 171 HIS A ND1 1 
ATOM   1251 C CD2 . HIS A 1 171 ? 38.757  23.430 117.098 1.00 67.55  ? 171 HIS A CD2 1 
ATOM   1252 C CE1 . HIS A 1 171 ? 37.139  23.267 118.570 1.00 80.56  ? 171 HIS A CE1 1 
ATOM   1253 N NE2 . HIS A 1 171 ? 38.057  22.577 117.917 1.00 72.43  ? 171 HIS A NE2 1 
ATOM   1254 N N   . LEU A 1 172 ? 41.461  25.864 117.654 1.00 26.91  ? 172 LEU A N   1 
ATOM   1255 C CA  . LEU A 1 172 ? 42.600  25.233 118.311 1.00 26.65  ? 172 LEU A CA  1 
ATOM   1256 C C   . LEU A 1 172 ? 43.174  26.098 119.438 1.00 34.15  ? 172 LEU A C   1 
ATOM   1257 O O   . LEU A 1 172 ? 43.646  25.576 120.444 1.00 38.59  ? 172 LEU A O   1 
ATOM   1258 C CB  . LEU A 1 172 ? 43.699  24.962 117.286 1.00 13.46  ? 172 LEU A CB  1 
ATOM   1259 C CG  . LEU A 1 172 ? 43.379  23.965 116.169 1.00 15.33  ? 172 LEU A CG  1 
ATOM   1260 C CD1 . LEU A 1 172 ? 44.622  23.610 115.356 1.00 16.24  ? 172 LEU A CD1 1 
ATOM   1261 C CD2 . LEU A 1 172 ? 42.845  22.717 116.798 1.00 23.54  ? 172 LEU A CD2 1 
ATOM   1262 N N   . ALA A 1 173 ? 43.139  27.414 119.255 1.00 46.34  ? 173 ALA A N   1 
ATOM   1263 C CA  . ALA A 1 173 ? 43.654  28.350 120.246 1.00 70.42  ? 173 ALA A CA  1 
ATOM   1264 C C   . ALA A 1 173 ? 42.934  28.253 121.590 1.00 87.76  ? 173 ALA A C   1 
ATOM   1265 O O   . ALA A 1 173 ? 43.455  28.678 122.614 1.00 88.98  ? 173 ALA A O   1 
ATOM   1266 C CB  . ALA A 1 173 ? 43.614  29.760 119.708 1.00 68.96  ? 173 ALA A CB  1 
ATOM   1267 N N   . GLN A 1 174 ? 41.769  27.623 121.610 1.00 114.74 ? 174 GLN A N   1 
ATOM   1268 C CA  . GLN A 1 174 ? 41.067  27.450 122.868 1.00 143.74 ? 174 GLN A CA  1 
ATOM   1269 C C   . GLN A 1 174 ? 40.551  26.012 123.038 1.00 162.37 ? 174 GLN A C   1 
ATOM   1270 O O   . GLN A 1 174 ? 39.398  25.716 122.716 1.00 162.97 ? 174 GLN A O   1 
ATOM   1271 C CB  . GLN A 1 174 ? 39.943  28.481 123.011 1.00 148.29 ? 174 GLN A CB  1 
ATOM   1272 C CG  . GLN A 1 174 ? 39.365  28.572 124.426 1.00 156.87 ? 174 GLN A CG  1 
ATOM   1273 C CD  . GLN A 1 174 ? 40.420  28.857 125.488 1.00 157.62 ? 174 GLN A CD  1 
ATOM   1274 O OE1 . GLN A 1 174 ? 40.854  29.996 125.656 1.00 160.91 ? 174 GLN A OE1 1 
ATOM   1275 N NE2 . GLN A 1 174 ? 40.831  27.822 126.214 1.00 157.15 ? 174 GLN A NE2 1 
ATOM   1276 N N   . PRO A 1 175 ? 41.438  25.084 123.457 1.00 180.07 ? 175 PRO A N   1 
ATOM   1277 C CA  . PRO A 1 175 ? 41.107  23.672 123.676 1.00 189.69 ? 175 PRO A CA  1 
ATOM   1278 C C   . PRO A 1 175 ? 40.949  23.341 125.172 1.00 194.87 ? 175 PRO A C   1 
ATOM   1279 O O   . PRO A 1 175 ? 40.766  24.282 125.980 1.00 198.62 ? 175 PRO A O   1 
ATOM   1280 C CB  . PRO A 1 175 ? 42.316  22.964 123.078 1.00 192.32 ? 175 PRO A CB  1 
ATOM   1281 C CG  . PRO A 1 175 ? 43.436  23.828 123.561 1.00 193.57 ? 175 PRO A CG  1 
ATOM   1282 C CD  . PRO A 1 175 ? 42.905  25.260 123.421 1.00 188.33 ? 175 PRO A CD  1 
ATOM   1283 O OXT . PRO A 1 175 ? 41.021  22.143 125.525 1.00 195.91 ? 175 PRO A OXT 1 
ATOM   1284 N N   . ALA B 2 1   ? 97.202  57.135 118.771 1.00 79.13  ? 1   ALA B N   1 
ATOM   1285 C CA  . ALA B 2 1   ? 97.368  55.819 119.464 1.00 82.13  ? 1   ALA B CA  1 
ATOM   1286 C C   . ALA B 2 1   ? 96.516  54.750 118.767 1.00 78.33  ? 1   ALA B C   1 
ATOM   1287 O O   . ALA B 2 1   ? 96.107  54.937 117.610 1.00 83.46  ? 1   ALA B O   1 
ATOM   1288 C CB  . ALA B 2 1   ? 96.983  55.939 120.952 1.00 80.62  ? 1   ALA B CB  1 
ATOM   1289 N N   . GLY B 2 2   ? 96.258  53.643 119.464 1.00 65.66  ? 2   GLY B N   1 
ATOM   1290 C CA  . GLY B 2 2   ? 95.452  52.575 118.897 1.00 47.69  ? 2   GLY B CA  1 
ATOM   1291 C C   . GLY B 2 2   ? 95.152  51.461 119.885 1.00 37.94  ? 2   GLY B C   1 
ATOM   1292 O O   . GLY B 2 2   ? 96.043  50.961 120.564 1.00 40.96  ? 2   GLY B O   1 
ATOM   1293 N N   . TYR B 2 3   ? 93.885  51.105 120.023 1.00 25.20  ? 3   TYR B N   1 
ATOM   1294 C CA  . TYR B 2 3   ? 93.521  50.026 120.926 1.00 22.96  ? 3   TYR B CA  1 
ATOM   1295 C C   . TYR B 2 3   ? 92.627  49.042 120.163 1.00 26.76  ? 3   TYR B C   1 
ATOM   1296 O O   . TYR B 2 3   ? 92.032  49.396 119.141 1.00 30.56  ? 3   TYR B O   1 
ATOM   1297 C CB  . TYR B 2 3   ? 92.780  50.562 122.144 1.00 15.59  ? 3   TYR B CB  1 
ATOM   1298 C CG  . TYR B 2 3   ? 93.448  51.733 122.858 1.00 33.33  ? 3   TYR B CG  1 
ATOM   1299 C CD1 . TYR B 2 3   ? 94.149  51.540 124.055 1.00 33.41  ? 3   TYR B CD1 1 
ATOM   1300 C CD2 . TYR B 2 3   ? 93.299  53.043 122.395 1.00 37.98  ? 3   TYR B CD2 1 
ATOM   1301 C CE1 . TYR B 2 3   ? 94.672  52.617 124.781 1.00 30.14  ? 3   TYR B CE1 1 
ATOM   1302 C CE2 . TYR B 2 3   ? 93.821  54.128 123.111 1.00 39.87  ? 3   TYR B CE2 1 
ATOM   1303 C CZ  . TYR B 2 3   ? 94.501  53.904 124.307 1.00 45.02  ? 3   TYR B CZ  1 
ATOM   1304 O OH  . TYR B 2 3   ? 94.984  54.967 125.045 1.00 49.47  ? 3   TYR B OH  1 
ATOM   1305 N N   . PRO B 2 4   ? 92.645  47.763 120.547 1.00 21.92  ? 4   PRO B N   1 
ATOM   1306 C CA  . PRO B 2 4   ? 91.801  46.788 119.858 1.00 26.43  ? 4   PRO B CA  1 
ATOM   1307 C C   . PRO B 2 4   ? 90.359  46.959 120.372 1.00 35.65  ? 4   PRO B C   1 
ATOM   1308 O O   . PRO B 2 4   ? 90.150  47.389 121.518 1.00 41.22  ? 4   PRO B O   1 
ATOM   1309 C CB  . PRO B 2 4   ? 92.408  45.463 120.294 1.00 26.45  ? 4   PRO B CB  1 
ATOM   1310 C CG  . PRO B 2 4   ? 92.898  45.764 121.673 1.00 32.13  ? 4   PRO B CG  1 
ATOM   1311 C CD  . PRO B 2 4   ? 93.565  47.093 121.477 1.00 24.27  ? 4   PRO B CD  1 
ATOM   1312 N N   . PRO B 2 5   ? 89.353  46.628 119.533 1.00 29.50  ? 5   PRO B N   1 
ATOM   1313 C CA  . PRO B 2 5   ? 87.906  46.707 119.777 1.00 16.32  ? 5   PRO B CA  1 
ATOM   1314 C C   . PRO B 2 5   ? 87.356  46.087 121.040 1.00 17.44  ? 5   PRO B C   1 
ATOM   1315 O O   . PRO B 2 5   ? 87.827  45.052 121.499 1.00 37.00  ? 5   PRO B O   1 
ATOM   1316 C CB  . PRO B 2 5   ? 87.326  45.988 118.574 1.00 17.61  ? 5   PRO B CB  1 
ATOM   1317 C CG  . PRO B 2 5   ? 88.256  46.310 117.540 1.00 23.27  ? 5   PRO B CG  1 
ATOM   1318 C CD  . PRO B 2 5   ? 89.597  46.103 118.185 1.00 27.51  ? 5   PRO B CD  1 
ATOM   1319 N N   . ALA B 2 6   ? 86.307  46.705 121.567 1.00 18.45  ? 6   ALA B N   1 
ATOM   1320 C CA  . ALA B 2 6   ? 85.643  46.210 122.759 1.00 13.08  ? 6   ALA B CA  1 
ATOM   1321 C C   . ALA B 2 6   ? 84.378  45.510 122.289 1.00 20.42  ? 6   ALA B C   1 
ATOM   1322 O O   . ALA B 2 6   ? 83.778  45.913 121.288 1.00 24.31  ? 6   ALA B O   1 
ATOM   1323 C CB  . ALA B 2 6   ? 85.290  47.353 123.663 1.00 4.09   ? 6   ALA B CB  1 
ATOM   1324 N N   . SER B 2 7   ? 84.005  44.438 122.972 1.00 12.88  ? 7   SER B N   1 
ATOM   1325 C CA  . SER B 2 7   ? 82.806  43.700 122.634 1.00 18.06  ? 7   SER B CA  1 
ATOM   1326 C C   . SER B 2 7   ? 81.586  44.592 122.877 1.00 25.84  ? 7   SER B C   1 
ATOM   1327 O O   . SER B 2 7   ? 81.359  45.059 124.002 1.00 43.02  ? 7   SER B O   1 
ATOM   1328 C CB  . SER B 2 7   ? 82.717  42.432 123.484 1.00 23.32  ? 7   SER B CB  1 
ATOM   1329 O OG  . SER B 2 7   ? 83.778  41.536 123.171 1.00 53.55  ? 7   SER B OG  1 
ATOM   1330 N N   . PRO B 2 8   ? 80.835  44.902 121.806 1.00 12.26  ? 8   PRO B N   1 
ATOM   1331 C CA  . PRO B 2 8   ? 79.637  45.730 121.818 1.00 2.00   ? 8   PRO B CA  1 
ATOM   1332 C C   . PRO B 2 8   ? 78.595  45.292 122.832 1.00 10.21  ? 8   PRO B C   1 
ATOM   1333 O O   . PRO B 2 8   ? 78.491  44.099 123.142 1.00 25.62  ? 8   PRO B O   1 
ATOM   1334 C CB  . PRO B 2 8   ? 79.151  45.590 120.393 1.00 2.00   ? 8   PRO B CB  1 
ATOM   1335 C CG  . PRO B 2 8   ? 80.453  45.616 119.631 1.00 2.00   ? 8   PRO B CG  1 
ATOM   1336 C CD  . PRO B 2 8   ? 81.215  44.595 120.416 1.00 12.49  ? 8   PRO B CD  1 
ATOM   1337 N N   . SER B 2 9   ? 77.834  46.255 123.365 1.00 13.12  ? 9   SER B N   1 
ATOM   1338 C CA  . SER B 2 9   ? 76.800  45.961 124.365 1.00 17.84  ? 9   SER B CA  1 
ATOM   1339 C C   . SER B 2 9   ? 75.486  46.675 124.059 1.00 18.66  ? 9   SER B C   1 
ATOM   1340 O O   . SER B 2 9   ? 75.399  47.388 123.064 1.00 23.57  ? 9   SER B O   1 
ATOM   1341 C CB  . SER B 2 9   ? 77.293  46.294 125.793 1.00 29.65  ? 9   SER B CB  1 
ATOM   1342 O OG  . SER B 2 9   ? 77.667  47.662 125.976 1.00 26.55  ? 9   SER B OG  1 
ATOM   1343 N N   . ASN B 2 10  ? 74.502  46.526 124.952 1.00 29.83  ? 10  ASN B N   1 
ATOM   1344 C CA  . ASN B 2 10  ? 73.150  47.116 124.829 1.00 29.98  ? 10  ASN B CA  1 
ATOM   1345 C C   . ASN B 2 10  ? 72.652  47.024 123.375 1.00 23.78  ? 10  ASN B C   1 
ATOM   1346 O O   . ASN B 2 10  ? 72.231  48.015 122.776 1.00 27.27  ? 10  ASN B O   1 
ATOM   1347 C CB  . ASN B 2 10  ? 73.057  48.571 125.414 1.00 41.03  ? 10  ASN B CB  1 
ATOM   1348 C CG  . ASN B 2 10  ? 71.603  48.965 125.869 1.00 55.06  ? 10  ASN B CG  1 
ATOM   1349 O OD1 . ASN B 2 10  ? 70.742  48.079 125.914 1.00 61.34  ? 10  ASN B OD1 1 
ATOM   1350 N ND2 . ASN B 2 10  ? 71.347  50.241 126.246 1.00 69.56  ? 10  ASN B ND2 1 
ATOM   1351 N N   . LEU B 2 11  ? 72.768  45.826 122.798 1.00 7.84   ? 11  LEU B N   1 
ATOM   1352 C CA  . LEU B 2 11  ? 72.292  45.582 121.437 1.00 10.19  ? 11  LEU B CA  1 
ATOM   1353 C C   . LEU B 2 11  ? 70.789  45.362 121.515 1.00 16.24  ? 11  LEU B C   1 
ATOM   1354 O O   . LEU B 2 11  ? 70.322  44.537 122.316 1.00 18.28  ? 11  LEU B O   1 
ATOM   1355 C CB  . LEU B 2 11  ? 72.942  44.331 120.844 1.00 9.18   ? 11  LEU B CB  1 
ATOM   1356 C CG  . LEU B 2 11  ? 72.413  43.725 119.525 1.00 9.67   ? 11  LEU B CG  1 
ATOM   1357 C CD1 . LEU B 2 11  ? 72.856  44.498 118.334 1.00 2.00   ? 11  LEU B CD1 1 
ATOM   1358 C CD2 . LEU B 2 11  ? 72.910  42.312 119.372 1.00 3.80   ? 11  LEU B CD2 1 
ATOM   1359 N N   . SER B 2 12  ? 70.035  46.101 120.700 1.00 11.17  ? 12  SER B N   1 
ATOM   1360 C CA  . SER B 2 12  ? 68.585  45.979 120.685 1.00 4.38   ? 12  SER B CA  1 
ATOM   1361 C C   . SER B 2 12  ? 68.113  46.094 119.252 1.00 6.83   ? 12  SER B C   1 
ATOM   1362 O O   . SER B 2 12  ? 68.792  46.639 118.379 1.00 5.31   ? 12  SER B O   1 
ATOM   1363 C CB  . SER B 2 12  ? 67.941  47.070 121.543 1.00 4.38   ? 12  SER B CB  1 
ATOM   1364 O OG  . SER B 2 12  ? 67.999  48.333 120.907 1.00 17.63  ? 12  SER B OG  1 
ATOM   1365 N N   . CYS B 2 13  ? 66.929  45.587 119.007 1.00 8.70   ? 13  CYS B N   1 
ATOM   1366 C CA  . CYS B 2 13  ? 66.402  45.666 117.682 1.00 6.48   ? 13  CYS B CA  1 
ATOM   1367 C C   . CYS B 2 13  ? 64.940  45.973 117.797 1.00 11.15  ? 13  CYS B C   1 
ATOM   1368 O O   . CYS B 2 13  ? 64.297  45.642 118.791 1.00 12.15  ? 13  CYS B O   1 
ATOM   1369 C CB  . CYS B 2 13  ? 66.596  44.343 116.984 1.00 5.46   ? 13  CYS B CB  1 
ATOM   1370 S SG  . CYS B 2 13  ? 68.338  43.903 116.795 1.00 22.98  ? 13  CYS B SG  1 
ATOM   1371 N N   . LEU B 2 14  ? 64.431  46.666 116.801 1.00 2.00   ? 14  LEU B N   1 
ATOM   1372 C CA  . LEU B 2 14  ? 63.041  46.991 116.768 1.00 2.00   ? 14  LEU B CA  1 
ATOM   1373 C C   . LEU B 2 14  ? 62.648  46.805 115.336 1.00 2.83   ? 14  LEU B C   1 
ATOM   1374 O O   . LEU B 2 14  ? 63.409  47.153 114.445 1.00 7.05   ? 14  LEU B O   1 
ATOM   1375 C CB  . LEU B 2 14  ? 62.822  48.437 117.163 1.00 2.00   ? 14  LEU B CB  1 
ATOM   1376 C CG  . LEU B 2 14  ? 62.904  48.746 118.645 1.00 6.95   ? 14  LEU B CG  1 
ATOM   1377 C CD1 . LEU B 2 14  ? 62.556  50.170 118.775 1.00 9.62   ? 14  LEU B CD1 1 
ATOM   1378 C CD2 . LEU B 2 14  ? 61.945  47.881 119.464 1.00 12.36  ? 14  LEU B CD2 1 
ATOM   1379 N N   . MET B 2 15  ? 61.455  46.268 115.125 1.00 10.89  ? 15  MET B N   1 
ATOM   1380 C CA  . MET B 2 15  ? 60.905  46.039 113.800 1.00 3.01   ? 15  MET B CA  1 
ATOM   1381 C C   . MET B 2 15  ? 60.102  47.260 113.390 1.00 11.11  ? 15  MET B C   1 
ATOM   1382 O O   . MET B 2 15  ? 59.144  47.631 114.070 1.00 18.12  ? 15  MET B O   1 
ATOM   1383 C CB  . MET B 2 15  ? 59.989  44.820 113.828 1.00 11.90  ? 15  MET B CB  1 
ATOM   1384 C CG  . MET B 2 15  ? 59.487  44.405 112.474 1.00 2.00   ? 15  MET B CG  1 
ATOM   1385 S SD  . MET B 2 15  ? 60.760  43.923 111.345 1.00 18.17  ? 15  MET B SD  1 
ATOM   1386 C CE  . MET B 2 15  ? 59.864  43.994 109.867 1.00 16.72  ? 15  MET B CE  1 
ATOM   1387 N N   . HIS B 2 16  ? 60.502  47.902 112.299 1.00 5.12   ? 16  HIS B N   1 
ATOM   1388 C CA  . HIS B 2 16  ? 59.796  49.082 111.839 1.00 2.00   ? 16  HIS B CA  1 
ATOM   1389 C C   . HIS B 2 16  ? 58.832  48.737 110.744 1.00 3.16   ? 16  HIS B C   1 
ATOM   1390 O O   . HIS B 2 16  ? 59.243  48.307 109.674 1.00 13.51  ? 16  HIS B O   1 
ATOM   1391 C CB  . HIS B 2 16  ? 60.782  50.102 111.345 1.00 6.95   ? 16  HIS B CB  1 
ATOM   1392 C CG  . HIS B 2 16  ? 61.405  50.898 112.439 1.00 13.78  ? 16  HIS B CG  1 
ATOM   1393 N ND1 . HIS B 2 16  ? 62.410  50.406 113.236 1.00 18.09  ? 16  HIS B ND1 1 
ATOM   1394 C CD2 . HIS B 2 16  ? 61.136  52.140 112.895 1.00 25.43  ? 16  HIS B CD2 1 
ATOM   1395 C CE1 . HIS B 2 16  ? 62.735  51.307 114.143 1.00 17.81  ? 16  HIS B CE1 1 
ATOM   1396 N NE2 . HIS B 2 16  ? 61.974  52.368 113.958 1.00 30.01  ? 16  HIS B NE2 1 
ATOM   1397 N N   . LEU B 2 17  ? 57.545  48.892 111.010 1.00 5.20   ? 17  LEU B N   1 
ATOM   1398 C CA  . LEU B 2 17  ? 56.517  48.565 110.019 1.00 2.00   ? 17  LEU B CA  1 
ATOM   1399 C C   . LEU B 2 17  ? 56.434  49.576 108.897 1.00 5.01   ? 17  LEU B C   1 
ATOM   1400 O O   . LEU B 2 17  ? 55.940  49.274 107.822 1.00 11.17  ? 17  LEU B O   1 
ATOM   1401 C CB  . LEU B 2 17  ? 55.154  48.439 110.682 1.00 2.00   ? 17  LEU B CB  1 
ATOM   1402 C CG  . LEU B 2 17  ? 55.044  47.365 111.751 1.00 8.19   ? 17  LEU B CG  1 
ATOM   1403 C CD1 . LEU B 2 17  ? 53.602  47.204 112.172 1.00 2.00   ? 17  LEU B CD1 1 
ATOM   1404 C CD2 . LEU B 2 17  ? 55.553  46.077 111.194 1.00 2.00   ? 17  LEU B CD2 1 
ATOM   1405 N N   . THR B 2 18  ? 56.912  50.783 109.173 1.00 15.40  ? 18  THR B N   1 
ATOM   1406 C CA  . THR B 2 18  ? 56.914  51.873 108.210 1.00 17.74  ? 18  THR B CA  1 
ATOM   1407 C C   . THR B 2 18  ? 57.870  51.548 107.064 1.00 22.84  ? 18  THR B C   1 
ATOM   1408 O O   . THR B 2 18  ? 57.505  51.610 105.890 1.00 33.18  ? 18  THR B O   1 
ATOM   1409 C CB  . THR B 2 18  ? 57.329  53.230 108.904 1.00 24.82  ? 18  THR B CB  1 
ATOM   1410 O OG1 . THR B 2 18  ? 58.337  53.008 109.907 1.00 31.53  ? 18  THR B OG1 1 
ATOM   1411 C CG2 . THR B 2 18  ? 56.137  53.867 109.582 1.00 38.02  ? 18  THR B CG2 1 
ATOM   1412 N N   . THR B 2 19  ? 59.075  51.124 107.435 1.00 19.55  ? 19  THR B N   1 
ATOM   1413 C CA  . THR B 2 19  ? 60.135  50.800 106.498 1.00 7.26   ? 19  THR B CA  1 
ATOM   1414 C C   . THR B 2 19  ? 60.225  49.305 106.229 1.00 9.49   ? 19  THR B C   1 
ATOM   1415 O O   . THR B 2 19  ? 60.900  48.863 105.301 1.00 15.57  ? 19  THR B O   1 
ATOM   1416 C CB  . THR B 2 19  ? 61.470  51.325 107.037 1.00 6.15   ? 19  THR B CB  1 
ATOM   1417 O OG1 . THR B 2 19  ? 61.790  50.689 108.281 1.00 29.99  ? 19  THR B OG1 1 
ATOM   1418 C CG2 . THR B 2 19  ? 61.381  52.801 107.301 1.00 29.79  ? 19  THR B CG2 1 
ATOM   1419 N N   . ASN B 2 20  ? 59.538  48.534 107.059 1.00 15.78  ? 20  ASN B N   1 
ATOM   1420 C CA  . ASN B 2 20  ? 59.508  47.082 106.949 1.00 21.18  ? 20  ASN B CA  1 
ATOM   1421 C C   . ASN B 2 20  ? 60.940  46.537 106.975 1.00 20.99  ? 20  ASN B C   1 
ATOM   1422 O O   . ASN B 2 20  ? 61.438  45.943 106.009 1.00 20.73  ? 20  ASN B O   1 
ATOM   1423 C CB  . ASN B 2 20  ? 58.740  46.662 105.685 1.00 13.28  ? 20  ASN B CB  1 
ATOM   1424 C CG  . ASN B 2 20  ? 57.944  45.377 105.873 1.00 31.24  ? 20  ASN B CG  1 
ATOM   1425 O OD1 . ASN B 2 20  ? 57.749  44.630 104.911 1.00 43.34  ? 20  ASN B OD1 1 
ATOM   1426 N ND2 . ASN B 2 20  ? 57.456  45.123 107.097 1.00 24.41  ? 20  ASN B ND2 1 
ATOM   1427 N N   . SER B 2 21  ? 61.620  46.798 108.085 1.00 21.35  ? 21  SER B N   1 
ATOM   1428 C CA  . SER B 2 21  ? 62.989  46.345 108.270 1.00 11.63  ? 21  SER B CA  1 
ATOM   1429 C C   . SER B 2 21  ? 63.296  46.320 109.741 1.00 8.43   ? 21  SER B C   1 
ATOM   1430 O O   . SER B 2 21  ? 62.742  47.105 110.510 1.00 15.83  ? 21  SER B O   1 
ATOM   1431 C CB  . SER B 2 21  ? 63.955  47.281 107.566 1.00 12.26  ? 21  SER B CB  1 
ATOM   1432 O OG  . SER B 2 21  ? 63.808  48.607 108.056 1.00 25.96  ? 21  SER B OG  1 
ATOM   1433 N N   . LEU B 2 22  ? 64.150  45.389 110.128 1.00 11.35  ? 22  LEU B N   1 
ATOM   1434 C CA  . LEU B 2 22  ? 64.566  45.226 111.512 1.00 2.00   ? 22  LEU B CA  1 
ATOM   1435 C C   . LEU B 2 22  ? 65.758  46.132 111.722 1.00 3.65   ? 22  LEU B C   1 
ATOM   1436 O O   . LEU B 2 22  ? 66.746  46.047 111.018 1.00 13.98  ? 22  LEU B O   1 
ATOM   1437 C CB  . LEU B 2 22  ? 64.965  43.782 111.769 1.00 2.00   ? 22  LEU B CB  1 
ATOM   1438 C CG  . LEU B 2 22  ? 65.298  43.493 113.199 1.00 2.00   ? 22  LEU B CG  1 
ATOM   1439 C CD1 . LEU B 2 22  ? 64.060  43.592 113.993 1.00 2.00   ? 22  LEU B CD1 1 
ATOM   1440 C CD2 . LEU B 2 22  ? 65.838  42.136 113.305 1.00 2.00   ? 22  LEU B CD2 1 
ATOM   1441 N N   . VAL B 2 23  ? 65.637  47.050 112.652 1.00 5.28   ? 23  VAL B N   1 
ATOM   1442 C CA  . VAL B 2 23  ? 66.716  47.958 112.916 1.00 7.00   ? 23  VAL B CA  1 
ATOM   1443 C C   . VAL B 2 23  ? 67.347  47.664 114.253 1.00 9.46   ? 23  VAL B C   1 
ATOM   1444 O O   . VAL B 2 23  ? 66.683  47.610 115.293 1.00 11.57  ? 23  VAL B O   1 
ATOM   1445 C CB  . VAL B 2 23  ? 66.239  49.386 112.867 1.00 17.32  ? 23  VAL B CB  1 
ATOM   1446 C CG1 . VAL B 2 23  ? 67.374  50.326 113.233 1.00 10.21  ? 23  VAL B CG1 1 
ATOM   1447 C CG2 . VAL B 2 23  ? 65.715  49.686 111.491 1.00 9.59   ? 23  VAL B CG2 1 
ATOM   1448 N N   . CYS B 2 24  ? 68.655  47.495 114.207 1.00 10.43  ? 24  CYS B N   1 
ATOM   1449 C CA  . CYS B 2 24  ? 69.420  47.173 115.381 1.00 8.65   ? 24  CYS B CA  1 
ATOM   1450 C C   . CYS B 2 24  ? 70.469  48.220 115.653 1.00 8.46   ? 24  CYS B C   1 
ATOM   1451 O O   . CYS B 2 24  ? 71.101  48.729 114.739 1.00 18.63  ? 24  CYS B O   1 
ATOM   1452 C CB  . CYS B 2 24  ? 70.061  45.815 115.177 1.00 8.25   ? 24  CYS B CB  1 
ATOM   1453 S SG  . CYS B 2 24  ? 68.821  44.509 114.916 1.00 26.49  ? 24  CYS B SG  1 
ATOM   1454 N N   . GLN B 2 25  ? 70.621  48.568 116.920 1.00 9.18   ? 25  GLN B N   1 
ATOM   1455 C CA  . GLN B 2 25  ? 71.598  49.557 117.341 1.00 12.92  ? 25  GLN B CA  1 
ATOM   1456 C C   . GLN B 2 25  ? 72.381  48.953 118.498 1.00 20.53  ? 25  GLN B C   1 
ATOM   1457 O O   . GLN B 2 25  ? 71.890  48.049 119.187 1.00 20.05  ? 25  GLN B O   1 
ATOM   1458 C CB  . GLN B 2 25  ? 70.906  50.853 117.773 1.00 19.02  ? 25  GLN B CB  1 
ATOM   1459 C CG  . GLN B 2 25  ? 69.782  50.683 118.795 1.00 37.09  ? 25  GLN B CG  1 
ATOM   1460 C CD  . GLN B 2 25  ? 69.013  51.969 119.035 1.00 45.12  ? 25  GLN B CD  1 
ATOM   1461 O OE1 . GLN B 2 25  ? 69.160  52.600 120.072 1.00 59.43  ? 25  GLN B OE1 1 
ATOM   1462 N NE2 . GLN B 2 25  ? 68.190  52.365 118.069 1.00 61.74  ? 25  GLN B NE2 1 
ATOM   1463 N N   . TRP B 2 26  ? 73.592  49.454 118.716 1.00 20.94  ? 26  TRP B N   1 
ATOM   1464 C CA  . TRP B 2 26  ? 74.452  48.940 119.782 1.00 18.55  ? 26  TRP B CA  1 
ATOM   1465 C C   . TRP B 2 26  ? 75.361  50.033 120.337 1.00 24.25  ? 26  TRP B C   1 
ATOM   1466 O O   . TRP B 2 26  ? 75.352  51.160 119.824 1.00 23.37  ? 26  TRP B O   1 
ATOM   1467 C CB  . TRP B 2 26  ? 75.323  47.792 119.236 1.00 15.55  ? 26  TRP B CB  1 
ATOM   1468 C CG  . TRP B 2 26  ? 76.122  48.177 118.001 1.00 14.09  ? 26  TRP B CG  1 
ATOM   1469 C CD1 . TRP B 2 26  ? 77.308  48.848 117.969 1.00 2.00   ? 26  TRP B CD1 1 
ATOM   1470 C CD2 . TRP B 2 26  ? 75.729  47.989 116.627 1.00 17.64  ? 26  TRP B CD2 1 
ATOM   1471 N NE1 . TRP B 2 26  ? 77.668  49.109 116.665 1.00 11.85  ? 26  TRP B NE1 1 
ATOM   1472 C CE2 . TRP B 2 26  ? 76.718  48.591 115.824 1.00 11.49  ? 26  TRP B CE2 1 
ATOM   1473 C CE3 . TRP B 2 26  ? 74.634  47.376 116.002 1.00 17.51  ? 26  TRP B CE3 1 
ATOM   1474 C CZ2 . TRP B 2 26  ? 76.644  48.603 114.429 1.00 17.72  ? 26  TRP B CZ2 1 
ATOM   1475 C CZ3 . TRP B 2 26  ? 74.562  47.390 114.614 1.00 16.56  ? 26  TRP B CZ3 1 
ATOM   1476 C CH2 . TRP B 2 26  ? 75.563  48.001 113.845 1.00 18.46  ? 26  TRP B CH2 1 
ATOM   1477 N N   . GLU B 2 27  ? 76.148  49.671 121.363 1.00 30.86  ? 27  GLU B N   1 
ATOM   1478 C CA  . GLU B 2 27  ? 77.123  50.551 122.026 1.00 28.42  ? 27  GLU B CA  1 
ATOM   1479 C C   . GLU B 2 27  ? 78.538  50.018 121.788 1.00 18.40  ? 27  GLU B C   1 
ATOM   1480 O O   . GLU B 2 27  ? 78.902  48.982 122.334 1.00 30.26  ? 27  GLU B O   1 
ATOM   1481 C CB  . GLU B 2 27  ? 76.864  50.604 123.533 1.00 40.59  ? 27  GLU B CB  1 
ATOM   1482 C CG  . GLU B 2 27  ? 77.914  51.397 124.324 1.00 72.77  ? 27  GLU B CG  1 
ATOM   1483 C CD  . GLU B 2 27  ? 78.099  52.825 123.813 1.00 89.19  ? 27  GLU B CD  1 
ATOM   1484 O OE1 . GLU B 2 27  ? 77.107  53.585 123.786 1.00 105.09 ? 27  GLU B OE1 1 
ATOM   1485 O OE2 . GLU B 2 27  ? 79.236  53.192 123.435 1.00 97.61  ? 27  GLU B OE2 1 
ATOM   1486 N N   . PRO B 2 28  ? 79.353  50.722 120.979 1.00 6.27   ? 28  PRO B N   1 
ATOM   1487 C CA  . PRO B 2 28  ? 80.734  50.298 120.672 1.00 11.66  ? 28  PRO B CA  1 
ATOM   1488 C C   . PRO B 2 28  ? 81.814  50.476 121.749 1.00 20.41  ? 28  PRO B C   1 
ATOM   1489 O O   . PRO B 2 28  ? 82.906  49.904 121.645 1.00 32.48  ? 28  PRO B O   1 
ATOM   1490 C CB  . PRO B 2 28  ? 81.061  51.079 119.392 1.00 11.89  ? 28  PRO B CB  1 
ATOM   1491 C CG  . PRO B 2 28  ? 80.257  52.357 119.542 1.00 3.23   ? 28  PRO B CG  1 
ATOM   1492 C CD  . PRO B 2 28  ? 78.942  51.860 120.127 1.00 7.77   ? 28  PRO B CD  1 
ATOM   1493 N N   . GLY B 2 29  ? 81.525  51.263 122.776 1.00 19.45  ? 29  GLY B N   1 
ATOM   1494 C CA  . GLY B 2 29  ? 82.502  51.465 123.820 1.00 4.66   ? 29  GLY B CA  1 
ATOM   1495 C C   . GLY B 2 29  ? 83.585  52.429 123.389 1.00 10.71  ? 29  GLY B C   1 
ATOM   1496 O O   . GLY B 2 29  ? 83.449  53.123 122.382 1.00 11.63  ? 29  GLY B O   1 
ATOM   1497 N N   . PRO B 2 30  ? 84.710  52.436 124.112 1.00 10.52  ? 30  PRO B N   1 
ATOM   1498 C CA  . PRO B 2 30  ? 85.900  53.269 123.929 1.00 2.00   ? 30  PRO B CA  1 
ATOM   1499 C C   . PRO B 2 30  ? 86.372  53.472 122.503 1.00 3.04   ? 30  PRO B C   1 
ATOM   1500 O O   . PRO B 2 30  ? 86.426  52.518 121.747 1.00 23.78  ? 30  PRO B O   1 
ATOM   1501 C CB  . PRO B 2 30  ? 86.922  52.545 124.774 1.00 3.58   ? 30  PRO B CB  1 
ATOM   1502 C CG  . PRO B 2 30  ? 86.078  52.051 125.958 1.00 2.00   ? 30  PRO B CG  1 
ATOM   1503 C CD  . PRO B 2 30  ? 84.908  51.477 125.220 1.00 8.33   ? 30  PRO B CD  1 
ATOM   1504 N N   . GLU B 2 31  ? 86.704  54.711 122.129 1.00 6.67   ? 31  GLU B N   1 
ATOM   1505 C CA  . GLU B 2 31  ? 87.173  54.979 120.772 1.00 21.73  ? 31  GLU B CA  1 
ATOM   1506 C C   . GLU B 2 31  ? 88.481  54.233 120.643 1.00 22.98  ? 31  GLU B C   1 
ATOM   1507 O O   . GLU B 2 31  ? 89.186  54.087 121.631 1.00 27.81  ? 31  GLU B O   1 
ATOM   1508 C CB  . GLU B 2 31  ? 87.370  56.483 120.498 1.00 24.06  ? 31  GLU B CB  1 
ATOM   1509 C CG  . GLU B 2 31  ? 87.987  56.826 119.096 1.00 54.34  ? 31  GLU B CG  1 
ATOM   1510 C CD  . GLU B 2 31  ? 87.081  56.532 117.878 1.00 72.22  ? 31  GLU B CD  1 
ATOM   1511 O OE1 . GLU B 2 31  ? 85.922  57.006 117.862 1.00 84.27  ? 31  GLU B OE1 1 
ATOM   1512 O OE2 . GLU B 2 31  ? 87.542  55.862 116.914 1.00 65.63  ? 31  GLU B OE2 1 
ATOM   1513 N N   . THR B 2 32  ? 88.782  53.744 119.437 1.00 28.40  ? 32  THR B N   1 
ATOM   1514 C CA  . THR B 2 32  ? 90.001  52.976 119.163 1.00 17.90  ? 32  THR B CA  1 
ATOM   1515 C C   . THR B 2 32  ? 91.102  53.761 118.441 1.00 14.09  ? 32  THR B C   1 
ATOM   1516 O O   . THR B 2 32  ? 92.277  53.487 118.622 1.00 26.66  ? 32  THR B O   1 
ATOM   1517 C CB  . THR B 2 32  ? 89.660  51.676 118.372 1.00 16.07  ? 32  THR B CB  1 
ATOM   1518 O OG1 . THR B 2 32  ? 89.229  51.989 117.036 1.00 33.08  ? 32  THR B OG1 1 
ATOM   1519 C CG2 . THR B 2 32  ? 88.552  50.938 119.070 1.00 6.80   ? 32  THR B CG2 1 
ATOM   1520 N N   . HIS B 2 33  ? 90.700  54.744 117.643 1.00 28.52  ? 33  HIS B N   1 
ATOM   1521 C CA  . HIS B 2 33  ? 91.596  55.622 116.874 1.00 30.27  ? 33  HIS B CA  1 
ATOM   1522 C C   . HIS B 2 33  ? 92.016  55.039 115.572 1.00 27.19  ? 33  HIS B C   1 
ATOM   1523 O O   . HIS B 2 33  ? 92.620  55.716 114.739 1.00 35.02  ? 33  HIS B O   1 
ATOM   1524 C CB  . HIS B 2 33  ? 92.799  56.066 117.686 1.00 26.92  ? 33  HIS B CB  1 
ATOM   1525 C CG  . HIS B 2 33  ? 92.444  56.980 118.822 1.00 36.22  ? 33  HIS B CG  1 
ATOM   1526 N ND1 . HIS B 2 33  ? 91.947  58.253 118.625 1.00 29.47  ? 33  HIS B ND1 1 
ATOM   1527 C CD2 . HIS B 2 33  ? 92.503  56.801 120.166 1.00 25.09  ? 33  HIS B CD2 1 
ATOM   1528 C CE1 . HIS B 2 33  ? 91.720  58.815 119.801 1.00 41.59  ? 33  HIS B CE1 1 
ATOM   1529 N NE2 . HIS B 2 33  ? 92.048  57.954 120.750 1.00 15.25  ? 33  HIS B NE2 1 
ATOM   1530 N N   . LEU B 2 34  ? 91.533  53.826 115.353 1.00 33.80  ? 34  LEU B N   1 
ATOM   1531 C CA  . LEU B 2 34  ? 91.810  53.071 114.147 1.00 40.13  ? 34  LEU B CA  1 
ATOM   1532 C C   . LEU B 2 34  ? 90.550  52.937 113.297 1.00 39.54  ? 34  LEU B C   1 
ATOM   1533 O O   . LEU B 2 34  ? 89.442  52.970 113.828 1.00 37.54  ? 34  LEU B O   1 
ATOM   1534 C CB  . LEU B 2 34  ? 92.320  51.685 114.544 1.00 27.16  ? 34  LEU B CB  1 
ATOM   1535 C CG  . LEU B 2 34  ? 93.674  51.699 115.249 1.00 16.99  ? 34  LEU B CG  1 
ATOM   1536 C CD1 . LEU B 2 34  ? 93.940  50.410 115.986 1.00 14.45  ? 34  LEU B CD1 1 
ATOM   1537 C CD2 . LEU B 2 34  ? 94.737  51.964 114.215 1.00 26.70  ? 34  LEU B CD2 1 
ATOM   1538 N N   . PRO B 2 35  ? 90.702  52.875 111.959 1.00 42.01  ? 35  PRO B N   1 
ATOM   1539 C CA  . PRO B 2 35  ? 89.555  52.732 111.060 1.00 38.63  ? 35  PRO B CA  1 
ATOM   1540 C C   . PRO B 2 35  ? 88.986  51.375 111.437 1.00 39.92  ? 35  PRO B C   1 
ATOM   1541 O O   . PRO B 2 35  ? 89.566  50.325 111.139 1.00 42.11  ? 35  PRO B O   1 
ATOM   1542 C CB  . PRO B 2 35  ? 90.210  52.685 109.687 1.00 36.87  ? 35  PRO B CB  1 
ATOM   1543 C CG  . PRO B 2 35  ? 91.433  53.504 109.872 1.00 42.29  ? 35  PRO B CG  1 
ATOM   1544 C CD  . PRO B 2 35  ? 91.946  52.991 111.185 1.00 46.58  ? 35  PRO B CD  1 
ATOM   1545 N N   . THR B 2 36  ? 87.877  51.416 112.153 1.00 37.36  ? 36  THR B N   1 
ATOM   1546 C CA  . THR B 2 36  ? 87.247  50.215 112.664 1.00 36.36  ? 36  THR B CA  1 
ATOM   1547 C C   . THR B 2 36  ? 85.950  49.914 111.899 1.00 31.85  ? 36  THR B C   1 
ATOM   1548 O O   . THR B 2 36  ? 85.356  50.836 111.330 1.00 45.61  ? 36  THR B O   1 
ATOM   1549 C CB  . THR B 2 36  ? 87.068  50.405 114.201 1.00 35.54  ? 36  THR B CB  1 
ATOM   1550 O OG1 . THR B 2 36  ? 86.436  49.269 114.781 1.00 24.55  ? 36  THR B OG1 1 
ATOM   1551 C CG2 . THR B 2 36  ? 86.277  51.670 114.510 1.00 54.43  ? 36  THR B CG2 1 
ATOM   1552 N N   . SER B 2 37  ? 85.548  48.640 111.823 1.00 21.50  ? 37  SER B N   1 
ATOM   1553 C CA  . SER B 2 37  ? 84.335  48.270 111.079 1.00 24.28  ? 37  SER B CA  1 
ATOM   1554 C C   . SER B 2 37  ? 83.408  47.393 111.876 1.00 24.22  ? 37  SER B C   1 
ATOM   1555 O O   . SER B 2 37  ? 83.861  46.454 112.523 1.00 26.32  ? 37  SER B O   1 
ATOM   1556 C CB  . SER B 2 37  ? 84.686  47.504 109.801 1.00 30.75  ? 37  SER B CB  1 
ATOM   1557 O OG  . SER B 2 37  ? 84.851  46.114 110.080 1.00 28.88  ? 37  SER B OG  1 
ATOM   1558 N N   . PHE B 2 38  ? 82.107  47.645 111.756 1.00 26.44  ? 38  PHE B N   1 
ATOM   1559 C CA  . PHE B 2 38  ? 81.092  46.852 112.464 1.00 25.56  ? 38  PHE B CA  1 
ATOM   1560 C C   . PHE B 2 38  ? 80.163  46.139 111.473 1.00 24.07  ? 38  PHE B C   1 
ATOM   1561 O O   . PHE B 2 38  ? 79.688  46.742 110.506 1.00 28.88  ? 38  PHE B O   1 
ATOM   1562 C CB  . PHE B 2 38  ? 80.242  47.745 113.363 1.00 27.33  ? 38  PHE B CB  1 
ATOM   1563 C CG  . PHE B 2 38  ? 81.019  48.503 114.390 1.00 15.77  ? 38  PHE B CG  1 
ATOM   1564 C CD1 . PHE B 2 38  ? 81.541  49.755 114.090 1.00 14.55  ? 38  PHE B CD1 1 
ATOM   1565 C CD2 . PHE B 2 38  ? 81.197  47.981 115.670 1.00 12.32  ? 38  PHE B CD2 1 
ATOM   1566 C CE1 . PHE B 2 38  ? 82.227  50.480 115.047 1.00 16.67  ? 38  PHE B CE1 1 
ATOM   1567 C CE2 . PHE B 2 38  ? 81.885  48.698 116.641 1.00 10.49  ? 38  PHE B CE2 1 
ATOM   1568 C CZ  . PHE B 2 38  ? 82.401  49.952 116.325 1.00 15.07  ? 38  PHE B CZ  1 
ATOM   1569 N N   . ILE B 2 39  ? 79.874  44.872 111.725 1.00 13.66  ? 39  ILE B N   1 
ATOM   1570 C CA  . ILE B 2 39  ? 79.012  44.120 110.834 1.00 9.34   ? 39  ILE B CA  1 
ATOM   1571 C C   . ILE B 2 39  ? 77.983  43.408 111.648 1.00 9.91   ? 39  ILE B C   1 
ATOM   1572 O O   . ILE B 2 39  ? 78.340  42.640 112.556 1.00 9.65   ? 39  ILE B O   1 
ATOM   1573 C CB  . ILE B 2 39  ? 79.795  43.046 110.076 1.00 13.07  ? 39  ILE B CB  1 
ATOM   1574 C CG1 . ILE B 2 39  ? 80.792  43.693 109.125 1.00 17.53  ? 39  ILE B CG1 1 
ATOM   1575 C CG2 . ILE B 2 39  ? 78.856  42.142 109.312 1.00 18.85  ? 39  ILE B CG2 1 
ATOM   1576 C CD1 . ILE B 2 39  ? 81.690  42.676 108.408 1.00 45.12  ? 39  ILE B CD1 1 
ATOM   1577 N N   . LEU B 2 40  ? 76.712  43.683 111.355 1.00 8.92   ? 40  LEU B N   1 
ATOM   1578 C CA  . LEU B 2 40  ? 75.609  43.021 112.047 1.00 12.00  ? 40  LEU B CA  1 
ATOM   1579 C C   . LEU B 2 40  ? 75.489  41.679 111.346 1.00 18.40  ? 40  LEU B C   1 
ATOM   1580 O O   . LEU B 2 40  ? 75.254  41.631 110.136 1.00 19.15  ? 40  LEU B O   1 
ATOM   1581 C CB  . LEU B 2 40  ? 74.315  43.802 111.881 1.00 5.15   ? 40  LEU B CB  1 
ATOM   1582 C CG  . LEU B 2 40  ? 73.146  43.337 112.744 1.00 2.00   ? 40  LEU B CG  1 
ATOM   1583 C CD1 . LEU B 2 40  ? 73.502  43.470 114.165 1.00 2.00   ? 40  LEU B CD1 1 
ATOM   1584 C CD2 . LEU B 2 40  ? 71.956  44.182 112.486 1.00 16.71  ? 40  LEU B CD2 1 
ATOM   1585 N N   . LYS B 2 41  ? 75.748  40.607 112.086 1.00 15.55  ? 41  LYS B N   1 
ATOM   1586 C CA  . LYS B 2 41  ? 75.705  39.255 111.547 1.00 18.97  ? 41  LYS B CA  1 
ATOM   1587 C C   . LYS B 2 41  ? 74.532  38.523 112.145 1.00 8.43   ? 41  LYS B C   1 
ATOM   1588 O O   . LYS B 2 41  ? 74.197  38.741 113.293 1.00 17.95  ? 41  LYS B O   1 
ATOM   1589 C CB  . LYS B 2 41  ? 77.000  38.472 111.894 1.00 17.62  ? 41  LYS B CB  1 
ATOM   1590 C CG  . LYS B 2 41  ? 78.248  38.834 111.074 1.00 28.65  ? 41  LYS B CG  1 
ATOM   1591 C CD  . LYS B 2 41  ? 79.012  37.592 110.642 1.00 38.53  ? 41  LYS B CD  1 
ATOM   1592 C CE  . LYS B 2 41  ? 80.242  37.952 109.830 1.00 49.39  ? 41  LYS B CE  1 
ATOM   1593 N NZ  . LYS B 2 41  ? 80.928  36.733 109.307 1.00 73.31  ? 41  LYS B NZ  1 
ATOM   1594 N N   . SER B 2 42  ? 73.949  37.606 111.391 1.00 11.08  ? 42  SER B N   1 
ATOM   1595 C CA  . SER B 2 42  ? 72.825  36.819 111.892 1.00 9.66   ? 42  SER B CA  1 
ATOM   1596 C C   . SER B 2 42  ? 72.519  35.580 111.061 1.00 9.98   ? 42  SER B C   1 
ATOM   1597 O O   . SER B 2 42  ? 72.985  35.425 109.920 1.00 12.58  ? 42  SER B O   1 
ATOM   1598 C CB  . SER B 2 42  ? 71.557  37.669 111.980 1.00 15.55  ? 42  SER B CB  1 
ATOM   1599 O OG  . SER B 2 42  ? 71.175  38.179 110.713 1.00 31.02  ? 42  SER B OG  1 
ATOM   1600 N N   . PHE B 2 43  ? 71.738  34.692 111.660 1.00 8.55   ? 43  PHE B N   1 
ATOM   1601 C CA  . PHE B 2 43  ? 71.300  33.474 111.008 1.00 13.23  ? 43  PHE B CA  1 
ATOM   1602 C C   . PHE B 2 43  ? 69.932  33.080 111.546 1.00 15.45  ? 43  PHE B C   1 
ATOM   1603 O O   . PHE B 2 43  ? 69.582  33.419 112.678 1.00 20.62  ? 43  PHE B O   1 
ATOM   1604 C CB  . PHE B 2 43  ? 72.337  32.331 111.142 1.00 5.59   ? 43  PHE B CB  1 
ATOM   1605 C CG  . PHE B 2 43  ? 72.616  31.865 112.562 1.00 5.28   ? 43  PHE B CG  1 
ATOM   1606 C CD1 . PHE B 2 43  ? 71.797  30.930 113.182 1.00 15.72  ? 43  PHE B CD1 1 
ATOM   1607 C CD2 . PHE B 2 43  ? 73.729  32.336 113.266 1.00 16.65  ? 43  PHE B CD2 1 
ATOM   1608 C CE1 . PHE B 2 43  ? 72.073  30.474 114.477 1.00 16.87  ? 43  PHE B CE1 1 
ATOM   1609 C CE2 . PHE B 2 43  ? 74.012  31.886 114.560 1.00 12.21  ? 43  PHE B CE2 1 
ATOM   1610 C CZ  . PHE B 2 43  ? 73.184  30.956 115.165 1.00 4.28   ? 43  PHE B CZ  1 
ATOM   1611 N N   . ARG B 2 44  ? 69.103  32.481 110.703 1.00 19.89  ? 44  ARG B N   1 
ATOM   1612 C CA  . ARG B 2 44  ? 67.780  32.038 111.152 1.00 20.65  ? 44  ARG B CA  1 
ATOM   1613 C C   . ARG B 2 44  ? 68.004  30.860 112.097 1.00 14.55  ? 44  ARG B C   1 
ATOM   1614 O O   . ARG B 2 44  ? 68.911  30.071 111.892 1.00 20.60  ? 44  ARG B O   1 
ATOM   1615 C CB  . ARG B 2 44  ? 66.907  31.618 109.961 1.00 24.89  ? 44  ARG B CB  1 
ATOM   1616 C CG  . ARG B 2 44  ? 66.672  32.738 108.960 1.00 38.57  ? 44  ARG B CG  1 
ATOM   1617 C CD  . ARG B 2 44  ? 65.835  32.335 107.763 1.00 38.58  ? 44  ARG B CD  1 
ATOM   1618 N NE  . ARG B 2 44  ? 65.910  33.353 106.714 1.00 52.14  ? 44  ARG B NE  1 
ATOM   1619 C CZ  . ARG B 2 44  ? 65.306  33.268 105.531 1.00 67.06  ? 44  ARG B CZ  1 
ATOM   1620 N NH1 . ARG B 2 44  ? 64.561  32.205 105.222 1.00 67.15  ? 44  ARG B NH1 1 
ATOM   1621 N NH2 . ARG B 2 44  ? 65.462  34.245 104.641 1.00 78.07  ? 44  ARG B NH2 1 
ATOM   1622 N N   . SER B 2 45  ? 67.193  30.746 113.134 1.00 9.81   ? 45  SER B N   1 
ATOM   1623 C CA  . SER B 2 45  ? 67.340  29.675 114.108 1.00 2.00   ? 45  SER B CA  1 
ATOM   1624 C C   . SER B 2 45  ? 65.949  29.220 114.530 1.00 8.08   ? 45  SER B C   1 
ATOM   1625 O O   . SER B 2 45  ? 65.016  29.282 113.729 1.00 20.15  ? 45  SER B O   1 
ATOM   1626 C CB  . SER B 2 45  ? 68.137  30.204 115.300 1.00 12.56  ? 45  SER B CB  1 
ATOM   1627 O OG  . SER B 2 45  ? 68.321  29.248 116.322 1.00 15.30  ? 45  SER B OG  1 
ATOM   1628 N N   . ARG B 2 46  ? 65.814  28.714 115.751 1.00 6.39   ? 46  ARG B N   1 
ATOM   1629 C CA  . ARG B 2 46  ? 64.529  28.249 116.292 1.00 14.71  ? 46  ARG B CA  1 
ATOM   1630 C C   . ARG B 2 46  ? 64.534  28.843 117.677 1.00 14.76  ? 46  ARG B C   1 
ATOM   1631 O O   . ARG B 2 46  ? 65.507  29.490 118.038 1.00 18.62  ? 46  ARG B O   1 
ATOM   1632 C CB  . ARG B 2 46  ? 64.470  26.714 116.416 1.00 20.61  ? 46  ARG B CB  1 
ATOM   1633 C CG  . ARG B 2 46  ? 64.428  25.942 115.117 1.00 18.16  ? 46  ARG B CG  1 
ATOM   1634 C CD  . ARG B 2 46  ? 63.037  25.381 114.841 1.00 64.07  ? 46  ARG B CD  1 
ATOM   1635 N NE  . ARG B 2 46  ? 63.060  24.322 113.827 1.00 83.60  ? 46  ARG B NE  1 
ATOM   1636 C CZ  . ARG B 2 46  ? 63.478  23.073 114.048 1.00 88.20  ? 46  ARG B CZ  1 
ATOM   1637 N NH1 . ARG B 2 46  ? 63.911  22.707 115.250 1.00 80.43  ? 46  ARG B NH1 1 
ATOM   1638 N NH2 . ARG B 2 46  ? 63.477  22.187 113.058 1.00 91.66  ? 46  ARG B NH2 1 
ATOM   1639 N N   . ALA B 2 47  ? 63.484  28.627 118.466 1.00 19.67  ? 47  ALA B N   1 
ATOM   1640 C CA  . ALA B 2 47  ? 63.462  29.188 119.818 1.00 19.52  ? 47  ALA B CA  1 
ATOM   1641 C C   . ALA B 2 47  ? 64.725  28.771 120.585 1.00 21.60  ? 47  ALA B C   1 
ATOM   1642 O O   . ALA B 2 47  ? 65.303  27.716 120.312 1.00 27.59  ? 47  ALA B O   1 
ATOM   1643 C CB  . ALA B 2 47  ? 62.208  28.749 120.559 1.00 18.79  ? 47  ALA B CB  1 
ATOM   1644 N N   . ASP B 2 48  ? 65.169  29.622 121.508 1.00 32.86  ? 48  ASP B N   1 
ATOM   1645 C CA  . ASP B 2 48  ? 66.369  29.382 122.325 1.00 32.37  ? 48  ASP B CA  1 
ATOM   1646 C C   . ASP B 2 48  ? 67.652  29.509 121.508 1.00 28.85  ? 48  ASP B C   1 
ATOM   1647 O O   . ASP B 2 48  ? 68.751  29.436 122.043 1.00 27.70  ? 48  ASP B O   1 
ATOM   1648 C CB  . ASP B 2 48  ? 66.321  28.017 123.026 1.00 51.60  ? 48  ASP B CB  1 
ATOM   1649 C CG  . ASP B 2 48  ? 65.081  27.842 123.901 1.00 68.98  ? 48  ASP B CG  1 
ATOM   1650 O OD1 . ASP B 2 48  ? 64.386  28.845 124.189 1.00 69.44  ? 48  ASP B OD1 1 
ATOM   1651 O OD2 . ASP B 2 48  ? 64.798  26.686 124.294 1.00 81.70  ? 48  ASP B OD2 1 
ATOM   1652 N N   . CYS B 2 49  ? 67.492  29.763 120.217 1.00 30.90  ? 49  CYS B N   1 
ATOM   1653 C CA  . CYS B 2 49  ? 68.600  29.938 119.279 1.00 43.16  ? 49  CYS B CA  1 
ATOM   1654 C C   . CYS B 2 49  ? 69.721  28.909 119.320 1.00 50.25  ? 49  CYS B C   1 
ATOM   1655 O O   . CYS B 2 49  ? 70.876  29.222 119.013 1.00 55.35  ? 49  CYS B O   1 
ATOM   1656 C CB  . CYS B 2 49  ? 69.168  31.367 119.343 1.00 51.43  ? 49  CYS B CB  1 
ATOM   1657 S SG  . CYS B 2 49  ? 68.108  32.674 118.599 1.00 43.00  ? 49  CYS B SG  1 
ATOM   1658 N N   . GLN B 2 50  ? 69.377  27.677 119.678 1.00 54.42  ? 50  GLN B N   1 
ATOM   1659 C CA  . GLN B 2 50  ? 70.361  26.605 119.708 1.00 48.25  ? 50  GLN B CA  1 
ATOM   1660 C C   . GLN B 2 50  ? 70.556  26.151 118.264 1.00 45.48  ? 50  GLN B C   1 
ATOM   1661 O O   . GLN B 2 50  ? 71.682  26.014 117.790 1.00 45.29  ? 50  GLN B O   1 
ATOM   1662 C CB  . GLN B 2 50  ? 69.876  25.450 120.587 1.00 50.17  ? 50  GLN B CB  1 
ATOM   1663 C CG  . GLN B 2 50  ? 70.060  25.685 122.086 1.00 73.15  ? 50  GLN B CG  1 
ATOM   1664 C CD  . GLN B 2 50  ? 71.530  25.709 122.503 1.00 88.48  ? 50  GLN B CD  1 
ATOM   1665 O OE1 . GLN B 2 50  ? 72.208  26.738 122.400 1.00 85.46  ? 50  GLN B OE1 1 
ATOM   1666 N NE2 . GLN B 2 50  ? 72.029  24.567 122.977 1.00 94.08  ? 50  GLN B NE2 1 
ATOM   1667 N N   . TYR B 2 51  ? 69.445  26.015 117.544 1.00 41.68  ? 51  TYR B N   1 
ATOM   1668 C CA  . TYR B 2 51  ? 69.441  25.576 116.147 1.00 39.12  ? 51  TYR B CA  1 
ATOM   1669 C C   . TYR B 2 51  ? 70.163  26.540 115.183 1.00 36.01  ? 51  TYR B C   1 
ATOM   1670 O O   . TYR B 2 51  ? 69.717  27.658 114.971 1.00 40.72  ? 51  TYR B O   1 
ATOM   1671 C CB  . TYR B 2 51  ? 67.987  25.364 115.707 1.00 42.68  ? 51  TYR B CB  1 
ATOM   1672 C CG  . TYR B 2 51  ? 67.813  24.742 114.339 1.00 50.14  ? 51  TYR B CG  1 
ATOM   1673 C CD1 . TYR B 2 51  ? 67.438  23.402 114.204 1.00 49.93  ? 51  TYR B CD1 1 
ATOM   1674 C CD2 . TYR B 2 51  ? 68.021  25.490 113.179 1.00 45.62  ? 51  TYR B CD2 1 
ATOM   1675 C CE1 . TYR B 2 51  ? 67.276  22.826 112.948 1.00 59.33  ? 51  TYR B CE1 1 
ATOM   1676 C CE2 . TYR B 2 51  ? 67.866  24.925 111.923 1.00 53.69  ? 51  TYR B CE2 1 
ATOM   1677 C CZ  . TYR B 2 51  ? 67.493  23.594 111.807 1.00 60.82  ? 51  TYR B CZ  1 
ATOM   1678 O OH  . TYR B 2 51  ? 67.340  23.042 110.549 1.00 68.36  ? 51  TYR B OH  1 
ATOM   1679 N N   . GLN B 2 52  ? 71.218  26.065 114.525 1.00 33.77  ? 52  GLN B N   1 
ATOM   1680 C CA  . GLN B 2 52  ? 72.006  26.893 113.602 1.00 35.26  ? 52  GLN B CA  1 
ATOM   1681 C C   . GLN B 2 52  ? 71.477  26.865 112.150 1.00 27.92  ? 52  GLN B C   1 
ATOM   1682 O O   . GLN B 2 52  ? 72.058  26.222 111.291 1.00 31.12  ? 52  GLN B O   1 
ATOM   1683 C CB  . GLN B 2 52  ? 73.490  26.443 113.661 1.00 49.22  ? 52  GLN B CB  1 
ATOM   1684 C CG  . GLN B 2 52  ? 74.567  27.553 113.822 1.00 63.45  ? 52  GLN B CG  1 
ATOM   1685 C CD  . GLN B 2 52  ? 75.022  27.822 115.273 1.00 79.55  ? 52  GLN B CD  1 
ATOM   1686 O OE1 . GLN B 2 52  ? 75.935  28.626 115.506 1.00 89.60  ? 52  GLN B OE1 1 
ATOM   1687 N NE2 . GLN B 2 52  ? 74.386  27.165 116.243 1.00 79.24  ? 52  GLN B NE2 1 
ATOM   1688 N N   . GLY B 2 53  ? 70.394  27.587 111.876 1.00 26.85  ? 53  GLY B N   1 
ATOM   1689 C CA  . GLY B 2 53  ? 69.815  27.622 110.534 1.00 6.57   ? 53  GLY B CA  1 
ATOM   1690 C C   . GLY B 2 53  ? 70.555  28.451 109.495 1.00 14.76  ? 53  GLY B C   1 
ATOM   1691 O O   . GLY B 2 53  ? 71.732  28.761 109.654 1.00 27.10  ? 53  GLY B O   1 
ATOM   1692 N N   . ASP B 2 54  ? 69.845  28.876 108.459 1.00 11.56  ? 54  ASP B N   1 
ATOM   1693 C CA  . ASP B 2 54  ? 70.441  29.648 107.373 1.00 18.06  ? 54  ASP B CA  1 
ATOM   1694 C C   . ASP B 2 54  ? 71.034  31.027 107.663 1.00 24.26  ? 54  ASP B C   1 
ATOM   1695 O O   . ASP B 2 54  ? 70.492  31.819 108.427 1.00 28.98  ? 54  ASP B O   1 
ATOM   1696 C CB  . ASP B 2 54  ? 69.443  29.785 106.228 1.00 44.63  ? 54  ASP B CB  1 
ATOM   1697 C CG  . ASP B 2 54  ? 69.159  28.469 105.547 1.00 69.95  ? 54  ASP B CG  1 
ATOM   1698 O OD1 . ASP B 2 54  ? 68.105  27.864 105.848 1.00 78.64  ? 54  ASP B OD1 1 
ATOM   1699 O OD2 . ASP B 2 54  ? 69.997  28.044 104.715 1.00 93.44  ? 54  ASP B OD2 1 
ATOM   1700 N N   . THR B 2 55  ? 72.085  31.349 106.926 1.00 23.99  ? 55  THR B N   1 
ATOM   1701 C CA  . THR B 2 55  ? 72.763  32.607 107.070 1.00 20.15  ? 55  THR B CA  1 
ATOM   1702 C C   . THR B 2 55  ? 72.063  33.730 106.354 1.00 26.23  ? 55  THR B C   1 
ATOM   1703 O O   . THR B 2 55  ? 71.763  33.640 105.165 1.00 38.79  ? 55  THR B O   1 
ATOM   1704 C CB  . THR B 2 55  ? 74.187  32.496 106.563 1.00 23.02  ? 55  THR B CB  1 
ATOM   1705 O OG1 . THR B 2 55  ? 74.908  31.629 107.440 1.00 30.58  ? 55  THR B OG1 1 
ATOM   1706 C CG2 . THR B 2 55  ? 74.875  33.873 106.509 1.00 29.67  ? 55  THR B CG2 1 
ATOM   1707 N N   . ILE B 2 56  ? 71.822  34.797 107.102 1.00 21.46  ? 56  ILE B N   1 
ATOM   1708 C CA  . ILE B 2 56  ? 71.182  35.995 106.592 1.00 10.30  ? 56  ILE B CA  1 
ATOM   1709 C C   . ILE B 2 56  ? 72.345  36.896 106.209 1.00 14.74  ? 56  ILE B C   1 
ATOM   1710 O O   . ILE B 2 56  ? 73.353  36.951 106.923 1.00 25.46  ? 56  ILE B O   1 
ATOM   1711 C CB  . ILE B 2 56  ? 70.357  36.653 107.710 1.00 11.36  ? 56  ILE B CB  1 
ATOM   1712 C CG1 . ILE B 2 56  ? 69.331  35.668 108.229 1.00 8.84   ? 56  ILE B CG1 1 
ATOM   1713 C CG2 . ILE B 2 56  ? 69.657  37.876 107.230 1.00 6.20   ? 56  ILE B CG2 1 
ATOM   1714 C CD1 . ILE B 2 56  ? 68.546  36.170 109.385 1.00 23.86  ? 56  ILE B CD1 1 
ATOM   1715 N N   . PRO B 2 57  ? 72.266  37.544 105.041 1.00 15.67  ? 57  PRO B N   1 
ATOM   1716 C CA  . PRO B 2 57  ? 73.301  38.449 104.533 1.00 17.24  ? 57  PRO B CA  1 
ATOM   1717 C C   . PRO B 2 57  ? 73.789  39.440 105.586 1.00 21.26  ? 57  PRO B C   1 
ATOM   1718 O O   . PRO B 2 57  ? 72.986  40.083 106.254 1.00 23.01  ? 57  PRO B O   1 
ATOM   1719 C CB  . PRO B 2 57  ? 72.573  39.168 103.415 1.00 9.36   ? 57  PRO B CB  1 
ATOM   1720 C CG  . PRO B 2 57  ? 71.741  38.103 102.856 1.00 7.04   ? 57  PRO B CG  1 
ATOM   1721 C CD  . PRO B 2 57  ? 71.166  37.426 104.073 1.00 9.81   ? 57  PRO B CD  1 
ATOM   1722 N N   . ASP B 2 58  ? 75.105  39.547 105.740 1.00 30.30  ? 58  ASP B N   1 
ATOM   1723 C CA  . ASP B 2 58  ? 75.698  40.464 106.714 1.00 25.45  ? 58  ASP B CA  1 
ATOM   1724 C C   . ASP B 2 58  ? 75.213  41.873 106.425 1.00 16.39  ? 58  ASP B C   1 
ATOM   1725 O O   . ASP B 2 58  ? 74.997  42.236 105.273 1.00 21.08  ? 58  ASP B O   1 
ATOM   1726 C CB  . ASP B 2 58  ? 77.242  40.470 106.625 1.00 30.88  ? 58  ASP B CB  1 
ATOM   1727 C CG  . ASP B 2 58  ? 77.887  39.144 107.034 1.00 44.96  ? 58  ASP B CG  1 
ATOM   1728 O OD1 . ASP B 2 58  ? 77.189  38.259 107.578 1.00 56.78  ? 58  ASP B OD1 1 
ATOM   1729 O OD2 . ASP B 2 58  ? 79.115  39.000 106.810 1.00 49.46  ? 58  ASP B OD2 1 
ATOM   1730 N N   . CYS B 2 59  ? 75.030  42.659 107.471 1.00 12.45  ? 59  CYS B N   1 
ATOM   1731 C CA  . CYS B 2 59  ? 74.610  44.033 107.300 1.00 18.42  ? 59  CYS B CA  1 
ATOM   1732 C C   . CYS B 2 59  ? 75.793  44.856 107.801 1.00 18.79  ? 59  CYS B C   1 
ATOM   1733 O O   . CYS B 2 59  ? 76.139  44.787 108.978 1.00 20.49  ? 59  CYS B O   1 
ATOM   1734 C CB  . CYS B 2 59  ? 73.362  44.304 108.135 1.00 20.56  ? 59  CYS B CB  1 
ATOM   1735 S SG  . CYS B 2 59  ? 72.567  45.910 107.802 1.00 56.09  ? 59  CYS B SG  1 
ATOM   1736 N N   . VAL B 2 60  ? 76.469  45.555 106.895 1.00 21.10  ? 60  VAL B N   1 
ATOM   1737 C CA  . VAL B 2 60  ? 77.630  46.371 107.263 1.00 23.38  ? 60  VAL B CA  1 
ATOM   1738 C C   . VAL B 2 60  ? 77.245  47.810 107.574 1.00 25.36  ? 60  VAL B C   1 
ATOM   1739 O O   . VAL B 2 60  ? 76.560  48.476 106.784 1.00 35.55  ? 60  VAL B O   1 
ATOM   1740 C CB  . VAL B 2 60  ? 78.729  46.383 106.159 1.00 27.56  ? 60  VAL B CB  1 
ATOM   1741 C CG1 . VAL B 2 60  ? 79.318  45.000 105.996 1.00 36.08  ? 60  VAL B CG1 1 
ATOM   1742 C CG2 . VAL B 2 60  ? 78.158  46.897 104.812 1.00 45.59  ? 60  VAL B CG2 1 
ATOM   1743 N N   . ALA B 2 61  ? 77.771  48.315 108.684 1.00 26.08  ? 61  ALA B N   1 
ATOM   1744 C CA  . ALA B 2 61  ? 77.488  49.669 109.160 1.00 28.87  ? 61  ALA B CA  1 
ATOM   1745 C C   . ALA B 2 61  ? 78.214  50.856 108.491 1.00 26.83  ? 61  ALA B C   1 
ATOM   1746 O O   . ALA B 2 61  ? 79.431  50.823 108.271 1.00 33.24  ? 61  ALA B O   1 
ATOM   1747 C CB  . ALA B 2 61  ? 77.694  49.711 110.668 1.00 26.04  ? 61  ALA B CB  1 
ATOM   1748 N N   . LYS B 2 62  ? 77.460  51.907 108.174 1.00 29.52  ? 62  LYS B N   1 
ATOM   1749 C CA  . LYS B 2 62  ? 78.036  53.108 107.574 1.00 26.94  ? 62  LYS B CA  1 
ATOM   1750 C C   . LYS B 2 62  ? 78.978  53.644 108.656 1.00 32.40  ? 62  LYS B C   1 
ATOM   1751 O O   . LYS B 2 62  ? 78.819  53.330 109.847 1.00 27.29  ? 62  LYS B O   1 
ATOM   1752 C CB  . LYS B 2 62  ? 76.946  54.150 107.247 1.00 29.52  ? 62  LYS B CB  1 
ATOM   1753 C CG  . LYS B 2 62  ? 75.834  53.705 106.263 1.00 36.65  ? 62  LYS B CG  1 
ATOM   1754 C CD  . LYS B 2 62  ? 76.136  54.039 104.795 1.00 63.35  ? 62  LYS B CD  1 
ATOM   1755 C CE  . LYS B 2 62  ? 74.946  53.696 103.879 1.00 73.13  ? 62  LYS B CE  1 
ATOM   1756 N NZ  . LYS B 2 62  ? 75.153  54.082 102.447 1.00 69.26  ? 62  LYS B NZ  1 
ATOM   1757 N N   . LYS B 2 63  ? 79.981  54.412 108.251 1.00 38.49  ? 63  LYS B N   1 
ATOM   1758 C CA  . LYS B 2 63  ? 80.942  54.952 109.209 1.00 45.49  ? 63  LYS B CA  1 
ATOM   1759 C C   . LYS B 2 63  ? 80.270  55.802 110.296 1.00 49.30  ? 63  LYS B C   1 
ATOM   1760 O O   . LYS B 2 63  ? 79.285  56.492 110.029 1.00 55.54  ? 63  LYS B O   1 
ATOM   1761 C CB  . LYS B 2 63  ? 82.003  55.759 108.481 1.00 44.72  ? 63  LYS B CB  1 
ATOM   1762 N N   . ARG B 2 64  ? 80.763  55.702 111.528 1.00 46.83  ? 64  ARG B N   1 
ATOM   1763 C CA  . ARG B 2 64  ? 80.220  56.475 112.644 1.00 42.29  ? 64  ARG B CA  1 
ATOM   1764 C C   . ARG B 2 64  ? 78.754  56.203 112.992 1.00 36.87  ? 64  ARG B C   1 
ATOM   1765 O O   . ARG B 2 64  ? 78.235  56.754 113.962 1.00 42.20  ? 64  ARG B O   1 
ATOM   1766 C CB  . ARG B 2 64  ? 80.442  57.968 112.404 1.00 48.55  ? 64  ARG B CB  1 
ATOM   1767 N N   . GLN B 2 65  ? 78.070  55.397 112.189 1.00 31.77  ? 65  GLN B N   1 
ATOM   1768 C CA  . GLN B 2 65  ? 76.677  55.047 112.468 1.00 28.07  ? 65  GLN B CA  1 
ATOM   1769 C C   . GLN B 2 65  ? 76.759  53.809 113.331 1.00 21.67  ? 65  GLN B C   1 
ATOM   1770 O O   . GLN B 2 65  ? 77.482  52.881 112.998 1.00 34.41  ? 65  GLN B O   1 
ATOM   1771 C CB  . GLN B 2 65  ? 75.914  54.719 111.177 1.00 36.06  ? 65  GLN B CB  1 
ATOM   1772 C CG  . GLN B 2 65  ? 75.171  55.896 110.567 1.00 51.33  ? 65  GLN B CG  1 
ATOM   1773 C CD  . GLN B 2 65  ? 74.066  56.410 111.472 1.00 68.85  ? 65  GLN B CD  1 
ATOM   1774 O OE1 . GLN B 2 65  ? 74.321  56.958 112.554 1.00 74.39  ? 65  GLN B OE1 1 
ATOM   1775 N NE2 . GLN B 2 65  ? 72.823  56.201 111.050 1.00 83.77  ? 65  GLN B NE2 1 
ATOM   1776 N N   . ASN B 2 66  ? 76.081  53.816 114.471 1.00 24.61  ? 66  ASN B N   1 
ATOM   1777 C CA  . ASN B 2 66  ? 76.106  52.668 115.380 1.00 14.65  ? 66  ASN B CA  1 
ATOM   1778 C C   . ASN B 2 66  ? 74.824  51.849 115.319 1.00 17.90  ? 66  ASN B C   1 
ATOM   1779 O O   . ASN B 2 66  ? 74.285  51.432 116.361 1.00 7.16   ? 66  ASN B O   1 
ATOM   1780 C CB  . ASN B 2 66  ? 76.373  53.115 116.819 1.00 20.91  ? 66  ASN B CB  1 
ATOM   1781 C CG  . ASN B 2 66  ? 77.826  53.471 117.057 1.00 43.74  ? 66  ASN B CG  1 
ATOM   1782 O OD1 . ASN B 2 66  ? 78.740  52.846 116.500 1.00 63.70  ? 66  ASN B OD1 1 
ATOM   1783 N ND2 . ASN B 2 66  ? 78.054  54.471 117.895 1.00 55.60  ? 66  ASN B ND2 1 
ATOM   1784 N N   . ASN B 2 67  ? 74.360  51.606 114.090 1.00 20.98  ? 67  ASN B N   1 
ATOM   1785 C CA  . ASN B 2 67  ? 73.148  50.839 113.821 1.00 18.39  ? 67  ASN B CA  1 
ATOM   1786 C C   . ASN B 2 67  ? 73.166  50.333 112.376 1.00 20.39  ? 67  ASN B C   1 
ATOM   1787 O O   . ASN B 2 67  ? 73.895  50.877 111.546 1.00 29.13  ? 67  ASN B O   1 
ATOM   1788 C CB  . ASN B 2 67  ? 71.895  51.706 114.053 1.00 27.21  ? 67  ASN B CB  1 
ATOM   1789 C CG  . ASN B 2 67  ? 71.857  52.968 113.174 1.00 31.33  ? 67  ASN B CG  1 
ATOM   1790 O OD1 . ASN B 2 67  ? 71.742  52.893 111.947 1.00 29.35  ? 67  ASN B OD1 1 
ATOM   1791 N ND2 . ASN B 2 67  ? 71.901  54.134 113.815 1.00 44.74  ? 67  ASN B ND2 1 
ATOM   1792 N N   . CYS B 2 68  ? 72.426  49.256 112.102 1.00 24.91  ? 68  CYS B N   1 
ATOM   1793 C CA  . CYS B 2 68  ? 72.289  48.682 110.754 1.00 26.86  ? 68  CYS B CA  1 
ATOM   1794 C C   . CYS B 2 68  ? 70.837  48.186 110.672 1.00 21.60  ? 68  CYS B C   1 
ATOM   1795 O O   . CYS B 2 68  ? 70.220  47.909 111.704 1.00 31.04  ? 68  CYS B O   1 
ATOM   1796 C CB  . CYS B 2 68  ? 73.294  47.528 110.476 1.00 23.87  ? 68  CYS B CB  1 
ATOM   1797 S SG  . CYS B 2 68  ? 73.793  47.289 108.700 1.00 75.97  ? 68  CYS B SG  1 
ATOM   1798 N N   . SER B 2 69  ? 70.299  48.116 109.455 1.00 20.30  ? 69  SER B N   1 
ATOM   1799 C CA  . SER B 2 69  ? 68.934  47.689 109.200 1.00 6.08   ? 69  SER B CA  1 
ATOM   1800 C C   . SER B 2 69  ? 68.912  46.469 108.286 1.00 10.70  ? 69  SER B C   1 
ATOM   1801 O O   . SER B 2 69  ? 69.585  46.441 107.254 1.00 19.02  ? 69  SER B O   1 
ATOM   1802 C CB  . SER B 2 69  ? 68.176  48.833 108.529 1.00 2.64   ? 69  SER B CB  1 
ATOM   1803 O OG  . SER B 2 69  ? 66.888  48.429 108.121 1.00 42.64  ? 69  SER B OG  1 
ATOM   1804 N N   . ILE B 2 70  ? 68.153  45.456 108.678 1.00 8.77   ? 70  ILE B N   1 
ATOM   1805 C CA  . ILE B 2 70  ? 67.996  44.249 107.871 1.00 12.72  ? 70  ILE B CA  1 
ATOM   1806 C C   . ILE B 2 70  ? 66.644  44.359 107.182 1.00 14.02  ? 70  ILE B C   1 
ATOM   1807 O O   . ILE B 2 70  ? 65.614  44.389 107.842 1.00 22.46  ? 70  ILE B O   1 
ATOM   1808 C CB  . ILE B 2 70  ? 67.969  42.989 108.726 1.00 16.20  ? 70  ILE B CB  1 
ATOM   1809 C CG1 . ILE B 2 70  ? 69.262  42.882 109.539 1.00 3.81   ? 70  ILE B CG1 1 
ATOM   1810 C CG2 . ILE B 2 70  ? 67.721  41.778 107.841 1.00 9.30   ? 70  ILE B CG2 1 
ATOM   1811 C CD1 . ILE B 2 70  ? 69.298  41.709 110.451 1.00 8.03   ? 70  ILE B CD1 1 
ATOM   1812 N N   . PRO B 2 71  ? 66.631  44.422 105.849 1.00 5.88   ? 71  PRO B N   1 
ATOM   1813 C CA  . PRO B 2 71  ? 65.399  44.539 105.090 1.00 2.00   ? 71  PRO B CA  1 
ATOM   1814 C C   . PRO B 2 71  ? 64.584  43.274 105.178 1.00 7.40   ? 71  PRO B C   1 
ATOM   1815 O O   . PRO B 2 71  ? 65.118  42.176 105.278 1.00 16.29  ? 71  PRO B O   1 
ATOM   1816 C CB  . PRO B 2 71  ? 65.906  44.778 103.690 1.00 2.00   ? 71  PRO B CB  1 
ATOM   1817 C CG  . PRO B 2 71  ? 67.086  43.894 103.649 1.00 10.61  ? 71  PRO B CG  1 
ATOM   1818 C CD  . PRO B 2 71  ? 67.767  44.250 104.935 1.00 12.53  ? 71  PRO B CD  1 
ATOM   1819 N N   . ARG B 2 72  ? 63.278  43.461 105.127 1.00 10.49  ? 72  ARG B N   1 
ATOM   1820 C CA  . ARG B 2 72  ? 62.285  42.404 105.208 1.00 10.54  ? 72  ARG B CA  1 
ATOM   1821 C C   . ARG B 2 72  ? 62.532  41.244 104.265 1.00 16.00  ? 72  ARG B C   1 
ATOM   1822 O O   . ARG B 2 72  ? 62.200  40.096 104.568 1.00 18.18  ? 72  ARG B O   1 
ATOM   1823 C CB  . ARG B 2 72  ? 60.955  43.022 104.845 1.00 10.06  ? 72  ARG B CB  1 
ATOM   1824 C CG  . ARG B 2 72  ? 59.768  42.363 105.408 1.00 14.17  ? 72  ARG B CG  1 
ATOM   1825 C CD  . ARG B 2 72  ? 59.081  41.515 104.429 1.00 12.50  ? 72  ARG B CD  1 
ATOM   1826 N NE  . ARG B 2 72  ? 59.321  40.115 104.706 1.00 7.81   ? 72  ARG B NE  1 
ATOM   1827 C CZ  . ARG B 2 72  ? 58.361  39.207 104.732 1.00 15.75  ? 72  ARG B CZ  1 
ATOM   1828 N NH1 . ARG B 2 72  ? 57.105  39.564 104.500 1.00 22.66  ? 72  ARG B NH1 1 
ATOM   1829 N NH2 . ARG B 2 72  ? 58.657  37.947 104.974 1.00 2.48   ? 72  ARG B NH2 1 
ATOM   1830 N N   . LYS B 2 73  ? 63.065  41.556 103.092 1.00 18.91  ? 73  LYS B N   1 
ATOM   1831 C CA  . LYS B 2 73  ? 63.327  40.531 102.108 1.00 4.64   ? 73  LYS B CA  1 
ATOM   1832 C C   . LYS B 2 73  ? 64.287  39.519 102.644 1.00 4.04   ? 73  LYS B C   1 
ATOM   1833 O O   . LYS B 2 73  ? 64.294  38.389 102.161 1.00 20.63  ? 73  LYS B O   1 
ATOM   1834 C CB  . LYS B 2 73  ? 63.834  41.135 100.799 1.00 2.00   ? 73  LYS B CB  1 
ATOM   1835 C CG  . LYS B 2 73  ? 65.152  41.833 100.897 1.00 22.55  ? 73  LYS B CG  1 
ATOM   1836 C CD  . LYS B 2 73  ? 65.547  42.459 99.582  1.00 29.16  ? 73  LYS B CD  1 
ATOM   1837 C CE  . LYS B 2 73  ? 66.935  43.052 99.695  1.00 41.53  ? 73  LYS B CE  1 
ATOM   1838 N NZ  . LYS B 2 73  ? 67.479  43.570 98.415  1.00 41.01  ? 73  LYS B NZ  1 
ATOM   1839 N N   . ASN B 2 74  ? 65.072  39.910 103.654 1.00 2.00   ? 74  ASN B N   1 
ATOM   1840 C CA  . ASN B 2 74  ? 66.055  39.011 104.284 1.00 7.06   ? 74  ASN B CA  1 
ATOM   1841 C C   . ASN B 2 74  ? 65.609  38.324 105.570 1.00 11.68  ? 74  ASN B C   1 
ATOM   1842 O O   . ASN B 2 74  ? 66.266  37.392 106.037 1.00 26.45  ? 74  ASN B O   1 
ATOM   1843 C CB  . ASN B 2 74  ? 67.369  39.729 104.571 1.00 12.78  ? 74  ASN B CB  1 
ATOM   1844 C CG  . ASN B 2 74  ? 68.079  40.205 103.316 1.00 22.78  ? 74  ASN B CG  1 
ATOM   1845 O OD1 . ASN B 2 74  ? 69.140  40.824 103.405 1.00 38.07  ? 74  ASN B OD1 1 
ATOM   1846 N ND2 . ASN B 2 74  ? 67.507  39.931 102.144 1.00 30.93  ? 74  ASN B ND2 1 
ATOM   1847 N N   . LEU B 2 75  ? 64.482  38.759 106.116 1.00 14.86  ? 75  LEU B N   1 
ATOM   1848 C CA  . LEU B 2 75  ? 63.941  38.213 107.354 1.00 3.45   ? 75  LEU B CA  1 
ATOM   1849 C C   . LEU B 2 75  ? 62.875  37.166 107.119 1.00 4.44   ? 75  LEU B C   1 
ATOM   1850 O O   . LEU B 2 75  ? 62.171  37.206 106.117 1.00 16.13  ? 75  LEU B O   1 
ATOM   1851 C CB  . LEU B 2 75  ? 63.283  39.325 108.141 1.00 2.00   ? 75  LEU B CB  1 
ATOM   1852 C CG  . LEU B 2 75  ? 64.134  40.536 108.410 1.00 2.00   ? 75  LEU B CG  1 
ATOM   1853 C CD1 . LEU B 2 75  ? 63.272  41.606 108.965 1.00 10.78  ? 75  LEU B CD1 1 
ATOM   1854 C CD2 . LEU B 2 75  ? 65.200  40.187 109.398 1.00 9.08   ? 75  LEU B CD2 1 
ATOM   1855 N N   . LEU B 2 76  ? 62.778  36.216 108.041 1.00 9.59   ? 76  LEU B N   1 
ATOM   1856 C CA  . LEU B 2 76  ? 61.744  35.196 108.003 1.00 5.15   ? 76  LEU B CA  1 
ATOM   1857 C C   . LEU B 2 76  ? 60.955  35.540 109.242 1.00 8.06   ? 76  LEU B C   1 
ATOM   1858 O O   . LEU B 2 76  ? 61.356  35.245 110.369 1.00 13.01  ? 76  LEU B O   1 
ATOM   1859 C CB  . LEU B 2 76  ? 62.289  33.769 108.122 1.00 7.20   ? 76  LEU B CB  1 
ATOM   1860 C CG  . LEU B 2 76  ? 61.241  32.699 108.474 1.00 5.45   ? 76  LEU B CG  1 
ATOM   1861 C CD1 . LEU B 2 76  ? 60.154  32.616 107.429 1.00 2.00   ? 76  LEU B CD1 1 
ATOM   1862 C CD2 . LEU B 2 76  ? 61.908  31.361 108.641 1.00 7.22   ? 76  LEU B CD2 1 
ATOM   1863 N N   . LEU B 2 77  ? 59.880  36.266 109.026 1.00 7.03   ? 77  LEU B N   1 
ATOM   1864 C CA  . LEU B 2 77  ? 59.029  36.674 110.113 1.00 10.10  ? 77  LEU B CA  1 
ATOM   1865 C C   . LEU B 2 77  ? 58.361  35.456 110.734 1.00 5.75   ? 77  LEU B C   1 
ATOM   1866 O O   . LEU B 2 77  ? 58.056  34.490 110.049 1.00 9.93   ? 77  LEU B O   1 
ATOM   1867 C CB  . LEU B 2 77  ? 57.999  37.684 109.606 1.00 16.31  ? 77  LEU B CB  1 
ATOM   1868 C CG  . LEU B 2 77  ? 58.586  38.919 108.898 1.00 2.00   ? 77  LEU B CG  1 
ATOM   1869 C CD1 . LEU B 2 77  ? 57.482  39.799 108.482 1.00 19.18  ? 77  LEU B CD1 1 
ATOM   1870 C CD2 . LEU B 2 77  ? 59.517  39.709 109.782 1.00 12.48  ? 77  LEU B CD2 1 
ATOM   1871 N N   . TYR B 2 78  ? 58.152  35.537 112.040 1.00 2.00   ? 78  TYR B N   1 
ATOM   1872 C CA  . TYR B 2 78  ? 57.555  34.495 112.853 1.00 2.00   ? 78  TYR B CA  1 
ATOM   1873 C C   . TYR B 2 78  ? 58.367  33.240 113.124 1.00 2.00   ? 78  TYR B C   1 
ATOM   1874 O O   . TYR B 2 78  ? 57.829  32.159 113.354 1.00 8.48   ? 78  TYR B O   1 
ATOM   1875 C CB  . TYR B 2 78  ? 56.147  34.181 112.418 1.00 3.12   ? 78  TYR B CB  1 
ATOM   1876 C CG  . TYR B 2 78  ? 55.281  35.405 112.386 1.00 2.00   ? 78  TYR B CG  1 
ATOM   1877 C CD1 . TYR B 2 78  ? 54.654  35.866 113.489 1.00 2.00   ? 78  TYR B CD1 1 
ATOM   1878 C CD2 . TYR B 2 78  ? 55.070  36.082 111.238 1.00 3.25   ? 78  TYR B CD2 1 
ATOM   1879 C CE1 . TYR B 2 78  ? 53.826  36.990 113.434 1.00 2.00   ? 78  TYR B CE1 1 
ATOM   1880 C CE2 . TYR B 2 78  ? 54.244  37.194 111.185 1.00 2.89   ? 78  TYR B CE2 1 
ATOM   1881 C CZ  . TYR B 2 78  ? 53.630  37.639 112.271 1.00 2.00   ? 78  TYR B CZ  1 
ATOM   1882 O OH  . TYR B 2 78  ? 52.796  38.708 112.173 1.00 4.47   ? 78  TYR B OH  1 
ATOM   1883 N N   . GLN B 2 79  ? 59.680  33.429 113.189 1.00 6.32   ? 79  GLN B N   1 
ATOM   1884 C CA  . GLN B 2 79  ? 60.641  32.377 113.519 1.00 7.06   ? 79  GLN B CA  1 
ATOM   1885 C C   . GLN B 2 79  ? 61.790  33.151 114.162 1.00 11.38  ? 79  GLN B C   1 
ATOM   1886 O O   . GLN B 2 79  ? 61.995  34.323 113.838 1.00 8.89   ? 79  GLN B O   1 
ATOM   1887 C CB  . GLN B 2 79  ? 61.123  31.603 112.282 1.00 4.16   ? 79  GLN B CB  1 
ATOM   1888 C CG  . GLN B 2 79  ? 61.876  30.307 112.627 1.00 4.02   ? 79  GLN B CG  1 
ATOM   1889 C CD  . GLN B 2 79  ? 61.253  29.556 113.808 1.00 11.97  ? 79  GLN B CD  1 
ATOM   1890 O OE1 . GLN B 2 79  ? 60.360  28.733 113.637 1.00 32.59  ? 79  GLN B OE1 1 
ATOM   1891 N NE2 . GLN B 2 79  ? 61.738  29.829 115.008 1.00 19.06  ? 79  GLN B NE2 1 
ATOM   1892 N N   . TYR B 2 80  ? 62.439  32.548 115.156 1.00 2.00   ? 80  TYR B N   1 
ATOM   1893 C CA  . TYR B 2 80  ? 63.550  33.183 115.858 1.00 2.68   ? 80  TYR B CA  1 
ATOM   1894 C C   . TYR B 2 80  ? 64.806  33.302 114.997 1.00 2.80   ? 80  TYR B C   1 
ATOM   1895 O O   . TYR B 2 80  ? 64.949  32.601 114.008 1.00 7.23   ? 80  TYR B O   1 
ATOM   1896 C CB  . TYR B 2 80  ? 63.872  32.420 117.141 1.00 2.00   ? 80  TYR B CB  1 
ATOM   1897 C CG  . TYR B 2 80  ? 62.758  32.422 118.158 1.00 2.00   ? 80  TYR B CG  1 
ATOM   1898 C CD1 . TYR B 2 80  ? 61.599  31.782 117.941 1.00 2.13   ? 80  TYR B CD1 1 
ATOM   1899 C CD2 . TYR B 2 80  ? 62.850  33.111 119.306 1.00 2.00   ? 80  TYR B CD2 1 
ATOM   1900 C CE1 . TYR B 2 80  ? 60.540  31.838 118.848 1.00 19.31  ? 80  TYR B CE1 1 
ATOM   1901 C CE2 . TYR B 2 80  ? 61.797  33.167 120.218 1.00 17.82  ? 80  TYR B CE2 1 
ATOM   1902 C CZ  . TYR B 2 80  ? 60.643  32.536 119.982 1.00 23.68  ? 80  TYR B CZ  1 
ATOM   1903 O OH  . TYR B 2 80  ? 59.583  32.631 120.865 1.00 39.08  ? 80  TYR B OH  1 
ATOM   1904 N N   . MET B 2 81  ? 65.682  34.238 115.333 1.00 6.73   ? 81  MET B N   1 
ATOM   1905 C CA  . MET B 2 81  ? 66.933  34.425 114.602 1.00 9.26   ? 81  MET B CA  1 
ATOM   1906 C C   . MET B 2 81  ? 67.966  34.925 115.589 1.00 10.30  ? 81  MET B C   1 
ATOM   1907 O O   . MET B 2 81  ? 67.625  35.582 116.572 1.00 26.61  ? 81  MET B O   1 
ATOM   1908 C CB  . MET B 2 81  ? 66.771  35.411 113.440 1.00 6.54   ? 81  MET B CB  1 
ATOM   1909 C CG  . MET B 2 81  ? 66.396  36.823 113.849 1.00 10.97  ? 81  MET B CG  1 
ATOM   1910 S SD  . MET B 2 81  ? 66.033  37.944 112.463 1.00 10.01  ? 81  MET B SD  1 
ATOM   1911 C CE  . MET B 2 81  ? 67.643  38.341 111.935 1.00 2.00   ? 81  MET B CE  1 
ATOM   1912 N N   . ALA B 2 82  ? 69.214  34.537 115.370 1.00 14.20  ? 82  ALA B N   1 
ATOM   1913 C CA  . ALA B 2 82  ? 70.308  34.929 116.239 1.00 2.56   ? 82  ALA B CA  1 
ATOM   1914 C C   . ALA B 2 82  ? 70.985  36.115 115.613 1.00 5.69   ? 82  ALA B C   1 
ATOM   1915 O O   . ALA B 2 82  ? 71.328  36.085 114.437 1.00 12.99  ? 82  ALA B O   1 
ATOM   1916 C CB  . ALA B 2 82  ? 71.274  33.812 116.384 1.00 7.10   ? 82  ALA B CB  1 
ATOM   1917 N N   . ILE B 2 83  ? 71.185  37.157 116.405 1.00 9.36   ? 83  ILE B N   1 
ATOM   1918 C CA  . ILE B 2 83  ? 71.811  38.384 115.931 1.00 9.63   ? 83  ILE B CA  1 
ATOM   1919 C C   . ILE B 2 83  ? 72.910  38.818 116.886 1.00 9.24   ? 83  ILE B C   1 
ATOM   1920 O O   . ILE B 2 83  ? 72.736  38.795 118.111 1.00 3.17   ? 83  ILE B O   1 
ATOM   1921 C CB  . ILE B 2 83  ? 70.798  39.554 115.885 1.00 2.85   ? 83  ILE B CB  1 
ATOM   1922 C CG1 . ILE B 2 83  ? 69.492  39.129 115.225 1.00 17.07  ? 83  ILE B CG1 1 
ATOM   1923 C CG2 . ILE B 2 83  ? 71.366  40.686 115.113 1.00 2.00   ? 83  ILE B CG2 1 
ATOM   1924 C CD1 . ILE B 2 83  ? 68.322  39.986 115.624 1.00 14.35  ? 83  ILE B CD1 1 
ATOM   1925 N N   . TRP B 2 84  ? 74.031  39.229 116.313 1.00 8.14   ? 84  TRP B N   1 
ATOM   1926 C CA  . TRP B 2 84  ? 75.177  39.716 117.074 1.00 11.94  ? 84  TRP B CA  1 
ATOM   1927 C C   . TRP B 2 84  ? 75.933  40.665 116.168 1.00 18.31  ? 84  TRP B C   1 
ATOM   1928 O O   . TRP B 2 84  ? 75.794  40.627 114.935 1.00 22.53  ? 84  TRP B O   1 
ATOM   1929 C CB  . TRP B 2 84  ? 76.104  38.588 117.558 1.00 15.20  ? 84  TRP B CB  1 
ATOM   1930 C CG  . TRP B 2 84  ? 76.883  37.918 116.465 1.00 22.16  ? 84  TRP B CG  1 
ATOM   1931 C CD1 . TRP B 2 84  ? 78.124  38.251 116.010 1.00 17.57  ? 84  TRP B CD1 1 
ATOM   1932 C CD2 . TRP B 2 84  ? 76.429  36.856 115.633 1.00 33.33  ? 84  TRP B CD2 1 
ATOM   1933 N NE1 . TRP B 2 84  ? 78.465  37.475 114.936 1.00 25.82  ? 84  TRP B NE1 1 
ATOM   1934 C CE2 . TRP B 2 84  ? 77.438  36.607 114.685 1.00 34.38  ? 84  TRP B CE2 1 
ATOM   1935 C CE3 . TRP B 2 84  ? 75.256  36.095 115.590 1.00 34.46  ? 84  TRP B CE3 1 
ATOM   1936 C CZ2 . TRP B 2 84  ? 77.311  35.630 113.705 1.00 45.24  ? 84  TRP B CZ2 1 
ATOM   1937 C CZ3 . TRP B 2 84  ? 75.131  35.128 114.620 1.00 39.85  ? 84  TRP B CZ3 1 
ATOM   1938 C CH2 . TRP B 2 84  ? 76.152  34.900 113.687 1.00 40.90  ? 84  TRP B CH2 1 
ATOM   1939 N N   . VAL B 2 85  ? 76.700  41.549 116.789 1.00 18.18  ? 85  VAL B N   1 
ATOM   1940 C CA  . VAL B 2 85  ? 77.463  42.525 116.042 1.00 23.74  ? 85  VAL B CA  1 
ATOM   1941 C C   . VAL B 2 85  ? 78.945  42.225 116.250 1.00 21.48  ? 85  VAL B C   1 
ATOM   1942 O O   . VAL B 2 85  ? 79.346  41.750 117.319 1.00 26.28  ? 85  VAL B O   1 
ATOM   1943 C CB  . VAL B 2 85  ? 77.033  43.974 116.429 1.00 6.75   ? 85  VAL B CB  1 
ATOM   1944 C CG1 . VAL B 2 85  ? 76.894  44.106 117.899 1.00 25.06  ? 85  VAL B CG1 1 
ATOM   1945 C CG2 . VAL B 2 85  ? 78.008  44.969 115.907 1.00 22.02  ? 85  VAL B CG2 1 
ATOM   1946 N N   . GLN B 2 86  ? 79.736  42.442 115.204 1.00 20.77  ? 86  GLN B N   1 
ATOM   1947 C CA  . GLN B 2 86  ? 81.167  42.172 115.230 1.00 22.05  ? 86  GLN B CA  1 
ATOM   1948 C C   . GLN B 2 86  ? 82.038  43.390 114.856 1.00 26.85  ? 86  GLN B C   1 
ATOM   1949 O O   . GLN B 2 86  ? 81.843  43.997 113.800 1.00 31.77  ? 86  GLN B O   1 
ATOM   1950 C CB  . GLN B 2 86  ? 81.410  41.027 114.270 1.00 24.21  ? 86  GLN B CB  1 
ATOM   1951 C CG  . GLN B 2 86  ? 82.818  40.674 114.051 1.00 41.66  ? 86  GLN B CG  1 
ATOM   1952 C CD  . GLN B 2 86  ? 82.925  39.753 112.905 1.00 48.32  ? 86  GLN B CD  1 
ATOM   1953 O OE1 . GLN B 2 86  ? 83.519  40.097 111.878 1.00 57.37  ? 86  GLN B OE1 1 
ATOM   1954 N NE2 . GLN B 2 86  ? 82.285  38.582 113.026 1.00 31.93  ? 86  GLN B NE2 1 
ATOM   1955 N N   . ALA B 2 87  ? 82.994  43.733 115.726 1.00 29.54  ? 87  ALA B N   1 
ATOM   1956 C CA  . ALA B 2 87  ? 83.898  44.869 115.522 1.00 24.56  ? 87  ALA B CA  1 
ATOM   1957 C C   . ALA B 2 87  ? 85.246  44.377 115.026 1.00 35.65  ? 87  ALA B C   1 
ATOM   1958 O O   . ALA B 2 87  ? 85.904  43.569 115.681 1.00 31.48  ? 87  ALA B O   1 
ATOM   1959 C CB  . ALA B 2 87  ? 84.072  45.615 116.798 1.00 19.59  ? 87  ALA B CB  1 
ATOM   1960 N N   . GLU B 2 88  ? 85.639  44.860 113.856 1.00 50.25  ? 88  GLU B N   1 
ATOM   1961 C CA  . GLU B 2 88  ? 86.891  44.473 113.219 1.00 57.79  ? 88  GLU B CA  1 
ATOM   1962 C C   . GLU B 2 88  ? 87.783  45.698 113.124 1.00 53.86  ? 88  GLU B C   1 
ATOM   1963 O O   . GLU B 2 88  ? 87.477  46.677 112.423 1.00 58.80  ? 88  GLU B O   1 
ATOM   1964 C CB  . GLU B 2 88  ? 86.615  43.895 111.813 1.00 80.78  ? 88  GLU B CB  1 
ATOM   1965 C CG  . GLU B 2 88  ? 87.843  43.362 111.053 1.00 99.34  ? 88  GLU B CG  1 
ATOM   1966 C CD  . GLU B 2 88  ? 87.542  43.031 109.588 1.00 115.40 ? 88  GLU B CD  1 
ATOM   1967 O OE1 . GLU B 2 88  ? 87.733  43.920 108.719 1.00 117.80 ? 88  GLU B OE1 1 
ATOM   1968 O OE2 . GLU B 2 88  ? 87.122  41.882 109.310 1.00 118.72 ? 88  GLU B OE2 1 
ATOM   1969 N N   . ASN B 2 89  ? 88.894  45.630 113.837 1.00 49.46  ? 89  ASN B N   1 
ATOM   1970 C CA  . ASN B 2 89  ? 89.876  46.710 113.873 1.00 52.94  ? 89  ASN B CA  1 
ATOM   1971 C C   . ASN B 2 89  ? 91.200  46.115 113.413 1.00 57.28  ? 89  ASN B C   1 
ATOM   1972 O O   . ASN B 2 89  ? 91.423  44.892 113.523 1.00 50.10  ? 89  ASN B O   1 
ATOM   1973 C CB  . ASN B 2 89  ? 90.060  47.155 115.322 1.00 48.01  ? 89  ASN B CB  1 
ATOM   1974 C CG  . ASN B 2 89  ? 90.505  48.570 115.462 1.00 32.79  ? 89  ASN B CG  1 
ATOM   1975 O OD1 . ASN B 2 89  ? 90.291  49.393 114.579 1.00 60.19  ? 89  ASN B OD1 1 
ATOM   1976 N ND2 . ASN B 2 89  ? 91.097  48.881 116.600 1.00 35.23  ? 89  ASN B ND2 1 
ATOM   1977 N N   . MET B 2 90  ? 92.111  46.983 112.989 1.00 55.54  ? 90  MET B N   1 
ATOM   1978 C CA  . MET B 2 90  ? 93.443  46.554 112.559 1.00 49.89  ? 90  MET B CA  1 
ATOM   1979 C C   . MET B 2 90  ? 94.259  45.839 113.673 1.00 41.32  ? 90  MET B C   1 
ATOM   1980 O O   . MET B 2 90  ? 95.312  45.276 113.402 1.00 40.99  ? 90  MET B O   1 
ATOM   1981 C CB  . MET B 2 90  ? 94.218  47.769 112.048 1.00 52.77  ? 90  MET B CB  1 
ATOM   1982 C CG  . MET B 2 90  ? 95.660  47.486 111.688 1.00 61.00  ? 90  MET B CG  1 
ATOM   1983 S SD  . MET B 2 90  ? 96.655  48.983 111.553 1.00 68.75  ? 90  MET B SD  1 
ATOM   1984 C CE  . MET B 2 90  ? 97.264  49.107 113.220 1.00 61.46  ? 90  MET B CE  1 
ATOM   1985 N N   . LEU B 2 91  ? 93.766  45.850 114.912 1.00 39.74  ? 91  LEU B N   1 
ATOM   1986 C CA  . LEU B 2 91  ? 94.458  45.215 116.039 1.00 36.69  ? 91  LEU B CA  1 
ATOM   1987 C C   . LEU B 2 91  ? 93.622  44.187 116.775 1.00 43.44  ? 91  LEU B C   1 
ATOM   1988 O O   . LEU B 2 91  ? 93.922  43.875 117.933 1.00 48.02  ? 91  LEU B O   1 
ATOM   1989 C CB  . LEU B 2 91  ? 94.876  46.247 117.097 1.00 44.79  ? 91  LEU B CB  1 
ATOM   1990 C CG  . LEU B 2 91  ? 95.806  47.424 116.830 1.00 51.06  ? 91  LEU B CG  1 
ATOM   1991 C CD1 . LEU B 2 91  ? 96.213  47.983 118.164 1.00 51.93  ? 91  LEU B CD1 1 
ATOM   1992 C CD2 . LEU B 2 91  ? 97.035  47.003 116.054 1.00 55.19  ? 91  LEU B CD2 1 
ATOM   1993 N N   . GLY B 2 92  ? 92.534  43.717 116.169 1.00 50.78  ? 92  GLY B N   1 
ATOM   1994 C CA  . GLY B 2 92  ? 91.709  42.734 116.860 1.00 48.91  ? 92  GLY B CA  1 
ATOM   1995 C C   . GLY B 2 92  ? 90.254  42.697 116.445 1.00 41.73  ? 92  GLY B C   1 
ATOM   1996 O O   . GLY B 2 92  ? 89.830  43.485 115.588 1.00 36.31  ? 92  GLY B O   1 
ATOM   1997 N N   . SER B 2 93  ? 89.497  41.794 117.074 1.00 35.21  ? 93  SER B N   1 
ATOM   1998 C CA  . SER B 2 93  ? 88.079  41.609 116.790 1.00 31.29  ? 93  SER B CA  1 
ATOM   1999 C C   . SER B 2 93  ? 87.348  41.294 118.092 1.00 32.64  ? 93  SER B C   1 
ATOM   2000 O O   . SER B 2 93  ? 87.939  40.746 119.019 1.00 37.09  ? 93  SER B O   1 
ATOM   2001 C CB  . SER B 2 93  ? 87.880  40.452 115.796 1.00 37.53  ? 93  SER B CB  1 
ATOM   2002 O OG  . SER B 2 93  ? 88.578  40.658 114.572 1.00 47.06  ? 93  SER B OG  1 
ATOM   2003 N N   . SER B 2 94  ? 86.075  41.670 118.160 1.00 35.05  ? 94  SER B N   1 
ATOM   2004 C CA  . SER B 2 94  ? 85.234  41.420 119.327 1.00 31.76  ? 94  SER B CA  1 
ATOM   2005 C C   . SER B 2 94  ? 83.836  41.145 118.786 1.00 28.08  ? 94  SER B C   1 
ATOM   2006 O O   . SER B 2 94  ? 83.547  41.466 117.632 1.00 28.74  ? 94  SER B O   1 
ATOM   2007 C CB  . SER B 2 94  ? 85.203  42.655 120.225 1.00 40.14  ? 94  SER B CB  1 
ATOM   2008 O OG  . SER B 2 94  ? 84.830  43.813 119.485 1.00 55.55  ? 94  SER B OG  1 
ATOM   2009 N N   . GLU B 2 95  ? 82.975  40.559 119.610 1.00 22.29  ? 95  GLU B N   1 
ATOM   2010 C CA  . GLU B 2 95  ? 81.602  40.245 119.208 1.00 23.66  ? 95  GLU B CA  1 
ATOM   2011 C C   . GLU B 2 95  ? 80.683  40.453 120.392 1.00 23.55  ? 95  GLU B C   1 
ATOM   2012 O O   . GLU B 2 95  ? 81.084  40.277 121.541 1.00 36.58  ? 95  GLU B O   1 
ATOM   2013 C CB  . GLU B 2 95  ? 81.467  38.772 118.804 1.00 35.33  ? 95  GLU B CB  1 
ATOM   2014 C CG  . GLU B 2 95  ? 82.295  38.306 117.612 1.00 65.31  ? 95  GLU B CG  1 
ATOM   2015 C CD  . GLU B 2 95  ? 81.974  36.869 117.201 1.00 72.70  ? 95  GLU B CD  1 
ATOM   2016 O OE1 . GLU B 2 95  ? 82.199  36.527 116.016 1.00 81.21  ? 95  GLU B OE1 1 
ATOM   2017 O OE2 . GLU B 2 95  ? 81.487  36.090 118.055 1.00 78.88  ? 95  GLU B OE2 1 
ATOM   2018 N N   . SER B 2 96  ? 79.436  40.784 120.129 1.00 17.96  ? 96  SER B N   1 
ATOM   2019 C CA  . SER B 2 96  ? 78.493  40.958 121.220 1.00 23.25  ? 96  SER B CA  1 
ATOM   2020 C C   . SER B 2 96  ? 77.868  39.614 121.521 1.00 15.66  ? 96  SER B C   1 
ATOM   2021 O O   . SER B 2 96  ? 77.948  38.681 120.721 1.00 23.83  ? 96  SER B O   1 
ATOM   2022 C CB  . SER B 2 96  ? 77.378  41.891 120.790 1.00 29.44  ? 96  SER B CB  1 
ATOM   2023 O OG  . SER B 2 96  ? 76.689  41.331 119.678 1.00 27.45  ? 96  SER B OG  1 
ATOM   2024 N N   . PRO B 2 97  ? 77.309  39.460 122.714 1.00 13.06  ? 97  PRO B N   1 
ATOM   2025 C CA  . PRO B 2 97  ? 76.687  38.157 122.979 1.00 26.58  ? 97  PRO B CA  1 
ATOM   2026 C C   . PRO B 2 97  ? 75.510  38.035 122.000 1.00 31.37  ? 97  PRO B C   1 
ATOM   2027 O O   . PRO B 2 97  ? 74.983  39.047 121.529 1.00 50.17  ? 97  PRO B O   1 
ATOM   2028 C CB  . PRO B 2 97  ? 76.233  38.258 124.450 1.00 14.83  ? 97  PRO B CB  1 
ATOM   2029 C CG  . PRO B 2 97  ? 76.286  39.738 124.767 1.00 31.35  ? 97  PRO B CG  1 
ATOM   2030 C CD  . PRO B 2 97  ? 77.420  40.274 123.931 1.00 22.15  ? 97  PRO B CD  1 
ATOM   2031 N N   . LYS B 2 98  ? 75.114  36.817 121.669 1.00 29.50  ? 98  LYS B N   1 
ATOM   2032 C CA  . LYS B 2 98  ? 74.037  36.647 120.719 1.00 15.22  ? 98  LYS B CA  1 
ATOM   2033 C C   . LYS B 2 98  ? 72.654  36.884 121.272 1.00 12.90  ? 98  LYS B C   1 
ATOM   2034 O O   . LYS B 2 98  ? 72.307  36.452 122.369 1.00 15.14  ? 98  LYS B O   1 
ATOM   2035 C CB  . LYS B 2 98  ? 74.138  35.287 120.037 1.00 17.40  ? 98  LYS B CB  1 
ATOM   2036 C CG  . LYS B 2 98  ? 75.354  35.171 119.110 1.00 19.59  ? 98  LYS B CG  1 
ATOM   2037 C CD  . LYS B 2 98  ? 75.418  33.820 118.420 1.00 30.45  ? 98  LYS B CD  1 
ATOM   2038 C CE  . LYS B 2 98  ? 76.754  33.613 117.709 1.00 41.60  ? 98  LYS B CE  1 
ATOM   2039 N NZ  . LYS B 2 98  ? 77.918  33.528 118.646 1.00 45.72  ? 98  LYS B NZ  1 
ATOM   2040 N N   . LEU B 2 99  ? 71.885  37.643 120.511 1.00 13.81  ? 99  LEU B N   1 
ATOM   2041 C CA  . LEU B 2 99  ? 70.519  37.965 120.866 1.00 16.49  ? 99  LEU B CA  1 
ATOM   2042 C C   . LEU B 2 99  ? 69.581  37.052 120.074 1.00 10.03  ? 99  LEU B C   1 
ATOM   2043 O O   . LEU B 2 99  ? 69.825  36.741 118.919 1.00 13.01  ? 99  LEU B O   1 
ATOM   2044 C CB  . LEU B 2 99  ? 70.250  39.439 120.572 1.00 20.30  ? 99  LEU B CB  1 
ATOM   2045 C CG  . LEU B 2 99  ? 68.875  39.984 120.934 1.00 26.96  ? 99  LEU B CG  1 
ATOM   2046 C CD1 . LEU B 2 99  ? 68.518  39.697 122.407 1.00 41.88  ? 99  LEU B CD1 1 
ATOM   2047 C CD2 . LEU B 2 99  ? 68.876  41.468 120.633 1.00 24.09  ? 99  LEU B CD2 1 
ATOM   2048 N N   . CYS B 2 100 ? 68.485  36.663 120.693 1.00 8.76   ? 100 CYS B N   1 
ATOM   2049 C CA  . CYS B 2 100 ? 67.549  35.754 120.077 1.00 2.00   ? 100 CYS B CA  1 
ATOM   2050 C C   . CYS B 2 100 ? 66.139  36.309 120.028 1.00 8.28   ? 100 CYS B C   1 
ATOM   2051 O O   . CYS B 2 100 ? 65.420  36.316 121.039 1.00 16.19  ? 100 CYS B O   1 
ATOM   2052 C CB  . CYS B 2 100 ? 67.524  34.474 120.900 1.00 13.10  ? 100 CYS B CB  1 
ATOM   2053 S SG  . CYS B 2 100 ? 66.739  33.082 120.055 1.00 42.72  ? 100 CYS B SG  1 
ATOM   2054 N N   . LEU B 2 101 ? 65.704  36.682 118.838 1.00 5.57   ? 101 LEU B N   1 
ATOM   2055 C CA  . LEU B 2 101 ? 64.364  37.217 118.679 1.00 2.79   ? 101 LEU B CA  1 
ATOM   2056 C C   . LEU B 2 101 ? 63.686  36.791 117.402 1.00 6.66   ? 101 LEU B C   1 
ATOM   2057 O O   . LEU B 2 101 ? 64.294  36.272 116.480 1.00 11.75  ? 101 LEU B O   1 
ATOM   2058 C CB  . LEU B 2 101 ? 64.409  38.741 118.688 1.00 14.80  ? 101 LEU B CB  1 
ATOM   2059 C CG  . LEU B 2 101 ? 65.368  39.390 117.684 1.00 9.02   ? 101 LEU B CG  1 
ATOM   2060 C CD1 . LEU B 2 101 ? 64.772  39.497 116.287 1.00 24.79  ? 101 LEU B CD1 1 
ATOM   2061 C CD2 . LEU B 2 101 ? 65.694  40.757 118.204 1.00 19.81  ? 101 LEU B CD2 1 
ATOM   2062 N N   . ASP B 2 102 ? 62.409  37.098 117.350 1.00 10.55  ? 102 ASP B N   1 
ATOM   2063 C CA  . ASP B 2 102 ? 61.565  36.847 116.203 1.00 4.15   ? 102 ASP B CA  1 
ATOM   2064 C C   . ASP B 2 102 ? 61.279  38.310 115.887 1.00 11.10  ? 102 ASP B C   1 
ATOM   2065 O O   . ASP B 2 102 ? 60.789  39.035 116.737 1.00 13.88  ? 102 ASP B O   1 
ATOM   2066 C CB  . ASP B 2 102 ? 60.313  36.140 116.697 1.00 2.00   ? 102 ASP B CB  1 
ATOM   2067 C CG  . ASP B 2 102 ? 59.202  36.106 115.692 1.00 6.99   ? 102 ASP B CG  1 
ATOM   2068 O OD1 . ASP B 2 102 ? 59.249  36.794 114.657 1.00 11.62  ? 102 ASP B OD1 1 
ATOM   2069 O OD2 . ASP B 2 102 ? 58.241  35.376 115.966 1.00 7.08   ? 102 ASP B OD2 1 
ATOM   2070 N N   . PRO B 2 103 ? 61.610  38.774 114.676 1.00 9.23   ? 103 PRO B N   1 
ATOM   2071 C CA  . PRO B 2 103 ? 61.373  40.174 114.309 1.00 2.00   ? 103 PRO B CA  1 
ATOM   2072 C C   . PRO B 2 103 ? 60.021  40.700 114.761 1.00 2.17   ? 103 PRO B C   1 
ATOM   2073 O O   . PRO B 2 103 ? 59.923  41.799 115.270 1.00 10.86  ? 103 PRO B O   1 
ATOM   2074 C CB  . PRO B 2 103 ? 61.473  40.144 112.786 1.00 2.00   ? 103 PRO B CB  1 
ATOM   2075 C CG  . PRO B 2 103 ? 62.447  39.107 112.547 1.00 2.00   ? 103 PRO B CG  1 
ATOM   2076 C CD  . PRO B 2 103 ? 62.073  38.008 113.510 1.00 3.88   ? 103 PRO B CD  1 
ATOM   2077 N N   . MET B 2 104 ? 58.991  39.882 114.626 1.00 3.18   ? 104 MET B N   1 
ATOM   2078 C CA  . MET B 2 104 ? 57.655  40.291 115.007 1.00 4.17   ? 104 MET B CA  1 
ATOM   2079 C C   . MET B 2 104 ? 57.405  40.465 116.503 1.00 14.98  ? 104 MET B C   1 
ATOM   2080 O O   . MET B 2 104 ? 56.365  40.988 116.891 1.00 26.16  ? 104 MET B O   1 
ATOM   2081 C CB  . MET B 2 104 ? 56.633  39.343 114.396 1.00 3.50   ? 104 MET B CB  1 
ATOM   2082 C CG  . MET B 2 104 ? 56.646  39.396 112.888 1.00 21.56  ? 104 MET B CG  1 
ATOM   2083 S SD  . MET B 2 104 ? 56.589  41.102 112.295 1.00 22.83  ? 104 MET B SD  1 
ATOM   2084 C CE  . MET B 2 104 ? 54.922  41.365 112.318 1.00 32.17  ? 104 MET B CE  1 
ATOM   2085 N N   . ASP B 2 105 ? 58.360  40.057 117.335 1.00 15.71  ? 105 ASP B N   1 
ATOM   2086 C CA  . ASP B 2 105 ? 58.247  40.169 118.792 1.00 6.08   ? 105 ASP B CA  1 
ATOM   2087 C C   . ASP B 2 105 ? 58.751  41.527 119.295 1.00 11.63  ? 105 ASP B C   1 
ATOM   2088 O O   . ASP B 2 105 ? 58.581  41.877 120.464 1.00 18.54  ? 105 ASP B O   1 
ATOM   2089 C CB  . ASP B 2 105 ? 59.055  39.061 119.479 1.00 4.91   ? 105 ASP B CB  1 
ATOM   2090 C CG  . ASP B 2 105 ? 58.285  37.771 119.655 1.00 11.82  ? 105 ASP B CG  1 
ATOM   2091 O OD1 . ASP B 2 105 ? 57.102  37.723 119.270 1.00 17.23  ? 105 ASP B OD1 1 
ATOM   2092 O OD2 . ASP B 2 105 ? 58.864  36.801 120.204 1.00 15.36  ? 105 ASP B OD2 1 
ATOM   2093 N N   . VAL B 2 106 ? 59.389  42.285 118.414 1.00 13.66  ? 106 VAL B N   1 
ATOM   2094 C CA  . VAL B 2 106 ? 59.936  43.584 118.781 1.00 5.25   ? 106 VAL B CA  1 
ATOM   2095 C C   . VAL B 2 106 ? 59.443  44.666 117.851 1.00 2.00   ? 106 VAL B C   1 
ATOM   2096 O O   . VAL B 2 106 ? 60.168  45.566 117.487 1.00 2.87   ? 106 VAL B O   1 
ATOM   2097 C CB  . VAL B 2 106 ? 61.482  43.568 118.759 1.00 2.00   ? 106 VAL B CB  1 
ATOM   2098 C CG1 . VAL B 2 106 ? 61.992  42.640 119.805 1.00 10.03  ? 106 VAL B CG1 1 
ATOM   2099 C CG2 . VAL B 2 106 ? 61.986  43.092 117.440 1.00 2.00   ? 106 VAL B CG2 1 
ATOM   2100 N N   . VAL B 2 107 ? 58.200  44.564 117.445 1.00 2.00   ? 107 VAL B N   1 
ATOM   2101 C CA  . VAL B 2 107 ? 57.643  45.552 116.558 1.00 3.49   ? 107 VAL B CA  1 
ATOM   2102 C C   . VAL B 2 107 ? 57.474  46.843 117.313 1.00 2.00   ? 107 VAL B C   1 
ATOM   2103 O O   . VAL B 2 107 ? 57.073  46.820 118.469 1.00 2.00   ? 107 VAL B O   1 
ATOM   2104 C CB  . VAL B 2 107 ? 56.297  45.112 116.032 1.00 2.89   ? 107 VAL B CB  1 
ATOM   2105 C CG1 . VAL B 2 107 ? 55.584  46.280 115.414 1.00 17.25  ? 107 VAL B CG1 1 
ATOM   2106 C CG2 . VAL B 2 107 ? 56.490  44.029 115.010 1.00 2.00   ? 107 VAL B CG2 1 
ATOM   2107 N N   . LYS B 2 108 ? 57.858  47.950 116.675 1.00 5.15   ? 108 LYS B N   1 
ATOM   2108 C CA  . LYS B 2 108 ? 57.749  49.287 117.260 1.00 2.13   ? 108 LYS B CA  1 
ATOM   2109 C C   . LYS B 2 108 ? 56.426  49.876 116.861 1.00 9.19   ? 108 LYS B C   1 
ATOM   2110 O O   . LYS B 2 108 ? 56.207  50.229 115.710 1.00 20.27  ? 108 LYS B O   1 
ATOM   2111 C CB  . LYS B 2 108 ? 58.829  50.213 116.766 1.00 2.00   ? 108 LYS B CB  1 
ATOM   2112 C CG  . LYS B 2 108 ? 58.541  51.649 117.082 1.00 4.75   ? 108 LYS B CG  1 
ATOM   2113 C CD  . LYS B 2 108 ? 59.710  52.490 116.701 1.00 30.55  ? 108 LYS B CD  1 
ATOM   2114 C CE  . LYS B 2 108 ? 59.532  53.904 117.147 1.00 34.34  ? 108 LYS B CE  1 
ATOM   2115 N NZ  . LYS B 2 108 ? 60.860  54.596 117.106 1.00 60.13  ? 108 LYS B NZ  1 
ATOM   2116 N N   . LEU B 2 109 ? 55.563  50.011 117.849 1.00 14.42  ? 109 LEU B N   1 
ATOM   2117 C CA  . LEU B 2 109 ? 54.217  50.525 117.675 1.00 3.15   ? 109 LEU B CA  1 
ATOM   2118 C C   . LEU B 2 109 ? 54.119  52.037 117.878 1.00 9.95   ? 109 LEU B C   1 
ATOM   2119 O O   . LEU B 2 109 ? 54.903  52.633 118.629 1.00 27.09  ? 109 LEU B O   1 
ATOM   2120 C CB  . LEU B 2 109 ? 53.324  49.838 118.701 1.00 3.42   ? 109 LEU B CB  1 
ATOM   2121 C CG  . LEU B 2 109 ? 52.071  49.054 118.352 1.00 2.00   ? 109 LEU B CG  1 
ATOM   2122 C CD1 . LEU B 2 109 ? 52.271  48.180 117.145 1.00 5.57   ? 109 LEU B CD1 1 
ATOM   2123 C CD2 . LEU B 2 109 ? 51.760  48.215 119.544 1.00 2.00   ? 109 LEU B CD2 1 
ATOM   2124 N N   . GLU B 2 110 ? 53.187  52.656 117.156 1.00 15.66  ? 110 GLU B N   1 
ATOM   2125 C CA  . GLU B 2 110 ? 52.909  54.082 117.268 1.00 11.54  ? 110 GLU B CA  1 
ATOM   2126 C C   . GLU B 2 110 ? 51.494  54.114 117.831 1.00 13.87  ? 110 GLU B C   1 
ATOM   2127 O O   . GLU B 2 110 ? 50.699  53.211 117.587 1.00 17.72  ? 110 GLU B O   1 
ATOM   2128 C CB  . GLU B 2 110 ? 53.033  54.792 115.941 1.00 17.25  ? 110 GLU B CB  1 
ATOM   2129 C CG  . GLU B 2 110 ? 54.424  55.286 115.712 1.00 32.36  ? 110 GLU B CG  1 
ATOM   2130 C CD  . GLU B 2 110 ? 54.507  56.137 114.476 1.00 62.40  ? 110 GLU B CD  1 
ATOM   2131 O OE1 . GLU B 2 110 ? 53.796  57.168 114.420 1.00 74.53  ? 110 GLU B OE1 1 
ATOM   2132 O OE2 . GLU B 2 110 ? 55.269  55.771 113.555 1.00 72.05  ? 110 GLU B OE2 1 
ATOM   2133 N N   . PRO B 2 111 ? 51.184  55.124 118.642 1.00 13.97  ? 111 PRO B N   1 
ATOM   2134 C CA  . PRO B 2 111 ? 49.881  55.284 119.286 1.00 2.00   ? 111 PRO B CA  1 
ATOM   2135 C C   . PRO B 2 111 ? 48.662  55.274 118.383 1.00 7.35   ? 111 PRO B C   1 
ATOM   2136 O O   . PRO B 2 111 ? 48.752  55.539 117.185 1.00 16.79  ? 111 PRO B O   1 
ATOM   2137 C CB  . PRO B 2 111 ? 50.052  56.567 120.061 1.00 2.00   ? 111 PRO B CB  1 
ATOM   2138 C CG  . PRO B 2 111 ? 50.984  57.324 119.214 1.00 2.00   ? 111 PRO B CG  1 
ATOM   2139 C CD  . PRO B 2 111 ? 51.997  56.337 118.809 1.00 9.69   ? 111 PRO B CD  1 
ATOM   2140 N N   . PRO B 2 112 ? 47.510  54.885 118.942 1.00 3.95   ? 112 PRO B N   1 
ATOM   2141 C CA  . PRO B 2 112 ? 46.248  54.821 118.215 1.00 2.00   ? 112 PRO B CA  1 
ATOM   2142 C C   . PRO B 2 112 ? 45.630  56.175 117.920 1.00 7.86   ? 112 PRO B C   1 
ATOM   2143 O O   . PRO B 2 112 ? 45.943  57.191 118.557 1.00 12.87  ? 112 PRO B O   1 
ATOM   2144 C CB  . PRO B 2 112 ? 45.372  53.957 119.126 1.00 2.00   ? 112 PRO B CB  1 
ATOM   2145 C CG  . PRO B 2 112 ? 45.882  54.199 120.452 1.00 2.00   ? 112 PRO B CG  1 
ATOM   2146 C CD  . PRO B 2 112 ? 47.366  54.301 120.285 1.00 3.91   ? 112 PRO B CD  1 
ATOM   2147 N N   . MET B 2 113 ? 44.774  56.181 116.909 1.00 17.20  ? 113 MET B N   1 
ATOM   2148 C CA  . MET B 2 113 ? 44.115  57.385 116.444 1.00 20.22  ? 113 MET B CA  1 
ATOM   2149 C C   . MET B 2 113 ? 42.881  57.541 117.269 1.00 19.18  ? 113 MET B C   1 
ATOM   2150 O O   . MET B 2 113 ? 41.875  56.898 116.995 1.00 34.07  ? 113 MET B O   1 
ATOM   2151 C CB  . MET B 2 113 ? 43.741  57.242 114.969 1.00 36.28  ? 113 MET B CB  1 
ATOM   2152 C CG  . MET B 2 113 ? 44.944  57.126 114.031 1.00 60.82  ? 113 MET B CG  1 
ATOM   2153 S SD  . MET B 2 113 ? 44.719  55.949 112.650 1.00 81.10  ? 113 MET B SD  1 
ATOM   2154 C CE  . MET B 2 113 ? 43.110  56.486 111.965 1.00 77.86  ? 113 MET B CE  1 
ATOM   2155 N N   . LEU B 2 114 ? 42.982  58.368 118.303 1.00 21.28  ? 114 LEU B N   1 
ATOM   2156 C CA  . LEU B 2 114 ? 41.877  58.641 119.217 1.00 13.29  ? 114 LEU B CA  1 
ATOM   2157 C C   . LEU B 2 114 ? 41.300  59.998 118.884 1.00 7.45   ? 114 LEU B C   1 
ATOM   2158 O O   . LEU B 2 114 ? 42.031  60.988 118.775 1.00 21.78  ? 114 LEU B O   1 
ATOM   2159 C CB  . LEU B 2 114 ? 42.391  58.629 120.668 1.00 16.32  ? 114 LEU B CB  1 
ATOM   2160 C CG  . LEU B 2 114 ? 41.483  59.007 121.833 1.00 3.57   ? 114 LEU B CG  1 
ATOM   2161 C CD1 . LEU B 2 114 ? 40.564  57.877 122.126 1.00 17.76  ? 114 LEU B CD1 1 
ATOM   2162 C CD2 . LEU B 2 114 ? 42.314  59.323 123.056 1.00 23.66  ? 114 LEU B CD2 1 
ATOM   2163 N N   . GLN B 2 115 ? 39.994  60.046 118.704 1.00 7.64   ? 115 GLN B N   1 
ATOM   2164 C CA  . GLN B 2 115 ? 39.345  61.312 118.400 1.00 20.44  ? 115 GLN B CA  1 
ATOM   2165 C C   . GLN B 2 115 ? 38.009  61.431 119.120 1.00 16.12  ? 115 GLN B C   1 
ATOM   2166 O O   . GLN B 2 115 ? 37.407  60.437 119.493 1.00 20.93  ? 115 GLN B O   1 
ATOM   2167 C CB  . GLN B 2 115 ? 39.138  61.437 116.903 1.00 22.47  ? 115 GLN B CB  1 
ATOM   2168 C CG  . GLN B 2 115 ? 38.234  60.378 116.327 1.00 30.48  ? 115 GLN B CG  1 
ATOM   2169 C CD  . GLN B 2 115 ? 38.561  60.074 114.874 1.00 54.44  ? 115 GLN B CD  1 
ATOM   2170 O OE1 . GLN B 2 115 ? 39.527  60.606 114.306 1.00 67.37  ? 115 GLN B OE1 1 
ATOM   2171 N NE2 . GLN B 2 115 ? 37.780  59.190 114.271 1.00 65.71  ? 115 GLN B NE2 1 
ATOM   2172 N N   . ALA B 2 116 ? 37.578  62.652 119.365 1.00 12.86  ? 116 ALA B N   1 
ATOM   2173 C CA  . ALA B 2 116 ? 36.308  62.885 120.023 1.00 4.86   ? 116 ALA B CA  1 
ATOM   2174 C C   . ALA B 2 116 ? 35.184  62.721 119.020 1.00 10.12  ? 116 ALA B C   1 
ATOM   2175 O O   . ALA B 2 116 ? 35.397  62.866 117.817 1.00 30.30  ? 116 ALA B O   1 
ATOM   2176 C CB  . ALA B 2 116 ? 36.285  64.265 120.563 1.00 18.82  ? 116 ALA B CB  1 
ATOM   2177 N N   . LEU B 2 117 ? 33.967  62.550 119.524 1.00 16.77  ? 117 LEU B N   1 
ATOM   2178 C CA  . LEU B 2 117 ? 32.810  62.382 118.664 1.00 24.58  ? 117 LEU B CA  1 
ATOM   2179 C C   . LEU B 2 117 ? 31.821  63.527 118.584 1.00 44.04  ? 117 LEU B C   1 
ATOM   2180 O O   . LEU B 2 117 ? 31.299  63.996 119.608 1.00 32.52  ? 117 LEU B O   1 
ATOM   2181 C CB  . LEU B 2 117 ? 32.083  61.101 118.988 1.00 18.14  ? 117 LEU B CB  1 
ATOM   2182 C CG  . LEU B 2 117 ? 32.848  59.903 118.461 1.00 14.79  ? 117 LEU B CG  1 
ATOM   2183 C CD1 . LEU B 2 117 ? 31.903  58.752 118.420 1.00 17.93  ? 117 LEU B CD1 1 
ATOM   2184 C CD2 . LEU B 2 117 ? 33.388  60.185 117.077 1.00 20.85  ? 117 LEU B CD2 1 
ATOM   2185 N N   . ASP B 2 118 ? 31.571  63.924 117.329 1.00 69.91  ? 118 ASP B N   1 
ATOM   2186 C CA  . ASP B 2 118 ? 30.672  65.011 116.905 1.00 89.27  ? 118 ASP B CA  1 
ATOM   2187 C C   . ASP B 2 118 ? 29.211  64.542 117.022 1.00 92.39  ? 118 ASP B C   1 
ATOM   2188 O O   . ASP B 2 118 ? 28.607  64.114 116.027 1.00 96.04  ? 118 ASP B O   1 
ATOM   2189 C CB  . ASP B 2 118 ? 30.997  65.383 115.426 1.00 100.29 ? 118 ASP B CB  1 
ATOM   2190 C CG  . ASP B 2 118 ? 30.625  66.837 115.046 1.00 105.14 ? 118 ASP B CG  1 
ATOM   2191 O OD1 . ASP B 2 118 ? 31.400  67.456 114.280 1.00 106.25 ? 118 ASP B OD1 1 
ATOM   2192 O OD2 . ASP B 2 118 ? 29.564  67.352 115.466 1.00 102.47 ? 118 ASP B OD2 1 
ATOM   2193 N N   . ILE B 2 119 ? 28.685  64.559 118.248 1.00 90.61  ? 119 ILE B N   1 
ATOM   2194 C CA  . ILE B 2 119 ? 27.299  64.162 118.512 1.00 93.06  ? 119 ILE B CA  1 
ATOM   2195 C C   . ILE B 2 119 ? 26.391  65.384 118.315 1.00 105.17 ? 119 ILE B C   1 
ATOM   2196 O O   . ILE B 2 119 ? 25.613  65.402 117.335 1.00 109.03 ? 119 ILE B O   1 
ATOM   2197 C CB  . ILE B 2 119 ? 27.130  63.581 119.959 1.00 76.48  ? 119 ILE B CB  1 
ATOM   2198 C CG1 . ILE B 2 119 ? 27.770  62.194 120.060 1.00 69.07  ? 119 ILE B CG1 1 
ATOM   2199 C CG2 . ILE B 2 119 ? 25.661  63.487 120.351 1.00 66.20  ? 119 ILE B CG2 1 
ATOM   2200 C CD1 . ILE B 2 119 ? 27.100  61.126 119.223 1.00 52.40  ? 119 ILE B CD1 1 
ATOM   2201 N N   . GLN B 2 127 ? 21.597  64.482 129.587 1.00 51.34  ? 127 GLN B N   1 
ATOM   2202 C CA  . GLN B 2 127 ? 22.386  63.913 130.723 1.00 58.25  ? 127 GLN B CA  1 
ATOM   2203 C C   . GLN B 2 127 ? 23.699  64.712 130.807 1.00 58.83  ? 127 GLN B C   1 
ATOM   2204 O O   . GLN B 2 127 ? 24.278  65.030 129.773 1.00 61.07  ? 127 GLN B O   1 
ATOM   2205 C CB  . GLN B 2 127 ? 22.648  62.419 130.479 1.00 55.58  ? 127 GLN B CB  1 
ATOM   2206 C CG  . GLN B 2 127 ? 23.295  61.688 131.663 1.00 63.54  ? 127 GLN B CG  1 
ATOM   2207 C CD  . GLN B 2 127 ? 23.172  60.171 131.585 1.00 66.91  ? 127 GLN B CD  1 
ATOM   2208 O OE1 . GLN B 2 127 ? 24.002  59.439 132.131 1.00 60.57  ? 127 GLN B OE1 1 
ATOM   2209 N NE2 . GLN B 2 127 ? 22.111  59.691 130.939 1.00 73.78  ? 127 GLN B NE2 1 
ATOM   2210 N N   . PRO B 2 128 ? 24.169  65.060 132.028 1.00 54.26  ? 128 PRO B N   1 
ATOM   2211 C CA  . PRO B 2 128 ? 25.406  65.833 132.191 1.00 42.63  ? 128 PRO B CA  1 
ATOM   2212 C C   . PRO B 2 128 ? 26.689  65.078 132.589 1.00 39.09  ? 128 PRO B C   1 
ATOM   2213 O O   . PRO B 2 128 ? 26.655  64.113 133.370 1.00 38.49  ? 128 PRO B O   1 
ATOM   2214 C CB  . PRO B 2 128 ? 25.008  66.832 133.267 1.00 48.50  ? 128 PRO B CB  1 
ATOM   2215 C CG  . PRO B 2 128 ? 24.229  65.948 134.224 1.00 59.27  ? 128 PRO B CG  1 
ATOM   2216 C CD  . PRO B 2 128 ? 23.460  64.955 133.321 1.00 60.47  ? 128 PRO B CD  1 
ATOM   2217 N N   . GLY B 2 129 ? 27.821  65.594 132.098 1.00 28.14  ? 129 GLY B N   1 
ATOM   2218 C CA  . GLY B 2 129 ? 29.134  65.022 132.369 1.00 13.87  ? 129 GLY B CA  1 
ATOM   2219 C C   . GLY B 2 129 ? 29.589  63.848 131.508 1.00 7.24   ? 129 GLY B C   1 
ATOM   2220 O O   . GLY B 2 129 ? 30.310  62.986 132.002 1.00 14.17  ? 129 GLY B O   1 
ATOM   2221 N N   . CYS B 2 130 ? 29.211  63.841 130.227 1.00 9.36   ? 130 CYS B N   1 
ATOM   2222 C CA  . CYS B 2 130 ? 29.539  62.761 129.285 1.00 17.46  ? 130 CYS B CA  1 
ATOM   2223 C C   . CYS B 2 130 ? 30.430  63.141 128.088 1.00 20.44  ? 130 CYS B C   1 
ATOM   2224 O O   . CYS B 2 130 ? 30.445  64.292 127.644 1.00 26.41  ? 130 CYS B O   1 
ATOM   2225 C CB  . CYS B 2 130 ? 28.248  62.130 128.716 1.00 18.36  ? 130 CYS B CB  1 
ATOM   2226 S SG  . CYS B 2 130 ? 27.168  61.194 129.850 1.00 30.18  ? 130 CYS B SG  1 
ATOM   2227 N N   . LEU B 2 131 ? 31.069  62.126 127.504 1.00 12.33  ? 131 LEU B N   1 
ATOM   2228 C CA  . LEU B 2 131 ? 31.949  62.279 126.350 1.00 9.91   ? 131 LEU B CA  1 
ATOM   2229 C C   . LEU B 2 131 ? 31.824  61.033 125.526 1.00 11.50  ? 131 LEU B C   1 
ATOM   2230 O O   . LEU B 2 131 ? 31.653  59.948 126.077 1.00 19.47  ? 131 LEU B O   1 
ATOM   2231 C CB  . LEU B 2 131 ? 33.407  62.337 126.790 1.00 2.00   ? 131 LEU B CB  1 
ATOM   2232 C CG  . LEU B 2 131 ? 33.905  63.634 127.359 1.00 4.25   ? 131 LEU B CG  1 
ATOM   2233 C CD1 . LEU B 2 131 ? 35.281  63.407 127.904 1.00 2.00   ? 131 LEU B CD1 1 
ATOM   2234 C CD2 . LEU B 2 131 ? 33.872  64.684 126.256 1.00 29.68  ? 131 LEU B CD2 1 
ATOM   2235 N N   . TRP B 2 132 ? 31.970  61.164 124.217 1.00 10.66  ? 132 TRP B N   1 
ATOM   2236 C CA  . TRP B 2 132 ? 31.915  59.996 123.349 1.00 15.29  ? 132 TRP B CA  1 
ATOM   2237 C C   . TRP B 2 132 ? 33.222  59.932 122.610 1.00 15.74  ? 132 TRP B C   1 
ATOM   2238 O O   . TRP B 2 132 ? 33.697  60.956 122.130 1.00 25.06  ? 132 TRP B O   1 
ATOM   2239 C CB  . TRP B 2 132 ? 30.748  60.076 122.371 1.00 10.35  ? 132 TRP B CB  1 
ATOM   2240 C CG  . TRP B 2 132 ? 29.457  59.765 123.039 1.00 20.43  ? 132 TRP B CG  1 
ATOM   2241 C CD1 . TRP B 2 132 ? 28.850  58.544 123.118 1.00 30.18  ? 132 TRP B CD1 1 
ATOM   2242 C CD2 . TRP B 2 132 ? 28.645  60.666 123.792 1.00 11.83  ? 132 TRP B CD2 1 
ATOM   2243 N NE1 . TRP B 2 132 ? 27.723  58.630 123.883 1.00 25.16  ? 132 TRP B NE1 1 
ATOM   2244 C CE2 . TRP B 2 132 ? 27.570  59.923 124.308 1.00 8.64   ? 132 TRP B CE2 1 
ATOM   2245 C CE3 . TRP B 2 132 ? 28.723  62.036 124.083 1.00 14.84  ? 132 TRP B CE3 1 
ATOM   2246 C CZ2 . TRP B 2 132 ? 26.573  60.503 125.102 1.00 22.02  ? 132 TRP B CZ2 1 
ATOM   2247 C CZ3 . TRP B 2 132 ? 27.732  62.613 124.876 1.00 10.85  ? 132 TRP B CZ3 1 
ATOM   2248 C CH2 . TRP B 2 132 ? 26.672  61.847 125.376 1.00 12.01  ? 132 TRP B CH2 1 
ATOM   2249 N N   . LEU B 2 133 ? 33.827  58.749 122.565 1.00 12.08  ? 133 LEU B N   1 
ATOM   2250 C CA  . LEU B 2 133 ? 35.107  58.565 121.886 1.00 8.35   ? 133 LEU B CA  1 
ATOM   2251 C C   . LEU B 2 133 ? 35.049  57.519 120.794 1.00 10.88  ? 133 LEU B C   1 
ATOM   2252 O O   . LEU B 2 133 ? 34.112  56.725 120.713 1.00 17.40  ? 133 LEU B O   1 
ATOM   2253 C CB  . LEU B 2 133 ? 36.198  58.154 122.870 1.00 10.12  ? 133 LEU B CB  1 
ATOM   2254 C CG  . LEU B 2 133 ? 36.371  58.987 124.124 1.00 2.00   ? 133 LEU B CG  1 
ATOM   2255 C CD1 . LEU B 2 133 ? 37.351  58.329 125.034 1.00 2.00   ? 133 LEU B CD1 1 
ATOM   2256 C CD2 . LEU B 2 133 ? 36.835  60.353 123.744 1.00 16.44  ? 133 LEU B CD2 1 
ATOM   2257 N N   . SER B 2 134 ? 36.100  57.506 119.988 1.00 10.30  ? 134 SER B N   1 
ATOM   2258 C CA  . SER B 2 134 ? 36.250  56.585 118.881 1.00 2.00   ? 134 SER B CA  1 
ATOM   2259 C C   . SER B 2 134 ? 37.737  56.400 118.722 1.00 2.00   ? 134 SER B C   1 
ATOM   2260 O O   . SER B 2 134 ? 38.524  57.323 118.957 1.00 5.94   ? 134 SER B O   1 
ATOM   2261 C CB  . SER B 2 134 ? 35.692  57.225 117.615 1.00 2.00   ? 134 SER B CB  1 
ATOM   2262 O OG  . SER B 2 134 ? 36.254  56.678 116.433 1.00 31.68  ? 134 SER B OG  1 
ATOM   2263 N N   . TRP B 2 135 ? 38.150  55.182 118.452 1.00 4.87   ? 135 TRP B N   1 
ATOM   2264 C CA  . TRP B 2 135 ? 39.559  54.953 118.190 1.00 3.87   ? 135 TRP B CA  1 
ATOM   2265 C C   . TRP B 2 135 ? 39.732  53.790 117.239 1.00 9.39   ? 135 TRP B C   1 
ATOM   2266 O O   . TRP B 2 135 ? 38.871  52.912 117.119 1.00 16.73  ? 135 TRP B O   1 
ATOM   2267 C CB  . TRP B 2 135 ? 40.388  54.778 119.466 1.00 4.82   ? 135 TRP B CB  1 
ATOM   2268 C CG  . TRP B 2 135 ? 40.020  53.627 120.328 1.00 9.79   ? 135 TRP B CG  1 
ATOM   2269 C CD1 . TRP B 2 135 ? 40.450  52.344 120.211 1.00 3.67   ? 135 TRP B CD1 1 
ATOM   2270 C CD2 . TRP B 2 135 ? 39.135  53.650 121.444 1.00 6.25   ? 135 TRP B CD2 1 
ATOM   2271 N NE1 . TRP B 2 135 ? 39.883  51.561 121.182 1.00 3.97   ? 135 TRP B NE1 1 
ATOM   2272 C CE2 . TRP B 2 135 ? 39.068  52.343 121.952 1.00 2.00   ? 135 TRP B CE2 1 
ATOM   2273 C CE3 . TRP B 2 135 ? 38.389  54.649 122.063 1.00 11.01  ? 135 TRP B CE3 1 
ATOM   2274 C CZ2 . TRP B 2 135 ? 38.289  52.014 123.040 1.00 2.56   ? 135 TRP B CZ2 1 
ATOM   2275 C CZ3 . TRP B 2 135 ? 37.614  54.317 123.145 1.00 2.64   ? 135 TRP B CZ3 1 
ATOM   2276 C CH2 . TRP B 2 135 ? 37.570  53.015 123.621 1.00 11.02  ? 135 TRP B CH2 1 
ATOM   2277 N N   . LYS B 2 136 ? 40.773  53.899 116.443 1.00 9.08   ? 136 LYS B N   1 
ATOM   2278 C CA  . LYS B 2 136 ? 41.138  52.890 115.474 1.00 4.95   ? 136 LYS B CA  1 
ATOM   2279 C C   . LYS B 2 136 ? 42.631  52.754 115.760 1.00 12.94  ? 136 LYS B C   1 
ATOM   2280 O O   . LYS B 2 136 ? 43.269  53.672 116.312 1.00 13.45  ? 136 LYS B O   1 
ATOM   2281 C CB  . LYS B 2 136 ? 40.939  53.414 114.042 1.00 7.30   ? 136 LYS B CB  1 
ATOM   2282 C CG  . LYS B 2 136 ? 39.499  53.674 113.622 1.00 43.53  ? 136 LYS B CG  1 
ATOM   2283 C CD  . LYS B 2 136 ? 39.434  54.184 112.182 1.00 53.36  ? 136 LYS B CD  1 
ATOM   2284 C CE  . LYS B 2 136 ? 37.996  54.236 111.659 1.00 74.66  ? 136 LYS B CE  1 
ATOM   2285 N NZ  . LYS B 2 136 ? 37.346  52.887 111.607 1.00 81.62  ? 136 LYS B NZ  1 
ATOM   2286 N N   . PRO B 2 137 ? 43.206  51.591 115.474 1.00 13.12  ? 137 PRO B N   1 
ATOM   2287 C CA  . PRO B 2 137 ? 44.634  51.461 115.734 1.00 7.62   ? 137 PRO B CA  1 
ATOM   2288 C C   . PRO B 2 137 ? 45.478  52.064 114.614 1.00 8.41   ? 137 PRO B C   1 
ATOM   2289 O O   . PRO B 2 137 ? 44.985  52.462 113.554 1.00 16.22  ? 137 PRO B O   1 
ATOM   2290 C CB  . PRO B 2 137 ? 44.821  49.960 115.814 1.00 5.96   ? 137 PRO B CB  1 
ATOM   2291 C CG  . PRO B 2 137 ? 43.855  49.466 114.832 1.00 2.00   ? 137 PRO B CG  1 
ATOM   2292 C CD  . PRO B 2 137 ? 42.622  50.292 115.110 1.00 13.75  ? 137 PRO B CD  1 
ATOM   2293 N N   . TRP B 2 138 ? 46.767  52.119 114.872 1.00 6.99   ? 138 TRP B N   1 
ATOM   2294 C CA  . TRP B 2 138 ? 47.719  52.666 113.945 1.00 3.90   ? 138 TRP B CA  1 
ATOM   2295 C C   . TRP B 2 138 ? 47.648  51.756 112.728 1.00 9.68   ? 138 TRP B C   1 
ATOM   2296 O O   . TRP B 2 138 ? 48.024  50.583 112.816 1.00 15.38  ? 138 TRP B O   1 
ATOM   2297 C CB  . TRP B 2 138 ? 49.077  52.639 114.636 1.00 9.19   ? 138 TRP B CB  1 
ATOM   2298 C CG  . TRP B 2 138 ? 50.170  53.117 113.817 1.00 9.89   ? 138 TRP B CG  1 
ATOM   2299 C CD1 . TRP B 2 138 ? 50.190  54.231 113.062 1.00 2.00   ? 138 TRP B CD1 1 
ATOM   2300 C CD2 . TRP B 2 138 ? 51.409  52.458 113.606 1.00 12.32  ? 138 TRP B CD2 1 
ATOM   2301 N NE1 . TRP B 2 138 ? 51.358  54.306 112.386 1.00 3.86   ? 138 TRP B NE1 1 
ATOM   2302 C CE2 . TRP B 2 138 ? 52.129  53.225 112.701 1.00 4.57   ? 138 TRP B CE2 1 
ATOM   2303 C CE3 . TRP B 2 138 ? 51.977  51.279 114.097 1.00 13.45  ? 138 TRP B CE3 1 
ATOM   2304 C CZ2 . TRP B 2 138 ? 53.393  52.862 112.265 1.00 13.20  ? 138 TRP B CZ2 1 
ATOM   2305 C CZ3 . TRP B 2 138 ? 53.233  50.918 113.667 1.00 2.00   ? 138 TRP B CZ3 1 
ATOM   2306 C CH2 . TRP B 2 138 ? 53.926  51.701 112.764 1.00 2.00   ? 138 TRP B CH2 1 
ATOM   2307 N N   . LYS B 2 139 ? 47.219  52.299 111.584 1.00 7.89   ? 139 LYS B N   1 
ATOM   2308 C CA  . LYS B 2 139 ? 47.024  51.483 110.371 1.00 6.91   ? 139 LYS B CA  1 
ATOM   2309 C C   . LYS B 2 139 ? 48.052  50.413 109.984 1.00 2.00   ? 139 LYS B C   1 
ATOM   2310 O O   . LYS B 2 139 ? 47.707  49.272 109.685 1.00 15.22  ? 139 LYS B O   1 
ATOM   2311 C CB  . LYS B 2 139 ? 46.665  52.359 109.167 1.00 14.71  ? 139 LYS B CB  1 
ATOM   2312 C CG  . LYS B 2 139 ? 45.827  51.614 108.136 1.00 21.39  ? 139 LYS B CG  1 
ATOM   2313 C CD  . LYS B 2 139 ? 44.969  52.554 107.325 1.00 53.52  ? 139 LYS B CD  1 
ATOM   2314 C CE  . LYS B 2 139 ? 43.769  51.818 106.730 1.00 72.83  ? 139 LYS B CE  1 
ATOM   2315 N NZ  . LYS B 2 139 ? 42.819  51.313 107.772 1.00 88.28  ? 139 LYS B NZ  1 
ATOM   2316 N N   . PRO B 2 140 ? 49.321  50.763 109.972 1.00 2.00   ? 140 PRO B N   1 
ATOM   2317 C CA  . PRO B 2 140 ? 50.314  49.769 109.614 1.00 2.00   ? 140 PRO B CA  1 
ATOM   2318 C C   . PRO B 2 140 ? 50.271  48.534 110.509 1.00 2.00   ? 140 PRO B C   1 
ATOM   2319 O O   . PRO B 2 140 ? 50.775  47.494 110.138 1.00 14.77  ? 140 PRO B O   1 
ATOM   2320 C CB  . PRO B 2 140 ? 51.618  50.533 109.808 1.00 3.98   ? 140 PRO B CB  1 
ATOM   2321 C CG  . PRO B 2 140 ? 51.259  51.902 109.539 1.00 2.00   ? 140 PRO B CG  1 
ATOM   2322 C CD  . PRO B 2 140 ? 49.959  52.056 110.239 1.00 6.02   ? 140 PRO B CD  1 
ATOM   2323 N N   . SER B 2 141 ? 49.694  48.647 111.693 1.00 2.00   ? 141 SER B N   1 
ATOM   2324 C CA  . SER B 2 141 ? 49.644  47.500 112.586 1.00 2.00   ? 141 SER B CA  1 
ATOM   2325 C C   . SER B 2 141 ? 48.249  46.922 112.760 1.00 8.89   ? 141 SER B C   1 
ATOM   2326 O O   . SER B 2 141 ? 48.051  46.083 113.628 1.00 9.14   ? 141 SER B O   1 
ATOM   2327 C CB  . SER B 2 141 ? 50.157  47.889 113.961 1.00 2.25   ? 141 SER B CB  1 
ATOM   2328 O OG  . SER B 2 141 ? 49.263  48.791 114.573 1.00 2.00   ? 141 SER B OG  1 
ATOM   2329 N N   . GLU B 2 142 ? 47.295  47.332 111.926 1.00 9.08   ? 142 GLU B N   1 
ATOM   2330 C CA  . GLU B 2 142 ? 45.930  46.855 112.056 1.00 2.00   ? 142 GLU B CA  1 
ATOM   2331 C C   . GLU B 2 142 ? 45.750  45.322 112.058 1.00 10.01  ? 142 GLU B C   1 
ATOM   2332 O O   . GLU B 2 142 ? 44.751  44.821 112.588 1.00 15.28  ? 142 GLU B O   1 
ATOM   2333 C CB  . GLU B 2 142 ? 45.014  47.514 111.016 1.00 4.02   ? 142 GLU B CB  1 
ATOM   2334 C CG  . GLU B 2 142 ? 45.391  47.266 109.548 1.00 50.40  ? 142 GLU B CG  1 
ATOM   2335 C CD  . GLU B 2 142 ? 44.352  47.783 108.537 1.00 67.21  ? 142 GLU B CD  1 
ATOM   2336 O OE1 . GLU B 2 142 ? 43.278  48.282 108.958 1.00 68.17  ? 142 GLU B OE1 1 
ATOM   2337 O OE2 . GLU B 2 142 ? 44.617  47.676 107.311 1.00 77.63  ? 142 GLU B OE2 1 
ATOM   2338 N N   . TYR B 2 143 ? 46.728  44.574 111.542 1.00 2.00   ? 143 TYR B N   1 
ATOM   2339 C CA  . TYR B 2 143 ? 46.609  43.115 111.480 1.00 2.00   ? 143 TYR B CA  1 
ATOM   2340 C C   . TYR B 2 143 ? 46.958  42.422 112.781 1.00 9.26   ? 143 TYR B C   1 
ATOM   2341 O O   . TYR B 2 143 ? 46.802  41.202 112.927 1.00 16.43  ? 143 TYR B O   1 
ATOM   2342 C CB  . TYR B 2 143 ? 47.479  42.536 110.369 1.00 2.75   ? 143 TYR B CB  1 
ATOM   2343 C CG  . TYR B 2 143 ? 48.951  42.651 110.632 1.00 2.00   ? 143 TYR B CG  1 
ATOM   2344 C CD1 . TYR B 2 143 ? 49.662  43.759 110.196 1.00 2.00   ? 143 TYR B CD1 1 
ATOM   2345 C CD2 . TYR B 2 143 ? 49.610  41.701 111.402 1.00 10.96  ? 143 TYR B CD2 1 
ATOM   2346 C CE1 . TYR B 2 143 ? 50.976  43.924 110.528 1.00 8.46   ? 143 TYR B CE1 1 
ATOM   2347 C CE2 . TYR B 2 143 ? 50.926  41.861 111.746 1.00 5.82   ? 143 TYR B CE2 1 
ATOM   2348 C CZ  . TYR B 2 143 ? 51.597  42.978 111.306 1.00 3.08   ? 143 TYR B CZ  1 
ATOM   2349 O OH  . TYR B 2 143 ? 52.887  43.168 111.671 1.00 24.31  ? 143 TYR B OH  1 
ATOM   2350 N N   . MET B 2 144 ? 47.448  43.212 113.715 1.00 9.55   ? 144 MET B N   1 
ATOM   2351 C CA  . MET B 2 144 ? 47.868  42.737 115.012 1.00 8.64   ? 144 MET B CA  1 
ATOM   2352 C C   . MET B 2 144 ? 46.715  42.927 116.015 1.00 7.33   ? 144 MET B C   1 
ATOM   2353 O O   . MET B 2 144 ? 46.075  43.977 116.017 1.00 24.45  ? 144 MET B O   1 
ATOM   2354 C CB  . MET B 2 144 ? 49.082  43.568 115.371 1.00 2.00   ? 144 MET B CB  1 
ATOM   2355 C CG  . MET B 2 144 ? 49.755  43.211 116.628 1.00 28.80  ? 144 MET B CG  1 
ATOM   2356 S SD  . MET B 2 144 ? 51.218  44.221 116.800 1.00 26.57  ? 144 MET B SD  1 
ATOM   2357 C CE  . MET B 2 144 ? 51.891  44.098 115.098 1.00 11.90  ? 144 MET B CE  1 
ATOM   2358 N N   . GLU B 2 145 ? 46.392  41.901 116.807 1.00 10.98  ? 145 GLU B N   1 
ATOM   2359 C CA  . GLU B 2 145 ? 45.298  41.995 117.790 1.00 8.33   ? 145 GLU B CA  1 
ATOM   2360 C C   . GLU B 2 145 ? 45.935  42.769 118.913 1.00 7.41   ? 145 GLU B C   1 
ATOM   2361 O O   . GLU B 2 145 ? 46.990  42.398 119.392 1.00 3.98   ? 145 GLU B O   1 
ATOM   2362 C CB  . GLU B 2 145 ? 44.866  40.604 118.284 1.00 14.96  ? 145 GLU B CB  1 
ATOM   2363 C CG  . GLU B 2 145 ? 43.470  40.513 118.895 1.00 50.90  ? 145 GLU B CG  1 
ATOM   2364 C CD  . GLU B 2 145 ? 42.356  40.215 117.878 1.00 74.80  ? 145 GLU B CD  1 
ATOM   2365 O OE1 . GLU B 2 145 ? 41.723  39.141 117.991 1.00 84.37  ? 145 GLU B OE1 1 
ATOM   2366 O OE2 . GLU B 2 145 ? 42.088  41.058 116.992 1.00 88.79  ? 145 GLU B OE2 1 
ATOM   2367 N N   . GLN B 2 146 ? 45.337  43.889 119.287 1.00 17.22  ? 146 GLN B N   1 
ATOM   2368 C CA  . GLN B 2 146 ? 45.899  44.723 120.349 1.00 6.41   ? 146 GLN B CA  1 
ATOM   2369 C C   . GLN B 2 146 ? 44.925  44.929 121.485 1.00 2.00   ? 146 GLN B C   1 
ATOM   2370 O O   . GLN B 2 146 ? 43.723  44.695 121.344 1.00 10.08  ? 146 GLN B O   1 
ATOM   2371 C CB  . GLN B 2 146 ? 46.356  46.081 119.791 1.00 2.00   ? 146 GLN B CB  1 
ATOM   2372 C CG  . GLN B 2 146 ? 47.601  46.032 118.937 1.00 6.79   ? 146 GLN B CG  1 
ATOM   2373 C CD  . GLN B 2 146 ? 47.664  47.184 117.991 1.00 4.82   ? 146 GLN B CD  1 
ATOM   2374 O OE1 . GLN B 2 146 ? 47.896  48.306 118.404 1.00 29.75  ? 146 GLN B OE1 1 
ATOM   2375 N NE2 . GLN B 2 146 ? 47.409  46.932 116.718 1.00 25.35  ? 146 GLN B NE2 1 
ATOM   2376 N N   . GLU B 2 147 ? 45.469  45.436 122.581 1.00 2.00   ? 147 GLU B N   1 
ATOM   2377 C CA  . GLU B 2 147 ? 44.761  45.709 123.836 1.00 2.00   ? 147 GLU B CA  1 
ATOM   2378 C C   . GLU B 2 147 ? 45.190  47.116 124.154 1.00 5.77   ? 147 GLU B C   1 
ATOM   2379 O O   . GLU B 2 147 ? 46.380  47.429 124.028 1.00 11.71  ? 147 GLU B O   1 
ATOM   2380 C CB  . GLU B 2 147 ? 45.328  44.771 124.922 1.00 13.12  ? 147 GLU B CB  1 
ATOM   2381 C CG  . GLU B 2 147 ? 44.691  44.779 126.295 1.00 33.61  ? 147 GLU B CG  1 
ATOM   2382 C CD  . GLU B 2 147 ? 45.342  43.763 127.206 1.00 49.95  ? 147 GLU B CD  1 
ATOM   2383 O OE1 . GLU B 2 147 ? 44.893  42.591 127.213 1.00 72.33  ? 147 GLU B OE1 1 
ATOM   2384 O OE2 . GLU B 2 147 ? 46.322  44.129 127.892 1.00 47.75  ? 147 GLU B OE2 1 
ATOM   2385 N N   . CYS B 2 148 ? 44.247  47.950 124.591 1.00 5.39   ? 148 CYS B N   1 
ATOM   2386 C CA  . CYS B 2 148 ? 44.546  49.342 124.917 1.00 13.34  ? 148 CYS B CA  1 
ATOM   2387 C C   . CYS B 2 148 ? 44.151  49.801 126.324 1.00 10.08  ? 148 CYS B C   1 
ATOM   2388 O O   . CYS B 2 148 ? 43.228  49.259 126.930 1.00 19.17  ? 148 CYS B O   1 
ATOM   2389 C CB  . CYS B 2 148 ? 43.898  50.269 123.873 1.00 9.06   ? 148 CYS B CB  1 
ATOM   2390 S SG  . CYS B 2 148 ? 44.303  49.808 122.170 1.00 25.19  ? 148 CYS B SG  1 
ATOM   2391 N N   . GLU B 2 149 ? 44.884  50.789 126.831 1.00 2.00   ? 149 GLU B N   1 
ATOM   2392 C CA  . GLU B 2 149 ? 44.618  51.406 128.124 1.00 2.00   ? 149 GLU B CA  1 
ATOM   2393 C C   . GLU B 2 149 ? 44.260  52.846 127.764 1.00 5.06   ? 149 GLU B C   1 
ATOM   2394 O O   . GLU B 2 149 ? 44.868  53.386 126.854 1.00 7.49   ? 149 GLU B O   1 
ATOM   2395 C CB  . GLU B 2 149 ? 45.891  51.439 128.987 1.00 2.39   ? 149 GLU B CB  1 
ATOM   2396 C CG  . GLU B 2 149 ? 46.412  50.059 129.467 1.00 27.28  ? 149 GLU B CG  1 
ATOM   2397 C CD  . GLU B 2 149 ? 47.630  50.138 130.407 1.00 16.92  ? 149 GLU B CD  1 
ATOM   2398 O OE1 . GLU B 2 149 ? 47.934  49.142 131.108 1.00 31.15  ? 149 GLU B OE1 1 
ATOM   2399 O OE2 . GLU B 2 149 ? 48.282  51.194 130.449 1.00 20.67  ? 149 GLU B OE2 1 
ATOM   2400 N N   . LEU B 2 150 ? 43.252  53.436 128.409 1.00 2.00   ? 150 LEU B N   1 
ATOM   2401 C CA  . LEU B 2 150 ? 42.871  54.839 128.184 1.00 2.00   ? 150 LEU B CA  1 
ATOM   2402 C C   . LEU B 2 150 ? 43.058  55.534 129.501 1.00 2.00   ? 150 LEU B C   1 
ATOM   2403 O O   . LEU B 2 150 ? 42.720  54.952 130.513 1.00 9.47   ? 150 LEU B O   1 
ATOM   2404 C CB  . LEU B 2 150 ? 41.396  54.957 127.861 1.00 11.93  ? 150 LEU B CB  1 
ATOM   2405 C CG  . LEU B 2 150 ? 40.712  56.316 128.053 1.00 3.62   ? 150 LEU B CG  1 
ATOM   2406 C CD1 . LEU B 2 150 ? 41.159  57.286 126.992 1.00 10.70  ? 150 LEU B CD1 1 
ATOM   2407 C CD2 . LEU B 2 150 ? 39.229  56.126 127.950 1.00 2.00   ? 150 LEU B CD2 1 
ATOM   2408 N N   . ARG B 2 151 ? 43.640  56.726 129.530 1.00 5.24   ? 151 ARG B N   1 
ATOM   2409 C CA  . ARG B 2 151 ? 43.778  57.460 130.793 1.00 2.18   ? 151 ARG B CA  1 
ATOM   2410 C C   . ARG B 2 151 ? 43.113  58.821 130.640 1.00 7.80   ? 151 ARG B C   1 
ATOM   2411 O O   . ARG B 2 151 ? 43.168  59.439 129.581 1.00 15.66  ? 151 ARG B O   1 
ATOM   2412 C CB  . ARG B 2 151 ? 45.233  57.601 131.297 1.00 2.00   ? 151 ARG B CB  1 
ATOM   2413 C CG  . ARG B 2 151 ? 46.240  57.979 130.256 1.00 2.34   ? 151 ARG B CG  1 
ATOM   2414 C CD  . ARG B 2 151 ? 47.266  59.037 130.655 1.00 4.38   ? 151 ARG B CD  1 
ATOM   2415 N NE  . ARG B 2 151 ? 48.571  58.559 131.102 1.00 3.33   ? 151 ARG B NE  1 
ATOM   2416 C CZ  . ARG B 2 151 ? 49.710  59.167 130.810 1.00 2.00   ? 151 ARG B CZ  1 
ATOM   2417 N NH1 . ARG B 2 151 ? 49.680  60.225 130.082 1.00 2.00   ? 151 ARG B NH1 1 
ATOM   2418 N NH2 . ARG B 2 151 ? 50.877  58.762 131.264 1.00 15.85  ? 151 ARG B NH2 1 
ATOM   2419 N N   . TYR B 2 152 ? 42.367  59.218 131.659 1.00 4.44   ? 152 TYR B N   1 
ATOM   2420 C CA  . TYR B 2 152 ? 41.690  60.500 131.638 1.00 6.77   ? 152 TYR B CA  1 
ATOM   2421 C C   . TYR B 2 152 ? 41.755  61.217 132.970 1.00 7.25   ? 152 TYR B C   1 
ATOM   2422 O O   . TYR B 2 152 ? 41.809  60.592 134.019 1.00 16.04  ? 152 TYR B O   1 
ATOM   2423 C CB  . TYR B 2 152 ? 40.243  60.350 131.182 1.00 6.82   ? 152 TYR B CB  1 
ATOM   2424 C CG  . TYR B 2 152 ? 39.340  59.545 132.084 1.00 22.10  ? 152 TYR B CG  1 
ATOM   2425 C CD1 . TYR B 2 152 ? 39.102  58.188 131.838 1.00 24.81  ? 152 TYR B CD1 1 
ATOM   2426 C CD2 . TYR B 2 152 ? 38.693  60.140 133.159 1.00 16.73  ? 152 TYR B CD2 1 
ATOM   2427 C CE1 . TYR B 2 152 ? 38.239  57.442 132.640 1.00 22.66  ? 152 TYR B CE1 1 
ATOM   2428 C CE2 . TYR B 2 152 ? 37.834  59.399 133.971 1.00 38.40  ? 152 TYR B CE2 1 
ATOM   2429 C CZ  . TYR B 2 152 ? 37.613  58.050 133.708 1.00 32.70  ? 152 TYR B CZ  1 
ATOM   2430 O OH  . TYR B 2 152 ? 36.809  57.308 134.553 1.00 46.28  ? 152 TYR B OH  1 
ATOM   2431 N N   . GLN B 2 153 ? 41.832  62.535 132.918 1.00 6.24   ? 153 GLN B N   1 
ATOM   2432 C CA  . GLN B 2 153 ? 41.899  63.332 134.127 1.00 8.39   ? 153 GLN B CA  1 
ATOM   2433 C C   . GLN B 2 153 ? 41.258  64.678 133.894 1.00 9.48   ? 153 GLN B C   1 
ATOM   2434 O O   . GLN B 2 153 ? 41.217  65.162 132.770 1.00 13.93  ? 153 GLN B O   1 
ATOM   2435 C CB  . GLN B 2 153 ? 43.342  63.532 134.579 1.00 2.91   ? 153 GLN B CB  1 
ATOM   2436 C CG  . GLN B 2 153 ? 44.080  64.621 133.871 1.00 3.47   ? 153 GLN B CG  1 
ATOM   2437 C CD  . GLN B 2 153 ? 45.517  64.717 134.310 1.00 14.79  ? 153 GLN B CD  1 
ATOM   2438 O OE1 . GLN B 2 153 ? 46.355  65.269 133.598 1.00 26.90  ? 153 GLN B OE1 1 
ATOM   2439 N NE2 . GLN B 2 153 ? 45.821  64.169 135.483 1.00 23.46  ? 153 GLN B NE2 1 
ATOM   2440 N N   . PRO B 2 154 ? 40.665  65.259 134.939 1.00 8.23   ? 154 PRO B N   1 
ATOM   2441 C CA  . PRO B 2 154 ? 40.030  66.561 134.793 1.00 13.69  ? 154 PRO B CA  1 
ATOM   2442 C C   . PRO B 2 154 ? 41.173  67.537 134.835 1.00 11.09  ? 154 PRO B C   1 
ATOM   2443 O O   . PRO B 2 154 ? 42.162  67.271 135.515 1.00 6.21   ? 154 PRO B O   1 
ATOM   2444 C CB  . PRO B 2 154 ? 39.191  66.652 136.063 1.00 11.52  ? 154 PRO B CB  1 
ATOM   2445 C CG  . PRO B 2 154 ? 40.057  65.995 137.059 1.00 4.49   ? 154 PRO B CG  1 
ATOM   2446 C CD  . PRO B 2 154 ? 40.557  64.782 136.328 1.00 2.00   ? 154 PRO B CD  1 
ATOM   2447 N N   . GLN B 2 155 ? 41.082  68.631 134.091 1.00 13.40  ? 155 GLN B N   1 
ATOM   2448 C CA  . GLN B 2 155 ? 42.152  69.616 134.117 1.00 14.49  ? 155 GLN B CA  1 
ATOM   2449 C C   . GLN B 2 155 ? 42.091  70.372 135.447 1.00 18.68  ? 155 GLN B C   1 
ATOM   2450 O O   . GLN B 2 155 ? 41.266  71.277 135.601 1.00 16.75  ? 155 GLN B O   1 
ATOM   2451 C CB  . GLN B 2 155 ? 42.012  70.596 132.962 1.00 15.21  ? 155 GLN B CB  1 
ATOM   2452 C CG  . GLN B 2 155 ? 42.380  70.031 131.622 1.00 28.08  ? 155 GLN B CG  1 
ATOM   2453 C CD  . GLN B 2 155 ? 42.654  71.117 130.615 1.00 44.22  ? 155 GLN B CD  1 
ATOM   2454 O OE1 . GLN B 2 155 ? 41.798  71.957 130.338 1.00 58.11  ? 155 GLN B OE1 1 
ATOM   2455 N NE2 . GLN B 2 155 ? 43.868  71.131 130.082 1.00 67.60  ? 155 GLN B NE2 1 
ATOM   2456 N N   . LEU B 2 156 ? 42.959  70.005 136.397 1.00 26.27  ? 156 LEU B N   1 
ATOM   2457 C CA  . LEU B 2 156 ? 42.981  70.645 137.720 1.00 35.51  ? 156 LEU B CA  1 
ATOM   2458 C C   . LEU B 2 156 ? 44.318  70.725 138.471 1.00 45.46  ? 156 LEU B C   1 
ATOM   2459 O O   . LEU B 2 156 ? 45.390  70.436 137.935 1.00 48.41  ? 156 LEU B O   1 
ATOM   2460 C CB  . LEU B 2 156 ? 41.982  69.965 138.656 1.00 25.92  ? 156 LEU B CB  1 
ATOM   2461 C CG  . LEU B 2 156 ? 40.496  69.952 138.343 1.00 20.84  ? 156 LEU B CG  1 
ATOM   2462 C CD1 . LEU B 2 156 ? 39.764  69.197 139.450 1.00 2.00   ? 156 LEU B CD1 1 
ATOM   2463 C CD2 . LEU B 2 156 ? 39.995  71.373 138.208 1.00 23.98  ? 156 LEU B CD2 1 
ATOM   2464 N N   . LYS B 2 157 ? 44.205  71.142 139.731 1.00 55.67  ? 157 LYS B N   1 
ATOM   2465 C CA  . LYS B 2 157 ? 45.314  71.282 140.657 1.00 68.92  ? 157 LYS B CA  1 
ATOM   2466 C C   . LYS B 2 157 ? 45.848  69.877 140.915 1.00 70.60  ? 157 LYS B C   1 
ATOM   2467 O O   . LYS B 2 157 ? 45.250  69.120 141.687 1.00 71.39  ? 157 LYS B O   1 
ATOM   2468 C CB  . LYS B 2 157 ? 44.790  71.882 141.972 1.00 78.15  ? 157 LYS B CB  1 
ATOM   2469 C CG  . LYS B 2 157 ? 45.839  72.122 143.054 1.00 86.20  ? 157 LYS B CG  1 
ATOM   2470 C CD  . LYS B 2 157 ? 45.238  72.119 144.468 1.00 96.36  ? 157 LYS B CD  1 
ATOM   2471 C CE  . LYS B 2 157 ? 44.207  73.223 144.693 1.00 101.34 ? 157 LYS B CE  1 
ATOM   2472 N NZ  . LYS B 2 157 ? 42.931  73.010 143.949 1.00 109.54 ? 157 LYS B NZ  1 
ATOM   2473 N N   . GLY B 2 158 ? 46.937  69.519 140.233 1.00 71.81  ? 158 GLY B N   1 
ATOM   2474 C CA  . GLY B 2 158 ? 47.532  68.199 140.405 1.00 66.72  ? 158 GLY B CA  1 
ATOM   2475 C C   . GLY B 2 158 ? 46.489  67.108 140.266 1.00 63.99  ? 158 GLY B C   1 
ATOM   2476 O O   . GLY B 2 158 ? 46.151  66.404 141.225 1.00 58.04  ? 158 GLY B O   1 
ATOM   2477 N N   . ALA B 2 159 ? 45.935  67.012 139.067 1.00 60.89  ? 159 ALA B N   1 
ATOM   2478 C CA  . ALA B 2 159 ? 44.909  66.031 138.792 1.00 56.21  ? 159 ALA B CA  1 
ATOM   2479 C C   . ALA B 2 159 ? 45.511  64.644 138.853 1.00 53.42  ? 159 ALA B C   1 
ATOM   2480 O O   . ALA B 2 159 ? 46.698  64.462 138.594 1.00 52.55  ? 159 ALA B O   1 
ATOM   2481 C CB  . ALA B 2 159 ? 44.304  66.288 137.434 1.00 63.89  ? 159 ALA B CB  1 
ATOM   2482 N N   . ASN B 2 160 ? 44.686  63.665 139.184 1.00 50.54  ? 160 ASN B N   1 
ATOM   2483 C CA  . ASN B 2 160 ? 45.146  62.295 139.271 1.00 50.07  ? 160 ASN B CA  1 
ATOM   2484 C C   . ASN B 2 160 ? 44.607  61.514 138.062 1.00 43.61  ? 160 ASN B C   1 
ATOM   2485 O O   . ASN B 2 160 ? 43.430  61.651 137.694 1.00 41.20  ? 160 ASN B O   1 
ATOM   2486 C CB  . ASN B 2 160 ? 44.640  61.686 140.581 1.00 75.70  ? 160 ASN B CB  1 
ATOM   2487 C CG  . ASN B 2 160 ? 45.516  60.558 141.079 1.00 94.77  ? 160 ASN B CG  1 
ATOM   2488 O OD1 . ASN B 2 160 ? 46.727  60.558 140.864 1.00 104.80 ? 160 ASN B OD1 1 
ATOM   2489 N ND2 . ASN B 2 160 ? 44.910  59.594 141.760 1.00 103.59 ? 160 ASN B ND2 1 
ATOM   2490 N N   . TRP B 2 161 ? 45.469  60.722 137.424 1.00 31.08  ? 161 TRP B N   1 
ATOM   2491 C CA  . TRP B 2 161 ? 45.057  59.919 136.266 1.00 13.47  ? 161 TRP B CA  1 
ATOM   2492 C C   . TRP B 2 161 ? 44.115  58.783 136.653 1.00 8.95   ? 161 TRP B C   1 
ATOM   2493 O O   . TRP B 2 161 ? 44.410  58.000 137.553 1.00 22.81  ? 161 TRP B O   1 
ATOM   2494 C CB  . TRP B 2 161 ? 46.266  59.278 135.572 1.00 2.00   ? 161 TRP B CB  1 
ATOM   2495 C CG  . TRP B 2 161 ? 46.999  60.141 134.628 1.00 2.00   ? 161 TRP B CG  1 
ATOM   2496 C CD1 . TRP B 2 161 ? 48.341  60.391 134.621 1.00 8.25   ? 161 TRP B CD1 1 
ATOM   2497 C CD2 . TRP B 2 161 ? 46.449  60.893 133.551 1.00 3.73   ? 161 TRP B CD2 1 
ATOM   2498 N NE1 . TRP B 2 161 ? 48.662  61.254 133.607 1.00 13.03  ? 161 TRP B NE1 1 
ATOM   2499 C CE2 . TRP B 2 161 ? 47.515  61.582 132.937 1.00 6.68   ? 161 TRP B CE2 1 
ATOM   2500 C CE3 . TRP B 2 161 ? 45.159  61.051 133.039 1.00 13.05  ? 161 TRP B CE3 1 
ATOM   2501 C CZ2 . TRP B 2 161 ? 47.329  62.411 131.850 1.00 2.00   ? 161 TRP B CZ2 1 
ATOM   2502 C CZ3 . TRP B 2 161 ? 44.980  61.874 131.953 1.00 2.00   ? 161 TRP B CZ3 1 
ATOM   2503 C CH2 . TRP B 2 161 ? 46.061  62.545 131.372 1.00 2.00   ? 161 TRP B CH2 1 
ATOM   2504 N N   . THR B 2 162 ? 43.015  58.664 135.932 1.00 2.07   ? 162 THR B N   1 
ATOM   2505 C CA  . THR B 2 162 ? 42.052  57.593 136.157 1.00 6.42   ? 162 THR B CA  1 
ATOM   2506 C C   . THR B 2 162 ? 42.219  56.646 134.968 1.00 16.67  ? 162 THR B C   1 
ATOM   2507 O O   . THR B 2 162 ? 42.226  57.092 133.817 1.00 13.79  ? 162 THR B O   1 
ATOM   2508 C CB  . THR B 2 162 ? 40.612  58.137 136.160 1.00 11.07  ? 162 THR B CB  1 
ATOM   2509 O OG1 . THR B 2 162 ? 40.421  59.013 137.286 1.00 37.13  ? 162 THR B OG1 1 
ATOM   2510 C CG2 . THR B 2 162 ? 39.604  56.997 136.187 1.00 4.95   ? 162 THR B CG2 1 
ATOM   2511 N N   . LEU B 2 163 ? 42.337  55.349 135.234 1.00 17.20  ? 163 LEU B N   1 
ATOM   2512 C CA  . LEU B 2 163 ? 42.521  54.391 134.155 1.00 6.32   ? 163 LEU B CA  1 
ATOM   2513 C C   . LEU B 2 163 ? 41.435  53.412 133.853 1.00 6.45   ? 163 LEU B C   1 
ATOM   2514 O O   . LEU B 2 163 ? 40.650  53.017 134.717 1.00 25.38  ? 163 LEU B O   1 
ATOM   2515 C CB  . LEU B 2 163 ? 43.794  53.601 134.340 1.00 2.40   ? 163 LEU B CB  1 
ATOM   2516 C CG  . LEU B 2 163 ? 45.012  54.405 133.948 1.00 9.76   ? 163 LEU B CG  1 
ATOM   2517 C CD1 . LEU B 2 163 ? 45.721  54.869 135.194 1.00 14.39  ? 163 LEU B CD1 1 
ATOM   2518 C CD2 . LEU B 2 163 ? 45.906  53.556 133.064 1.00 17.51  ? 163 LEU B CD2 1 
ATOM   2519 N N   . VAL B 2 164 ? 41.429  53.018 132.589 1.00 3.99   ? 164 VAL B N   1 
ATOM   2520 C CA  . VAL B 2 164 ? 40.506  52.039 132.055 1.00 5.95   ? 164 VAL B CA  1 
ATOM   2521 C C   . VAL B 2 164 ? 41.426  51.034 131.337 1.00 13.76  ? 164 VAL B C   1 
ATOM   2522 O O   . VAL B 2 164 ? 42.194  51.408 130.446 1.00 8.96   ? 164 VAL B O   1 
ATOM   2523 C CB  . VAL B 2 164 ? 39.543  52.686 131.082 1.00 6.35   ? 164 VAL B CB  1 
ATOM   2524 C CG1 . VAL B 2 164 ? 38.592  51.665 130.569 1.00 2.00   ? 164 VAL B CG1 1 
ATOM   2525 C CG2 . VAL B 2 164 ? 38.794  53.828 131.751 1.00 4.71   ? 164 VAL B CG2 1 
ATOM   2526 N N   . PHE B 2 165 ? 41.397  49.777 131.771 1.00 13.46  ? 165 PHE B N   1 
ATOM   2527 C CA  . PHE B 2 165 ? 42.260  48.752 131.206 1.00 2.00   ? 165 PHE B CA  1 
ATOM   2528 C C   . PHE B 2 165 ? 41.582  47.739 130.296 1.00 6.68   ? 165 PHE B C   1 
ATOM   2529 O O   . PHE B 2 165 ? 40.361  47.581 130.281 1.00 10.32  ? 165 PHE B O   1 
ATOM   2530 C CB  . PHE B 2 165 ? 42.915  47.959 132.320 1.00 5.54   ? 165 PHE B CB  1 
ATOM   2531 C CG  . PHE B 2 165 ? 43.680  48.783 133.297 1.00 5.51   ? 165 PHE B CG  1 
ATOM   2532 C CD1 . PHE B 2 165 ? 45.011  48.983 133.163 1.00 2.00   ? 165 PHE B CD1 1 
ATOM   2533 C CD2 . PHE B 2 165 ? 43.084  49.312 134.394 1.00 3.76   ? 165 PHE B CD2 1 
ATOM   2534 C CE1 . PHE B 2 165 ? 45.732  49.708 134.115 1.00 2.00   ? 165 PHE B CE1 1 
ATOM   2535 C CE2 . PHE B 2 165 ? 43.821  50.032 135.341 1.00 2.00   ? 165 PHE B CE2 1 
ATOM   2536 C CZ  . PHE B 2 165 ? 45.133  50.222 135.194 1.00 2.00   ? 165 PHE B CZ  1 
ATOM   2537 N N   . HIS B 2 166 ? 42.412  47.002 129.574 1.00 2.00   ? 166 HIS B N   1 
ATOM   2538 C CA  . HIS B 2 166 ? 41.943  45.948 128.702 1.00 5.82   ? 166 HIS B CA  1 
ATOM   2539 C C   . HIS B 2 166 ? 40.853  46.360 127.738 1.00 8.31   ? 166 HIS B C   1 
ATOM   2540 O O   . HIS B 2 166 ? 39.828  45.686 127.602 1.00 20.83  ? 166 HIS B O   1 
ATOM   2541 C CB  . HIS B 2 166 ? 41.520  44.751 129.550 1.00 10.22  ? 166 HIS B CB  1 
ATOM   2542 C CG  . HIS B 2 166 ? 42.559  44.350 130.547 1.00 8.77   ? 166 HIS B CG  1 
ATOM   2543 N ND1 . HIS B 2 166 ? 43.723  43.708 130.186 1.00 24.25  ? 166 HIS B ND1 1 
ATOM   2544 C CD2 . HIS B 2 166 ? 42.675  44.617 131.868 1.00 7.82   ? 166 HIS B CD2 1 
ATOM   2545 C CE1 . HIS B 2 166 ? 44.518  43.609 131.237 1.00 8.18   ? 166 HIS B CE1 1 
ATOM   2546 N NE2 . HIS B 2 166 ? 43.905  44.155 132.271 1.00 13.90  ? 166 HIS B NE2 1 
ATOM   2547 N N   . LEU B 2 167 ? 41.096  47.475 127.066 1.00 7.08   ? 167 LEU B N   1 
ATOM   2548 C CA  . LEU B 2 167 ? 40.179  48.000 126.083 1.00 7.11   ? 167 LEU B CA  1 
ATOM   2549 C C   . LEU B 2 167 ? 40.504  47.398 124.720 1.00 4.85   ? 167 LEU B C   1 
ATOM   2550 O O   . LEU B 2 167 ? 41.643  47.033 124.454 1.00 10.68  ? 167 LEU B O   1 
ATOM   2551 C CB  . LEU B 2 167 ? 40.343  49.510 126.014 1.00 2.00   ? 167 LEU B CB  1 
ATOM   2552 C CG  . LEU B 2 167 ? 39.645  50.281 127.106 1.00 2.00   ? 167 LEU B CG  1 
ATOM   2553 C CD1 . LEU B 2 167 ? 39.974  51.725 126.956 1.00 2.00   ? 167 LEU B CD1 1 
ATOM   2554 C CD2 . LEU B 2 167 ? 38.176  50.068 126.980 1.00 2.00   ? 167 LEU B CD2 1 
ATOM   2555 N N   . PRO B 2 168 ? 39.493  47.240 123.855 1.00 2.00   ? 168 PRO B N   1 
ATOM   2556 C CA  . PRO B 2 168 ? 39.681  46.692 122.523 1.00 2.00   ? 168 PRO B CA  1 
ATOM   2557 C C   . PRO B 2 168 ? 40.480  47.629 121.655 1.00 6.81   ? 168 PRO B C   1 
ATOM   2558 O O   . PRO B 2 168 ? 40.568  48.831 121.921 1.00 13.62  ? 168 PRO B O   1 
ATOM   2559 C CB  . PRO B 2 168 ? 38.253  46.549 122.020 1.00 2.63   ? 168 PRO B CB  1 
ATOM   2560 C CG  . PRO B 2 168 ? 37.502  47.544 122.789 1.00 2.00   ? 168 PRO B CG  1 
ATOM   2561 C CD  . PRO B 2 168 ? 38.057  47.366 124.142 1.00 8.27   ? 168 PRO B CD  1 
ATOM   2562 N N   . SER B 2 169 ? 41.008  47.071 120.574 1.00 14.98  ? 169 SER B N   1 
ATOM   2563 C CA  . SER B 2 169 ? 41.850  47.811 119.654 1.00 8.32   ? 169 SER B CA  1 
ATOM   2564 C C   . SER B 2 169 ? 41.127  48.933 118.924 1.00 9.70   ? 169 SER B C   1 
ATOM   2565 O O   . SER B 2 169 ? 41.766  49.898 118.497 1.00 14.22  ? 169 SER B O   1 
ATOM   2566 C CB  . SER B 2 169 ? 42.496  46.840 118.679 1.00 10.10  ? 169 SER B CB  1 
ATOM   2567 O OG  . SER B 2 169 ? 43.652  47.422 118.114 1.00 49.34  ? 169 SER B OG  1 
ATOM   2568 N N   . SER B 2 170 ? 39.809  48.788 118.757 1.00 2.00   ? 170 SER B N   1 
ATOM   2569 C CA  . SER B 2 170 ? 38.999  49.801 118.099 1.00 4.44   ? 170 SER B CA  1 
ATOM   2570 C C   . SER B 2 170 ? 37.589  49.812 118.678 1.00 5.45   ? 170 SER B C   1 
ATOM   2571 O O   . SER B 2 170 ? 37.096  48.787 119.149 1.00 13.72  ? 170 SER B O   1 
ATOM   2572 C CB  . SER B 2 170 ? 38.954  49.573 116.595 1.00 2.00   ? 170 SER B CB  1 
ATOM   2573 O OG  . SER B 2 170 ? 38.234  48.404 116.304 1.00 25.98  ? 170 SER B OG  1 
ATOM   2574 N N   . LYS B 2 171 ? 36.977  50.994 118.674 1.00 9.67   ? 171 LYS B N   1 
ATOM   2575 C CA  . LYS B 2 171 ? 35.631  51.227 119.191 1.00 9.01   ? 171 LYS B CA  1 
ATOM   2576 C C   . LYS B 2 171 ? 35.002  52.306 118.316 1.00 17.36  ? 171 LYS B C   1 
ATOM   2577 O O   . LYS B 2 171 ? 35.627  53.335 118.052 1.00 19.66  ? 171 LYS B O   1 
ATOM   2578 C CB  . LYS B 2 171 ? 35.690  51.728 120.644 1.00 12.55  ? 171 LYS B CB  1 
ATOM   2579 C CG  . LYS B 2 171 ? 35.338  50.700 121.685 1.00 13.53  ? 171 LYS B CG  1 
ATOM   2580 C CD  . LYS B 2 171 ? 33.869  50.350 121.619 1.00 20.58  ? 171 LYS B CD  1 
ATOM   2581 C CE  . LYS B 2 171 ? 33.583  49.022 122.312 1.00 45.32  ? 171 LYS B CE  1 
ATOM   2582 N NZ  . LYS B 2 171 ? 32.242  48.477 121.937 1.00 60.68  ? 171 LYS B NZ  1 
ATOM   2583 N N   . ASP B 2 172 ? 33.794  52.050 117.827 1.00 29.11  ? 172 ASP B N   1 
ATOM   2584 C CA  . ASP B 2 172 ? 33.106  53.016 116.986 1.00 31.34  ? 172 ASP B CA  1 
ATOM   2585 C C   . ASP B 2 172 ? 32.631  54.179 117.845 1.00 27.78  ? 172 ASP B C   1 
ATOM   2586 O O   . ASP B 2 172 ? 32.820  55.329 117.483 1.00 36.04  ? 172 ASP B O   1 
ATOM   2587 C CB  . ASP B 2 172 ? 31.954  52.350 116.244 1.00 48.96  ? 172 ASP B CB  1 
ATOM   2588 C CG  . ASP B 2 172 ? 32.434  51.323 115.227 1.00 67.00  ? 172 ASP B CG  1 
ATOM   2589 O OD1 . ASP B 2 172 ? 33.450  51.589 114.541 1.00 69.29  ? 172 ASP B OD1 1 
ATOM   2590 O OD2 . ASP B 2 172 ? 31.795  50.250 115.117 1.00 83.81  ? 172 ASP B OD2 1 
ATOM   2591 N N   . GLN B 2 173 ? 32.014  53.873 118.980 1.00 21.00  ? 173 GLN B N   1 
ATOM   2592 C CA  . GLN B 2 173 ? 31.557  54.888 119.922 1.00 11.45  ? 173 GLN B CA  1 
ATOM   2593 C C   . GLN B 2 173 ? 31.650  54.259 121.289 1.00 9.28   ? 173 GLN B C   1 
ATOM   2594 O O   . GLN B 2 173 ? 31.167  53.160 121.504 1.00 31.16  ? 173 GLN B O   1 
ATOM   2595 C CB  . GLN B 2 173 ? 30.126  55.354 119.663 1.00 11.39  ? 173 GLN B CB  1 
ATOM   2596 C CG  . GLN B 2 173 ? 29.092  54.276 119.771 1.00 48.22  ? 173 GLN B CG  1 
ATOM   2597 C CD  . GLN B 2 173 ? 27.863  54.732 120.514 1.00 60.72  ? 173 GLN B CD  1 
ATOM   2598 O OE1 . GLN B 2 173 ? 26.835  55.015 119.908 1.00 73.75  ? 173 GLN B OE1 1 
ATOM   2599 N NE2 . GLN B 2 173 ? 27.959  54.797 121.836 1.00 64.53  ? 173 GLN B NE2 1 
ATOM   2600 N N   . PHE B 2 174 ? 32.315  54.953 122.198 1.00 11.52  ? 174 PHE B N   1 
ATOM   2601 C CA  . PHE B 2 174 ? 32.535  54.492 123.562 1.00 5.52   ? 174 PHE B CA  1 
ATOM   2602 C C   . PHE B 2 174 ? 32.140  55.639 124.452 1.00 9.57   ? 174 PHE B C   1 
ATOM   2603 O O   . PHE B 2 174 ? 32.731  56.710 124.383 1.00 10.40  ? 174 PHE B O   1 
ATOM   2604 C CB  . PHE B 2 174 ? 34.014  54.182 123.735 1.00 9.95   ? 174 PHE B CB  1 
ATOM   2605 C CG  . PHE B 2 174 ? 34.430  53.934 125.137 1.00 2.00   ? 174 PHE B CG  1 
ATOM   2606 C CD1 . PHE B 2 174 ? 34.269  52.690 125.713 1.00 16.77  ? 174 PHE B CD1 1 
ATOM   2607 C CD2 . PHE B 2 174 ? 35.061  54.912 125.859 1.00 7.89   ? 174 PHE B CD2 1 
ATOM   2608 C CE1 . PHE B 2 174 ? 34.745  52.427 126.995 1.00 2.00   ? 174 PHE B CE1 1 
ATOM   2609 C CE2 . PHE B 2 174 ? 35.541  54.662 127.147 1.00 8.43   ? 174 PHE B CE2 1 
ATOM   2610 C CZ  . PHE B 2 174 ? 35.380  53.417 127.706 1.00 2.00   ? 174 PHE B CZ  1 
ATOM   2611 N N   . GLU B 2 175 ? 31.097  55.428 125.244 1.00 17.83  ? 175 GLU B N   1 
ATOM   2612 C CA  . GLU B 2 175 ? 30.579  56.456 126.141 1.00 12.44  ? 175 GLU B CA  1 
ATOM   2613 C C   . GLU B 2 175 ? 31.255  56.420 127.502 1.00 9.49   ? 175 GLU B C   1 
ATOM   2614 O O   . GLU B 2 175 ? 31.312  55.376 128.153 1.00 27.43  ? 175 GLU B O   1 
ATOM   2615 C CB  . GLU B 2 175 ? 29.090  56.252 126.282 1.00 20.18  ? 175 GLU B CB  1 
ATOM   2616 C CG  . GLU B 2 175 ? 28.367  57.292 127.075 1.00 34.30  ? 175 GLU B CG  1 
ATOM   2617 C CD  . GLU B 2 175 ? 26.885  56.941 127.259 1.00 44.98  ? 175 GLU B CD  1 
ATOM   2618 O OE1 . GLU B 2 175 ? 26.135  56.901 126.244 1.00 26.62  ? 175 GLU B OE1 1 
ATOM   2619 O OE2 . GLU B 2 175 ? 26.483  56.692 128.423 1.00 48.08  ? 175 GLU B OE2 1 
ATOM   2620 N N   . LEU B 2 176 ? 31.824  57.543 127.898 1.00 2.00   ? 176 LEU B N   1 
ATOM   2621 C CA  . LEU B 2 176 ? 32.504  57.645 129.172 1.00 6.37   ? 176 LEU B CA  1 
ATOM   2622 C C   . LEU B 2 176 ? 31.739  58.734 129.921 1.00 9.92   ? 176 LEU B C   1 
ATOM   2623 O O   . LEU B 2 176 ? 31.621  59.815 129.407 1.00 13.63  ? 176 LEU B O   1 
ATOM   2624 C CB  . LEU B 2 176 ? 33.954  58.055 128.934 1.00 2.00   ? 176 LEU B CB  1 
ATOM   2625 C CG  . LEU B 2 176 ? 34.775  58.321 130.184 1.00 13.41  ? 176 LEU B CG  1 
ATOM   2626 C CD1 . LEU B 2 176 ? 35.012  57.035 130.983 1.00 12.42  ? 176 LEU B CD1 1 
ATOM   2627 C CD2 . LEU B 2 176 ? 36.082  58.931 129.758 1.00 17.97  ? 176 LEU B CD2 1 
ATOM   2628 N N   . CYS B 2 177 ? 31.141  58.451 131.080 1.00 18.37  ? 177 CYS B N   1 
ATOM   2629 C CA  . CYS B 2 177 ? 30.359  59.478 131.796 1.00 12.04  ? 177 CYS B CA  1 
ATOM   2630 C C   . CYS B 2 177 ? 30.698  59.632 133.282 1.00 21.88  ? 177 CYS B C   1 
ATOM   2631 O O   . CYS B 2 177 ? 31.560  58.913 133.815 1.00 25.38  ? 177 CYS B O   1 
ATOM   2632 C CB  . CYS B 2 177 ? 28.835  59.213 131.688 1.00 16.23  ? 177 CYS B CB  1 
ATOM   2633 S SG  . CYS B 2 177 ? 27.970  59.310 130.072 1.00 44.29  ? 177 CYS B SG  1 
ATOM   2634 N N   . GLY B 2 178 ? 29.952  60.522 133.951 1.00 18.10  ? 178 GLY B N   1 
ATOM   2635 C CA  . GLY B 2 178 ? 30.167  60.784 135.369 1.00 28.30  ? 178 GLY B CA  1 
ATOM   2636 C C   . GLY B 2 178 ? 31.349  61.721 135.611 1.00 33.59  ? 178 GLY B C   1 
ATOM   2637 O O   . GLY B 2 178 ? 31.865  61.848 136.738 1.00 44.90  ? 178 GLY B O   1 
ATOM   2638 N N   . LEU B 2 179 ? 31.696  62.464 134.563 1.00 27.86  ? 179 LEU B N   1 
ATOM   2639 C CA  . LEU B 2 179 ? 32.812  63.398 134.577 1.00 20.54  ? 179 LEU B CA  1 
ATOM   2640 C C   . LEU B 2 179 ? 32.375  64.785 135.033 1.00 17.35  ? 179 LEU B C   1 
ATOM   2641 O O   . LEU B 2 179 ? 32.138  65.661 134.208 1.00 10.03  ? 179 LEU B O   1 
ATOM   2642 C CB  . LEU B 2 179 ? 33.430  63.433 133.176 1.00 14.04  ? 179 LEU B CB  1 
ATOM   2643 C CG  . LEU B 2 179 ? 33.791  62.036 132.633 1.00 3.10   ? 179 LEU B CG  1 
ATOM   2644 C CD1 . LEU B 2 179 ? 34.328  62.121 131.247 1.00 2.00   ? 179 LEU B CD1 1 
ATOM   2645 C CD2 . LEU B 2 179 ? 34.802  61.343 133.495 1.00 17.59  ? 179 LEU B CD2 1 
ATOM   2646 N N   . HIS B 2 180 ? 32.321  64.975 136.357 1.00 20.68  ? 180 HIS B N   1 
ATOM   2647 C CA  . HIS B 2 180 ? 31.863  66.228 136.960 1.00 15.95  ? 180 HIS B CA  1 
ATOM   2648 C C   . HIS B 2 180 ? 32.879  67.114 137.651 1.00 21.11  ? 180 HIS B C   1 
ATOM   2649 O O   . HIS B 2 180 ? 32.505  68.145 138.196 1.00 43.58  ? 180 HIS B O   1 
ATOM   2650 C CB  . HIS B 2 180 ? 30.773  65.939 137.979 1.00 12.05  ? 180 HIS B CB  1 
ATOM   2651 C CG  . HIS B 2 180 ? 29.667  65.095 137.450 1.00 17.57  ? 180 HIS B CG  1 
ATOM   2652 N ND1 . HIS B 2 180 ? 29.498  63.775 137.816 1.00 25.99  ? 180 HIS B ND1 1 
ATOM   2653 C CD2 . HIS B 2 180 ? 28.673  65.377 136.576 1.00 19.72  ? 180 HIS B CD2 1 
ATOM   2654 C CE1 . HIS B 2 180 ? 28.445  63.279 137.190 1.00 25.66  ? 180 HIS B CE1 1 
ATOM   2655 N NE2 . HIS B 2 180 ? 27.928  64.229 136.431 1.00 33.29  ? 180 HIS B NE2 1 
ATOM   2656 N N   . GLN B 2 181 ? 34.145  66.728 137.663 1.00 9.52   ? 181 GLN B N   1 
ATOM   2657 C CA  . GLN B 2 181 ? 35.147  67.521 138.355 1.00 3.53   ? 181 GLN B CA  1 
ATOM   2658 C C   . GLN B 2 181 ? 35.657  68.775 137.652 1.00 12.98  ? 181 GLN B C   1 
ATOM   2659 O O   . GLN B 2 181 ? 36.336  69.589 138.274 1.00 24.60  ? 181 GLN B O   1 
ATOM   2660 C CB  . GLN B 2 181 ? 36.339  66.651 138.767 1.00 15.29  ? 181 GLN B CB  1 
ATOM   2661 C CG  . GLN B 2 181 ? 36.100  65.740 139.959 1.00 10.54  ? 181 GLN B CG  1 
ATOM   2662 C CD  . GLN B 2 181 ? 37.343  64.951 140.374 1.00 33.72  ? 181 GLN B CD  1 
ATOM   2663 O OE1 . GLN B 2 181 ? 38.057  65.343 141.299 1.00 38.11  ? 181 GLN B OE1 1 
ATOM   2664 N NE2 . GLN B 2 181 ? 37.583  63.817 139.711 1.00 34.51  ? 181 GLN B NE2 1 
ATOM   2665 N N   . ALA B 2 182 ? 35.372  68.945 136.367 1.00 12.48  ? 182 ALA B N   1 
ATOM   2666 C CA  . ALA B 2 182 ? 35.858  70.131 135.670 1.00 5.60   ? 182 ALA B CA  1 
ATOM   2667 C C   . ALA B 2 182 ? 35.242  70.280 134.303 1.00 10.20  ? 182 ALA B C   1 
ATOM   2668 O O   . ALA B 2 182 ? 34.617  69.358 133.797 1.00 19.58  ? 182 ALA B O   1 
ATOM   2669 C CB  . ALA B 2 182 ? 37.366  70.090 135.559 1.00 2.00   ? 182 ALA B CB  1 
ATOM   2670 N N   . PRO B 2 183 ? 35.389  71.463 133.694 1.00 12.91  ? 183 PRO B N   1 
ATOM   2671 C CA  . PRO B 2 183 ? 34.842  71.731 132.369 1.00 12.07  ? 183 PRO B CA  1 
ATOM   2672 C C   . PRO B 2 183 ? 35.657  71.097 131.251 1.00 7.41   ? 183 PRO B C   1 
ATOM   2673 O O   . PRO B 2 183 ? 35.193  71.016 130.117 1.00 25.73  ? 183 PRO B O   1 
ATOM   2674 C CB  . PRO B 2 183 ? 34.898  73.257 132.288 1.00 4.40   ? 183 PRO B CB  1 
ATOM   2675 C CG  . PRO B 2 183 ? 36.112  73.576 133.040 1.00 14.37  ? 183 PRO B CG  1 
ATOM   2676 C CD  . PRO B 2 183 ? 35.941  72.700 134.262 1.00 7.74   ? 183 PRO B CD  1 
ATOM   2677 N N   . VAL B 2 184 ? 36.885  70.687 131.556 1.00 3.34   ? 184 VAL B N   1 
ATOM   2678 C CA  . VAL B 2 184 ? 37.745  70.082 130.545 1.00 2.00   ? 184 VAL B CA  1 
ATOM   2679 C C   . VAL B 2 184 ? 38.528  68.918 131.123 1.00 5.16   ? 184 VAL B C   1 
ATOM   2680 O O   . VAL B 2 184 ? 39.031  68.984 132.253 1.00 8.76   ? 184 VAL B O   1 
ATOM   2681 C CB  . VAL B 2 184 ? 38.742  71.111 129.919 1.00 2.00   ? 184 VAL B CB  1 
ATOM   2682 C CG1 . VAL B 2 184 ? 39.566  70.472 128.872 1.00 7.96   ? 184 VAL B CG1 1 
ATOM   2683 C CG2 . VAL B 2 184 ? 38.015  72.224 129.255 1.00 8.78   ? 184 VAL B CG2 1 
ATOM   2684 N N   . TYR B 2 185 ? 38.587  67.840 130.347 1.00 4.29   ? 185 TYR B N   1 
ATOM   2685 C CA  . TYR B 2 185 ? 39.319  66.646 130.694 1.00 2.67   ? 185 TYR B CA  1 
ATOM   2686 C C   . TYR B 2 185 ? 40.350  66.356 129.596 1.00 6.37   ? 185 TYR B C   1 
ATOM   2687 O O   . TYR B 2 185 ? 40.163  66.743 128.446 1.00 14.36  ? 185 TYR B O   1 
ATOM   2688 C CB  . TYR B 2 185 ? 38.348  65.477 130.809 1.00 5.86   ? 185 TYR B CB  1 
ATOM   2689 C CG  . TYR B 2 185 ? 37.642  65.377 132.144 1.00 15.11  ? 185 TYR B CG  1 
ATOM   2690 C CD1 . TYR B 2 185 ? 36.568  66.227 132.470 1.00 13.02  ? 185 TYR B CD1 1 
ATOM   2691 C CD2 . TYR B 2 185 ? 38.014  64.403 133.074 1.00 18.79  ? 185 TYR B CD2 1 
ATOM   2692 C CE1 . TYR B 2 185 ? 35.879  66.092 133.695 1.00 11.83  ? 185 TYR B CE1 1 
ATOM   2693 C CE2 . TYR B 2 185 ? 37.338  64.266 134.296 1.00 27.83  ? 185 TYR B CE2 1 
ATOM   2694 C CZ  . TYR B 2 185 ? 36.276  65.107 134.595 1.00 22.91  ? 185 TYR B CZ  1 
ATOM   2695 O OH  . TYR B 2 185 ? 35.612  64.937 135.784 1.00 30.75  ? 185 TYR B OH  1 
ATOM   2696 N N   . THR B 2 186 ? 41.457  65.722 129.960 1.00 6.00   ? 186 THR B N   1 
ATOM   2697 C CA  . THR B 2 186 ? 42.475  65.338 128.994 1.00 5.13   ? 186 THR B CA  1 
ATOM   2698 C C   . THR B 2 186 ? 42.422  63.822 128.868 1.00 4.49   ? 186 THR B C   1 
ATOM   2699 O O   . THR B 2 186 ? 42.304  63.135 129.871 1.00 10.53  ? 186 THR B O   1 
ATOM   2700 C CB  . THR B 2 186 ? 43.843  65.698 129.473 1.00 2.10   ? 186 THR B CB  1 
ATOM   2701 O OG1 . THR B 2 186 ? 43.917  67.119 129.672 1.00 18.74  ? 186 THR B OG1 1 
ATOM   2702 C CG2 . THR B 2 186 ? 44.866  65.249 128.460 1.00 2.00   ? 186 THR B CG2 1 
ATOM   2703 N N   . LEU B 2 187 ? 42.479  63.296 127.655 1.00 2.00   ? 187 LEU B N   1 
ATOM   2704 C CA  . LEU B 2 187 ? 42.437  61.858 127.480 1.00 2.00   ? 187 LEU B CA  1 
ATOM   2705 C C   . LEU B 2 187 ? 43.545  61.433 126.554 1.00 2.00   ? 187 LEU B C   1 
ATOM   2706 O O   . LEU B 2 187 ? 43.945  62.183 125.678 1.00 13.31  ? 187 LEU B O   1 
ATOM   2707 C CB  . LEU B 2 187 ? 41.112  61.407 126.892 1.00 2.54   ? 187 LEU B CB  1 
ATOM   2708 C CG  . LEU B 2 187 ? 39.823  61.733 127.632 1.00 2.26   ? 187 LEU B CG  1 
ATOM   2709 C CD1 . LEU B 2 187 ? 39.472  63.156 127.442 1.00 2.00   ? 187 LEU B CD1 1 
ATOM   2710 C CD2 . LEU B 2 187 ? 38.728  60.913 127.080 1.00 2.45   ? 187 LEU B CD2 1 
ATOM   2711 N N   . GLN B 2 188 ? 44.069  60.243 126.785 1.00 5.96   ? 188 GLN B N   1 
ATOM   2712 C CA  . GLN B 2 188 ? 45.147  59.675 125.981 1.00 5.38   ? 188 GLN B CA  1 
ATOM   2713 C C   . GLN B 2 188 ? 44.933  58.181 125.979 1.00 8.87   ? 188 GLN B C   1 
ATOM   2714 O O   . GLN B 2 188 ? 44.242  57.650 126.845 1.00 17.32  ? 188 GLN B O   1 
ATOM   2715 C CB  . GLN B 2 188 ? 46.510  59.970 126.585 1.00 7.58   ? 188 GLN B CB  1 
ATOM   2716 C CG  . GLN B 2 188 ? 46.936  61.422 126.561 1.00 2.00   ? 188 GLN B CG  1 
ATOM   2717 C CD  . GLN B 2 188 ? 48.284  61.599 127.186 1.00 2.00   ? 188 GLN B CD  1 
ATOM   2718 O OE1 . GLN B 2 188 ? 48.415  61.577 128.392 1.00 5.06   ? 188 GLN B OE1 1 
ATOM   2719 N NE2 . GLN B 2 188 ? 49.300  61.703 126.373 1.00 2.00   ? 188 GLN B NE2 1 
ATOM   2720 N N   . MET B 2 189 ? 45.521  57.507 125.008 1.00 2.42   ? 189 MET B N   1 
ATOM   2721 C CA  . MET B 2 189 ? 45.369  56.086 124.879 1.00 2.00   ? 189 MET B CA  1 
ATOM   2722 C C   . MET B 2 189 ? 46.646  55.528 124.281 1.00 2.00   ? 189 MET B C   1 
ATOM   2723 O O   . MET B 2 189 ? 47.325  56.217 123.532 1.00 11.90  ? 189 MET B O   1 
ATOM   2724 C CB  . MET B 2 189 ? 44.175  55.817 123.977 1.00 2.00   ? 189 MET B CB  1 
ATOM   2725 C CG  . MET B 2 189 ? 43.801  54.370 123.846 1.00 14.17  ? 189 MET B CG  1 
ATOM   2726 S SD  . MET B 2 189 ? 42.275  54.142 122.996 1.00 21.80  ? 189 MET B SD  1 
ATOM   2727 C CE  . MET B 2 189 ? 41.285  55.079 123.989 1.00 7.15   ? 189 MET B CE  1 
ATOM   2728 N N   . ARG B 2 190 ? 47.021  54.315 124.689 1.00 6.29   ? 190 ARG B N   1 
ATOM   2729 C CA  . ARG B 2 190 ? 48.225  53.620 124.195 1.00 2.00   ? 190 ARG B CA  1 
ATOM   2730 C C   . ARG B 2 190 ? 47.830  52.172 123.986 1.00 2.00   ? 190 ARG B C   1 
ATOM   2731 O O   . ARG B 2 190 ? 46.907  51.698 124.620 1.00 3.11   ? 190 ARG B O   1 
ATOM   2732 C CB  . ARG B 2 190 ? 49.359  53.698 125.219 1.00 2.00   ? 190 ARG B CB  1 
ATOM   2733 C CG  . ARG B 2 190 ? 49.371  52.576 126.211 1.00 2.00   ? 190 ARG B CG  1 
ATOM   2734 C CD  . ARG B 2 190 ? 49.779  52.946 127.611 1.00 2.00   ? 190 ARG B CD  1 
ATOM   2735 N NE  . ARG B 2 190 ? 51.183  52.747 127.934 1.00 7.73   ? 190 ARG B NE  1 
ATOM   2736 C CZ  . ARG B 2 190 ? 51.611  52.178 129.056 1.00 7.46   ? 190 ARG B CZ  1 
ATOM   2737 N NH1 . ARG B 2 190 ? 50.744  51.736 129.936 1.00 2.00   ? 190 ARG B NH1 1 
ATOM   2738 N NH2 . ARG B 2 190 ? 52.902  52.140 129.343 1.00 12.30  ? 190 ARG B NH2 1 
ATOM   2739 N N   . CYS B 2 191 ? 48.533  51.455 123.128 1.00 2.18   ? 191 CYS B N   1 
ATOM   2740 C CA  . CYS B 2 191 ? 48.182  50.073 122.877 1.00 2.00   ? 191 CYS B CA  1 
ATOM   2741 C C   . CYS B 2 191 ? 49.384  49.176 122.885 1.00 2.00   ? 191 CYS B C   1 
ATOM   2742 O O   . CYS B 2 191 ? 50.530  49.641 122.911 1.00 4.30   ? 191 CYS B O   1 
ATOM   2743 C CB  . CYS B 2 191 ? 47.415  49.960 121.560 1.00 2.00   ? 191 CYS B CB  1 
ATOM   2744 S SG  . CYS B 2 191 ? 45.876  50.972 121.547 1.00 49.26  ? 191 CYS B SG  1 
ATOM   2745 N N   . ILE B 2 192 ? 49.115  47.884 122.983 1.00 2.00   ? 192 ILE B N   1 
ATOM   2746 C CA  . ILE B 2 192 ? 50.161  46.873 122.985 1.00 2.09   ? 192 ILE B CA  1 
ATOM   2747 C C   . ILE B 2 192 ? 49.649  45.604 122.299 1.00 9.04   ? 192 ILE B C   1 
ATOM   2748 O O   . ILE B 2 192 ? 48.436  45.376 122.209 1.00 13.56  ? 192 ILE B O   1 
ATOM   2749 C CB  . ILE B 2 192 ? 50.637  46.548 124.429 1.00 2.46   ? 192 ILE B CB  1 
ATOM   2750 C CG1 . ILE B 2 192 ? 51.998  45.852 124.399 1.00 9.27   ? 192 ILE B CG1 1 
ATOM   2751 C CG2 . ILE B 2 192 ? 49.621  45.708 125.164 1.00 2.00   ? 192 ILE B CG2 1 
ATOM   2752 C CD1 . ILE B 2 192 ? 52.539  45.542 125.746 1.00 3.78   ? 192 ILE B CD1 1 
ATOM   2753 N N   . ARG B 2 193 ? 50.575  44.786 121.814 1.00 4.67   ? 193 ARG B N   1 
ATOM   2754 C CA  . ARG B 2 193 ? 50.236  43.543 121.139 1.00 6.14   ? 193 ARG B CA  1 
ATOM   2755 C C   . ARG B 2 193 ? 49.589  42.627 122.134 1.00 5.72   ? 193 ARG B C   1 
ATOM   2756 O O   . ARG B 2 193 ? 50.109  42.429 123.219 1.00 6.30   ? 193 ARG B O   1 
ATOM   2757 C CB  . ARG B 2 193 ? 51.487  42.889 120.587 1.00 2.00   ? 193 ARG B CB  1 
ATOM   2758 C CG  . ARG B 2 193 ? 51.224  41.815 119.578 1.00 2.00   ? 193 ARG B CG  1 
ATOM   2759 C CD  . ARG B 2 193 ? 52.538  41.242 119.201 1.00 2.00   ? 193 ARG B CD  1 
ATOM   2760 N NE  . ARG B 2 193 ? 52.489  40.258 118.131 1.00 13.50  ? 193 ARG B NE  1 
ATOM   2761 C CZ  . ARG B 2 193 ? 53.473  39.400 117.879 1.00 13.73  ? 193 ARG B CZ  1 
ATOM   2762 N NH1 . ARG B 2 193 ? 54.564  39.393 118.634 1.00 15.41  ? 193 ARG B NH1 1 
ATOM   2763 N NH2 . ARG B 2 193 ? 53.404  38.605 116.822 1.00 16.03  ? 193 ARG B NH2 1 
ATOM   2764 N N   . SER B 2 194 ? 48.491  42.016 121.735 1.00 3.34   ? 194 SER B N   1 
ATOM   2765 C CA  . SER B 2 194 ? 47.745  41.163 122.628 1.00 7.33   ? 194 SER B CA  1 
ATOM   2766 C C   . SER B 2 194 ? 48.245  39.737 122.642 1.00 13.88  ? 194 SER B C   1 
ATOM   2767 O O   . SER B 2 194 ? 48.429  39.133 121.589 1.00 23.98  ? 194 SER B O   1 
ATOM   2768 C CB  . SER B 2 194 ? 46.255  41.214 122.246 1.00 4.97   ? 194 SER B CB  1 
ATOM   2769 O OG  . SER B 2 194 ? 45.409  40.832 123.311 1.00 33.74  ? 194 SER B OG  1 
ATOM   2770 N N   . SER B 2 195 ? 48.508  39.231 123.847 1.00 18.44  ? 195 SER B N   1 
ATOM   2771 C CA  . SER B 2 195 ? 48.941  37.847 124.085 1.00 10.99  ? 195 SER B CA  1 
ATOM   2772 C C   . SER B 2 195 ? 50.301  37.395 123.569 1.00 14.50  ? 195 SER B C   1 
ATOM   2773 O O   . SER B 2 195 ? 50.670  36.221 123.704 1.00 24.77  ? 195 SER B O   1 
ATOM   2774 C CB  . SER B 2 195 ? 47.879  36.881 123.565 1.00 9.88   ? 195 SER B CB  1 
ATOM   2775 O OG  . SER B 2 195 ? 46.577  37.289 123.962 1.00 35.16  ? 195 SER B OG  1 
ATOM   2776 N N   . LEU B 2 196 ? 51.035  38.294 122.940 1.00 6.46   ? 196 LEU B N   1 
ATOM   2777 C CA  . LEU B 2 196 ? 52.331  37.934 122.433 1.00 2.79   ? 196 LEU B CA  1 
ATOM   2778 C C   . LEU B 2 196 ? 53.303  39.022 122.827 1.00 6.51   ? 196 LEU B C   1 
ATOM   2779 O O   . LEU B 2 196 ? 52.932  40.047 123.371 1.00 21.37  ? 196 LEU B O   1 
ATOM   2780 C CB  . LEU B 2 196 ? 52.275  37.773 120.918 1.00 3.71   ? 196 LEU B CB  1 
ATOM   2781 C CG  . LEU B 2 196 ? 51.584  36.563 120.300 1.00 2.00   ? 196 LEU B CG  1 
ATOM   2782 C CD1 . LEU B 2 196 ? 51.300  36.811 118.848 1.00 2.00   ? 196 LEU B CD1 1 
ATOM   2783 C CD2 . LEU B 2 196 ? 52.459  35.365 120.450 1.00 2.00   ? 196 LEU B CD2 1 
ATOM   2784 N N   . PRO B 2 197 ? 54.580  38.782 122.605 1.00 7.13   ? 197 PRO B N   1 
ATOM   2785 C CA  . PRO B 2 197 ? 55.605  39.761 122.947 1.00 2.00   ? 197 PRO B CA  1 
ATOM   2786 C C   . PRO B 2 197 ? 55.540  41.091 122.193 1.00 6.20   ? 197 PRO B C   1 
ATOM   2787 O O   . PRO B 2 197 ? 55.455  41.120 120.968 1.00 13.60  ? 197 PRO B O   1 
ATOM   2788 C CB  . PRO B 2 197 ? 56.891  39.002 122.636 1.00 2.00   ? 197 PRO B CB  1 
ATOM   2789 C CG  . PRO B 2 197 ? 56.530  37.605 122.962 1.00 2.00   ? 197 PRO B CG  1 
ATOM   2790 C CD  . PRO B 2 197 ? 55.186  37.476 122.307 1.00 7.79   ? 197 PRO B CD  1 
ATOM   2791 N N   . GLY B 2 198 ? 55.641  42.187 122.937 1.00 3.15   ? 198 GLY B N   1 
ATOM   2792 C CA  . GLY B 2 198 ? 55.616  43.499 122.332 1.00 2.00   ? 198 GLY B CA  1 
ATOM   2793 C C   . GLY B 2 198 ? 55.732  44.576 123.375 1.00 7.95   ? 198 GLY B C   1 
ATOM   2794 O O   . GLY B 2 198 ? 55.448  44.331 124.539 1.00 22.48  ? 198 GLY B O   1 
ATOM   2795 N N   . PHE B 2 199 ? 56.197  45.750 122.977 1.00 11.03  ? 199 PHE B N   1 
ATOM   2796 C CA  . PHE B 2 199 ? 56.339  46.859 123.907 1.00 13.76  ? 199 PHE B CA  1 
ATOM   2797 C C   . PHE B 2 199 ? 55.078  47.715 123.805 1.00 12.80  ? 199 PHE B C   1 
ATOM   2798 O O   . PHE B 2 199 ? 54.344  47.612 122.836 1.00 10.06  ? 199 PHE B O   1 
ATOM   2799 C CB  . PHE B 2 199 ? 57.545  47.712 123.524 1.00 15.46  ? 199 PHE B CB  1 
ATOM   2800 C CG  . PHE B 2 199 ? 58.799  46.938 123.363 1.00 35.50  ? 199 PHE B CG  1 
ATOM   2801 C CD1 . PHE B 2 199 ? 59.521  46.525 124.484 1.00 33.77  ? 199 PHE B CD1 1 
ATOM   2802 C CD2 . PHE B 2 199 ? 59.267  46.617 122.084 1.00 37.75  ? 199 PHE B CD2 1 
ATOM   2803 C CE1 . PHE B 2 199 ? 60.694  45.803 124.338 1.00 40.01  ? 199 PHE B CE1 1 
ATOM   2804 C CE2 . PHE B 2 199 ? 60.446  45.893 121.919 1.00 41.48  ? 199 PHE B CE2 1 
ATOM   2805 C CZ  . PHE B 2 199 ? 61.164  45.482 123.050 1.00 52.50  ? 199 PHE B CZ  1 
ATOM   2806 N N   . TRP B 2 200 ? 54.810  48.541 124.809 1.00 10.18  ? 200 TRP B N   1 
ATOM   2807 C CA  . TRP B 2 200 ? 53.647  49.412 124.744 1.00 2.00   ? 200 TRP B CA  1 
ATOM   2808 C C   . TRP B 2 200 ? 53.973  50.500 123.762 1.00 2.58   ? 200 TRP B C   1 
ATOM   2809 O O   . TRP B 2 200 ? 55.148  50.810 123.533 1.00 14.20  ? 200 TRP B O   1 
ATOM   2810 C CB  . TRP B 2 200 ? 53.406  50.103 126.072 1.00 3.79   ? 200 TRP B CB  1 
ATOM   2811 C CG  . TRP B 2 200 ? 52.626  49.341 127.060 1.00 3.20   ? 200 TRP B CG  1 
ATOM   2812 C CD1 . TRP B 2 200 ? 53.099  48.736 128.182 1.00 2.00   ? 200 TRP B CD1 1 
ATOM   2813 C CD2 . TRP B 2 200 ? 51.209  49.140 127.058 1.00 2.00   ? 200 TRP B CD2 1 
ATOM   2814 N NE1 . TRP B 2 200 ? 52.057  48.175 128.884 1.00 8.62   ? 200 TRP B NE1 1 
ATOM   2815 C CE2 . TRP B 2 200 ? 50.890  48.410 128.213 1.00 2.00   ? 200 TRP B CE2 1 
ATOM   2816 C CE3 . TRP B 2 200 ? 50.179  49.506 126.190 1.00 13.27  ? 200 TRP B CE3 1 
ATOM   2817 C CZ2 . TRP B 2 200 ? 49.589  48.042 128.518 1.00 2.22   ? 200 TRP B CZ2 1 
ATOM   2818 C CZ3 . TRP B 2 200 ? 48.880  49.139 126.503 1.00 2.00   ? 200 TRP B CZ3 1 
ATOM   2819 C CH2 . TRP B 2 200 ? 48.601  48.418 127.651 1.00 2.00   ? 200 TRP B CH2 1 
ATOM   2820 N N   . SER B 2 201 ? 52.942  51.076 123.168 1.00 2.00   ? 201 SER B N   1 
ATOM   2821 C CA  . SER B 2 201 ? 53.140  52.190 122.257 1.00 2.00   ? 201 SER B CA  1 
ATOM   2822 C C   . SER B 2 201 ? 53.228  53.445 123.129 1.00 3.13   ? 201 SER B C   1 
ATOM   2823 O O   . SER B 2 201 ? 52.919  53.417 124.316 1.00 12.79  ? 201 SER B O   1 
ATOM   2824 C CB  . SER B 2 201 ? 51.918  52.359 121.385 1.00 7.15   ? 201 SER B CB  1 
ATOM   2825 O OG  . SER B 2 201 ? 50.886  52.990 122.120 1.00 8.11   ? 201 SER B OG  1 
ATOM   2826 N N   . PRO B 2 202 ? 53.611  54.582 122.552 1.00 9.82   ? 202 PRO B N   1 
ATOM   2827 C CA  . PRO B 2 202 ? 53.675  55.773 123.404 1.00 2.64   ? 202 PRO B CA  1 
ATOM   2828 C C   . PRO B 2 202 ? 52.232  56.195 123.627 1.00 5.86   ? 202 PRO B C   1 
ATOM   2829 O O   . PRO B 2 202 ? 51.340  55.736 122.917 1.00 14.77  ? 202 PRO B O   1 
ATOM   2830 C CB  . PRO B 2 202 ? 54.373  56.781 122.500 1.00 4.76   ? 202 PRO B CB  1 
ATOM   2831 C CG  . PRO B 2 202 ? 55.110  55.947 121.512 1.00 2.00   ? 202 PRO B CG  1 
ATOM   2832 C CD  . PRO B 2 202 ? 54.153  54.865 121.215 1.00 11.99  ? 202 PRO B CD  1 
ATOM   2833 N N   . TRP B 2 203 ? 51.968  57.041 124.610 1.00 7.63   ? 203 TRP B N   1 
ATOM   2834 C CA  . TRP B 2 203 ? 50.590  57.469 124.795 1.00 2.00   ? 203 TRP B CA  1 
ATOM   2835 C C   . TRP B 2 203 ? 50.317  58.466 123.674 1.00 4.43   ? 203 TRP B C   1 
ATOM   2836 O O   . TRP B 2 203 ? 51.180  59.265 123.310 1.00 11.22  ? 203 TRP B O   1 
ATOM   2837 C CB  . TRP B 2 203 ? 50.379  58.175 126.140 1.00 2.00   ? 203 TRP B CB  1 
ATOM   2838 C CG  . TRP B 2 203 ? 50.351  57.321 127.374 1.00 2.00   ? 203 TRP B CG  1 
ATOM   2839 C CD1 . TRP B 2 203 ? 51.389  57.067 128.205 1.00 2.00   ? 203 TRP B CD1 1 
ATOM   2840 C CD2 . TRP B 2 203 ? 49.233  56.603 127.902 1.00 2.00   ? 203 TRP B CD2 1 
ATOM   2841 N NE1 . TRP B 2 203 ? 50.999  56.221 129.210 1.00 2.00   ? 203 TRP B NE1 1 
ATOM   2842 C CE2 . TRP B 2 203 ? 49.678  55.921 129.043 1.00 2.00   ? 203 TRP B CE2 1 
ATOM   2843 C CE3 . TRP B 2 203 ? 47.909  56.459 127.514 1.00 2.00   ? 203 TRP B CE3 1 
ATOM   2844 C CZ2 . TRP B 2 203 ? 48.851  55.109 129.793 1.00 2.00   ? 203 TRP B CZ2 1 
ATOM   2845 C CZ3 . TRP B 2 203 ? 47.087  55.645 128.265 1.00 7.25   ? 203 TRP B CZ3 1 
ATOM   2846 C CH2 . TRP B 2 203 ? 47.564  54.981 129.392 1.00 2.00   ? 203 TRP B CH2 1 
ATOM   2847 N N   . SER B 2 204 ? 49.120  58.415 123.121 1.00 7.50   ? 204 SER B N   1 
ATOM   2848 C CA  . SER B 2 204 ? 48.714  59.337 122.076 1.00 2.00   ? 204 SER B CA  1 
ATOM   2849 C C   . SER B 2 204 ? 48.709  60.763 122.632 1.00 3.84   ? 204 SER B C   1 
ATOM   2850 O O   . SER B 2 204 ? 48.651  60.961 123.844 1.00 2.61   ? 204 SER B O   1 
ATOM   2851 C CB  . SER B 2 204 ? 47.295  58.973 121.620 1.00 2.00   ? 204 SER B CB  1 
ATOM   2852 O OG  . SER B 2 204 ? 46.356  59.101 122.685 1.00 7.30   ? 204 SER B OG  1 
ATOM   2853 N N   . PRO B 2 205 ? 48.837  61.773 121.759 1.00 8.07   ? 205 PRO B N   1 
ATOM   2854 C CA  . PRO B 2 205 ? 48.825  63.171 122.191 1.00 2.00   ? 205 PRO B CA  1 
ATOM   2855 C C   . PRO B 2 205 ? 47.512  63.505 122.887 1.00 3.80   ? 205 PRO B C   1 
ATOM   2856 O O   . PRO B 2 205 ? 46.434  63.124 122.433 1.00 13.77  ? 205 PRO B O   1 
ATOM   2857 C CB  . PRO B 2 205 ? 48.966  63.925 120.877 1.00 6.99   ? 205 PRO B CB  1 
ATOM   2858 C CG  . PRO B 2 205 ? 48.573  62.929 119.836 1.00 5.70   ? 205 PRO B CG  1 
ATOM   2859 C CD  . PRO B 2 205 ? 49.201  61.693 120.340 1.00 9.91   ? 205 PRO B CD  1 
ATOM   2860 N N   . GLY B 2 206 ? 47.619  64.196 124.007 1.00 9.50   ? 206 GLY B N   1 
ATOM   2861 C CA  . GLY B 2 206 ? 46.452  64.530 124.797 1.00 2.03   ? 206 GLY B CA  1 
ATOM   2862 C C   . GLY B 2 206 ? 45.301  65.173 124.076 1.00 5.21   ? 206 GLY B C   1 
ATOM   2863 O O   . GLY B 2 206 ? 45.490  66.105 123.311 1.00 20.52  ? 206 GLY B O   1 
ATOM   2864 N N   . LEU B 2 207 ? 44.112  64.631 124.287 1.00 5.28   ? 207 LEU B N   1 
ATOM   2865 C CA  . LEU B 2 207 ? 42.899  65.168 123.705 1.00 2.00   ? 207 LEU B CA  1 
ATOM   2866 C C   . LEU B 2 207 ? 42.353  65.942 124.858 1.00 2.47   ? 207 LEU B C   1 
ATOM   2867 O O   . LEU B 2 207 ? 42.366  65.453 125.972 1.00 14.01  ? 207 LEU B O   1 
ATOM   2868 C CB  . LEU B 2 207 ? 41.879  64.078 123.401 1.00 2.00   ? 207 LEU B CB  1 
ATOM   2869 C CG  . LEU B 2 207 ? 41.512  63.735 121.970 1.00 2.00   ? 207 LEU B CG  1 
ATOM   2870 C CD1 . LEU B 2 207 ? 40.282  62.834 121.992 1.00 2.00   ? 207 LEU B CD1 1 
ATOM   2871 C CD2 . LEU B 2 207 ? 41.217  64.990 121.223 1.00 23.41  ? 207 LEU B CD2 1 
ATOM   2872 N N   . GLN B 2 208 ? 41.900  67.157 124.598 1.00 13.33  ? 208 GLN B N   1 
ATOM   2873 C CA  . GLN B 2 208 ? 41.297  68.009 125.608 1.00 2.00   ? 208 GLN B CA  1 
ATOM   2874 C C   . GLN B 2 208 ? 39.856  68.172 125.167 1.00 8.08   ? 208 GLN B C   1 
ATOM   2875 O O   . GLN B 2 208 ? 39.564  68.873 124.202 1.00 13.13  ? 208 GLN B O   1 
ATOM   2876 C CB  . GLN B 2 208 ? 42.012  69.342 125.656 1.00 2.00   ? 208 GLN B CB  1 
ATOM   2877 C CG  . GLN B 2 208 ? 43.407  69.190 126.194 1.00 25.33  ? 208 GLN B CG  1 
ATOM   2878 C CD  . GLN B 2 208 ? 44.170  70.493 126.275 1.00 43.42  ? 208 GLN B CD  1 
ATOM   2879 O OE1 . GLN B 2 208 ? 43.635  71.540 126.670 1.00 44.96  ? 208 GLN B OE1 1 
ATOM   2880 N NE2 . GLN B 2 208 ? 45.445  70.436 125.907 1.00 66.36  ? 208 GLN B NE2 1 
ATOM   2881 N N   . LEU B 2 209 ? 38.966  67.462 125.843 1.00 6.60   ? 209 LEU B N   1 
ATOM   2882 C CA  . LEU B 2 209 ? 37.551  67.463 125.497 1.00 5.55   ? 209 LEU B CA  1 
ATOM   2883 C C   . LEU B 2 209 ? 36.681  68.023 126.603 1.00 8.82   ? 209 LEU B C   1 
ATOM   2884 O O   . LEU B 2 209 ? 36.985  67.870 127.784 1.00 15.03  ? 209 LEU B O   1 
ATOM   2885 C CB  . LEU B 2 209 ? 37.098  66.030 125.162 1.00 8.34   ? 209 LEU B CB  1 
ATOM   2886 C CG  . LEU B 2 209 ? 37.786  65.412 123.947 1.00 23.33  ? 209 LEU B CG  1 
ATOM   2887 C CD1 . LEU B 2 209 ? 37.345  64.005 123.758 1.00 15.88  ? 209 LEU B CD1 1 
ATOM   2888 C CD2 . LEU B 2 209 ? 37.493  66.237 122.711 1.00 33.54  ? 209 LEU B CD2 1 
ATOM   2889 N N   . ARG B 2 210 ? 35.606  68.692 126.221 1.00 8.51   ? 210 ARG B N   1 
ATOM   2890 C CA  . ARG B 2 210 ? 34.708  69.263 127.202 1.00 6.02   ? 210 ARG B CA  1 
ATOM   2891 C C   . ARG B 2 210 ? 33.565  68.300 127.345 1.00 7.09   ? 210 ARG B C   1 
ATOM   2892 O O   . ARG B 2 210 ? 32.995  67.850 126.336 1.00 11.32  ? 210 ARG B O   1 
ATOM   2893 C CB  . ARG B 2 210 ? 34.154  70.629 126.731 1.00 10.42  ? 210 ARG B CB  1 
ATOM   2894 C CG  . ARG B 2 210 ? 35.095  71.852 126.887 1.00 29.95  ? 210 ARG B CG  1 
ATOM   2895 C CD  . ARG B 2 210 ? 34.432  73.202 126.479 1.00 19.51  ? 210 ARG B CD  1 
ATOM   2896 N NE  . ARG B 2 210 ? 35.279  74.388 126.709 1.00 19.75  ? 210 ARG B NE  1 
ATOM   2897 C CZ  . ARG B 2 210 ? 35.586  74.897 127.907 1.00 39.59  ? 210 ARG B CZ  1 
ATOM   2898 N NH1 . ARG B 2 210 ? 35.109  74.344 129.018 1.00 52.65  ? 210 ARG B NH1 1 
ATOM   2899 N NH2 . ARG B 2 210 ? 36.434  75.920 128.006 1.00 44.79  ? 210 ARG B NH2 1 
ATOM   2900 N N   . PRO B 2 211 ? 33.254  67.904 128.586 1.00 4.61   ? 211 PRO B N   1 
ATOM   2901 C CA  . PRO B 2 211 ? 32.145  66.983 128.820 1.00 2.00   ? 211 PRO B CA  1 
ATOM   2902 C C   . PRO B 2 211 ? 30.871  67.788 128.582 1.00 9.80   ? 211 PRO B C   1 
ATOM   2903 O O   . PRO B 2 211 ? 30.924  68.946 128.217 1.00 29.22  ? 211 PRO B O   1 
ATOM   2904 C CB  . PRO B 2 211 ? 32.296  66.628 130.296 1.00 2.00   ? 211 PRO B CB  1 
ATOM   2905 C CG  . PRO B 2 211 ? 33.715  66.840 130.567 1.00 2.00   ? 211 PRO B CG  1 
ATOM   2906 C CD  . PRO B 2 211 ? 34.013  68.110 129.823 1.00 10.54  ? 211 PRO B CD  1 
ATOM   2907 N N   . THR B 2 212 ? 29.724  67.188 128.814 1.00 16.50  ? 212 THR B N   1 
ATOM   2908 C CA  . THR B 2 212 ? 28.475  67.878 128.604 1.00 11.73  ? 212 THR B CA  1 
ATOM   2909 C C   . THR B 2 212 ? 28.127  68.830 129.742 1.00 23.70  ? 212 THR B C   1 
ATOM   2910 O O   . THR B 2 212 ? 28.545  68.626 130.893 1.00 31.82  ? 212 THR B O   1 
ATOM   2911 C CB  . THR B 2 212 ? 27.360  66.856 128.377 1.00 20.20  ? 212 THR B CB  1 
ATOM   2912 O OG1 . THR B 2 212 ? 27.555  66.234 127.104 1.00 30.23  ? 212 THR B OG1 1 
ATOM   2913 C CG2 . THR B 2 212 ? 25.989  67.513 128.392 1.00 55.60  ? 212 THR B CG2 1 
ATOM   2914 N N   . MET B 2 213 ? 27.344  69.853 129.385 1.00 31.68  ? 213 MET B N   1 
ATOM   2915 C CA  . MET B 2 213 ? 26.849  70.916 130.260 1.00 38.72  ? 213 MET B CA  1 
ATOM   2916 C C   . MET B 2 213 ? 27.838  72.089 130.297 1.00 48.57  ? 213 MET B C   1 
ATOM   2917 O O   . MET B 2 213 ? 28.474  72.299 131.351 1.00 49.23  ? 213 MET B O   1 
ATOM   2918 C CB  . MET B 2 213 ? 26.517  70.409 131.673 1.00 47.27  ? 213 MET B CB  1 
ATOM   2919 C CG  . MET B 2 213 ? 25.462  71.256 132.367 1.00 71.67  ? 213 MET B CG  1 
ATOM   2920 S SD  . MET B 2 213 ? 25.711  71.406 134.140 1.00 109.36 ? 213 MET B SD  1 
ATOM   2921 C CE  . MET B 2 213 ? 27.040  72.706 134.232 1.00 87.15  ? 213 MET B CE  1 
ATOM   2922 N N   . ALA C 1 7   ? 37.324  44.617 129.685 1.00 70.70  ? 7   ALA C N   1 
ATOM   2923 C CA  . ALA C 1 7   ? 37.825  45.940 130.145 1.00 64.63  ? 7   ALA C CA  1 
ATOM   2924 C C   . ALA C 1 7   ? 37.474  46.116 131.621 1.00 62.57  ? 7   ALA C C   1 
ATOM   2925 O O   . ALA C 1 7   ? 36.345  45.855 132.038 1.00 66.61  ? 7   ALA C O   1 
ATOM   2926 C CB  . ALA C 1 7   ? 37.209  47.053 129.307 1.00 58.22  ? 7   ALA C CB  1 
ATOM   2927 N N   . SER C 1 8   ? 38.443  46.557 132.410 1.00 48.87  ? 8   SER C N   1 
ATOM   2928 C CA  . SER C 1 8   ? 38.222  46.734 133.831 1.00 40.21  ? 8   SER C CA  1 
ATOM   2929 C C   . SER C 1 8   ? 38.971  47.952 134.367 1.00 36.75  ? 8   SER C C   1 
ATOM   2930 O O   . SER C 1 8   ? 39.730  48.605 133.647 1.00 23.31  ? 8   SER C O   1 
ATOM   2931 C CB  . SER C 1 8   ? 38.630  45.458 134.607 1.00 48.82  ? 8   SER C CB  1 
ATOM   2932 O OG  . SER C 1 8   ? 37.717  44.369 134.417 1.00 55.86  ? 8   SER C OG  1 
ATOM   2933 N N   . SER C 1 9   ? 38.689  48.279 135.622 1.00 30.24  ? 9   SER C N   1 
ATOM   2934 C CA  . SER C 1 9   ? 39.305  49.390 136.323 1.00 18.52  ? 9   SER C CA  1 
ATOM   2935 C C   . SER C 1 9   ? 40.576  48.904 136.978 1.00 17.41  ? 9   SER C C   1 
ATOM   2936 O O   . SER C 1 9   ? 41.377  49.705 137.436 1.00 23.66  ? 9   SER C O   1 
ATOM   2937 C CB  . SER C 1 9   ? 38.344  49.912 137.389 1.00 36.91  ? 9   SER C CB  1 
ATOM   2938 O OG  . SER C 1 9   ? 37.395  48.910 137.757 1.00 45.00  ? 9   SER C OG  1 
ATOM   2939 N N   . LEU C 1 10  ? 40.765  47.582 136.959 1.00 15.65  ? 10  LEU C N   1 
ATOM   2940 C CA  . LEU C 1 10  ? 41.912  46.901 137.547 1.00 3.24   ? 10  LEU C CA  1 
ATOM   2941 C C   . LEU C 1 10  ? 42.696  46.113 136.516 1.00 7.07   ? 10  LEU C C   1 
ATOM   2942 O O   . LEU C 1 10  ? 42.120  45.485 135.620 1.00 12.19  ? 10  LEU C O   1 
ATOM   2943 C CB  . LEU C 1 10  ? 41.418  45.948 138.620 1.00 9.05   ? 10  LEU C CB  1 
ATOM   2944 C CG  . LEU C 1 10  ? 40.816  46.667 139.823 1.00 13.49  ? 10  LEU C CG  1 
ATOM   2945 C CD1 . LEU C 1 10  ? 40.130  45.691 140.731 1.00 16.58  ? 10  LEU C CD1 1 
ATOM   2946 C CD2 . LEU C 1 10  ? 41.904  47.384 140.561 1.00 4.27   ? 10  LEU C CD2 1 
ATOM   2947 N N   . PRO C 1 11  ? 44.035  46.167 136.602 1.00 4.83   ? 11  PRO C N   1 
ATOM   2948 C CA  . PRO C 1 11  ? 44.950  45.466 135.689 1.00 2.00   ? 11  PRO C CA  1 
ATOM   2949 C C   . PRO C 1 11  ? 45.025  43.995 136.042 1.00 9.11   ? 11  PRO C C   1 
ATOM   2950 O O   . PRO C 1 11  ? 45.355  43.641 137.175 1.00 23.16  ? 11  PRO C O   1 
ATOM   2951 C CB  . PRO C 1 11  ? 46.289  46.170 135.935 1.00 2.00   ? 11  PRO C CB  1 
ATOM   2952 C CG  . PRO C 1 11  ? 46.192  46.626 137.352 1.00 2.00   ? 11  PRO C CG  1 
ATOM   2953 C CD  . PRO C 1 11  ? 44.769  47.087 137.495 1.00 2.15   ? 11  PRO C CD  1 
ATOM   2954 N N   . GLN C 1 12  ? 44.757  43.131 135.073 1.00 12.13  ? 12  GLN C N   1 
ATOM   2955 C CA  . GLN C 1 12  ? 44.754  41.686 135.309 1.00 3.65   ? 12  GLN C CA  1 
ATOM   2956 C C   . GLN C 1 12  ? 45.910  41.161 136.187 1.00 7.75   ? 12  GLN C C   1 
ATOM   2957 O O   . GLN C 1 12  ? 45.684  40.396 137.121 1.00 22.07  ? 12  GLN C O   1 
ATOM   2958 C CB  . GLN C 1 12  ? 44.693  40.939 133.971 1.00 7.85   ? 12  GLN C CB  1 
ATOM   2959 C CG  . GLN C 1 12  ? 44.396  39.444 134.078 1.00 34.46  ? 12  GLN C CG  1 
ATOM   2960 C CD  . GLN C 1 12  ? 42.923  39.107 133.940 1.00 51.37  ? 12  GLN C CD  1 
ATOM   2961 O OE1 . GLN C 1 12  ? 42.052  39.960 134.145 1.00 69.95  ? 12  GLN C OE1 1 
ATOM   2962 N NE2 . GLN C 1 12  ? 42.635  37.862 133.564 1.00 55.69  ? 12  GLN C NE2 1 
ATOM   2963 N N   . SER C 1 13  ? 47.130  41.616 135.946 1.00 3.65   ? 13  SER C N   1 
ATOM   2964 C CA  . SER C 1 13  ? 48.261  41.144 136.733 1.00 4.29   ? 13  SER C CA  1 
ATOM   2965 C C   . SER C 1 13  ? 48.073  41.345 138.234 1.00 12.18  ? 13  SER C C   1 
ATOM   2966 O O   . SER C 1 13  ? 48.550  40.565 139.041 1.00 22.84  ? 13  SER C O   1 
ATOM   2967 C CB  . SER C 1 13  ? 49.540  41.822 136.285 1.00 7.77   ? 13  SER C CB  1 
ATOM   2968 O OG  . SER C 1 13  ? 49.393  43.226 136.385 1.00 45.31  ? 13  SER C OG  1 
ATOM   2969 N N   . PHE C 1 14  ? 47.349  42.376 138.609 1.00 8.39   ? 14  PHE C N   1 
ATOM   2970 C CA  . PHE C 1 14  ? 47.124  42.636 139.999 1.00 2.00   ? 14  PHE C CA  1 
ATOM   2971 C C   . PHE C 1 14  ? 46.156  41.614 140.540 1.00 2.98   ? 14  PHE C C   1 
ATOM   2972 O O   . PHE C 1 14  ? 46.386  41.013 141.591 1.00 18.56  ? 14  PHE C O   1 
ATOM   2973 C CB  . PHE C 1 14  ? 46.574  44.038 140.156 1.00 3.21   ? 14  PHE C CB  1 
ATOM   2974 C CG  . PHE C 1 14  ? 45.963  44.292 141.482 1.00 13.50  ? 14  PHE C CG  1 
ATOM   2975 C CD1 . PHE C 1 14  ? 46.741  44.325 142.618 1.00 2.00   ? 14  PHE C CD1 1 
ATOM   2976 C CD2 . PHE C 1 14  ? 44.594  44.429 141.605 1.00 16.19  ? 14  PHE C CD2 1 
ATOM   2977 C CE1 . PHE C 1 14  ? 46.165  44.479 143.844 1.00 6.08   ? 14  PHE C CE1 1 
ATOM   2978 C CE2 . PHE C 1 14  ? 44.022  44.584 142.833 1.00 17.70  ? 14  PHE C CE2 1 
ATOM   2979 C CZ  . PHE C 1 14  ? 44.805  44.607 143.951 1.00 11.84  ? 14  PHE C CZ  1 
ATOM   2980 N N   . LEU C 1 15  ? 45.071  41.402 139.816 1.00 2.00   ? 15  LEU C N   1 
ATOM   2981 C CA  . LEU C 1 15  ? 44.068  40.444 140.255 1.00 2.72   ? 15  LEU C CA  1 
ATOM   2982 C C   . LEU C 1 15  ? 44.632  39.041 140.350 1.00 8.50   ? 15  LEU C C   1 
ATOM   2983 O O   . LEU C 1 15  ? 44.257  38.266 141.231 1.00 17.18  ? 15  LEU C O   1 
ATOM   2984 C CB  . LEU C 1 15  ? 42.904  40.433 139.289 1.00 2.00   ? 15  LEU C CB  1 
ATOM   2985 C CG  . LEU C 1 15  ? 41.969  41.618 139.269 1.00 2.00   ? 15  LEU C CG  1 
ATOM   2986 C CD1 . LEU C 1 15  ? 40.896  41.296 138.273 1.00 14.51  ? 15  LEU C CD1 1 
ATOM   2987 C CD2 . LEU C 1 15  ? 41.353  41.788 140.630 1.00 2.00   ? 15  LEU C CD2 1 
ATOM   2988 N N   . LEU C 1 16  ? 45.547  38.716 139.442 1.00 8.32   ? 16  LEU C N   1 
ATOM   2989 C CA  . LEU C 1 16  ? 46.141  37.394 139.427 1.00 2.00   ? 16  LEU C CA  1 
ATOM   2990 C C   . LEU C 1 16  ? 47.059  37.200 140.595 1.00 2.00   ? 16  LEU C C   1 
ATOM   2991 O O   . LEU C 1 16  ? 47.111  36.114 141.159 1.00 18.45  ? 16  LEU C O   1 
ATOM   2992 C CB  . LEU C 1 16  ? 46.820  37.104 138.101 1.00 2.00   ? 16  LEU C CB  1 
ATOM   2993 C CG  . LEU C 1 16  ? 45.896  36.932 136.887 1.00 2.00   ? 16  LEU C CG  1 
ATOM   2994 C CD1 . LEU C 1 16  ? 46.711  36.412 135.790 1.00 2.00   ? 16  LEU C CD1 1 
ATOM   2995 C CD2 . LEU C 1 16  ? 44.786  35.958 137.102 1.00 2.00   ? 16  LEU C CD2 1 
ATOM   2996 N N   . LYS C 1 17  ? 47.780  38.247 140.971 1.00 2.00   ? 17  LYS C N   1 
ATOM   2997 C CA  . LYS C 1 17  ? 48.638  38.172 142.149 1.00 2.00   ? 17  LYS C CA  1 
ATOM   2998 C C   . LYS C 1 17  ? 47.774  38.111 143.412 1.00 10.50  ? 17  LYS C C   1 
ATOM   2999 O O   . LYS C 1 17  ? 48.142  37.467 144.382 1.00 23.80  ? 17  LYS C O   1 
ATOM   3000 C CB  . LYS C 1 17  ? 49.546  39.371 142.231 1.00 2.32   ? 17  LYS C CB  1 
ATOM   3001 C CG  . LYS C 1 17  ? 50.523  39.459 141.090 1.00 13.58  ? 17  LYS C CG  1 
ATOM   3002 C CD  . LYS C 1 17  ? 51.515  40.604 141.332 1.00 27.32  ? 17  LYS C CD  1 
ATOM   3003 C CE  . LYS C 1 17  ? 52.363  40.899 140.093 1.00 52.53  ? 17  LYS C CE  1 
ATOM   3004 N NZ  . LYS C 1 17  ? 53.197  42.126 140.244 1.00 61.93  ? 17  LYS C NZ  1 
ATOM   3005 N N   . CYS C 1 18  ? 46.634  38.792 143.409 1.00 3.75   ? 18  CYS C N   1 
ATOM   3006 C CA  . CYS C 1 18  ? 45.744  38.742 144.549 1.00 2.00   ? 18  CYS C CA  1 
ATOM   3007 C C   . CYS C 1 18  ? 45.293  37.306 144.802 1.00 2.00   ? 18  CYS C C   1 
ATOM   3008 O O   . CYS C 1 18  ? 45.387  36.805 145.914 1.00 12.40  ? 18  CYS C O   1 
ATOM   3009 C CB  . CYS C 1 18  ? 44.563  39.638 144.290 1.00 2.00   ? 18  CYS C CB  1 
ATOM   3010 S SG  . CYS C 1 18  ? 44.980  41.342 144.562 1.00 6.90   ? 18  CYS C SG  1 
ATOM   3011 N N   . LEU C 1 19  ? 44.888  36.620 143.741 1.00 2.00   ? 19  LEU C N   1 
ATOM   3012 C CA  . LEU C 1 19  ? 44.425  35.233 143.820 1.00 2.92   ? 19  LEU C CA  1 
ATOM   3013 C C   . LEU C 1 19  ? 45.473  34.268 144.304 1.00 8.24   ? 19  LEU C C   1 
ATOM   3014 O O   . LEU C 1 19  ? 45.178  33.253 144.913 1.00 17.05  ? 19  LEU C O   1 
ATOM   3015 C CB  . LEU C 1 19  ? 43.954  34.764 142.463 1.00 9.51   ? 19  LEU C CB  1 
ATOM   3016 C CG  . LEU C 1 19  ? 42.692  35.422 141.907 1.00 12.13  ? 19  LEU C CG  1 
ATOM   3017 C CD1 . LEU C 1 19  ? 42.497  34.971 140.479 1.00 3.84   ? 19  LEU C CD1 1 
ATOM   3018 C CD2 . LEU C 1 19  ? 41.493  35.051 142.755 1.00 18.70  ? 19  LEU C CD2 1 
ATOM   3019 N N   . GLU C 1 20  ? 46.712  34.579 144.007 1.00 12.19  ? 20  GLU C N   1 
ATOM   3020 C CA  . GLU C 1 20  ? 47.787  33.729 144.426 1.00 2.00   ? 20  GLU C CA  1 
ATOM   3021 C C   . GLU C 1 20  ? 48.073  33.977 145.910 1.00 6.85   ? 20  GLU C C   1 
ATOM   3022 O O   . GLU C 1 20  ? 48.379  33.049 146.639 1.00 12.34  ? 20  GLU C O   1 
ATOM   3023 C CB  . GLU C 1 20  ? 49.000  34.011 143.557 1.00 2.00   ? 20  GLU C CB  1 
ATOM   3024 C CG  . GLU C 1 20  ? 50.074  33.020 143.746 1.00 3.81   ? 20  GLU C CG  1 
ATOM   3025 C CD  . GLU C 1 20  ? 51.197  33.236 142.824 1.00 11.23  ? 20  GLU C CD  1 
ATOM   3026 O OE1 . GLU C 1 20  ? 52.131  33.892 143.213 1.00 4.66   ? 20  GLU C OE1 1 
ATOM   3027 O OE2 . GLU C 1 20  ? 51.189  32.746 141.706 1.00 18.65  ? 20  GLU C OE2 1 
ATOM   3028 N N   . GLN C 1 21  ? 47.954  35.221 146.368 1.00 6.38   ? 21  GLN C N   1 
ATOM   3029 C CA  . GLN C 1 21  ? 48.202  35.519 147.765 1.00 2.00   ? 21  GLN C CA  1 
ATOM   3030 C C   . GLN C 1 21  ? 47.090  34.875 148.595 1.00 2.00   ? 21  GLN C C   1 
ATOM   3031 O O   . GLN C 1 21  ? 47.330  34.306 149.647 1.00 11.32  ? 21  GLN C O   1 
ATOM   3032 C CB  . GLN C 1 21  ? 48.283  37.019 147.988 1.00 2.00   ? 21  GLN C CB  1 
ATOM   3033 C CG  . GLN C 1 21  ? 49.424  37.698 147.258 1.00 2.46   ? 21  GLN C CG  1 
ATOM   3034 C CD  . GLN C 1 21  ? 49.637  39.155 147.664 1.00 12.76  ? 21  GLN C CD  1 
ATOM   3035 O OE1 . GLN C 1 21  ? 49.293  40.068 146.924 1.00 7.82   ? 21  GLN C OE1 1 
ATOM   3036 N NE2 . GLN C 1 21  ? 50.225  39.371 148.827 1.00 8.14   ? 21  GLN C NE2 1 
ATOM   3037 N N   . VAL C 1 22  ? 45.880  34.874 148.085 1.00 2.00   ? 22  VAL C N   1 
ATOM   3038 C CA  . VAL C 1 22  ? 44.807  34.248 148.811 1.00 2.00   ? 22  VAL C CA  1 
ATOM   3039 C C   . VAL C 1 22  ? 45.168  32.794 148.999 1.00 3.52   ? 22  VAL C C   1 
ATOM   3040 O O   . VAL C 1 22  ? 45.151  32.300 150.106 1.00 23.32  ? 22  VAL C O   1 
ATOM   3041 C CB  . VAL C 1 22  ? 43.482  34.371 148.050 1.00 2.70   ? 22  VAL C CB  1 
ATOM   3042 C CG1 . VAL C 1 22  ? 42.505  33.351 148.516 1.00 4.35   ? 22  VAL C CG1 1 
ATOM   3043 C CG2 . VAL C 1 22  ? 42.908  35.731 148.248 1.00 2.00   ? 22  VAL C CG2 1 
ATOM   3044 N N   . ARG C 1 23  ? 45.539  32.108 147.931 1.00 8.50   ? 23  ARG C N   1 
ATOM   3045 C CA  . ARG C 1 23  ? 45.904  30.705 148.064 1.00 2.00   ? 23  ARG C CA  1 
ATOM   3046 C C   . ARG C 1 23  ? 47.095  30.478 148.997 1.00 2.06   ? 23  ARG C C   1 
ATOM   3047 O O   . ARG C 1 23  ? 47.061  29.585 149.817 1.00 8.20   ? 23  ARG C O   1 
ATOM   3048 C CB  . ARG C 1 23  ? 46.219  30.099 146.705 1.00 10.14  ? 23  ARG C CB  1 
ATOM   3049 C CG  . ARG C 1 23  ? 45.034  29.761 145.816 1.00 3.80   ? 23  ARG C CG  1 
ATOM   3050 C CD  . ARG C 1 23  ? 45.553  29.170 144.484 1.00 18.10  ? 23  ARG C CD  1 
ATOM   3051 N NE  . ARG C 1 23  ? 44.891  29.761 143.321 1.00 37.39  ? 23  ARG C NE  1 
ATOM   3052 C CZ  . ARG C 1 23  ? 45.481  30.523 142.399 1.00 29.77  ? 23  ARG C CZ  1 
ATOM   3053 N NH1 . ARG C 1 23  ? 46.780  30.797 142.464 1.00 15.01  ? 23  ARG C NH1 1 
ATOM   3054 N NH2 . ARG C 1 23  ? 44.739  31.080 141.446 1.00 28.45  ? 23  ARG C NH2 1 
ATOM   3055 N N   . LYS C 1 24  ? 48.137  31.288 148.873 1.00 2.00   ? 24  LYS C N   1 
ATOM   3056 C CA  . LYS C 1 24  ? 49.321  31.143 149.698 1.00 2.00   ? 24  LYS C CA  1 
ATOM   3057 C C   . LYS C 1 24  ? 48.883  31.225 151.130 1.00 5.87   ? 24  LYS C C   1 
ATOM   3058 O O   . LYS C 1 24  ? 49.240  30.373 151.938 1.00 15.33  ? 24  LYS C O   1 
ATOM   3059 C CB  . LYS C 1 24  ? 50.321  32.251 149.382 1.00 2.00   ? 24  LYS C CB  1 
ATOM   3060 C CG  . LYS C 1 24  ? 51.710  32.036 149.921 1.00 4.28   ? 24  LYS C CG  1 
ATOM   3061 C CD  . LYS C 1 24  ? 52.659  33.042 149.305 1.00 5.63   ? 24  LYS C CD  1 
ATOM   3062 C CE  . LYS C 1 24  ? 54.015  33.039 149.983 1.00 25.70  ? 24  LYS C CE  1 
ATOM   3063 N NZ  . LYS C 1 24  ? 54.741  31.768 149.806 1.00 33.89  ? 24  LYS C NZ  1 
ATOM   3064 N N   . ILE C 1 25  ? 48.024  32.197 151.418 1.00 5.48   ? 25  ILE C N   1 
ATOM   3065 C CA  . ILE C 1 25  ? 47.517  32.404 152.766 1.00 5.48   ? 25  ILE C CA  1 
ATOM   3066 C C   . ILE C 1 25  ? 46.582  31.304 153.235 1.00 4.26   ? 25  ILE C C   1 
ATOM   3067 O O   . ILE C 1 25  ? 46.530  30.990 154.412 1.00 17.19  ? 25  ILE C O   1 
ATOM   3068 C CB  . ILE C 1 25  ? 46.810  33.730 152.898 1.00 2.00   ? 25  ILE C CB  1 
ATOM   3069 C CG1 . ILE C 1 25  ? 47.806  34.861 152.717 1.00 8.94   ? 25  ILE C CG1 1 
ATOM   3070 C CG2 . ILE C 1 25  ? 46.241  33.869 154.267 1.00 2.00   ? 25  ILE C CG2 1 
ATOM   3071 C CD1 . ILE C 1 25  ? 47.144  36.219 152.561 1.00 5.43   ? 25  ILE C CD1 1 
ATOM   3072 N N   . GLN C 1 26  ? 45.813  30.734 152.335 1.00 5.13   ? 26  GLN C N   1 
ATOM   3073 C CA  . GLN C 1 26  ? 44.934  29.647 152.728 1.00 7.24   ? 26  GLN C CA  1 
ATOM   3074 C C   . GLN C 1 26  ? 45.773  28.417 153.051 1.00 7.27   ? 26  GLN C C   1 
ATOM   3075 O O   . GLN C 1 26  ? 45.329  27.525 153.745 1.00 26.82  ? 26  GLN C O   1 
ATOM   3076 C CB  . GLN C 1 26  ? 44.002  29.277 151.595 1.00 3.21   ? 26  GLN C CB  1 
ATOM   3077 C CG  . GLN C 1 26  ? 43.002  30.302 151.248 1.00 9.07   ? 26  GLN C CG  1 
ATOM   3078 C CD  . GLN C 1 26  ? 42.260  29.914 150.012 1.00 13.81  ? 26  GLN C CD  1 
ATOM   3079 O OE1 . GLN C 1 26  ? 41.056  29.716 150.039 1.00 24.75  ? 26  GLN C OE1 1 
ATOM   3080 N NE2 . GLN C 1 26  ? 42.983  29.765 148.915 1.00 34.84  ? 26  GLN C NE2 1 
ATOM   3081 N N   . GLY C 1 27  ? 46.961  28.329 152.480 1.00 13.10  ? 27  GLY C N   1 
ATOM   3082 C CA  . GLY C 1 27  ? 47.799  27.181 152.749 1.00 9.99   ? 27  GLY C CA  1 
ATOM   3083 C C   . GLY C 1 27  ? 48.525  27.405 154.054 1.00 12.84  ? 27  GLY C C   1 
ATOM   3084 O O   . GLY C 1 27  ? 48.873  26.441 154.733 1.00 24.01  ? 27  GLY C O   1 
ATOM   3085 N N   . ASP C 1 28  ? 48.788  28.668 154.384 1.00 8.18   ? 28  ASP C N   1 
ATOM   3086 C CA  . ASP C 1 28  ? 49.471  29.014 155.624 1.00 15.20  ? 28  ASP C CA  1 
ATOM   3087 C C   . ASP C 1 28  ? 48.544  28.749 156.818 1.00 17.49  ? 28  ASP C C   1 
ATOM   3088 O O   . ASP C 1 28  ? 48.965  28.235 157.852 1.00 24.57  ? 28  ASP C O   1 
ATOM   3089 C CB  . ASP C 1 28  ? 49.903  30.483 155.612 1.00 17.26  ? 28  ASP C CB  1 
ATOM   3090 C CG  . ASP C 1 28  ? 51.041  30.769 154.639 1.00 25.61  ? 28  ASP C CG  1 
ATOM   3091 O OD1 . ASP C 1 28  ? 51.796  29.849 154.239 1.00 40.33  ? 28  ASP C OD1 1 
ATOM   3092 O OD2 . ASP C 1 28  ? 51.177  31.947 154.280 1.00 19.48  ? 28  ASP C OD2 1 
ATOM   3093 N N   . GLY C 1 29  ? 47.272  29.081 156.656 1.00 17.64  ? 29  GLY C N   1 
ATOM   3094 C CA  . GLY C 1 29  ? 46.297  28.856 157.709 1.00 2.90   ? 29  GLY C CA  1 
ATOM   3095 C C   . GLY C 1 29  ? 46.081  27.379 157.932 1.00 2.80   ? 29  GLY C C   1 
ATOM   3096 O O   . GLY C 1 29  ? 45.891  26.959 159.053 1.00 14.25  ? 29  GLY C O   1 
ATOM   3097 N N   . ALA C 1 30  ? 46.129  26.579 156.877 1.00 4.17   ? 30  ALA C N   1 
ATOM   3098 C CA  . ALA C 1 30  ? 45.952  25.139 157.017 1.00 2.00   ? 30  ALA C CA  1 
ATOM   3099 C C   . ALA C 1 30  ? 47.109  24.585 157.787 1.00 7.28   ? 30  ALA C C   1 
ATOM   3100 O O   . ALA C 1 30  ? 46.932  23.724 158.636 1.00 29.84  ? 30  ALA C O   1 
ATOM   3101 C CB  . ALA C 1 30  ? 45.901  24.491 155.707 1.00 2.48   ? 30  ALA C CB  1 
ATOM   3102 N N   . ALA C 1 31  ? 48.305  25.062 157.470 1.00 9.43   ? 31  ALA C N   1 
ATOM   3103 C CA  . ALA C 1 31  ? 49.496  24.626 158.162 1.00 4.25   ? 31  ALA C CA  1 
ATOM   3104 C C   . ALA C 1 31  ? 49.284  24.904 159.645 1.00 9.67   ? 31  ALA C C   1 
ATOM   3105 O O   . ALA C 1 31  ? 49.490  24.023 160.480 1.00 24.36  ? 31  ALA C O   1 
ATOM   3106 C CB  . ALA C 1 31  ? 50.680  25.387 157.644 1.00 4.77   ? 31  ALA C CB  1 
ATOM   3107 N N   . LEU C 1 32  ? 48.797  26.108 159.950 1.00 11.94  ? 32  LEU C N   1 
ATOM   3108 C CA  . LEU C 1 32  ? 48.519  26.545 161.327 1.00 10.26  ? 32  LEU C CA  1 
ATOM   3109 C C   . LEU C 1 32  ? 47.506  25.619 161.997 1.00 10.70  ? 32  LEU C C   1 
ATOM   3110 O O   . LEU C 1 32  ? 47.744  25.048 163.039 1.00 21.66  ? 32  LEU C O   1 
ATOM   3111 C CB  . LEU C 1 32  ? 47.972  27.972 161.328 1.00 2.00   ? 32  LEU C CB  1 
ATOM   3112 C CG  . LEU C 1 32  ? 47.650  28.563 162.700 1.00 8.73   ? 32  LEU C CG  1 
ATOM   3113 C CD1 . LEU C 1 32  ? 48.875  28.438 163.540 1.00 16.54  ? 32  LEU C CD1 1 
ATOM   3114 C CD2 . LEU C 1 32  ? 47.203  30.019 162.660 1.00 2.00   ? 32  LEU C CD2 1 
ATOM   3115 N N   . GLN C 1 33  ? 46.372  25.448 161.373 1.00 6.77   ? 33  GLN C N   1 
ATOM   3116 C CA  . GLN C 1 33  ? 45.385  24.575 161.931 1.00 11.34  ? 33  GLN C CA  1 
ATOM   3117 C C   . GLN C 1 33  ? 45.892  23.140 162.058 1.00 16.79  ? 33  GLN C C   1 
ATOM   3118 O O   . GLN C 1 33  ? 45.460  22.410 162.940 1.00 33.97  ? 33  GLN C O   1 
ATOM   3119 C CB  . GLN C 1 33  ? 44.125  24.618 161.084 1.00 10.05  ? 33  GLN C CB  1 
ATOM   3120 C CG  . GLN C 1 33  ? 43.298  25.861 161.302 1.00 26.13  ? 33  GLN C CG  1 
ATOM   3121 C CD  . GLN C 1 33  ? 42.197  26.004 160.267 1.00 55.04  ? 33  GLN C CD  1 
ATOM   3122 O OE1 . GLN C 1 33  ? 41.031  26.215 160.606 1.00 62.61  ? 33  GLN C OE1 1 
ATOM   3123 N NE2 . GLN C 1 33  ? 42.564  25.894 158.993 1.00 56.94  ? 33  GLN C NE2 1 
ATOM   3124 N N   . GLU C 1 34  ? 46.797  22.716 161.195 1.00 11.03  ? 34  GLU C N   1 
ATOM   3125 C CA  . GLU C 1 34  ? 47.280  21.357 161.312 1.00 17.39  ? 34  GLU C CA  1 
ATOM   3126 C C   . GLU C 1 34  ? 48.134  21.321 162.572 1.00 14.89  ? 34  GLU C C   1 
ATOM   3127 O O   . GLU C 1 34  ? 47.926  20.495 163.448 1.00 18.68  ? 34  GLU C O   1 
ATOM   3128 C CB  . GLU C 1 34  ? 48.095  20.947 160.083 1.00 39.26  ? 34  GLU C CB  1 
ATOM   3129 C CG  . GLU C 1 34  ? 48.170  19.425 159.830 1.00 78.84  ? 34  GLU C CG  1 
ATOM   3130 C CD  . GLU C 1 34  ? 48.800  18.614 160.968 1.00 96.03  ? 34  GLU C CD  1 
ATOM   3131 O OE1 . GLU C 1 34  ? 49.989  18.836 161.289 1.00 105.15 ? 34  GLU C OE1 1 
ATOM   3132 O OE2 . GLU C 1 34  ? 48.103  17.735 161.524 1.00 97.73  ? 34  GLU C OE2 1 
ATOM   3133 N N   . LYS C 1 35  ? 49.044  22.275 162.696 1.00 9.61   ? 35  LYS C N   1 
ATOM   3134 C CA  . LYS C 1 35  ? 49.928  22.345 163.850 1.00 9.34   ? 35  LYS C CA  1 
ATOM   3135 C C   . LYS C 1 35  ? 49.135  22.337 165.180 1.00 18.47  ? 35  LYS C C   1 
ATOM   3136 O O   . LYS C 1 35  ? 49.422  21.553 166.074 1.00 29.95  ? 35  LYS C O   1 
ATOM   3137 C CB  . LYS C 1 35  ? 50.797  23.593 163.731 1.00 3.80   ? 35  LYS C CB  1 
ATOM   3138 C CG  . LYS C 1 35  ? 52.077  23.585 164.541 1.00 11.64  ? 35  LYS C CG  1 
ATOM   3139 C CD  . LYS C 1 35  ? 53.104  22.629 164.006 1.00 16.33  ? 35  LYS C CD  1 
ATOM   3140 C CE  . LYS C 1 35  ? 54.370  22.700 164.842 1.00 34.92  ? 35  LYS C CE  1 
ATOM   3141 N NZ  . LYS C 1 35  ? 55.348  21.640 164.459 1.00 66.70  ? 35  LYS C NZ  1 
ATOM   3142 N N   . LEU C 1 36  ? 48.099  23.157 165.286 1.00 18.42  ? 36  LEU C N   1 
ATOM   3143 C CA  . LEU C 1 36  ? 47.286  23.222 166.501 1.00 8.34   ? 36  LEU C CA  1 
ATOM   3144 C C   . LEU C 1 36  ? 46.581  21.928 166.769 1.00 12.47  ? 36  LEU C C   1 
ATOM   3145 O O   . LEU C 1 36  ? 46.311  21.588 167.902 1.00 19.27  ? 36  LEU C O   1 
ATOM   3146 C CB  . LEU C 1 36  ? 46.236  24.302 166.390 1.00 2.00   ? 36  LEU C CB  1 
ATOM   3147 C CG  . LEU C 1 36  ? 46.815  25.692 166.320 1.00 2.00   ? 36  LEU C CG  1 
ATOM   3148 C CD1 . LEU C 1 36  ? 45.839  26.581 165.671 1.00 7.33   ? 36  LEU C CD1 1 
ATOM   3149 C CD2 . LEU C 1 36  ? 47.143  26.178 167.659 1.00 2.00   ? 36  LEU C CD2 1 
ATOM   3150 N N   . CYS C 1 37  ? 46.228  21.219 165.721 1.00 13.93  ? 37  CYS C N   1 
ATOM   3151 C CA  . CYS C 1 37  ? 45.553  19.963 165.918 1.00 21.15  ? 37  CYS C CA  1 
ATOM   3152 C C   . CYS C 1 37  ? 46.557  18.892 166.308 1.00 19.26  ? 37  CYS C C   1 
ATOM   3153 O O   . CYS C 1 37  ? 46.301  18.080 167.177 1.00 35.39  ? 37  CYS C O   1 
ATOM   3154 C CB  . CYS C 1 37  ? 44.803  19.583 164.661 1.00 24.55  ? 37  CYS C CB  1 
ATOM   3155 S SG  . CYS C 1 37  ? 44.146  17.906 164.693 1.00 63.71  ? 37  CYS C SG  1 
ATOM   3156 N N   . ALA C 1 38  ? 47.747  18.961 165.744 1.00 20.60  ? 38  ALA C N   1 
ATOM   3157 C CA  . ALA C 1 38  ? 48.791  17.980 166.032 1.00 22.05  ? 38  ALA C CA  1 
ATOM   3158 C C   . ALA C 1 38  ? 49.385  18.135 167.421 1.00 19.77  ? 38  ALA C C   1 
ATOM   3159 O O   . ALA C 1 38  ? 49.558  17.171 168.170 1.00 37.05  ? 38  ALA C O   1 
ATOM   3160 C CB  . ALA C 1 38  ? 49.897  18.111 165.000 1.00 19.42  ? 38  ALA C CB  1 
ATOM   3161 N N   . THR C 1 39  ? 49.725  19.375 167.719 1.00 11.31  ? 39  THR C N   1 
ATOM   3162 C CA  . THR C 1 39  ? 50.342  19.797 168.956 1.00 9.99   ? 39  THR C CA  1 
ATOM   3163 C C   . THR C 1 39  ? 49.442  19.869 170.217 1.00 16.63  ? 39  THR C C   1 
ATOM   3164 O O   . THR C 1 39  ? 49.925  19.648 171.324 1.00 17.72  ? 39  THR C O   1 
ATOM   3165 C CB  . THR C 1 39  ? 51.023  21.162 168.686 1.00 2.10   ? 39  THR C CB  1 
ATOM   3166 O OG1 . THR C 1 39  ? 51.901  21.022 167.567 1.00 26.10  ? 39  THR C OG1 1 
ATOM   3167 C CG2 . THR C 1 39  ? 51.821  21.650 169.862 1.00 11.26  ? 39  THR C CG2 1 
ATOM   3168 N N   . TYR C 1 40  ? 48.146  20.137 170.056 1.00 12.60  ? 40  TYR C N   1 
ATOM   3169 C CA  . TYR C 1 40  ? 47.250  20.268 171.203 1.00 2.00   ? 40  TYR C CA  1 
ATOM   3170 C C   . TYR C 1 40  ? 45.898  19.638 170.993 1.00 11.97  ? 40  TYR C C   1 
ATOM   3171 O O   . TYR C 1 40  ? 44.918  20.105 171.559 1.00 18.92  ? 40  TYR C O   1 
ATOM   3172 C CB  . TYR C 1 40  ? 46.990  21.735 171.488 1.00 2.00   ? 40  TYR C CB  1 
ATOM   3173 C CG  . TYR C 1 40  ? 48.216  22.612 171.594 1.00 10.90  ? 40  TYR C CG  1 
ATOM   3174 C CD1 . TYR C 1 40  ? 49.284  22.258 172.400 1.00 14.18  ? 40  TYR C CD1 1 
ATOM   3175 C CD2 . TYR C 1 40  ? 48.289  23.827 170.903 1.00 13.60  ? 40  TYR C CD2 1 
ATOM   3176 C CE1 . TYR C 1 40  ? 50.409  23.099 172.524 1.00 36.04  ? 40  TYR C CE1 1 
ATOM   3177 C CE2 . TYR C 1 40  ? 49.405  24.678 171.012 1.00 3.06   ? 40  TYR C CE2 1 
ATOM   3178 C CZ  . TYR C 1 40  ? 50.460  24.315 171.824 1.00 28.91  ? 40  TYR C CZ  1 
ATOM   3179 O OH  . TYR C 1 40  ? 51.539  25.177 171.948 1.00 7.57   ? 40  TYR C OH  1 
ATOM   3180 N N   . LYS C 1 41  ? 45.829  18.607 170.165 1.00 12.42  ? 41  LYS C N   1 
ATOM   3181 C CA  . LYS C 1 41  ? 44.571  17.923 169.863 1.00 14.12  ? 41  LYS C CA  1 
ATOM   3182 C C   . LYS C 1 41  ? 43.298  18.805 169.761 1.00 25.06  ? 41  LYS C C   1 
ATOM   3183 O O   . LYS C 1 41  ? 42.166  18.340 170.020 1.00 36.02  ? 41  LYS C O   1 
ATOM   3184 C CB  . LYS C 1 41  ? 44.375  16.716 170.784 1.00 9.87   ? 41  LYS C CB  1 
ATOM   3185 C CG  . LYS C 1 41  ? 45.368  15.580 170.528 1.00 28.99  ? 41  LYS C CG  1 
ATOM   3186 C CD  . LYS C 1 41  ? 44.654  14.217 170.325 1.00 55.65  ? 41  LYS C CD  1 
ATOM   3187 C CE  . LYS C 1 41  ? 43.704  14.203 169.104 1.00 64.89  ? 41  LYS C CE  1 
ATOM   3188 N NZ  . LYS C 1 41  ? 42.949  12.917 168.955 1.00 69.81  ? 41  LYS C NZ  1 
ATOM   3189 N N   . LEU C 1 42  ? 43.508  20.067 169.364 1.00 24.75  ? 42  LEU C N   1 
ATOM   3190 C CA  . LEU C 1 42  ? 42.456  21.065 169.132 1.00 25.10  ? 42  LEU C CA  1 
ATOM   3191 C C   . LEU C 1 42  ? 42.193  20.992 167.611 1.00 31.92  ? 42  LEU C C   1 
ATOM   3192 O O   . LEU C 1 42  ? 42.755  21.759 166.834 1.00 33.45  ? 42  LEU C O   1 
ATOM   3193 C CB  . LEU C 1 42  ? 42.980  22.448 169.508 1.00 11.25  ? 42  LEU C CB  1 
ATOM   3194 C CG  . LEU C 1 42  ? 42.889  22.866 170.971 1.00 11.05  ? 42  LEU C CG  1 
ATOM   3195 C CD1 . LEU C 1 42  ? 43.707  24.094 171.222 1.00 16.50  ? 42  LEU C CD1 1 
ATOM   3196 C CD2 . LEU C 1 42  ? 41.451  23.154 171.289 1.00 27.22  ? 42  LEU C CD2 1 
ATOM   3197 N N   . CYS C 1 43  ? 41.307  20.089 167.203 1.00 37.36  ? 43  CYS C N   1 
ATOM   3198 C CA  . CYS C 1 43  ? 41.049  19.848 165.790 1.00 38.53  ? 43  CYS C CA  1 
ATOM   3199 C C   . CYS C 1 43  ? 39.769  20.289 165.102 1.00 42.92  ? 43  CYS C C   1 
ATOM   3200 O O   . CYS C 1 43  ? 39.720  20.371 163.875 1.00 59.27  ? 43  CYS C O   1 
ATOM   3201 C CB  . CYS C 1 43  ? 41.250  18.363 165.556 1.00 38.45  ? 43  CYS C CB  1 
ATOM   3202 S SG  . CYS C 1 43  ? 42.842  17.841 166.276 1.00 61.61  ? 43  CYS C SG  1 
ATOM   3203 N N   . HIS C 1 44  ? 38.726  20.564 165.862 1.00 40.68  ? 44  HIS C N   1 
ATOM   3204 C CA  . HIS C 1 44  ? 37.482  20.938 165.237 1.00 39.49  ? 44  HIS C CA  1 
ATOM   3205 C C   . HIS C 1 44  ? 37.010  22.284 165.743 1.00 42.35  ? 44  HIS C C   1 
ATOM   3206 O O   . HIS C 1 44  ? 36.445  22.385 166.827 1.00 48.68  ? 44  HIS C O   1 
ATOM   3207 C CB  . HIS C 1 44  ? 36.436  19.858 165.504 1.00 43.21  ? 44  HIS C CB  1 
ATOM   3208 C CG  . HIS C 1 44  ? 36.975  18.465 165.424 1.00 59.44  ? 44  HIS C CG  1 
ATOM   3209 N ND1 . HIS C 1 44  ? 37.971  18.003 166.259 1.00 66.67  ? 44  HIS C ND1 1 
ATOM   3210 C CD2 . HIS C 1 44  ? 36.652  17.427 164.617 1.00 72.59  ? 44  HIS C CD2 1 
ATOM   3211 C CE1 . HIS C 1 44  ? 38.237  16.741 165.971 1.00 73.66  ? 44  HIS C CE1 1 
ATOM   3212 N NE2 . HIS C 1 44  ? 37.450  16.367 164.978 1.00 76.84  ? 44  HIS C NE2 1 
ATOM   3213 N N   . PRO C 1 45  ? 37.208  23.337 164.947 1.00 39.21  ? 45  PRO C N   1 
ATOM   3214 C CA  . PRO C 1 45  ? 36.794  24.689 165.326 1.00 38.34  ? 45  PRO C CA  1 
ATOM   3215 C C   . PRO C 1 45  ? 35.325  24.775 165.767 1.00 40.88  ? 45  PRO C C   1 
ATOM   3216 O O   . PRO C 1 45  ? 34.958  25.617 166.587 1.00 50.61  ? 45  PRO C O   1 
ATOM   3217 C CB  . PRO C 1 45  ? 37.066  25.492 164.049 1.00 35.22  ? 45  PRO C CB  1 
ATOM   3218 C CG  . PRO C 1 45  ? 37.011  24.442 162.952 1.00 31.33  ? 45  PRO C CG  1 
ATOM   3219 C CD  . PRO C 1 45  ? 37.756  23.319 163.582 1.00 35.45  ? 45  PRO C CD  1 
ATOM   3220 N N   . GLU C 1 46  ? 34.498  23.880 165.243 1.00 44.44  ? 46  GLU C N   1 
ATOM   3221 C CA  . GLU C 1 46  ? 33.078  23.849 165.572 1.00 49.26  ? 46  GLU C CA  1 
ATOM   3222 C C   . GLU C 1 46  ? 32.896  23.735 167.083 1.00 49.24  ? 46  GLU C C   1 
ATOM   3223 O O   . GLU C 1 46  ? 32.026  24.386 167.666 1.00 53.75  ? 46  GLU C O   1 
ATOM   3224 C CB  . GLU C 1 46  ? 32.411  22.666 164.871 1.00 58.05  ? 46  GLU C CB  1 
ATOM   3225 C CG  . GLU C 1 46  ? 32.409  22.744 163.340 1.00 90.91  ? 46  GLU C CG  1 
ATOM   3226 C CD  . GLU C 1 46  ? 33.801  22.660 162.709 1.00 103.82 ? 46  GLU C CD  1 
ATOM   3227 O OE1 . GLU C 1 46  ? 34.586  21.762 163.087 1.00 105.07 ? 46  GLU C OE1 1 
ATOM   3228 O OE2 . GLU C 1 46  ? 34.106  23.494 161.826 1.00 114.60 ? 46  GLU C OE2 1 
ATOM   3229 N N   . GLU C 1 47  ? 33.773  22.956 167.714 1.00 40.34  ? 47  GLU C N   1 
ATOM   3230 C CA  . GLU C 1 47  ? 33.742  22.734 169.160 1.00 33.38  ? 47  GLU C CA  1 
ATOM   3231 C C   . GLU C 1 47  ? 34.040  23.976 169.975 1.00 29.29  ? 47  GLU C C   1 
ATOM   3232 O O   . GLU C 1 47  ? 33.600  24.106 171.107 1.00 42.08  ? 47  GLU C O   1 
ATOM   3233 C CB  . GLU C 1 47  ? 34.713  21.621 169.553 1.00 36.77  ? 47  GLU C CB  1 
ATOM   3234 C CG  . GLU C 1 47  ? 34.420  20.293 168.838 1.00 50.79  ? 47  GLU C CG  1 
ATOM   3235 C CD  . GLU C 1 47  ? 35.267  19.116 169.331 1.00 58.14  ? 47  GLU C CD  1 
ATOM   3236 O OE1 . GLU C 1 47  ? 36.423  19.327 169.798 1.00 40.88  ? 47  GLU C OE1 1 
ATOM   3237 O OE2 . GLU C 1 47  ? 34.761  17.968 169.225 1.00 55.51  ? 47  GLU C OE2 1 
ATOM   3238 N N   . LEU C 1 48  ? 34.737  24.921 169.373 1.00 30.00  ? 48  LEU C N   1 
ATOM   3239 C CA  . LEU C 1 48  ? 35.085  26.155 170.056 1.00 24.32  ? 48  LEU C CA  1 
ATOM   3240 C C   . LEU C 1 48  ? 34.196  27.316 169.673 1.00 27.05  ? 48  LEU C C   1 
ATOM   3241 O O   . LEU C 1 48  ? 34.332  28.392 170.238 1.00 23.67  ? 48  LEU C O   1 
ATOM   3242 C CB  . LEU C 1 48  ? 36.538  26.501 169.755 1.00 28.38  ? 48  LEU C CB  1 
ATOM   3243 C CG  . LEU C 1 48  ? 37.496  25.365 170.115 1.00 19.73  ? 48  LEU C CG  1 
ATOM   3244 C CD1 . LEU C 1 48  ? 38.919  25.713 169.799 1.00 15.16  ? 48  LEU C CD1 1 
ATOM   3245 C CD2 . LEU C 1 48  ? 37.355  25.126 171.585 1.00 42.45  ? 48  LEU C CD2 1 
ATOM   3246 N N   . VAL C 1 49  ? 33.275  27.086 168.737 1.00 38.83  ? 49  VAL C N   1 
ATOM   3247 C CA  . VAL C 1 49  ? 32.358  28.116 168.245 1.00 41.95  ? 49  VAL C CA  1 
ATOM   3248 C C   . VAL C 1 49  ? 31.944  29.125 169.308 1.00 42.98  ? 49  VAL C C   1 
ATOM   3249 O O   . VAL C 1 49  ? 32.177  30.322 169.150 1.00 46.86  ? 49  VAL C O   1 
ATOM   3250 C CB  . VAL C 1 49  ? 31.103  27.474 167.569 1.00 48.71  ? 49  VAL C CB  1 
ATOM   3251 C CG1 . VAL C 1 49  ? 29.944  28.466 167.483 1.00 58.06  ? 49  VAL C CG1 1 
ATOM   3252 C CG2 . VAL C 1 49  ? 31.457  27.007 166.164 1.00 59.16  ? 49  VAL C CG2 1 
ATOM   3253 N N   . LEU C 1 50  ? 31.452  28.622 170.435 1.00 47.61  ? 50  LEU C N   1 
ATOM   3254 C CA  . LEU C 1 50  ? 30.974  29.459 171.526 1.00 51.26  ? 50  LEU C CA  1 
ATOM   3255 C C   . LEU C 1 50  ? 31.941  30.479 172.123 1.00 54.11  ? 50  LEU C C   1 
ATOM   3256 O O   . LEU C 1 50  ? 31.521  31.534 172.630 1.00 69.00  ? 50  LEU C O   1 
ATOM   3257 C CB  . LEU C 1 50  ? 30.387  28.570 172.613 1.00 51.18  ? 50  LEU C CB  1 
ATOM   3258 C CG  . LEU C 1 50  ? 29.080  27.901 172.179 1.00 39.82  ? 50  LEU C CG  1 
ATOM   3259 C CD1 . LEU C 1 50  ? 28.471  27.193 173.359 1.00 53.21  ? 50  LEU C CD1 1 
ATOM   3260 C CD2 . LEU C 1 50  ? 28.118  28.965 171.658 1.00 42.42  ? 50  LEU C CD2 1 
ATOM   3261 N N   . LEU C 1 51  ? 33.232  30.196 172.028 1.00 49.22  ? 51  LEU C N   1 
ATOM   3262 C CA  . LEU C 1 51  ? 34.251  31.103 172.565 1.00 47.75  ? 51  LEU C CA  1 
ATOM   3263 C C   . LEU C 1 51  ? 34.490  32.382 171.736 1.00 49.55  ? 51  LEU C C   1 
ATOM   3264 O O   . LEU C 1 51  ? 35.097  33.334 172.227 1.00 47.28  ? 51  LEU C O   1 
ATOM   3265 C CB  . LEU C 1 51  ? 35.558  30.339 172.816 1.00 33.19  ? 51  LEU C CB  1 
ATOM   3266 C CG  . LEU C 1 51  ? 35.622  29.433 174.058 1.00 33.26  ? 51  LEU C CG  1 
ATOM   3267 C CD1 . LEU C 1 51  ? 34.276  28.798 174.366 1.00 32.93  ? 51  LEU C CD1 1 
ATOM   3268 C CD2 . LEU C 1 51  ? 36.669  28.360 173.874 1.00 11.40  ? 51  LEU C CD2 1 
ATOM   3269 N N   . GLY C 1 52  ? 33.960  32.426 170.511 1.00 59.08  ? 52  GLY C N   1 
ATOM   3270 C CA  . GLY C 1 52  ? 34.108  33.609 169.668 1.00 66.72  ? 52  GLY C CA  1 
ATOM   3271 C C   . GLY C 1 52  ? 33.490  34.788 170.393 1.00 69.40  ? 52  GLY C C   1 
ATOM   3272 O O   . GLY C 1 52  ? 33.823  35.958 170.166 1.00 76.16  ? 52  GLY C O   1 
ATOM   3273 N N   . HIS C 1 53  ? 32.615  34.425 171.328 1.00 65.27  ? 53  HIS C N   1 
ATOM   3274 C CA  . HIS C 1 53  ? 31.898  35.350 172.196 1.00 69.91  ? 53  HIS C CA  1 
ATOM   3275 C C   . HIS C 1 53  ? 32.808  35.747 173.365 1.00 71.49  ? 53  HIS C C   1 
ATOM   3276 O O   . HIS C 1 53  ? 33.210  36.924 173.471 1.00 70.30  ? 53  HIS C O   1 
ATOM   3277 C CB  . HIS C 1 53  ? 30.589  34.678 172.735 1.00 76.64  ? 53  HIS C CB  1 
ATOM   3278 N N   . SER C 1 54  ? 33.166  34.768 174.200 1.00 74.65  ? 54  SER C N   1 
ATOM   3279 C CA  . SER C 1 54  ? 34.011  35.009 175.368 1.00 79.82  ? 54  SER C CA  1 
ATOM   3280 C C   . SER C 1 54  ? 35.285  35.800 175.086 1.00 78.87  ? 54  SER C C   1 
ATOM   3281 O O   . SER C 1 54  ? 35.663  36.695 175.847 1.00 82.22  ? 54  SER C O   1 
ATOM   3282 C CB  . SER C 1 54  ? 34.379  33.680 176.032 1.00 77.82  ? 54  SER C CB  1 
ATOM   3283 O OG  . SER C 1 54  ? 33.221  33.002 176.483 1.00 88.02  ? 54  SER C OG  1 
ATOM   3284 N N   . LEU C 1 55  ? 35.940  35.469 173.985 1.00 74.56  ? 55  LEU C N   1 
ATOM   3285 C CA  . LEU C 1 55  ? 37.183  36.122 173.623 1.00 76.03  ? 55  LEU C CA  1 
ATOM   3286 C C   . LEU C 1 55  ? 37.010  37.362 172.772 1.00 79.74  ? 55  LEU C C   1 
ATOM   3287 O O   . LEU C 1 55  ? 37.965  38.111 172.565 1.00 88.43  ? 55  LEU C O   1 
ATOM   3288 C CB  . LEU C 1 55  ? 38.094  35.129 172.913 1.00 68.42  ? 55  LEU C CB  1 
ATOM   3289 C CG  . LEU C 1 55  ? 38.387  33.891 173.759 1.00 62.03  ? 55  LEU C CG  1 
ATOM   3290 C CD1 . LEU C 1 55  ? 39.216  32.899 172.971 1.00 48.99  ? 55  LEU C CD1 1 
ATOM   3291 C CD2 . LEU C 1 55  ? 39.084  34.301 175.045 1.00 64.50  ? 55  LEU C CD2 1 
ATOM   3292 N N   . GLY C 1 56  ? 35.802  37.575 172.268 1.00 77.20  ? 56  GLY C N   1 
ATOM   3293 C CA  . GLY C 1 56  ? 35.558  38.742 171.443 1.00 78.25  ? 56  GLY C CA  1 
ATOM   3294 C C   . GLY C 1 56  ? 36.296  38.717 170.115 1.00 73.80  ? 56  GLY C C   1 
ATOM   3295 O O   . GLY C 1 56  ? 37.069  39.629 169.791 1.00 69.53  ? 56  GLY C O   1 
ATOM   3296 N N   . ILE C 1 57  ? 36.071  37.655 169.352 1.00 71.30  ? 57  ILE C N   1 
ATOM   3297 C CA  . ILE C 1 57  ? 36.688  37.523 168.047 1.00 59.37  ? 57  ILE C CA  1 
ATOM   3298 C C   . ILE C 1 57  ? 35.623  37.763 167.004 1.00 60.63  ? 57  ILE C C   1 
ATOM   3299 O O   . ILE C 1 57  ? 34.631  37.019 166.896 1.00 58.31  ? 57  ILE C O   1 
ATOM   3300 C CB  . ILE C 1 57  ? 37.344  36.178 167.859 1.00 58.16  ? 57  ILE C CB  1 
ATOM   3301 C CG1 . ILE C 1 57  ? 38.505  36.075 168.844 1.00 64.61  ? 57  ILE C CG1 1 
ATOM   3302 C CG2 . ILE C 1 57  ? 37.829  36.030 166.424 1.00 58.25  ? 57  ILE C CG2 1 
ATOM   3303 C CD1 . ILE C 1 57  ? 39.225  34.770 168.803 1.00 77.64  ? 57  ILE C CD1 1 
ATOM   3304 N N   . PRO C 1 58  ? 35.786  38.865 166.266 1.00 58.62  ? 58  PRO C N   1 
ATOM   3305 C CA  . PRO C 1 58  ? 34.886  39.299 165.214 1.00 55.43  ? 58  PRO C CA  1 
ATOM   3306 C C   . PRO C 1 58  ? 35.057  38.538 163.930 1.00 59.05  ? 58  PRO C C   1 
ATOM   3307 O O   . PRO C 1 58  ? 36.040  37.821 163.719 1.00 65.39  ? 58  PRO C O   1 
ATOM   3308 C CB  . PRO C 1 58  ? 35.290  40.751 165.024 1.00 54.56  ? 58  PRO C CB  1 
ATOM   3309 C CG  . PRO C 1 58  ? 36.760  40.689 165.214 1.00 51.89  ? 58  PRO C CG  1 
ATOM   3310 C CD  . PRO C 1 58  ? 36.877  39.841 166.447 1.00 55.84  ? 58  PRO C CD  1 
ATOM   3311 N N   . TRP C 1 59  ? 34.044  38.683 163.095 1.00 62.37  ? 59  TRP C N   1 
ATOM   3312 C CA  . TRP C 1 59  ? 33.994  38.091 161.762 1.00 66.68  ? 59  TRP C CA  1 
ATOM   3313 C C   . TRP C 1 59  ? 34.248  39.320 160.845 1.00 75.14  ? 59  TRP C C   1 
ATOM   3314 O O   . TRP C 1 59  ? 33.640  40.410 161.043 1.00 70.55  ? 59  TRP C O   1 
ATOM   3315 C CB  . TRP C 1 59  ? 32.583  37.466 161.482 1.00 61.41  ? 59  TRP C CB  1 
ATOM   3316 N N   . ALA C 1 60  ? 35.218  39.199 159.935 1.00 83.54  ? 60  ALA C N   1 
ATOM   3317 C CA  . ALA C 1 60  ? 35.511  40.301 159.029 1.00 78.79  ? 60  ALA C CA  1 
ATOM   3318 C C   . ALA C 1 60  ? 34.353  40.324 158.067 1.00 79.96  ? 60  ALA C C   1 
ATOM   3319 O O   . ALA C 1 60  ? 33.934  39.278 157.558 1.00 73.42  ? 60  ALA C O   1 
ATOM   3320 C CB  . ALA C 1 60  ? 36.794  40.075 158.291 1.00 76.17  ? 60  ALA C CB  1 
ATOM   3321 N N   . PRO C 1 61  ? 33.754  41.503 157.888 1.00 84.43  ? 61  PRO C N   1 
ATOM   3322 C CA  . PRO C 1 61  ? 32.616  41.676 156.986 1.00 88.94  ? 61  PRO C CA  1 
ATOM   3323 C C   . PRO C 1 61  ? 33.013  41.868 155.520 1.00 96.30  ? 61  PRO C C   1 
ATOM   3324 O O   . PRO C 1 61  ? 34.028  42.503 155.211 1.00 102.77 ? 61  PRO C O   1 
ATOM   3325 C CB  . PRO C 1 61  ? 31.944  42.923 157.546 1.00 88.01  ? 61  PRO C CB  1 
ATOM   3326 C CG  . PRO C 1 61  ? 33.135  43.759 157.985 1.00 93.61  ? 61  PRO C CG  1 
ATOM   3327 C CD  . PRO C 1 61  ? 34.029  42.734 158.656 1.00 88.62  ? 61  PRO C CD  1 
ATOM   3328 N N   . LEU C 1 62  ? 32.225  41.278 154.627 1.00 101.52 ? 62  LEU C N   1 
ATOM   3329 C CA  . LEU C 1 62  ? 32.430  41.406 153.186 1.00 106.90 ? 62  LEU C CA  1 
ATOM   3330 C C   . LEU C 1 62  ? 31.015  41.579 152.629 1.00 115.69 ? 62  LEU C C   1 
ATOM   3331 O O   . LEU C 1 62  ? 30.383  40.620 152.169 1.00 117.56 ? 62  LEU C O   1 
ATOM   3332 C CB  . LEU C 1 62  ? 33.135  40.170 152.604 1.00 94.78  ? 62  LEU C CB  1 
ATOM   3333 C CG  . LEU C 1 62  ? 33.645  40.209 151.153 1.00 85.23  ? 62  LEU C CG  1 
ATOM   3334 C CD1 . LEU C 1 62  ? 34.462  41.461 150.845 1.00 80.01  ? 62  LEU C CD1 1 
ATOM   3335 C CD2 . LEU C 1 62  ? 34.498  38.987 150.917 1.00 83.96  ? 62  LEU C CD2 1 
ATOM   3336 N N   . SER C 1 63  ? 30.517  42.810 152.776 1.00 125.17 ? 63  SER C N   1 
ATOM   3337 C CA  . SER C 1 63  ? 29.177  43.243 152.365 1.00 135.37 ? 63  SER C CA  1 
ATOM   3338 C C   . SER C 1 63  ? 28.910  43.053 150.871 1.00 141.89 ? 63  SER C C   1 
ATOM   3339 O O   . SER C 1 63  ? 28.775  44.040 150.138 1.00 145.00 ? 63  SER C O   1 
ATOM   3340 C CB  . SER C 1 63  ? 28.986  44.726 152.756 1.00 135.43 ? 63  SER C CB  1 
ATOM   3341 O OG  . SER C 1 63  ? 27.662  45.206 152.545 1.00 133.72 ? 63  SER C OG  1 
ATOM   3342 N N   . SER C 1 64  ? 28.772  41.791 150.450 1.00 147.29 ? 64  SER C N   1 
ATOM   3343 C CA  . SER C 1 64  ? 28.525  41.427 149.051 1.00 146.28 ? 64  SER C CA  1 
ATOM   3344 C C   . SER C 1 64  ? 29.231  42.430 148.143 1.00 139.52 ? 64  SER C C   1 
ATOM   3345 O O   . SER C 1 64  ? 28.591  43.360 147.641 1.00 142.20 ? 64  SER C O   1 
ATOM   3346 C CB  . SER C 1 64  ? 27.011  41.420 148.738 1.00 150.84 ? 64  SER C CB  1 
ATOM   3347 O OG  . SER C 1 64  ? 26.289  40.471 149.512 1.00 151.61 ? 64  SER C OG  1 
ATOM   3348 N N   . CYS C 1 65  ? 30.525  42.252 147.890 1.00 127.23 ? 65  CYS C N   1 
ATOM   3349 C CA  . CYS C 1 65  ? 31.177  43.236 147.045 1.00 121.51 ? 65  CYS C CA  1 
ATOM   3350 C C   . CYS C 1 65  ? 31.356  43.006 145.540 1.00 121.72 ? 65  CYS C C   1 
ATOM   3351 O O   . CYS C 1 65  ? 32.407  43.328 144.981 1.00 125.05 ? 65  CYS C O   1 
ATOM   3352 C CB  . CYS C 1 65  ? 32.447  43.816 147.703 1.00 117.14 ? 65  CYS C CB  1 
ATOM   3353 S SG  . CYS C 1 65  ? 34.006  42.862 147.747 1.00 108.73 ? 65  CYS C SG  1 
ATOM   3354 N N   . PRO C 1 66  ? 30.334  42.450 144.855 1.00 117.30 ? 66  PRO C N   1 
ATOM   3355 C CA  . PRO C 1 66  ? 30.511  42.256 143.412 1.00 118.09 ? 66  PRO C CA  1 
ATOM   3356 C C   . PRO C 1 66  ? 30.716  43.610 142.690 1.00 118.48 ? 66  PRO C C   1 
ATOM   3357 O O   . PRO C 1 66  ? 31.556  43.726 141.791 1.00 121.39 ? 66  PRO C O   1 
ATOM   3358 C CB  . PRO C 1 66  ? 29.202  41.578 143.019 1.00 117.63 ? 66  PRO C CB  1 
ATOM   3359 C CG  . PRO C 1 66  ? 28.919  40.722 144.223 1.00 108.01 ? 66  PRO C CG  1 
ATOM   3360 C CD  . PRO C 1 66  ? 29.142  41.712 145.316 1.00 111.44 ? 66  PRO C CD  1 
ATOM   3361 N N   . SER C 1 67  ? 29.922  44.605 143.079 1.00 113.88 ? 67  SER C N   1 
ATOM   3362 C CA  . SER C 1 67  ? 29.996  45.968 142.547 1.00 111.51 ? 67  SER C CA  1 
ATOM   3363 C C   . SER C 1 67  ? 28.949  46.742 143.337 1.00 114.55 ? 67  SER C C   1 
ATOM   3364 O O   . SER C 1 67  ? 27.759  46.390 143.344 1.00 107.21 ? 67  SER C O   1 
ATOM   3365 C CB  . SER C 1 67  ? 29.715  46.038 141.038 1.00 102.32 ? 67  SER C CB  1 
ATOM   3366 O OG  . SER C 1 67  ? 30.233  47.242 140.478 1.00 91.98  ? 67  SER C OG  1 
ATOM   3367 N N   . GLN C 1 68  ? 29.433  47.748 144.061 1.00 114.28 ? 68  GLN C N   1 
ATOM   3368 C CA  . GLN C 1 68  ? 28.609  48.602 144.934 1.00 121.21 ? 68  GLN C CA  1 
ATOM   3369 C C   . GLN C 1 68  ? 28.503  50.098 144.445 1.00 123.31 ? 68  GLN C C   1 
ATOM   3370 O O   . GLN C 1 68  ? 28.660  50.412 143.218 1.00 127.24 ? 68  GLN C O   1 
ATOM   3371 C CB  . GLN C 1 68  ? 29.198  48.524 146.397 1.00 130.15 ? 68  GLN C CB  1 
ATOM   3372 N N   . ALA C 1 69  ? 28.265  51.009 145.395 1.00 134.80 ? 69  ALA C N   1 
ATOM   3373 C CA  . ALA C 1 69  ? 28.179  52.444 145.099 1.00 131.73 ? 69  ALA C CA  1 
ATOM   3374 C C   . ALA C 1 69  ? 29.493  52.835 144.428 1.00 130.30 ? 69  ALA C C   1 
ATOM   3375 O O   . ALA C 1 69  ? 29.636  53.935 143.876 1.00 125.47 ? 69  ALA C O   1 
ATOM   3376 C CB  . ALA C 1 69  ? 27.988  53.243 146.387 1.00 116.41 ? 69  ALA C CB  1 
ATOM   3377 N N   . LEU C 1 70  ? 30.457  51.920 144.523 1.00 118.01 ? 70  LEU C N   1 
ATOM   3378 C CA  . LEU C 1 70  ? 31.786  52.090 143.922 1.00 121.32 ? 70  LEU C CA  1 
ATOM   3379 C C   . LEU C 1 70  ? 32.070  51.044 142.792 1.00 114.13 ? 70  LEU C C   1 
ATOM   3380 O O   . LEU C 1 70  ? 31.870  49.809 143.010 1.00 112.44 ? 70  LEU C O   1 
ATOM   3381 C CB  . LEU C 1 70  ? 32.905  52.006 145.061 1.00 132.28 ? 70  LEU C CB  1 
ATOM   3382 N N   . GLN C 1 71  ? 32.505  51.541 141.609 1.00 104.85 ? 71  GLN C N   1 
ATOM   3383 C CA  . GLN C 1 71  ? 32.890  50.677 140.457 1.00 93.23  ? 71  GLN C CA  1 
ATOM   3384 C C   . GLN C 1 71  ? 34.288  50.044 140.798 1.00 89.78  ? 71  GLN C C   1 
ATOM   3385 O O   . GLN C 1 71  ? 35.288  50.251 140.053 1.00 79.30  ? 71  GLN C O   1 
ATOM   3386 C CB  . GLN C 1 71  ? 32.974  51.525 139.124 1.00 82.36  ? 71  GLN C CB  1 
ATOM   3387 N N   . LEU C 1 72  ? 34.327  49.324 141.934 1.00 93.73  ? 72  LEU C N   1 
ATOM   3388 C CA  . LEU C 1 72  ? 35.495  48.630 142.523 1.00 86.56  ? 72  LEU C CA  1 
ATOM   3389 C C   . LEU C 1 72  ? 36.273  49.324 143.657 1.00 83.04  ? 72  LEU C C   1 
ATOM   3390 O O   . LEU C 1 72  ? 36.835  48.644 144.527 1.00 70.92  ? 72  LEU C O   1 
ATOM   3391 C CB  . LEU C 1 72  ? 36.444  48.081 141.456 1.00 73.91  ? 72  LEU C CB  1 
ATOM   3392 C CG  . LEU C 1 72  ? 35.899  46.755 140.941 1.00 60.89  ? 72  LEU C CG  1 
ATOM   3393 C CD1 . LEU C 1 72  ? 36.658  46.309 139.719 1.00 58.93  ? 72  LEU C CD1 1 
ATOM   3394 C CD2 . LEU C 1 72  ? 35.961  45.727 142.063 1.00 55.21  ? 72  LEU C CD2 1 
ATOM   3395 N N   . ALA C 1 73  ? 36.252  50.659 143.677 1.00 82.92  ? 73  ALA C N   1 
ATOM   3396 C CA  . ALA C 1 73  ? 36.928  51.453 144.709 1.00 80.31  ? 73  ALA C CA  1 
ATOM   3397 C C   . ALA C 1 73  ? 36.649  50.856 146.083 1.00 80.81  ? 73  ALA C C   1 
ATOM   3398 O O   . ALA C 1 73  ? 37.560  50.662 146.884 1.00 80.94  ? 73  ALA C O   1 
ATOM   3399 C CB  . ALA C 1 73  ? 36.434  52.916 144.663 1.00 74.68  ? 73  ALA C CB  1 
ATOM   3400 N N   . GLY C 1 74  ? 35.389  50.470 146.283 1.00 83.86  ? 74  GLY C N   1 
ATOM   3401 C CA  . GLY C 1 74  ? 34.929  49.902 147.540 1.00 80.03  ? 74  GLY C CA  1 
ATOM   3402 C C   . GLY C 1 74  ? 35.172  48.430 147.854 1.00 76.22  ? 74  GLY C C   1 
ATOM   3403 O O   . GLY C 1 74  ? 35.532  48.111 148.991 1.00 80.12  ? 74  GLY C O   1 
ATOM   3404 N N   . CYS C 1 75  ? 34.931  47.525 146.904 1.00 64.71  ? 75  CYS C N   1 
ATOM   3405 C CA  . CYS C 1 75  ? 35.149  46.097 147.157 1.00 60.58  ? 75  CYS C CA  1 
ATOM   3406 C C   . CYS C 1 75  ? 36.578  45.849 147.635 1.00 51.62  ? 75  CYS C C   1 
ATOM   3407 O O   . CYS C 1 75  ? 36.801  45.135 148.615 1.00 55.28  ? 75  CYS C O   1 
ATOM   3408 C CB  . CYS C 1 75  ? 34.832  45.260 145.918 1.00 73.04  ? 75  CYS C CB  1 
ATOM   3409 S SG  . CYS C 1 75  ? 35.065  43.452 146.097 1.00 98.22  ? 75  CYS C SG  1 
ATOM   3410 N N   . LEU C 1 76  ? 37.545  46.468 146.969 1.00 40.13  ? 76  LEU C N   1 
ATOM   3411 C CA  . LEU C 1 76  ? 38.921  46.326 147.395 1.00 27.58  ? 76  LEU C CA  1 
ATOM   3412 C C   . LEU C 1 76  ? 39.025  46.920 148.787 1.00 26.61  ? 76  LEU C C   1 
ATOM   3413 O O   . LEU C 1 76  ? 39.675  46.352 149.649 1.00 38.81  ? 76  LEU C O   1 
ATOM   3414 C CB  . LEU C 1 76  ? 39.876  47.065 146.472 1.00 32.31  ? 76  LEU C CB  1 
ATOM   3415 C CG  . LEU C 1 76  ? 40.122  46.481 145.087 1.00 31.75  ? 76  LEU C CG  1 
ATOM   3416 C CD1 . LEU C 1 76  ? 41.379  47.119 144.554 1.00 31.66  ? 76  LEU C CD1 1 
ATOM   3417 C CD2 . LEU C 1 76  ? 40.318  44.991 145.160 1.00 21.63  ? 76  LEU C CD2 1 
ATOM   3418 N N   . SER C 1 77  ? 38.360  48.043 149.017 1.00 21.59  ? 77  SER C N   1 
ATOM   3419 C CA  . SER C 1 77  ? 38.395  48.680 150.322 1.00 29.72  ? 77  SER C CA  1 
ATOM   3420 C C   . SER C 1 77  ? 38.053  47.681 151.438 1.00 30.19  ? 77  SER C C   1 
ATOM   3421 O O   . SER C 1 77  ? 38.748  47.630 152.474 1.00 25.81  ? 77  SER C O   1 
ATOM   3422 C CB  . SER C 1 77  ? 37.442  49.880 150.348 1.00 40.75  ? 77  SER C CB  1 
ATOM   3423 O OG  . SER C 1 77  ? 37.490  50.569 151.589 1.00 72.98  ? 77  SER C OG  1 
ATOM   3424 N N   . GLN C 1 78  ? 37.036  46.849 151.199 1.00 29.50  ? 78  GLN C N   1 
ATOM   3425 C CA  . GLN C 1 78  ? 36.601  45.851 152.185 1.00 34.83  ? 78  GLN C CA  1 
ATOM   3426 C C   . GLN C 1 78  ? 37.575  44.711 152.345 1.00 31.50  ? 78  GLN C C   1 
ATOM   3427 O O   . GLN C 1 78  ? 37.879  44.282 153.465 1.00 42.01  ? 78  GLN C O   1 
ATOM   3428 C CB  . GLN C 1 78  ? 35.215  45.306 151.861 1.00 37.61  ? 78  GLN C CB  1 
ATOM   3429 C CG  . GLN C 1 78  ? 34.112  46.321 152.120 1.00 59.70  ? 78  GLN C CG  1 
ATOM   3430 C CD  . GLN C 1 78  ? 32.816  45.691 152.575 1.00 63.90  ? 78  GLN C CD  1 
ATOM   3431 O OE1 . GLN C 1 78  ? 32.044  45.181 151.763 1.00 71.96  ? 78  GLN C OE1 1 
ATOM   3432 N NE2 . GLN C 1 78  ? 32.561  45.734 153.879 1.00 60.80  ? 78  GLN C NE2 1 
ATOM   3433 N N   . LEU C 1 79  ? 38.061  44.217 151.220 1.00 24.84  ? 79  LEU C N   1 
ATOM   3434 C CA  . LEU C 1 79  ? 39.034  43.145 151.232 1.00 14.25  ? 79  LEU C CA  1 
ATOM   3435 C C   . LEU C 1 79  ? 40.186  43.633 152.087 1.00 11.77  ? 79  LEU C C   1 
ATOM   3436 O O   . LEU C 1 79  ? 40.635  42.931 152.976 1.00 16.01  ? 79  LEU C O   1 
ATOM   3437 C CB  . LEU C 1 79  ? 39.530  42.873 149.821 1.00 19.92  ? 79  LEU C CB  1 
ATOM   3438 C CG  . LEU C 1 79  ? 39.399  41.440 149.341 1.00 30.43  ? 79  LEU C CG  1 
ATOM   3439 C CD1 . LEU C 1 79  ? 39.800  41.403 147.892 1.00 38.96  ? 79  LEU C CD1 1 
ATOM   3440 C CD2 . LEU C 1 79  ? 40.263  40.508 150.186 1.00 24.51  ? 79  LEU C CD2 1 
ATOM   3441 N N   . HIS C 1 80  ? 40.627  44.866 151.864 1.00 7.48   ? 80  HIS C N   1 
ATOM   3442 C CA  . HIS C 1 80  ? 41.719  45.394 152.658 1.00 3.44   ? 80  HIS C CA  1 
ATOM   3443 C C   . HIS C 1 80  ? 41.380  45.497 154.135 1.00 11.53  ? 80  HIS C C   1 
ATOM   3444 O O   . HIS C 1 80  ? 42.224  45.187 154.956 1.00 23.00  ? 80  HIS C O   1 
ATOM   3445 C CB  . HIS C 1 80  ? 42.208  46.752 152.154 1.00 2.00   ? 80  HIS C CB  1 
ATOM   3446 C CG  . HIS C 1 80  ? 43.211  47.387 153.065 1.00 2.00   ? 80  HIS C CG  1 
ATOM   3447 N ND1 . HIS C 1 80  ? 42.851  48.059 154.211 1.00 17.56  ? 80  HIS C ND1 1 
ATOM   3448 C CD2 . HIS C 1 80  ? 44.562  47.359 153.060 1.00 2.28   ? 80  HIS C CD2 1 
ATOM   3449 C CE1 . HIS C 1 80  ? 43.935  48.412 154.876 1.00 18.34  ? 80  HIS C CE1 1 
ATOM   3450 N NE2 . HIS C 1 80  ? 44.988  47.999 154.199 1.00 8.29   ? 80  HIS C NE2 1 
ATOM   3451 N N   . SER C 1 81  ? 40.194  46.005 154.482 1.00 25.49  ? 81  SER C N   1 
ATOM   3452 C CA  . SER C 1 81  ? 39.796  46.129 155.896 1.00 25.99  ? 81  SER C CA  1 
ATOM   3453 C C   . SER C 1 81  ? 39.816  44.793 156.605 1.00 21.22  ? 81  SER C C   1 
ATOM   3454 O O   . SER C 1 81  ? 40.327  44.685 157.713 1.00 31.05  ? 81  SER C O   1 
ATOM   3455 C CB  . SER C 1 81  ? 38.411  46.741 156.027 1.00 18.15  ? 81  SER C CB  1 
ATOM   3456 O OG  . SER C 1 81  ? 38.485  48.127 155.769 1.00 58.54  ? 81  SER C OG  1 
ATOM   3457 N N   . GLY C 1 82  ? 39.266  43.780 155.947 1.00 18.57  ? 82  GLY C N   1 
ATOM   3458 C CA  . GLY C 1 82  ? 39.250  42.453 156.508 1.00 4.44   ? 82  GLY C CA  1 
ATOM   3459 C C   . GLY C 1 82  ? 40.661  41.976 156.768 1.00 14.67  ? 82  GLY C C   1 
ATOM   3460 O O   . GLY C 1 82  ? 41.017  41.713 157.904 1.00 28.00  ? 82  GLY C O   1 
ATOM   3461 N N   . LEU C 1 83  ? 41.478  41.894 155.726 1.00 19.12  ? 83  LEU C N   1 
ATOM   3462 C CA  . LEU C 1 83  ? 42.857  41.430 155.852 1.00 12.75  ? 83  LEU C CA  1 
ATOM   3463 C C   . LEU C 1 83  ? 43.566  42.197 156.939 1.00 12.32  ? 83  LEU C C   1 
ATOM   3464 O O   . LEU C 1 83  ? 44.353  41.649 157.722 1.00 13.95  ? 83  LEU C O   1 
ATOM   3465 C CB  . LEU C 1 83  ? 43.604  41.625 154.537 1.00 5.76   ? 83  LEU C CB  1 
ATOM   3466 C CG  . LEU C 1 83  ? 43.091  40.732 153.428 1.00 10.55  ? 83  LEU C CG  1 
ATOM   3467 C CD1 . LEU C 1 83  ? 43.824  41.069 152.178 1.00 13.78  ? 83  LEU C CD1 1 
ATOM   3468 C CD2 . LEU C 1 83  ? 43.277  39.281 153.817 1.00 5.99   ? 83  LEU C CD2 1 
ATOM   3469 N N   . PHE C 1 84  ? 43.235  43.469 157.018 1.00 4.98   ? 84  PHE C N   1 
ATOM   3470 C CA  . PHE C 1 84  ? 43.846  44.338 157.999 1.00 19.80  ? 84  PHE C CA  1 
ATOM   3471 C C   . PHE C 1 84  ? 43.479  43.916 159.406 1.00 14.63  ? 84  PHE C C   1 
ATOM   3472 O O   . PHE C 1 84  ? 44.302  43.946 160.319 1.00 29.43  ? 84  PHE C O   1 
ATOM   3473 C CB  . PHE C 1 84  ? 43.420  45.781 157.764 1.00 19.09  ? 84  PHE C CB  1 
ATOM   3474 C CG  . PHE C 1 84  ? 44.137  46.749 158.628 1.00 30.48  ? 84  PHE C CG  1 
ATOM   3475 C CD1 . PHE C 1 84  ? 45.529  46.702 158.734 1.00 37.58  ? 84  PHE C CD1 1 
ATOM   3476 C CD2 . PHE C 1 84  ? 43.433  47.687 159.365 1.00 35.43  ? 84  PHE C CD2 1 
ATOM   3477 C CE1 . PHE C 1 84  ? 46.207  47.571 159.563 1.00 35.54  ? 84  PHE C CE1 1 
ATOM   3478 C CE2 . PHE C 1 84  ? 44.105  48.563 160.198 1.00 35.14  ? 84  PHE C CE2 1 
ATOM   3479 C CZ  . PHE C 1 84  ? 45.494  48.505 160.298 1.00 30.88  ? 84  PHE C CZ  1 
ATOM   3480 N N   . LEU C 1 85  ? 42.235  43.513 159.569 1.00 13.28  ? 85  LEU C N   1 
ATOM   3481 C CA  . LEU C 1 85  ? 41.720  43.067 160.846 1.00 5.37   ? 85  LEU C CA  1 
ATOM   3482 C C   . LEU C 1 85  ? 42.373  41.772 161.297 1.00 18.80  ? 85  LEU C C   1 
ATOM   3483 O O   . LEU C 1 85  ? 42.783  41.633 162.451 1.00 24.49  ? 85  LEU C O   1 
ATOM   3484 C CB  . LEU C 1 85  ? 40.249  42.804 160.701 1.00 4.98   ? 85  LEU C CB  1 
ATOM   3485 C CG  . LEU C 1 85  ? 39.637  42.372 162.008 1.00 21.88  ? 85  LEU C CG  1 
ATOM   3486 C CD1 . LEU C 1 85  ? 39.791  43.531 162.987 1.00 20.02  ? 85  LEU C CD1 1 
ATOM   3487 C CD2 . LEU C 1 85  ? 38.183  42.000 161.783 1.00 4.67   ? 85  LEU C CD2 1 
ATOM   3488 N N   . TYR C 1 86  ? 42.408  40.789 160.405 1.00 19.68  ? 86  TYR C N   1 
ATOM   3489 C CA  . TYR C 1 86  ? 43.010  39.522 160.752 1.00 8.11   ? 86  TYR C CA  1 
ATOM   3490 C C   . TYR C 1 86  ? 44.486  39.733 160.990 1.00 12.87  ? 86  TYR C C   1 
ATOM   3491 O O   . TYR C 1 86  ? 45.101  39.010 161.767 1.00 22.86  ? 86  TYR C O   1 
ATOM   3492 C CB  . TYR C 1 86  ? 42.755  38.502 159.666 1.00 2.93   ? 86  TYR C CB  1 
ATOM   3493 C CG  . TYR C 1 86  ? 41.318  38.103 159.605 1.00 12.31  ? 86  TYR C CG  1 
ATOM   3494 C CD1 . TYR C 1 86  ? 40.711  37.476 160.678 1.00 14.13  ? 86  TYR C CD1 1 
ATOM   3495 C CD2 . TYR C 1 86  ? 40.555  38.384 158.493 1.00 17.49  ? 86  TYR C CD2 1 
ATOM   3496 C CE1 . TYR C 1 86  ? 39.388  37.149 160.649 1.00 12.56  ? 86  TYR C CE1 1 
ATOM   3497 C CE2 . TYR C 1 86  ? 39.228  38.051 158.449 1.00 18.99  ? 86  TYR C CE2 1 
ATOM   3498 C CZ  . TYR C 1 86  ? 38.643  37.435 159.537 1.00 18.93  ? 86  TYR C CZ  1 
ATOM   3499 O OH  . TYR C 1 86  ? 37.294  37.126 159.509 1.00 33.92  ? 86  TYR C OH  1 
ATOM   3500 N N   . GLN C 1 87  ? 45.046  40.760 160.362 1.00 17.18  ? 87  GLN C N   1 
ATOM   3501 C CA  . GLN C 1 87  ? 46.461  41.056 160.540 1.00 23.41  ? 87  GLN C CA  1 
ATOM   3502 C C   . GLN C 1 87  ? 46.654  41.379 162.000 1.00 19.51  ? 87  GLN C C   1 
ATOM   3503 O O   . GLN C 1 87  ? 47.641  40.987 162.608 1.00 37.01  ? 87  GLN C O   1 
ATOM   3504 C CB  . GLN C 1 87  ? 46.879  42.261 159.698 1.00 26.00  ? 87  GLN C CB  1 
ATOM   3505 C CG  . GLN C 1 87  ? 48.348  42.572 159.807 1.00 24.54  ? 87  GLN C CG  1 
ATOM   3506 C CD  . GLN C 1 87  ? 48.710  43.890 159.186 1.00 33.02  ? 87  GLN C CD  1 
ATOM   3507 O OE1 . GLN C 1 87  ? 49.387  44.710 159.807 1.00 59.63  ? 87  GLN C OE1 1 
ATOM   3508 N NE2 . GLN C 1 87  ? 48.274  44.107 157.955 1.00 32.94  ? 87  GLN C NE2 1 
ATOM   3509 N N   . GLY C 1 88  ? 45.673  42.070 162.556 1.00 13.71  ? 88  GLY C N   1 
ATOM   3510 C CA  . GLY C 1 88  ? 45.711  42.460 163.951 1.00 19.65  ? 88  GLY C CA  1 
ATOM   3511 C C   . GLY C 1 88  ? 45.375  41.329 164.891 1.00 21.74  ? 88  GLY C C   1 
ATOM   3512 O O   . GLY C 1 88  ? 46.089  41.094 165.856 1.00 24.19  ? 88  GLY C O   1 
ATOM   3513 N N   . LEU C 1 89  ? 44.290  40.623 164.620 1.00 15.66  ? 89  LEU C N   1 
ATOM   3514 C CA  . LEU C 1 89  ? 43.930  39.506 165.460 1.00 7.95   ? 89  LEU C CA  1 
ATOM   3515 C C   . LEU C 1 89  ? 45.112  38.559 165.581 1.00 14.39  ? 89  LEU C C   1 
ATOM   3516 O O   . LEU C 1 89  ? 45.483  38.192 166.682 1.00 26.94  ? 89  LEU C O   1 
ATOM   3517 C CB  . LEU C 1 89  ? 42.737  38.759 164.877 1.00 4.12   ? 89  LEU C CB  1 
ATOM   3518 C CG  . LEU C 1 89  ? 41.424  39.526 164.870 1.00 7.35   ? 89  LEU C CG  1 
ATOM   3519 C CD1 . LEU C 1 89  ? 40.312  38.661 164.357 1.00 2.00   ? 89  LEU C CD1 1 
ATOM   3520 C CD2 . LEU C 1 89  ? 41.131  39.952 166.265 1.00 8.42   ? 89  LEU C CD2 1 
ATOM   3521 N N   . LEU C 1 90  ? 45.742  38.210 164.462 1.00 16.35  ? 90  LEU C N   1 
ATOM   3522 C CA  . LEU C 1 90  ? 46.879  37.296 164.498 1.00 11.45  ? 90  LEU C CA  1 
ATOM   3523 C C   . LEU C 1 90  ? 48.020  37.876 165.331 1.00 9.74   ? 90  LEU C C   1 
ATOM   3524 O O   . LEU C 1 90  ? 48.776  37.127 165.942 1.00 22.57  ? 90  LEU C O   1 
ATOM   3525 C CB  . LEU C 1 90  ? 47.350  36.923 163.081 1.00 2.00   ? 90  LEU C CB  1 
ATOM   3526 C CG  . LEU C 1 90  ? 46.356  36.243 162.123 1.00 3.04   ? 90  LEU C CG  1 
ATOM   3527 C CD1 . LEU C 1 90  ? 46.878  36.291 160.701 1.00 9.85   ? 90  LEU C CD1 1 
ATOM   3528 C CD2 . LEU C 1 90  ? 46.109  34.822 162.530 1.00 6.66   ? 90  LEU C CD2 1 
ATOM   3529 N N   . GLN C 1 91  ? 48.140  39.201 165.383 1.00 10.18  ? 91  GLN C N   1 
ATOM   3530 C CA  . GLN C 1 91  ? 49.218  39.813 166.168 1.00 29.67  ? 91  GLN C CA  1 
ATOM   3531 C C   . GLN C 1 91  ? 48.910  39.729 167.655 1.00 33.14  ? 91  GLN C C   1 
ATOM   3532 O O   . GLN C 1 91  ? 49.812  39.569 168.472 1.00 44.25  ? 91  GLN C O   1 
ATOM   3533 C CB  . GLN C 1 91  ? 49.461  41.275 165.787 1.00 45.65  ? 91  GLN C CB  1 
ATOM   3534 C CG  . GLN C 1 91  ? 50.525  41.496 164.710 1.00 75.72  ? 91  GLN C CG  1 
ATOM   3535 C CD  . GLN C 1 91  ? 50.775  42.979 164.421 1.00 92.73  ? 91  GLN C CD  1 
ATOM   3536 O OE1 . GLN C 1 91  ? 51.216  43.727 165.299 1.00 99.43  ? 91  GLN C OE1 1 
ATOM   3537 N NE2 . GLN C 1 91  ? 50.495  43.406 163.187 1.00 95.79  ? 91  GLN C NE2 1 
ATOM   3538 N N   . ALA C 1 92  ? 47.627  39.792 167.996 1.00 35.67  ? 92  ALA C N   1 
ATOM   3539 C CA  . ALA C 1 92  ? 47.172  39.726 169.388 1.00 29.56  ? 92  ALA C CA  1 
ATOM   3540 C C   . ALA C 1 92  ? 47.417  38.373 170.038 1.00 29.29  ? 92  ALA C C   1 
ATOM   3541 O O   . ALA C 1 92  ? 47.482  38.274 171.264 1.00 41.00  ? 92  ALA C O   1 
ATOM   3542 C CB  . ALA C 1 92  ? 45.695  40.071 169.473 1.00 29.81  ? 92  ALA C CB  1 
ATOM   3543 N N   . LEU C 1 93  ? 47.520  37.332 169.216 1.00 21.89  ? 93  LEU C N   1 
ATOM   3544 C CA  . LEU C 1 93  ? 47.768  35.977 169.687 1.00 6.09   ? 93  LEU C CA  1 
ATOM   3545 C C   . LEU C 1 93  ? 49.187  35.842 170.180 1.00 12.86  ? 93  LEU C C   1 
ATOM   3546 O O   . LEU C 1 93  ? 49.634  34.740 170.437 1.00 15.59  ? 93  LEU C O   1 
ATOM   3547 C CB  . LEU C 1 93  ? 47.572  34.974 168.561 1.00 2.00   ? 93  LEU C CB  1 
ATOM   3548 C CG  . LEU C 1 93  ? 46.142  34.803 168.091 1.00 7.60   ? 93  LEU C CG  1 
ATOM   3549 C CD1 . LEU C 1 93  ? 46.051  33.839 166.945 1.00 2.40   ? 93  LEU C CD1 1 
ATOM   3550 C CD2 . LEU C 1 93  ? 45.337  34.282 169.241 1.00 26.53  ? 93  LEU C CD2 1 
ATOM   3551 N N   . GLU C 1 94  ? 49.912  36.953 170.213 1.00 14.59  ? 94  GLU C N   1 
ATOM   3552 C CA  . GLU C 1 94  ? 51.296  37.009 170.652 1.00 21.72  ? 94  GLU C CA  1 
ATOM   3553 C C   . GLU C 1 94  ? 52.092  35.712 170.435 1.00 15.18  ? 94  GLU C C   1 
ATOM   3554 O O   . GLU C 1 94  ? 52.738  35.207 171.340 1.00 32.11  ? 94  GLU C O   1 
ATOM   3555 C CB  . GLU C 1 94  ? 51.357  37.530 172.096 1.00 40.42  ? 94  GLU C CB  1 
ATOM   3556 C CG  . GLU C 1 94  ? 50.864  39.002 172.263 1.00 66.86  ? 94  GLU C CG  1 
ATOM   3557 C CD  . GLU C 1 94  ? 50.017  39.261 173.532 1.00 87.53  ? 94  GLU C CD  1 
ATOM   3558 O OE1 . GLU C 1 94  ? 49.056  40.068 173.463 1.00 83.40  ? 94  GLU C OE1 1 
ATOM   3559 O OE2 . GLU C 1 94  ? 50.312  38.675 174.598 1.00 102.30 ? 94  GLU C OE2 1 
ATOM   3560 N N   . GLY C 1 95  ? 52.010  35.174 169.221 1.00 15.54  ? 95  GLY C N   1 
ATOM   3561 C CA  . GLY C 1 95  ? 52.731  33.963 168.847 1.00 10.79  ? 95  GLY C CA  1 
ATOM   3562 C C   . GLY C 1 95  ? 52.140  32.622 169.259 1.00 19.04  ? 95  GLY C C   1 
ATOM   3563 O O   . GLY C 1 95  ? 52.579  31.575 168.775 1.00 17.08  ? 95  GLY C O   1 
ATOM   3564 N N   . ILE C 1 96  ? 51.136  32.655 170.131 1.00 15.51  ? 96  ILE C N   1 
ATOM   3565 C CA  . ILE C 1 96  ? 50.485  31.466 170.678 1.00 13.74  ? 96  ILE C CA  1 
ATOM   3566 C C   . ILE C 1 96  ? 51.392  30.699 171.661 1.00 16.06  ? 96  ILE C C   1 
ATOM   3567 O O   . ILE C 1 96  ? 51.066  30.559 172.839 1.00 35.34  ? 96  ILE C O   1 
ATOM   3568 C CB  . ILE C 1 96  ? 49.959  30.550 169.603 1.00 4.36   ? 96  ILE C CB  1 
ATOM   3569 C CG1 . ILE C 1 96  ? 48.937  31.310 168.760 1.00 14.38  ? 96  ILE C CG1 1 
ATOM   3570 C CG2 . ILE C 1 96  ? 49.306  29.344 170.249 1.00 19.46  ? 96  ILE C CG2 1 
ATOM   3571 C CD1 . ILE C 1 96  ? 48.190  30.457 167.734 1.00 5.18   ? 96  ILE C CD1 1 
ATOM   3572 N N   . SER C 1 97  ? 52.529  30.215 171.187 1.00 19.21  ? 97  SER C N   1 
ATOM   3573 C CA  . SER C 1 97  ? 53.481  29.514 172.034 1.00 18.12  ? 97  SER C CA  1 
ATOM   3574 C C   . SER C 1 97  ? 54.690  29.245 171.181 1.00 27.03  ? 97  SER C C   1 
ATOM   3575 O O   . SER C 1 97  ? 54.621  29.301 169.963 1.00 35.89  ? 97  SER C O   1 
ATOM   3576 C CB  . SER C 1 97  ? 52.914  28.194 172.516 1.00 24.16  ? 97  SER C CB  1 
ATOM   3577 O OG  . SER C 1 97  ? 52.945  27.253 171.475 1.00 16.86  ? 97  SER C OG  1 
ATOM   3578 N N   . PRO C 1 98  ? 55.821  28.947 171.808 1.00 31.32  ? 98  PRO C N   1 
ATOM   3579 C CA  . PRO C 1 98  ? 57.064  28.666 171.088 1.00 25.50  ? 98  PRO C CA  1 
ATOM   3580 C C   . PRO C 1 98  ? 56.958  27.630 169.976 1.00 25.30  ? 98  PRO C C   1 
ATOM   3581 O O   . PRO C 1 98  ? 57.593  27.764 168.939 1.00 33.22  ? 98  PRO C O   1 
ATOM   3582 C CB  . PRO C 1 98  ? 57.974  28.223 172.204 1.00 19.42  ? 98  PRO C CB  1 
ATOM   3583 C CG  . PRO C 1 98  ? 57.561  29.177 173.301 1.00 22.85  ? 98  PRO C CG  1 
ATOM   3584 C CD  . PRO C 1 98  ? 56.069  29.059 173.254 1.00 27.34  ? 98  PRO C CD  1 
ATOM   3585 N N   . GLU C 1 99  ? 56.149  26.604 170.178 1.00 29.21  ? 99  GLU C N   1 
ATOM   3586 C CA  . GLU C 1 99  ? 55.988  25.573 169.160 1.00 37.82  ? 99  GLU C CA  1 
ATOM   3587 C C   . GLU C 1 99  ? 55.309  26.130 167.903 1.00 31.34  ? 99  GLU C C   1 
ATOM   3588 O O   . GLU C 1 99  ? 55.588  25.705 166.786 1.00 44.97  ? 99  GLU C O   1 
ATOM   3589 C CB  . GLU C 1 99  ? 55.146  24.421 169.716 1.00 56.72  ? 99  GLU C CB  1 
ATOM   3590 C CG  . GLU C 1 99  ? 55.715  23.726 170.945 1.00 96.89  ? 99  GLU C CG  1 
ATOM   3591 C CD  . GLU C 1 99  ? 56.782  22.702 170.602 1.00 120.73 ? 99  GLU C CD  1 
ATOM   3592 O OE1 . GLU C 1 99  ? 56.511  21.802 169.771 1.00 130.44 ? 99  GLU C OE1 1 
ATOM   3593 O OE2 . GLU C 1 99  ? 57.891  22.793 171.175 1.00 131.47 ? 99  GLU C OE2 1 
ATOM   3594 N N   . LEU C 1 100 ? 54.417  27.088 168.095 1.00 23.62  ? 100 LEU C N   1 
ATOM   3595 C CA  . LEU C 1 100 ? 53.671  27.669 166.994 1.00 21.66  ? 100 LEU C CA  1 
ATOM   3596 C C   . LEU C 1 100 ? 54.123  28.993 166.401 1.00 20.83  ? 100 LEU C C   1 
ATOM   3597 O O   . LEU C 1 100 ? 53.787  29.314 165.260 1.00 29.44  ? 100 LEU C O   1 
ATOM   3598 C CB  . LEU C 1 100 ? 52.202  27.746 167.355 1.00 6.35   ? 100 LEU C CB  1 
ATOM   3599 C CG  . LEU C 1 100 ? 51.553  26.448 166.940 1.00 8.68   ? 100 LEU C CG  1 
ATOM   3600 C CD1 . LEU C 1 100 ? 51.784  25.444 167.992 1.00 3.15   ? 100 LEU C CD1 1 
ATOM   3601 C CD2 . LEU C 1 100 ? 50.099  26.657 166.713 1.00 27.12  ? 100 LEU C CD2 1 
ATOM   3602 N N   . GLY C 1 101 ? 54.888  29.752 167.164 1.00 20.83  ? 101 GLY C N   1 
ATOM   3603 C CA  . GLY C 1 101 ? 55.385  31.032 166.697 1.00 30.70  ? 101 GLY C CA  1 
ATOM   3604 C C   . GLY C 1 101 ? 55.794  31.069 165.237 1.00 25.79  ? 101 GLY C C   1 
ATOM   3605 O O   . GLY C 1 101 ? 55.370  31.970 164.513 1.00 29.04  ? 101 GLY C O   1 
ATOM   3606 N N   . PRO C 1 102 ? 56.625  30.123 164.776 1.00 19.79  ? 102 PRO C N   1 
ATOM   3607 C CA  . PRO C 1 102 ? 57.061  30.090 163.386 1.00 14.68  ? 102 PRO C CA  1 
ATOM   3608 C C   . PRO C 1 102 ? 55.904  29.994 162.426 1.00 14.64  ? 102 PRO C C   1 
ATOM   3609 O O   . PRO C 1 102 ? 55.725  30.858 161.569 1.00 25.92  ? 102 PRO C O   1 
ATOM   3610 C CB  . PRO C 1 102 ? 57.918  28.841 163.343 1.00 18.20  ? 102 PRO C CB  1 
ATOM   3611 C CG  . PRO C 1 102 ? 58.559  28.860 164.661 1.00 6.81   ? 102 PRO C CG  1 
ATOM   3612 C CD  . PRO C 1 102 ? 57.375  29.123 165.554 1.00 22.94  ? 102 PRO C CD  1 
ATOM   3613 N N   . THR C 1 103 ? 55.095  28.964 162.595 1.00 11.79  ? 103 THR C N   1 
ATOM   3614 C CA  . THR C 1 103 ? 53.946  28.765 161.718 1.00 10.86  ? 103 THR C CA  1 
ATOM   3615 C C   . THR C 1 103 ? 52.989  29.964 161.684 1.00 9.48   ? 103 THR C C   1 
ATOM   3616 O O   . THR C 1 103 ? 52.479  30.337 160.636 1.00 13.57  ? 103 THR C O   1 
ATOM   3617 C CB  . THR C 1 103 ? 53.180  27.514 162.109 1.00 7.30   ? 103 THR C CB  1 
ATOM   3618 O OG1 . THR C 1 103 ? 54.084  26.408 162.199 1.00 29.49  ? 103 THR C OG1 1 
ATOM   3619 C CG2 . THR C 1 103 ? 52.123  27.206 161.097 1.00 26.85  ? 103 THR C CG2 1 
ATOM   3620 N N   . LEU C 1 104 ? 52.771  30.592 162.821 1.00 7.56   ? 104 LEU C N   1 
ATOM   3621 C CA  . LEU C 1 104 ? 51.881  31.732 162.864 1.00 2.13   ? 104 LEU C CA  1 
ATOM   3622 C C   . LEU C 1 104 ? 52.528  32.948 162.227 1.00 8.30   ? 104 LEU C C   1 
ATOM   3623 O O   . LEU C 1 104 ? 51.885  33.663 161.478 1.00 20.48  ? 104 LEU C O   1 
ATOM   3624 C CB  . LEU C 1 104 ? 51.495  32.025 164.309 1.00 2.00   ? 104 LEU C CB  1 
ATOM   3625 C CG  . LEU C 1 104 ? 50.609  33.228 164.565 1.00 2.00   ? 104 LEU C CG  1 
ATOM   3626 C CD1 . LEU C 1 104 ? 49.270  32.961 163.944 1.00 13.22  ? 104 LEU C CD1 1 
ATOM   3627 C CD2 . LEU C 1 104 ? 50.472  33.508 166.041 1.00 7.42   ? 104 LEU C CD2 1 
ATOM   3628 N N   . ASP C 1 105 ? 53.810  33.159 162.488 1.00 17.98  ? 105 ASP C N   1 
ATOM   3629 C CA  . ASP C 1 105 ? 54.519  34.301 161.933 1.00 18.89  ? 105 ASP C CA  1 
ATOM   3630 C C   . ASP C 1 105 ? 54.436  34.279 160.412 1.00 20.17  ? 105 ASP C C   1 
ATOM   3631 O O   . ASP C 1 105 ? 54.277  35.315 159.767 1.00 17.22  ? 105 ASP C O   1 
ATOM   3632 C CB  . ASP C 1 105 ? 55.976  34.289 162.383 1.00 29.92  ? 105 ASP C CB  1 
ATOM   3633 C CG  . ASP C 1 105 ? 56.670  35.615 162.150 1.00 62.55  ? 105 ASP C CG  1 
ATOM   3634 O OD1 . ASP C 1 105 ? 56.209  36.641 162.699 1.00 70.88  ? 105 ASP C OD1 1 
ATOM   3635 O OD2 . ASP C 1 105 ? 57.686  35.633 161.424 1.00 76.41  ? 105 ASP C OD2 1 
ATOM   3636 N N   . THR C 1 106 ? 54.525  33.095 159.829 1.00 16.59  ? 106 THR C N   1 
ATOM   3637 C CA  . THR C 1 106 ? 54.432  32.993 158.386 1.00 7.81   ? 106 THR C CA  1 
ATOM   3638 C C   . THR C 1 106 ? 53.069  33.469 157.959 1.00 5.01   ? 106 THR C C   1 
ATOM   3639 O O   . THR C 1 106 ? 52.962  34.331 157.121 1.00 12.31  ? 106 THR C O   1 
ATOM   3640 C CB  . THR C 1 106 ? 54.634  31.571 157.917 1.00 7.78   ? 106 THR C CB  1 
ATOM   3641 O OG1 . THR C 1 106 ? 55.991  31.182 158.157 1.00 27.20  ? 106 THR C OG1 1 
ATOM   3642 C CG2 . THR C 1 106 ? 54.324  31.453 156.462 1.00 8.41   ? 106 THR C CG2 1 
ATOM   3643 N N   . LEU C 1 107 ? 52.024  32.933 158.561 1.00 5.97   ? 107 LEU C N   1 
ATOM   3644 C CA  . LEU C 1 107 ? 50.680  33.344 158.216 1.00 2.00   ? 107 LEU C CA  1 
ATOM   3645 C C   . LEU C 1 107 ? 50.480  34.825 158.376 1.00 2.00   ? 107 LEU C C   1 
ATOM   3646 O O   . LEU C 1 107 ? 49.854  35.437 157.549 1.00 14.00  ? 107 LEU C O   1 
ATOM   3647 C CB  . LEU C 1 107 ? 49.665  32.648 159.087 1.00 2.00   ? 107 LEU C CB  1 
ATOM   3648 C CG  . LEU C 1 107 ? 48.254  33.147 158.852 1.00 2.00   ? 107 LEU C CG  1 
ATOM   3649 C CD1 . LEU C 1 107 ? 47.910  33.104 157.372 1.00 5.30   ? 107 LEU C CD1 1 
ATOM   3650 C CD2 . LEU C 1 107 ? 47.302  32.285 159.644 1.00 11.46  ? 107 LEU C CD2 1 
ATOM   3651 N N   . GLN C 1 108 ? 51.014  35.397 159.442 1.00 5.05   ? 108 GLN C N   1 
ATOM   3652 C CA  . GLN C 1 108 ? 50.885  36.831 159.745 1.00 7.64   ? 108 GLN C CA  1 
ATOM   3653 C C   . GLN C 1 108 ? 51.578  37.705 158.675 1.00 11.01  ? 108 GLN C C   1 
ATOM   3654 O O   . GLN C 1 108 ? 51.001  38.678 158.177 1.00 14.74  ? 108 GLN C O   1 
ATOM   3655 C CB  . GLN C 1 108 ? 51.503  37.083 161.129 1.00 2.00   ? 108 GLN C CB  1 
ATOM   3656 C CG  . GLN C 1 108 ? 51.172  38.341 161.913 1.00 23.76  ? 108 GLN C CG  1 
ATOM   3657 C CD  . GLN C 1 108 ? 51.371  39.679 161.192 1.00 46.10  ? 108 GLN C CD  1 
ATOM   3658 O OE1 . GLN C 1 108 ? 52.475  40.033 160.761 1.00 63.30  ? 108 GLN C OE1 1 
ATOM   3659 N NE2 . GLN C 1 108 ? 50.301  40.469 161.140 1.00 37.11  ? 108 GLN C NE2 1 
ATOM   3660 N N   . LEU C 1 109 ? 52.813  37.376 158.331 1.00 6.86   ? 109 LEU C N   1 
ATOM   3661 C CA  . LEU C 1 109 ? 53.534  38.145 157.330 1.00 2.92   ? 109 LEU C CA  1 
ATOM   3662 C C   . LEU C 1 109 ? 52.808  38.115 155.990 1.00 7.14   ? 109 LEU C C   1 
ATOM   3663 O O   . LEU C 1 109 ? 52.582  39.151 155.358 1.00 22.53  ? 109 LEU C O   1 
ATOM   3664 C CB  . LEU C 1 109 ? 54.954  37.595 157.177 1.00 9.95   ? 109 LEU C CB  1 
ATOM   3665 C CG  . LEU C 1 109 ? 55.908  37.953 158.320 1.00 9.74   ? 109 LEU C CG  1 
ATOM   3666 C CD1 . LEU C 1 109 ? 57.163  37.178 158.149 1.00 15.22  ? 109 LEU C CD1 1 
ATOM   3667 C CD2 . LEU C 1 109 ? 56.199  39.458 158.312 1.00 16.37  ? 109 LEU C CD2 1 
ATOM   3668 N N   . ASP C 1 110 ? 52.403  36.922 155.579 1.00 3.49   ? 110 ASP C N   1 
ATOM   3669 C CA  . ASP C 1 110 ? 51.688  36.754 154.329 1.00 4.69   ? 110 ASP C CA  1 
ATOM   3670 C C   . ASP C 1 110 ? 50.394  37.557 154.311 1.00 3.37   ? 110 ASP C C   1 
ATOM   3671 O O   . ASP C 1 110 ? 50.039  38.109 153.287 1.00 16.18  ? 110 ASP C O   1 
ATOM   3672 C CB  . ASP C 1 110 ? 51.475  35.263 154.009 1.00 2.00   ? 110 ASP C CB  1 
ATOM   3673 C CG  . ASP C 1 110 ? 52.771  34.578 153.514 1.00 15.41  ? 110 ASP C CG  1 
ATOM   3674 O OD1 . ASP C 1 110 ? 53.470  35.145 152.652 1.00 38.84  ? 110 ASP C OD1 1 
ATOM   3675 O OD2 . ASP C 1 110 ? 53.118  33.477 153.969 1.00 26.53  ? 110 ASP C OD2 1 
ATOM   3676 N N   . VAL C 1 111 ? 49.738  37.704 155.453 1.00 10.56  ? 111 VAL C N   1 
ATOM   3677 C CA  . VAL C 1 111 ? 48.507  38.487 155.511 1.00 5.23   ? 111 VAL C CA  1 
ATOM   3678 C C   . VAL C 1 111 ? 48.844  39.970 155.474 1.00 6.18   ? 111 VAL C C   1 
ATOM   3679 O O   . VAL C 1 111 ? 48.188  40.751 154.818 1.00 6.98   ? 111 VAL C O   1 
ATOM   3680 C CB  . VAL C 1 111 ? 47.705  38.217 156.787 1.00 2.14   ? 111 VAL C CB  1 
ATOM   3681 C CG1 . VAL C 1 111 ? 46.601  39.234 156.907 1.00 3.60   ? 111 VAL C CG1 1 
ATOM   3682 C CG2 . VAL C 1 111 ? 47.095  36.812 156.768 1.00 10.64  ? 111 VAL C CG2 1 
ATOM   3683 N N   . ALA C 1 112 ? 49.893  40.358 156.169 1.00 6.02   ? 112 ALA C N   1 
ATOM   3684 C CA  . ALA C 1 112 ? 50.281  41.751 156.187 1.00 7.01   ? 112 ALA C CA  1 
ATOM   3685 C C   . ALA C 1 112 ? 50.587  42.264 154.786 1.00 13.64  ? 112 ALA C C   1 
ATOM   3686 O O   . ALA C 1 112 ? 50.089  43.305 154.366 1.00 26.24  ? 112 ALA C O   1 
ATOM   3687 C CB  . ALA C 1 112 ? 51.474  41.931 157.077 1.00 10.81  ? 112 ALA C CB  1 
ATOM   3688 N N   . ASP C 1 113 ? 51.395  41.514 154.059 1.00 4.68   ? 113 ASP C N   1 
ATOM   3689 C CA  . ASP C 1 113 ? 51.795  41.892 152.715 1.00 8.17   ? 113 ASP C CA  1 
ATOM   3690 C C   . ASP C 1 113 ? 50.631  41.962 151.760 1.00 10.40  ? 113 ASP C C   1 
ATOM   3691 O O   . ASP C 1 113 ? 50.585  42.811 150.892 1.00 19.46  ? 113 ASP C O   1 
ATOM   3692 C CB  . ASP C 1 113 ? 52.803  40.882 152.162 1.00 14.52  ? 113 ASP C CB  1 
ATOM   3693 C CG  . ASP C 1 113 ? 54.120  40.906 152.899 1.00 24.04  ? 113 ASP C CG  1 
ATOM   3694 O OD1 . ASP C 1 113 ? 54.203  41.510 153.983 1.00 40.09  ? 113 ASP C OD1 1 
ATOM   3695 O OD2 . ASP C 1 113 ? 55.086  40.318 152.389 1.00 24.64  ? 113 ASP C OD2 1 
ATOM   3696 N N   . PHE C 1 114 ? 49.723  41.013 151.867 1.00 11.79  ? 114 PHE C N   1 
ATOM   3697 C CA  . PHE C 1 114 ? 48.581  41.008 150.988 1.00 2.28   ? 114 PHE C CA  1 
ATOM   3698 C C   . PHE C 1 114 ? 47.770  42.258 151.238 1.00 7.52   ? 114 PHE C C   1 
ATOM   3699 O O   . PHE C 1 114 ? 47.243  42.864 150.320 1.00 15.03  ? 114 PHE C O   1 
ATOM   3700 C CB  . PHE C 1 114 ? 47.726  39.795 151.236 1.00 2.00   ? 114 PHE C CB  1 
ATOM   3701 C CG  . PHE C 1 114 ? 46.640  39.654 150.271 1.00 2.00   ? 114 PHE C CG  1 
ATOM   3702 C CD1 . PHE C 1 114 ? 46.653  40.376 149.081 1.00 2.00   ? 114 PHE C CD1 1 
ATOM   3703 C CD2 . PHE C 1 114 ? 45.580  38.820 150.531 1.00 5.07   ? 114 PHE C CD2 1 
ATOM   3704 C CE1 . PHE C 1 114 ? 45.623  40.275 148.164 1.00 2.00   ? 114 PHE C CE1 1 
ATOM   3705 C CE2 . PHE C 1 114 ? 44.535  38.704 149.618 1.00 2.00   ? 114 PHE C CE2 1 
ATOM   3706 C CZ  . PHE C 1 114 ? 44.558  39.436 148.438 1.00 7.72   ? 114 PHE C CZ  1 
ATOM   3707 N N   . ALA C 1 115 ? 47.644  42.641 152.490 1.00 10.11  ? 115 ALA C N   1 
ATOM   3708 C CA  . ALA C 1 115 ? 46.903  43.848 152.810 1.00 10.33  ? 115 ALA C CA  1 
ATOM   3709 C C   . ALA C 1 115 ? 47.644  45.052 152.227 1.00 15.85  ? 115 ALA C C   1 
ATOM   3710 O O   . ALA C 1 115 ? 47.036  45.928 151.627 1.00 27.89  ? 115 ALA C O   1 
ATOM   3711 C CB  . ALA C 1 115 ? 46.765  43.994 154.300 1.00 9.28   ? 115 ALA C CB  1 
ATOM   3712 N N   . THR C 1 116 ? 48.963  45.081 152.390 1.00 14.87  ? 116 THR C N   1 
ATOM   3713 C CA  . THR C 1 116 ? 49.813  46.160 151.875 1.00 2.00   ? 116 THR C CA  1 
ATOM   3714 C C   . THR C 1 116 ? 49.700  46.310 150.361 1.00 2.00   ? 116 THR C C   1 
ATOM   3715 O O   . THR C 1 116 ? 49.486  47.378 149.831 1.00 12.12  ? 116 THR C O   1 
ATOM   3716 C CB  . THR C 1 116 ? 51.237  45.849 152.199 1.00 2.00   ? 116 THR C CB  1 
ATOM   3717 O OG1 . THR C 1 116 ? 51.399  45.776 153.625 1.00 18.66  ? 116 THR C OG1 1 
ATOM   3718 C CG2 . THR C 1 116 ? 52.115  46.876 151.618 1.00 7.39   ? 116 THR C CG2 1 
ATOM   3719 N N   . THR C 1 117 ? 49.920  45.209 149.680 1.00 7.43   ? 117 THR C N   1 
ATOM   3720 C CA  . THR C 1 117 ? 49.804  45.092 148.244 1.00 2.00   ? 117 THR C CA  1 
ATOM   3721 C C   . THR C 1 117 ? 48.484  45.696 147.754 1.00 2.00   ? 117 THR C C   1 
ATOM   3722 O O   . THR C 1 117 ? 48.481  46.467 146.802 1.00 19.66  ? 117 THR C O   1 
ATOM   3723 C CB  . THR C 1 117 ? 49.906  43.567 147.896 1.00 9.36   ? 117 THR C CB  1 
ATOM   3724 O OG1 . THR C 1 117 ? 51.280  43.163 147.971 1.00 27.58  ? 117 THR C OG1 1 
ATOM   3725 C CG2 . THR C 1 117 ? 49.251  43.177 146.544 1.00 2.00   ? 117 THR C CG2 1 
ATOM   3726 N N   . ILE C 1 118 ? 47.368  45.363 148.403 1.00 9.24   ? 118 ILE C N   1 
ATOM   3727 C CA  . ILE C 1 118 ? 46.051  45.874 147.994 1.00 2.78   ? 118 ILE C CA  1 
ATOM   3728 C C   . ILE C 1 118 ? 45.977  47.362 148.210 1.00 9.63   ? 118 ILE C C   1 
ATOM   3729 O O   . ILE C 1 118 ? 45.466  48.089 147.370 1.00 12.89  ? 118 ILE C O   1 
ATOM   3730 C CB  . ILE C 1 118 ? 44.898  45.243 148.774 1.00 2.00   ? 118 ILE C CB  1 
ATOM   3731 C CG1 . ILE C 1 118 ? 44.815  43.754 148.494 1.00 2.22   ? 118 ILE C CG1 1 
ATOM   3732 C CG2 . ILE C 1 118 ? 43.597  45.873 148.376 1.00 2.00   ? 118 ILE C CG2 1 
ATOM   3733 C CD1 . ILE C 1 118 ? 43.443  43.173 148.831 1.00 16.14  ? 118 ILE C CD1 1 
ATOM   3734 N N   . TRP C 1 119 ? 46.519  47.819 149.325 1.00 9.14   ? 119 TRP C N   1 
ATOM   3735 C CA  . TRP C 1 119 ? 46.502  49.234 149.630 1.00 10.18  ? 119 TRP C CA  1 
ATOM   3736 C C   . TRP C 1 119 ? 47.223  50.015 148.555 1.00 12.76  ? 119 TRP C C   1 
ATOM   3737 O O   . TRP C 1 119 ? 46.668  50.926 147.950 1.00 34.83  ? 119 TRP C O   1 
ATOM   3738 C CB  . TRP C 1 119 ? 47.170  49.490 150.964 1.00 10.85  ? 119 TRP C CB  1 
ATOM   3739 C CG  . TRP C 1 119 ? 47.074  50.877 151.352 1.00 8.82   ? 119 TRP C CG  1 
ATOM   3740 C CD1 . TRP C 1 119 ? 48.062  51.796 151.325 1.00 19.08  ? 119 TRP C CD1 1 
ATOM   3741 C CD2 . TRP C 1 119 ? 45.893  51.553 151.781 1.00 11.53  ? 119 TRP C CD2 1 
ATOM   3742 N NE1 . TRP C 1 119 ? 47.572  53.015 151.701 1.00 22.99  ? 119 TRP C NE1 1 
ATOM   3743 C CE2 . TRP C 1 119 ? 46.239  52.892 151.991 1.00 13.48  ? 119 TRP C CE2 1 
ATOM   3744 C CE3 . TRP C 1 119 ? 44.568  51.149 152.016 1.00 14.22  ? 119 TRP C CE3 1 
ATOM   3745 C CZ2 . TRP C 1 119 ? 45.310  53.847 152.427 1.00 26.63  ? 119 TRP C CZ2 1 
ATOM   3746 C CZ3 . TRP C 1 119 ? 43.645  52.097 152.452 1.00 13.39  ? 119 TRP C CZ3 1 
ATOM   3747 C CH2 . TRP C 1 119 ? 44.023  53.431 152.652 1.00 17.32  ? 119 TRP C CH2 1 
ATOM   3748 N N   . GLN C 1 120 ? 48.459  49.632 148.291 1.00 11.47  ? 120 GLN C N   1 
ATOM   3749 C CA  . GLN C 1 120 ? 49.276  50.298 147.279 1.00 12.84  ? 120 GLN C CA  1 
ATOM   3750 C C   . GLN C 1 120 ? 48.672  50.293 145.896 1.00 9.36   ? 120 GLN C C   1 
ATOM   3751 O O   . GLN C 1 120 ? 48.860  51.235 145.154 1.00 18.14  ? 120 GLN C O   1 
ATOM   3752 C CB  . GLN C 1 120 ? 50.663  49.680 147.233 1.00 3.60   ? 120 GLN C CB  1 
ATOM   3753 C CG  . GLN C 1 120 ? 51.293  49.674 148.599 1.00 16.67  ? 120 GLN C CG  1 
ATOM   3754 C CD  . GLN C 1 120 ? 52.719  49.237 148.588 1.00 20.35  ? 120 GLN C CD  1 
ATOM   3755 O OE1 . GLN C 1 120 ? 53.115  48.377 147.803 1.00 21.78  ? 120 GLN C OE1 1 
ATOM   3756 N NE2 . GLN C 1 120 ? 53.512  49.816 149.482 1.00 39.79  ? 120 GLN C NE2 1 
ATOM   3757 N N   . GLN C 1 121 ? 47.926  49.252 145.554 1.00 6.37   ? 121 GLN C N   1 
ATOM   3758 C CA  . GLN C 1 121 ? 47.303  49.203 144.244 1.00 5.48   ? 121 GLN C CA  1 
ATOM   3759 C C   . GLN C 1 121 ? 46.216  50.239 144.243 1.00 14.37  ? 121 GLN C C   1 
ATOM   3760 O O   . GLN C 1 121 ? 46.096  51.017 143.308 1.00 23.59  ? 121 GLN C O   1 
ATOM   3761 C CB  . GLN C 1 121 ? 46.689  47.838 143.970 1.00 20.16  ? 121 GLN C CB  1 
ATOM   3762 C CG  . GLN C 1 121 ? 46.213  47.674 142.540 1.00 31.20  ? 121 GLN C CG  1 
ATOM   3763 C CD  . GLN C 1 121 ? 47.335  47.829 141.515 1.00 35.19  ? 121 GLN C CD  1 
ATOM   3764 O OE1 . GLN C 1 121 ? 47.079  48.125 140.351 1.00 31.37  ? 121 GLN C OE1 1 
ATOM   3765 N NE2 . GLN C 1 121 ? 48.576  47.606 141.938 1.00 33.60  ? 121 GLN C NE2 1 
ATOM   3766 N N   . MET C 1 122 ? 45.441  50.264 145.319 1.00 21.16  ? 122 MET C N   1 
ATOM   3767 C CA  . MET C 1 122 ? 44.368  51.226 145.450 1.00 11.07  ? 122 MET C CA  1 
ATOM   3768 C C   . MET C 1 122 ? 44.910  52.650 145.327 1.00 18.71  ? 122 MET C C   1 
ATOM   3769 O O   . MET C 1 122 ? 44.302  53.488 144.653 1.00 23.46  ? 122 MET C O   1 
ATOM   3770 C CB  . MET C 1 122 ? 43.621  51.024 146.767 1.00 2.18   ? 122 MET C CB  1 
ATOM   3771 C CG  . MET C 1 122 ? 42.732  49.792 146.754 1.00 16.40  ? 122 MET C CG  1 
ATOM   3772 S SD  . MET C 1 122 ? 41.471  49.768 148.062 1.00 17.55  ? 122 MET C SD  1 
ATOM   3773 C CE  . MET C 1 122 ? 42.509  50.172 149.447 1.00 7.01   ? 122 MET C CE  1 
ATOM   3774 N N   . GLU C 1 123 ? 46.062  52.927 145.933 1.00 10.34  ? 123 GLU C N   1 
ATOM   3775 C CA  . GLU C 1 123 ? 46.616  54.267 145.829 1.00 22.20  ? 123 GLU C CA  1 
ATOM   3776 C C   . GLU C 1 123 ? 46.981  54.590 144.380 1.00 18.15  ? 123 GLU C C   1 
ATOM   3777 O O   . GLU C 1 123 ? 46.586  55.620 143.858 1.00 20.93  ? 123 GLU C O   1 
ATOM   3778 C CB  . GLU C 1 123 ? 47.834  54.424 146.724 1.00 26.46  ? 123 GLU C CB  1 
ATOM   3779 C CG  . GLU C 1 123 ? 47.534  54.188 148.166 1.00 34.64  ? 123 GLU C CG  1 
ATOM   3780 C CD  . GLU C 1 123 ? 48.574  54.797 149.081 1.00 52.48  ? 123 GLU C CD  1 
ATOM   3781 O OE1 . GLU C 1 123 ? 49.756  54.372 149.039 1.00 59.08  ? 123 GLU C OE1 1 
ATOM   3782 O OE2 . GLU C 1 123 ? 48.201  55.710 149.848 1.00 64.26  ? 123 GLU C OE2 1 
ATOM   3783 N N   . GLU C 1 124 ? 47.702  53.679 143.733 1.00 21.09  ? 124 GLU C N   1 
ATOM   3784 C CA  . GLU C 1 124 ? 48.136  53.830 142.347 1.00 15.37  ? 124 GLU C CA  1 
ATOM   3785 C C   . GLU C 1 124 ? 46.951  54.188 141.442 1.00 12.11  ? 124 GLU C C   1 
ATOM   3786 O O   . GLU C 1 124 ? 47.076  54.997 140.534 1.00 27.26  ? 124 GLU C O   1 
ATOM   3787 C CB  . GLU C 1 124 ? 48.810  52.530 141.893 1.00 27.39  ? 124 GLU C CB  1 
ATOM   3788 C CG  . GLU C 1 124 ? 49.505  52.556 140.534 1.00 77.99  ? 124 GLU C CG  1 
ATOM   3789 C CD  . GLU C 1 124 ? 50.113  51.203 140.162 1.00 96.26  ? 124 GLU C CD  1 
ATOM   3790 O OE1 . GLU C 1 124 ? 50.931  50.674 140.952 1.00 106.93 ? 124 GLU C OE1 1 
ATOM   3791 O OE2 . GLU C 1 124 ? 49.771  50.667 139.082 1.00 105.23 ? 124 GLU C OE2 1 
ATOM   3792 N N   . LEU C 1 125 ? 45.786  53.622 141.722 1.00 9.65   ? 125 LEU C N   1 
ATOM   3793 C CA  . LEU C 1 125 ? 44.600  53.892 140.917 1.00 16.69  ? 125 LEU C CA  1 
ATOM   3794 C C   . LEU C 1 125 ? 43.729  55.026 141.434 1.00 25.47  ? 125 LEU C C   1 
ATOM   3795 O O   . LEU C 1 125 ? 42.725  55.376 140.810 1.00 32.21  ? 125 LEU C O   1 
ATOM   3796 C CB  . LEU C 1 125 ? 43.723  52.651 140.828 1.00 9.04   ? 125 LEU C CB  1 
ATOM   3797 C CG  . LEU C 1 125 ? 44.324  51.323 140.391 1.00 24.95  ? 125 LEU C CG  1 
ATOM   3798 C CD1 . LEU C 1 125 ? 43.174  50.364 140.273 1.00 12.37  ? 125 LEU C CD1 1 
ATOM   3799 C CD2 . LEU C 1 125 ? 45.078  51.437 139.059 1.00 26.14  ? 125 LEU C CD2 1 
ATOM   3800 N N   . GLY C 1 126 ? 44.081  55.576 142.584 1.00 27.63  ? 126 GLY C N   1 
ATOM   3801 C CA  . GLY C 1 126 ? 43.273  56.632 143.147 1.00 25.45  ? 126 GLY C CA  1 
ATOM   3802 C C   . GLY C 1 126 ? 41.946  56.080 143.636 1.00 32.05  ? 126 GLY C C   1 
ATOM   3803 O O   . GLY C 1 126 ? 40.928  56.755 143.547 1.00 44.72  ? 126 GLY C O   1 
ATOM   3804 N N   . MET C 1 127 ? 41.948  54.841 144.125 1.00 31.14  ? 127 MET C N   1 
ATOM   3805 C CA  . MET C 1 127 ? 40.736  54.197 144.635 1.00 28.69  ? 127 MET C CA  1 
ATOM   3806 C C   . MET C 1 127 ? 40.791  54.013 146.141 1.00 29.39  ? 127 MET C C   1 
ATOM   3807 O O   . MET C 1 127 ? 39.848  53.471 146.727 1.00 35.42  ? 127 MET C O   1 
ATOM   3808 C CB  . MET C 1 127 ? 40.557  52.809 144.033 1.00 22.33  ? 127 MET C CB  1 
ATOM   3809 C CG  . MET C 1 127 ? 40.473  52.745 142.539 1.00 41.96  ? 127 MET C CG  1 
ATOM   3810 S SD  . MET C 1 127 ? 40.561  51.029 141.987 1.00 40.40  ? 127 MET C SD  1 
ATOM   3811 C CE  . MET C 1 127 ? 38.982  50.929 141.090 1.00 56.15  ? 127 MET C CE  1 
ATOM   3812 N N   . ALA C 1 128 ? 41.905  54.419 146.757 1.00 30.60  ? 128 ALA C N   1 
ATOM   3813 C CA  . ALA C 1 128 ? 42.114  54.259 148.203 1.00 29.62  ? 128 ALA C CA  1 
ATOM   3814 C C   . ALA C 1 128 ? 41.071  55.007 149.016 1.00 33.26  ? 128 ALA C C   1 
ATOM   3815 O O   . ALA C 1 128 ? 40.709  56.131 148.668 1.00 51.34  ? 128 ALA C O   1 
ATOM   3816 C CB  . ALA C 1 128 ? 43.527  54.721 148.610 1.00 19.18  ? 128 ALA C CB  1 
ATOM   3817 N N   . PRO C 1 129 ? 40.537  54.375 150.083 1.00 33.48  ? 129 PRO C N   1 
ATOM   3818 C CA  . PRO C 1 129 ? 39.537  55.025 150.921 1.00 24.94  ? 129 PRO C CA  1 
ATOM   3819 C C   . PRO C 1 129 ? 40.139  56.319 151.450 1.00 20.92  ? 129 PRO C C   1 
ATOM   3820 O O   . PRO C 1 129 ? 41.358  56.416 151.634 1.00 25.51  ? 129 PRO C O   1 
ATOM   3821 C CB  . PRO C 1 129 ? 39.331  54.002 152.036 1.00 23.26  ? 129 PRO C CB  1 
ATOM   3822 C CG  . PRO C 1 129 ? 39.475  52.723 151.327 1.00 20.18  ? 129 PRO C CG  1 
ATOM   3823 C CD  . PRO C 1 129 ? 40.733  52.985 150.531 1.00 42.15  ? 129 PRO C CD  1 
ATOM   3824 N N   . ALA C 1 130 ? 39.285  57.317 151.651 1.00 20.74  ? 130 ALA C N   1 
ATOM   3825 C CA  . ALA C 1 130 ? 39.717  58.618 152.141 1.00 29.99  ? 130 ALA C CA  1 
ATOM   3826 C C   . ALA C 1 130 ? 40.085  58.583 153.613 1.00 39.40  ? 130 ALA C C   1 
ATOM   3827 O O   . ALA C 1 130 ? 40.941  59.356 154.053 1.00 47.15  ? 130 ALA C O   1 
ATOM   3828 C CB  . ALA C 1 130 ? 38.650  59.665 151.885 1.00 20.34  ? 130 ALA C CB  1 
ATOM   3829 N N   . LEU C 1 131 ? 39.441  57.699 154.374 1.00 49.97  ? 131 LEU C N   1 
ATOM   3830 C CA  . LEU C 1 131 ? 39.724  57.574 155.798 1.00 60.81  ? 131 LEU C CA  1 
ATOM   3831 C C   . LEU C 1 131 ? 40.586  56.322 156.014 1.00 68.79  ? 131 LEU C C   1 
ATOM   3832 O O   . LEU C 1 131 ? 40.114  55.191 155.846 1.00 77.55  ? 131 LEU C O   1 
ATOM   3833 C CB  . LEU C 1 131 ? 38.413  57.507 156.590 1.00 66.44  ? 131 LEU C CB  1 
ATOM   3834 C CG  . LEU C 1 131 ? 38.431  57.932 158.060 1.00 71.76  ? 131 LEU C CG  1 
ATOM   3835 C CD1 . LEU C 1 131 ? 39.023  59.322 158.197 1.00 84.58  ? 131 LEU C CD1 1 
ATOM   3836 C CD2 . LEU C 1 131 ? 37.018  57.908 158.607 1.00 77.06  ? 131 LEU C CD2 1 
ATOM   3837 N N   . GLN C 1 132 ? 41.863  56.542 156.331 1.00 73.50  ? 132 GLN C N   1 
ATOM   3838 C CA  . GLN C 1 132 ? 42.827  55.461 156.561 1.00 76.14  ? 132 GLN C CA  1 
ATOM   3839 C C   . GLN C 1 132 ? 42.420  54.714 157.831 1.00 71.88  ? 132 GLN C C   1 
ATOM   3840 O O   . GLN C 1 132 ? 42.016  55.328 158.822 1.00 75.19  ? 132 GLN C O   1 
ATOM   3841 C CB  . GLN C 1 132 ? 44.248  56.028 156.705 1.00 88.57  ? 132 GLN C CB  1 
ATOM   3842 C CG  . GLN C 1 132 ? 44.541  57.273 155.840 1.00 104.51 ? 132 GLN C CG  1 
ATOM   3843 C CD  . GLN C 1 132 ? 45.158  56.965 154.486 1.00 108.80 ? 132 GLN C CD  1 
ATOM   3844 O OE1 . GLN C 1 132 ? 46.170  56.271 154.403 1.00 120.23 ? 132 GLN C OE1 1 
ATOM   3845 N NE2 . GLN C 1 132 ? 44.580  57.519 153.425 1.00 105.13 ? 132 GLN C NE2 1 
ATOM   3846 N N   . PRO C 1 133 ? 42.525  53.381 157.813 1.00 67.56  ? 133 PRO C N   1 
ATOM   3847 C CA  . PRO C 1 133 ? 42.181  52.476 158.909 1.00 73.08  ? 133 PRO C CA  1 
ATOM   3848 C C   . PRO C 1 133 ? 42.944  52.642 160.210 1.00 85.07  ? 133 PRO C C   1 
ATOM   3849 O O   . PRO C 1 133 ? 44.176  52.648 160.225 1.00 83.21  ? 133 PRO C O   1 
ATOM   3850 C CB  . PRO C 1 133 ? 42.456  51.104 158.307 1.00 67.98  ? 133 PRO C CB  1 
ATOM   3851 C CG  . PRO C 1 133 ? 42.240  51.321 156.860 1.00 64.73  ? 133 PRO C CG  1 
ATOM   3852 C CD  . PRO C 1 133 ? 42.961  52.609 156.644 1.00 62.17  ? 133 PRO C CD  1 
ATOM   3853 N N   . THR C 1 134 ? 42.187  52.793 161.293 1.00 102.24 ? 134 THR C N   1 
ATOM   3854 C CA  . THR C 1 134 ? 42.732  52.907 162.637 1.00 116.11 ? 134 THR C CA  1 
ATOM   3855 C C   . THR C 1 134 ? 42.327  51.572 163.232 1.00 119.16 ? 134 THR C C   1 
ATOM   3856 O O   . THR C 1 134 ? 41.163  51.167 163.126 1.00 121.21 ? 134 THR C O   1 
ATOM   3857 C CB  . THR C 1 134 ? 42.070  54.047 163.444 1.00 123.64 ? 134 THR C CB  1 
ATOM   3858 O OG1 . THR C 1 134 ? 42.295  55.297 162.782 1.00 131.06 ? 134 THR C OG1 1 
ATOM   3859 C CG2 . THR C 1 134 ? 42.647  54.112 164.863 1.00 130.64 ? 134 THR C CG2 1 
ATOM   3860 N N   . GLN C 1 135 ? 43.289  50.866 163.807 1.00 120.37 ? 135 GLN C N   1 
ATOM   3861 C CA  . GLN C 1 135 ? 43.006  49.563 164.377 1.00 119.71 ? 135 GLN C CA  1 
ATOM   3862 C C   . GLN C 1 135 ? 41.897  49.622 165.409 1.00 119.45 ? 135 GLN C C   1 
ATOM   3863 O O   . GLN C 1 135 ? 41.826  50.557 166.208 1.00 121.56 ? 135 GLN C O   1 
ATOM   3864 C CB  . GLN C 1 135 ? 44.265  48.941 164.977 1.00 118.84 ? 135 GLN C CB  1 
ATOM   3865 C CG  . GLN C 1 135 ? 44.141  47.438 165.201 1.00 114.26 ? 135 GLN C CG  1 
ATOM   3866 C CD  . GLN C 1 135 ? 43.687  46.687 163.949 1.00 106.55 ? 135 GLN C CD  1 
ATOM   3867 O OE1 . GLN C 1 135 ? 42.489  46.587 163.667 1.00 104.37 ? 135 GLN C OE1 1 
ATOM   3868 N NE2 . GLN C 1 135 ? 44.645  46.161 163.194 1.00 99.75  ? 135 GLN C NE2 1 
ATOM   3869 N N   . GLY C 1 136 ? 41.005  48.642 165.341 1.00 118.89 ? 136 GLY C N   1 
ATOM   3870 C CA  . GLY C 1 136 ? 39.899  48.579 166.272 1.00 115.12 ? 136 GLY C CA  1 
ATOM   3871 C C   . GLY C 1 136 ? 40.299  48.004 167.618 1.00 111.04 ? 136 GLY C C   1 
ATOM   3872 O O   . GLY C 1 136 ? 41.483  47.782 167.901 1.00 108.53 ? 136 GLY C O   1 
ATOM   3873 N N   . ALA C 1 137 ? 39.296  47.781 168.461 1.00 105.56 ? 137 ALA C N   1 
ATOM   3874 C CA  . ALA C 1 137 ? 39.506  47.220 169.789 1.00 95.01  ? 137 ALA C CA  1 
ATOM   3875 C C   . ALA C 1 137 ? 39.954  45.784 169.613 1.00 84.12  ? 137 ALA C C   1 
ATOM   3876 O O   . ALA C 1 137 ? 39.180  44.923 169.173 1.00 82.94  ? 137 ALA C O   1 
ATOM   3877 C CB  . ALA C 1 137 ? 38.217  47.274 170.598 1.00 102.51 ? 137 ALA C CB  1 
ATOM   3878 N N   . MET C 1 138 ? 41.208  45.530 169.947 1.00 66.73  ? 138 MET C N   1 
ATOM   3879 C CA  . MET C 1 138 ? 41.745  44.197 169.792 1.00 59.43  ? 138 MET C CA  1 
ATOM   3880 C C   . MET C 1 138 ? 41.517  43.280 170.985 1.00 56.02  ? 138 MET C C   1 
ATOM   3881 O O   . MET C 1 138 ? 41.961  43.585 172.091 1.00 64.30  ? 138 MET C O   1 
ATOM   3882 C CB  . MET C 1 138 ? 43.229  44.282 169.442 1.00 64.70  ? 138 MET C CB  1 
ATOM   3883 C CG  . MET C 1 138 ? 43.499  44.746 168.007 1.00 55.64  ? 138 MET C CG  1 
ATOM   3884 S SD  . MET C 1 138 ? 42.908  43.577 166.754 1.00 48.97  ? 138 MET C SD  1 
ATOM   3885 C CE  . MET C 1 138 ? 41.276  44.265 166.337 1.00 43.77  ? 138 MET C CE  1 
ATOM   3886 N N   . PRO C 1 139 ? 40.788  42.158 170.781 1.00 51.93  ? 139 PRO C N   1 
ATOM   3887 C CA  . PRO C 1 139 ? 40.504  41.192 171.842 1.00 44.50  ? 139 PRO C CA  1 
ATOM   3888 C C   . PRO C 1 139 ? 41.791  40.699 172.451 1.00 40.97  ? 139 PRO C C   1 
ATOM   3889 O O   . PRO C 1 139 ? 42.769  40.485 171.745 1.00 39.10  ? 139 PRO C O   1 
ATOM   3890 C CB  . PRO C 1 139 ? 39.782  40.067 171.100 1.00 37.22  ? 139 PRO C CB  1 
ATOM   3891 C CG  . PRO C 1 139 ? 40.238  40.201 169.725 1.00 41.72  ? 139 PRO C CG  1 
ATOM   3892 C CD  . PRO C 1 139 ? 40.188  41.689 169.526 1.00 57.06  ? 139 PRO C CD  1 
ATOM   3893 N N   . ALA C 1 140 ? 41.798  40.572 173.770 1.00 44.83  ? 140 ALA C N   1 
ATOM   3894 C CA  . ALA C 1 140 ? 42.977  40.115 174.484 1.00 48.33  ? 140 ALA C CA  1 
ATOM   3895 C C   . ALA C 1 140 ? 42.926  38.620 174.676 1.00 47.98  ? 140 ALA C C   1 
ATOM   3896 O O   . ALA C 1 140 ? 41.885  38.036 175.016 1.00 50.18  ? 140 ALA C O   1 
ATOM   3897 C CB  . ALA C 1 140 ? 43.098  40.806 175.822 1.00 54.47  ? 140 ALA C CB  1 
ATOM   3898 N N   . PHE C 1 141 ? 44.075  38.005 174.470 1.00 38.23  ? 141 PHE C N   1 
ATOM   3899 C CA  . PHE C 1 141 ? 44.187  36.581 174.608 1.00 29.21  ? 141 PHE C CA  1 
ATOM   3900 C C   . PHE C 1 141 ? 45.131  36.383 175.779 1.00 38.43  ? 141 PHE C C   1 
ATOM   3901 O O   . PHE C 1 141 ? 46.330  36.182 175.610 1.00 47.61  ? 141 PHE C O   1 
ATOM   3902 C CB  . PHE C 1 141 ? 44.710  36.010 173.301 1.00 25.31  ? 141 PHE C CB  1 
ATOM   3903 C CG  . PHE C 1 141 ? 43.809  36.293 172.100 1.00 14.25  ? 141 PHE C CG  1 
ATOM   3904 C CD1 . PHE C 1 141 ? 42.685  35.510 171.854 1.00 2.00   ? 141 PHE C CD1 1 
ATOM   3905 C CD2 . PHE C 1 141 ? 44.107  37.314 171.207 1.00 11.81  ? 141 PHE C CD2 1 
ATOM   3906 C CE1 . PHE C 1 141 ? 41.874  35.730 170.745 1.00 6.79   ? 141 PHE C CE1 1 
ATOM   3907 C CE2 . PHE C 1 141 ? 43.294  37.537 170.091 1.00 27.95  ? 141 PHE C CE2 1 
ATOM   3908 C CZ  . PHE C 1 141 ? 42.175  36.737 169.864 1.00 9.53   ? 141 PHE C CZ  1 
ATOM   3909 N N   . ALA C 1 142 ? 44.547  36.490 176.973 1.00 41.33  ? 142 ALA C N   1 
ATOM   3910 C CA  . ALA C 1 142 ? 45.241  36.412 178.250 1.00 33.11  ? 142 ALA C CA  1 
ATOM   3911 C C   . ALA C 1 142 ? 46.039  35.165 178.515 1.00 39.08  ? 142 ALA C C   1 
ATOM   3912 O O   . ALA C 1 142 ? 47.261  35.222 178.709 1.00 51.54  ? 142 ALA C O   1 
ATOM   3913 C CB  . ALA C 1 142 ? 44.251  36.618 179.366 1.00 29.63  ? 142 ALA C CB  1 
ATOM   3914 N N   . SER C 1 143 ? 45.342  34.039 178.526 1.00 29.34  ? 143 SER C N   1 
ATOM   3915 C CA  . SER C 1 143 ? 45.964  32.766 178.835 1.00 26.56  ? 143 SER C CA  1 
ATOM   3916 C C   . SER C 1 143 ? 46.397  31.946 177.645 1.00 27.07  ? 143 SER C C   1 
ATOM   3917 O O   . SER C 1 143 ? 45.860  32.092 176.550 1.00 32.00  ? 143 SER C O   1 
ATOM   3918 C CB  . SER C 1 143 ? 44.971  31.933 179.632 1.00 41.68  ? 143 SER C CB  1 
ATOM   3919 O OG  . SER C 1 143 ? 43.771  31.750 178.891 1.00 29.96  ? 143 SER C OG  1 
ATOM   3920 N N   . ALA C 1 144 ? 47.256  30.969 177.912 1.00 24.02  ? 144 ALA C N   1 
ATOM   3921 C CA  . ALA C 1 144 ? 47.732  30.059 176.880 1.00 8.15   ? 144 ALA C CA  1 
ATOM   3922 C C   . ALA C 1 144 ? 46.553  29.457 176.118 1.00 16.26  ? 144 ALA C C   1 
ATOM   3923 O O   . ALA C 1 144 ? 46.530  29.472 174.891 1.00 24.77  ? 144 ALA C O   1 
ATOM   3924 C CB  . ALA C 1 144 ? 48.555  28.961 177.496 1.00 5.34   ? 144 ALA C CB  1 
ATOM   3925 N N   . PHE C 1 145 ? 45.564  28.941 176.836 1.00 12.94  ? 145 PHE C N   1 
ATOM   3926 C CA  . PHE C 1 145 ? 44.437  28.354 176.163 1.00 12.32  ? 145 PHE C CA  1 
ATOM   3927 C C   . PHE C 1 145 ? 43.708  29.375 175.298 1.00 14.13  ? 145 PHE C C   1 
ATOM   3928 O O   . PHE C 1 145 ? 43.305  29.064 174.175 1.00 14.73  ? 145 PHE C O   1 
ATOM   3929 C CB  . PHE C 1 145 ? 43.472  27.729 177.147 1.00 5.88   ? 145 PHE C CB  1 
ATOM   3930 C CG  . PHE C 1 145 ? 42.297  27.086 176.482 1.00 10.89  ? 145 PHE C CG  1 
ATOM   3931 C CD1 . PHE C 1 145 ? 42.467  25.937 175.706 1.00 2.00   ? 145 PHE C CD1 1 
ATOM   3932 C CD2 . PHE C 1 145 ? 41.030  27.669 176.573 1.00 20.36  ? 145 PHE C CD2 1 
ATOM   3933 C CE1 . PHE C 1 145 ? 41.395  25.388 175.026 1.00 8.86   ? 145 PHE C CE1 1 
ATOM   3934 C CE2 . PHE C 1 145 ? 39.936  27.126 175.895 1.00 8.75   ? 145 PHE C CE2 1 
ATOM   3935 C CZ  . PHE C 1 145 ? 40.119  25.984 175.117 1.00 8.32   ? 145 PHE C CZ  1 
ATOM   3936 N N   . GLN C 1 146 ? 43.551  30.593 175.795 1.00 14.61  ? 146 GLN C N   1 
ATOM   3937 C CA  . GLN C 1 146 ? 42.856  31.601 175.003 1.00 18.58  ? 146 GLN C CA  1 
ATOM   3938 C C   . GLN C 1 146 ? 43.614  31.860 173.703 1.00 20.71  ? 146 GLN C C   1 
ATOM   3939 O O   . GLN C 1 146 ? 43.004  32.000 172.652 1.00 29.87  ? 146 GLN C O   1 
ATOM   3940 C CB  . GLN C 1 146 ? 42.648  32.892 175.788 1.00 21.35  ? 146 GLN C CB  1 
ATOM   3941 C CG  . GLN C 1 146 ? 41.623  32.797 176.908 1.00 18.02  ? 146 GLN C CG  1 
ATOM   3942 C CD  . GLN C 1 146 ? 41.388  34.133 177.602 1.00 34.22  ? 146 GLN C CD  1 
ATOM   3943 O OE1 . GLN C 1 146 ? 42.336  34.846 177.962 1.00 36.66  ? 146 GLN C OE1 1 
ATOM   3944 N NE2 . GLN C 1 146 ? 40.122  34.475 177.803 1.00 37.15  ? 146 GLN C NE2 1 
ATOM   3945 N N   . ARG C 1 147 ? 44.942  31.867 173.759 1.00 17.67  ? 147 ARG C N   1 
ATOM   3946 C CA  . ARG C 1 147 ? 45.757  32.066 172.561 1.00 2.00   ? 147 ARG C CA  1 
ATOM   3947 C C   . ARG C 1 147 ? 45.642  30.873 171.603 1.00 8.67   ? 147 ARG C C   1 
ATOM   3948 O O   . ARG C 1 147 ? 45.596  31.051 170.409 1.00 20.76  ? 147 ARG C O   1 
ATOM   3949 C CB  . ARG C 1 147 ? 47.211  32.271 172.942 1.00 2.00   ? 147 ARG C CB  1 
ATOM   3950 C CG  . ARG C 1 147 ? 47.515  33.590 173.574 1.00 2.00   ? 147 ARG C CG  1 
ATOM   3951 C CD  . ARG C 1 147 ? 48.962  33.655 174.062 1.00 16.06  ? 147 ARG C CD  1 
ATOM   3952 N NE  . ARG C 1 147 ? 49.144  33.123 175.417 1.00 47.51  ? 147 ARG C NE  1 
ATOM   3953 C CZ  . ARG C 1 147 ? 50.258  32.543 175.865 1.00 58.29  ? 147 ARG C CZ  1 
ATOM   3954 N NH1 . ARG C 1 147 ? 51.318  32.408 175.075 1.00 62.18  ? 147 ARG C NH1 1 
ATOM   3955 N NH2 . ARG C 1 147 ? 50.309  32.084 177.111 1.00 76.18  ? 147 ARG C NH2 1 
ATOM   3956 N N   . ARG C 1 148 ? 45.575  29.658 172.131 1.00 16.12  ? 148 ARG C N   1 
ATOM   3957 C CA  . ARG C 1 148 ? 45.449  28.459 171.310 1.00 7.39   ? 148 ARG C CA  1 
ATOM   3958 C C   . ARG C 1 148 ? 44.083  28.388 170.677 1.00 10.44  ? 148 ARG C C   1 
ATOM   3959 O O   . ARG C 1 148 ? 43.976  28.140 169.486 1.00 22.32  ? 148 ARG C O   1 
ATOM   3960 C CB  . ARG C 1 148 ? 45.687  27.212 172.150 1.00 8.98   ? 148 ARG C CB  1 
ATOM   3961 C CG  . ARG C 1 148 ? 46.997  27.280 172.901 1.00 25.19  ? 148 ARG C CG  1 
ATOM   3962 C CD  . ARG C 1 148 ? 47.262  26.064 173.779 1.00 32.31  ? 148 ARG C CD  1 
ATOM   3963 N NE  . ARG C 1 148 ? 48.579  26.154 174.414 1.00 28.55  ? 148 ARG C NE  1 
ATOM   3964 C CZ  . ARG C 1 148 ? 49.111  25.210 175.178 1.00 17.29  ? 148 ARG C CZ  1 
ATOM   3965 N NH1 . ARG C 1 148 ? 48.441  24.084 175.414 1.00 22.55  ? 148 ARG C NH1 1 
ATOM   3966 N NH2 . ARG C 1 148 ? 50.323  25.392 175.688 1.00 19.08  ? 148 ARG C NH2 1 
ATOM   3967 N N   . ALA C 1 149 ? 43.026  28.560 171.457 1.00 10.37  ? 149 ALA C N   1 
ATOM   3968 C CA  . ALA C 1 149 ? 41.701  28.528 170.861 1.00 14.52  ? 149 ALA C CA  1 
ATOM   3969 C C   . ALA C 1 149 ? 41.532  29.723 169.930 1.00 18.80  ? 149 ALA C C   1 
ATOM   3970 O O   . ALA C 1 149 ? 40.997  29.575 168.833 1.00 29.73  ? 149 ALA C O   1 
ATOM   3971 C CB  . ALA C 1 149 ? 40.641  28.526 171.905 1.00 22.38  ? 149 ALA C CB  1 
ATOM   3972 N N   . GLY C 1 150 ? 42.028  30.893 170.336 1.00 19.83  ? 150 GLY C N   1 
ATOM   3973 C CA  . GLY C 1 150 ? 41.929  32.084 169.498 1.00 19.01  ? 150 GLY C CA  1 
ATOM   3974 C C   . GLY C 1 150 ? 42.534  31.821 168.123 1.00 25.91  ? 150 GLY C C   1 
ATOM   3975 O O   . GLY C 1 150 ? 41.987  32.190 167.078 1.00 31.97  ? 150 GLY C O   1 
ATOM   3976 N N   . GLY C 1 151 ? 43.656  31.121 168.127 1.00 18.18  ? 151 GLY C N   1 
ATOM   3977 C CA  . GLY C 1 151 ? 44.319  30.783 166.894 1.00 10.04  ? 151 GLY C CA  1 
ATOM   3978 C C   . GLY C 1 151 ? 43.401  29.979 166.013 1.00 12.68  ? 151 GLY C C   1 
ATOM   3979 O O   . GLY C 1 151 ? 43.159  30.331 164.866 1.00 25.87  ? 151 GLY C O   1 
ATOM   3980 N N   . VAL C 1 152 ? 42.838  28.917 166.551 1.00 9.05   ? 152 VAL C N   1 
ATOM   3981 C CA  . VAL C 1 152 ? 41.952  28.093 165.746 1.00 11.62  ? 152 VAL C CA  1 
ATOM   3982 C C   . VAL C 1 152 ? 40.815  28.890 165.166 1.00 11.83  ? 152 VAL C C   1 
ATOM   3983 O O   . VAL C 1 152 ? 40.445  28.711 164.009 1.00 25.97  ? 152 VAL C O   1 
ATOM   3984 C CB  . VAL C 1 152 ? 41.357  26.943 166.538 1.00 4.45   ? 152 VAL C CB  1 
ATOM   3985 C CG1 . VAL C 1 152 ? 40.492  26.124 165.638 1.00 12.72  ? 152 VAL C CG1 1 
ATOM   3986 C CG2 . VAL C 1 152 ? 42.447  26.082 167.088 1.00 2.00   ? 152 VAL C CG2 1 
ATOM   3987 N N   . LEU C 1 153 ? 40.289  29.801 165.964 1.00 10.24  ? 153 LEU C N   1 
ATOM   3988 C CA  . LEU C 1 153 ? 39.173  30.620 165.532 1.00 11.91  ? 153 LEU C CA  1 
ATOM   3989 C C   . LEU C 1 153 ? 39.519  31.646 164.488 1.00 15.82  ? 153 LEU C C   1 
ATOM   3990 O O   . LEU C 1 153 ? 38.850  31.726 163.463 1.00 20.46  ? 153 LEU C O   1 
ATOM   3991 C CB  . LEU C 1 153 ? 38.540  31.277 166.733 1.00 22.05  ? 153 LEU C CB  1 
ATOM   3992 C CG  . LEU C 1 153 ? 37.893  30.213 167.621 1.00 23.12  ? 153 LEU C CG  1 
ATOM   3993 C CD1 . LEU C 1 153 ? 37.410  30.849 168.900 1.00 26.90  ? 153 LEU C CD1 1 
ATOM   3994 C CD2 . LEU C 1 153 ? 36.750  29.517 166.886 1.00 5.12   ? 153 LEU C CD2 1 
ATOM   3995 N N   . VAL C 1 154 ? 40.548  32.439 164.751 1.00 11.97  ? 154 VAL C N   1 
ATOM   3996 C CA  . VAL C 1 154 ? 40.977  33.438 163.796 1.00 7.00   ? 154 VAL C CA  1 
ATOM   3997 C C   . VAL C 1 154 ? 41.328  32.762 162.490 1.00 9.04   ? 154 VAL C C   1 
ATOM   3998 O O   . VAL C 1 154 ? 40.958  33.223 161.430 1.00 24.72  ? 154 VAL C O   1 
ATOM   3999 C CB  . VAL C 1 154 ? 42.177  34.146 164.290 1.00 4.58   ? 154 VAL C CB  1 
ATOM   4000 C CG1 . VAL C 1 154 ? 42.641  35.130 163.269 1.00 13.07  ? 154 VAL C CG1 1 
ATOM   4001 C CG2 . VAL C 1 154 ? 41.835  34.830 165.573 1.00 10.59  ? 154 VAL C CG2 1 
ATOM   4002 N N   . ALA C 1 155 ? 41.990  31.627 162.577 1.00 7.30   ? 155 ALA C N   1 
ATOM   4003 C CA  . ALA C 1 155 ? 42.368  30.883 161.403 1.00 6.34   ? 155 ALA C CA  1 
ATOM   4004 C C   . ALA C 1 155 ? 41.120  30.462 160.675 1.00 6.48   ? 155 ALA C C   1 
ATOM   4005 O O   . ALA C 1 155 ? 41.068  30.446 159.462 1.00 17.92  ? 155 ALA C O   1 
ATOM   4006 C CB  . ALA C 1 155 ? 43.138  29.665 161.823 1.00 3.50   ? 155 ALA C CB  1 
ATOM   4007 N N   . SER C 1 156 ? 40.100  30.106 161.422 1.00 19.14  ? 156 SER C N   1 
ATOM   4008 C CA  . SER C 1 156 ? 38.876  29.654 160.797 1.00 23.07  ? 156 SER C CA  1 
ATOM   4009 C C   . SER C 1 156 ? 38.108  30.783 160.139 1.00 18.67  ? 156 SER C C   1 
ATOM   4010 O O   . SER C 1 156 ? 37.469  30.581 159.119 1.00 22.04  ? 156 SER C O   1 
ATOM   4011 C CB  . SER C 1 156 ? 38.003  28.938 161.818 1.00 22.79  ? 156 SER C CB  1 
ATOM   4012 O OG  . SER C 1 156 ? 37.065  28.111 161.165 1.00 48.07  ? 156 SER C OG  1 
ATOM   4013 N N   . HIS C 1 157 ? 38.176  31.974 160.719 1.00 22.92  ? 157 HIS C N   1 
ATOM   4014 C CA  . HIS C 1 157 ? 37.481  33.141 160.172 1.00 20.81  ? 157 HIS C CA  1 
ATOM   4015 C C   . HIS C 1 157 ? 38.221  33.650 158.942 1.00 23.71  ? 157 HIS C C   1 
ATOM   4016 O O   . HIS C 1 157 ? 37.614  33.968 157.925 1.00 24.14  ? 157 HIS C O   1 
ATOM   4017 C CB  . HIS C 1 157 ? 37.390  34.259 161.216 1.00 33.53  ? 157 HIS C CB  1 
ATOM   4018 C CG  . HIS C 1 157 ? 36.426  33.986 162.335 1.00 47.41  ? 157 HIS C CG  1 
ATOM   4019 N ND1 . HIS C 1 157 ? 36.136  34.916 163.313 1.00 55.13  ? 157 HIS C ND1 1 
ATOM   4020 C CD2 . HIS C 1 157 ? 35.671  32.898 162.621 1.00 54.09  ? 157 HIS C CD2 1 
ATOM   4021 C CE1 . HIS C 1 157 ? 35.245  34.415 164.151 1.00 49.57  ? 157 HIS C CE1 1 
ATOM   4022 N NE2 . HIS C 1 157 ? 34.946  33.191 163.753 1.00 51.70  ? 157 HIS C NE2 1 
ATOM   4023 N N   . LEU C 1 158 ? 39.541  33.710 159.043 1.00 22.33  ? 158 LEU C N   1 
ATOM   4024 C CA  . LEU C 1 158 ? 40.363  34.160 157.954 1.00 7.48   ? 158 LEU C CA  1 
ATOM   4025 C C   . LEU C 1 158 ? 40.055  33.269 156.799 1.00 2.00   ? 158 LEU C C   1 
ATOM   4026 O O   . LEU C 1 158 ? 39.811  33.745 155.719 1.00 19.70  ? 158 LEU C O   1 
ATOM   4027 C CB  . LEU C 1 158 ? 41.814  34.004 158.313 1.00 2.94   ? 158 LEU C CB  1 
ATOM   4028 C CG  . LEU C 1 158 ? 42.767  34.500 157.263 1.00 2.80   ? 158 LEU C CG  1 
ATOM   4029 C CD1 . LEU C 1 158 ? 42.519  35.960 157.023 1.00 2.00   ? 158 LEU C CD1 1 
ATOM   4030 C CD2 . LEU C 1 158 ? 44.155  34.290 157.804 1.00 14.83  ? 158 LEU C CD2 1 
ATOM   4031 N N   . GLN C 1 159 ? 39.922  31.982 157.066 1.00 2.00   ? 159 GLN C N   1 
ATOM   4032 C CA  . GLN C 1 159 ? 39.670  31.003 156.020 1.00 2.56   ? 159 GLN C CA  1 
ATOM   4033 C C   . GLN C 1 159 ? 38.373  31.220 155.292 1.00 8.86   ? 159 GLN C C   1 
ATOM   4034 O O   . GLN C 1 159 ? 38.314  31.097 154.073 1.00 23.88  ? 159 GLN C O   1 
ATOM   4035 C CB  . GLN C 1 159 ? 39.709  29.584 156.575 1.00 16.80  ? 159 GLN C CB  1 
ATOM   4036 C CG  . GLN C 1 159 ? 40.241  28.532 155.582 1.00 49.22  ? 159 GLN C CG  1 
ATOM   4037 C CD  . GLN C 1 159 ? 41.758  28.617 155.353 1.00 62.73  ? 159 GLN C CD  1 
ATOM   4038 O OE1 . GLN C 1 159 ? 42.237  28.505 154.221 1.00 58.15  ? 159 GLN C OE1 1 
ATOM   4039 N NE2 . GLN C 1 159 ? 42.514  28.798 156.434 1.00 76.01  ? 159 GLN C NE2 1 
ATOM   4040 N N   . SER C 1 160 ? 37.325  31.534 156.031 1.00 11.51  ? 160 SER C N   1 
ATOM   4041 C CA  . SER C 1 160 ? 36.026  31.778 155.407 1.00 15.96  ? 160 SER C CA  1 
ATOM   4042 C C   . SER C 1 160 ? 36.069  33.089 154.645 1.00 18.95  ? 160 SER C C   1 
ATOM   4043 O O   . SER C 1 160 ? 35.422  33.236 153.613 1.00 14.68  ? 160 SER C O   1 
ATOM   4044 C CB  . SER C 1 160 ? 34.937  31.843 156.462 1.00 16.78  ? 160 SER C CB  1 
ATOM   4045 O OG  . SER C 1 160 ? 35.006  30.680 157.267 1.00 54.69  ? 160 SER C OG  1 
ATOM   4046 N N   . PHE C 1 161 ? 36.856  34.030 155.156 1.00 14.66  ? 161 PHE C N   1 
ATOM   4047 C CA  . PHE C 1 161 ? 37.010  35.328 154.533 1.00 2.83   ? 161 PHE C CA  1 
ATOM   4048 C C   . PHE C 1 161 ? 37.717  35.170 153.201 1.00 13.91  ? 161 PHE C C   1 
ATOM   4049 O O   . PHE C 1 161 ? 37.369  35.821 152.223 1.00 33.11  ? 161 PHE C O   1 
ATOM   4050 C CB  . PHE C 1 161 ? 37.828  36.238 155.438 1.00 4.62   ? 161 PHE C CB  1 
ATOM   4051 C CG  . PHE C 1 161 ? 38.047  37.607 154.884 1.00 2.00   ? 161 PHE C CG  1 
ATOM   4052 C CD1 . PHE C 1 161 ? 36.989  38.472 154.700 1.00 2.00   ? 161 PHE C CD1 1 
ATOM   4053 C CD2 . PHE C 1 161 ? 39.328  38.048 154.585 1.00 18.32  ? 161 PHE C CD2 1 
ATOM   4054 C CE1 . PHE C 1 161 ? 37.203  39.753 154.233 1.00 5.66   ? 161 PHE C CE1 1 
ATOM   4055 C CE2 . PHE C 1 161 ? 39.555  39.338 154.112 1.00 13.06  ? 161 PHE C CE2 1 
ATOM   4056 C CZ  . PHE C 1 161 ? 38.495  40.189 153.937 1.00 7.90   ? 161 PHE C CZ  1 
ATOM   4057 N N   . LEU C 1 162 ? 38.696  34.284 153.145 1.00 7.74   ? 162 LEU C N   1 
ATOM   4058 C CA  . LEU C 1 162 ? 39.421  34.097 151.918 1.00 4.86   ? 162 LEU C CA  1 
ATOM   4059 C C   . LEU C 1 162 ? 38.661  33.254 150.905 1.00 12.40  ? 162 LEU C C   1 
ATOM   4060 O O   . LEU C 1 162 ? 38.872  33.410 149.703 1.00 21.50  ? 162 LEU C O   1 
ATOM   4061 C CB  . LEU C 1 162 ? 40.805  33.541 152.198 1.00 3.21   ? 162 LEU C CB  1 
ATOM   4062 C CG  . LEU C 1 162 ? 41.722  34.382 153.091 1.00 6.56   ? 162 LEU C CG  1 
ATOM   4063 C CD1 . LEU C 1 162 ? 43.008  33.623 153.245 1.00 15.75  ? 162 LEU C CD1 1 
ATOM   4064 C CD2 . LEU C 1 162 ? 41.985  35.772 152.526 1.00 9.16   ? 162 LEU C CD2 1 
ATOM   4065 N N   . GLU C 1 163 ? 37.748  32.400 151.354 1.00 10.00  ? 163 GLU C N   1 
ATOM   4066 C CA  . GLU C 1 163 ? 36.986  31.600 150.396 1.00 15.90  ? 163 GLU C CA  1 
ATOM   4067 C C   . GLU C 1 163 ? 36.065  32.498 149.602 1.00 12.60  ? 163 GLU C C   1 
ATOM   4068 O O   . GLU C 1 163 ? 35.938  32.345 148.396 1.00 33.58  ? 163 GLU C O   1 
ATOM   4069 C CB  . GLU C 1 163 ? 36.208  30.481 151.077 1.00 19.57  ? 163 GLU C CB  1 
ATOM   4070 C CG  . GLU C 1 163 ? 37.132  29.404 151.630 1.00 71.02  ? 163 GLU C CG  1 
ATOM   4071 C CD  . GLU C 1 163 ? 36.389  28.196 152.169 1.00 92.65  ? 163 GLU C CD  1 
ATOM   4072 O OE1 . GLU C 1 163 ? 35.827  28.290 153.287 1.00 98.95  ? 163 GLU C OE1 1 
ATOM   4073 O OE2 . GLU C 1 163 ? 36.376  27.152 151.473 1.00 111.90 ? 163 GLU C OE2 1 
ATOM   4074 N N   . VAL C 1 164 ? 35.464  33.474 150.267 1.00 15.16  ? 164 VAL C N   1 
ATOM   4075 C CA  . VAL C 1 164 ? 34.577  34.422 149.599 1.00 14.32  ? 164 VAL C CA  1 
ATOM   4076 C C   . VAL C 1 164 ? 35.416  35.330 148.710 1.00 20.59  ? 164 VAL C C   1 
ATOM   4077 O O   . VAL C 1 164 ? 35.083  35.545 147.549 1.00 37.42  ? 164 VAL C O   1 
ATOM   4078 C CB  . VAL C 1 164 ? 33.829  35.319 150.588 1.00 15.74  ? 164 VAL C CB  1 
ATOM   4079 C CG1 . VAL C 1 164 ? 32.804  36.134 149.853 1.00 30.58  ? 164 VAL C CG1 1 
ATOM   4080 C CG2 . VAL C 1 164 ? 33.152  34.494 151.641 1.00 20.70  ? 164 VAL C CG2 1 
ATOM   4081 N N   . SER C 1 165 ? 36.492  35.883 149.256 1.00 19.50  ? 165 SER C N   1 
ATOM   4082 C CA  . SER C 1 165 ? 37.384  36.742 148.479 1.00 11.01  ? 165 SER C CA  1 
ATOM   4083 C C   . SER C 1 165 ? 37.871  36.075 147.195 1.00 7.12   ? 165 SER C C   1 
ATOM   4084 O O   . SER C 1 165 ? 37.991  36.725 146.166 1.00 21.85  ? 165 SER C O   1 
ATOM   4085 C CB  . SER C 1 165 ? 38.579  37.157 149.326 1.00 3.78   ? 165 SER C CB  1 
ATOM   4086 O OG  . SER C 1 165 ? 38.163  38.049 150.344 1.00 30.80  ? 165 SER C OG  1 
ATOM   4087 N N   . TYR C 1 166 ? 38.119  34.774 147.239 1.00 9.08   ? 166 TYR C N   1 
ATOM   4088 C CA  . TYR C 1 166 ? 38.591  34.090 146.056 1.00 6.26   ? 166 TYR C CA  1 
ATOM   4089 C C   . TYR C 1 166 ? 37.533  34.078 144.994 1.00 11.68  ? 166 TYR C C   1 
ATOM   4090 O O   . TYR C 1 166 ? 37.840  34.237 143.819 1.00 23.71  ? 166 TYR C O   1 
ATOM   4091 C CB  . TYR C 1 166 ? 39.001  32.673 146.366 1.00 2.00   ? 166 TYR C CB  1 
ATOM   4092 C CG  . TYR C 1 166 ? 39.790  32.064 145.252 1.00 6.02   ? 166 TYR C CG  1 
ATOM   4093 C CD1 . TYR C 1 166 ? 41.109  32.438 145.030 1.00 2.04   ? 166 TYR C CD1 1 
ATOM   4094 C CD2 . TYR C 1 166 ? 39.235  31.099 144.432 1.00 9.10   ? 166 TYR C CD2 1 
ATOM   4095 C CE1 . TYR C 1 166 ? 41.844  31.861 144.023 1.00 10.73  ? 166 TYR C CE1 1 
ATOM   4096 C CE2 . TYR C 1 166 ? 39.973  30.515 143.420 1.00 12.04  ? 166 TYR C CE2 1 
ATOM   4097 C CZ  . TYR C 1 166 ? 41.265  30.901 143.225 1.00 7.01   ? 166 TYR C CZ  1 
ATOM   4098 O OH  . TYR C 1 166 ? 41.981  30.345 142.209 1.00 10.88  ? 166 TYR C OH  1 
ATOM   4099 N N   . ARG C 1 167 ? 36.284  33.871 145.392 1.00 14.68  ? 167 ARG C N   1 
ATOM   4100 C CA  . ARG C 1 167 ? 35.203  33.869 144.414 1.00 24.89  ? 167 ARG C CA  1 
ATOM   4101 C C   . ARG C 1 167 ? 35.039  35.266 143.792 1.00 23.79  ? 167 ARG C C   1 
ATOM   4102 O O   . ARG C 1 167 ? 34.971  35.409 142.572 1.00 26.41  ? 167 ARG C O   1 
ATOM   4103 C CB  . ARG C 1 167 ? 33.894  33.375 145.036 1.00 25.23  ? 167 ARG C CB  1 
ATOM   4104 C CG  . ARG C 1 167 ? 33.927  31.916 145.525 1.00 67.09  ? 167 ARG C CG  1 
ATOM   4105 C CD  . ARG C 1 167 ? 34.721  30.949 144.599 1.00 93.92  ? 167 ARG C CD  1 
ATOM   4106 N NE  . ARG C 1 167 ? 34.136  30.747 143.268 1.00 115.48 ? 167 ARG C NE  1 
ATOM   4107 C CZ  . ARG C 1 167 ? 34.556  29.834 142.393 1.00 122.02 ? 167 ARG C CZ  1 
ATOM   4108 N NH1 . ARG C 1 167 ? 35.570  29.027 142.699 1.00 127.43 ? 167 ARG C NH1 1 
ATOM   4109 N NH2 . ARG C 1 167 ? 33.960  29.724 141.209 1.00 130.41 ? 167 ARG C NH2 1 
ATOM   4110 N N   . VAL C 1 168 ? 35.033  36.290 144.635 1.00 17.24  ? 168 VAL C N   1 
ATOM   4111 C CA  . VAL C 1 168 ? 34.903  37.667 144.187 1.00 14.54  ? 168 VAL C CA  1 
ATOM   4112 C C   . VAL C 1 168 ? 36.011  37.992 143.192 1.00 18.52  ? 168 VAL C C   1 
ATOM   4113 O O   . VAL C 1 168 ? 35.736  38.362 142.066 1.00 30.26  ? 168 VAL C O   1 
ATOM   4114 C CB  . VAL C 1 168 ? 34.938  38.652 145.391 1.00 13.97  ? 168 VAL C CB  1 
ATOM   4115 C CG1 . VAL C 1 168 ? 35.041  40.071 144.913 1.00 17.49  ? 168 VAL C CG1 1 
ATOM   4116 C CG2 . VAL C 1 168 ? 33.682  38.486 146.250 1.00 2.00   ? 168 VAL C CG2 1 
ATOM   4117 N N   . LEU C 1 169 ? 37.260  37.818 143.587 1.00 13.57  ? 169 LEU C N   1 
ATOM   4118 C CA  . LEU C 1 169 ? 38.355  38.102 142.693 1.00 5.20   ? 169 LEU C CA  1 
ATOM   4119 C C   . LEU C 1 169 ? 38.336  37.191 141.485 1.00 11.44  ? 169 LEU C C   1 
ATOM   4120 O O   . LEU C 1 169 ? 38.494  37.669 140.379 1.00 23.90  ? 169 LEU C O   1 
ATOM   4121 C CB  . LEU C 1 169 ? 39.690  37.986 143.408 1.00 2.00   ? 169 LEU C CB  1 
ATOM   4122 C CG  . LEU C 1 169 ? 39.907  38.979 144.546 1.00 8.75   ? 169 LEU C CG  1 
ATOM   4123 C CD1 . LEU C 1 169 ? 41.177  38.626 145.250 1.00 21.25  ? 169 LEU C CD1 1 
ATOM   4124 C CD2 . LEU C 1 169 ? 39.984  40.391 144.039 1.00 7.03   ? 169 LEU C CD2 1 
ATOM   4125 N N   . ARG C 1 170 ? 38.079  35.901 141.655 1.00 7.36   ? 170 ARG C N   1 
ATOM   4126 C CA  . ARG C 1 170 ? 38.091  35.013 140.493 1.00 14.56  ? 170 ARG C CA  1 
ATOM   4127 C C   . ARG C 1 170 ? 37.142  35.521 139.426 1.00 15.14  ? 170 ARG C C   1 
ATOM   4128 O O   . ARG C 1 170 ? 37.417  35.391 138.250 1.00 29.70  ? 170 ARG C O   1 
ATOM   4129 C CB  . ARG C 1 170 ? 37.740  33.578 140.868 1.00 24.30  ? 170 ARG C CB  1 
ATOM   4130 C CG  . ARG C 1 170 ? 38.290  32.548 139.896 1.00 53.91  ? 170 ARG C CG  1 
ATOM   4131 C CD  . ARG C 1 170 ? 38.016  31.136 140.385 1.00 90.51  ? 170 ARG C CD  1 
ATOM   4132 N NE  . ARG C 1 170 ? 38.831  30.143 139.686 1.00 122.84 ? 170 ARG C NE  1 
ATOM   4133 C CZ  . ARG C 1 170 ? 38.918  28.859 140.032 1.00 137.16 ? 170 ARG C CZ  1 
ATOM   4134 N NH1 . ARG C 1 170 ? 38.241  28.392 141.074 1.00 144.28 ? 170 ARG C NH1 1 
ATOM   4135 N NH2 . ARG C 1 170 ? 39.692  28.039 139.334 1.00 144.74 ? 170 ARG C NH2 1 
ATOM   4136 N N   . HIS C 1 171 ? 36.054  36.151 139.839 1.00 10.67  ? 171 HIS C N   1 
ATOM   4137 C CA  . HIS C 1 171 ? 35.093  36.683 138.890 1.00 14.46  ? 171 HIS C CA  1 
ATOM   4138 C C   . HIS C 1 171 ? 35.639  37.918 138.172 1.00 25.06  ? 171 HIS C C   1 
ATOM   4139 O O   . HIS C 1 171 ? 35.630  37.981 136.946 1.00 31.71  ? 171 HIS C O   1 
ATOM   4140 C CB  . HIS C 1 171 ? 33.798  37.008 139.596 1.00 23.56  ? 171 HIS C CB  1 
ATOM   4141 C CG  . HIS C 1 171 ? 32.865  37.864 138.802 1.00 43.58  ? 171 HIS C CG  1 
ATOM   4142 N ND1 . HIS C 1 171 ? 32.065  37.362 137.796 1.00 38.36  ? 171 HIS C ND1 1 
ATOM   4143 C CD2 . HIS C 1 171 ? 32.533  39.171 138.935 1.00 52.44  ? 171 HIS C CD2 1 
ATOM   4144 C CE1 . HIS C 1 171 ? 31.267  38.320 137.358 1.00 51.39  ? 171 HIS C CE1 1 
ATOM   4145 N NE2 . HIS C 1 171 ? 31.530  39.427 138.033 1.00 50.86  ? 171 HIS C NE2 1 
ATOM   4146 N N   . LEU C 1 172 ? 36.101  38.906 138.928 1.00 24.41  ? 172 LEU C N   1 
ATOM   4147 C CA  . LEU C 1 172 ? 36.658  40.111 138.328 1.00 8.78   ? 172 LEU C CA  1 
ATOM   4148 C C   . LEU C 1 172 ? 37.702  39.771 137.254 1.00 20.81  ? 172 LEU C C   1 
ATOM   4149 O O   . LEU C 1 172 ? 37.844  40.484 136.259 1.00 35.68  ? 172 LEU C O   1 
ATOM   4150 C CB  . LEU C 1 172 ? 37.335  40.980 139.390 1.00 2.00   ? 172 LEU C CB  1 
ATOM   4151 C CG  . LEU C 1 172 ? 36.488  41.591 140.481 1.00 3.18   ? 172 LEU C CG  1 
ATOM   4152 C CD1 . LEU C 1 172 ? 37.322  42.476 141.391 1.00 10.36  ? 172 LEU C CD1 1 
ATOM   4153 C CD2 . LEU C 1 172 ? 35.417  42.370 139.796 1.00 8.34   ? 172 LEU C CD2 1 
ATOM   4154 N N   . ALA C 1 173 ? 38.431  38.684 137.460 1.00 32.44  ? 173 ALA C N   1 
ATOM   4155 C CA  . ALA C 1 173 ? 39.487  38.285 136.542 1.00 50.47  ? 173 ALA C CA  1 
ATOM   4156 C C   . ALA C 1 173 ? 39.088  37.636 135.232 1.00 65.26  ? 173 ALA C C   1 
ATOM   4157 O O   . ALA C 1 173 ? 39.396  38.155 134.171 1.00 74.61  ? 173 ALA C O   1 
ATOM   4158 C CB  . ALA C 1 173 ? 40.479  37.400 137.253 1.00 45.99  ? 173 ALA C CB  1 
ATOM   4159 N N   . GLN C 1 174 ? 38.551  36.419 135.319 1.00 84.21  ? 174 GLN C N   1 
ATOM   4160 C CA  . GLN C 1 174 ? 38.143  35.637 134.146 1.00 104.32 ? 174 GLN C CA  1 
ATOM   4161 C C   . GLN C 1 174 ? 39.362  35.427 133.233 1.00 122.05 ? 174 GLN C C   1 
ATOM   4162 O O   . GLN C 1 174 ? 39.430  35.998 132.141 1.00 127.98 ? 174 GLN C O   1 
ATOM   4163 C CB  . GLN C 1 174 ? 37.014  36.345 133.373 1.00 96.36  ? 174 GLN C CB  1 
ATOM   4164 C CG  . GLN C 1 174 ? 35.790  36.733 134.212 1.00 89.86  ? 174 GLN C CG  1 
ATOM   4165 C CD  . GLN C 1 174 ? 34.722  35.643 134.321 1.00 89.98  ? 174 GLN C CD  1 
ATOM   4166 O OE1 . GLN C 1 174 ? 33.533  35.903 134.086 1.00 91.78  ? 174 GLN C OE1 1 
ATOM   4167 N NE2 . GLN C 1 174 ? 35.130  34.432 134.700 1.00 87.77  ? 174 GLN C NE2 1 
ATOM   4168 N N   . PRO C 1 175 ? 40.349  34.631 133.692 1.00 134.56 ? 175 PRO C N   1 
ATOM   4169 C CA  . PRO C 1 175 ? 41.584  34.325 132.957 1.00 142.62 ? 175 PRO C CA  1 
ATOM   4170 C C   . PRO C 1 175 ? 41.369  33.689 131.583 1.00 150.10 ? 175 PRO C C   1 
ATOM   4171 O O   . PRO C 1 175 ? 40.382  32.939 131.414 1.00 154.64 ? 175 PRO C O   1 
ATOM   4172 C CB  . PRO C 1 175 ? 42.310  33.365 133.900 1.00 141.25 ? 175 PRO C CB  1 
ATOM   4173 C CG  . PRO C 1 175 ? 41.833  33.787 135.248 1.00 138.61 ? 175 PRO C CG  1 
ATOM   4174 C CD  . PRO C 1 175 ? 40.363  33.967 135.007 1.00 136.42 ? 175 PRO C CD  1 
ATOM   4175 O OXT . PRO C 1 175 ? 42.211  33.939 130.696 1.00 157.88 ? 175 PRO C OXT 1 
ATOM   4176 N N   . GLY D 2 2   ? 96.981  43.339 139.933 1.00 82.15  ? 2   GLY D N   1 
ATOM   4177 C CA  . GLY D 2 2   ? 96.454  44.481 140.747 1.00 97.17  ? 2   GLY D CA  1 
ATOM   4178 C C   . GLY D 2 2   ? 95.528  43.969 141.837 1.00 100.76 ? 2   GLY D C   1 
ATOM   4179 O O   . GLY D 2 2   ? 95.135  42.803 141.776 1.00 107.47 ? 2   GLY D O   1 
ATOM   4180 N N   . TYR D 2 3   ? 95.157  44.826 142.796 1.00 102.10 ? 3   TYR D N   1 
ATOM   4181 C CA  . TYR D 2 3   ? 94.280  44.436 143.914 1.00 103.35 ? 3   TYR D CA  1 
ATOM   4182 C C   . TYR D 2 3   ? 92.938  45.174 144.132 1.00 100.71 ? 3   TYR D C   1 
ATOM   4183 O O   . TYR D 2 3   ? 92.208  44.855 145.078 1.00 90.66  ? 3   TYR D O   1 
ATOM   4184 C CB  . TYR D 2 3   ? 95.060  44.476 145.229 1.00 108.85 ? 3   TYR D CB  1 
ATOM   4185 C CG  . TYR D 2 3   ? 96.448  43.903 145.145 1.00 117.00 ? 3   TYR D CG  1 
ATOM   4186 C CD1 . TYR D 2 3   ? 96.650  42.534 145.009 1.00 120.70 ? 3   TYR D CD1 1 
ATOM   4187 C CD2 . TYR D 2 3   ? 97.565  44.736 145.185 1.00 126.16 ? 3   TYR D CD2 1 
ATOM   4188 C CE1 . TYR D 2 3   ? 97.932  42.004 144.912 1.00 130.48 ? 3   TYR D CE1 1 
ATOM   4189 C CE2 . TYR D 2 3   ? 98.851  44.221 145.090 1.00 134.38 ? 3   TYR D CE2 1 
ATOM   4190 C CZ  . TYR D 2 3   ? 99.029  42.852 144.952 1.00 136.14 ? 3   TYR D CZ  1 
ATOM   4191 O OH  . TYR D 2 3   ? 100.301 42.336 144.841 1.00 144.16 ? 3   TYR D OH  1 
ATOM   4192 N N   . PRO D 2 4   ? 92.615  46.196 143.314 1.00 104.80 ? 4   PRO D N   1 
ATOM   4193 C CA  . PRO D 2 4   ? 91.323  46.836 143.588 1.00 105.20 ? 4   PRO D CA  1 
ATOM   4194 C C   . PRO D 2 4   ? 90.197  45.877 143.207 1.00 98.29  ? 4   PRO D C   1 
ATOM   4195 O O   . PRO D 2 4   ? 90.221  45.288 142.111 1.00 103.33 ? 4   PRO D O   1 
ATOM   4196 C CB  . PRO D 2 4   ? 91.327  48.050 142.645 1.00 113.40 ? 4   PRO D CB  1 
ATOM   4197 C CG  . PRO D 2 4   ? 92.785  48.299 142.374 1.00 117.51 ? 4   PRO D CG  1 
ATOM   4198 C CD  . PRO D 2 4   ? 93.321  46.902 142.231 1.00 111.45 ? 4   PRO D CD  1 
ATOM   4199 N N   . PRO D 2 5   ? 89.229  45.658 144.117 1.00 84.09  ? 5   PRO D N   1 
ATOM   4200 C CA  . PRO D 2 5   ? 88.123  44.752 143.798 1.00 73.61  ? 5   PRO D CA  1 
ATOM   4201 C C   . PRO D 2 5   ? 87.333  45.337 142.629 1.00 74.67  ? 5   PRO D C   1 
ATOM   4202 O O   . PRO D 2 5   ? 87.091  46.550 142.580 1.00 81.08  ? 5   PRO D O   1 
ATOM   4203 C CB  . PRO D 2 5   ? 87.318  44.740 145.093 1.00 65.04  ? 5   PRO D CB  1 
ATOM   4204 C CG  . PRO D 2 5   ? 87.571  46.097 145.657 1.00 66.36  ? 5   PRO D CG  1 
ATOM   4205 C CD  . PRO D 2 5   ? 89.047  46.256 145.449 1.00 73.81  ? 5   PRO D CD  1 
ATOM   4206 N N   . ALA D 2 6   ? 87.010  44.490 141.653 1.00 72.03  ? 6   ALA D N   1 
ATOM   4207 C CA  . ALA D 2 6   ? 86.269  44.928 140.471 1.00 73.18  ? 6   ALA D CA  1 
ATOM   4208 C C   . ALA D 2 6   ? 84.773  44.658 140.626 1.00 74.05  ? 6   ALA D C   1 
ATOM   4209 O O   . ALA D 2 6   ? 84.370  43.840 141.449 1.00 76.59  ? 6   ALA D O   1 
ATOM   4210 C CB  . ALA D 2 6   ? 86.807  44.246 139.228 1.00 76.22  ? 6   ALA D CB  1 
ATOM   4211 N N   . SER D 2 7   ? 83.958  45.380 139.863 1.00 75.07  ? 7   SER D N   1 
ATOM   4212 C CA  . SER D 2 7   ? 82.500  45.243 139.901 1.00 67.72  ? 7   SER D CA  1 
ATOM   4213 C C   . SER D 2 7   ? 82.020  43.806 139.556 1.00 69.24  ? 7   SER D C   1 
ATOM   4214 O O   . SER D 2 7   ? 82.233  43.340 138.430 1.00 80.98  ? 7   SER D O   1 
ATOM   4215 C CB  . SER D 2 7   ? 81.884  46.295 138.949 1.00 62.67  ? 7   SER D CB  1 
ATOM   4216 O OG  . SER D 2 7   ? 82.833  46.783 137.993 1.00 56.50  ? 7   SER D OG  1 
ATOM   4217 N N   . PRO D 2 8   ? 81.410  43.076 140.531 1.00 61.26  ? 8   PRO D N   1 
ATOM   4218 C CA  . PRO D 2 8   ? 80.904  41.700 140.345 1.00 53.14  ? 8   PRO D CA  1 
ATOM   4219 C C   . PRO D 2 8   ? 79.788  41.603 139.292 1.00 52.74  ? 8   PRO D C   1 
ATOM   4220 O O   . PRO D 2 8   ? 79.108  42.599 139.010 1.00 55.41  ? 8   PRO D O   1 
ATOM   4221 C CB  . PRO D 2 8   ? 80.390  41.332 141.736 1.00 40.53  ? 8   PRO D CB  1 
ATOM   4222 C CG  . PRO D 2 8   ? 81.244  42.128 142.641 1.00 52.21  ? 8   PRO D CG  1 
ATOM   4223 C CD  . PRO D 2 8   ? 81.262  43.474 141.941 1.00 58.94  ? 8   PRO D CD  1 
ATOM   4224 N N   . SER D 2 9   ? 79.561  40.400 138.755 1.00 47.65  ? 9   SER D N   1 
ATOM   4225 C CA  . SER D 2 9   ? 78.556  40.208 137.700 1.00 48.86  ? 9   SER D CA  1 
ATOM   4226 C C   . SER D 2 9   ? 77.693  38.935 137.792 1.00 43.51  ? 9   SER D C   1 
ATOM   4227 O O   . SER D 2 9   ? 77.814  38.155 138.737 1.00 35.19  ? 9   SER D O   1 
ATOM   4228 C CB  . SER D 2 9   ? 79.237  40.278 136.315 1.00 56.99  ? 9   SER D CB  1 
ATOM   4229 O OG  . SER D 2 9   ? 80.239  39.272 136.158 1.00 64.94  ? 9   SER D OG  1 
ATOM   4230 N N   . ASN D 2 10  ? 76.853  38.737 136.773 1.00 45.63  ? 10  ASN D N   1 
ATOM   4231 C CA  . ASN D 2 10  ? 75.938  37.603 136.663 1.00 49.28  ? 10  ASN D CA  1 
ATOM   4232 C C   . ASN D 2 10  ? 75.265  37.322 138.006 1.00 50.54  ? 10  ASN D C   1 
ATOM   4233 O O   . ASN D 2 10  ? 75.288  36.197 138.516 1.00 56.19  ? 10  ASN D O   1 
ATOM   4234 C CB  . ASN D 2 10  ? 76.639  36.351 136.101 1.00 53.45  ? 10  ASN D CB  1 
ATOM   4235 C CG  . ASN D 2 10  ? 75.686  35.441 135.303 1.00 67.38  ? 10  ASN D CG  1 
ATOM   4236 O OD1 . ASN D 2 10  ? 74.521  35.795 135.059 1.00 59.06  ? 10  ASN D OD1 1 
ATOM   4237 N ND2 . ASN D 2 10  ? 76.223  34.307 134.843 1.00 80.65  ? 10  ASN D ND2 1 
ATOM   4238 N N   . LEU D 2 11  ? 74.724  38.384 138.601 1.00 49.27  ? 11  LEU D N   1 
ATOM   4239 C CA  . LEU D 2 11  ? 74.000  38.298 139.875 1.00 41.84  ? 11  LEU D CA  1 
ATOM   4240 C C   . LEU D 2 11  ? 72.576  37.801 139.596 1.00 44.42  ? 11  LEU D C   1 
ATOM   4241 O O   . LEU D 2 11  ? 71.851  38.369 138.755 1.00 45.20  ? 11  LEU D O   1 
ATOM   4242 C CB  . LEU D 2 11  ? 73.919  39.671 140.556 1.00 45.16  ? 11  LEU D CB  1 
ATOM   4243 C CG  . LEU D 2 11  ? 72.945  39.851 141.734 1.00 31.04  ? 11  LEU D CG  1 
ATOM   4244 C CD1 . LEU D 2 11  ? 73.505  39.235 143.003 1.00 24.46  ? 11  LEU D CD1 1 
ATOM   4245 C CD2 . LEU D 2 11  ? 72.655  41.328 141.941 1.00 33.24  ? 11  LEU D CD2 1 
ATOM   4246 N N   . SER D 2 12  ? 72.195  36.728 140.283 1.00 40.39  ? 12  SER D N   1 
ATOM   4247 C CA  . SER D 2 12  ? 70.873  36.144 140.133 1.00 31.59  ? 12  SER D CA  1 
ATOM   4248 C C   . SER D 2 12  ? 70.338  35.801 141.506 1.00 30.27  ? 12  SER D C   1 
ATOM   4249 O O   . SER D 2 12  ? 71.093  35.574 142.464 1.00 29.95  ? 12  SER D O   1 
ATOM   4250 C CB  . SER D 2 12  ? 70.915  34.874 139.266 1.00 36.01  ? 12  SER D CB  1 
ATOM   4251 O OG  . SER D 2 12  ? 71.379  33.731 139.977 1.00 43.00  ? 12  SER D OG  1 
ATOM   4252 N N   . CYS D 2 13  ? 69.024  35.741 141.593 1.00 24.99  ? 13  CYS D N   1 
ATOM   4253 C CA  . CYS D 2 13  ? 68.390  35.420 142.838 1.00 19.01  ? 13  CYS D CA  1 
ATOM   4254 C C   . CYS D 2 13  ? 67.232  34.504 142.524 1.00 20.00  ? 13  CYS D C   1 
ATOM   4255 O O   . CYS D 2 13  ? 66.591  34.642 141.485 1.00 21.63  ? 13  CYS D O   1 
ATOM   4256 C CB  . CYS D 2 13  ? 67.873  36.697 143.502 1.00 17.20  ? 13  CYS D CB  1 
ATOM   4257 S SG  . CYS D 2 13  ? 69.140  37.881 144.028 1.00 28.14  ? 13  CYS D SG  1 
ATOM   4258 N N   . LEU D 2 14  ? 67.004  33.539 143.401 1.00 17.77  ? 14  LEU D N   1 
ATOM   4259 C CA  . LEU D 2 14  ? 65.894  32.629 143.268 1.00 11.72  ? 14  LEU D CA  1 
ATOM   4260 C C   . LEU D 2 14  ? 65.227  32.522 144.640 1.00 17.56  ? 14  LEU D C   1 
ATOM   4261 O O   . LEU D 2 14  ? 65.918  32.422 145.661 1.00 20.11  ? 14  LEU D O   1 
ATOM   4262 C CB  . LEU D 2 14  ? 66.379  31.261 142.819 1.00 13.00  ? 14  LEU D CB  1 
ATOM   4263 C CG  . LEU D 2 14  ? 66.731  31.113 141.356 1.00 10.62  ? 14  LEU D CG  1 
ATOM   4264 C CD1 . LEU D 2 14  ? 67.157  29.706 141.137 1.00 30.96  ? 14  LEU D CD1 1 
ATOM   4265 C CD2 . LEU D 2 14  ? 65.541  31.421 140.494 1.00 22.97  ? 14  LEU D CD2 1 
ATOM   4266 N N   . MET D 2 15  ? 63.897  32.558 144.664 1.00 11.18  ? 15  MET D N   1 
ATOM   4267 C CA  . MET D 2 15  ? 63.127  32.452 145.897 1.00 10.44  ? 15  MET D CA  1 
ATOM   4268 C C   . MET D 2 15  ? 62.929  30.982 146.202 1.00 9.16   ? 15  MET D C   1 
ATOM   4269 O O   . MET D 2 15  ? 62.295  30.275 145.436 1.00 23.55  ? 15  MET D O   1 
ATOM   4270 C CB  . MET D 2 15  ? 61.780  33.124 145.708 1.00 2.00   ? 15  MET D CB  1 
ATOM   4271 C CG  . MET D 2 15  ? 60.912  33.065 146.898 1.00 2.00   ? 15  MET D CG  1 
ATOM   4272 S SD  . MET D 2 15  ? 61.539  34.048 148.184 1.00 20.62  ? 15  MET D SD  1 
ATOM   4273 C CE  . MET D 2 15  ? 60.693  33.396 149.567 1.00 9.26   ? 15  MET D CE  1 
ATOM   4274 N N   . HIS D 2 16  ? 63.498  30.512 147.301 1.00 10.20  ? 16  HIS D N   1 
ATOM   4275 C CA  . HIS D 2 16  ? 63.406  29.106 147.674 1.00 7.15   ? 16  HIS D CA  1 
ATOM   4276 C C   . HIS D 2 16  ? 62.266  28.883 148.620 1.00 14.48  ? 16  HIS D C   1 
ATOM   4277 O O   . HIS D 2 16  ? 62.307  29.335 149.763 1.00 15.29  ? 16  HIS D O   1 
ATOM   4278 C CB  . HIS D 2 16  ? 64.703  28.664 148.329 1.00 7.51   ? 16  HIS D CB  1 
ATOM   4279 C CG  . HIS D 2 16  ? 65.770  28.285 147.353 1.00 13.51  ? 16  HIS D CG  1 
ATOM   4280 N ND1 . HIS D 2 16  ? 66.435  29.209 146.577 1.00 21.72  ? 16  HIS D ND1 1 
ATOM   4281 C CD2 . HIS D 2 16  ? 66.271  27.077 147.009 1.00 20.42  ? 16  HIS D CD2 1 
ATOM   4282 C CE1 . HIS D 2 16  ? 67.297  28.590 145.794 1.00 28.03  ? 16  HIS D CE1 1 
ATOM   4283 N NE2 . HIS D 2 16  ? 67.217  27.295 146.037 1.00 36.41  ? 16  HIS D NE2 1 
ATOM   4284 N N   . LEU D 2 17  ? 61.253  28.173 148.153 1.00 12.41  ? 17  LEU D N   1 
ATOM   4285 C CA  . LEU D 2 17  ? 60.089  27.917 148.975 1.00 11.95  ? 17  LEU D CA  1 
ATOM   4286 C C   . LEU D 2 17  ? 60.320  26.912 150.105 1.00 16.82  ? 17  LEU D C   1 
ATOM   4287 O O   . LEU D 2 17  ? 59.533  26.856 151.055 1.00 28.01  ? 17  LEU D O   1 
ATOM   4288 C CB  . LEU D 2 17  ? 58.950  27.438 148.093 1.00 12.28  ? 17  LEU D CB  1 
ATOM   4289 C CG  . LEU D 2 17  ? 58.373  28.444 147.113 1.00 2.00   ? 17  LEU D CG  1 
ATOM   4290 C CD1 . LEU D 2 17  ? 57.196  27.829 146.417 1.00 7.11   ? 17  LEU D CD1 1 
ATOM   4291 C CD2 . LEU D 2 17  ? 57.925  29.675 147.851 1.00 5.69   ? 17  LEU D CD2 1 
ATOM   4292 N N   . THR D 2 18  ? 61.369  26.103 149.978 1.00 9.15   ? 18  THR D N   1 
ATOM   4293 C CA  . THR D 2 18  ? 61.708  25.089 150.977 1.00 17.83  ? 18  THR D CA  1 
ATOM   4294 C C   . THR D 2 18  ? 62.279  25.729 152.229 1.00 14.90  ? 18  THR D C   1 
ATOM   4295 O O   . THR D 2 18  ? 61.911  25.382 153.340 1.00 30.91  ? 18  THR D O   1 
ATOM   4296 C CB  . THR D 2 18  ? 62.740  24.098 150.421 1.00 20.11  ? 18  THR D CB  1 
ATOM   4297 O OG1 . THR D 2 18  ? 63.777  24.819 149.741 1.00 35.81  ? 18  THR D OG1 1 
ATOM   4298 C CG2 . THR D 2 18  ? 62.086  23.164 149.425 1.00 27.77  ? 18  THR D CG2 1 
ATOM   4299 N N   . THR D 2 19  ? 63.160  26.695 152.027 1.00 15.92  ? 19  THR D N   1 
ATOM   4300 C CA  . THR D 2 19  ? 63.806  27.424 153.112 1.00 21.44  ? 19  THR D CA  1 
ATOM   4301 C C   . THR D 2 19  ? 63.186  28.810 153.321 1.00 25.58  ? 19  THR D C   1 
ATOM   4302 O O   . THR D 2 19  ? 63.567  29.537 154.235 1.00 41.01  ? 19  THR D O   1 
ATOM   4303 C CB  . THR D 2 19  ? 65.293  27.603 152.801 1.00 31.78  ? 19  THR D CB  1 
ATOM   4304 O OG1 . THR D 2 19  ? 65.440  28.436 151.648 1.00 41.47  ? 19  THR D OG1 1 
ATOM   4305 C CG2 . THR D 2 19  ? 65.926  26.260 152.484 1.00 36.13  ? 19  THR D CG2 1 
ATOM   4306 N N   . ASN D 2 20  ? 62.244  29.162 152.447 1.00 28.83  ? 20  ASN D N   1 
ATOM   4307 C CA  . ASN D 2 20  ? 61.538  30.436 152.458 1.00 16.82  ? 20  ASN D CA  1 
ATOM   4308 C C   . ASN D 2 20  ? 62.538  31.572 152.567 1.00 18.66  ? 20  ASN D C   1 
ATOM   4309 O O   . ASN D 2 20  ? 62.518  32.357 153.512 1.00 27.69  ? 20  ASN D O   1 
ATOM   4310 C CB  . ASN D 2 20  ? 60.503  30.474 153.579 1.00 9.84   ? 20  ASN D CB  1 
ATOM   4311 C CG  . ASN D 2 20  ? 59.217  31.233 153.191 1.00 21.21  ? 20  ASN D CG  1 
ATOM   4312 O OD1 . ASN D 2 20  ? 58.497  31.711 154.059 1.00 26.91  ? 20  ASN D OD1 1 
ATOM   4313 N ND2 . ASN D 2 20  ? 58.903  31.298 151.903 1.00 34.60  ? 20  ASN D ND2 1 
ATOM   4314 N N   . SER D 2 21  ? 63.447  31.626 151.603 1.00 15.64  ? 21  SER D N   1 
ATOM   4315 C CA  . SER D 2 21  ? 64.459  32.667 151.575 1.00 12.88  ? 21  SER D CA  1 
ATOM   4316 C C   . SER D 2 21  ? 64.913  32.951 150.156 1.00 9.16   ? 21  SER D C   1 
ATOM   4317 O O   . SER D 2 21  ? 64.899  32.071 149.314 1.00 22.74  ? 21  SER D O   1 
ATOM   4318 C CB  . SER D 2 21  ? 65.655  32.274 152.435 1.00 6.53   ? 21  SER D CB  1 
ATOM   4319 O OG  . SER D 2 21  ? 66.090  30.960 152.157 1.00 23.60  ? 21  SER D OG  1 
ATOM   4320 N N   . LEU D 2 22  ? 65.228  34.208 149.885 1.00 13.59  ? 22  LEU D N   1 
ATOM   4321 C CA  . LEU D 2 22  ? 65.702  34.661 148.583 1.00 4.09   ? 22  LEU D CA  1 
ATOM   4322 C C   . LEU D 2 22  ? 67.197  34.440 148.550 1.00 8.06   ? 22  LEU D C   1 
ATOM   4323 O O   . LEU D 2 22  ? 67.938  35.041 149.311 1.00 13.39  ? 22  LEU D O   1 
ATOM   4324 C CB  . LEU D 2 22  ? 65.442  36.140 148.449 1.00 2.00   ? 22  LEU D CB  1 
ATOM   4325 C CG  . LEU D 2 22  ? 65.808  36.722 147.114 1.00 2.00   ? 22  LEU D CG  1 
ATOM   4326 C CD1 . LEU D 2 22  ? 64.833  36.237 146.098 1.00 2.00   ? 22  LEU D CD1 1 
ATOM   4327 C CD2 . LEU D 2 22  ? 65.696  38.190 147.216 1.00 9.96   ? 22  LEU D CD2 1 
ATOM   4328 N N   . VAL D 2 23  ? 67.632  33.562 147.672 1.00 16.99  ? 23  VAL D N   1 
ATOM   4329 C CA  . VAL D 2 23  ? 69.033  33.229 147.561 1.00 12.17  ? 23  VAL D CA  1 
ATOM   4330 C C   . VAL D 2 23  ? 69.680  33.846 146.353 1.00 14.56  ? 23  VAL D C   1 
ATOM   4331 O O   . VAL D 2 23  ? 69.298  33.574 145.218 1.00 12.30  ? 23  VAL D O   1 
ATOM   4332 C CB  . VAL D 2 23  ? 69.191  31.735 147.513 1.00 7.06   ? 23  VAL D CB  1 
ATOM   4333 C CG1 . VAL D 2 23  ? 70.606  31.373 147.185 1.00 14.16  ? 23  VAL D CG1 1 
ATOM   4334 C CG2 . VAL D 2 23  ? 68.777  31.165 148.858 1.00 19.27  ? 23  VAL D CG2 1 
ATOM   4335 N N   . CYS D 2 24  ? 70.719  34.620 146.614 1.00 19.74  ? 24  CYS D N   1 
ATOM   4336 C CA  . CYS D 2 24  ? 71.438  35.314 145.572 1.00 24.40  ? 24  CYS D CA  1 
ATOM   4337 C C   . CYS D 2 24  ? 72.876  34.874 145.461 1.00 25.93  ? 24  CYS D C   1 
ATOM   4338 O O   . CYS D 2 24  ? 73.556  34.666 146.465 1.00 28.81  ? 24  CYS D O   1 
ATOM   4339 C CB  . CYS D 2 24  ? 71.344  36.798 145.835 1.00 26.99  ? 24  CYS D CB  1 
ATOM   4340 S SG  . CYS D 2 24  ? 69.605  37.284 145.927 1.00 35.73  ? 24  CYS D SG  1 
ATOM   4341 N N   . GLN D 2 25  ? 73.322  34.699 144.226 1.00 29.65  ? 25  GLN D N   1 
ATOM   4342 C CA  . GLN D 2 25  ? 74.680  34.265 143.945 1.00 33.10  ? 25  GLN D CA  1 
ATOM   4343 C C   . GLN D 2 25  ? 75.259  35.198 142.888 1.00 35.86  ? 25  GLN D C   1 
ATOM   4344 O O   . GLN D 2 25  ? 74.506  35.713 142.060 1.00 34.46  ? 25  GLN D O   1 
ATOM   4345 C CB  . GLN D 2 25  ? 74.657  32.825 143.455 1.00 26.37  ? 25  GLN D CB  1 
ATOM   4346 C CG  . GLN D 2 25  ? 73.646  32.549 142.367 1.00 44.56  ? 25  GLN D CG  1 
ATOM   4347 C CD  . GLN D 2 25  ? 73.653  31.098 141.955 1.00 60.94  ? 25  GLN D CD  1 
ATOM   4348 O OE1 . GLN D 2 25  ? 74.229  30.730 140.925 1.00 77.04  ? 25  GLN D OE1 1 
ATOM   4349 N NE2 . GLN D 2 25  ? 73.033  30.255 142.770 1.00 68.83  ? 25  GLN D NE2 1 
ATOM   4350 N N   . TRP D 2 26  ? 76.580  35.401 142.905 1.00 35.81  ? 26  TRP D N   1 
ATOM   4351 C CA  . TRP D 2 26  ? 77.260  36.315 141.969 1.00 35.42  ? 26  TRP D CA  1 
ATOM   4352 C C   . TRP D 2 26  ? 78.621  35.784 141.532 1.00 43.96  ? 26  TRP D C   1 
ATOM   4353 O O   . TRP D 2 26  ? 79.059  34.743 142.025 1.00 49.90  ? 26  TRP D O   1 
ATOM   4354 C CB  . TRP D 2 26  ? 77.495  37.662 142.663 1.00 22.12  ? 26  TRP D CB  1 
ATOM   4355 C CG  . TRP D 2 26  ? 78.231  37.513 143.964 1.00 33.76  ? 26  TRP D CG  1 
ATOM   4356 C CD1 . TRP D 2 26  ? 79.589  37.376 144.148 1.00 31.59  ? 26  TRP D CD1 1 
ATOM   4357 C CD2 . TRP D 2 26  ? 77.643  37.388 145.259 1.00 45.86  ? 26  TRP D CD2 1 
ATOM   4358 N NE1 . TRP D 2 26  ? 79.872  37.161 145.480 1.00 32.32  ? 26  TRP D NE1 1 
ATOM   4359 C CE2 . TRP D 2 26  ? 78.694  37.167 146.183 1.00 40.40  ? 26  TRP D CE2 1 
ATOM   4360 C CE3 . TRP D 2 26  ? 76.325  37.432 145.732 1.00 45.98  ? 26  TRP D CE3 1 
ATOM   4361 C CZ2 . TRP D 2 26  ? 78.463  36.995 147.544 1.00 33.73  ? 26  TRP D CZ2 1 
ATOM   4362 C CZ3 . TRP D 2 26  ? 76.099  37.259 147.085 1.00 45.71  ? 26  TRP D CZ3 1 
ATOM   4363 C CH2 . TRP D 2 26  ? 77.164  37.044 147.976 1.00 28.58  ? 26  TRP D CH2 1 
ATOM   4364 N N   . GLU D 2 27  ? 79.296  36.537 140.653 1.00 53.35  ? 27  GLU D N   1 
ATOM   4365 C CA  . GLU D 2 27  ? 80.645  36.214 140.158 1.00 61.02  ? 27  GLU D CA  1 
ATOM   4366 C C   . GLU D 2 27  ? 81.634  37.305 140.601 1.00 54.39  ? 27  GLU D C   1 
ATOM   4367 O O   . GLU D 2 27  ? 81.552  38.450 140.141 1.00 59.22  ? 27  GLU D O   1 
ATOM   4368 C CB  . GLU D 2 27  ? 80.650  36.102 138.623 1.00 89.58  ? 27  GLU D CB  1 
ATOM   4369 C CG  . GLU D 2 27  ? 82.042  35.930 137.967 1.00 125.09 ? 27  GLU D CG  1 
ATOM   4370 C CD  . GLU D 2 27  ? 82.792  34.667 138.404 1.00 143.57 ? 27  GLU D CD  1 
ATOM   4371 O OE1 . GLU D 2 27  ? 82.260  33.547 138.233 1.00 155.39 ? 27  GLU D OE1 1 
ATOM   4372 O OE2 . GLU D 2 27  ? 83.933  34.796 138.900 1.00 156.78 ? 27  GLU D OE2 1 
ATOM   4373 N N   . PRO D 2 28  ? 82.558  36.972 141.523 1.00 46.15  ? 28  PRO D N   1 
ATOM   4374 C CA  . PRO D 2 28  ? 83.552  37.929 142.020 1.00 53.05  ? 28  PRO D CA  1 
ATOM   4375 C C   . PRO D 2 28  ? 84.635  38.264 140.994 1.00 62.54  ? 28  PRO D C   1 
ATOM   4376 O O   . PRO D 2 28  ? 85.000  39.424 140.817 1.00 69.87  ? 28  PRO D O   1 
ATOM   4377 C CB  . PRO D 2 28  ? 84.130  37.216 143.246 1.00 48.18  ? 28  PRO D CB  1 
ATOM   4378 C CG  . PRO D 2 28  ? 84.006  35.770 142.907 1.00 32.34  ? 28  PRO D CG  1 
ATOM   4379 C CD  . PRO D 2 28  ? 82.647  35.695 142.255 1.00 44.10  ? 28  PRO D CD  1 
ATOM   4380 N N   . GLY D 2 29  ? 85.136  37.240 140.315 1.00 72.79  ? 29  GLY D N   1 
ATOM   4381 C CA  . GLY D 2 29  ? 86.167  37.439 139.316 1.00 82.72  ? 29  GLY D CA  1 
ATOM   4382 C C   . GLY D 2 29  ? 87.565  37.232 139.871 1.00 87.81  ? 29  GLY D C   1 
ATOM   4383 O O   . GLY D 2 29  ? 87.803  36.296 140.638 1.00 89.19  ? 29  GLY D O   1 
ATOM   4384 N N   . PRO D 2 30  ? 88.517  38.091 139.478 1.00 89.58  ? 30  PRO D N   1 
ATOM   4385 C CA  . PRO D 2 30  ? 89.917  38.056 139.899 1.00 93.60  ? 30  PRO D CA  1 
ATOM   4386 C C   . PRO D 2 30  ? 90.144  37.699 141.365 1.00 101.71 ? 30  PRO D C   1 
ATOM   4387 O O   . PRO D 2 30  ? 89.643  38.367 142.268 1.00 105.62 ? 30  PRO D O   1 
ATOM   4388 C CB  . PRO D 2 30  ? 90.383  39.467 139.574 1.00 94.62  ? 30  PRO D CB  1 
ATOM   4389 C CG  . PRO D 2 30  ? 89.671  39.727 138.276 1.00 91.61  ? 30  PRO D CG  1 
ATOM   4390 C CD  . PRO D 2 30  ? 88.279  39.213 138.547 1.00 88.19  ? 30  PRO D CD  1 
ATOM   4391 N N   . GLU D 2 31  ? 90.895  36.626 141.583 1.00 112.20 ? 31  GLU D N   1 
ATOM   4392 C CA  . GLU D 2 31  ? 91.218  36.158 142.923 1.00 126.47 ? 31  GLU D CA  1 
ATOM   4393 C C   . GLU D 2 31  ? 92.255  37.097 143.537 1.00 126.08 ? 31  GLU D C   1 
ATOM   4394 O O   . GLU D 2 31  ? 93.452  36.973 143.270 1.00 132.15 ? 31  GLU D O   1 
ATOM   4395 C CB  . GLU D 2 31  ? 91.751  34.714 142.849 1.00 140.87 ? 31  GLU D CB  1 
ATOM   4396 C CG  . GLU D 2 31  ? 92.489  34.188 144.094 1.00 161.90 ? 31  GLU D CG  1 
ATOM   4397 C CD  . GLU D 2 31  ? 91.605  34.030 145.320 1.00 172.26 ? 31  GLU D CD  1 
ATOM   4398 O OE1 . GLU D 2 31  ? 90.411  33.688 145.167 1.00 180.61 ? 31  GLU D OE1 1 
ATOM   4399 O OE2 . GLU D 2 31  ? 92.116  34.232 146.443 1.00 177.72 ? 31  GLU D OE2 1 
ATOM   4400 N N   . THR D 2 32  ? 91.789  38.092 144.284 1.00 125.03 ? 32  THR D N   1 
ATOM   4401 C CA  . THR D 2 32  ? 92.697  39.027 144.933 1.00 124.30 ? 32  THR D CA  1 
ATOM   4402 C C   . THR D 2 32  ? 93.413  38.267 146.051 1.00 136.15 ? 32  THR D C   1 
ATOM   4403 O O   . THR D 2 32  ? 92.912  37.256 146.542 1.00 137.17 ? 32  THR D O   1 
ATOM   4404 C CB  . THR D 2 32  ? 91.939  40.235 145.516 1.00 112.69 ? 32  THR D CB  1 
ATOM   4405 O OG1 . THR D 2 32  ? 91.115  40.821 144.503 1.00 97.57  ? 32  THR D OG1 1 
ATOM   4406 C CG2 . THR D 2 32  ? 92.910  41.282 146.001 1.00 107.83 ? 32  THR D CG2 1 
ATOM   4407 N N   . HIS D 2 33  ? 94.586  38.748 146.446 1.00 149.21 ? 33  HIS D N   1 
ATOM   4408 C CA  . HIS D 2 33  ? 95.375  38.103 147.494 1.00 165.54 ? 33  HIS D CA  1 
ATOM   4409 C C   . HIS D 2 33  ? 95.215  38.817 148.851 1.00 160.13 ? 33  HIS D C   1 
ATOM   4410 O O   . HIS D 2 33  ? 96.024  38.618 149.759 1.00 164.15 ? 33  HIS D O   1 
ATOM   4411 C CB  . HIS D 2 33  ? 96.850  38.076 147.042 1.00 192.54 ? 33  HIS D CB  1 
ATOM   4412 C CG  . HIS D 2 33  ? 97.784  37.366 147.978 1.00 219.73 ? 33  HIS D CG  1 
ATOM   4413 N ND1 . HIS D 2 33  ? 97.367  36.410 148.880 1.00 232.37 ? 33  HIS D ND1 1 
ATOM   4414 C CD2 . HIS D 2 33  ? 99.125  37.477 148.145 1.00 230.09 ? 33  HIS D CD2 1 
ATOM   4415 C CE1 . HIS D 2 33  ? 98.407  35.964 149.562 1.00 240.11 ? 33  HIS D CE1 1 
ATOM   4416 N NE2 . HIS D 2 33  ? 99.486  36.596 149.135 1.00 238.68 ? 33  HIS D NE2 1 
ATOM   4417 N N   . LEU D 2 34  ? 94.132  39.579 149.013 1.00 150.18 ? 34  LEU D N   1 
ATOM   4418 C CA  . LEU D 2 34  ? 93.890  40.341 150.246 1.00 138.80 ? 34  LEU D CA  1 
ATOM   4419 C C   . LEU D 2 34  ? 92.524  40.101 150.900 1.00 132.44 ? 34  LEU D C   1 
ATOM   4420 O O   . LEU D 2 34  ? 91.549  39.794 150.214 1.00 131.14 ? 34  LEU D O   1 
ATOM   4421 C CB  . LEU D 2 34  ? 94.032  41.836 149.950 1.00 136.17 ? 34  LEU D CB  1 
ATOM   4422 C CG  . LEU D 2 34  ? 95.365  42.302 149.362 1.00 135.96 ? 34  LEU D CG  1 
ATOM   4423 C CD1 . LEU D 2 34  ? 95.238  43.721 148.831 1.00 132.62 ? 34  LEU D CD1 1 
ATOM   4424 C CD2 . LEU D 2 34  ? 96.461  42.202 150.420 1.00 139.12 ? 34  LEU D CD2 1 
ATOM   4425 N N   . PRO D 2 35  ? 92.436  40.267 152.237 1.00 127.98 ? 35  PRO D N   1 
ATOM   4426 C CA  . PRO D 2 35  ? 91.208  40.083 153.029 1.00 123.05 ? 35  PRO D CA  1 
ATOM   4427 C C   . PRO D 2 35  ? 90.014  40.931 152.552 1.00 115.34 ? 35  PRO D C   1 
ATOM   4428 O O   . PRO D 2 35  ? 89.803  42.064 153.009 1.00 117.47 ? 35  PRO D O   1 
ATOM   4429 C CB  . PRO D 2 35  ? 91.654  40.476 154.440 1.00 125.95 ? 35  PRO D CB  1 
ATOM   4430 C CG  . PRO D 2 35  ? 93.081  40.032 154.466 1.00 128.93 ? 35  PRO D CG  1 
ATOM   4431 C CD  . PRO D 2 35  ? 93.584  40.529 153.126 1.00 130.06 ? 35  PRO D CD  1 
ATOM   4432 N N   . THR D 2 36  ? 89.229  40.351 151.649 1.00 99.59  ? 36  THR D N   1 
ATOM   4433 C CA  . THR D 2 36  ? 88.065  41.010 151.080 1.00 84.45  ? 36  THR D CA  1 
ATOM   4434 C C   . THR D 2 36  ? 86.774  40.477 151.713 1.00 75.88  ? 36  THR D C   1 
ATOM   4435 O O   . THR D 2 36  ? 86.796  39.508 152.478 1.00 79.84  ? 36  THR D O   1 
ATOM   4436 C CB  . THR D 2 36  ? 88.041  40.811 149.548 1.00 81.28  ? 36  THR D CB  1 
ATOM   4437 O OG1 . THR D 2 36  ? 87.018  41.622 148.961 1.00 78.14  ? 36  THR D OG1 1 
ATOM   4438 C CG2 . THR D 2 36  ? 87.795  39.357 149.207 1.00 79.00  ? 36  THR D CG2 1 
ATOM   4439 N N   . SER D 2 37  ? 85.652  41.098 151.370 1.00 58.92  ? 37  SER D N   1 
ATOM   4440 C CA  . SER D 2 37  ? 84.357  40.713 151.912 1.00 50.67  ? 37  SER D CA  1 
ATOM   4441 C C   . SER D 2 37  ? 83.217  41.139 150.986 1.00 52.67  ? 37  SER D C   1 
ATOM   4442 O O   . SER D 2 37  ? 83.260  42.219 150.397 1.00 64.53  ? 37  SER D O   1 
ATOM   4443 C CB  . SER D 2 37  ? 84.155  41.369 153.278 1.00 50.87  ? 37  SER D CB  1 
ATOM   4444 O OG  . SER D 2 37  ? 83.853  42.748 153.141 1.00 49.17  ? 37  SER D OG  1 
ATOM   4445 N N   . PHE D 2 38  ? 82.183  40.308 150.891 1.00 47.61  ? 38  PHE D N   1 
ATOM   4446 C CA  . PHE D 2 38  ? 81.031  40.598 150.041 1.00 36.73  ? 38  PHE D CA  1 
ATOM   4447 C C   . PHE D 2 38  ? 79.774  40.758 150.890 1.00 38.51  ? 38  PHE D C   1 
ATOM   4448 O O   . PHE D 2 38  ? 79.484  39.931 151.753 1.00 41.92  ? 38  PHE D O   1 
ATOM   4449 C CB  . PHE D 2 38  ? 80.801  39.458 149.057 1.00 41.13  ? 38  PHE D CB  1 
ATOM   4450 C CG  . PHE D 2 38  ? 81.973  39.164 148.155 1.00 46.26  ? 38  PHE D CG  1 
ATOM   4451 C CD1 . PHE D 2 38  ? 82.969  38.266 148.546 1.00 45.18  ? 38  PHE D CD1 1 
ATOM   4452 C CD2 . PHE D 2 38  ? 82.057  39.750 146.892 1.00 42.59  ? 38  PHE D CD2 1 
ATOM   4453 C CE1 . PHE D 2 38  ? 84.028  37.958 147.692 1.00 37.88  ? 38  PHE D CE1 1 
ATOM   4454 C CE2 . PHE D 2 38  ? 83.109  39.447 146.035 1.00 37.76  ? 38  PHE D CE2 1 
ATOM   4455 C CZ  . PHE D 2 38  ? 84.098  38.548 146.438 1.00 35.25  ? 38  PHE D CZ  1 
ATOM   4456 N N   . ILE D 2 39  ? 79.017  41.814 150.641 1.00 38.08  ? 39  ILE D N   1 
ATOM   4457 C CA  . ILE D 2 39  ? 77.800  42.053 151.391 1.00 40.08  ? 39  ILE D CA  1 
ATOM   4458 C C   . ILE D 2 39  ? 76.638  42.268 150.437 1.00 47.40  ? 39  ILE D C   1 
ATOM   4459 O O   . ILE D 2 39  ? 76.669  43.179 149.597 1.00 53.45  ? 39  ILE D O   1 
ATOM   4460 C CB  . ILE D 2 39  ? 77.929  43.286 152.291 1.00 39.48  ? 39  ILE D CB  1 
ATOM   4461 C CG1 . ILE D 2 39  ? 78.951  43.031 153.396 1.00 49.55  ? 39  ILE D CG1 1 
ATOM   4462 C CG2 . ILE D 2 39  ? 76.583  43.634 152.892 1.00 46.50  ? 39  ILE D CG2 1 
ATOM   4463 C CD1 . ILE D 2 39  ? 79.141  44.214 154.342 1.00 64.07  ? 39  ILE D CD1 1 
ATOM   4464 N N   . LEU D 2 40  ? 75.637  41.400 150.539 1.00 42.45  ? 40  LEU D N   1 
ATOM   4465 C CA  . LEU D 2 40  ? 74.452  41.500 149.706 1.00 35.81  ? 40  LEU D CA  1 
ATOM   4466 C C   . LEU D 2 40  ? 73.609  42.583 150.357 1.00 34.43  ? 40  LEU D C   1 
ATOM   4467 O O   . LEU D 2 40  ? 73.142  42.427 151.492 1.00 36.92  ? 40  LEU D O   1 
ATOM   4468 C CB  . LEU D 2 40  ? 73.715  40.162 149.692 1.00 36.05  ? 40  LEU D CB  1 
ATOM   4469 C CG  . LEU D 2 40  ? 72.474  40.062 148.815 1.00 29.88  ? 40  LEU D CG  1 
ATOM   4470 C CD1 . LEU D 2 40  ? 72.817  40.439 147.409 1.00 33.71  ? 40  LEU D CD1 1 
ATOM   4471 C CD2 . LEU D 2 40  ? 71.936  38.647 148.864 1.00 45.89  ? 40  LEU D CD2 1 
ATOM   4472 N N   . LYS D 2 41  ? 73.499  43.711 149.676 1.00 27.92  ? 41  LYS D N   1 
ATOM   4473 C CA  . LYS D 2 41  ? 72.742  44.819 150.206 1.00 33.10  ? 41  LYS D CA  1 
ATOM   4474 C C   . LYS D 2 41  ? 71.446  44.958 149.455 1.00 25.60  ? 41  LYS D C   1 
ATOM   4475 O O   . LYS D 2 41  ? 71.364  44.623 148.276 1.00 16.95  ? 41  LYS D O   1 
ATOM   4476 C CB  . LYS D 2 41  ? 73.544  46.118 150.096 1.00 43.20  ? 41  LYS D CB  1 
ATOM   4477 C CG  . LYS D 2 41  ? 74.729  46.250 151.057 1.00 51.10  ? 41  LYS D CG  1 
ATOM   4478 C CD  . LYS D 2 41  ? 74.841  47.707 151.536 1.00 68.95  ? 41  LYS D CD  1 
ATOM   4479 C CE  . LYS D 2 41  ? 75.966  47.938 152.548 1.00 79.09  ? 41  LYS D CE  1 
ATOM   4480 N NZ  . LYS D 2 41  ? 75.936  49.317 153.144 1.00 82.78  ? 41  LYS D NZ  1 
ATOM   4481 N N   . SER D 2 42  ? 70.446  45.512 150.122 1.00 28.62  ? 42  SER D N   1 
ATOM   4482 C CA  . SER D 2 42  ? 69.152  45.695 149.492 1.00 24.91  ? 42  SER D CA  1 
ATOM   4483 C C   . SER D 2 42  ? 68.231  46.649 150.257 1.00 28.21  ? 42  SER D C   1 
ATOM   4484 O O   . SER D 2 42  ? 68.477  46.974 151.424 1.00 36.60  ? 42  SER D O   1 
ATOM   4485 C CB  . SER D 2 42  ? 68.488  44.334 149.355 1.00 16.70  ? 42  SER D CB  1 
ATOM   4486 O OG  . SER D 2 42  ? 68.653  43.607 150.563 1.00 23.66  ? 42  SER D OG  1 
ATOM   4487 N N   . PHE D 2 43  ? 67.205  47.137 149.565 1.00 25.33  ? 43  PHE D N   1 
ATOM   4488 C CA  . PHE D 2 43  ? 66.204  48.019 150.143 1.00 24.38  ? 43  PHE D CA  1 
ATOM   4489 C C   . PHE D 2 43  ? 64.852  47.825 149.434 1.00 29.94  ? 43  PHE D C   1 
ATOM   4490 O O   . PHE D 2 43  ? 64.796  47.551 148.226 1.00 30.75  ? 43  PHE D O   1 
ATOM   4491 C CB  . PHE D 2 43  ? 66.663  49.490 150.112 1.00 28.97  ? 43  PHE D CB  1 
ATOM   4492 C CG  . PHE D 2 43  ? 66.810  50.094 148.720 1.00 28.67  ? 43  PHE D CG  1 
ATOM   4493 C CD1 . PHE D 2 43  ? 65.687  50.461 147.956 1.00 33.93  ? 43  PHE D CD1 1 
ATOM   4494 C CD2 . PHE D 2 43  ? 68.075  50.364 148.199 1.00 17.47  ? 43  PHE D CD2 1 
ATOM   4495 C CE1 . PHE D 2 43  ? 65.826  51.093 146.689 1.00 19.38  ? 43  PHE D CE1 1 
ATOM   4496 C CE2 . PHE D 2 43  ? 68.221  50.989 146.943 1.00 12.55  ? 43  PHE D CE2 1 
ATOM   4497 C CZ  . PHE D 2 43  ? 67.087  51.353 146.191 1.00 8.58   ? 43  PHE D CZ  1 
ATOM   4498 N N   . ARG D 2 44  ? 63.768  47.874 150.198 1.00 26.86  ? 44  ARG D N   1 
ATOM   4499 C CA  . ARG D 2 44  ? 62.450  47.725 149.609 1.00 37.34  ? 44  ARG D CA  1 
ATOM   4500 C C   . ARG D 2 44  ? 62.226  48.932 148.702 1.00 33.44  ? 44  ARG D C   1 
ATOM   4501 O O   . ARG D 2 44  ? 62.711  50.014 148.983 1.00 38.04  ? 44  ARG D O   1 
ATOM   4502 C CB  . ARG D 2 44  ? 61.379  47.598 150.696 1.00 43.15  ? 44  ARG D CB  1 
ATOM   4503 C CG  . ARG D 2 44  ? 61.595  46.376 151.604 1.00 62.87  ? 44  ARG D CG  1 
ATOM   4504 C CD  . ARG D 2 44  ? 60.444  46.129 152.571 1.00 72.73  ? 44  ARG D CD  1 
ATOM   4505 N NE  . ARG D 2 44  ? 60.844  45.224 153.643 1.00 86.88  ? 44  ARG D NE  1 
ATOM   4506 C CZ  . ARG D 2 44  ? 60.097  44.941 154.705 1.00 99.90  ? 44  ARG D CZ  1 
ATOM   4507 N NH1 . ARG D 2 44  ? 58.895  45.485 154.842 1.00 104.07 ? 44  ARG D NH1 1 
ATOM   4508 N NH2 . ARG D 2 44  ? 60.570  44.143 155.654 1.00 114.74 ? 44  ARG D NH2 1 
ATOM   4509 N N   . SER D 2 45  ? 61.516  48.744 147.604 1.00 26.82  ? 45  SER D N   1 
ATOM   4510 C CA  . SER D 2 45  ? 61.308  49.826 146.663 1.00 21.56  ? 45  SER D CA  1 
ATOM   4511 C C   . SER D 2 45  ? 59.950  49.610 146.001 1.00 23.09  ? 45  SER D C   1 
ATOM   4512 O O   . SER D 2 45  ? 59.080  49.013 146.628 1.00 34.17  ? 45  SER D O   1 
ATOM   4513 C CB  . SER D 2 45  ? 62.440  49.782 145.642 1.00 27.67  ? 45  SER D CB  1 
ATOM   4514 O OG  . SER D 2 45  ? 62.328  50.822 144.704 1.00 27.80  ? 45  SER D OG  1 
ATOM   4515 N N   . ARG D 2 46  ? 59.730  50.152 144.800 1.00 8.38   ? 46  ARG D N   1 
ATOM   4516 C CA  . ARG D 2 46  ? 58.464  49.956 144.073 1.00 28.52  ? 46  ARG D CA  1 
ATOM   4517 C C   . ARG D 2 46  ? 58.907  49.592 142.677 1.00 31.78  ? 46  ARG D C   1 
ATOM   4518 O O   . ARG D 2 46  ? 60.112  49.564 142.437 1.00 35.79  ? 46  ARG D O   1 
ATOM   4519 C CB  . ARG D 2 46  ? 57.567  51.201 144.059 1.00 38.82  ? 46  ARG D CB  1 
ATOM   4520 C CG  . ARG D 2 46  ? 56.885  51.510 145.402 1.00 56.21  ? 46  ARG D CG  1 
ATOM   4521 C CD  . ARG D 2 46  ? 55.357  51.266 145.406 1.00 61.72  ? 46  ARG D CD  1 
ATOM   4522 N NE  . ARG D 2 46  ? 54.673  52.138 146.376 1.00 88.87  ? 46  ARG D NE  1 
ATOM   4523 C CZ  . ARG D 2 46  ? 54.512  53.467 146.239 1.00 107.24 ? 46  ARG D CZ  1 
ATOM   4524 N NH1 . ARG D 2 46  ? 54.973  54.114 145.165 1.00 120.41 ? 46  ARG D NH1 1 
ATOM   4525 N NH2 . ARG D 2 46  ? 53.918  54.173 147.200 1.00 106.36 ? 46  ARG D NH2 1 
ATOM   4526 N N   . ALA D 2 47  ? 57.978  49.275 141.767 1.00 38.45  ? 47  ALA D N   1 
ATOM   4527 C CA  . ALA D 2 47  ? 58.371  48.879 140.400 1.00 37.98  ? 47  ALA D CA  1 
ATOM   4528 C C   . ALA D 2 47  ? 59.372  49.858 139.790 1.00 39.72  ? 47  ALA D C   1 
ATOM   4529 O O   . ALA D 2 47  ? 59.383  51.049 140.130 1.00 47.76  ? 47  ALA D O   1 
ATOM   4530 C CB  . ALA D 2 47  ? 57.144  48.693 139.490 1.00 27.74  ? 47  ALA D CB  1 
ATOM   4531 N N   . ASP D 2 48  ? 60.271  49.323 138.969 1.00 51.32  ? 48  ASP D N   1 
ATOM   4532 C CA  . ASP D 2 48  ? 61.319  50.110 138.306 1.00 60.65  ? 48  ASP D CA  1 
ATOM   4533 C C   . ASP D 2 48  ? 62.422  50.553 139.286 1.00 59.36  ? 48  ASP D C   1 
ATOM   4534 O O   . ASP D 2 48  ? 63.413  51.154 138.884 1.00 66.16  ? 48  ASP D O   1 
ATOM   4535 C CB  . ASP D 2 48  ? 60.722  51.314 137.552 1.00 71.43  ? 48  ASP D CB  1 
ATOM   4536 C CG  . ASP D 2 48  ? 59.652  50.909 136.518 1.00 88.57  ? 48  ASP D CG  1 
ATOM   4537 O OD1 . ASP D 2 48  ? 59.447  49.694 136.269 1.00 100.24 ? 48  ASP D OD1 1 
ATOM   4538 O OD2 . ASP D 2 48  ? 59.004  51.820 135.953 1.00 97.72  ? 48  ASP D OD2 1 
ATOM   4539 N N   . CYS D 2 49  ? 62.258  50.197 140.559 1.00 57.15  ? 49  CYS D N   1 
ATOM   4540 C CA  . CYS D 2 49  ? 63.203  50.508 141.637 1.00 57.07  ? 49  CYS D CA  1 
ATOM   4541 C C   . CYS D 2 49  ? 63.684  51.970 141.814 1.00 62.68  ? 49  CYS D C   1 
ATOM   4542 O O   . CYS D 2 49  ? 64.827  52.231 142.209 1.00 59.28  ? 49  CYS D O   1 
ATOM   4543 C CB  . CYS D 2 49  ? 64.363  49.491 141.653 1.00 52.83  ? 49  CYS D CB  1 
ATOM   4544 S SG  . CYS D 2 49  ? 63.903  47.789 142.185 1.00 49.51  ? 49  CYS D SG  1 
ATOM   4545 N N   . GLN D 2 50  ? 62.766  52.914 141.598 1.00 71.14  ? 50  GLN D N   1 
ATOM   4546 C CA  . GLN D 2 50  ? 63.038  54.341 141.770 1.00 77.52  ? 50  GLN D CA  1 
ATOM   4547 C C   . GLN D 2 50  ? 62.104  54.800 142.889 1.00 76.55  ? 50  GLN D C   1 
ATOM   4548 O O   . GLN D 2 50  ? 60.922  55.096 142.669 1.00 81.30  ? 50  GLN D O   1 
ATOM   4549 C CB  . GLN D 2 50  ? 62.785  55.102 140.465 1.00 92.41  ? 50  GLN D CB  1 
ATOM   4550 C CG  . GLN D 2 50  ? 63.861  54.855 139.404 1.00 111.42 ? 50  GLN D CG  1 
ATOM   4551 C CD  . GLN D 2 50  ? 63.497  55.392 138.030 1.00 121.51 ? 50  GLN D CD  1 
ATOM   4552 O OE1 . GLN D 2 50  ? 62.400  55.908 137.817 1.00 130.38 ? 50  GLN D OE1 1 
ATOM   4553 N NE2 . GLN D 2 50  ? 64.419  55.261 137.085 1.00 127.48 ? 50  GLN D NE2 1 
ATOM   4554 N N   . TYR D 2 51  ? 62.648  54.752 144.101 1.00 67.69  ? 51  TYR D N   1 
ATOM   4555 C CA  . TYR D 2 51  ? 61.963  55.095 145.347 1.00 60.01  ? 51  TYR D CA  1 
ATOM   4556 C C   . TYR D 2 51  ? 62.877  54.360 146.286 1.00 46.73  ? 51  TYR D C   1 
ATOM   4557 O O   . TYR D 2 51  ? 62.808  53.150 146.369 1.00 44.55  ? 51  TYR D O   1 
ATOM   4558 C CB  . TYR D 2 51  ? 60.561  54.452 145.400 1.00 71.40  ? 51  TYR D CB  1 
ATOM   4559 C CG  . TYR D 2 51  ? 59.870  54.479 146.758 1.00 93.02  ? 51  TYR D CG  1 
ATOM   4560 C CD1 . TYR D 2 51  ? 58.699  55.207 146.953 1.00 102.34 ? 51  TYR D CD1 1 
ATOM   4561 C CD2 . TYR D 2 51  ? 60.363  53.739 147.833 1.00 100.00 ? 51  TYR D CD2 1 
ATOM   4562 C CE1 . TYR D 2 51  ? 58.034  55.192 148.187 1.00 111.18 ? 51  TYR D CE1 1 
ATOM   4563 C CE2 . TYR D 2 51  ? 59.711  53.717 149.063 1.00 109.57 ? 51  TYR D CE2 1 
ATOM   4564 C CZ  . TYR D 2 51  ? 58.548  54.441 149.237 1.00 114.70 ? 51  TYR D CZ  1 
ATOM   4565 O OH  . TYR D 2 51  ? 57.904  54.396 150.456 1.00 119.88 ? 51  TYR D OH  1 
ATOM   4566 N N   . GLN D 2 52  ? 63.818  55.046 146.901 1.00 46.02  ? 52  GLN D N   1 
ATOM   4567 C CA  . GLN D 2 52  ? 64.711  54.334 147.789 1.00 53.75  ? 52  GLN D CA  1 
ATOM   4568 C C   . GLN D 2 52  ? 63.975  54.136 149.107 1.00 54.44  ? 52  GLN D C   1 
ATOM   4569 O O   . GLN D 2 52  ? 63.888  55.056 149.916 1.00 61.38  ? 52  GLN D O   1 
ATOM   4570 C CB  . GLN D 2 52  ? 66.039  55.088 147.955 1.00 61.61  ? 52  GLN D CB  1 
ATOM   4571 C CG  . GLN D 2 52  ? 67.134  54.283 148.652 1.00 74.39  ? 52  GLN D CG  1 
ATOM   4572 C CD  . GLN D 2 52  ? 68.543  54.804 148.371 1.00 86.78  ? 52  GLN D CD  1 
ATOM   4573 O OE1 . GLN D 2 52  ? 68.814  55.371 147.308 1.00 91.58  ? 52  GLN D OE1 1 
ATOM   4574 N NE2 . GLN D 2 52  ? 69.455  54.579 149.314 1.00 91.51  ? 52  GLN D NE2 1 
ATOM   4575 N N   . GLY D 2 53  ? 63.368  52.957 149.256 1.00 55.53  ? 53  GLY D N   1 
ATOM   4576 C CA  . GLY D 2 53  ? 62.612  52.592 150.454 1.00 42.48  ? 53  GLY D CA  1 
ATOM   4577 C C   . GLY D 2 53  ? 63.388  52.041 151.648 1.00 40.15  ? 53  GLY D C   1 
ATOM   4578 O O   . GLY D 2 53  ? 64.605  52.232 151.772 1.00 45.95  ? 53  GLY D O   1 
ATOM   4579 N N   . ASP D 2 54  ? 62.701  51.310 152.520 1.00 37.57  ? 54  ASP D N   1 
ATOM   4580 C CA  . ASP D 2 54  ? 63.353  50.792 153.719 1.00 44.17  ? 54  ASP D CA  1 
ATOM   4581 C C   . ASP D 2 54  ? 64.527  49.851 153.465 1.00 35.20  ? 54  ASP D C   1 
ATOM   4582 O O   . ASP D 2 54  ? 64.432  48.917 152.692 1.00 46.99  ? 54  ASP D O   1 
ATOM   4583 C CB  . ASP D 2 54  ? 62.328  50.148 154.662 1.00 60.80  ? 54  ASP D CB  1 
ATOM   4584 C CG  . ASP D 2 54  ? 62.795  50.137 156.114 1.00 76.57  ? 54  ASP D CG  1 
ATOM   4585 O OD1 . ASP D 2 54  ? 63.303  51.182 156.577 1.00 86.00  ? 54  ASP D OD1 1 
ATOM   4586 O OD2 . ASP D 2 54  ? 62.654  49.093 156.794 1.00 80.50  ? 54  ASP D OD2 1 
ATOM   4587 N N   . THR D 2 55  ? 65.647  50.133 154.106 1.00 33.45  ? 55  THR D N   1 
ATOM   4588 C CA  . THR D 2 55  ? 66.841  49.319 153.982 1.00 35.17  ? 55  THR D CA  1 
ATOM   4589 C C   . THR D 2 55  ? 66.666  47.941 154.603 1.00 36.43  ? 55  THR D C   1 
ATOM   4590 O O   . THR D 2 55  ? 66.279  47.804 155.760 1.00 49.93  ? 55  THR D O   1 
ATOM   4591 C CB  . THR D 2 55  ? 68.055  50.012 154.646 1.00 34.05  ? 55  THR D CB  1 
ATOM   4592 O OG1 . THR D 2 55  ? 68.453  51.131 153.848 1.00 43.98  ? 55  THR D OG1 1 
ATOM   4593 C CG2 . THR D 2 55  ? 69.228  49.049 154.797 1.00 33.82  ? 55  THR D CG2 1 
ATOM   4594 N N   . ILE D 2 56  ? 66.984  46.925 153.818 1.00 30.06  ? 56  ILE D N   1 
ATOM   4595 C CA  . ILE D 2 56  ? 66.903  45.539 154.239 1.00 17.48  ? 56  ILE D CA  1 
ATOM   4596 C C   . ILE D 2 56  ? 68.267  45.209 154.811 1.00 16.97  ? 56  ILE D C   1 
ATOM   4597 O O   . ILE D 2 56  ? 69.300  45.603 154.270 1.00 26.26  ? 56  ILE D O   1 
ATOM   4598 C CB  . ILE D 2 56  ? 66.593  44.606 153.005 1.00 19.67  ? 56  ILE D CB  1 
ATOM   4599 C CG1 . ILE D 2 56  ? 65.243  44.994 152.376 1.00 8.91   ? 56  ILE D CG1 1 
ATOM   4600 C CG2 . ILE D 2 56  ? 66.581  43.139 153.407 1.00 11.02  ? 56  ILE D CG2 1 
ATOM   4601 C CD1 . ILE D 2 56  ? 64.934  44.330 151.078 1.00 14.08  ? 56  ILE D CD1 1 
ATOM   4602 N N   . PRO D 2 57  ? 68.290  44.519 155.943 1.00 16.98  ? 57  PRO D N   1 
ATOM   4603 C CA  . PRO D 2 57  ? 69.528  44.125 156.609 1.00 28.98  ? 57  PRO D CA  1 
ATOM   4604 C C   . PRO D 2 57  ? 70.522  43.526 155.638 1.00 36.14  ? 57  PRO D C   1 
ATOM   4605 O O   . PRO D 2 57  ? 70.164  42.671 154.827 1.00 42.96  ? 57  PRO D O   1 
ATOM   4606 C CB  . PRO D 2 57  ? 69.051  43.062 157.595 1.00 27.18  ? 57  PRO D CB  1 
ATOM   4607 C CG  . PRO D 2 57  ? 67.770  43.588 158.023 1.00 21.32  ? 57  PRO D CG  1 
ATOM   4608 C CD  . PRO D 2 57  ? 67.124  44.083 156.721 1.00 24.67  ? 57  PRO D CD  1 
ATOM   4609 N N   . ASP D 2 58  ? 71.770  43.971 155.728 1.00 47.97  ? 58  ASP D N   1 
ATOM   4610 C CA  . ASP D 2 58  ? 72.818  43.452 154.864 1.00 54.03  ? 58  ASP D CA  1 
ATOM   4611 C C   . ASP D 2 58  ? 72.992  41.966 155.125 1.00 54.98  ? 58  ASP D C   1 
ATOM   4612 O O   . ASP D 2 58  ? 72.832  41.497 156.258 1.00 62.94  ? 58  ASP D O   1 
ATOM   4613 C CB  . ASP D 2 58  ? 74.153  44.139 155.153 1.00 57.05  ? 58  ASP D CB  1 
ATOM   4614 C CG  . ASP D 2 58  ? 74.139  45.607 154.817 1.00 71.66  ? 58  ASP D CG  1 
ATOM   4615 O OD1 . ASP D 2 58  ? 73.176  46.070 154.155 1.00 72.00  ? 58  ASP D OD1 1 
ATOM   4616 O OD2 . ASP D 2 58  ? 75.104  46.294 155.225 1.00 82.91  ? 58  ASP D OD2 1 
ATOM   4617 N N   . CYS D 2 59  ? 73.287  41.222 154.071 1.00 51.14  ? 59  CYS D N   1 
ATOM   4618 C CA  . CYS D 2 59  ? 73.530  39.804 154.219 1.00 49.89  ? 59  CYS D CA  1 
ATOM   4619 C C   . CYS D 2 59  ? 75.022  39.618 153.939 1.00 47.96  ? 59  CYS D C   1 
ATOM   4620 O O   . CYS D 2 59  ? 75.484  39.865 152.816 1.00 46.55  ? 59  CYS D O   1 
ATOM   4621 C CB  . CYS D 2 59  ? 72.692  39.006 153.224 1.00 51.28  ? 59  CYS D CB  1 
ATOM   4622 S SG  . CYS D 2 59  ? 72.684  37.214 153.575 1.00 71.21  ? 59  CYS D SG  1 
ATOM   4623 N N   . VAL D 2 60  ? 75.794  39.293 154.975 1.00 40.83  ? 60  VAL D N   1 
ATOM   4624 C CA  . VAL D 2 60  ? 77.228  39.084 154.799 1.00 34.68  ? 60  VAL D CA  1 
ATOM   4625 C C   . VAL D 2 60  ? 77.498  37.651 154.391 1.00 36.95  ? 60  VAL D C   1 
ATOM   4626 O O   . VAL D 2 60  ? 77.126  36.695 155.092 1.00 44.28  ? 60  VAL D O   1 
ATOM   4627 C CB  . VAL D 2 60  ? 78.049  39.442 156.055 1.00 34.35  ? 60  VAL D CB  1 
ATOM   4628 C CG1 . VAL D 2 60  ? 77.926  40.931 156.348 1.00 32.34  ? 60  VAL D CG1 1 
ATOM   4629 C CG2 . VAL D 2 60  ? 77.604  38.605 157.251 1.00 41.66  ? 60  VAL D CG2 1 
ATOM   4630 N N   . ALA D 2 61  ? 78.106  37.523 153.220 1.00 40.08  ? 61  ALA D N   1 
ATOM   4631 C CA  . ALA D 2 61  ? 78.438  36.233 152.630 1.00 47.45  ? 61  ALA D CA  1 
ATOM   4632 C C   . ALA D 2 61  ? 79.407  35.423 153.467 1.00 55.12  ? 61  ALA D C   1 
ATOM   4633 O O   . ALA D 2 61  ? 80.337  35.971 154.069 1.00 64.41  ? 61  ALA D O   1 
ATOM   4634 C CB  . ALA D 2 61  ? 79.005  36.436 151.246 1.00 44.70  ? 61  ALA D CB  1 
ATOM   4635 N N   . LYS D 2 62  ? 79.189  34.114 153.507 1.00 58.95  ? 62  LYS D N   1 
ATOM   4636 C CA  . LYS D 2 62  ? 80.069  33.255 154.269 1.00 53.06  ? 62  LYS D CA  1 
ATOM   4637 C C   . LYS D 2 62  ? 81.436  33.292 153.602 1.00 51.00  ? 62  LYS D C   1 
ATOM   4638 O O   . LYS D 2 62  ? 81.556  33.598 152.416 1.00 37.53  ? 62  LYS D O   1 
ATOM   4639 C CB  . LYS D 2 62  ? 79.527  31.838 154.326 1.00 46.73  ? 62  LYS D CB  1 
ATOM   4640 N N   . LYS D 2 63  ? 82.459  33.006 154.401 1.00 59.88  ? 63  LYS D N   1 
ATOM   4641 C CA  . LYS D 2 63  ? 83.871  32.987 153.977 1.00 63.94  ? 63  LYS D CA  1 
ATOM   4642 C C   . LYS D 2 63  ? 84.193  32.480 152.542 1.00 63.51  ? 63  LYS D C   1 
ATOM   4643 O O   . LYS D 2 63  ? 84.680  33.265 151.695 1.00 59.80  ? 63  LYS D O   1 
ATOM   4644 C CB  . LYS D 2 63  ? 84.716  32.226 155.027 1.00 72.74  ? 63  LYS D CB  1 
ATOM   4645 N N   . ARG D 2 64  ? 83.952  31.207 152.256 1.00 66.84  ? 64  ARG D N   1 
ATOM   4646 C CA  . ARG D 2 64  ? 84.264  30.706 150.920 1.00 76.77  ? 64  ARG D CA  1 
ATOM   4647 C C   . ARG D 2 64  ? 83.137  30.890 149.902 1.00 78.25  ? 64  ARG D C   1 
ATOM   4648 O O   . ARG D 2 64  ? 83.387  31.244 148.745 1.00 74.14  ? 64  ARG D O   1 
ATOM   4649 C CB  . ARG D 2 64  ? 84.681  29.246 150.992 1.00 79.43  ? 64  ARG D CB  1 
ATOM   4650 N N   . GLN D 2 65  ? 81.905  30.642 150.352 1.00 76.90  ? 65  GLN D N   1 
ATOM   4651 C CA  . GLN D 2 65  ? 80.708  30.734 149.521 1.00 65.93  ? 65  GLN D CA  1 
ATOM   4652 C C   . GLN D 2 65  ? 80.455  32.120 148.956 1.00 53.53  ? 65  GLN D C   1 
ATOM   4653 O O   . GLN D 2 65  ? 80.533  33.108 149.670 1.00 50.32  ? 65  GLN D O   1 
ATOM   4654 C CB  . GLN D 2 65  ? 79.471  30.262 150.303 1.00 73.89  ? 65  GLN D CB  1 
ATOM   4655 C CG  . GLN D 2 65  ? 79.347  28.739 150.455 1.00 96.27  ? 65  GLN D CG  1 
ATOM   4656 C CD  . GLN D 2 65  ? 79.132  27.999 149.126 1.00 107.47 ? 65  GLN D CD  1 
ATOM   4657 O OE1 . GLN D 2 65  ? 79.903  28.153 148.179 1.00 108.86 ? 65  GLN D OE1 1 
ATOM   4658 N NE2 . GLN D 2 65  ? 78.084  27.185 149.066 1.00 111.67 ? 65  GLN D NE2 1 
ATOM   4659 N N   . ASN D 2 66  ? 80.181  32.177 147.657 1.00 46.14  ? 66  ASN D N   1 
ATOM   4660 C CA  . ASN D 2 66  ? 79.881  33.431 146.979 1.00 44.60  ? 66  ASN D CA  1 
ATOM   4661 C C   . ASN D 2 66  ? 78.391  33.504 146.684 1.00 44.55  ? 66  ASN D C   1 
ATOM   4662 O O   . ASN D 2 66  ? 77.957  33.415 145.528 1.00 43.01  ? 66  ASN D O   1 
ATOM   4663 C CB  . ASN D 2 66  ? 80.697  33.578 145.698 1.00 55.21  ? 66  ASN D CB  1 
ATOM   4664 C CG  . ASN D 2 66  ? 81.951  34.405 145.911 1.00 70.58  ? 66  ASN D CG  1 
ATOM   4665 O OD1 . ASN D 2 66  ? 81.887  35.550 146.389 1.00 67.32  ? 66  ASN D OD1 1 
ATOM   4666 N ND2 . ASN D 2 66  ? 83.105  33.830 145.574 1.00 66.80  ? 66  ASN D ND2 1 
ATOM   4667 N N   . ASN D 2 67  ? 77.626  33.625 147.771 1.00 41.52  ? 67  ASN D N   1 
ATOM   4668 C CA  . ASN D 2 67  ? 76.161  33.713 147.778 1.00 27.94  ? 67  ASN D CA  1 
ATOM   4669 C C   . ASN D 2 67  ? 75.690  34.033 149.201 1.00 27.70  ? 67  ASN D C   1 
ATOM   4670 O O   . ASN D 2 67  ? 76.414  33.793 150.178 1.00 31.45  ? 67  ASN D O   1 
ATOM   4671 C CB  . ASN D 2 67  ? 75.523  32.389 147.327 1.00 28.91  ? 67  ASN D CB  1 
ATOM   4672 C CG  . ASN D 2 67  ? 75.843  31.204 148.268 1.00 39.58  ? 67  ASN D CG  1 
ATOM   4673 O OD1 . ASN D 2 67  ? 75.511  31.221 149.456 1.00 45.93  ? 67  ASN D OD1 1 
ATOM   4674 N ND2 . ASN D 2 67  ? 76.453  30.156 147.716 1.00 34.88  ? 67  ASN D ND2 1 
ATOM   4675 N N   . CYS D 2 68  ? 74.503  34.611 149.316 1.00 21.28  ? 68  CYS D N   1 
ATOM   4676 C CA  . CYS D 2 68  ? 73.948  34.925 150.612 1.00 29.78  ? 68  CYS D CA  1 
ATOM   4677 C C   . CYS D 2 68  ? 72.450  34.746 150.447 1.00 28.22  ? 68  CYS D C   1 
ATOM   4678 O O   . CYS D 2 68  ? 71.928  34.864 149.346 1.00 36.26  ? 68  CYS D O   1 
ATOM   4679 C CB  . CYS D 2 68  ? 74.312  36.350 151.079 1.00 38.53  ? 68  CYS D CB  1 
ATOM   4680 S SG  . CYS D 2 68  ? 74.481  36.525 152.911 1.00 72.60  ? 68  CYS D SG  1 
ATOM   4681 N N   . SER D 2 69  ? 71.774  34.471 151.554 1.00 27.33  ? 69  SER D N   1 
ATOM   4682 C CA  . SER D 2 69  ? 70.346  34.235 151.587 1.00 16.16  ? 69  SER D CA  1 
ATOM   4683 C C   . SER D 2 69  ? 69.613  35.248 152.455 1.00 19.00  ? 69  SER D C   1 
ATOM   4684 O O   . SER D 2 69  ? 69.983  35.447 153.611 1.00 39.07  ? 69  SER D O   1 
ATOM   4685 C CB  . SER D 2 69  ? 70.127  32.843 152.169 1.00 11.38  ? 69  SER D CB  1 
ATOM   4686 O OG  . SER D 2 69  ? 68.762  32.538 152.297 1.00 38.13  ? 69  SER D OG  1 
ATOM   4687 N N   . ILE D 2 70  ? 68.584  35.890 151.910 1.00 15.21  ? 70  ILE D N   1 
ATOM   4688 C CA  . ILE D 2 70  ? 67.777  36.836 152.691 1.00 18.36  ? 70  ILE D CA  1 
ATOM   4689 C C   . ILE D 2 70  ? 66.541  36.086 153.196 1.00 18.86  ? 70  ILE D C   1 
ATOM   4690 O O   . ILE D 2 70  ? 65.694  35.694 152.403 1.00 21.58  ? 70  ILE D O   1 
ATOM   4691 C CB  . ILE D 2 70  ? 67.303  38.027 151.857 1.00 13.74  ? 70  ILE D CB  1 
ATOM   4692 C CG1 . ILE D 2 70  ? 68.497  38.783 151.311 1.00 9.96   ? 70  ILE D CG1 1 
ATOM   4693 C CG2 . ILE D 2 70  ? 66.463  38.987 152.714 1.00 12.55  ? 70  ILE D CG2 1 
ATOM   4694 C CD1 . ILE D 2 70  ? 68.081  39.854 150.334 1.00 29.85  ? 70  ILE D CD1 1 
ATOM   4695 N N   . PRO D 2 71  ? 66.401  35.929 154.523 1.00 18.05  ? 71  PRO D N   1 
ATOM   4696 C CA  . PRO D 2 71  ? 65.266  35.217 155.104 1.00 16.28  ? 71  PRO D CA  1 
ATOM   4697 C C   . PRO D 2 71  ? 63.989  35.963 154.784 1.00 14.43  ? 71  PRO D C   1 
ATOM   4698 O O   . PRO D 2 71  ? 63.988  37.191 154.745 1.00 9.74   ? 71  PRO D O   1 
ATOM   4699 C CB  . PRO D 2 71  ? 65.598  35.237 156.591 1.00 15.47  ? 71  PRO D CB  1 
ATOM   4700 C CG  . PRO D 2 71  ? 66.185  36.581 156.742 1.00 15.88  ? 71  PRO D CG  1 
ATOM   4701 C CD  . PRO D 2 71  ? 67.144  36.639 155.578 1.00 20.31  ? 71  PRO D CD  1 
ATOM   4702 N N   . ARG D 2 72  ? 62.901  35.224 154.584 1.00 15.99  ? 72  ARG D N   1 
ATOM   4703 C CA  . ARG D 2 72  ? 61.641  35.846 154.232 1.00 13.65  ? 72  ARG D CA  1 
ATOM   4704 C C   . ARG D 2 72  ? 61.105  36.802 155.257 1.00 15.09  ? 72  ARG D C   1 
ATOM   4705 O O   . ARG D 2 72  ? 60.252  37.608 154.933 1.00 22.19  ? 72  ARG D O   1 
ATOM   4706 C CB  . ARG D 2 72  ? 60.597  34.825 153.854 1.00 9.84   ? 72  ARG D CB  1 
ATOM   4707 C CG  . ARG D 2 72  ? 59.589  34.588 154.884 1.00 34.25  ? 72  ARG D CG  1 
ATOM   4708 C CD  . ARG D 2 72  ? 58.223  34.855 154.377 1.00 28.90  ? 72  ARG D CD  1 
ATOM   4709 N NE  . ARG D 2 72  ? 57.934  36.268 154.249 1.00 16.24  ? 72  ARG D NE  1 
ATOM   4710 C CZ  . ARG D 2 72  ? 56.695  36.727 154.139 1.00 28.13  ? 72  ARG D CZ  1 
ATOM   4711 N NH1 . ARG D 2 72  ? 55.674  35.872 154.148 1.00 34.21  ? 72  ARG D NH1 1 
ATOM   4712 N NH2 . ARG D 2 72  ? 56.476  38.024 154.001 1.00 5.45   ? 72  ARG D NH2 1 
ATOM   4713 N N   . LYS D 2 73  ? 61.586  36.717 156.491 1.00 17.91  ? 73  LYS D N   1 
ATOM   4714 C CA  . LYS D 2 73  ? 61.137  37.660 157.507 1.00 17.15  ? 73  LYS D CA  1 
ATOM   4715 C C   . LYS D 2 73  ? 61.580  39.069 157.112 1.00 11.87  ? 73  LYS D C   1 
ATOM   4716 O O   . LYS D 2 73  ? 61.013  40.057 157.558 1.00 20.13  ? 73  LYS D O   1 
ATOM   4717 C CB  . LYS D 2 73  ? 61.696  37.308 158.885 1.00 22.05  ? 73  LYS D CB  1 
ATOM   4718 C CG  . LYS D 2 73  ? 63.219  37.277 158.967 1.00 46.33  ? 73  LYS D CG  1 
ATOM   4719 C CD  . LYS D 2 73  ? 63.710  36.996 160.387 1.00 47.83  ? 73  LYS D CD  1 
ATOM   4720 C CE  . LYS D 2 73  ? 65.224  36.861 160.452 1.00 45.70  ? 73  LYS D CE  1 
ATOM   4721 N NZ  . LYS D 2 73  ? 65.701  36.733 161.858 1.00 60.90  ? 73  LYS D NZ  1 
ATOM   4722 N N   . ASN D 2 74  ? 62.589  39.162 156.255 1.00 18.98  ? 74  ASN D N   1 
ATOM   4723 C CA  . ASN D 2 74  ? 63.089  40.471 155.809 1.00 25.60  ? 74  ASN D CA  1 
ATOM   4724 C C   . ASN D 2 74  ? 62.545  40.916 154.446 1.00 28.74  ? 74  ASN D C   1 
ATOM   4725 O O   . ASN D 2 74  ? 62.767  42.046 154.033 1.00 35.51  ? 74  ASN D O   1 
ATOM   4726 C CB  . ASN D 2 74  ? 64.629  40.517 155.756 1.00 20.17  ? 74  ASN D CB  1 
ATOM   4727 C CG  . ASN D 2 74  ? 65.292  40.313 157.123 1.00 36.94  ? 74  ASN D CG  1 
ATOM   4728 O OD1 . ASN D 2 74  ? 66.499  40.065 157.197 1.00 37.85  ? 74  ASN D OD1 1 
ATOM   4729 N ND2 . ASN D 2 74  ? 64.518  40.431 158.205 1.00 29.70  ? 74  ASN D ND2 1 
ATOM   4730 N N   . LEU D 2 75  ? 61.818  40.056 153.752 1.00 22.01  ? 75  LEU D N   1 
ATOM   4731 C CA  . LEU D 2 75  ? 61.299  40.429 152.448 1.00 13.31  ? 75  LEU D CA  1 
ATOM   4732 C C   . LEU D 2 75  ? 59.838  40.800 152.501 1.00 12.75  ? 75  LEU D C   1 
ATOM   4733 O O   . LEU D 2 75  ? 59.097  40.331 153.350 1.00 23.51  ? 75  LEU D O   1 
ATOM   4734 C CB  . LEU D 2 75  ? 61.416  39.256 151.485 1.00 13.79  ? 75  LEU D CB  1 
ATOM   4735 C CG  . LEU D 2 75  ? 62.760  38.579 151.481 1.00 14.71  ? 75  LEU D CG  1 
ATOM   4736 C CD1 . LEU D 2 75  ? 62.633  37.193 150.921 1.00 13.59  ? 75  LEU D CD1 1 
ATOM   4737 C CD2 . LEU D 2 75  ? 63.676  39.426 150.683 1.00 15.57  ? 75  LEU D CD2 1 
ATOM   4738 N N   . LEU D 2 76  ? 59.424  41.639 151.567 1.00 10.06  ? 76  LEU D N   1 
ATOM   4739 C CA  . LEU D 2 76  ? 58.032  41.996 151.453 1.00 12.89  ? 76  LEU D CA  1 
ATOM   4740 C C   . LEU D 2 76  ? 57.669  41.364 150.130 1.00 14.38  ? 76  LEU D C   1 
ATOM   4741 O O   . LEU D 2 76  ? 58.040  41.851 149.068 1.00 24.98  ? 76  LEU D O   1 
ATOM   4742 C CB  . LEU D 2 76  ? 57.809  43.509 151.395 1.00 24.87  ? 76  LEU D CB  1 
ATOM   4743 C CG  . LEU D 2 76  ? 56.484  43.936 150.700 1.00 36.35  ? 76  LEU D CG  1 
ATOM   4744 C CD1 . LEU D 2 76  ? 55.226  43.459 151.416 1.00 22.10  ? 76  LEU D CD1 1 
ATOM   4745 C CD2 . LEU D 2 76  ? 56.432  45.430 150.564 1.00 45.78  ? 76  LEU D CD2 1 
ATOM   4746 N N   . LEU D 2 77  ? 57.016  40.223 150.199 1.00 9.46   ? 77  LEU D N   1 
ATOM   4747 C CA  . LEU D 2 77  ? 56.632  39.538 148.994 1.00 6.99   ? 77  LEU D CA  1 
ATOM   4748 C C   . LEU D 2 77  ? 55.571  40.331 148.247 1.00 2.65   ? 77  LEU D C   1 
ATOM   4749 O O   . LEU D 2 77  ? 54.839  41.114 148.823 1.00 20.08  ? 77  LEU D O   1 
ATOM   4750 C CB  . LEU D 2 77  ? 56.176  38.116 149.319 1.00 12.92  ? 77  LEU D CB  1 
ATOM   4751 C CG  . LEU D 2 77  ? 57.143  37.280 150.175 1.00 2.00   ? 77  LEU D CG  1 
ATOM   4752 C CD1 . LEU D 2 77  ? 56.586  35.890 150.369 1.00 12.48  ? 77  LEU D CD1 1 
ATOM   4753 C CD2 . LEU D 2 77  ? 58.479  37.191 149.542 1.00 12.99  ? 77  LEU D CD2 1 
ATOM   4754 N N   . TYR D 2 78  ? 55.548  40.139 146.939 1.00 5.91   ? 78  TYR D N   1 
ATOM   4755 C CA  . TYR D 2 78  ? 54.626  40.798 146.019 1.00 7.83   ? 78  TYR D CA  1 
ATOM   4756 C C   . TYR D 2 78  ? 54.817  42.299 145.868 1.00 18.46  ? 78  TYR D C   1 
ATOM   4757 O O   . TYR D 2 78  ? 53.867  43.031 145.542 1.00 16.40  ? 78  TYR D O   1 
ATOM   4758 C CB  . TYR D 2 78  ? 53.168  40.433 146.278 1.00 6.39   ? 78  TYR D CB  1 
ATOM   4759 C CG  . TYR D 2 78  ? 52.916  38.943 146.186 1.00 14.84  ? 78  TYR D CG  1 
ATOM   4760 C CD1 . TYR D 2 78  ? 53.093  38.136 147.257 1.00 13.50  ? 78  TYR D CD1 1 
ATOM   4761 C CD2 . TYR D 2 78  ? 52.553  38.332 145.025 1.00 11.59  ? 78  TYR D CD2 1 
ATOM   4762 C CE1 . TYR D 2 78  ? 52.923  36.763 147.180 1.00 4.09   ? 78  TYR D CE1 1 
ATOM   4763 C CE2 . TYR D 2 78  ? 52.383  36.947 144.962 1.00 2.00   ? 78  TYR D CE2 1 
ATOM   4764 C CZ  . TYR D 2 78  ? 52.573  36.178 146.053 1.00 2.00   ? 78  TYR D CZ  1 
ATOM   4765 O OH  . TYR D 2 78  ? 52.419  34.821 146.059 1.00 13.83  ? 78  TYR D OH  1 
ATOM   4766 N N   . GLN D 2 79  ? 56.074  42.721 146.042 1.00 16.63  ? 79  GLN D N   1 
ATOM   4767 C CA  . GLN D 2 79  ? 56.499  44.094 145.855 1.00 23.80  ? 79  GLN D CA  1 
ATOM   4768 C C   . GLN D 2 79  ? 57.979  44.056 145.451 1.00 23.76  ? 79  GLN D C   1 
ATOM   4769 O O   . GLN D 2 79  ? 58.712  43.170 145.891 1.00 29.48  ? 79  GLN D O   1 
ATOM   4770 C CB  . GLN D 2 79  ? 56.266  44.949 147.103 1.00 31.39  ? 79  GLN D CB  1 
ATOM   4771 C CG  . GLN D 2 79  ? 56.277  46.480 146.798 1.00 53.75  ? 79  GLN D CG  1 
ATOM   4772 C CD  . GLN D 2 79  ? 55.570  46.886 145.467 1.00 57.60  ? 79  GLN D CD  1 
ATOM   4773 O OE1 . GLN D 2 79  ? 54.349  47.031 145.402 1.00 59.47  ? 79  GLN D OE1 1 
ATOM   4774 N NE2 . GLN D 2 79  ? 56.359  47.100 144.424 1.00 59.44  ? 79  GLN D NE2 1 
ATOM   4775 N N   . TYR D 2 80  ? 58.372  44.953 144.540 1.00 18.66  ? 80  TYR D N   1 
ATOM   4776 C CA  . TYR D 2 80  ? 59.739  45.055 144.021 1.00 8.69   ? 80  TYR D CA  1 
ATOM   4777 C C   . TYR D 2 80  ? 60.797  45.508 145.012 1.00 12.59  ? 80  TYR D C   1 
ATOM   4778 O O   . TYR D 2 80  ? 60.501  46.206 145.960 1.00 21.45  ? 80  TYR D O   1 
ATOM   4779 C CB  . TYR D 2 80  ? 59.750  45.966 142.803 1.00 2.00   ? 80  TYR D CB  1 
ATOM   4780 C CG  . TYR D 2 80  ? 58.937  45.418 141.655 1.00 18.59  ? 80  TYR D CG  1 
ATOM   4781 C CD1 . TYR D 2 80  ? 59.428  44.437 140.842 1.00 14.99  ? 80  TYR D CD1 1 
ATOM   4782 C CD2 . TYR D 2 80  ? 57.679  45.869 141.386 1.00 13.10  ? 80  TYR D CD2 1 
ATOM   4783 C CE1 . TYR D 2 80  ? 58.677  43.918 139.784 1.00 27.54  ? 80  TYR D CE1 1 
ATOM   4784 C CE2 . TYR D 2 80  ? 56.926  45.352 140.321 1.00 18.04  ? 80  TYR D CE2 1 
ATOM   4785 C CZ  . TYR D 2 80  ? 57.431  44.376 139.525 1.00 29.16  ? 80  TYR D CZ  1 
ATOM   4786 O OH  . TYR D 2 80  ? 56.700  43.843 138.477 1.00 46.06  ? 80  TYR D OH  1 
ATOM   4787 N N   . MET D 2 81  ? 62.038  45.108 144.794 1.00 18.76  ? 81  MET D N   1 
ATOM   4788 C CA  . MET D 2 81  ? 63.123  45.489 145.680 1.00 12.80  ? 81  MET D CA  1 
ATOM   4789 C C   . MET D 2 81  ? 64.401  45.545 144.872 1.00 20.79  ? 81  MET D C   1 
ATOM   4790 O O   . MET D 2 81  ? 64.573  44.820 143.889 1.00 21.76  ? 81  MET D O   1 
ATOM   4791 C CB  . MET D 2 81  ? 63.264  44.491 146.827 1.00 5.18   ? 81  MET D CB  1 
ATOM   4792 C CG  . MET D 2 81  ? 63.548  43.053 146.395 1.00 6.32   ? 81  MET D CG  1 
ATOM   4793 S SD  . MET D 2 81  ? 63.624  41.850 147.747 1.00 24.92  ? 81  MET D SD  1 
ATOM   4794 C CE  . MET D 2 81  ? 65.223  42.171 148.406 1.00 18.81  ? 81  MET D CE  1 
ATOM   4795 N N   . ALA D 2 82  ? 65.279  46.440 145.283 1.00 19.78  ? 82  ALA D N   1 
ATOM   4796 C CA  . ALA D 2 82  ? 66.552  46.639 144.628 1.00 17.60  ? 82  ALA D CA  1 
ATOM   4797 C C   . ALA D 2 82  ? 67.574  45.819 145.366 1.00 14.71  ? 82  ALA D C   1 
ATOM   4798 O O   . ALA D 2 82  ? 67.650  45.894 146.587 1.00 27.04  ? 82  ALA D O   1 
ATOM   4799 C CB  . ALA D 2 82  ? 66.927  48.095 144.685 1.00 15.39  ? 82  ALA D CB  1 
ATOM   4800 N N   . ILE D 2 83  ? 68.365  45.048 144.630 1.00 20.05  ? 83  ILE D N   1 
ATOM   4801 C CA  . ILE D 2 83  ? 69.394  44.193 145.225 1.00 19.94  ? 83  ILE D CA  1 
ATOM   4802 C C   . ILE D 2 83  ? 70.703  44.369 144.487 1.00 21.62  ? 83  ILE D C   1 
ATOM   4803 O O   . ILE D 2 83  ? 70.718  44.497 143.261 1.00 19.82  ? 83  ILE D O   1 
ATOM   4804 C CB  . ILE D 2 83  ? 69.034  42.708 145.092 1.00 9.28   ? 83  ILE D CB  1 
ATOM   4805 C CG1 . ILE D 2 83  ? 67.575  42.494 145.452 1.00 16.52  ? 83  ILE D CG1 1 
ATOM   4806 C CG2 . ILE D 2 83  ? 69.871  41.896 146.021 1.00 13.92  ? 83  ILE D CG2 1 
ATOM   4807 C CD1 . ILE D 2 83  ? 67.084  41.149 145.152 1.00 24.27  ? 83  ILE D CD1 1 
ATOM   4808 N N   . TRP D 2 84  ? 71.796  44.378 145.237 1.00 19.90  ? 84  TRP D N   1 
ATOM   4809 C CA  . TRP D 2 84  ? 73.125  44.505 144.665 1.00 10.99  ? 84  TRP D CA  1 
ATOM   4810 C C   . TRP D 2 84  ? 74.113  43.980 145.670 1.00 9.48   ? 84  TRP D C   1 
ATOM   4811 O O   . TRP D 2 84  ? 73.830  43.889 146.864 1.00 12.14  ? 84  TRP D O   1 
ATOM   4812 C CB  . TRP D 2 84  ? 73.447  45.959 144.318 1.00 21.53  ? 84  TRP D CB  1 
ATOM   4813 C CG  . TRP D 2 84  ? 73.655  46.844 145.498 1.00 36.67  ? 84  TRP D CG  1 
ATOM   4814 C CD1 . TRP D 2 84  ? 74.845  47.163 146.087 1.00 31.35  ? 84  TRP D CD1 1 
ATOM   4815 C CD2 . TRP D 2 84  ? 72.645  47.533 146.234 1.00 46.45  ? 84  TRP D CD2 1 
ATOM   4816 N NE1 . TRP D 2 84  ? 74.633  48.008 147.145 1.00 43.33  ? 84  TRP D NE1 1 
ATOM   4817 C CE2 . TRP D 2 84  ? 73.291  48.252 147.258 1.00 45.23  ? 84  TRP D CE2 1 
ATOM   4818 C CE3 . TRP D 2 84  ? 71.254  47.616 146.126 1.00 49.93  ? 84  TRP D CE3 1 
ATOM   4819 C CZ2 . TRP D 2 84  ? 72.594  49.043 148.166 1.00 47.17  ? 84  TRP D CZ2 1 
ATOM   4820 C CZ3 . TRP D 2 84  ? 70.566  48.402 147.027 1.00 46.02  ? 84  TRP D CZ3 1 
ATOM   4821 C CH2 . TRP D 2 84  ? 71.235  49.106 148.034 1.00 49.99  ? 84  TRP D CH2 1 
ATOM   4822 N N   . VAL D 2 85  ? 75.280  43.626 145.182 1.00 14.67  ? 85  VAL D N   1 
ATOM   4823 C CA  . VAL D 2 85  ? 76.321  43.120 146.046 1.00 27.55  ? 85  VAL D CA  1 
ATOM   4824 C C   . VAL D 2 85  ? 77.521  44.084 146.030 1.00 38.37  ? 85  VAL D C   1 
ATOM   4825 O O   . VAL D 2 85  ? 77.840  44.667 144.987 1.00 36.34  ? 85  VAL D O   1 
ATOM   4826 C CB  . VAL D 2 85  ? 76.698  41.683 145.638 1.00 23.36  ? 85  VAL D CB  1 
ATOM   4827 C CG1 . VAL D 2 85  ? 76.873  41.583 144.152 1.00 23.23  ? 85  VAL D CG1 1 
ATOM   4828 C CG2 . VAL D 2 85  ? 77.943  41.246 146.348 1.00 33.97  ? 85  VAL D CG2 1 
ATOM   4829 N N   . GLN D 2 86  ? 78.151  44.274 147.191 1.00 38.74  ? 86  GLN D N   1 
ATOM   4830 C CA  . GLN D 2 86  ? 79.279  45.195 147.338 1.00 40.69  ? 86  GLN D CA  1 
ATOM   4831 C C   . GLN D 2 86  ? 80.524  44.495 147.850 1.00 43.46  ? 86  GLN D C   1 
ATOM   4832 O O   . GLN D 2 86  ? 80.473  43.745 148.823 1.00 46.69  ? 86  GLN D O   1 
ATOM   4833 C CB  . GLN D 2 86  ? 78.886  46.321 148.300 1.00 46.60  ? 86  GLN D CB  1 
ATOM   4834 C CG  . GLN D 2 86  ? 79.979  47.309 148.699 1.00 49.56  ? 86  GLN D CG  1 
ATOM   4835 C CD  . GLN D 2 86  ? 79.557  48.172 149.890 1.00 62.04  ? 86  GLN D CD  1 
ATOM   4836 O OE1 . GLN D 2 86  ? 80.014  47.961 151.012 1.00 67.23  ? 86  GLN D OE1 1 
ATOM   4837 N NE2 . GLN D 2 86  ? 78.661  49.127 149.653 1.00 63.52  ? 86  GLN D NE2 1 
ATOM   4838 N N   . ALA D 2 87  ? 81.645  44.763 147.196 1.00 50.38  ? 87  ALA D N   1 
ATOM   4839 C CA  . ALA D 2 87  ? 82.919  44.168 147.568 1.00 49.87  ? 87  ALA D CA  1 
ATOM   4840 C C   . ALA D 2 87  ? 83.812  45.191 148.246 1.00 56.74  ? 87  ALA D C   1 
ATOM   4841 O O   . ALA D 2 87  ? 84.185  46.201 147.631 1.00 54.82  ? 87  ALA D O   1 
ATOM   4842 C CB  . ALA D 2 87  ? 83.598  43.628 146.350 1.00 54.62  ? 87  ALA D CB  1 
ATOM   4843 N N   . GLU D 2 88  ? 84.133  44.923 149.512 1.00 64.50  ? 88  GLU D N   1 
ATOM   4844 C CA  . GLU D 2 88  ? 84.975  45.787 150.340 1.00 69.20  ? 88  GLU D CA  1 
ATOM   4845 C C   . GLU D 2 88  ? 86.334  45.115 150.548 1.00 62.90  ? 88  GLU D C   1 
ATOM   4846 O O   . GLU D 2 88  ? 86.446  44.052 151.173 1.00 45.45  ? 88  GLU D O   1 
ATOM   4847 C CB  . GLU D 2 88  ? 84.286  46.066 151.695 1.00 90.53  ? 88  GLU D CB  1 
ATOM   4848 C CG  . GLU D 2 88  ? 84.993  47.085 152.618 1.00 119.16 ? 88  GLU D CG  1 
ATOM   4849 C CD  . GLU D 2 88  ? 84.364  47.186 154.017 1.00 134.64 ? 88  GLU D CD  1 
ATOM   4850 O OE1 . GLU D 2 88  ? 84.798  46.447 154.932 1.00 138.31 ? 88  GLU D OE1 1 
ATOM   4851 O OE2 . GLU D 2 88  ? 83.446  48.016 154.207 1.00 142.93 ? 88  GLU D OE2 1 
ATOM   4852 N N   . ASN D 2 89  ? 87.363  45.744 150.003 1.00 63.89  ? 89  ASN D N   1 
ATOM   4853 C CA  . ASN D 2 89  ? 88.719  45.243 150.102 1.00 60.70  ? 89  ASN D CA  1 
ATOM   4854 C C   . ASN D 2 89  ? 89.539  46.358 150.712 1.00 61.31  ? 89  ASN D C   1 
ATOM   4855 O O   . ASN D 2 89  ? 89.171  47.524 150.600 1.00 55.72  ? 89  ASN D O   1 
ATOM   4856 C CB  . ASN D 2 89  ? 89.237  44.948 148.705 1.00 62.52  ? 89  ASN D CB  1 
ATOM   4857 C CG  . ASN D 2 89  ? 90.403  44.032 148.717 1.00 62.16  ? 89  ASN D CG  1 
ATOM   4858 O OD1 . ASN D 2 89  ? 90.599  43.292 149.672 1.00 68.29  ? 89  ASN D OD1 1 
ATOM   4859 N ND2 . ASN D 2 89  ? 91.190  44.057 147.652 1.00 67.04  ? 89  ASN D ND2 1 
ATOM   4860 N N   . MET D 2 90  ? 90.670  46.017 151.313 1.00 64.81  ? 90  MET D N   1 
ATOM   4861 C CA  . MET D 2 90  ? 91.533  47.026 151.926 1.00 70.63  ? 90  MET D CA  1 
ATOM   4862 C C   . MET D 2 90  ? 92.020  48.119 150.944 1.00 70.43  ? 90  MET D C   1 
ATOM   4863 O O   . MET D 2 90  ? 92.514  49.161 151.383 1.00 73.62  ? 90  MET D O   1 
ATOM   4864 C CB  . MET D 2 90  ? 92.727  46.338 152.598 1.00 76.23  ? 90  MET D CB  1 
ATOM   4865 C CG  . MET D 2 90  ? 93.725  47.275 153.253 1.00 78.90  ? 90  MET D CG  1 
ATOM   4866 S SD  . MET D 2 90  ? 95.294  46.462 153.546 1.00 89.15  ? 90  MET D SD  1 
ATOM   4867 C CE  . MET D 2 90  ? 96.092  46.621 151.918 1.00 72.63  ? 90  MET D CE  1 
ATOM   4868 N N   . LEU D 2 91  ? 91.849  47.895 149.635 1.00 68.60  ? 91  LEU D N   1 
ATOM   4869 C CA  . LEU D 2 91  ? 92.290  48.847 148.595 1.00 66.51  ? 91  LEU D CA  1 
ATOM   4870 C C   . LEU D 2 91  ? 91.188  49.420 147.697 1.00 62.84  ? 91  LEU D C   1 
ATOM   4871 O O   . LEU D 2 91  ? 91.460  49.847 146.567 1.00 63.02  ? 91  LEU D O   1 
ATOM   4872 C CB  . LEU D 2 91  ? 93.329  48.198 147.661 1.00 72.97  ? 91  LEU D CB  1 
ATOM   4873 C CG  . LEU D 2 91  ? 94.665  47.608 148.126 1.00 75.87  ? 91  LEU D CG  1 
ATOM   4874 C CD1 . LEU D 2 91  ? 95.542  47.400 146.893 1.00 74.82  ? 91  LEU D CD1 1 
ATOM   4875 C CD2 . LEU D 2 91  ? 95.362  48.533 149.110 1.00 77.06  ? 91  LEU D CD2 1 
ATOM   4876 N N   . GLY D 2 92  ? 89.944  49.386 148.150 1.00 62.37  ? 92  GLY D N   1 
ATOM   4877 C CA  . GLY D 2 92  ? 88.881  49.909 147.311 1.00 59.09  ? 92  GLY D CA  1 
ATOM   4878 C C   . GLY D 2 92  ? 87.580  49.149 147.439 1.00 57.49  ? 92  GLY D C   1 
ATOM   4879 O O   . GLY D 2 92  ? 87.508  48.119 148.120 1.00 48.88  ? 92  GLY D O   1 
ATOM   4880 N N   . SER D 2 93  ? 86.552  49.655 146.767 1.00 59.68  ? 93  SER D N   1 
ATOM   4881 C CA  . SER D 2 93  ? 85.224  49.051 146.801 1.00 58.43  ? 93  SER D CA  1 
ATOM   4882 C C   . SER D 2 93  ? 84.647  49.017 145.402 1.00 60.92  ? 93  SER D C   1 
ATOM   4883 O O   . SER D 2 93  ? 85.049  49.799 144.522 1.00 58.47  ? 93  SER D O   1 
ATOM   4884 C CB  . SER D 2 93  ? 84.263  49.857 147.695 1.00 57.02  ? 93  SER D CB  1 
ATOM   4885 O OG  . SER D 2 93  ? 84.674  49.885 149.055 1.00 69.45  ? 93  SER D OG  1 
ATOM   4886 N N   . SER D 2 94  ? 83.694  48.111 145.213 1.00 61.10  ? 94  SER D N   1 
ATOM   4887 C CA  . SER D 2 94  ? 83.007  47.951 143.939 1.00 62.81  ? 94  SER D CA  1 
ATOM   4888 C C   . SER D 2 94  ? 81.601  47.477 144.243 1.00 55.34  ? 94  SER D C   1 
ATOM   4889 O O   . SER D 2 94  ? 81.352  46.916 145.312 1.00 51.59  ? 94  SER D O   1 
ATOM   4890 C CB  . SER D 2 94  ? 83.710  46.912 143.077 1.00 64.44  ? 94  SER D CB  1 
ATOM   4891 O OG  . SER D 2 94  ? 83.685  45.653 143.717 1.00 71.69  ? 94  SER D OG  1 
ATOM   4892 N N   . GLU D 2 95  ? 80.687  47.727 143.315 1.00 54.28  ? 95  GLU D N   1 
ATOM   4893 C CA  . GLU D 2 95  ? 79.294  47.335 143.469 1.00 53.99  ? 95  GLU D CA  1 
ATOM   4894 C C   . GLU D 2 95  ? 78.817  46.804 142.133 1.00 55.02  ? 95  GLU D C   1 
ATOM   4895 O O   . GLU D 2 95  ? 79.311  47.216 141.076 1.00 65.43  ? 95  GLU D O   1 
ATOM   4896 C CB  . GLU D 2 95  ? 78.401  48.538 143.833 1.00 57.73  ? 95  GLU D CB  1 
ATOM   4897 C CG  . GLU D 2 95  ? 78.691  49.242 145.155 1.00 71.40  ? 95  GLU D CG  1 
ATOM   4898 C CD  . GLU D 2 95  ? 77.785  50.445 145.388 1.00 79.52  ? 95  GLU D CD  1 
ATOM   4899 O OE1 . GLU D 2 95  ? 77.749  50.947 146.533 1.00 95.58  ? 95  GLU D OE1 1 
ATOM   4900 O OE2 . GLU D 2 95  ? 77.111  50.895 144.432 1.00 85.38  ? 95  GLU D OE2 1 
ATOM   4901 N N   . SER D 2 96  ? 77.835  45.913 142.190 1.00 53.00  ? 96  SER D N   1 
ATOM   4902 C CA  . SER D 2 96  ? 77.231  45.328 141.002 1.00 41.19  ? 96  SER D CA  1 
ATOM   4903 C C   . SER D 2 96  ? 76.075  46.215 140.557 1.00 36.88  ? 96  SER D C   1 
ATOM   4904 O O   . SER D 2 96  ? 75.581  47.041 141.329 1.00 43.10  ? 96  SER D O   1 
ATOM   4905 C CB  . SER D 2 96  ? 76.678  43.942 141.344 1.00 40.61  ? 96  SER D CB  1 
ATOM   4906 O OG  . SER D 2 96  ? 75.619  44.009 142.294 1.00 38.33  ? 96  SER D OG  1 
ATOM   4907 N N   . PRO D 2 97  ? 75.684  46.129 139.281 1.00 35.95  ? 97  PRO D N   1 
ATOM   4908 C CA  . PRO D 2 97  ? 74.560  46.975 138.890 1.00 43.92  ? 97  PRO D CA  1 
ATOM   4909 C C   . PRO D 2 97  ? 73.351  46.481 139.695 1.00 46.64  ? 97  PRO D C   1 
ATOM   4910 O O   . PRO D 2 97  ? 73.283  45.299 140.052 1.00 43.32  ? 97  PRO D O   1 
ATOM   4911 C CB  . PRO D 2 97  ? 74.424  46.695 137.390 1.00 46.76  ? 97  PRO D CB  1 
ATOM   4912 C CG  . PRO D 2 97  ? 75.094  45.363 137.201 1.00 34.32  ? 97  PRO D CG  1 
ATOM   4913 C CD  . PRO D 2 97  ? 76.272  45.465 138.110 1.00 40.02  ? 97  PRO D CD  1 
ATOM   4914 N N   . LYS D 2 98  ? 72.443  47.389 140.034 1.00 46.79  ? 98  LYS D N   1 
ATOM   4915 C CA  . LYS D 2 98  ? 71.286  47.023 140.824 1.00 37.73  ? 98  LYS D CA  1 
ATOM   4916 C C   . LYS D 2 98  ? 70.257  46.226 140.060 1.00 39.13  ? 98  LYS D C   1 
ATOM   4917 O O   . LYS D 2 98  ? 69.883  46.554 138.924 1.00 41.56  ? 98  LYS D O   1 
ATOM   4918 C CB  . LYS D 2 98  ? 70.655  48.254 141.484 1.00 40.92  ? 98  LYS D CB  1 
ATOM   4919 C CG  . LYS D 2 98  ? 71.507  48.835 142.618 1.00 37.81  ? 98  LYS D CG  1 
ATOM   4920 C CD  . LYS D 2 98  ? 70.848  50.037 143.272 1.00 34.66  ? 98  LYS D CD  1 
ATOM   4921 C CE  . LYS D 2 98  ? 71.787  50.723 144.271 1.00 47.80  ? 98  LYS D CE  1 
ATOM   4922 N NZ  . LYS D 2 98  ? 73.008  51.326 143.642 1.00 41.09  ? 98  LYS D NZ  1 
ATOM   4923 N N   . LEU D 2 99  ? 69.840  45.138 140.693 1.00 32.73  ? 99  LEU D N   1 
ATOM   4924 C CA  . LEU D 2 99  ? 68.848  44.243 140.134 1.00 35.30  ? 99  LEU D CA  1 
ATOM   4925 C C   . LEU D 2 99  ? 67.499  44.606 140.748 1.00 29.11  ? 99  LEU D C   1 
ATOM   4926 O O   . LEU D 2 99  ? 67.440  45.003 141.915 1.00 29.50  ? 99  LEU D O   1 
ATOM   4927 C CB  . LEU D 2 99  ? 69.246  42.805 140.462 1.00 43.37  ? 99  LEU D CB  1 
ATOM   4928 C CG  . LEU D 2 99  ? 68.379  41.677 139.927 1.00 50.33  ? 99  LEU D CG  1 
ATOM   4929 C CD1 . LEU D 2 99  ? 68.101  41.839 138.425 1.00 68.58  ? 99  LEU D CD1 1 
ATOM   4930 C CD2 . LEU D 2 99  ? 69.092  40.393 140.231 1.00 48.24  ? 99  LEU D CD2 1 
ATOM   4931 N N   . CYS D 2 100 ? 66.434  44.512 139.955 1.00 22.92  ? 100 CYS D N   1 
ATOM   4932 C CA  . CYS D 2 100 ? 65.094  44.849 140.435 1.00 28.26  ? 100 CYS D CA  1 
ATOM   4933 C C   . CYS D 2 100 ? 64.104  43.695 140.260 1.00 29.33  ? 100 CYS D C   1 
ATOM   4934 O O   . CYS D 2 100 ? 63.609  43.444 139.146 1.00 32.92  ? 100 CYS D O   1 
ATOM   4935 C CB  . CYS D 2 100 ? 64.571  46.103 139.720 1.00 43.57  ? 100 CYS D CB  1 
ATOM   4936 S SG  . CYS D 2 100 ? 63.129  46.931 140.500 1.00 58.02  ? 100 CYS D SG  1 
ATOM   4937 N N   . LEU D 2 101 ? 63.749  43.060 141.380 1.00 22.51  ? 101 LEU D N   1 
ATOM   4938 C CA  . LEU D 2 101 ? 62.843  41.922 141.343 1.00 24.40  ? 101 LEU D CA  1 
ATOM   4939 C C   . LEU D 2 101 ? 61.833  41.895 142.469 1.00 26.14  ? 101 LEU D C   1 
ATOM   4940 O O   . LEU D 2 101 ? 61.934  42.661 143.430 1.00 29.35  ? 101 LEU D O   1 
ATOM   4941 C CB  . LEU D 2 101 ? 63.669  40.623 141.393 1.00 22.87  ? 101 LEU D CB  1 
ATOM   4942 C CG  . LEU D 2 101 ? 64.672  40.455 142.553 1.00 17.30  ? 101 LEU D CG  1 
ATOM   4943 C CD1 . LEU D 2 101 ? 63.959  39.985 143.807 1.00 35.28  ? 101 LEU D CD1 1 
ATOM   4944 C CD2 . LEU D 2 101 ? 65.763  39.454 142.186 1.00 11.35  ? 101 LEU D CD2 1 
ATOM   4945 N N   . ASP D 2 102 ? 60.868  40.989 142.329 1.00 26.09  ? 102 ASP D N   1 
ATOM   4946 C CA  . ASP D 2 102 ? 59.831  40.721 143.324 1.00 15.95  ? 102 ASP D CA  1 
ATOM   4947 C C   . ASP D 2 102 ? 60.208  39.278 143.606 1.00 8.66   ? 102 ASP D C   1 
ATOM   4948 O O   . ASP D 2 102 ? 60.195  38.452 142.709 1.00 20.81  ? 102 ASP D O   1 
ATOM   4949 C CB  . ASP D 2 102 ? 58.444  40.823 142.678 1.00 12.32  ? 102 ASP D CB  1 
ATOM   4950 C CG  . ASP D 2 102 ? 57.324  40.316 143.573 1.00 22.04  ? 102 ASP D CG  1 
ATOM   4951 O OD1 . ASP D 2 102 ? 57.594  39.900 144.719 1.00 22.62  ? 102 ASP D OD1 1 
ATOM   4952 O OD2 . ASP D 2 102 ? 56.161  40.317 143.100 1.00 17.56  ? 102 ASP D OD2 1 
ATOM   4953 N N   . PRO D 2 103 ? 60.564  38.951 144.849 1.00 3.12   ? 103 PRO D N   1 
ATOM   4954 C CA  . PRO D 2 103 ? 60.951  37.570 145.145 1.00 6.36   ? 103 PRO D CA  1 
ATOM   4955 C C   . PRO D 2 103 ? 60.013  36.501 144.565 1.00 12.33  ? 103 PRO D C   1 
ATOM   4956 O O   . PRO D 2 103 ? 60.440  35.461 144.077 1.00 18.66  ? 103 PRO D O   1 
ATOM   4957 C CB  . PRO D 2 103 ? 60.981  37.555 146.663 1.00 2.00   ? 103 PRO D CB  1 
ATOM   4958 C CG  . PRO D 2 103 ? 61.360  38.957 147.007 1.00 5.62   ? 103 PRO D CG  1 
ATOM   4959 C CD  . PRO D 2 103 ? 60.474  39.741 146.084 1.00 5.66   ? 103 PRO D CD  1 
ATOM   4960 N N   . MET D 2 104 ? 58.733  36.807 144.517 1.00 8.22   ? 104 MET D N   1 
ATOM   4961 C CA  . MET D 2 104 ? 57.782  35.849 144.010 1.00 7.63   ? 104 MET D CA  1 
ATOM   4962 C C   . MET D 2 104 ? 57.835  35.628 142.506 1.00 12.13  ? 104 MET D C   1 
ATOM   4963 O O   . MET D 2 104 ? 57.210  34.699 141.984 1.00 20.63  ? 104 MET D O   1 
ATOM   4964 C CB  . MET D 2 104 ? 56.378  36.222 144.482 1.00 2.03   ? 104 MET D CB  1 
ATOM   4965 C CG  . MET D 2 104 ? 56.238  36.238 145.999 1.00 2.00   ? 104 MET D CG  1 
ATOM   4966 S SD  . MET D 2 104 ? 56.828  34.740 146.845 1.00 18.85  ? 104 MET D SD  1 
ATOM   4967 C CE  . MET D 2 104 ? 55.523  33.635 146.498 1.00 15.84  ? 104 MET D CE  1 
ATOM   4968 N N   . ASP D 2 105 ? 58.635  36.441 141.828 1.00 16.77  ? 105 ASP D N   1 
ATOM   4969 C CA  . ASP D 2 105 ? 58.791  36.364 140.376 1.00 15.50  ? 105 ASP D CA  1 
ATOM   4970 C C   . ASP D 2 105 ? 59.946  35.461 139.991 1.00 20.35  ? 105 ASP D C   1 
ATOM   4971 O O   . ASP D 2 105 ? 60.146  35.144 138.809 1.00 19.96  ? 105 ASP D O   1 
ATOM   4972 C CB  . ASP D 2 105 ? 59.085  37.754 139.812 1.00 20.14  ? 105 ASP D CB  1 
ATOM   4973 C CG  . ASP D 2 105 ? 57.837  38.585 139.579 1.00 23.19  ? 105 ASP D CG  1 
ATOM   4974 O OD1 . ASP D 2 105 ? 56.717  38.026 139.629 1.00 32.35  ? 105 ASP D OD1 1 
ATOM   4975 O OD2 . ASP D 2 105 ? 57.985  39.806 139.316 1.00 24.94  ? 105 ASP D OD2 1 
ATOM   4976 N N   . VAL D 2 106 ? 60.738  35.100 140.989 1.00 10.13  ? 106 VAL D N   1 
ATOM   4977 C CA  . VAL D 2 106 ? 61.889  34.269 140.753 1.00 9.07   ? 106 VAL D CA  1 
ATOM   4978 C C   . VAL D 2 106 ? 61.858  33.041 141.634 1.00 7.43   ? 106 VAL D C   1 
ATOM   4979 O O   . VAL D 2 106 ? 62.862  32.588 142.168 1.00 10.50  ? 106 VAL D O   1 
ATOM   4980 C CB  . VAL D 2 106 ? 63.155  35.089 140.963 1.00 19.01  ? 106 VAL D CB  1 
ATOM   4981 C CG1 . VAL D 2 106 ? 63.272  36.112 139.857 1.00 7.72   ? 106 VAL D CG1 1 
ATOM   4982 C CG2 . VAL D 2 106 ? 63.094  35.802 142.302 1.00 18.42  ? 106 VAL D CG2 1 
ATOM   4983 N N   . VAL D 2 107 ? 60.675  32.487 141.767 1.00 10.98  ? 107 VAL D N   1 
ATOM   4984 C CA  . VAL D 2 107 ? 60.496  31.311 142.582 1.00 13.10  ? 107 VAL D CA  1 
ATOM   4985 C C   . VAL D 2 107 ? 61.079  30.103 141.856 1.00 14.24  ? 107 VAL D C   1 
ATOM   4986 O O   . VAL D 2 107 ? 60.807  29.902 140.663 1.00 13.49  ? 107 VAL D O   1 
ATOM   4987 C CB  . VAL D 2 107 ? 59.008  31.115 142.862 1.00 7.93   ? 107 VAL D CB  1 
ATOM   4988 C CG1 . VAL D 2 107 ? 58.763  29.768 143.454 1.00 2.00   ? 107 VAL D CG1 1 
ATOM   4989 C CG2 . VAL D 2 107 ? 58.528  32.207 143.791 1.00 2.00   ? 107 VAL D CG2 1 
ATOM   4990 N N   . LYS D 2 108 ? 61.921  29.349 142.563 1.00 6.69   ? 108 LYS D N   1 
ATOM   4991 C CA  . LYS D 2 108 ? 62.540  28.159 142.011 1.00 2.00   ? 108 LYS D CA  1 
ATOM   4992 C C   . LYS D 2 108 ? 61.595  27.006 142.228 1.00 8.12   ? 108 LYS D C   1 
ATOM   4993 O O   . LYS D 2 108 ? 61.341  26.589 143.349 1.00 22.10  ? 108 LYS D O   1 
ATOM   4994 C CB  . LYS D 2 108 ? 63.885  27.876 142.674 1.00 3.70   ? 108 LYS D CB  1 
ATOM   4995 C CG  . LYS D 2 108 ? 64.437  26.474 142.441 1.00 24.31  ? 108 LYS D CG  1 
ATOM   4996 C CD  . LYS D 2 108 ? 65.796  26.265 143.102 1.00 30.67  ? 108 LYS D CD  1 
ATOM   4997 C CE  . LYS D 2 108 ? 66.420  24.947 142.679 1.00 57.61  ? 108 LYS D CE  1 
ATOM   4998 N NZ  . LYS D 2 108 ? 67.900  24.924 142.919 1.00 76.10  ? 108 LYS D NZ  1 
ATOM   4999 N N   . LEU D 2 109 ? 61.067  26.513 141.123 1.00 10.60  ? 109 LEU D N   1 
ATOM   5000 C CA  . LEU D 2 109 ? 60.131  25.400 141.088 1.00 2.20   ? 109 LEU D CA  1 
ATOM   5001 C C   . LEU D 2 109 ? 60.820  24.030 140.935 1.00 5.11   ? 109 LEU D C   1 
ATOM   5002 O O   . LEU D 2 109 ? 61.906  23.914 140.367 1.00 14.75  ? 109 LEU D O   1 
ATOM   5003 C CB  . LEU D 2 109 ? 59.188  25.631 139.904 1.00 6.60   ? 109 LEU D CB  1 
ATOM   5004 C CG  . LEU D 2 109 ? 57.710  25.981 140.062 1.00 2.13   ? 109 LEU D CG  1 
ATOM   5005 C CD1 . LEU D 2 109 ? 57.439  26.814 141.286 1.00 17.56  ? 109 LEU D CD1 1 
ATOM   5006 C CD2 . LEU D 2 109 ? 57.255  26.652 138.824 1.00 2.00   ? 109 LEU D CD2 1 
ATOM   5007 N N   . GLU D 2 110 ? 60.195  23.000 141.482 1.00 9.30   ? 110 GLU D N   1 
ATOM   5008 C CA  . GLU D 2 110 ? 60.716  21.656 141.387 1.00 2.00   ? 110 GLU D CA  1 
ATOM   5009 C C   . GLU D 2 110 ? 59.591  20.982 140.629 1.00 7.96   ? 110 GLU D C   1 
ATOM   5010 O O   . GLU D 2 110 ? 58.442  21.419 140.692 1.00 9.57   ? 110 GLU D O   1 
ATOM   5011 C CB  . GLU D 2 110 ? 60.960  21.066 142.770 1.00 25.06  ? 110 GLU D CB  1 
ATOM   5012 C CG  . GLU D 2 110 ? 62.384  21.324 143.306 1.00 45.93  ? 110 GLU D CG  1 
ATOM   5013 C CD  . GLU D 2 110 ? 62.683  20.612 144.635 1.00 64.16  ? 110 GLU D CD  1 
ATOM   5014 O OE1 . GLU D 2 110 ? 62.595  19.360 144.686 1.00 85.27  ? 110 GLU D OE1 1 
ATOM   5015 O OE2 . GLU D 2 110 ? 63.032  21.302 145.622 1.00 51.53  ? 110 GLU D OE2 1 
ATOM   5016 N N   . PRO D 2 111 ? 59.920  19.987 139.818 1.00 10.48  ? 111 PRO D N   1 
ATOM   5017 C CA  . PRO D 2 111 ? 58.967  19.236 138.997 1.00 6.72   ? 111 PRO D CA  1 
ATOM   5018 C C   . PRO D 2 111 ? 57.793  18.620 139.725 1.00 11.32  ? 111 PRO D C   1 
ATOM   5019 O O   . PRO D 2 111 ? 57.859  18.329 140.918 1.00 27.56  ? 111 PRO D O   1 
ATOM   5020 C CB  . PRO D 2 111 ? 59.847  18.174 138.362 1.00 12.16  ? 111 PRO D CB  1 
ATOM   5021 C CG  . PRO D 2 111 ? 60.924  17.977 139.413 1.00 24.57  ? 111 PRO D CG  1 
ATOM   5022 C CD  . PRO D 2 111 ? 61.252  19.369 139.792 1.00 11.73  ? 111 PRO D CD  1 
ATOM   5023 N N   . PRO D 2 112 ? 56.689  18.415 139.008 1.00 9.19   ? 112 PRO D N   1 
ATOM   5024 C CA  . PRO D 2 112 ? 55.473  17.825 139.571 1.00 3.79   ? 112 PRO D CA  1 
ATOM   5025 C C   . PRO D 2 112 ? 55.562  16.304 139.768 1.00 11.03  ? 112 PRO D C   1 
ATOM   5026 O O   . PRO D 2 112 ? 56.456  15.632 139.248 1.00 22.21  ? 112 PRO D O   1 
ATOM   5027 C CB  . PRO D 2 112 ? 54.397  18.251 138.577 1.00 2.00   ? 112 PRO D CB  1 
ATOM   5028 C CG  . PRO D 2 112 ? 55.110  18.261 137.297 1.00 4.78   ? 112 PRO D CG  1 
ATOM   5029 C CD  . PRO D 2 112 ? 56.471  18.876 137.631 1.00 2.00   ? 112 PRO D CD  1 
ATOM   5030 N N   . MET D 2 113 ? 54.662  15.793 140.598 1.00 26.13  ? 113 MET D N   1 
ATOM   5031 C CA  . MET D 2 113 ? 54.589  14.382 140.953 1.00 26.59  ? 113 MET D CA  1 
ATOM   5032 C C   . MET D 2 113 ? 53.721  13.681 139.929 1.00 26.26  ? 113 MET D C   1 
ATOM   5033 O O   . MET D 2 113 ? 52.494  13.755 139.994 1.00 36.31  ? 113 MET D O   1 
ATOM   5034 C CB  . MET D 2 113 ? 54.004  14.236 142.377 1.00 48.41  ? 113 MET D CB  1 
ATOM   5035 C CG  . MET D 2 113 ? 54.911  14.792 143.517 1.00 54.47  ? 113 MET D CG  1 
ATOM   5036 S SD  . MET D 2 113 ? 54.073  15.677 144.882 1.00 65.67  ? 113 MET D SD  1 
ATOM   5037 C CE  . MET D 2 113 ? 52.696  14.539 145.283 1.00 70.64  ? 113 MET D CE  1 
ATOM   5038 N N   . LEU D 2 114 ? 54.382  13.093 138.935 1.00 17.47  ? 114 LEU D N   1 
ATOM   5039 C CA  . LEU D 2 114 ? 53.731  12.365 137.838 1.00 22.29  ? 114 LEU D CA  1 
ATOM   5040 C C   . LEU D 2 114 ? 53.806  10.864 138.117 1.00 26.05  ? 114 LEU D C   1 
ATOM   5041 O O   . LEU D 2 114 ? 54.882  10.329 138.380 1.00 28.77  ? 114 LEU D O   1 
ATOM   5042 C CB  . LEU D 2 114 ? 54.422  12.685 136.493 1.00 8.18   ? 114 LEU D CB  1 
ATOM   5043 C CG  . LEU D 2 114 ? 53.919  12.023 135.197 1.00 10.05  ? 114 LEU D CG  1 
ATOM   5044 C CD1 . LEU D 2 114 ? 52.529  12.498 134.778 1.00 10.89  ? 114 LEU D CD1 1 
ATOM   5045 C CD2 . LEU D 2 114 ? 54.935  12.284 134.100 1.00 9.00   ? 114 LEU D CD2 1 
ATOM   5046 N N   . GLN D 2 115 ? 52.681  10.173 138.023 1.00 31.35  ? 115 GLN D N   1 
ATOM   5047 C CA  . GLN D 2 115 ? 52.672  8.755  138.290 1.00 29.84  ? 115 GLN D CA  1 
ATOM   5048 C C   . GLN D 2 115 ? 51.649  8.074  137.393 1.00 32.73  ? 115 GLN D C   1 
ATOM   5049 O O   . GLN D 2 115 ? 50.753  8.731  136.839 1.00 39.22  ? 115 GLN D O   1 
ATOM   5050 C CB  . GLN D 2 115 ? 52.351  8.526  139.784 1.00 38.75  ? 115 GLN D CB  1 
ATOM   5051 C CG  . GLN D 2 115 ? 50.932  8.935  140.225 1.00 50.03  ? 115 GLN D CG  1 
ATOM   5052 C CD  . GLN D 2 115 ? 50.859  9.368  141.682 1.00 63.77  ? 115 GLN D CD  1 
ATOM   5053 O OE1 . GLN D 2 115 ? 51.864  9.359  142.397 1.00 65.69  ? 115 GLN D OE1 1 
ATOM   5054 N NE2 . GLN D 2 115 ? 49.673  9.797  142.116 1.00 74.58  ? 115 GLN D NE2 1 
ATOM   5055 N N   . ALA D 2 116 ? 51.832  6.772  137.193 1.00 31.17  ? 116 ALA D N   1 
ATOM   5056 C CA  . ALA D 2 116 ? 50.898  5.963  136.409 1.00 25.62  ? 116 ALA D CA  1 
ATOM   5057 C C   . ALA D 2 116 ? 49.746  5.778  137.364 1.00 20.56  ? 116 ALA D C   1 
ATOM   5058 O O   . ALA D 2 116 ? 49.969  5.569  138.545 1.00 33.36  ? 116 ALA D O   1 
ATOM   5059 C CB  . ALA D 2 116 ? 51.515  4.642  136.070 1.00 36.55  ? 116 ALA D CB  1 
ATOM   5060 N N   . LEU D 2 117 ? 48.520  5.866  136.886 1.00 33.21  ? 117 LEU D N   1 
ATOM   5061 C CA  . LEU D 2 117 ? 47.367  5.783  137.779 1.00 48.63  ? 117 LEU D CA  1 
ATOM   5062 C C   . LEU D 2 117 ? 47.109  4.486  138.541 1.00 69.07  ? 117 LEU D C   1 
ATOM   5063 O O   . LEU D 2 117 ? 47.528  3.406  138.106 1.00 74.14  ? 117 LEU D O   1 
ATOM   5064 C CB  . LEU D 2 117 ? 46.117  6.179  137.012 1.00 47.64  ? 117 LEU D CB  1 
ATOM   5065 C CG  . LEU D 2 117 ? 44.896  6.472  137.867 1.00 57.70  ? 117 LEU D CG  1 
ATOM   5066 C CD1 . LEU D 2 117 ? 45.169  7.644  138.805 1.00 68.44  ? 117 LEU D CD1 1 
ATOM   5067 C CD2 . LEU D 2 117 ? 43.728  6.745  136.962 1.00 58.60  ? 117 LEU D CD2 1 
ATOM   5068 N N   . ASP D 2 118 ? 46.400  4.626  139.670 1.00 95.32  ? 118 ASP D N   1 
ATOM   5069 C CA  . ASP D 2 118 ? 45.987  3.532  140.562 1.00 117.60 ? 118 ASP D CA  1 
ATOM   5070 C C   . ASP D 2 118 ? 44.575  3.811  141.116 1.00 121.26 ? 118 ASP D C   1 
ATOM   5071 O O   . ASP D 2 118 ? 43.732  2.889  141.099 1.00 122.45 ? 118 ASP D O   1 
ATOM   5072 C CB  . ASP D 2 118 ? 46.965  3.369  141.736 1.00 136.04 ? 118 ASP D CB  1 
ATOM   5073 C CG  . ASP D 2 118 ? 48.228  2.609  141.355 1.00 152.44 ? 118 ASP D CG  1 
ATOM   5074 O OD1 . ASP D 2 118 ? 49.334  3.125  141.625 1.00 158.15 ? 118 ASP D OD1 1 
ATOM   5075 O OD2 . ASP D 2 118 ? 48.119  1.491  140.801 1.00 162.00 ? 118 ASP D OD2 1 
ATOM   5076 N N   . GLN D 2 127 ? 42.805  -0.292 128.287 1.00 60.29  ? 127 GLN D N   1 
ATOM   5077 C CA  . GLN D 2 127 ? 42.581  -0.032 126.835 1.00 71.73  ? 127 GLN D CA  1 
ATOM   5078 C C   . GLN D 2 127 ? 43.878  -0.309 126.067 1.00 72.37  ? 127 GLN D C   1 
ATOM   5079 O O   . GLN D 2 127 ? 44.959  -0.021 126.565 1.00 70.13  ? 127 GLN D O   1 
ATOM   5080 C CB  . GLN D 2 127 ? 42.129  1.397  126.625 1.00 73.67  ? 127 GLN D CB  1 
ATOM   5081 N N   . PRO D 2 128 ? 43.776  -0.852 124.837 1.00 76.91  ? 128 PRO D N   1 
ATOM   5082 C CA  . PRO D 2 128 ? 44.888  -1.209 123.937 1.00 72.32  ? 128 PRO D CA  1 
ATOM   5083 C C   . PRO D 2 128 ? 45.784  -0.071 123.461 1.00 65.58  ? 128 PRO D C   1 
ATOM   5084 O O   . PRO D 2 128 ? 45.341  0.805  122.720 1.00 63.10  ? 128 PRO D O   1 
ATOM   5085 C CB  . PRO D 2 128 ? 44.174  -1.858 122.747 1.00 80.69  ? 128 PRO D CB  1 
ATOM   5086 C CG  . PRO D 2 128 ? 42.867  -2.337 123.323 1.00 86.54  ? 128 PRO D CG  1 
ATOM   5087 C CD  . PRO D 2 128 ? 42.487  -1.185 124.207 1.00 84.71  ? 128 PRO D CD  1 
ATOM   5088 N N   . GLY D 2 129 ? 47.068  -0.165 123.797 1.00 62.24  ? 129 GLY D N   1 
ATOM   5089 C CA  . GLY D 2 129 ? 48.047  0.846  123.419 1.00 59.31  ? 129 GLY D CA  1 
ATOM   5090 C C   . GLY D 2 129 ? 47.914  2.159  124.180 1.00 60.70  ? 129 GLY D C   1 
ATOM   5091 O O   . GLY D 2 129 ? 48.407  3.202  123.710 1.00 49.88  ? 129 GLY D O   1 
ATOM   5092 N N   . CYS D 2 130 ? 47.290  2.088  125.364 1.00 55.44  ? 130 CYS D N   1 
ATOM   5093 C CA  . CYS D 2 130 ? 47.029  3.235  126.238 1.00 48.57  ? 130 CYS D CA  1 
ATOM   5094 C C   . CYS D 2 130 ? 47.835  3.260  127.546 1.00 49.29  ? 130 CYS D C   1 
ATOM   5095 O O   . CYS D 2 130 ? 48.444  2.267  127.939 1.00 56.38  ? 130 CYS D O   1 
ATOM   5096 C CB  . CYS D 2 130 ? 45.548  3.264  126.597 1.00 53.73  ? 130 CYS D CB  1 
ATOM   5097 S SG  . CYS D 2 130 ? 44.520  4.514  125.760 1.00 83.90  ? 130 CYS D SG  1 
ATOM   5098 N N   . LEU D 2 131 ? 47.790  4.403  128.229 1.00 42.80  ? 131 LEU D N   1 
ATOM   5099 C CA  . LEU D 2 131 ? 48.466  4.643  129.502 1.00 31.63  ? 131 LEU D CA  1 
ATOM   5100 C C   . LEU D 2 131 ? 47.640  5.635  130.311 1.00 32.92  ? 131 LEU D C   1 
ATOM   5101 O O   . LEU D 2 131 ? 47.006  6.530  129.751 1.00 38.42  ? 131 LEU D O   1 
ATOM   5102 C CB  . LEU D 2 131 ? 49.821  5.284  129.267 1.00 20.83  ? 131 LEU D CB  1 
ATOM   5103 C CG  . LEU D 2 131 ? 51.044  4.404  129.088 1.00 38.74  ? 131 LEU D CG  1 
ATOM   5104 C CD1 . LEU D 2 131 ? 52.274  5.285  128.832 1.00 30.33  ? 131 LEU D CD1 1 
ATOM   5105 C CD2 . LEU D 2 131 ? 51.234  3.543  130.337 1.00 43.52  ? 131 LEU D CD2 1 
ATOM   5106 N N   . TRP D 2 132 ? 47.625  5.478  131.623 1.00 30.64  ? 132 TRP D N   1 
ATOM   5107 C CA  . TRP D 2 132 ? 46.893  6.418  132.444 1.00 38.52  ? 132 TRP D CA  1 
ATOM   5108 C C   . TRP D 2 132 ? 47.888  7.067  133.380 1.00 42.03  ? 132 TRP D C   1 
ATOM   5109 O O   . TRP D 2 132 ? 48.738  6.392  133.980 1.00 44.03  ? 132 TRP D O   1 
ATOM   5110 C CB  . TRP D 2 132 ? 45.756  5.756  133.225 1.00 45.05  ? 132 TRP D CB  1 
ATOM   5111 C CG  . TRP D 2 132 ? 44.570  5.455  132.384 1.00 53.68  ? 132 TRP D CG  1 
ATOM   5112 C CD1 . TRP D 2 132 ? 43.467  6.244  132.193 1.00 53.36  ? 132 TRP D CD1 1 
ATOM   5113 C CD2 . TRP D 2 132 ? 44.384  4.293  131.577 1.00 60.74  ? 132 TRP D CD2 1 
ATOM   5114 N NE1 . TRP D 2 132 ? 42.612  5.642  131.306 1.00 52.34  ? 132 TRP D NE1 1 
ATOM   5115 C CE2 . TRP D 2 132 ? 43.151  4.442  130.911 1.00 62.57  ? 132 TRP D CE2 1 
ATOM   5116 C CE3 . TRP D 2 132 ? 45.147  3.132  131.347 1.00 76.94  ? 132 TRP D CE3 1 
ATOM   5117 C CZ2 . TRP D 2 132 ? 42.659  3.470  130.021 1.00 74.77  ? 132 TRP D CZ2 1 
ATOM   5118 C CZ3 . TRP D 2 132 ? 44.661  2.167  130.466 1.00 80.86  ? 132 TRP D CZ3 1 
ATOM   5119 C CH2 . TRP D 2 132 ? 43.426  2.344  129.813 1.00 80.88  ? 132 TRP D CH2 1 
ATOM   5120 N N   . LEU D 2 133 ? 47.795  8.387  133.464 1.00 36.91  ? 133 LEU D N   1 
ATOM   5121 C CA  . LEU D 2 133 ? 48.674  9.162  134.302 1.00 27.66  ? 133 LEU D CA  1 
ATOM   5122 C C   . LEU D 2 133 ? 47.911  9.915  135.360 1.00 26.92  ? 133 LEU D C   1 
ATOM   5123 O O   . LEU D 2 133 ? 46.677  10.014 135.331 1.00 26.34  ? 133 LEU D O   1 
ATOM   5124 C CB  . LEU D 2 133 ? 49.445  10.145 133.448 1.00 29.10  ? 133 LEU D CB  1 
ATOM   5125 C CG  . LEU D 2 133 ? 50.200  9.499  132.303 1.00 20.04  ? 133 LEU D CG  1 
ATOM   5126 C CD1 . LEU D 2 133 ? 50.933  10.598 131.604 1.00 31.36  ? 133 LEU D CD1 1 
ATOM   5127 C CD2 . LEU D 2 133 ? 51.183  8.440  132.814 1.00 23.43  ? 133 LEU D CD2 1 
ATOM   5128 N N   . SER D 2 134 ? 48.681  10.466 136.280 1.00 20.97  ? 134 SER D N   1 
ATOM   5129 C CA  . SER D 2 134 ? 48.159  11.236 137.375 1.00 21.98  ? 134 SER D CA  1 
ATOM   5130 C C   . SER D 2 134 ? 49.312  12.135 137.789 1.00 14.17  ? 134 SER D C   1 
ATOM   5131 O O   . SER D 2 134 ? 50.473  11.763 137.636 1.00 4.64   ? 134 SER D O   1 
ATOM   5132 C CB  . SER D 2 134 ? 47.770  10.272 138.510 1.00 35.21  ? 134 SER D CB  1 
ATOM   5133 O OG  . SER D 2 134 ? 47.737  10.891 139.793 1.00 67.45  ? 134 SER D OG  1 
ATOM   5134 N N   . TRP D 2 135 ? 49.007  13.355 138.199 1.00 3.68   ? 135 TRP D N   1 
ATOM   5135 C CA  . TRP D 2 135 ? 50.052  14.227 138.671 1.00 2.00   ? 135 TRP D CA  1 
ATOM   5136 C C   . TRP D 2 135 ? 49.474  15.255 139.604 1.00 11.72  ? 135 TRP D C   1 
ATOM   5137 O O   . TRP D 2 135 ? 48.283  15.556 139.563 1.00 17.11  ? 135 TRP D O   1 
ATOM   5138 C CB  . TRP D 2 135 ? 50.877  14.857 137.520 1.00 14.09  ? 135 TRP D CB  1 
ATOM   5139 C CG  . TRP D 2 135 ? 50.130  15.726 136.542 1.00 17.55  ? 135 TRP D CG  1 
ATOM   5140 C CD1 . TRP D 2 135 ? 49.755  17.029 136.715 1.00 7.20   ? 135 TRP D CD1 1 
ATOM   5141 C CD2 . TRP D 2 135 ? 49.592  15.319 135.280 1.00 18.88  ? 135 TRP D CD2 1 
ATOM   5142 N NE1 . TRP D 2 135 ? 48.994  17.447 135.651 1.00 17.33  ? 135 TRP D NE1 1 
ATOM   5143 C CE2 . TRP D 2 135 ? 48.878  16.415 134.758 1.00 14.20  ? 135 TRP D CE2 1 
ATOM   5144 C CE3 . TRP D 2 135 ? 49.636  14.127 134.548 1.00 19.91  ? 135 TRP D CE3 1 
ATOM   5145 C CZ2 . TRP D 2 135 ? 48.213  16.353 133.548 1.00 23.00  ? 135 TRP D CZ2 1 
ATOM   5146 C CZ3 . TRP D 2 135 ? 48.975  14.069 133.349 1.00 18.18  ? 135 TRP D CZ3 1 
ATOM   5147 C CH2 . TRP D 2 135 ? 48.271  15.175 132.859 1.00 26.50  ? 135 TRP D CH2 1 
ATOM   5148 N N   . LYS D 2 136 ? 50.299  15.655 140.553 1.00 16.40  ? 136 LYS D N   1 
ATOM   5149 C CA  . LYS D 2 136 ? 49.960  16.663 141.539 1.00 19.25  ? 136 LYS D CA  1 
ATOM   5150 C C   . LYS D 2 136 ? 51.185  17.547 141.488 1.00 20.33  ? 136 LYS D C   1 
ATOM   5151 O O   . LYS D 2 136 ? 52.241  17.100 141.058 1.00 21.33  ? 136 LYS D O   1 
ATOM   5152 C CB  . LYS D 2 136 ? 49.858  16.040 142.916 1.00 29.95  ? 136 LYS D CB  1 
ATOM   5153 C CG  . LYS D 2 136 ? 48.669  15.143 143.122 1.00 53.64  ? 136 LYS D CG  1 
ATOM   5154 C CD  . LYS D 2 136 ? 48.653  14.636 144.564 1.00 81.31  ? 136 LYS D CD  1 
ATOM   5155 C CE  . LYS D 2 136 ? 47.392  13.827 144.882 1.00 97.10  ? 136 LYS D CE  1 
ATOM   5156 N NZ  . LYS D 2 136 ? 46.138  14.640 144.844 1.00 103.10 ? 136 LYS D NZ  1 
ATOM   5157 N N   . PRO D 2 137 ? 51.069  18.818 141.882 1.00 15.38  ? 137 PRO D N   1 
ATOM   5158 C CA  . PRO D 2 137 ? 52.264  19.661 141.824 1.00 12.94  ? 137 PRO D CA  1 
ATOM   5159 C C   . PRO D 2 137 ? 53.167  19.491 143.032 1.00 12.46  ? 137 PRO D C   1 
ATOM   5160 O O   . PRO D 2 137 ? 52.822  18.785 143.987 1.00 20.39  ? 137 PRO D O   1 
ATOM   5161 C CB  . PRO D 2 137 ? 51.676  21.068 141.784 1.00 5.17   ? 137 PRO D CB  1 
ATOM   5162 C CG  . PRO D 2 137 ? 50.521  20.942 142.691 1.00 2.00   ? 137 PRO D CG  1 
ATOM   5163 C CD  . PRO D 2 137 ? 49.889  19.618 142.236 1.00 9.04   ? 137 PRO D CD  1 
ATOM   5164 N N   . TRP D 2 138 ? 54.334  20.121 142.955 1.00 7.80   ? 138 TRP D N   1 
ATOM   5165 C CA  . TRP D 2 138 ? 55.303  20.116 144.018 1.00 5.18   ? 138 TRP D CA  1 
ATOM   5166 C C   . TRP D 2 138 ? 54.582  20.853 145.165 1.00 20.94  ? 138 TRP D C   1 
ATOM   5167 O O   . TRP D 2 138 ? 54.322  22.055 145.095 1.00 25.94  ? 138 TRP D O   1 
ATOM   5168 C CB  . TRP D 2 138 ? 56.517  20.872 143.526 1.00 2.00   ? 138 TRP D CB  1 
ATOM   5169 C CG  . TRP D 2 138 ? 57.633  20.941 144.503 1.00 11.82  ? 138 TRP D CG  1 
ATOM   5170 C CD1 . TRP D 2 138 ? 58.113  19.928 145.276 1.00 4.72   ? 138 TRP D CD1 1 
ATOM   5171 C CD2 . TRP D 2 138 ? 58.381  22.109 144.860 1.00 8.94   ? 138 TRP D CD2 1 
ATOM   5172 N NE1 . TRP D 2 138 ? 59.102  20.398 146.102 1.00 19.27  ? 138 TRP D NE1 1 
ATOM   5173 C CE2 . TRP D 2 138 ? 59.285  21.735 145.864 1.00 9.04   ? 138 TRP D CE2 1 
ATOM   5174 C CE3 . TRP D 2 138 ? 58.362  23.435 144.434 1.00 16.54  ? 138 TRP D CE3 1 
ATOM   5175 C CZ2 . TRP D 2 138 ? 60.163  22.636 146.450 1.00 11.69  ? 138 TRP D CZ2 1 
ATOM   5176 C CZ3 . TRP D 2 138 ? 59.241  24.335 145.021 1.00 19.33  ? 138 TRP D CZ3 1 
ATOM   5177 C CH2 . TRP D 2 138 ? 60.127  23.929 146.017 1.00 14.94  ? 138 TRP D CH2 1 
ATOM   5178 N N   . LYS D 2 139 ? 54.261  20.125 146.224 1.00 18.61  ? 139 LYS D N   1 
ATOM   5179 C CA  . LYS D 2 139 ? 53.500  20.686 147.333 1.00 13.00  ? 139 LYS D CA  1 
ATOM   5180 C C   . LYS D 2 139 ? 53.782  22.098 147.832 1.00 11.18  ? 139 LYS D C   1 
ATOM   5181 O O   . LYS D 2 139 ? 52.851  22.877 148.049 1.00 20.95  ? 139 LYS D O   1 
ATOM   5182 C CB  . LYS D 2 139 ? 53.465  19.704 148.506 1.00 16.42  ? 139 LYS D CB  1 
ATOM   5183 C CG  . LYS D 2 139 ? 52.257  19.877 149.404 1.00 36.50  ? 139 LYS D CG  1 
ATOM   5184 C CD  . LYS D 2 139 ? 51.942  18.604 150.154 1.00 56.57  ? 139 LYS D CD  1 
ATOM   5185 C CE  . LYS D 2 139 ? 50.475  18.568 150.530 1.00 75.41  ? 139 LYS D CE  1 
ATOM   5186 N NZ  . LYS D 2 139 ? 49.603  18.553 149.320 1.00 84.47  ? 139 LYS D NZ  1 
ATOM   5187 N N   . PRO D 2 140 ? 55.057  22.471 147.994 1.00 6.83   ? 140 PRO D N   1 
ATOM   5188 C CA  . PRO D 2 140 ? 55.354  23.821 148.492 1.00 3.71   ? 140 PRO D CA  1 
ATOM   5189 C C   . PRO D 2 140 ? 54.862  24.917 147.616 1.00 2.00   ? 140 PRO D C   1 
ATOM   5190 O O   . PRO D 2 140 ? 54.721  26.045 148.063 1.00 22.29  ? 140 PRO D O   1 
ATOM   5191 C CB  . PRO D 2 140 ? 56.881  23.848 148.568 1.00 9.32   ? 140 PRO D CB  1 
ATOM   5192 C CG  . PRO D 2 140 ? 57.244  22.422 148.786 1.00 6.47   ? 140 PRO D CG  1 
ATOM   5193 C CD  . PRO D 2 140 ? 56.302  21.705 147.823 1.00 12.70  ? 140 PRO D CD  1 
ATOM   5194 N N   . SER D 2 141 ? 54.570  24.578 146.372 1.00 6.48   ? 141 SER D N   1 
ATOM   5195 C CA  . SER D 2 141 ? 54.103  25.563 145.420 1.00 2.00   ? 141 SER D CA  1 
ATOM   5196 C C   . SER D 2 141 ? 52.669  25.326 145.021 1.00 2.00   ? 141 SER D C   1 
ATOM   5197 O O   . SER D 2 141 ? 52.195  25.952 144.084 1.00 5.10   ? 141 SER D O   1 
ATOM   5198 C CB  . SER D 2 141 ? 54.973  25.527 144.169 1.00 2.00   ? 141 SER D CB  1 
ATOM   5199 O OG  . SER D 2 141 ? 54.746  24.348 143.423 1.00 6.86   ? 141 SER D OG  1 
ATOM   5200 N N   . GLU D 2 142 ? 51.955  24.491 145.768 1.00 3.54   ? 142 GLU D N   1 
ATOM   5201 C CA  . GLU D 2 142 ? 50.576  24.168 145.413 1.00 7.54   ? 142 GLU D CA  1 
ATOM   5202 C C   . GLU D 2 142 ? 49.642  25.382 145.307 1.00 11.94  ? 142 GLU D C   1 
ATOM   5203 O O   . GLU D 2 142 ? 48.632  25.334 144.587 1.00 17.99  ? 142 GLU D O   1 
ATOM   5204 C CB  . GLU D 2 142 ? 50.011  23.083 146.348 1.00 5.74   ? 142 GLU D CB  1 
ATOM   5205 C CG  . GLU D 2 142 ? 49.985  23.462 147.832 1.00 57.33  ? 142 GLU D CG  1 
ATOM   5206 C CD  . GLU D 2 142 ? 49.223  22.469 148.717 1.00 73.46  ? 142 GLU D CD  1 
ATOM   5207 O OE1 . GLU D 2 142 ? 48.665  21.474 148.187 1.00 71.26  ? 142 GLU D OE1 1 
ATOM   5208 O OE2 . GLU D 2 142 ? 49.183  22.702 149.955 1.00 81.46  ? 142 GLU D OE2 1 
ATOM   5209 N N   . TYR D 2 143 ? 50.015  26.481 145.970 1.00 6.23   ? 143 TYR D N   1 
ATOM   5210 C CA  . TYR D 2 143 ? 49.214  27.714 145.977 1.00 10.15  ? 143 TYR D CA  1 
ATOM   5211 C C   . TYR D 2 143 ? 49.344  28.511 144.690 1.00 15.58  ? 143 TYR D C   1 
ATOM   5212 O O   . TYR D 2 143 ? 48.632  29.494 144.483 1.00 23.31  ? 143 TYR D O   1 
ATOM   5213 C CB  . TYR D 2 143 ? 49.636  28.625 147.127 1.00 8.32   ? 143 TYR D CB  1 
ATOM   5214 C CG  . TYR D 2 143 ? 51.012  29.212 146.939 1.00 11.29  ? 143 TYR D CG  1 
ATOM   5215 C CD1 . TYR D 2 143 ? 52.146  28.560 147.431 1.00 17.91  ? 143 TYR D CD1 1 
ATOM   5216 C CD2 . TYR D 2 143 ? 51.187  30.378 146.223 1.00 7.59   ? 143 TYR D CD2 1 
ATOM   5217 C CE1 . TYR D 2 143 ? 53.402  29.059 147.199 1.00 8.72   ? 143 TYR D CE1 1 
ATOM   5218 C CE2 . TYR D 2 143 ? 52.431  30.876 145.983 1.00 12.61  ? 143 TYR D CE2 1 
ATOM   5219 C CZ  . TYR D 2 143 ? 53.526  30.215 146.463 1.00 12.48  ? 143 TYR D CZ  1 
ATOM   5220 O OH  . TYR D 2 143 ? 54.749  30.696 146.123 1.00 15.73  ? 143 TYR D OH  1 
ATOM   5221 N N   . MET D 2 144 ? 50.304  28.113 143.866 1.00 14.46  ? 144 MET D N   1 
ATOM   5222 C CA  . MET D 2 144 ? 50.594  28.769 142.606 1.00 13.23  ? 144 MET D CA  1 
ATOM   5223 C C   . MET D 2 144 ? 49.792  28.122 141.463 1.00 12.87  ? 144 MET D C   1 
ATOM   5224 O O   . MET D 2 144 ? 49.731  26.902 141.374 1.00 21.71  ? 144 MET D O   1 
ATOM   5225 C CB  . MET D 2 144 ? 52.090  28.625 142.383 1.00 2.00   ? 144 MET D CB  1 
ATOM   5226 C CG  . MET D 2 144 ? 52.646  29.423 141.265 1.00 19.67  ? 144 MET D CG  1 
ATOM   5227 S SD  . MET D 2 144 ? 54.416  29.274 141.257 1.00 17.64  ? 144 MET D SD  1 
ATOM   5228 C CE  . MET D 2 144 ? 54.763  29.685 143.000 1.00 17.96  ? 144 MET D CE  1 
ATOM   5229 N N   . GLU D 2 145 ? 49.113  28.917 140.639 1.00 18.72  ? 145 GLU D N   1 
ATOM   5230 C CA  . GLU D 2 145 ? 48.350  28.358 139.517 1.00 11.68  ? 145 GLU D CA  1 
ATOM   5231 C C   . GLU D 2 145 ? 49.417  28.069 138.491 1.00 12.65  ? 145 GLU D C   1 
ATOM   5232 O O   . GLU D 2 145 ? 50.102  28.983 138.038 1.00 21.26  ? 145 GLU D O   1 
ATOM   5233 C CB  . GLU D 2 145 ? 47.391  29.386 138.934 1.00 8.32   ? 145 GLU D CB  1 
ATOM   5234 C CG  . GLU D 2 145 ? 46.292  28.823 138.084 1.00 50.02  ? 145 GLU D CG  1 
ATOM   5235 C CD  . GLU D 2 145 ? 45.061  28.474 138.903 1.00 86.21  ? 145 GLU D CD  1 
ATOM   5236 O OE1 . GLU D 2 145 ? 43.999  29.082 138.644 1.00 106.65 ? 145 GLU D OE1 1 
ATOM   5237 O OE2 . GLU D 2 145 ? 45.151  27.610 139.810 1.00 97.00  ? 145 GLU D OE2 1 
ATOM   5238 N N   . GLN D 2 146 ? 49.587  26.805 138.142 1.00 18.76  ? 146 GLN D N   1 
ATOM   5239 C CA  . GLN D 2 146 ? 50.613  26.417 137.184 1.00 16.53  ? 146 GLN D CA  1 
ATOM   5240 C C   . GLN D 2 146 ? 50.048  25.831 135.891 1.00 13.64  ? 146 GLN D C   1 
ATOM   5241 O O   . GLN D 2 146 ? 48.859  25.482 135.823 1.00 24.06  ? 146 GLN D O   1 
ATOM   5242 C CB  . GLN D 2 146 ? 51.596  25.436 137.845 1.00 16.61  ? 146 GLN D CB  1 
ATOM   5243 C CG  . GLN D 2 146 ? 52.397  26.051 139.001 1.00 26.94  ? 146 GLN D CG  1 
ATOM   5244 C CD  . GLN D 2 146 ? 52.982  25.028 139.970 1.00 20.33  ? 146 GLN D CD  1 
ATOM   5245 O OE1 . GLN D 2 146 ? 53.952  24.342 139.663 1.00 36.10  ? 146 GLN D OE1 1 
ATOM   5246 N NE2 . GLN D 2 146 ? 52.403  24.947 141.158 1.00 49.07  ? 146 GLN D NE2 1 
ATOM   5247 N N   . GLU D 2 147 ? 50.917  25.735 134.883 1.00 8.09   ? 147 GLU D N   1 
ATOM   5248 C CA  . GLU D 2 147 ? 50.607  25.214 133.554 1.00 9.01   ? 147 GLU D CA  1 
ATOM   5249 C C   . GLU D 2 147 ? 51.763  24.259 133.284 1.00 9.60   ? 147 GLU D C   1 
ATOM   5250 O O   . GLU D 2 147 ? 52.913  24.602 133.583 1.00 16.76  ? 147 GLU D O   1 
ATOM   5251 C CB  . GLU D 2 147 ? 50.649  26.387 132.580 1.00 18.20  ? 147 GLU D CB  1 
ATOM   5252 C CG  . GLU D 2 147 ? 50.323  26.113 131.140 1.00 43.90  ? 147 GLU D CG  1 
ATOM   5253 C CD  . GLU D 2 147 ? 50.487  27.378 130.327 1.00 60.33  ? 147 GLU D CD  1 
ATOM   5254 O OE1 . GLU D 2 147 ? 49.536  28.191 130.298 1.00 69.15  ? 147 GLU D OE1 1 
ATOM   5255 O OE2 . GLU D 2 147 ? 51.584  27.587 129.760 1.00 73.96  ? 147 GLU D OE2 1 
ATOM   5256 N N   . CYS D 2 148 ? 51.496  23.099 132.692 1.00 2.00   ? 148 CYS D N   1 
ATOM   5257 C CA  . CYS D 2 148 ? 52.566  22.148 132.460 1.00 6.32   ? 148 CYS D CA  1 
ATOM   5258 C C   . CYS D 2 148 ? 52.631  21.579 131.064 1.00 10.02  ? 148 CYS D C   1 
ATOM   5259 O O   . CYS D 2 148 ? 51.663  21.628 130.328 1.00 19.76  ? 148 CYS D O   1 
ATOM   5260 C CB  . CYS D 2 148 ? 52.437  20.989 133.439 1.00 17.00  ? 148 CYS D CB  1 
ATOM   5261 S SG  . CYS D 2 148 ? 52.152  21.538 135.131 1.00 26.59  ? 148 CYS D SG  1 
ATOM   5262 N N   . GLU D 2 149 ? 53.802  21.039 130.730 1.00 6.23   ? 149 GLU D N   1 
ATOM   5263 C CA  . GLU D 2 149 ? 54.092  20.376 129.461 1.00 5.34   ? 149 GLU D CA  1 
ATOM   5264 C C   . GLU D 2 149 ? 54.453  18.955 129.897 1.00 8.80   ? 149 GLU D C   1 
ATOM   5265 O O   . GLU D 2 149 ? 55.070  18.769 130.937 1.00 11.93  ? 149 GLU D O   1 
ATOM   5266 C CB  . GLU D 2 149 ? 55.318  20.997 128.749 1.00 2.00   ? 149 GLU D CB  1 
ATOM   5267 C CG  . GLU D 2 149 ? 55.098  22.410 128.206 1.00 9.83   ? 149 GLU D CG  1 
ATOM   5268 C CD  . GLU D 2 149 ? 56.338  23.038 127.556 1.00 16.04  ? 149 GLU D CD  1 
ATOM   5269 O OE1 . GLU D 2 149 ? 56.222  24.163 127.027 1.00 31.77  ? 149 GLU D OE1 1 
ATOM   5270 O OE2 . GLU D 2 149 ? 57.426  22.427 127.568 1.00 24.64  ? 149 GLU D OE2 1 
ATOM   5271 N N   . LEU D 2 150 ? 54.010  17.962 129.140 1.00 5.84   ? 150 LEU D N   1 
ATOM   5272 C CA  . LEU D 2 150 ? 54.307  16.567 129.399 1.00 2.00   ? 150 LEU D CA  1 
ATOM   5273 C C   . LEU D 2 150 ? 54.984  16.124 128.139 1.00 2.00   ? 150 LEU D C   1 
ATOM   5274 O O   . LEU D 2 150 ? 54.531  16.483 127.070 1.00 17.99  ? 150 LEU D O   1 
ATOM   5275 C CB  . LEU D 2 150 ? 53.010  15.798 129.523 1.00 6.96   ? 150 LEU D CB  1 
ATOM   5276 C CG  . LEU D 2 150 ? 53.025  14.279 129.391 1.00 11.79  ? 150 LEU D CG  1 
ATOM   5277 C CD1 . LEU D 2 150 ? 53.599  13.694 130.638 1.00 7.72   ? 150 LEU D CD1 1 
ATOM   5278 C CD2 . LEU D 2 150 ? 51.617  13.750 129.190 1.00 4.36   ? 150 LEU D CD2 1 
ATOM   5279 N N   . ARG D 2 151 ? 56.108  15.438 128.225 1.00 6.84   ? 151 ARG D N   1 
ATOM   5280 C CA  . ARG D 2 151 ? 56.733  14.971 127.000 1.00 5.21   ? 151 ARG D CA  1 
ATOM   5281 C C   . ARG D 2 151 ? 56.871  13.478 127.079 1.00 11.96  ? 151 ARG D C   1 
ATOM   5282 O O   . ARG D 2 151 ? 57.127  12.945 128.162 1.00 14.36  ? 151 ARG D O   1 
ATOM   5283 C CB  . ARG D 2 151 ? 58.075  15.647 126.717 1.00 2.32   ? 151 ARG D CB  1 
ATOM   5284 C CG  . ARG D 2 151 ? 59.192  15.430 127.705 1.00 2.00   ? 151 ARG D CG  1 
ATOM   5285 C CD  . ARG D 2 151 ? 60.472  16.011 127.139 1.00 2.00   ? 151 ARG D CD  1 
ATOM   5286 N NE  . ARG D 2 151 ? 61.628  15.858 128.006 1.00 2.00   ? 151 ARG D NE  1 
ATOM   5287 C CZ  . ARG D 2 151 ? 62.778  16.516 127.846 1.00 12.26  ? 151 ARG D CZ  1 
ATOM   5288 N NH1 . ARG D 2 151 ? 62.917  17.356 126.862 1.00 19.34  ? 151 ARG D NH1 1 
ATOM   5289 N NH2 . ARG D 2 151 ? 63.802  16.392 128.665 1.00 2.00   ? 151 ARG D NH2 1 
ATOM   5290 N N   . TYR D 2 152 ? 56.608  12.810 125.955 1.00 16.95  ? 152 TYR D N   1 
ATOM   5291 C CA  . TYR D 2 152 ? 56.690  11.356 125.875 1.00 18.36  ? 152 TYR D CA  1 
ATOM   5292 C C   . TYR D 2 152 ? 57.339  10.823 124.613 1.00 22.10  ? 152 TYR D C   1 
ATOM   5293 O O   . TYR D 2 152 ? 57.191  11.411 123.545 1.00 32.04  ? 152 TYR D O   1 
ATOM   5294 C CB  . TYR D 2 152 ? 55.301  10.740 126.018 1.00 9.71   ? 152 TYR D CB  1 
ATOM   5295 C CG  . TYR D 2 152 ? 54.302  11.079 124.929 1.00 14.85  ? 152 TYR D CG  1 
ATOM   5296 C CD1 . TYR D 2 152 ? 53.321  12.041 125.141 1.00 26.17  ? 152 TYR D CD1 1 
ATOM   5297 C CD2 . TYR D 2 152 ? 54.261  10.355 123.742 1.00 17.74  ? 152 TYR D CD2 1 
ATOM   5298 C CE1 . TYR D 2 152 ? 52.320  12.263 124.208 1.00 32.40  ? 152 TYR D CE1 1 
ATOM   5299 C CE2 . TYR D 2 152 ? 53.264  10.572 122.799 1.00 32.03  ? 152 TYR D CE2 1 
ATOM   5300 C CZ  . TYR D 2 152 ? 52.297  11.526 123.042 1.00 35.01  ? 152 TYR D CZ  1 
ATOM   5301 O OH  . TYR D 2 152 ? 51.309  11.740 122.113 1.00 41.10  ? 152 TYR D OH  1 
ATOM   5302 N N   . GLN D 2 153 ? 58.057  9.709  124.741 1.00 24.67  ? 153 GLN D N   1 
ATOM   5303 C CA  . GLN D 2 153 ? 58.704  9.088  123.598 1.00 28.79  ? 153 GLN D CA  1 
ATOM   5304 C C   . GLN D 2 153 ? 58.819  7.594  123.732 1.00 27.33  ? 153 GLN D C   1 
ATOM   5305 O O   . GLN D 2 153 ? 58.922  7.067  124.831 1.00 34.84  ? 153 GLN D O   1 
ATOM   5306 C CB  . GLN D 2 153 ? 60.095  9.668  123.359 1.00 13.25  ? 153 GLN D CB  1 
ATOM   5307 C CG  . GLN D 2 153 ? 61.171  9.156  124.246 1.00 7.70   ? 153 GLN D CG  1 
ATOM   5308 C CD  . GLN D 2 153 ? 62.544  9.736  123.884 1.00 15.80  ? 153 GLN D CD  1 
ATOM   5309 O OE1 . GLN D 2 153 ? 63.541  9.507  124.570 1.00 29.13  ? 153 GLN D OE1 1 
ATOM   5310 N NE2 . GLN D 2 153 ? 62.602  10.470 122.793 1.00 27.00  ? 153 GLN D NE2 1 
ATOM   5311 N N   . PRO D 2 154 ? 58.683  6.876  122.616 1.00 27.71  ? 154 PRO D N   1 
ATOM   5312 C CA  . PRO D 2 154 ? 58.808  5.433  122.712 1.00 22.07  ? 154 PRO D CA  1 
ATOM   5313 C C   . PRO D 2 154 ? 60.288  5.292  122.965 1.00 17.82  ? 154 PRO D C   1 
ATOM   5314 O O   . PRO D 2 154 ? 61.077  6.083  122.460 1.00 24.04  ? 154 PRO D O   1 
ATOM   5315 C CB  . PRO D 2 154 ? 58.426  4.987  121.314 1.00 19.56  ? 154 PRO D CB  1 
ATOM   5316 C CG  . PRO D 2 154 ? 58.955  6.094  120.467 1.00 16.45  ? 154 PRO D CG  1 
ATOM   5317 C CD  . PRO D 2 154 ? 58.501  7.296  121.218 1.00 28.87  ? 154 PRO D CD  1 
ATOM   5318 N N   . GLN D 2 155 ? 60.672  4.405  123.854 1.00 20.73  ? 155 GLN D N   1 
ATOM   5319 C CA  . GLN D 2 155 ? 62.088  4.268  124.108 1.00 35.19  ? 155 GLN D CA  1 
ATOM   5320 C C   . GLN D 2 155 ? 62.761  3.479  122.979 1.00 41.15  ? 155 GLN D C   1 
ATOM   5321 O O   . GLN D 2 155 ? 62.728  2.245  122.971 1.00 51.16  ? 155 GLN D O   1 
ATOM   5322 C CB  . GLN D 2 155 ? 62.313  3.622  125.468 1.00 22.36  ? 155 GLN D CB  1 
ATOM   5323 C CG  . GLN D 2 155 ? 63.628  4.051  126.113 1.00 40.80  ? 155 GLN D CG  1 
ATOM   5324 C CD  . GLN D 2 155 ? 63.778  3.582  127.555 1.00 41.44  ? 155 GLN D CD  1 
ATOM   5325 O OE1 . GLN D 2 155 ? 64.784  3.886  128.218 1.00 32.80  ? 155 GLN D OE1 1 
ATOM   5326 N NE2 . GLN D 2 155 ? 62.782  2.848  128.052 1.00 26.83  ? 155 GLN D NE2 1 
ATOM   5327 N N   . LEU D 2 156 ? 63.304  4.204  121.998 1.00 40.11  ? 156 LEU D N   1 
ATOM   5328 C CA  . LEU D 2 156 ? 63.991  3.609  120.840 1.00 34.09  ? 156 LEU D CA  1 
ATOM   5329 C C   . LEU D 2 156 ? 65.314  4.336  120.583 1.00 38.39  ? 156 LEU D C   1 
ATOM   5330 O O   . LEU D 2 156 ? 65.633  5.315  121.266 1.00 45.76  ? 156 LEU D O   1 
ATOM   5331 C CB  . LEU D 2 156 ? 63.108  3.642  119.587 1.00 17.25  ? 156 LEU D CB  1 
ATOM   5332 C CG  . LEU D 2 156 ? 61.721  2.992  119.700 1.00 28.12  ? 156 LEU D CG  1 
ATOM   5333 C CD1 . LEU D 2 156 ? 60.932  3.247  118.447 1.00 34.34  ? 156 LEU D CD1 1 
ATOM   5334 C CD2 . LEU D 2 156 ? 61.830  1.504  119.937 1.00 41.26  ? 156 LEU D CD2 1 
ATOM   5335 N N   . LYS D 2 157 ? 66.079  3.857  119.607 1.00 42.95  ? 157 LYS D N   1 
ATOM   5336 C CA  . LYS D 2 157 ? 67.382  4.436  119.298 1.00 49.83  ? 157 LYS D CA  1 
ATOM   5337 C C   . LYS D 2 157 ? 67.334  5.871  118.766 1.00 49.91  ? 157 LYS D C   1 
ATOM   5338 O O   . LYS D 2 157 ? 68.329  6.599  118.833 1.00 47.92  ? 157 LYS D O   1 
ATOM   5339 C CB  . LYS D 2 157 ? 68.128  3.510  118.346 1.00 61.48  ? 157 LYS D CB  1 
ATOM   5340 C CG  . LYS D 2 157 ? 69.639  3.641  118.393 1.00 80.90  ? 157 LYS D CG  1 
ATOM   5341 C CD  . LYS D 2 157 ? 70.309  2.476  117.662 1.00 97.42  ? 157 LYS D CD  1 
ATOM   5342 C CE  . LYS D 2 157 ? 69.789  2.324  116.229 1.00 106.29 ? 157 LYS D CE  1 
ATOM   5343 N NZ  . LYS D 2 157 ? 70.376  1.144  115.532 1.00 105.73 ? 157 LYS D NZ  1 
ATOM   5344 N N   . GLY D 2 158 ? 66.170  6.271  118.254 1.00 57.82  ? 158 GLY D N   1 
ATOM   5345 C CA  . GLY D 2 158 ? 65.972  7.625  117.744 1.00 65.19  ? 158 GLY D CA  1 
ATOM   5346 C C   . GLY D 2 158 ? 65.123  8.455  118.703 1.00 66.54  ? 158 GLY D C   1 
ATOM   5347 O O   . GLY D 2 158 ? 63.889  8.471  118.631 1.00 57.60  ? 158 GLY D O   1 
ATOM   5348 N N   . ALA D 2 159 ? 65.792  9.159  119.607 1.00 71.96  ? 159 ALA D N   1 
ATOM   5349 C CA  . ALA D 2 159 ? 65.113  9.973  120.613 1.00 77.99  ? 159 ALA D CA  1 
ATOM   5350 C C   . ALA D 2 159 ? 64.213  11.116 120.091 1.00 75.28  ? 159 ALA D C   1 
ATOM   5351 O O   . ALA D 2 159 ? 64.649  12.273 120.019 1.00 85.57  ? 159 ALA D O   1 
ATOM   5352 C CB  . ALA D 2 159 ? 66.152  10.522 121.619 1.00 82.87  ? 159 ALA D CB  1 
ATOM   5353 N N   . ASN D 2 160 ? 62.954  10.814 119.770 1.00 58.78  ? 160 ASN D N   1 
ATOM   5354 C CA  . ASN D 2 160 ? 62.053  11.864 119.290 1.00 50.33  ? 160 ASN D CA  1 
ATOM   5355 C C   . ASN D 2 160 ? 60.932  12.201 120.279 1.00 39.95  ? 160 ASN D C   1 
ATOM   5356 O O   . ASN D 2 160 ? 59.996  11.406 120.490 1.00 31.38  ? 160 ASN D O   1 
ATOM   5357 C CB  . ASN D 2 160 ? 61.465  11.506 117.915 1.00 74.65  ? 160 ASN D CB  1 
ATOM   5358 C CG  . ASN D 2 160 ? 61.472  12.693 116.938 1.00 80.00  ? 160 ASN D CG  1 
ATOM   5359 O OD1 . ASN D 2 160 ? 62.265  13.631 117.079 1.00 79.98  ? 160 ASN D OD1 1 
ATOM   5360 N ND2 . ASN D 2 160 ? 60.599  12.638 115.932 1.00 72.31  ? 160 ASN D ND2 1 
ATOM   5361 N N   . TRP D 2 161 ? 61.029  13.401 120.859 1.00 30.32  ? 161 TRP D N   1 
ATOM   5362 C CA  . TRP D 2 161 ? 60.058  13.909 121.838 1.00 14.81  ? 161 TRP D CA  1 
ATOM   5363 C C   . TRP D 2 161 ? 58.718  14.411 121.267 1.00 21.97  ? 161 TRP D C   1 
ATOM   5364 O O   . TRP D 2 161 ? 58.685  15.260 120.361 1.00 31.28  ? 161 TRP D O   1 
ATOM   5365 C CB  . TRP D 2 161 ? 60.697  15.024 122.661 1.00 14.53  ? 161 TRP D CB  1 
ATOM   5366 C CG  . TRP D 2 161 ? 61.616  14.555 123.786 1.00 5.05   ? 161 TRP D CG  1 
ATOM   5367 C CD1 . TRP D 2 161 ? 62.911  14.965 124.037 1.00 2.00   ? 161 TRP D CD1 1 
ATOM   5368 C CD2 . TRP D 2 161 ? 61.291  13.627 124.813 1.00 8.15   ? 161 TRP D CD2 1 
ATOM   5369 N NE1 . TRP D 2 161 ? 63.394  14.349 125.155 1.00 6.49   ? 161 TRP D NE1 1 
ATOM   5370 C CE2 . TRP D 2 161 ? 62.420  13.522 125.655 1.00 6.77   ? 161 TRP D CE2 1 
ATOM   5371 C CE3 . TRP D 2 161 ? 60.147  12.867 125.110 1.00 29.61  ? 161 TRP D CE3 1 
ATOM   5372 C CZ2 . TRP D 2 161 ? 62.439  12.690 126.775 1.00 2.00   ? 161 TRP D CZ2 1 
ATOM   5373 C CZ3 . TRP D 2 161 ? 60.166  12.036 126.222 1.00 21.29  ? 161 TRP D CZ3 1 
ATOM   5374 C CH2 . TRP D 2 161 ? 61.306  11.957 127.042 1.00 3.35   ? 161 TRP D CH2 1 
ATOM   5375 N N   . THR D 2 162 ? 57.628  13.877 121.816 1.00 15.25  ? 162 THR D N   1 
ATOM   5376 C CA  . THR D 2 162 ? 56.273  14.244 121.433 1.00 11.71  ? 162 THR D CA  1 
ATOM   5377 C C   . THR D 2 162 ? 55.704  15.019 122.612 1.00 20.65  ? 162 THR D C   1 
ATOM   5378 O O   . THR D 2 162 ? 55.720  14.524 123.748 1.00 18.86  ? 162 THR D O   1 
ATOM   5379 C CB  . THR D 2 162 ? 55.418  13.020 121.225 1.00 18.21  ? 162 THR D CB  1 
ATOM   5380 O OG1 . THR D 2 162 ? 55.931  12.264 120.121 1.00 43.48  ? 162 THR D OG1 1 
ATOM   5381 C CG2 . THR D 2 162 ? 53.972  13.418 120.995 1.00 19.70  ? 162 THR D CG2 1 
ATOM   5382 N N   . LEU D 2 163 ? 55.170  16.210 122.339 1.00 23.47  ? 163 LEU D N   1 
ATOM   5383 C CA  . LEU D 2 163 ? 54.626  17.054 123.388 1.00 10.86  ? 163 LEU D CA  1 
ATOM   5384 C C   . LEU D 2 163 ? 53.144  17.309 123.489 1.00 13.96  ? 163 LEU D C   1 
ATOM   5385 O O   . LEU D 2 163 ? 52.421  17.293 122.495 1.00 26.00  ? 163 LEU D O   1 
ATOM   5386 C CB  . LEU D 2 163 ? 55.302  18.398 123.369 1.00 2.00   ? 163 LEU D CB  1 
ATOM   5387 C CG  . LEU D 2 163 ? 56.720  18.333 123.871 1.00 14.44  ? 163 LEU D CG  1 
ATOM   5388 C CD1 . LEU D 2 163 ? 57.616  18.493 122.667 1.00 26.33  ? 163 LEU D CD1 1 
ATOM   5389 C CD2 . LEU D 2 163 ? 56.959  19.399 124.935 1.00 2.00   ? 163 LEU D CD2 1 
ATOM   5390 N N   . VAL D 2 164 ? 52.722  17.563 124.725 1.00 6.73   ? 164 VAL D N   1 
ATOM   5391 C CA  . VAL D 2 164 ? 51.351  17.911 125.077 1.00 10.87  ? 164 VAL D CA  1 
ATOM   5392 C C   . VAL D 2 164 ? 51.545  19.195 125.886 1.00 15.16  ? 164 VAL D C   1 
ATOM   5393 O O   . VAL D 2 164 ? 52.305  19.210 126.846 1.00 19.72  ? 164 VAL D O   1 
ATOM   5394 C CB  . VAL D 2 164 ? 50.693  16.857 125.954 1.00 12.54  ? 164 VAL D CB  1 
ATOM   5395 C CG1 . VAL D 2 164 ? 49.273  17.256 126.286 1.00 6.90   ? 164 VAL D CG1 1 
ATOM   5396 C CG2 . VAL D 2 164 ? 50.710  15.533 125.258 1.00 19.88  ? 164 VAL D CG2 1 
ATOM   5397 N N   . PHE D 2 165 ? 50.921  20.281 125.444 1.00 16.41  ? 165 PHE D N   1 
ATOM   5398 C CA  . PHE D 2 165 ? 51.081  21.569 126.077 1.00 2.74   ? 165 PHE D CA  1 
ATOM   5399 C C   . PHE D 2 165 ? 49.885  22.045 126.866 1.00 9.30   ? 165 PHE D C   1 
ATOM   5400 O O   . PHE D 2 165 ? 48.793  21.531 126.735 1.00 10.01  ? 165 PHE D O   1 
ATOM   5401 C CB  . PHE D 2 165 ? 51.375  22.612 125.017 1.00 2.00   ? 165 PHE D CB  1 
ATOM   5402 C CG  . PHE D 2 165 ? 52.559  22.301 124.152 1.00 2.00   ? 165 PHE D CG  1 
ATOM   5403 C CD1 . PHE D 2 165 ? 52.411  21.779 122.920 1.00 2.00   ? 165 PHE D CD1 1 
ATOM   5404 C CD2 . PHE D 2 165 ? 53.811  22.651 124.522 1.00 3.32   ? 165 PHE D CD2 1 
ATOM   5405 C CE1 . PHE D 2 165 ? 53.500  21.625 122.068 1.00 3.28   ? 165 PHE D CE1 1 
ATOM   5406 C CE2 . PHE D 2 165 ? 54.896  22.489 123.660 1.00 2.00   ? 165 PHE D CE2 1 
ATOM   5407 C CZ  . PHE D 2 165 ? 54.731  21.984 122.442 1.00 2.00   ? 165 PHE D CZ  1 
ATOM   5408 N N   . HIS D 2 166 ? 50.116  23.057 127.689 1.00 12.57  ? 166 HIS D N   1 
ATOM   5409 C CA  . HIS D 2 166 ? 49.063  23.663 128.474 1.00 13.80  ? 166 HIS D CA  1 
ATOM   5410 C C   . HIS D 2 166 ? 48.232  22.710 129.303 1.00 13.19  ? 166 HIS D C   1 
ATOM   5411 O O   . HIS D 2 166 ? 47.008  22.813 129.375 1.00 26.34  ? 166 HIS D O   1 
ATOM   5412 C CB  . HIS D 2 166 ? 48.175  24.494 127.562 1.00 15.55  ? 166 HIS D CB  1 
ATOM   5413 C CG  . HIS D 2 166 ? 48.937  25.505 126.762 1.00 27.85  ? 166 HIS D CG  1 
ATOM   5414 N ND1 . HIS D 2 166 ? 49.375  26.699 127.293 1.00 29.86  ? 166 HIS D ND1 1 
ATOM   5415 C CD2 . HIS D 2 166 ? 49.349  25.491 125.474 1.00 8.89   ? 166 HIS D CD2 1 
ATOM   5416 C CE1 . HIS D 2 166 ? 50.025  27.378 126.365 1.00 21.24  ? 166 HIS D CE1 1 
ATOM   5417 N NE2 . HIS D 2 166 ? 50.021  26.666 125.254 1.00 8.57   ? 166 HIS D NE2 1 
ATOM   5418 N N   . LEU D 2 167 ? 48.908  21.798 129.971 1.00 15.94  ? 167 LEU D N   1 
ATOM   5419 C CA  . LEU D 2 167 ? 48.225  20.859 130.835 1.00 19.22  ? 167 LEU D CA  1 
ATOM   5420 C C   . LEU D 2 167 ? 48.076  21.493 132.194 1.00 16.03  ? 167 LEU D C   1 
ATOM   5421 O O   . LEU D 2 167 ? 48.878  22.328 132.595 1.00 25.48  ? 167 LEU D O   1 
ATOM   5422 C CB  . LEU D 2 167 ? 49.031  19.578 130.999 1.00 14.52  ? 167 LEU D CB  1 
ATOM   5423 C CG  . LEU D 2 167 ? 48.968  18.514 129.919 1.00 7.97   ? 167 LEU D CG  1 
ATOM   5424 C CD1 . LEU D 2 167 ? 50.005  17.505 130.229 1.00 2.00   ? 167 LEU D CD1 1 
ATOM   5425 C CD2 . LEU D 2 167 ? 47.594  17.869 129.847 1.00 2.00   ? 167 LEU D CD2 1 
ATOM   5426 N N   . PRO D 2 168 ? 47.035  21.103 132.919 1.00 16.27  ? 168 PRO D N   1 
ATOM   5427 C CA  . PRO D 2 168 ? 46.747  21.608 134.260 1.00 16.21  ? 168 PRO D CA  1 
ATOM   5428 C C   . PRO D 2 168 ? 47.801  21.157 135.263 1.00 20.81  ? 168 PRO D C   1 
ATOM   5429 O O   . PRO D 2 168 ? 48.521  20.186 135.056 1.00 22.37  ? 168 PRO D O   1 
ATOM   5430 C CB  . PRO D 2 168 ? 45.390  20.989 134.570 1.00 18.35  ? 168 PRO D CB  1 
ATOM   5431 C CG  . PRO D 2 168 ? 45.382  19.732 133.729 1.00 31.85  ? 168 PRO D CG  1 
ATOM   5432 C CD  . PRO D 2 168 ? 45.965  20.208 132.449 1.00 31.45  ? 168 PRO D CD  1 
ATOM   5433 N N   . SER D 2 169 ? 47.836  21.838 136.389 1.00 24.63  ? 169 SER D N   1 
ATOM   5434 C CA  . SER D 2 169 ? 48.799  21.549 137.428 1.00 17.97  ? 169 SER D CA  1 
ATOM   5435 C C   . SER D 2 169 ? 48.612  20.171 138.042 1.00 18.27  ? 169 SER D C   1 
ATOM   5436 O O   . SER D 2 169 ? 49.534  19.627 138.639 1.00 24.76  ? 169 SER D O   1 
ATOM   5437 C CB  . SER D 2 169 ? 48.668  22.607 138.506 1.00 28.52  ? 169 SER D CB  1 
ATOM   5438 O OG  . SER D 2 169 ? 49.857  22.697 139.249 1.00 51.58  ? 169 SER D OG  1 
ATOM   5439 N N   . SER D 2 170 ? 47.394  19.648 137.990 1.00 18.84  ? 170 SER D N   1 
ATOM   5440 C CA  . SER D 2 170 ? 47.107  18.331 138.539 1.00 12.65  ? 170 SER D CA  1 
ATOM   5441 C C   . SER D 2 170 ? 45.969  17.676 137.771 1.00 14.96  ? 170 SER D C   1 
ATOM   5442 O O   . SER D 2 170 ? 45.098  18.348 137.211 1.00 24.39  ? 170 SER D O   1 
ATOM   5443 C CB  . SER D 2 170 ? 46.773  18.412 140.030 1.00 3.23   ? 170 SER D CB  1 
ATOM   5444 O OG  . SER D 2 170 ? 45.552  19.085 140.251 1.00 25.30  ? 170 SER D OG  1 
ATOM   5445 N N   . LYS D 2 171 ? 46.014  16.356 137.712 1.00 19.65  ? 171 LYS D N   1 
ATOM   5446 C CA  . LYS D 2 171 ? 45.009  15.573 137.021 1.00 20.58  ? 171 LYS D CA  1 
ATOM   5447 C C   . LYS D 2 171 ? 44.873  14.290 137.828 1.00 29.24  ? 171 LYS D C   1 
ATOM   5448 O O   . LYS D 2 171 ? 45.893  13.725 138.239 1.00 23.00  ? 171 LYS D O   1 
ATOM   5449 C CB  . LYS D 2 171 ? 45.482  15.273 135.591 1.00 24.62  ? 171 LYS D CB  1 
ATOM   5450 C CG  . LYS D 2 171 ? 44.879  16.168 134.520 1.00 21.62  ? 171 LYS D CG  1 
ATOM   5451 C CD  . LYS D 2 171 ? 43.466  15.722 134.206 1.00 36.44  ? 171 LYS D CD  1 
ATOM   5452 C CE  . LYS D 2 171 ? 42.679  16.767 133.429 1.00 43.24  ? 171 LYS D CE  1 
ATOM   5453 N NZ  . LYS D 2 171 ? 41.195  16.540 133.524 1.00 60.30  ? 171 LYS D NZ  1 
ATOM   5454 N N   . ASP D 2 172 ? 43.631  13.891 138.127 1.00 38.21  ? 172 ASP D N   1 
ATOM   5455 C CA  . ASP D 2 172 ? 43.361  12.664 138.883 1.00 51.10  ? 172 ASP D CA  1 
ATOM   5456 C C   . ASP D 2 172 ? 43.670  11.467 138.000 1.00 49.94  ? 172 ASP D C   1 
ATOM   5457 O O   . ASP D 2 172 ? 44.337  10.526 138.421 1.00 57.05  ? 172 ASP D O   1 
ATOM   5458 C CB  . ASP D 2 172 ? 41.903  12.608 139.345 1.00 70.78  ? 172 ASP D CB  1 
ATOM   5459 C CG  . ASP D 2 172 ? 41.604  13.599 140.452 1.00 91.24  ? 172 ASP D CG  1 
ATOM   5460 O OD1 . ASP D 2 172 ? 42.470  13.786 141.338 1.00 102.19 ? 172 ASP D OD1 1 
ATOM   5461 O OD2 . ASP D 2 172 ? 40.501  14.186 140.438 1.00 97.73  ? 172 ASP D OD2 1 
ATOM   5462 N N   . GLN D 2 173 ? 43.167  11.507 136.775 1.00 45.74  ? 173 GLN D N   1 
ATOM   5463 C CA  . GLN D 2 173 ? 43.418  10.459 135.810 1.00 39.67  ? 173 GLN D CA  1 
ATOM   5464 C C   . GLN D 2 173 ? 43.436  11.110 134.437 1.00 37.13  ? 173 GLN D C   1 
ATOM   5465 O O   . GLN D 2 173 ? 42.543  11.874 134.080 1.00 43.88  ? 173 GLN D O   1 
ATOM   5466 C CB  . GLN D 2 173 ? 42.363  9.358  135.895 1.00 48.70  ? 173 GLN D CB  1 
ATOM   5467 C CG  . GLN D 2 173 ? 40.954  9.761  135.561 1.00 72.37  ? 173 GLN D CG  1 
ATOM   5468 C CD  . GLN D 2 173 ? 40.277  8.716  134.711 1.00 82.96  ? 173 GLN D CD  1 
ATOM   5469 O OE1 . GLN D 2 173 ? 39.423  7.979  135.188 1.00 89.06  ? 173 GLN D OE1 1 
ATOM   5470 N NE2 . GLN D 2 173 ? 40.676  8.628  133.446 1.00 84.33  ? 173 GLN D NE2 1 
ATOM   5471 N N   . PHE D 2 174 ? 44.500  10.865 133.697 1.00 34.62  ? 174 PHE D N   1 
ATOM   5472 C CA  . PHE D 2 174 ? 44.653  11.429 132.374 1.00 26.88  ? 174 PHE D CA  1 
ATOM   5473 C C   . PHE D 2 174 ? 45.004  10.284 131.461 1.00 34.17  ? 174 PHE D C   1 
ATOM   5474 O O   . PHE D 2 174 ? 46.064  9.679  131.585 1.00 36.96  ? 174 PHE D O   1 
ATOM   5475 C CB  . PHE D 2 174 ? 45.783  12.449 132.388 1.00 27.56  ? 174 PHE D CB  1 
ATOM   5476 C CG  . PHE D 2 174 ? 46.216  12.900 131.023 1.00 15.20  ? 174 PHE D CG  1 
ATOM   5477 C CD1 . PHE D 2 174 ? 45.472  13.831 130.318 1.00 17.57  ? 174 PHE D CD1 1 
ATOM   5478 C CD2 . PHE D 2 174 ? 47.395  12.426 130.465 1.00 18.44  ? 174 PHE D CD2 1 
ATOM   5479 C CE1 . PHE D 2 174 ? 45.891  14.284 129.087 1.00 14.30  ? 174 PHE D CE1 1 
ATOM   5480 C CE2 . PHE D 2 174 ? 47.833  12.875 129.228 1.00 8.34   ? 174 PHE D CE2 1 
ATOM   5481 C CZ  . PHE D 2 174 ? 47.077  13.808 128.537 1.00 18.99  ? 174 PHE D CZ  1 
ATOM   5482 N N   . GLU D 2 175 ? 44.092  9.965  130.561 1.00 47.64  ? 175 GLU D N   1 
ATOM   5483 C CA  . GLU D 2 175 ? 44.302  8.879  129.626 1.00 52.31  ? 175 GLU D CA  1 
ATOM   5484 C C   . GLU D 2 175 ? 45.064  9.360  128.391 1.00 48.25  ? 175 GLU D C   1 
ATOM   5485 O O   . GLU D 2 175 ? 44.632  10.278 127.685 1.00 56.42  ? 175 GLU D O   1 
ATOM   5486 C CB  . GLU D 2 175 ? 42.955  8.285  129.235 1.00 65.58  ? 175 GLU D CB  1 
ATOM   5487 C CG  . GLU D 2 175 ? 43.027  7.065  128.341 1.00 82.51  ? 175 GLU D CG  1 
ATOM   5488 C CD  . GLU D 2 175 ? 41.648  6.584  127.934 1.00 94.58  ? 175 GLU D CD  1 
ATOM   5489 O OE1 . GLU D 2 175 ? 40.849  6.250  128.838 1.00 99.12  ? 175 GLU D OE1 1 
ATOM   5490 O OE2 . GLU D 2 175 ? 41.356  6.557  126.716 1.00 101.84 ? 175 GLU D OE2 1 
ATOM   5491 N N   . LEU D 2 176 ? 46.223  8.768  128.167 1.00 32.59  ? 176 LEU D N   1 
ATOM   5492 C CA  . LEU D 2 176 ? 47.038  9.118  127.026 1.00 36.19  ? 176 LEU D CA  1 
ATOM   5493 C C   . LEU D 2 176 ? 47.078  7.902  126.132 1.00 44.43  ? 176 LEU D C   1 
ATOM   5494 O O   . LEU D 2 176 ? 47.275  6.789  126.612 1.00 47.77  ? 176 LEU D O   1 
ATOM   5495 C CB  . LEU D 2 176 ? 48.453  9.470  127.482 1.00 35.67  ? 176 LEU D CB  1 
ATOM   5496 C CG  . LEU D 2 176 ? 49.518  9.681  126.403 1.00 25.29  ? 176 LEU D CG  1 
ATOM   5497 C CD1 . LEU D 2 176 ? 49.238  10.947 125.611 1.00 32.02  ? 176 LEU D CD1 1 
ATOM   5498 C CD2 . LEU D 2 176 ? 50.861  9.750  127.050 1.00 15.91  ? 176 LEU D CD2 1 
ATOM   5499 N N   . CYS D 2 177 ? 46.943  8.116  124.832 1.00 57.69  ? 177 CYS D N   1 
ATOM   5500 C CA  . CYS D 2 177 ? 46.962  7.002  123.907 1.00 60.99  ? 177 CYS D CA  1 
ATOM   5501 C C   . CYS D 2 177 ? 47.669  7.311  122.597 1.00 53.70  ? 177 CYS D C   1 
ATOM   5502 O O   . CYS D 2 177 ? 48.069  8.446  122.339 1.00 55.28  ? 177 CYS D O   1 
ATOM   5503 C CB  . CYS D 2 177 ? 45.537  6.507  123.664 1.00 68.57  ? 177 CYS D CB  1 
ATOM   5504 S SG  . CYS D 2 177 ? 45.327  4.708  123.904 1.00 97.42  ? 177 CYS D SG  1 
ATOM   5505 N N   . GLY D 2 178 ? 47.805  6.283  121.771 1.00 50.29  ? 178 GLY D N   1 
ATOM   5506 C CA  . GLY D 2 178 ? 48.484  6.431  120.501 1.00 56.37  ? 178 GLY D CA  1 
ATOM   5507 C C   . GLY D 2 178 ? 49.899  5.951  120.720 1.00 60.13  ? 178 GLY D C   1 
ATOM   5508 O O   . GLY D 2 178 ? 50.816  6.268  119.961 1.00 66.23  ? 178 GLY D O   1 
ATOM   5509 N N   . LEU D 2 179 ? 50.051  5.085  121.716 1.00 62.63  ? 179 LEU D N   1 
ATOM   5510 C CA  . LEU D 2 179 ? 51.355  4.569  122.078 1.00 60.51  ? 179 LEU D CA  1 
ATOM   5511 C C   . LEU D 2 179 ? 51.615  3.123  121.705 1.00 57.70  ? 179 LEU D C   1 
ATOM   5512 O O   . LEU D 2 179 ? 51.333  2.190  122.465 1.00 55.26  ? 179 LEU D O   1 
ATOM   5513 C CB  . LEU D 2 179 ? 51.588  4.797  123.568 1.00 64.95  ? 179 LEU D CB  1 
ATOM   5514 C CG  . LEU D 2 179 ? 51.287  6.246  123.976 1.00 58.96  ? 179 LEU D CG  1 
ATOM   5515 C CD1 . LEU D 2 179 ? 51.051  6.355  125.471 1.00 48.37  ? 179 LEU D CD1 1 
ATOM   5516 C CD2 . LEU D 2 179 ? 52.405  7.160  123.509 1.00 41.57  ? 179 LEU D CD2 1 
ATOM   5517 N N   . HIS D 2 180 ? 52.086  2.958  120.478 1.00 51.98  ? 180 HIS D N   1 
ATOM   5518 C CA  . HIS D 2 180 ? 52.461  1.662  119.938 1.00 55.92  ? 180 HIS D CA  1 
ATOM   5519 C C   . HIS D 2 180 ? 53.509  1.949  118.875 1.00 51.94  ? 180 HIS D C   1 
ATOM   5520 O O   . HIS D 2 180 ? 53.169  2.198  117.726 1.00 70.36  ? 180 HIS D O   1 
ATOM   5521 C CB  . HIS D 2 180 ? 51.271  0.863  119.361 1.00 58.70  ? 180 HIS D CB  1 
ATOM   5522 C CG  . HIS D 2 180 ? 50.075  1.688  118.989 1.00 69.97  ? 180 HIS D CG  1 
ATOM   5523 N ND1 . HIS D 2 180 ? 50.153  2.809  118.190 1.00 74.34  ? 180 HIS D ND1 1 
ATOM   5524 C CD2 . HIS D 2 180 ? 48.758  1.514  119.264 1.00 74.54  ? 180 HIS D CD2 1 
ATOM   5525 C CE1 . HIS D 2 180 ? 48.937  3.288  117.985 1.00 79.55  ? 180 HIS D CE1 1 
ATOM   5526 N NE2 . HIS D 2 180 ? 48.073  2.520  118.626 1.00 76.28  ? 180 HIS D NE2 1 
ATOM   5527 N N   . GLN D 2 181 ? 54.767  2.020  119.304 1.00 40.78  ? 181 GLN D N   1 
ATOM   5528 C CA  . GLN D 2 181 ? 55.918  2.309  118.438 1.00 43.20  ? 181 GLN D CA  1 
ATOM   5529 C C   . GLN D 2 181 ? 57.131  1.714  119.180 1.00 43.91  ? 181 GLN D C   1 
ATOM   5530 O O   . GLN D 2 181 ? 58.277  1.701  118.694 1.00 41.30  ? 181 GLN D O   1 
ATOM   5531 C CB  . GLN D 2 181 ? 56.053  3.843  118.266 1.00 50.71  ? 181 GLN D CB  1 
ATOM   5532 C CG  . GLN D 2 181 ? 56.863  4.346  117.047 1.00 76.75  ? 181 GLN D CG  1 
ATOM   5533 C CD  . GLN D 2 181 ? 56.790  5.876  116.843 1.00 89.52  ? 181 GLN D CD  1 
ATOM   5534 O OE1 . GLN D 2 181 ? 56.451  6.628  117.761 1.00 97.77  ? 181 GLN D OE1 1 
ATOM   5535 N NE2 . GLN D 2 181 ? 57.111  6.331  115.631 1.00 98.43  ? 181 GLN D NE2 1 
ATOM   5536 N N   . ALA D 2 182 ? 56.829  1.174  120.354 1.00 38.49  ? 182 ALA D N   1 
ATOM   5537 C CA  . ALA D 2 182 ? 57.798  0.562  121.234 1.00 36.75  ? 182 ALA D CA  1 
ATOM   5538 C C   . ALA D 2 182 ? 56.991  -0.017 122.391 1.00 43.17  ? 182 ALA D C   1 
ATOM   5539 O O   . ALA D 2 182 ? 55.838  0.386  122.616 1.00 46.03  ? 182 ALA D O   1 
ATOM   5540 C CB  . ALA D 2 182 ? 58.779  1.592  121.725 1.00 36.35  ? 182 ALA D CB  1 
ATOM   5541 N N   . PRO D 2 183 ? 57.553  -1.016 123.103 1.00 48.44  ? 183 PRO D N   1 
ATOM   5542 C CA  . PRO D 2 183 ? 56.832  -1.623 124.226 1.00 47.75  ? 183 PRO D CA  1 
ATOM   5543 C C   . PRO D 2 183 ? 56.834  -0.726 125.457 1.00 44.12  ? 183 PRO D C   1 
ATOM   5544 O O   . PRO D 2 183 ? 55.904  -0.773 126.253 1.00 45.49  ? 183 PRO D O   1 
ATOM   5545 C CB  . PRO D 2 183 ? 57.602  -2.921 124.457 1.00 47.49  ? 183 PRO D CB  1 
ATOM   5546 C CG  . PRO D 2 183 ? 59.011  -2.512 124.165 1.00 48.56  ? 183 PRO D CG  1 
ATOM   5547 C CD  . PRO D 2 183 ? 58.877  -1.646 122.925 1.00 50.30  ? 183 PRO D CD  1 
ATOM   5548 N N   . VAL D 2 184 ? 57.861  0.113  125.588 1.00 37.53  ? 184 VAL D N   1 
ATOM   5549 C CA  . VAL D 2 184 ? 57.973  1.018  126.723 1.00 30.22  ? 184 VAL D CA  1 
ATOM   5550 C C   . VAL D 2 184 ? 58.275  2.475  126.357 1.00 34.00  ? 184 VAL D C   1 
ATOM   5551 O O   . VAL D 2 184 ? 59.100  2.760  125.473 1.00 27.46  ? 184 VAL D O   1 
ATOM   5552 C CB  . VAL D 2 184 ? 58.984  0.471  127.740 1.00 28.37  ? 184 VAL D CB  1 
ATOM   5553 C CG1 . VAL D 2 184 ? 59.606  1.579  128.568 1.00 18.10  ? 184 VAL D CG1 1 
ATOM   5554 C CG2 . VAL D 2 184 ? 58.272  -0.502 128.650 1.00 33.74  ? 184 VAL D CG2 1 
ATOM   5555 N N   . TYR D 2 185 ? 57.603  3.387  127.059 1.00 27.36  ? 185 TYR D N   1 
ATOM   5556 C CA  . TYR D 2 185 ? 57.759  4.817  126.845 1.00 19.66  ? 185 TYR D CA  1 
ATOM   5557 C C   . TYR D 2 185 ? 58.310  5.553  128.062 1.00 15.88  ? 185 TYR D C   1 
ATOM   5558 O O   . TYR D 2 185 ? 58.104  5.129  129.192 1.00 31.02  ? 185 TYR D O   1 
ATOM   5559 C CB  . TYR D 2 185 ? 56.408  5.418  126.500 1.00 26.81  ? 185 TYR D CB  1 
ATOM   5560 C CG  . TYR D 2 185 ? 55.983  5.187  125.080 1.00 41.90  ? 185 TYR D CG  1 
ATOM   5561 C CD1 . TYR D 2 185 ? 55.522  3.944  124.659 1.00 51.56  ? 185 TYR D CD1 1 
ATOM   5562 C CD2 . TYR D 2 185 ? 56.023  6.219  124.155 1.00 42.28  ? 185 TYR D CD2 1 
ATOM   5563 C CE1 . TYR D 2 185 ? 55.108  3.741  123.345 1.00 58.06  ? 185 TYR D CE1 1 
ATOM   5564 C CE2 . TYR D 2 185 ? 55.614  6.026  122.842 1.00 51.26  ? 185 TYR D CE2 1 
ATOM   5565 C CZ  . TYR D 2 185 ? 55.156  4.792  122.446 1.00 51.30  ? 185 TYR D CZ  1 
ATOM   5566 O OH  . TYR D 2 185 ? 54.729  4.619  121.158 1.00 58.76  ? 185 TYR D OH  1 
ATOM   5567 N N   . THR D 2 186 ? 59.059  6.622  127.821 1.00 9.56   ? 186 THR D N   1 
ATOM   5568 C CA  . THR D 2 186 ? 59.585  7.480  128.884 1.00 10.30  ? 186 THR D CA  1 
ATOM   5569 C C   . THR D 2 186 ? 58.700  8.722  128.957 1.00 16.91  ? 186 THR D C   1 
ATOM   5570 O O   . THR D 2 186 ? 58.346  9.286  127.932 1.00 25.74  ? 186 THR D O   1 
ATOM   5571 C CB  . THR D 2 186 ? 60.954  8.027  128.557 1.00 2.27   ? 186 THR D CB  1 
ATOM   5572 O OG1 . THR D 2 186 ? 61.872  6.951  128.346 1.00 26.79  ? 186 THR D OG1 1 
ATOM   5573 C CG2 . THR D 2 186 ? 61.442  8.896  129.685 1.00 8.69   ? 186 THR D CG2 1 
ATOM   5574 N N   . LEU D 2 187 ? 58.368  9.178  130.154 1.00 18.77  ? 187 LEU D N   1 
ATOM   5575 C CA  . LEU D 2 187 ? 57.540  10.357 130.269 1.00 11.59  ? 187 LEU D CA  1 
ATOM   5576 C C   . LEU D 2 187 ? 58.128  11.276 131.293 1.00 6.28   ? 187 LEU D C   1 
ATOM   5577 O O   . LEU D 2 187 ? 58.710  10.818 132.264 1.00 19.05  ? 187 LEU D O   1 
ATOM   5578 C CB  . LEU D 2 187 ? 56.121  9.991  130.682 1.00 2.00   ? 187 LEU D CB  1 
ATOM   5579 C CG  . LEU D 2 187 ? 55.319  9.124  129.716 1.00 5.69   ? 187 LEU D CG  1 
ATOM   5580 C CD1 . LEU D 2 187 ? 55.752  7.688  129.826 1.00 17.09  ? 187 LEU D CD1 1 
ATOM   5581 C CD2 . LEU D 2 187 ? 53.844  9.234  130.051 1.00 2.00   ? 187 LEU D CD2 1 
ATOM   5582 N N   . GLN D 2 188 ? 58.041  12.571 131.026 1.00 3.65   ? 188 GLN D N   1 
ATOM   5583 C CA  . GLN D 2 188 ? 58.506  13.593 131.947 1.00 2.50   ? 188 GLN D CA  1 
ATOM   5584 C C   . GLN D 2 188 ? 57.521  14.741 131.889 1.00 10.85  ? 188 GLN D C   1 
ATOM   5585 O O   . GLN D 2 188 ? 56.766  14.877 130.929 1.00 21.81  ? 188 GLN D O   1 
ATOM   5586 C CB  . GLN D 2 188 ? 59.889  14.077 131.591 1.00 2.00   ? 188 GLN D CB  1 
ATOM   5587 C CG  . GLN D 2 188 ? 60.944  13.053 131.835 1.00 6.61   ? 188 GLN D CG  1 
ATOM   5588 C CD  . GLN D 2 188 ? 62.339  13.541 131.487 1.00 17.80  ? 188 GLN D CD  1 
ATOM   5589 O OE1 . GLN D 2 188 ? 62.659  13.737 130.325 1.00 35.21  ? 188 GLN D OE1 1 
ATOM   5590 N NE2 . GLN D 2 188 ? 63.179  13.725 132.495 1.00 30.13  ? 188 GLN D NE2 1 
ATOM   5591 N N   . MET D 2 189 ? 57.520  15.561 132.922 1.00 8.46   ? 189 MET D N   1 
ATOM   5592 C CA  . MET D 2 189 ? 56.611  16.682 132.979 1.00 2.44   ? 189 MET D CA  1 
ATOM   5593 C C   . MET D 2 189 ? 57.331  17.796 133.693 1.00 2.84   ? 189 MET D C   1 
ATOM   5594 O O   . MET D 2 189 ? 58.212  17.522 134.488 1.00 17.28  ? 189 MET D O   1 
ATOM   5595 C CB  . MET D 2 189 ? 55.362  16.278 133.751 1.00 2.00   ? 189 MET D CB  1 
ATOM   5596 C CG  . MET D 2 189 ? 54.273  17.277 133.688 1.00 10.98  ? 189 MET D CG  1 
ATOM   5597 S SD  . MET D 2 189 ? 52.793  16.641 134.391 1.00 19.99  ? 189 MET D SD  1 
ATOM   5598 C CE  . MET D 2 189 ? 52.361  15.503 133.155 1.00 34.80  ? 189 MET D CE  1 
ATOM   5599 N N   . ARG D 2 190 ? 57.039  19.044 133.336 1.00 2.00   ? 190 ARG D N   1 
ATOM   5600 C CA  . ARG D 2 190 ? 57.668  20.203 133.972 1.00 2.00   ? 190 ARG D CA  1 
ATOM   5601 C C   . ARG D 2 190 ? 56.569  21.233 134.045 1.00 5.72   ? 190 ARG D C   1 
ATOM   5602 O O   . ARG D 2 190 ? 55.614  21.165 133.264 1.00 8.90   ? 190 ARG D O   1 
ATOM   5603 C CB  . ARG D 2 190 ? 58.850  20.729 133.146 1.00 2.00   ? 190 ARG D CB  1 
ATOM   5604 C CG  . ARG D 2 190 ? 58.500  21.824 132.183 1.00 2.00   ? 190 ARG D CG  1 
ATOM   5605 C CD  . ARG D 2 190 ? 59.178  21.711 130.848 1.00 2.13   ? 190 ARG D CD  1 
ATOM   5606 N NE  . ARG D 2 190 ? 60.329  22.591 130.663 1.00 14.72  ? 190 ARG D NE  1 
ATOM   5607 C CZ  . ARG D 2 190 ? 60.544  23.322 129.569 1.00 11.26  ? 190 ARG D CZ  1 
ATOM   5608 N NH1 . ARG D 2 190 ? 59.689  23.298 128.558 1.00 6.33   ? 190 ARG D NH1 1 
ATOM   5609 N NH2 . ARG D 2 190 ? 61.652  24.034 129.463 1.00 15.01  ? 190 ARG D NH2 1 
ATOM   5610 N N   . CYS D 2 191 ? 56.670  22.163 134.986 1.00 9.62   ? 191 CYS D N   1 
ATOM   5611 C CA  . CYS D 2 191 ? 55.638  23.176 135.124 1.00 19.35  ? 191 CYS D CA  1 
ATOM   5612 C C   . CYS D 2 191 ? 56.183  24.595 135.244 1.00 13.71  ? 191 CYS D C   1 
ATOM   5613 O O   . CYS D 2 191 ? 57.374  24.786 135.461 1.00 29.38  ? 191 CYS D O   1 
ATOM   5614 C CB  . CYS D 2 191 ? 54.737  22.838 136.315 1.00 19.30  ? 191 CYS D CB  1 
ATOM   5615 S SG  . CYS D 2 191 ? 53.891  21.230 136.151 1.00 48.94  ? 191 CYS D SG  1 
ATOM   5616 N N   . ILE D 2 192 ? 55.314  25.590 135.079 1.00 4.88   ? 192 ILE D N   1 
ATOM   5617 C CA  . ILE D 2 192 ? 55.709  26.993 135.177 1.00 6.69   ? 192 ILE D CA  1 
ATOM   5618 C C   . ILE D 2 192 ? 54.502  27.772 135.698 1.00 13.53  ? 192 ILE D C   1 
ATOM   5619 O O   . ILE D 2 192 ? 53.352  27.344 135.489 1.00 17.11  ? 192 ILE D O   1 
ATOM   5620 C CB  . ILE D 2 192 ? 56.159  27.559 133.774 1.00 2.01   ? 192 ILE D CB  1 
ATOM   5621 C CG1 . ILE D 2 192 ? 56.956  28.838 133.947 1.00 6.36   ? 192 ILE D CG1 1 
ATOM   5622 C CG2 . ILE D 2 192 ? 54.970  27.801 132.863 1.00 2.95   ? 192 ILE D CG2 1 
ATOM   5623 C CD1 . ILE D 2 192 ? 57.269  29.497 132.684 1.00 2.00   ? 192 ILE D CD1 1 
ATOM   5624 N N   . ARG D 2 193 ? 54.768  28.894 136.374 1.00 7.50   ? 193 ARG D N   1 
ATOM   5625 C CA  . ARG D 2 193 ? 53.724  29.762 136.934 1.00 2.00   ? 193 ARG D CA  1 
ATOM   5626 C C   . ARG D 2 193 ? 52.851  30.266 135.801 1.00 7.03   ? 193 ARG D C   1 
ATOM   5627 O O   . ARG D 2 193 ? 53.353  30.751 134.788 1.00 17.94  ? 193 ARG D O   1 
ATOM   5628 C CB  . ARG D 2 193 ? 54.368  30.943 137.648 1.00 9.24   ? 193 ARG D CB  1 
ATOM   5629 C CG  . ARG D 2 193 ? 53.465  31.829 138.505 1.00 2.00   ? 193 ARG D CG  1 
ATOM   5630 C CD  . ARG D 2 193 ? 54.356  32.865 139.123 1.00 2.00   ? 193 ARG D CD  1 
ATOM   5631 N NE  . ARG D 2 193 ? 53.705  33.670 140.133 1.00 8.22   ? 193 ARG D NE  1 
ATOM   5632 C CZ  . ARG D 2 193 ? 54.006  34.947 140.368 1.00 10.59  ? 193 ARG D CZ  1 
ATOM   5633 N NH1 . ARG D 2 193 ? 54.932  35.563 139.659 1.00 9.16   ? 193 ARG D NH1 1 
ATOM   5634 N NH2 . ARG D 2 193 ? 53.422  35.608 141.344 1.00 20.90  ? 193 ARG D NH2 1 
ATOM   5635 N N   . SER D 2 194 ? 51.541  30.170 135.970 1.00 4.50   ? 194 SER D N   1 
ATOM   5636 C CA  . SER D 2 194 ? 50.637  30.605 134.925 1.00 8.93   ? 194 SER D CA  1 
ATOM   5637 C C   . SER D 2 194 ? 50.360  32.107 134.925 1.00 14.54  ? 194 SER D C   1 
ATOM   5638 O O   . SER D 2 194 ? 50.066  32.707 135.961 1.00 28.01  ? 194 SER D O   1 
ATOM   5639 C CB  . SER D 2 194 ? 49.320  29.827 134.997 1.00 2.01   ? 194 SER D CB  1 
ATOM   5640 O OG  . SER D 2 194 ? 48.616  29.906 133.768 1.00 33.64  ? 194 SER D OG  1 
ATOM   5641 N N   . SER D 2 195 ? 50.524  32.707 133.753 1.00 17.95  ? 195 SER D N   1 
ATOM   5642 C CA  . SER D 2 195 ? 50.252  34.117 133.520 1.00 3.66   ? 195 SER D CA  1 
ATOM   5643 C C   . SER D 2 195 ? 51.093  35.152 134.238 1.00 12.22  ? 195 SER D C   1 
ATOM   5644 O O   . SER D 2 195 ? 50.884  36.351 134.070 1.00 35.98  ? 195 SER D O   1 
ATOM   5645 C CB  . SER D 2 195 ? 48.776  34.392 133.739 1.00 6.54   ? 195 SER D CB  1 
ATOM   5646 O OG  . SER D 2 195 ? 47.957  33.399 133.122 1.00 36.75  ? 195 SER D OG  1 
ATOM   5647 N N   . LEU D 2 196 ? 52.035  34.723 135.050 1.00 2.00   ? 196 LEU D N   1 
ATOM   5648 C CA  . LEU D 2 196 ? 52.884  35.697 135.687 1.00 2.00   ? 196 LEU D CA  1 
ATOM   5649 C C   . LEU D 2 196 ? 54.338  35.275 135.545 1.00 2.63   ? 196 LEU D C   1 
ATOM   5650 O O   . LEU D 2 196 ? 54.638  34.175 135.093 1.00 18.42  ? 196 LEU D O   1 
ATOM   5651 C CB  . LEU D 2 196 ? 52.497  35.844 137.132 1.00 2.00   ? 196 LEU D CB  1 
ATOM   5652 C CG  . LEU D 2 196 ? 51.132  36.458 137.366 1.00 2.00   ? 196 LEU D CG  1 
ATOM   5653 C CD1 . LEU D 2 196 ? 50.612  35.996 138.720 1.00 10.59  ? 196 LEU D CD1 1 
ATOM   5654 C CD2 . LEU D 2 196 ? 51.263  37.951 137.309 1.00 10.42  ? 196 LEU D CD2 1 
ATOM   5655 N N   . PRO D 2 197 ? 55.267  36.178 135.849 1.00 9.21   ? 197 PRO D N   1 
ATOM   5656 C CA  . PRO D 2 197 ? 56.695  35.862 135.749 1.00 7.00   ? 197 PRO D CA  1 
ATOM   5657 C C   . PRO D 2 197 ? 57.213  34.677 136.597 1.00 14.45  ? 197 PRO D C   1 
ATOM   5658 O O   . PRO D 2 197 ? 56.975  34.580 137.812 1.00 26.79  ? 197 PRO D O   1 
ATOM   5659 C CB  . PRO D 2 197 ? 57.359  37.173 136.173 1.00 2.00   ? 197 PRO D CB  1 
ATOM   5660 C CG  . PRO D 2 197 ? 56.393  38.190 135.714 1.00 11.52  ? 197 PRO D CG  1 
ATOM   5661 C CD  . PRO D 2 197 ? 55.064  37.613 136.106 1.00 12.58  ? 197 PRO D CD  1 
ATOM   5662 N N   . GLY D 2 198 ? 57.985  33.819 135.940 1.00 19.44  ? 198 GLY D N   1 
ATOM   5663 C CA  . GLY D 2 198 ? 58.589  32.674 136.593 1.00 19.82  ? 198 GLY D CA  1 
ATOM   5664 C C   . GLY D 2 198 ? 59.384  31.848 135.602 1.00 15.14  ? 198 GLY D C   1 
ATOM   5665 O O   . GLY D 2 198 ? 59.173  31.936 134.399 1.00 21.51  ? 198 GLY D O   1 
ATOM   5666 N N   . PHE D 2 199 ? 60.292  31.034 136.108 1.00 19.39  ? 199 PHE D N   1 
ATOM   5667 C CA  . PHE D 2 199 ? 61.109  30.189 135.257 1.00 13.36  ? 199 PHE D CA  1 
ATOM   5668 C C   . PHE D 2 199 ? 60.535  28.767 135.225 1.00 13.44  ? 199 PHE D C   1 
ATOM   5669 O O   . PHE D 2 199 ? 59.900  28.342 136.179 1.00 14.84  ? 199 PHE D O   1 
ATOM   5670 C CB  . PHE D 2 199 ? 62.513  30.127 135.820 1.00 29.61  ? 199 PHE D CB  1 
ATOM   5671 C CG  . PHE D 2 199 ? 63.108  31.457 136.134 1.00 28.54  ? 199 PHE D CG  1 
ATOM   5672 C CD1 . PHE D 2 199 ? 63.749  32.190 135.146 1.00 26.33  ? 199 PHE D CD1 1 
ATOM   5673 C CD2 . PHE D 2 199 ? 63.095  31.940 137.435 1.00 34.29  ? 199 PHE D CD2 1 
ATOM   5674 C CE1 . PHE D 2 199 ? 64.372  33.369 135.446 1.00 33.06  ? 199 PHE D CE1 1 
ATOM   5675 C CE2 . PHE D 2 199 ? 63.716  33.128 137.748 1.00 37.59  ? 199 PHE D CE2 1 
ATOM   5676 C CZ  . PHE D 2 199 ? 64.357  33.843 136.755 1.00 41.26  ? 199 PHE D CZ  1 
ATOM   5677 N N   . TRP D 2 200 ? 60.738  28.035 134.131 1.00 18.31  ? 200 TRP D N   1 
ATOM   5678 C CA  . TRP D 2 200 ? 60.245  26.661 134.052 1.00 7.23   ? 200 TRP D CA  1 
ATOM   5679 C C   . TRP D 2 200 ? 60.920  25.860 135.149 1.00 6.85   ? 200 TRP D C   1 
ATOM   5680 O O   . TRP D 2 200 ? 61.999  26.212 135.616 1.00 21.74  ? 200 TRP D O   1 
ATOM   5681 C CB  . TRP D 2 200 ? 60.632  26.021 132.720 1.00 7.97   ? 200 TRP D CB  1 
ATOM   5682 C CG  . TRP D 2 200 ? 59.731  26.289 131.577 1.00 2.00   ? 200 TRP D CG  1 
ATOM   5683 C CD1 . TRP D 2 200 ? 59.976  27.109 130.545 1.00 2.00   ? 200 TRP D CD1 1 
ATOM   5684 C CD2 . TRP D 2 200 ? 58.431  25.726 131.349 1.00 2.00   ? 200 TRP D CD2 1 
ATOM   5685 N NE1 . TRP D 2 200 ? 58.909  27.107 129.675 1.00 2.66   ? 200 TRP D NE1 1 
ATOM   5686 C CE2 . TRP D 2 200 ? 57.949  26.264 130.154 1.00 2.00   ? 200 TRP D CE2 1 
ATOM   5687 C CE3 . TRP D 2 200 ? 57.629  24.828 132.051 1.00 2.45   ? 200 TRP D CE3 1 
ATOM   5688 C CZ2 . TRP D 2 200 ? 56.706  25.939 129.639 1.00 9.02   ? 200 TRP D CZ2 1 
ATOM   5689 C CZ3 . TRP D 2 200 ? 56.399  24.503 131.546 1.00 2.00   ? 200 TRP D CZ3 1 
ATOM   5690 C CH2 . TRP D 2 200 ? 55.944  25.056 130.352 1.00 5.05   ? 200 TRP D CH2 1 
ATOM   5691 N N   . SER D 2 201 ? 60.277  24.793 135.575 1.00 2.00   ? 201 SER D N   1 
ATOM   5692 C CA  . SER D 2 201 ? 60.854  23.924 136.577 1.00 2.00   ? 201 SER D CA  1 
ATOM   5693 C C   . SER D 2 201 ? 61.696  22.934 135.785 1.00 11.49  ? 201 SER D C   1 
ATOM   5694 O O   . SER D 2 201 ? 61.587  22.860 134.553 1.00 21.43  ? 201 SER D O   1 
ATOM   5695 C CB  . SER D 2 201 ? 59.749  23.127 137.244 1.00 6.49   ? 201 SER D CB  1 
ATOM   5696 O OG  . SER D 2 201 ? 59.210  22.167 136.338 1.00 2.43   ? 201 SER D OG  1 
ATOM   5697 N N   . PRO D 2 202 ? 62.529  22.140 136.466 1.00 6.29   ? 202 PRO D N   1 
ATOM   5698 C CA  . PRO D 2 202 ? 63.323  21.176 135.713 1.00 2.69   ? 202 PRO D CA  1 
ATOM   5699 C C   . PRO D 2 202 ? 62.342  20.047 135.283 1.00 12.96  ? 202 PRO D C   1 
ATOM   5700 O O   . PRO D 2 202 ? 61.232  19.969 135.826 1.00 25.73  ? 202 PRO D O   1 
ATOM   5701 C CB  . PRO D 2 202 ? 64.295  20.674 136.766 1.00 3.31   ? 202 PRO D CB  1 
ATOM   5702 C CG  . PRO D 2 202 ? 64.340  21.753 137.748 1.00 3.05   ? 202 PRO D CG  1 
ATOM   5703 C CD  . PRO D 2 202 ? 62.931  22.139 137.873 1.00 11.51  ? 202 PRO D CD  1 
ATOM   5704 N N   . TRP D 2 203 ? 62.699  19.212 134.301 1.00 7.48   ? 203 TRP D N   1 
ATOM   5705 C CA  . TRP D 2 203 ? 61.798  18.137 133.889 1.00 2.00   ? 203 TRP D CA  1 
ATOM   5706 C C   . TRP D 2 203 ? 61.894  17.076 134.974 1.00 3.67   ? 203 TRP D C   1 
ATOM   5707 O O   . TRP D 2 203 ? 62.983  16.771 135.470 1.00 15.94  ? 203 TRP D O   1 
ATOM   5708 C CB  . TRP D 2 203 ? 62.214  17.511 132.545 1.00 2.00   ? 203 TRP D CB  1 
ATOM   5709 C CG  . TRP D 2 203 ? 61.922  18.306 131.296 1.00 2.00   ? 203 TRP D CG  1 
ATOM   5710 C CD1 . TRP D 2 203 ? 62.805  19.080 130.599 1.00 5.28   ? 203 TRP D CD1 1 
ATOM   5711 C CD2 . TRP D 2 203 ? 60.659  18.412 130.593 1.00 2.00   ? 203 TRP D CD2 1 
ATOM   5712 N NE1 . TRP D 2 203 ? 62.172  19.666 129.514 1.00 8.04   ? 203 TRP D NE1 1 
ATOM   5713 C CE2 . TRP D 2 203 ? 60.861  19.270 129.493 1.00 2.00   ? 203 TRP D CE2 1 
ATOM   5714 C CE3 . TRP D 2 203 ? 59.387  17.870 130.797 1.00 3.18   ? 203 TRP D CE3 1 
ATOM   5715 C CZ2 . TRP D 2 203 ? 59.845  19.596 128.609 1.00 2.00   ? 203 TRP D CZ2 1 
ATOM   5716 C CZ3 . TRP D 2 203 ? 58.375  18.200 129.911 1.00 13.68  ? 203 TRP D CZ3 1 
ATOM   5717 C CH2 . TRP D 2 203 ? 58.611  19.056 128.832 1.00 5.07   ? 203 TRP D CH2 1 
ATOM   5718 N N   . SER D 2 204 ? 60.760  16.510 135.338 1.00 2.00   ? 204 SER D N   1 
ATOM   5719 C CA  . SER D 2 204 ? 60.704  15.477 136.350 1.00 2.00   ? 204 SER D CA  1 
ATOM   5720 C C   . SER D 2 204 ? 61.508  14.288 135.893 1.00 14.55  ? 204 SER D C   1 
ATOM   5721 O O   . SER D 2 204 ? 61.729  14.127 134.698 1.00 18.04  ? 204 SER D O   1 
ATOM   5722 C CB  . SER D 2 204 ? 59.268  15.015 136.502 1.00 6.96   ? 204 SER D CB  1 
ATOM   5723 O OG  . SER D 2 204 ? 58.786  14.491 135.274 1.00 13.86  ? 204 SER D OG  1 
ATOM   5724 N N   . PRO D 2 205 ? 62.005  13.466 136.838 1.00 24.77  ? 205 PRO D N   1 
ATOM   5725 C CA  . PRO D 2 205 ? 62.777  12.285 136.457 1.00 22.33  ? 205 PRO D CA  1 
ATOM   5726 C C   . PRO D 2 205 ? 61.922  11.379 135.566 1.00 23.63  ? 205 PRO D C   1 
ATOM   5727 O O   . PRO D 2 205 ? 60.693  11.272 135.720 1.00 22.78  ? 205 PRO D O   1 
ATOM   5728 C CB  . PRO D 2 205 ? 63.100  11.644 137.808 1.00 27.79  ? 205 PRO D CB  1 
ATOM   5729 C CG  . PRO D 2 205 ? 62.118  12.276 138.777 1.00 16.92  ? 205 PRO D CG  1 
ATOM   5730 C CD  . PRO D 2 205 ? 62.080  13.672 138.297 1.00 23.46  ? 205 PRO D CD  1 
ATOM   5731 N N   . GLY D 2 206 ? 62.583  10.784 134.589 1.00 18.52  ? 206 GLY D N   1 
ATOM   5732 C CA  . GLY D 2 206 ? 61.895  9.936  133.649 1.00 14.18  ? 206 GLY D CA  1 
ATOM   5733 C C   . GLY D 2 206 ? 61.109  8.791  134.214 1.00 11.72  ? 206 GLY D C   1 
ATOM   5734 O O   . GLY D 2 206 ? 61.598  8.039  135.048 1.00 31.14  ? 206 GLY D O   1 
ATOM   5735 N N   . LEU D 2 207 ? 59.864  8.702  133.778 1.00 15.24  ? 207 LEU D N   1 
ATOM   5736 C CA  . LEU D 2 207 ? 58.961  7.636  134.161 1.00 15.15  ? 207 LEU D CA  1 
ATOM   5737 C C   . LEU D 2 207 ? 59.004  6.704  132.974 1.00 17.06  ? 207 LEU D C   1 
ATOM   5738 O O   . LEU D 2 207 ? 58.821  7.132  131.848 1.00 27.69  ? 207 LEU D O   1 
ATOM   5739 C CB  . LEU D 2 207 ? 57.536  8.145  134.278 1.00 17.45  ? 207 LEU D CB  1 
ATOM   5740 C CG  . LEU D 2 207 ? 56.836  8.106  135.626 1.00 14.61  ? 207 LEU D CG  1 
ATOM   5741 C CD1 . LEU D 2 207 ? 55.344  8.163  135.380 1.00 26.14  ? 207 LEU D CD1 1 
ATOM   5742 C CD2 . LEU D 2 207 ? 57.184  6.832  136.366 1.00 40.50  ? 207 LEU D CD2 1 
ATOM   5743 N N   . GLN D 2 208 ? 59.276  5.439  133.212 1.00 19.31  ? 208 GLN D N   1 
ATOM   5744 C CA  . GLN D 2 208 ? 59.336  4.477  132.135 1.00 15.29  ? 208 GLN D CA  1 
ATOM   5745 C C   . GLN D 2 208 ? 58.121  3.591  132.361 1.00 19.37  ? 208 GLN D C   1 
ATOM   5746 O O   . GLN D 2 208 ? 58.054  2.836  133.333 1.00 34.18  ? 208 GLN D O   1 
ATOM   5747 C CB  . GLN D 2 208 ? 60.665  3.722  132.209 1.00 14.19  ? 208 GLN D CB  1 
ATOM   5748 C CG  . GLN D 2 208 ? 61.891  4.660  132.209 1.00 28.06  ? 208 GLN D CG  1 
ATOM   5749 C CD  . GLN D 2 208 ? 63.228  3.936  132.312 1.00 50.24  ? 208 GLN D CD  1 
ATOM   5750 O OE1 . GLN D 2 208 ? 63.352  2.768  131.943 1.00 71.80  ? 208 GLN D OE1 1 
ATOM   5751 N NE2 . GLN D 2 208 ? 64.240  4.637  132.809 1.00 59.32  ? 208 GLN D NE2 1 
ATOM   5752 N N   . LEU D 2 209 ? 57.103  3.797  131.537 1.00 21.30  ? 209 LEU D N   1 
ATOM   5753 C CA  . LEU D 2 209 ? 55.862  3.052  131.653 1.00 22.68  ? 209 LEU D CA  1 
ATOM   5754 C C   . LEU D 2 209 ? 55.564  2.202  130.436 1.00 34.74  ? 209 LEU D C   1 
ATOM   5755 O O   . LEU D 2 209 ? 56.032  2.487  129.325 1.00 33.75  ? 209 LEU D O   1 
ATOM   5756 C CB  . LEU D 2 209 ? 54.696  3.998  131.905 1.00 9.98   ? 209 LEU D CB  1 
ATOM   5757 C CG  . LEU D 2 209 ? 54.786  4.760  133.207 1.00 11.78  ? 209 LEU D CG  1 
ATOM   5758 C CD1 . LEU D 2 209 ? 53.663  5.743  133.276 1.00 22.97  ? 209 LEU D CD1 1 
ATOM   5759 C CD2 . LEU D 2 209 ? 54.725  3.791  134.361 1.00 21.12  ? 209 LEU D CD2 1 
ATOM   5760 N N   . ARG D 2 210 ? 54.733  1.185  130.653 1.00 46.45  ? 210 ARG D N   1 
ATOM   5761 C CA  . ARG D 2 210 ? 54.344  0.253  129.604 1.00 42.75  ? 210 ARG D CA  1 
ATOM   5762 C C   . ARG D 2 210 ? 52.877  0.440  129.199 1.00 40.63  ? 210 ARG D C   1 
ATOM   5763 O O   . ARG D 2 210 ? 51.959  0.396  130.040 1.00 45.71  ? 210 ARG D O   1 
ATOM   5764 C CB  . ARG D 2 210 ? 54.586  -1.192 130.068 1.00 43.28  ? 210 ARG D CB  1 
ATOM   5765 C CG  . ARG D 2 210 ? 55.865  -1.403 130.895 1.00 54.69  ? 210 ARG D CG  1 
ATOM   5766 C CD  . ARG D 2 210 ? 56.136  -2.884 131.181 1.00 60.49  ? 210 ARG D CD  1 
ATOM   5767 N NE  . ARG D 2 210 ? 56.587  -3.589 129.983 1.00 51.49  ? 210 ARG D NE  1 
ATOM   5768 C CZ  . ARG D 2 210 ? 57.832  -4.014 129.794 1.00 41.33  ? 210 ARG D CZ  1 
ATOM   5769 N NH1 . ARG D 2 210 ? 58.744  -3.814 130.735 1.00 32.26  ? 210 ARG D NH1 1 
ATOM   5770 N NH2 . ARG D 2 210 ? 58.175  -4.594 128.649 1.00 35.08  ? 210 ARG D NH2 1 
ATOM   5771 N N   . PRO D 2 211 ? 52.650  0.761  127.921 1.00 37.02  ? 211 PRO D N   1 
ATOM   5772 C CA  . PRO D 2 211 ? 51.303  0.964  127.373 1.00 42.34  ? 211 PRO D CA  1 
ATOM   5773 C C   . PRO D 2 211 ? 50.534  -0.353 127.415 1.00 50.27  ? 211 PRO D C   1 
ATOM   5774 O O   . PRO D 2 211 ? 51.092  -1.394 127.079 1.00 54.99  ? 211 PRO D O   1 
ATOM   5775 C CB  . PRO D 2 211 ? 51.588  1.377  125.923 1.00 37.46  ? 211 PRO D CB  1 
ATOM   5776 C CG  . PRO D 2 211 ? 52.933  2.063  126.012 1.00 26.89  ? 211 PRO D CG  1 
ATOM   5777 C CD  . PRO D 2 211 ? 53.689  1.170  126.958 1.00 34.48  ? 211 PRO D CD  1 
ATOM   5778 N N   . THR D 2 212 ? 49.276  -0.323 127.838 1.00 59.54  ? 212 THR D N   1 
ATOM   5779 C CA  . THR D 2 212 ? 48.469  -1.534 127.895 1.00 78.01  ? 212 THR D CA  1 
ATOM   5780 C C   . THR D 2 212 ? 48.515  -2.200 126.511 1.00 95.21  ? 212 THR D C   1 
ATOM   5781 O O   . THR D 2 212 ? 48.470  -1.506 125.495 1.00 92.21  ? 212 THR D O   1 
ATOM   5782 C CB  . THR D 2 212 ? 47.012  -1.202 128.272 1.00 78.24  ? 212 THR D CB  1 
ATOM   5783 O OG1 . THR D 2 212 ? 46.980  -0.007 129.066 1.00 88.13  ? 212 THR D OG1 1 
ATOM   5784 C CG2 . THR D 2 212 ? 46.399  -2.331 129.093 1.00 83.23  ? 212 THR D CG2 1 
ATOM   5785 N N   . MET D 2 213 ? 48.677  -3.525 126.482 1.00 117.65 ? 213 MET D N   1 
ATOM   5786 C CA  . MET D 2 213 ? 48.759  -4.297 125.232 1.00 134.27 ? 213 MET D CA  1 
ATOM   5787 C C   . MET D 2 213 ? 47.406  -4.466 124.524 1.00 139.67 ? 213 MET D C   1 
ATOM   5788 O O   . MET D 2 213 ? 46.358  -4.281 125.182 1.00 144.65 ? 213 MET D O   1 
ATOM   5789 C CB  . MET D 2 213 ? 49.385  -5.683 125.489 1.00 142.66 ? 213 MET D CB  1 
ATOM   5790 C CG  . MET D 2 213 ? 50.834  -5.674 125.990 1.00 154.50 ? 213 MET D CG  1 
ATOM   5791 S SD  . MET D 2 213 ? 51.530  -7.337 126.277 1.00 164.73 ? 213 MET D SD  1 
ATOM   5792 C CE  . MET D 2 213 ? 52.854  -7.386 125.068 1.00 169.73 ? 213 MET D CE  1 
HETATM 5793 C C1  . NAG E 3 .   ? 70.090  50.934 125.869 1.00 86.35  ? 323 NAG B C1  1 
HETATM 5794 C C2  . NAG E 3 .   ? 69.687  52.074 126.879 1.00 95.95  ? 323 NAG B C2  1 
HETATM 5795 C C3  . NAG E 3 .   ? 68.377  52.740 126.390 1.00 87.65  ? 323 NAG B C3  1 
HETATM 5796 C C4  . NAG E 3 .   ? 68.598  53.314 125.014 1.00 83.97  ? 323 NAG B C4  1 
HETATM 5797 C C5  . NAG E 3 .   ? 68.992  52.176 124.061 1.00 80.66  ? 323 NAG B C5  1 
HETATM 5798 C C6  . NAG E 3 .   ? 69.286  52.673 122.649 1.00 72.76  ? 323 NAG B C6  1 
HETATM 5799 C C7  . NAG E 3 .   ? 69.397  52.430 129.263 1.00 123.51 ? 323 NAG B C7  1 
HETATM 5800 C C8  . NAG E 3 .   ? 69.194  51.873 130.662 1.00 127.19 ? 323 NAG B C8  1 
HETATM 5801 N N2  . NAG E 3 .   ? 69.506  51.579 128.237 1.00 113.58 ? 323 NAG B N2  1 
HETATM 5802 O O3  . NAG E 3 .   ? 67.926  53.774 127.259 1.00 80.45  ? 323 NAG B O3  1 
HETATM 5803 O O4  . NAG E 3 .   ? 67.397  53.948 124.593 1.00 88.59  ? 323 NAG B O4  1 
HETATM 5804 O O5  . NAG E 3 .   ? 70.194  51.488 124.530 1.00 89.64  ? 323 NAG B O5  1 
HETATM 5805 O O6  . NAG E 3 .   ? 70.352  53.620 122.610 1.00 63.60  ? 323 NAG B O6  1 
HETATM 5806 O O7  . NAG E 3 .   ? 69.482  53.657 129.146 1.00 128.40 ? 323 NAG B O7  1 
HETATM 5807 C C1  . NAG F 3 .   ? 75.428  33.117 134.564 1.00 96.97  ? 923 NAG D C1  1 
HETATM 5808 C C2  . NAG F 3 .   ? 76.117  32.313 133.423 1.00 106.57 ? 923 NAG D C2  1 
HETATM 5809 C C3  . NAG F 3 .   ? 75.477  30.918 133.239 1.00 107.20 ? 923 NAG D C3  1 
HETATM 5810 C C4  . NAG F 3 .   ? 75.344  30.186 134.583 1.00 104.89 ? 923 NAG D C4  1 
HETATM 5811 C C5  . NAG F 3 .   ? 74.559  31.090 135.552 1.00 96.62  ? 923 NAG D C5  1 
HETATM 5812 C C6  . NAG F 3 .   ? 74.230  30.491 136.932 1.00 83.66  ? 923 NAG D C6  1 
HETATM 5813 C C7  . NAG F 3 .   ? 76.875  34.000 131.830 1.00 108.90 ? 923 NAG D C7  1 
HETATM 5814 C C8  . NAG F 3 .   ? 76.650  34.699 130.500 1.00 103.95 ? 923 NAG D C8  1 
HETATM 5815 N N2  . NAG F 3 .   ? 76.007  33.046 132.166 1.00 112.53 ? 923 NAG D N2  1 
HETATM 5816 O O3  . NAG F 3 .   ? 76.248  30.129 132.337 1.00 105.41 ? 923 NAG D O3  1 
HETATM 5817 O O4  . NAG F 3 .   ? 74.673  28.944 134.381 1.00 103.53 ? 923 NAG D O4  1 
HETATM 5818 O O5  . NAG F 3 .   ? 75.295  32.319 135.763 1.00 98.73  ? 923 NAG D O5  1 
HETATM 5819 O O6  . NAG F 3 .   ? 75.389  30.215 137.715 1.00 70.97  ? 923 NAG D O6  1 
HETATM 5820 O O7  . NAG F 3 .   ? 77.831  34.321 132.533 1.00 106.72 ? 923 NAG D O7  1 
HETATM 5821 O O   . HOH G 4 .   ? 38.203  36.547 108.852 1.00 32.09  ? 176 HOH A O   1 
HETATM 5822 O O   . HOH G 4 .   ? 40.146  35.965 104.253 1.00 25.39  ? 177 HOH A O   1 
HETATM 5823 O O   . HOH G 4 .   ? 46.944  36.226 117.288 1.00 9.42   ? 178 HOH A O   1 
HETATM 5824 O O   . HOH G 4 .   ? 47.744  39.445 117.193 1.00 26.80  ? 179 HOH A O   1 
HETATM 5825 O O   . HOH G 4 .   ? 53.109  30.567 112.889 1.00 17.60  ? 180 HOH A O   1 
HETATM 5826 O O   . HOH G 4 .   ? 49.677  42.897 98.855  1.00 7.00   ? 181 HOH A O   1 
HETATM 5827 O O   . HOH G 4 .   ? 45.438  48.364 96.965  1.00 28.43  ? 182 HOH A O   1 
HETATM 5828 O O   . HOH G 4 .   ? 52.252  48.283 93.531  1.00 45.75  ? 183 HOH A O   1 
HETATM 5829 O O   . HOH G 4 .   ? 29.958  49.999 86.981  1.00 39.79  ? 184 HOH A O   1 
HETATM 5830 O O   . HOH G 4 .   ? 33.057  47.782 88.086  1.00 22.29  ? 185 HOH A O   1 
HETATM 5831 O O   . HOH G 4 .   ? 33.937  45.355 87.050  1.00 20.42  ? 186 HOH A O   1 
HETATM 5832 O O   . HOH G 4 .   ? 33.281  32.891 84.290  1.00 29.07  ? 187 HOH A O   1 
HETATM 5833 O O   . HOH G 4 .   ? 41.939  29.646 78.106  1.00 53.05  ? 188 HOH A O   1 
HETATM 5834 O O   . HOH G 4 .   ? 46.600  46.811 103.984 1.00 26.88  ? 189 HOH A O   1 
HETATM 5835 O O   . HOH G 4 .   ? 52.999  28.795 124.644 1.00 31.31  ? 190 HOH A O   1 
HETATM 5836 O O   . HOH G 4 .   ? 57.209  43.978 101.438 1.00 37.49  ? 191 HOH A O   1 
HETATM 5837 O O   . HOH G 4 .   ? 56.336  42.943 85.068  1.00 66.57  ? 192 HOH A O   1 
HETATM 5838 O O   . HOH G 4 .   ? 34.715  26.177 89.892  1.00 30.03  ? 193 HOH A O   1 
HETATM 5839 O O   . HOH G 4 .   ? 53.863  36.038 106.935 1.00 5.44   ? 194 HOH A O   1 
HETATM 5840 O O   . HOH G 4 .   ? 45.781  48.515 80.575  1.00 12.56  ? 195 HOH A O   1 
HETATM 5841 O O   . HOH G 4 .   ? 53.137  46.507 103.574 1.00 32.12  ? 196 HOH A O   1 
HETATM 5842 O O   . HOH G 4 .   ? 49.400  45.742 103.206 1.00 32.06  ? 197 HOH A O   1 
HETATM 5843 O O   . HOH G 4 .   ? 40.344  38.318 110.009 1.00 44.77  ? 198 HOH A O   1 
HETATM 5844 O O   . HOH G 4 .   ? 64.218  17.980 116.492 1.00 59.45  ? 199 HOH A O   1 
HETATM 5845 O O   . HOH G 4 .   ? 57.835  24.971 102.636 1.00 41.49  ? 200 HOH A O   1 
HETATM 5846 O O   . HOH G 4 .   ? 59.372  22.312 102.105 1.00 47.63  ? 201 HOH A O   1 
HETATM 5847 O O   . HOH G 4 .   ? 35.336  14.894 114.386 1.00 56.40  ? 202 HOH A O   1 
HETATM 5848 O O   . HOH G 4 .   ? 60.611  25.279 102.975 1.00 48.76  ? 203 HOH A O   1 
HETATM 5849 O O   . HOH G 4 .   ? 62.539  14.375 104.234 1.00 48.24  ? 204 HOH A O   1 
HETATM 5850 O O   . HOH G 4 .   ? 61.767  31.319 101.427 1.00 67.76  ? 205 HOH A O   1 
HETATM 5851 O O   . HOH G 4 .   ? 61.054  41.657 98.156  1.00 75.04  ? 206 HOH A O   1 
HETATM 5852 O O   . HOH G 4 .   ? 56.010  41.634 101.904 1.00 23.95  ? 207 HOH A O   1 
HETATM 5853 O O   . HOH G 4 .   ? 60.616  22.986 123.092 1.00 55.63  ? 208 HOH A O   1 
HETATM 5854 O O   . HOH G 4 .   ? 62.686  24.096 119.938 1.00 46.13  ? 209 HOH A O   1 
HETATM 5855 O O   . HOH G 4 .   ? 63.923  21.398 122.774 1.00 60.77  ? 210 HOH A O   1 
HETATM 5856 O O   . HOH G 4 .   ? 53.329  43.722 104.773 1.00 17.17  ? 211 HOH A O   1 
HETATM 5857 O O   . HOH G 4 .   ? 55.273  42.143 105.595 1.00 24.59  ? 212 HOH A O   1 
HETATM 5858 O O   . HOH G 4 .   ? 57.775  44.782 97.430  1.00 17.91  ? 213 HOH A O   1 
HETATM 5859 O O   . HOH G 4 .   ? 28.412  41.986 88.752  1.00 34.62  ? 214 HOH A O   1 
HETATM 5860 O O   . HOH G 4 .   ? 54.346  42.742 82.657  1.00 29.07  ? 215 HOH A O   1 
HETATM 5861 O O   . HOH G 4 .   ? 51.981  51.104 93.559  1.00 57.17  ? 216 HOH A O   1 
HETATM 5862 O O   . HOH G 4 .   ? 53.902  51.130 91.504  1.00 61.83  ? 217 HOH A O   1 
HETATM 5863 O O   . HOH G 4 .   ? 61.967  20.559 120.590 1.00 64.77  ? 218 HOH A O   1 
HETATM 5864 O O   . HOH G 4 .   ? 52.495  46.154 99.730  1.00 62.53  ? 219 HOH A O   1 
HETATM 5865 O O   . HOH G 4 .   ? 39.253  41.343 93.137  1.00 25.12  ? 220 HOH A O   1 
HETATM 5866 O O   . HOH G 4 .   ? 41.535  53.686 89.028  1.00 41.77  ? 221 HOH A O   1 
HETATM 5867 O O   . HOH H 4 .   ? 56.148  30.252 114.184 1.00 16.85  ? 324 HOH B O   1 
HETATM 5868 O O   . HOH H 4 .   ? 54.077  53.749 127.102 1.00 21.41  ? 325 HOH B O   1 
HETATM 5869 O O   . HOH H 4 .   ? 52.842  50.564 132.909 1.00 57.49  ? 326 HOH B O   1 
HETATM 5870 O O   . HOH H 4 .   ? 66.427  49.747 117.708 1.00 21.98  ? 327 HOH B O   1 
HETATM 5871 O O   . HOH H 4 .   ? 64.802  35.926 110.169 1.00 12.51  ? 328 HOH B O   1 
HETATM 5872 O O   . HOH H 4 .   ? 42.286  42.624 124.599 1.00 49.11  ? 329 HOH B O   1 
HETATM 5873 O O   . HOH H 4 .   ? 49.913  42.882 128.416 1.00 6.51   ? 330 HOH B O   1 
HETATM 5874 O O   . HOH H 4 .   ? 61.455  37.326 120.990 1.00 16.25  ? 331 HOH B O   1 
HETATM 5875 O O   . HOH H 4 .   ? 67.941  43.747 123.603 1.00 24.88  ? 332 HOH B O   1 
HETATM 5876 O O   . HOH H 4 .   ? 86.434  60.899 117.903 1.00 20.76  ? 333 HOH B O   1 
HETATM 5877 O O   . HOH H 4 .   ? 55.970  43.368 118.352 1.00 30.91  ? 334 HOH B O   1 
HETATM 5878 O O   . HOH H 4 .   ? 53.076  45.784 121.317 1.00 2.00   ? 335 HOH B O   1 
HETATM 5879 O O   . HOH H 4 .   ? 58.979  49.996 121.494 1.00 42.97  ? 336 HOH B O   1 
HETATM 5880 O O   . HOH H 4 .   ? 55.448  45.693 120.199 1.00 28.62  ? 337 HOH B O   1 
HETATM 5881 O O   . HOH H 4 .   ? 66.277  27.651 108.242 1.00 23.95  ? 338 HOH B O   1 
HETATM 5882 O O   . HOH H 4 .   ? 41.925  53.908 137.833 1.00 34.79  ? 339 HOH B O   1 
HETATM 5883 O O   . HOH H 4 .   ? 82.258  49.982 108.796 1.00 73.79  ? 340 HOH B O   1 
HETATM 5884 O O   . HOH H 4 .   ? 85.654  49.565 120.455 1.00 19.95  ? 341 HOH B O   1 
HETATM 5885 O O   . HOH H 4 .   ? 64.941  29.265 106.409 1.00 27.65  ? 342 HOH B O   1 
HETATM 5886 O O   . HOH H 4 .   ? 53.812  59.058 131.412 1.00 10.30  ? 343 HOH B O   1 
HETATM 5887 O O   . HOH H 4 .   ? 63.815  34.009 111.554 1.00 28.94  ? 344 HOH B O   1 
HETATM 5888 O O   . HOH H 4 .   ? 75.413  36.889 108.878 1.00 34.65  ? 345 HOH B O   1 
HETATM 5889 O O   . HOH H 4 .   ? 33.175  71.993 137.504 1.00 41.17  ? 346 HOH B O   1 
HETATM 5890 O O   . HOH H 4 .   ? 32.249  49.152 118.432 1.00 30.46  ? 347 HOH B O   1 
HETATM 5891 O O   . HOH H 4 .   ? 64.970  18.372 113.541 1.00 56.87  ? 348 HOH B O   1 
HETATM 5892 O O   . HOH H 4 .   ? 55.890  37.176 116.888 1.00 14.68  ? 349 HOH B O   1 
HETATM 5893 O O   . HOH H 4 .   ? 57.244  50.540 113.160 1.00 41.28  ? 350 HOH B O   1 
HETATM 5894 O O   . HOH H 4 .   ? 81.506  53.671 112.897 1.00 49.59  ? 351 HOH B O   1 
HETATM 5895 O O   . HOH H 4 .   ? 47.649  41.461 130.851 1.00 42.57  ? 352 HOH B O   1 
HETATM 5896 O O   . HOH H 4 .   ? 54.948  46.004 107.182 1.00 31.69  ? 353 HOH B O   1 
HETATM 5897 O O   . HOH H 4 .   ? 75.018  45.419 103.954 1.00 31.22  ? 354 HOH B O   1 
HETATM 5898 O O   . HOH H 4 .   ? 45.408  46.717 129.252 1.00 21.92  ? 355 HOH B O   1 
HETATM 5899 O O   . HOH H 4 .   ? 32.445  64.103 122.602 1.00 21.38  ? 356 HOH B O   1 
HETATM 5900 O O   . HOH H 4 .   ? 50.532  65.365 124.628 1.00 25.07  ? 357 HOH B O   1 
HETATM 5901 O O   . HOH H 4 .   ? 30.081  67.488 124.003 1.00 87.03  ? 358 HOH B O   1 
HETATM 5902 O O   . HOH H 4 .   ? 72.796  39.986 109.317 1.00 48.54  ? 359 HOH B O   1 
HETATM 5903 O O   . HOH H 4 .   ? 33.651  66.467 123.228 1.00 32.62  ? 360 HOH B O   1 
HETATM 5904 O O   . HOH H 4 .   ? 48.519  44.371 129.843 1.00 12.00  ? 361 HOH B O   1 
HETATM 5905 O O   . HOH H 4 .   ? 48.030  51.006 117.693 1.00 45.09  ? 362 HOH B O   1 
HETATM 5906 O O   . HOH H 4 .   ? 83.520  48.387 119.687 1.00 18.35  ? 363 HOH B O   1 
HETATM 5907 O O   . HOH H 4 .   ? 35.947  74.460 123.825 1.00 31.91  ? 364 HOH B O   1 
HETATM 5908 O O   . HOH H 4 .   ? 35.357  69.774 123.761 1.00 18.95  ? 365 HOH B O   1 
HETATM 5909 O O   . HOH H 4 .   ? 53.919  41.978 126.020 1.00 50.52  ? 366 HOH B O   1 
HETATM 5910 O O   . HOH H 4 .   ? 64.560  27.192 111.683 1.00 37.56  ? 367 HOH B O   1 
HETATM 5911 O O   . HOH H 4 .   ? 60.320  28.769 117.236 1.00 55.08  ? 368 HOH B O   1 
HETATM 5912 O O   . HOH H 4 .   ? 55.310  49.284 103.648 1.00 39.08  ? 369 HOH B O   1 
HETATM 5913 O O   . HOH H 4 .   ? 52.549  50.213 105.633 1.00 44.06  ? 370 HOH B O   1 
HETATM 5914 O O   . HOH H 4 .   ? 62.687  43.978 101.536 1.00 30.29  ? 371 HOH B O   1 
HETATM 5915 O O   . HOH H 4 .   ? 51.237  33.110 124.484 1.00 42.01  ? 372 HOH B O   1 
HETATM 5916 O O   . HOH H 4 .   ? 31.615  52.905 131.924 1.00 58.80  ? 373 HOH B O   1 
HETATM 5917 O O   . HOH H 4 .   ? 84.542  57.173 120.478 1.00 43.00  ? 374 HOH B O   1 
HETATM 5918 O O   . HOH H 4 .   ? 44.442  62.342 119.567 1.00 41.60  ? 375 HOH B O   1 
HETATM 5919 O O   . HOH H 4 .   ? 57.187  51.540 126.157 1.00 37.75  ? 376 HOH B O   1 
HETATM 5920 O O   . HOH H 4 .   ? 30.282  52.869 126.079 1.00 35.11  ? 377 HOH B O   1 
HETATM 5921 O O   . HOH H 4 .   ? 91.298  38.045 114.588 1.00 70.49  ? 378 HOH B O   1 
HETATM 5922 O O   . HOH H 4 .   ? 26.057  54.761 137.368 1.00 47.77  ? 379 HOH B O   1 
HETATM 5923 O O   . HOH H 4 .   ? 52.467  43.138 129.244 1.00 24.22  ? 380 HOH B O   1 
HETATM 5924 O O   . HOH H 4 .   ? 76.239  42.882 127.123 1.00 22.41  ? 381 HOH B O   1 
HETATM 5925 O O   . HOH H 4 .   ? 80.958  33.290 113.618 1.00 65.27  ? 382 HOH B O   1 
HETATM 5926 O O   . HOH H 4 .   ? 48.834  44.392 132.655 1.00 19.86  ? 383 HOH B O   1 
HETATM 5927 O O   . HOH H 4 .   ? 41.347  80.004 130.297 1.00 42.43  ? 384 HOH B O   1 
HETATM 5928 O O   . HOH H 4 .   ? 53.793  37.221 125.853 1.00 34.41  ? 385 HOH B O   1 
HETATM 5929 O O   . HOH H 4 .   ? 79.888  35.781 122.928 1.00 36.21  ? 386 HOH B O   1 
HETATM 5930 O O   . HOH H 4 .   ? 36.176  61.514 137.445 1.00 43.03  ? 387 HOH B O   1 
HETATM 5931 O O   . HOH H 4 .   ? 56.562  56.390 128.126 1.00 49.09  ? 388 HOH B O   1 
HETATM 5932 O O   . HOH H 4 .   ? 58.020  53.799 123.774 1.00 22.31  ? 389 HOH B O   1 
HETATM 5933 O O   . HOH H 4 .   ? 48.478  39.762 132.690 1.00 36.13  ? 390 HOH B O   1 
HETATM 5934 O O   . HOH H 4 .   ? 33.846  47.374 117.541 1.00 48.50  ? 391 HOH B O   1 
HETATM 5935 O O   . HOH H 4 .   ? 40.453  77.538 129.079 1.00 52.53  ? 392 HOH B O   1 
HETATM 5936 O O   . HOH H 4 .   ? 52.118  40.005 129.464 1.00 20.20  ? 393 HOH B O   1 
HETATM 5937 O O   . HOH H 4 .   ? 52.188  39.286 126.956 1.00 23.07  ? 394 HOH B O   1 
HETATM 5938 O O   . HOH H 4 .   ? 50.901  44.661 130.532 1.00 10.22  ? 395 HOH B O   1 
HETATM 5939 O O   . HOH H 4 .   ? 57.583  53.237 113.256 1.00 22.32  ? 396 HOH B O   1 
HETATM 5940 O O   . HOH H 4 .   ? 61.180  28.615 123.813 1.00 39.55  ? 397 HOH B O   1 
HETATM 5941 O O   . HOH H 4 .   ? 59.521  27.154 122.266 1.00 49.07  ? 398 HOH B O   1 
HETATM 5942 O O   . HOH H 4 .   ? 63.593  23.721 125.899 1.00 41.61  ? 399 HOH B O   1 
HETATM 5943 O O   . HOH H 4 .   ? 92.020  41.415 111.587 1.00 39.88  ? 400 HOH B O   1 
HETATM 5944 O O   . HOH H 4 .   ? 55.604  38.559 127.239 1.00 66.91  ? 401 HOH B O   1 
HETATM 5945 O O   . HOH H 4 .   ? 75.584  34.118 123.106 1.00 38.02  ? 402 HOH B O   1 
HETATM 5946 O O   . HOH H 4 .   ? 81.355  39.365 124.315 1.00 41.90  ? 403 HOH B O   1 
HETATM 5947 O O   . HOH H 4 .   ? 35.503  58.888 137.129 1.00 39.38  ? 404 HOH B O   1 
HETATM 5948 O O   . HOH H 4 .   ? 31.239  55.792 132.588 1.00 37.87  ? 405 HOH B O   1 
HETATM 5949 O O   . HOH H 4 .   ? 55.240  52.126 131.466 1.00 31.11  ? 406 HOH B O   1 
HETATM 5950 O O   . HOH H 4 .   ? 57.309  54.231 129.746 1.00 63.37  ? 407 HOH B O   1 
HETATM 5951 O O   . HOH H 4 .   ? 54.713  40.511 129.751 1.00 40.57  ? 408 HOH B O   1 
HETATM 5952 O O   . HOH H 4 .   ? 50.770  41.494 131.258 1.00 33.40  ? 409 HOH B O   1 
HETATM 5953 O O   . HOH H 4 .   ? 71.550  35.993 125.132 1.00 70.15  ? 410 HOH B O   1 
HETATM 5954 O O   . HOH H 4 .   ? 41.326  39.514 120.994 1.00 40.86  ? 411 HOH B O   1 
HETATM 5955 O O   . HOH H 4 .   ? 50.214  57.517 115.380 1.00 42.79  ? 412 HOH B O   1 
HETATM 5956 O O   . HOH H 4 .   ? 47.678  59.460 118.035 1.00 36.46  ? 413 HOH B O   1 
HETATM 5957 O O   . HOH H 4 .   ? 68.350  31.920 102.820 1.00 45.33  ? 414 HOH B O   1 
HETATM 5958 O O   . HOH H 4 .   ? 65.319  44.211 121.702 1.00 35.17  ? 415 HOH B O   1 
HETATM 5959 O O   . HOH H 4 .   ? 83.954  61.585 116.511 1.00 61.89  ? 416 HOH B O   1 
HETATM 5960 O O   . HOH H 4 .   ? 66.918  25.289 119.229 1.00 48.09  ? 417 HOH B O   1 
HETATM 5961 O O   . HOH H 4 .   ? 88.812  47.193 109.542 1.00 36.78  ? 418 HOH B O   1 
HETATM 5962 O O   . HOH H 4 .   ? 73.593  42.710 123.879 1.00 60.75  ? 419 HOH B O   1 
HETATM 5963 O O   . HOH H 4 .   ? 61.779  35.234 122.873 1.00 31.17  ? 420 HOH B O   1 
HETATM 5964 O O   . HOH H 4 .   ? 74.201  28.595 111.185 1.00 49.52  ? 421 HOH B O   1 
HETATM 5965 O O   . HOH H 4 .   ? 26.117  54.774 124.697 1.00 42.20  ? 422 HOH B O   1 
HETATM 5966 O O   . HOH H 4 .   ? 27.382  70.869 126.008 1.00 56.54  ? 423 HOH B O   1 
HETATM 5967 O O   . HOH H 4 .   ? 40.784  58.563 140.200 1.00 48.59  ? 424 HOH B O   1 
HETATM 5968 O O   . HOH H 4 .   ? 68.753  45.953 126.000 1.00 61.14  ? 425 HOH B O   1 
HETATM 5969 O O   . HOH H 4 .   ? 85.285  53.304 117.819 1.00 40.26  ? 426 HOH B O   1 
HETATM 5970 O O   . HOH H 4 .   ? 30.988  71.734 131.970 1.00 30.47  ? 427 HOH B O   1 
HETATM 5971 O O   . HOH H 4 .   ? 73.636  53.315 118.706 1.00 66.51  ? 428 HOH B O   1 
HETATM 5972 O O   . HOH H 4 .   ? 89.337  57.218 114.493 1.00 52.11  ? 429 HOH B O   1 
HETATM 5973 O O   . HOH H 4 .   ? 73.620  48.106 104.091 1.00 56.09  ? 430 HOH B O   1 
HETATM 5974 O O   . HOH H 4 .   ? 81.375  44.927 128.147 1.00 50.95  ? 431 HOH B O   1 
HETATM 5975 O O   . HOH I 4 .   ? 51.488  28.171 151.053 1.00 31.80  ? 176 HOH C O   1 
HETATM 5976 O O   . HOH I 4 .   ? 46.819  58.329 146.385 1.00 60.69  ? 177 HOH C O   1 
HETATM 5977 O O   . HOH I 4 .   ? 51.088  37.637 150.843 1.00 13.23  ? 178 HOH C O   1 
HETATM 5978 O O   . HOH I 4 .   ? 43.280  20.284 160.872 1.00 36.08  ? 179 HOH C O   1 
HETATM 5979 O O   . HOH I 4 .   ? 28.836  47.656 153.599 1.00 30.68  ? 180 HOH C O   1 
HETATM 5980 O O   . HOH I 4 .   ? 48.451  20.289 175.226 1.00 11.48  ? 181 HOH C O   1 
HETATM 5981 O O   . HOH I 4 .   ? 51.400  28.957 158.311 1.00 11.22  ? 182 HOH C O   1 
HETATM 5982 O O   . HOH I 4 .   ? 51.552  36.484 166.842 1.00 62.75  ? 183 HOH C O   1 
HETATM 5983 O O   . HOH I 4 .   ? 53.926  30.167 151.975 1.00 18.99  ? 184 HOH C O   1 
HETATM 5984 O O   . HOH I 4 .   ? 38.805  20.272 169.093 1.00 22.75  ? 185 HOH C O   1 
HETATM 5985 O O   . HOH I 4 .   ? 40.861  27.988 146.154 1.00 24.28  ? 186 HOH C O   1 
HETATM 5986 O O   . HOH I 4 .   ? 52.639  26.131 153.469 1.00 31.85  ? 187 HOH C O   1 
HETATM 5987 O O   . HOH I 4 .   ? 47.830  48.612 155.099 1.00 11.94  ? 188 HOH C O   1 
HETATM 5988 O O   . HOH I 4 .   ? 52.523  27.242 175.865 1.00 27.69  ? 189 HOH C O   1 
HETATM 5989 O O   . HOH I 4 .   ? 48.721  31.693 140.794 1.00 30.95  ? 190 HOH C O   1 
HETATM 5990 O O   . HOH I 4 .   ? 43.767  56.572 146.139 1.00 31.27  ? 191 HOH C O   1 
HETATM 5991 O O   . HOH I 4 .   ? 37.706  53.669 138.696 1.00 45.63  ? 192 HOH C O   1 
HETATM 5992 O O   . HOH I 4 .   ? 48.973  23.511 153.422 1.00 44.30  ? 193 HOH C O   1 
HETATM 5993 O O   . HOH I 4 .   ? 40.661  11.388 170.482 1.00 4.93   ? 194 HOH C O   1 
HETATM 5994 O O   . HOH I 4 .   ? 51.200  22.038 176.105 1.00 27.59  ? 195 HOH C O   1 
HETATM 5995 O O   . HOH I 4 .   ? 47.731  51.664 155.576 1.00 36.96  ? 196 HOH C O   1 
HETATM 5996 O O   . HOH I 4 .   ? 52.763  43.938 133.745 1.00 42.71  ? 197 HOH C O   1 
HETATM 5997 O O   . HOH I 4 .   ? 29.539  32.755 143.314 1.00 23.15  ? 198 HOH C O   1 
HETATM 5998 O O   . HOH I 4 .   ? 38.324  26.282 148.319 1.00 47.11  ? 199 HOH C O   1 
HETATM 5999 O O   . HOH I 4 .   ? 49.462  53.478 156.416 1.00 44.27  ? 200 HOH C O   1 
HETATM 6000 O O   . HOH I 4 .   ? 45.656  20.641 174.353 1.00 25.29  ? 201 HOH C O   1 
HETATM 6001 O O   . HOH I 4 .   ? 53.298  23.714 176.495 1.00 30.15  ? 202 HOH C O   1 
HETATM 6002 O O   . HOH I 4 .   ? 50.006  50.010 154.290 1.00 29.42  ? 203 HOH C O   1 
HETATM 6003 O O   . HOH I 4 .   ? 29.795  37.884 148.834 1.00 30.17  ? 204 HOH C O   1 
HETATM 6004 O O   . HOH I 4 .   ? 55.033  34.917 165.381 1.00 57.85  ? 205 HOH C O   1 
HETATM 6005 O O   . HOH I 4 .   ? 38.919  53.391 164.557 1.00 57.66  ? 206 HOH C O   1 
HETATM 6006 O O   . HOH I 4 .   ? 40.195  13.637 169.442 1.00 38.89  ? 207 HOH C O   1 
HETATM 6007 O O   . HOH I 4 .   ? 36.311  35.458 179.613 1.00 68.00  ? 208 HOH C O   1 
HETATM 6008 O O   . HOH I 4 .   ? 53.853  24.612 173.469 1.00 35.79  ? 209 HOH C O   1 
HETATM 6009 O O   . HOH I 4 .   ? 51.588  50.869 156.319 1.00 100.50 ? 210 HOH C O   1 
HETATM 6010 O O   . HOH I 4 .   ? 40.582  15.106 167.375 1.00 62.64  ? 211 HOH C O   1 
HETATM 6011 O O   . HOH I 4 .   ? 40.382  31.802 137.254 1.00 68.82  ? 212 HOH C O   1 
HETATM 6012 O O   . HOH J 4 .   ? 46.370  26.352 130.324 1.00 38.74  ? 924 HOH D O   1 
HETATM 6013 O O   . HOH J 4 .   ? 54.520  17.773 120.146 1.00 26.41  ? 925 HOH D O   1 
HETATM 6014 O O   . HOH J 4 .   ? 45.216  11.025 124.909 1.00 66.43  ? 926 HOH D O   1 
HETATM 6015 O O   . HOH J 4 .   ? 63.310  23.296 132.093 1.00 18.84  ? 927 HOH D O   1 
HETATM 6016 O O   . HOH J 4 .   ? 56.015  32.112 153.034 1.00 23.28  ? 928 HOH D O   1 
HETATM 6017 O O   . HOH J 4 .   ? 65.520  11.880 133.930 1.00 30.79  ? 929 HOH D O   1 
HETATM 6018 O O   . HOH J 4 .   ? 51.995  47.010 144.158 1.00 29.81  ? 930 HOH D O   1 
HETATM 6019 O O   . HOH J 4 .   ? 51.081  17.828 146.174 1.00 31.45  ? 931 HOH D O   1 
HETATM 6020 O O   . HOH J 4 .   ? 60.927  43.212 149.323 1.00 25.07  ? 932 HOH D O   1 
HETATM 6021 O O   . HOH J 4 .   ? 55.756  28.042 150.696 1.00 37.53  ? 933 HOH D O   1 
HETATM 6022 O O   . HOH J 4 .   ? 66.567  34.794 138.483 1.00 44.77  ? 934 HOH D O   1 
HETATM 6023 O O   . HOH J 4 .   ? 82.930  35.645 151.267 1.00 63.76  ? 935 HOH D O   1 
HETATM 6024 O O   . HOH J 4 .   ? 52.597  30.979 130.339 1.00 35.47  ? 936 HOH D O   1 
HETATM 6025 O O   . HOH J 4 .   ? 59.828  16.895 142.882 1.00 39.17  ? 937 HOH D O   1 
HETATM 6026 O O   . HOH J 4 .   ? 55.659  34.845 127.862 1.00 58.09  ? 938 HOH D O   1 
HETATM 6027 O O   . HOH J 4 .   ? 54.743  21.768 140.733 1.00 38.37  ? 939 HOH D O   1 
HETATM 6028 O O   . HOH J 4 .   ? 58.444  30.424 127.892 1.00 30.03  ? 940 HOH D O   1 
HETATM 6029 O O   . HOH J 4 .   ? 62.176  19.024 148.159 1.00 48.93  ? 941 HOH D O   1 
HETATM 6030 O O   . HOH J 4 .   ? 49.166  -1.302 137.132 1.00 84.42  ? 942 HOH D O   1 
HETATM 6031 O O   . HOH J 4 .   ? 48.669  32.529 138.351 1.00 24.99  ? 943 HOH D O   1 
HETATM 6032 O O   . HOH J 4 .   ? 60.552  40.991 138.234 1.00 47.11  ? 944 HOH D O   1 
HETATM 6033 O O   . HOH J 4 .   ? 58.138  25.388 125.285 1.00 43.49  ? 945 HOH D O   1 
HETATM 6034 O O   . HOH J 4 .   ? 53.805  28.892 128.480 1.00 18.02  ? 946 HOH D O   1 
HETATM 6035 O O   . HOH J 4 .   ? 45.228  26.196 147.154 1.00 47.99  ? 947 HOH D O   1 
HETATM 6036 O O   . HOH J 4 .   ? 72.153  46.015 157.976 1.00 38.81  ? 948 HOH D O   1 
HETATM 6037 O O   . HOH J 4 .   ? 76.438  41.589 134.423 1.00 31.20  ? 949 HOH D O   1 
HETATM 6038 O O   . HOH J 4 .   ? 56.121  29.281 127.103 1.00 12.27  ? 950 HOH D O   1 
HETATM 6039 O O   . HOH J 4 .   ? 58.613  30.811 125.192 1.00 39.75  ? 951 HOH D O   1 
HETATM 6040 O O   . HOH J 4 .   ? 66.955  16.588 126.364 1.00 60.86  ? 952 HOH D O   1 
HETATM 6041 O O   . HOH J 4 .   ? 55.050  34.662 125.216 1.00 67.99  ? 953 HOH D O   1 
HETATM 6042 O O   . HOH J 4 .   ? 62.433  43.268 159.348 1.00 21.58  ? 954 HOH D O   1 
HETATM 6043 O O   . HOH J 4 .   ? 55.992  31.104 125.340 1.00 32.97  ? 955 HOH D O   1 
HETATM 6044 O O   . HOH J 4 .   ? 66.186  18.474 128.149 1.00 34.83  ? 956 HOH D O   1 
HETATM 6045 O O   . HOH J 4 .   ? 52.958  34.736 127.104 1.00 55.29  ? 957 HOH D O   1 
HETATM 6046 O O   . HOH J 4 .   ? 69.925  42.743 134.803 1.00 57.90  ? 958 HOH D O   1 
HETATM 6047 O O   . HOH J 4 .   ? 66.620  23.997 135.012 1.00 28.37  ? 959 HOH D O   1 
HETATM 6048 O O   . HOH J 4 .   ? 65.969  20.443 132.862 1.00 24.54  ? 960 HOH D O   1 
HETATM 6049 O O   . HOH J 4 .   ? 56.312  -7.499 131.639 1.00 53.88  ? 961 HOH D O   1 
HETATM 6050 O O   . HOH J 4 .   ? 54.590  37.254 132.102 1.00 32.57  ? 962 HOH D O   1 
HETATM 6051 O O   . HOH J 4 .   ? 53.972  33.042 129.104 1.00 70.58  ? 963 HOH D O   1 
HETATM 6052 O O   . HOH J 4 .   ? 54.575  27.009 125.952 1.00 13.23  ? 964 HOH D O   1 
HETATM 6053 O O   . HOH J 4 .   ? 58.839  27.884 126.325 1.00 21.75  ? 965 HOH D O   1 
HETATM 6054 O O   . HOH J 4 .   ? 61.005  28.942 127.458 1.00 52.74  ? 966 HOH D O   1 
HETATM 6055 O O   . HOH J 4 .   ? 51.969  23.900 150.631 1.00 32.23  ? 967 HOH D O   1 
HETATM 6056 O O   . HOH J 4 .   ? 56.265  30.941 129.298 1.00 22.11  ? 968 HOH D O   1 
HETATM 6057 O O   . HOH J 4 .   ? 71.003  45.180 136.475 1.00 80.91  ? 969 HOH D O   1 
HETATM 6058 O O   . HOH J 4 .   ? 58.165  -6.612 133.708 1.00 34.13  ? 970 HOH D O   1 
HETATM 6059 O O   . HOH J 4 .   ? 58.212  -3.298 134.281 1.00 32.35  ? 971 HOH D O   1 
HETATM 6060 O O   . HOH J 4 .   ? 59.852  14.819 140.958 1.00 28.76  ? 972 HOH D O   1 
HETATM 6061 O O   . HOH J 4 .   ? 81.677  50.478 140.607 1.00 54.87  ? 973 HOH D O   1 
HETATM 6062 O O   . HOH J 4 .   ? 55.534  -5.683 133.439 1.00 69.25  ? 974 HOH D O   1 
HETATM 6063 O O   . HOH J 4 .   ? 54.677  -2.063 134.389 1.00 60.22  ? 975 HOH D O   1 
HETATM 6064 O O   . HOH J 4 .   ? 58.463  32.435 139.891 1.00 26.10  ? 976 HOH D O   1 
HETATM 6065 O O   . HOH J 4 .   ? 53.341  0.534  133.323 1.00 49.36  ? 977 HOH D O   1 
HETATM 6066 O O   . HOH J 4 .   ? 54.971  48.825 141.946 1.00 47.30  ? 978 HOH D O   1 
HETATM 6067 O O   . HOH J 4 .   ? 69.375  40.022 155.323 1.00 35.25  ? 979 HOH D O   1 
HETATM 6068 O O   . HOH J 4 .   ? 62.284  29.940 131.669 1.00 50.14  ? 980 HOH D O   1 
HETATM 6069 O O   . HOH J 4 .   ? 58.611  -5.200 136.271 1.00 62.41  ? 981 HOH D O   1 
HETATM 6070 O O   . HOH J 4 .   ? 65.435  14.670 134.111 1.00 59.57  ? 982 HOH D O   1 
HETATM 6071 O O   . HOH J 4 .   ? 40.753  15.424 137.297 1.00 24.38  ? 983 HOH D O   1 
HETATM 6072 O O   . HOH J 4 .   ? 71.290  26.725 145.373 1.00 50.97  ? 984 HOH D O   1 
HETATM 6073 O O   . HOH J 4 .   ? 67.840  25.531 132.433 1.00 35.82  ? 985 HOH D O   1 
HETATM 6074 O O   . HOH J 4 .   ? 66.992  28.762 137.843 1.00 44.77  ? 986 HOH D O   1 
HETATM 6075 O O   . HOH J 4 .   ? 69.873  31.743 142.505 1.00 42.66  ? 987 HOH D O   1 
HETATM 6076 O O   . HOH J 4 .   ? 65.096  54.598 132.667 1.00 55.99  ? 988 HOH D O   1 
HETATM 6077 O O   . HOH J 4 .   ? 39.331  13.455 135.759 1.00 57.18  ? 989 HOH D O   1 
HETATM 6078 O O   . HOH J 4 .   ? 63.958  21.368 127.030 1.00 52.06  ? 990 HOH D O   1 
HETATM 6079 O O   . HOH J 4 .   ? 70.753  54.054 143.325 1.00 47.10  ? 991 HOH D O   1 
HETATM 6080 O O   . HOH J 4 .   ? 40.914  8.450  141.943 1.00 61.53  ? 992 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   THR 2   2   ?   ?   ?   A . n 
A 1 3   PRO 3   3   ?   ?   ?   A . n 
A 1 4   LEU 4   4   ?   ?   ?   A . n 
A 1 5   GLY 5   5   5   GLY GLY A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   ALA 7   7   7   ALA ALA A . n 
A 1 8   SER 8   8   8   SER SER A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  PRO 11  11  11  PRO PRO A . n 
A 1 12  GLN 12  12  12  GLN GLN A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  PHE 14  14  14  PHE PHE A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  LEU 16  16  16  LEU LEU A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  CYS 18  18  18  CYS CYS A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  GLN 21  21  21  GLN GLN A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  ARG 23  23  23  ARG ARG A . n 
A 1 24  LYS 24  24  24  LYS LYS A . n 
A 1 25  ILE 25  25  25  ILE ILE A . n 
A 1 26  GLN 26  26  26  GLN GLN A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  ASP 28  28  28  ASP ASP A . n 
A 1 29  GLY 29  29  29  GLY GLY A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  GLN 33  33  33  GLN GLN A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  LEU 36  36  36  LEU LEU A . n 
A 1 37  CYS 37  37  37  CYS CYS A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  TYR 40  40  40  TYR TYR A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  CYS 43  43  43  CYS CYS A . n 
A 1 44  HIS 44  44  44  HIS HIS A . n 
A 1 45  PRO 45  45  45  PRO PRO A . n 
A 1 46  GLU 46  46  46  GLU GLU A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  GLY 52  52  52  GLY GLY A . n 
A 1 53  HIS 53  53  53  HIS HIS A . n 
A 1 54  SER 54  54  54  SER SER A . n 
A 1 55  LEU 55  55  55  LEU LEU A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  ILE 57  57  57  ILE ILE A . n 
A 1 58  PRO 58  58  58  PRO PRO A . n 
A 1 59  TRP 59  59  59  TRP TRP A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  PRO 61  61  61  PRO PRO A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  CYS 65  65  65  CYS CYS A . n 
A 1 66  PRO 66  66  66  PRO PRO A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  CYS 75  75  75  CYS CYS A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  GLN 78  78  78  GLN GLN A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  HIS 80  80  80  HIS HIS A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  TYR 86  86  86  TYR TYR A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  ALA 92  92  92  ALA ALA A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  GLY 95  95  95  GLY GLY A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  SER 97  97  97  SER SER A . n 
A 1 98  PRO 98  98  98  PRO PRO A . n 
A 1 99  GLU 99  99  99  GLU GLU A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 GLY 101 101 101 GLY GLY A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 THR 106 106 106 THR THR A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 GLN 108 108 108 GLN GLN A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 PHE 114 114 114 PHE PHE A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 THR 117 117 117 THR THR A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 TRP 119 119 119 TRP TRP A . n 
A 1 120 GLN 120 120 120 GLN GLN A . n 
A 1 121 GLN 121 121 121 GLN GLN A . n 
A 1 122 MET 122 122 122 MET MET A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 GLU 124 124 124 GLU GLU A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 MET 127 127 127 MET MET A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 PRO 129 129 129 PRO PRO A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 GLN 132 132 132 GLN GLN A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 THR 134 134 134 THR THR A . n 
A 1 135 GLN 135 135 135 GLN GLN A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 MET 138 138 138 MET MET A . n 
A 1 139 PRO 139 139 139 PRO PRO A . n 
A 1 140 ALA 140 140 140 ALA ALA A . n 
A 1 141 PHE 141 141 141 PHE PHE A . n 
A 1 142 ALA 142 142 142 ALA ALA A . n 
A 1 143 SER 143 143 143 SER SER A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 PHE 145 145 145 PHE PHE A . n 
A 1 146 GLN 146 146 146 GLN GLN A . n 
A 1 147 ARG 147 147 147 ARG ARG A . n 
A 1 148 ARG 148 148 148 ARG ARG A . n 
A 1 149 ALA 149 149 149 ALA ALA A . n 
A 1 150 GLY 150 150 150 GLY GLY A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 VAL 152 152 152 VAL VAL A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 VAL 154 154 154 VAL VAL A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 HIS 157 157 157 HIS HIS A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 GLN 159 159 159 GLN GLN A . n 
A 1 160 SER 160 160 160 SER SER A . n 
A 1 161 PHE 161 161 161 PHE PHE A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 SER 165 165 165 SER SER A . n 
A 1 166 TYR 166 166 166 TYR TYR A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 LEU 169 169 169 LEU LEU A . n 
A 1 170 ARG 170 170 170 ARG ARG A . n 
A 1 171 HIS 171 171 171 HIS HIS A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 ALA 173 173 173 ALA ALA A . n 
A 1 174 GLN 174 174 174 GLN GLN A . n 
A 1 175 PRO 175 175 175 PRO PRO A . n 
B 2 1   ALA 1   1   1   ALA ALA B . n 
B 2 2   GLY 2   2   2   GLY GLY B . n 
B 2 3   TYR 3   3   3   TYR TYR B . n 
B 2 4   PRO 4   4   4   PRO PRO B . n 
B 2 5   PRO 5   5   5   PRO PRO B . n 
B 2 6   ALA 6   6   6   ALA ALA B . n 
B 2 7   SER 7   7   7   SER SER B . n 
B 2 8   PRO 8   8   8   PRO PRO B . n 
B 2 9   SER 9   9   9   SER SER B . n 
B 2 10  ASN 10  10  10  ASN ASN B . n 
B 2 11  LEU 11  11  11  LEU LEU B . n 
B 2 12  SER 12  12  12  SER SER B . n 
B 2 13  CYS 13  13  13  CYS CYS B . n 
B 2 14  LEU 14  14  14  LEU LEU B . n 
B 2 15  MET 15  15  15  MET MET B . n 
B 2 16  HIS 16  16  16  HIS HIS B . n 
B 2 17  LEU 17  17  17  LEU LEU B . n 
B 2 18  THR 18  18  18  THR THR B . n 
B 2 19  THR 19  19  19  THR THR B . n 
B 2 20  ASN 20  20  20  ASN ASN B . n 
B 2 21  SER 21  21  21  SER SER B . n 
B 2 22  LEU 22  22  22  LEU LEU B . n 
B 2 23  VAL 23  23  23  VAL VAL B . n 
B 2 24  CYS 24  24  24  CYS CYS B . n 
B 2 25  GLN 25  25  25  GLN GLN B . n 
B 2 26  TRP 26  26  26  TRP TRP B . n 
B 2 27  GLU 27  27  27  GLU GLU B . n 
B 2 28  PRO 28  28  28  PRO PRO B . n 
B 2 29  GLY 29  29  29  GLY GLY B . n 
B 2 30  PRO 30  30  30  PRO PRO B . n 
B 2 31  GLU 31  31  31  GLU GLU B . n 
B 2 32  THR 32  32  32  THR THR B . n 
B 2 33  HIS 33  33  33  HIS HIS B . n 
B 2 34  LEU 34  34  34  LEU LEU B . n 
B 2 35  PRO 35  35  35  PRO PRO B . n 
B 2 36  THR 36  36  36  THR THR B . n 
B 2 37  SER 37  37  37  SER SER B . n 
B 2 38  PHE 38  38  38  PHE PHE B . n 
B 2 39  ILE 39  39  39  ILE ILE B . n 
B 2 40  LEU 40  40  40  LEU LEU B . n 
B 2 41  LYS 41  41  41  LYS LYS B . n 
B 2 42  SER 42  42  42  SER SER B . n 
B 2 43  PHE 43  43  43  PHE PHE B . n 
B 2 44  ARG 44  44  44  ARG ARG B . n 
B 2 45  SER 45  45  45  SER SER B . n 
B 2 46  ARG 46  46  46  ARG ARG B . n 
B 2 47  ALA 47  47  47  ALA ALA B . n 
B 2 48  ASP 48  48  48  ASP ASP B . n 
B 2 49  CYS 49  49  49  CYS CYS B . n 
B 2 50  GLN 50  50  50  GLN GLN B . n 
B 2 51  TYR 51  51  51  TYR TYR B . n 
B 2 52  GLN 52  52  52  GLN GLN B . n 
B 2 53  GLY 53  53  53  GLY GLY B . n 
B 2 54  ASP 54  54  54  ASP ASP B . n 
B 2 55  THR 55  55  55  THR THR B . n 
B 2 56  ILE 56  56  56  ILE ILE B . n 
B 2 57  PRO 57  57  57  PRO PRO B . n 
B 2 58  ASP 58  58  58  ASP ASP B . n 
B 2 59  CYS 59  59  59  CYS CYS B . n 
B 2 60  VAL 60  60  60  VAL VAL B . n 
B 2 61  ALA 61  61  61  ALA ALA B . n 
B 2 62  LYS 62  62  62  LYS LYS B . n 
B 2 63  LYS 63  63  63  LYS LYS B . n 
B 2 64  ARG 64  64  64  ARG ARG B . n 
B 2 65  GLN 65  65  65  GLN GLN B . n 
B 2 66  ASN 66  66  66  ASN ASN B . n 
B 2 67  ASN 67  67  67  ASN ASN B . n 
B 2 68  CYS 68  68  68  CYS CYS B . n 
B 2 69  SER 69  69  69  SER SER B . n 
B 2 70  ILE 70  70  70  ILE ILE B . n 
B 2 71  PRO 71  71  71  PRO PRO B . n 
B 2 72  ARG 72  72  72  ARG ARG B . n 
B 2 73  LYS 73  73  73  LYS LYS B . n 
B 2 74  ASN 74  74  74  ASN ASN B . n 
B 2 75  LEU 75  75  75  LEU LEU B . n 
B 2 76  LEU 76  76  76  LEU LEU B . n 
B 2 77  LEU 77  77  77  LEU LEU B . n 
B 2 78  TYR 78  78  78  TYR TYR B . n 
B 2 79  GLN 79  79  79  GLN GLN B . n 
B 2 80  TYR 80  80  80  TYR TYR B . n 
B 2 81  MET 81  81  81  MET MET B . n 
B 2 82  ALA 82  82  82  ALA ALA B . n 
B 2 83  ILE 83  83  83  ILE ILE B . n 
B 2 84  TRP 84  84  84  TRP TRP B . n 
B 2 85  VAL 85  85  85  VAL VAL B . n 
B 2 86  GLN 86  86  86  GLN GLN B . n 
B 2 87  ALA 87  87  87  ALA ALA B . n 
B 2 88  GLU 88  88  88  GLU GLU B . n 
B 2 89  ASN 89  89  89  ASN ASN B . n 
B 2 90  MET 90  90  90  MET MET B . n 
B 2 91  LEU 91  91  91  LEU LEU B . n 
B 2 92  GLY 92  92  92  GLY GLY B . n 
B 2 93  SER 93  93  93  SER SER B . n 
B 2 94  SER 94  94  94  SER SER B . n 
B 2 95  GLU 95  95  95  GLU GLU B . n 
B 2 96  SER 96  96  96  SER SER B . n 
B 2 97  PRO 97  97  97  PRO PRO B . n 
B 2 98  LYS 98  98  98  LYS LYS B . n 
B 2 99  LEU 99  99  99  LEU LEU B . n 
B 2 100 CYS 100 100 100 CYS CYS B . n 
B 2 101 LEU 101 101 101 LEU LEU B . n 
B 2 102 ASP 102 102 102 ASP ASP B . n 
B 2 103 PRO 103 103 103 PRO PRO B . n 
B 2 104 MET 104 104 104 MET MET B . n 
B 2 105 ASP 105 105 105 ASP ASP B . n 
B 2 106 VAL 106 106 106 VAL VAL B . n 
B 2 107 VAL 107 107 107 VAL VAL B . n 
B 2 108 LYS 108 108 108 LYS LYS B . n 
B 2 109 LEU 109 109 109 LEU LEU B . n 
B 2 110 GLU 110 110 110 GLU GLU B . n 
B 2 111 PRO 111 111 111 PRO PRO B . n 
B 2 112 PRO 112 112 112 PRO PRO B . n 
B 2 113 MET 113 113 113 MET MET B . n 
B 2 114 LEU 114 114 114 LEU LEU B . n 
B 2 115 GLN 115 115 115 GLN GLN B . n 
B 2 116 ALA 116 116 116 ALA ALA B . n 
B 2 117 LEU 117 117 117 LEU LEU B . n 
B 2 118 ASP 118 118 118 ASP ASP B . n 
B 2 119 ILE 119 119 119 ILE ILE B . n 
B 2 120 GLY 120 120 ?   ?   ?   B . n 
B 2 121 PRO 121 121 ?   ?   ?   B . n 
B 2 122 ASP 122 122 ?   ?   ?   B . n 
B 2 123 VAL 123 123 ?   ?   ?   B . n 
B 2 124 VAL 124 124 ?   ?   ?   B . n 
B 2 125 SER 125 125 ?   ?   ?   B . n 
B 2 126 HIS 126 126 ?   ?   ?   B . n 
B 2 127 GLN 127 127 127 GLN GLN B . n 
B 2 128 PRO 128 128 128 PRO PRO B . n 
B 2 129 GLY 129 129 129 GLY GLY B . n 
B 2 130 CYS 130 130 130 CYS CYS B . n 
B 2 131 LEU 131 131 131 LEU LEU B . n 
B 2 132 TRP 132 132 132 TRP TRP B . n 
B 2 133 LEU 133 133 133 LEU LEU B . n 
B 2 134 SER 134 134 134 SER SER B . n 
B 2 135 TRP 135 135 135 TRP TRP B . n 
B 2 136 LYS 136 136 136 LYS LYS B . n 
B 2 137 PRO 137 137 137 PRO PRO B . n 
B 2 138 TRP 138 138 138 TRP TRP B . n 
B 2 139 LYS 139 139 139 LYS LYS B . n 
B 2 140 PRO 140 140 140 PRO PRO B . n 
B 2 141 SER 141 141 141 SER SER B . n 
B 2 142 GLU 142 142 142 GLU GLU B . n 
B 2 143 TYR 143 143 143 TYR TYR B . n 
B 2 144 MET 144 144 144 MET MET B . n 
B 2 145 GLU 145 145 145 GLU GLU B . n 
B 2 146 GLN 146 146 146 GLN GLN B . n 
B 2 147 GLU 147 147 147 GLU GLU B . n 
B 2 148 CYS 148 148 148 CYS CYS B . n 
B 2 149 GLU 149 149 149 GLU GLU B . n 
B 2 150 LEU 150 150 150 LEU LEU B . n 
B 2 151 ARG 151 151 151 ARG ARG B . n 
B 2 152 TYR 152 152 152 TYR TYR B . n 
B 2 153 GLN 153 153 153 GLN GLN B . n 
B 2 154 PRO 154 154 154 PRO PRO B . n 
B 2 155 GLN 155 155 155 GLN GLN B . n 
B 2 156 LEU 156 156 156 LEU LEU B . n 
B 2 157 LYS 157 157 157 LYS LYS B . n 
B 2 158 GLY 158 158 158 GLY GLY B . n 
B 2 159 ALA 159 159 159 ALA ALA B . n 
B 2 160 ASN 160 160 160 ASN ASN B . n 
B 2 161 TRP 161 161 161 TRP TRP B . n 
B 2 162 THR 162 162 162 THR THR B . n 
B 2 163 LEU 163 163 163 LEU LEU B . n 
B 2 164 VAL 164 164 164 VAL VAL B . n 
B 2 165 PHE 165 165 165 PHE PHE B . n 
B 2 166 HIS 166 166 166 HIS HIS B . n 
B 2 167 LEU 167 167 167 LEU LEU B . n 
B 2 168 PRO 168 168 168 PRO PRO B . n 
B 2 169 SER 169 169 169 SER SER B . n 
B 2 170 SER 170 170 170 SER SER B . n 
B 2 171 LYS 171 171 171 LYS LYS B . n 
B 2 172 ASP 172 172 172 ASP ASP B . n 
B 2 173 GLN 173 173 173 GLN GLN B . n 
B 2 174 PHE 174 174 174 PHE PHE B . n 
B 2 175 GLU 175 175 175 GLU GLU B . n 
B 2 176 LEU 176 176 176 LEU LEU B . n 
B 2 177 CYS 177 177 177 CYS CYS B . n 
B 2 178 GLY 178 178 178 GLY GLY B . n 
B 2 179 LEU 179 179 179 LEU LEU B . n 
B 2 180 HIS 180 180 180 HIS HIS B . n 
B 2 181 GLN 181 181 181 GLN GLN B . n 
B 2 182 ALA 182 182 182 ALA ALA B . n 
B 2 183 PRO 183 183 183 PRO PRO B . n 
B 2 184 VAL 184 184 184 VAL VAL B . n 
B 2 185 TYR 185 185 185 TYR TYR B . n 
B 2 186 THR 186 186 186 THR THR B . n 
B 2 187 LEU 187 187 187 LEU LEU B . n 
B 2 188 GLN 188 188 188 GLN GLN B . n 
B 2 189 MET 189 189 189 MET MET B . n 
B 2 190 ARG 190 190 190 ARG ARG B . n 
B 2 191 CYS 191 191 191 CYS CYS B . n 
B 2 192 ILE 192 192 192 ILE ILE B . n 
B 2 193 ARG 193 193 193 ARG ARG B . n 
B 2 194 SER 194 194 194 SER SER B . n 
B 2 195 SER 195 195 195 SER SER B . n 
B 2 196 LEU 196 196 196 LEU LEU B . n 
B 2 197 PRO 197 197 197 PRO PRO B . n 
B 2 198 GLY 198 198 198 GLY GLY B . n 
B 2 199 PHE 199 199 199 PHE PHE B . n 
B 2 200 TRP 200 200 200 TRP TRP B . n 
B 2 201 SER 201 201 201 SER SER B . n 
B 2 202 PRO 202 202 202 PRO PRO B . n 
B 2 203 TRP 203 203 203 TRP TRP B . n 
B 2 204 SER 204 204 204 SER SER B . n 
B 2 205 PRO 205 205 205 PRO PRO B . n 
B 2 206 GLY 206 206 206 GLY GLY B . n 
B 2 207 LEU 207 207 207 LEU LEU B . n 
B 2 208 GLN 208 208 208 GLN GLN B . n 
B 2 209 LEU 209 209 209 LEU LEU B . n 
B 2 210 ARG 210 210 210 ARG ARG B . n 
B 2 211 PRO 211 211 211 PRO PRO B . n 
B 2 212 THR 212 212 212 THR THR B . n 
B 2 213 MET 213 213 213 MET MET B . n 
B 2 214 LYS 214 214 ?   ?   ?   B . n 
B 2 215 ALA 215 215 ?   ?   ?   B . n 
C 1 1   MET 1   1   ?   ?   ?   C . n 
C 1 2   THR 2   2   ?   ?   ?   C . n 
C 1 3   PRO 3   3   ?   ?   ?   C . n 
C 1 4   LEU 4   4   ?   ?   ?   C . n 
C 1 5   GLY 5   5   ?   ?   ?   C . n 
C 1 6   PRO 6   6   ?   ?   ?   C . n 
C 1 7   ALA 7   7   7   ALA ALA C . n 
C 1 8   SER 8   8   8   SER SER C . n 
C 1 9   SER 9   9   9   SER SER C . n 
C 1 10  LEU 10  10  10  LEU LEU C . n 
C 1 11  PRO 11  11  11  PRO PRO C . n 
C 1 12  GLN 12  12  12  GLN GLN C . n 
C 1 13  SER 13  13  13  SER SER C . n 
C 1 14  PHE 14  14  14  PHE PHE C . n 
C 1 15  LEU 15  15  15  LEU LEU C . n 
C 1 16  LEU 16  16  16  LEU LEU C . n 
C 1 17  LYS 17  17  17  LYS LYS C . n 
C 1 18  CYS 18  18  18  CYS CYS C . n 
C 1 19  LEU 19  19  19  LEU LEU C . n 
C 1 20  GLU 20  20  20  GLU GLU C . n 
C 1 21  GLN 21  21  21  GLN GLN C . n 
C 1 22  VAL 22  22  22  VAL VAL C . n 
C 1 23  ARG 23  23  23  ARG ARG C . n 
C 1 24  LYS 24  24  24  LYS LYS C . n 
C 1 25  ILE 25  25  25  ILE ILE C . n 
C 1 26  GLN 26  26  26  GLN GLN C . n 
C 1 27  GLY 27  27  27  GLY GLY C . n 
C 1 28  ASP 28  28  28  ASP ASP C . n 
C 1 29  GLY 29  29  29  GLY GLY C . n 
C 1 30  ALA 30  30  30  ALA ALA C . n 
C 1 31  ALA 31  31  31  ALA ALA C . n 
C 1 32  LEU 32  32  32  LEU LEU C . n 
C 1 33  GLN 33  33  33  GLN GLN C . n 
C 1 34  GLU 34  34  34  GLU GLU C . n 
C 1 35  LYS 35  35  35  LYS LYS C . n 
C 1 36  LEU 36  36  36  LEU LEU C . n 
C 1 37  CYS 37  37  37  CYS CYS C . n 
C 1 38  ALA 38  38  38  ALA ALA C . n 
C 1 39  THR 39  39  39  THR THR C . n 
C 1 40  TYR 40  40  40  TYR TYR C . n 
C 1 41  LYS 41  41  41  LYS LYS C . n 
C 1 42  LEU 42  42  42  LEU LEU C . n 
C 1 43  CYS 43  43  43  CYS CYS C . n 
C 1 44  HIS 44  44  44  HIS HIS C . n 
C 1 45  PRO 45  45  45  PRO PRO C . n 
C 1 46  GLU 46  46  46  GLU GLU C . n 
C 1 47  GLU 47  47  47  GLU GLU C . n 
C 1 48  LEU 48  48  48  LEU LEU C . n 
C 1 49  VAL 49  49  49  VAL VAL C . n 
C 1 50  LEU 50  50  50  LEU LEU C . n 
C 1 51  LEU 51  51  51  LEU LEU C . n 
C 1 52  GLY 52  52  52  GLY GLY C . n 
C 1 53  HIS 53  53  53  HIS HIS C . n 
C 1 54  SER 54  54  54  SER SER C . n 
C 1 55  LEU 55  55  55  LEU LEU C . n 
C 1 56  GLY 56  56  56  GLY GLY C . n 
C 1 57  ILE 57  57  57  ILE ILE C . n 
C 1 58  PRO 58  58  58  PRO PRO C . n 
C 1 59  TRP 59  59  59  TRP TRP C . n 
C 1 60  ALA 60  60  60  ALA ALA C . n 
C 1 61  PRO 61  61  61  PRO PRO C . n 
C 1 62  LEU 62  62  62  LEU LEU C . n 
C 1 63  SER 63  63  63  SER SER C . n 
C 1 64  SER 64  64  64  SER SER C . n 
C 1 65  CYS 65  65  65  CYS CYS C . n 
C 1 66  PRO 66  66  66  PRO PRO C . n 
C 1 67  SER 67  67  67  SER SER C . n 
C 1 68  GLN 68  68  68  GLN GLN C . n 
C 1 69  ALA 69  69  69  ALA ALA C . n 
C 1 70  LEU 70  70  70  LEU LEU C . n 
C 1 71  GLN 71  71  71  GLN GLN C . n 
C 1 72  LEU 72  72  72  LEU LEU C . n 
C 1 73  ALA 73  73  73  ALA ALA C . n 
C 1 74  GLY 74  74  74  GLY GLY C . n 
C 1 75  CYS 75  75  75  CYS CYS C . n 
C 1 76  LEU 76  76  76  LEU LEU C . n 
C 1 77  SER 77  77  77  SER SER C . n 
C 1 78  GLN 78  78  78  GLN GLN C . n 
C 1 79  LEU 79  79  79  LEU LEU C . n 
C 1 80  HIS 80  80  80  HIS HIS C . n 
C 1 81  SER 81  81  81  SER SER C . n 
C 1 82  GLY 82  82  82  GLY GLY C . n 
C 1 83  LEU 83  83  83  LEU LEU C . n 
C 1 84  PHE 84  84  84  PHE PHE C . n 
C 1 85  LEU 85  85  85  LEU LEU C . n 
C 1 86  TYR 86  86  86  TYR TYR C . n 
C 1 87  GLN 87  87  87  GLN GLN C . n 
C 1 88  GLY 88  88  88  GLY GLY C . n 
C 1 89  LEU 89  89  89  LEU LEU C . n 
C 1 90  LEU 90  90  90  LEU LEU C . n 
C 1 91  GLN 91  91  91  GLN GLN C . n 
C 1 92  ALA 92  92  92  ALA ALA C . n 
C 1 93  LEU 93  93  93  LEU LEU C . n 
C 1 94  GLU 94  94  94  GLU GLU C . n 
C 1 95  GLY 95  95  95  GLY GLY C . n 
C 1 96  ILE 96  96  96  ILE ILE C . n 
C 1 97  SER 97  97  97  SER SER C . n 
C 1 98  PRO 98  98  98  PRO PRO C . n 
C 1 99  GLU 99  99  99  GLU GLU C . n 
C 1 100 LEU 100 100 100 LEU LEU C . n 
C 1 101 GLY 101 101 101 GLY GLY C . n 
C 1 102 PRO 102 102 102 PRO PRO C . n 
C 1 103 THR 103 103 103 THR THR C . n 
C 1 104 LEU 104 104 104 LEU LEU C . n 
C 1 105 ASP 105 105 105 ASP ASP C . n 
C 1 106 THR 106 106 106 THR THR C . n 
C 1 107 LEU 107 107 107 LEU LEU C . n 
C 1 108 GLN 108 108 108 GLN GLN C . n 
C 1 109 LEU 109 109 109 LEU LEU C . n 
C 1 110 ASP 110 110 110 ASP ASP C . n 
C 1 111 VAL 111 111 111 VAL VAL C . n 
C 1 112 ALA 112 112 112 ALA ALA C . n 
C 1 113 ASP 113 113 113 ASP ASP C . n 
C 1 114 PHE 114 114 114 PHE PHE C . n 
C 1 115 ALA 115 115 115 ALA ALA C . n 
C 1 116 THR 116 116 116 THR THR C . n 
C 1 117 THR 117 117 117 THR THR C . n 
C 1 118 ILE 118 118 118 ILE ILE C . n 
C 1 119 TRP 119 119 119 TRP TRP C . n 
C 1 120 GLN 120 120 120 GLN GLN C . n 
C 1 121 GLN 121 121 121 GLN GLN C . n 
C 1 122 MET 122 122 122 MET MET C . n 
C 1 123 GLU 123 123 123 GLU GLU C . n 
C 1 124 GLU 124 124 124 GLU GLU C . n 
C 1 125 LEU 125 125 125 LEU LEU C . n 
C 1 126 GLY 126 126 126 GLY GLY C . n 
C 1 127 MET 127 127 127 MET MET C . n 
C 1 128 ALA 128 128 128 ALA ALA C . n 
C 1 129 PRO 129 129 129 PRO PRO C . n 
C 1 130 ALA 130 130 130 ALA ALA C . n 
C 1 131 LEU 131 131 131 LEU LEU C . n 
C 1 132 GLN 132 132 132 GLN GLN C . n 
C 1 133 PRO 133 133 133 PRO PRO C . n 
C 1 134 THR 134 134 134 THR THR C . n 
C 1 135 GLN 135 135 135 GLN GLN C . n 
C 1 136 GLY 136 136 136 GLY GLY C . n 
C 1 137 ALA 137 137 137 ALA ALA C . n 
C 1 138 MET 138 138 138 MET MET C . n 
C 1 139 PRO 139 139 139 PRO PRO C . n 
C 1 140 ALA 140 140 140 ALA ALA C . n 
C 1 141 PHE 141 141 141 PHE PHE C . n 
C 1 142 ALA 142 142 142 ALA ALA C . n 
C 1 143 SER 143 143 143 SER SER C . n 
C 1 144 ALA 144 144 144 ALA ALA C . n 
C 1 145 PHE 145 145 145 PHE PHE C . n 
C 1 146 GLN 146 146 146 GLN GLN C . n 
C 1 147 ARG 147 147 147 ARG ARG C . n 
C 1 148 ARG 148 148 148 ARG ARG C . n 
C 1 149 ALA 149 149 149 ALA ALA C . n 
C 1 150 GLY 150 150 150 GLY GLY C . n 
C 1 151 GLY 151 151 151 GLY GLY C . n 
C 1 152 VAL 152 152 152 VAL VAL C . n 
C 1 153 LEU 153 153 153 LEU LEU C . n 
C 1 154 VAL 154 154 154 VAL VAL C . n 
C 1 155 ALA 155 155 155 ALA ALA C . n 
C 1 156 SER 156 156 156 SER SER C . n 
C 1 157 HIS 157 157 157 HIS HIS C . n 
C 1 158 LEU 158 158 158 LEU LEU C . n 
C 1 159 GLN 159 159 159 GLN GLN C . n 
C 1 160 SER 160 160 160 SER SER C . n 
C 1 161 PHE 161 161 161 PHE PHE C . n 
C 1 162 LEU 162 162 162 LEU LEU C . n 
C 1 163 GLU 163 163 163 GLU GLU C . n 
C 1 164 VAL 164 164 164 VAL VAL C . n 
C 1 165 SER 165 165 165 SER SER C . n 
C 1 166 TYR 166 166 166 TYR TYR C . n 
C 1 167 ARG 167 167 167 ARG ARG C . n 
C 1 168 VAL 168 168 168 VAL VAL C . n 
C 1 169 LEU 169 169 169 LEU LEU C . n 
C 1 170 ARG 170 170 170 ARG ARG C . n 
C 1 171 HIS 171 171 171 HIS HIS C . n 
C 1 172 LEU 172 172 172 LEU LEU C . n 
C 1 173 ALA 173 173 173 ALA ALA C . n 
C 1 174 GLN 174 174 174 GLN GLN C . n 
C 1 175 PRO 175 175 175 PRO PRO C . n 
D 2 1   ALA 1   1   ?   ?   ?   D . n 
D 2 2   GLY 2   2   2   GLY GLY D . n 
D 2 3   TYR 3   3   3   TYR TYR D . n 
D 2 4   PRO 4   4   4   PRO PRO D . n 
D 2 5   PRO 5   5   5   PRO PRO D . n 
D 2 6   ALA 6   6   6   ALA ALA D . n 
D 2 7   SER 7   7   7   SER SER D . n 
D 2 8   PRO 8   8   8   PRO PRO D . n 
D 2 9   SER 9   9   9   SER SER D . n 
D 2 10  ASN 10  10  10  ASN ASN D . n 
D 2 11  LEU 11  11  11  LEU LEU D . n 
D 2 12  SER 12  12  12  SER SER D . n 
D 2 13  CYS 13  13  13  CYS CYS D . n 
D 2 14  LEU 14  14  14  LEU LEU D . n 
D 2 15  MET 15  15  15  MET MET D . n 
D 2 16  HIS 16  16  16  HIS HIS D . n 
D 2 17  LEU 17  17  17  LEU LEU D . n 
D 2 18  THR 18  18  18  THR THR D . n 
D 2 19  THR 19  19  19  THR THR D . n 
D 2 20  ASN 20  20  20  ASN ASN D . n 
D 2 21  SER 21  21  21  SER SER D . n 
D 2 22  LEU 22  22  22  LEU LEU D . n 
D 2 23  VAL 23  23  23  VAL VAL D . n 
D 2 24  CYS 24  24  24  CYS CYS D . n 
D 2 25  GLN 25  25  25  GLN GLN D . n 
D 2 26  TRP 26  26  26  TRP TRP D . n 
D 2 27  GLU 27  27  27  GLU GLU D . n 
D 2 28  PRO 28  28  28  PRO PRO D . n 
D 2 29  GLY 29  29  29  GLY GLY D . n 
D 2 30  PRO 30  30  30  PRO PRO D . n 
D 2 31  GLU 31  31  31  GLU GLU D . n 
D 2 32  THR 32  32  32  THR THR D . n 
D 2 33  HIS 33  33  33  HIS HIS D . n 
D 2 34  LEU 34  34  34  LEU LEU D . n 
D 2 35  PRO 35  35  35  PRO PRO D . n 
D 2 36  THR 36  36  36  THR THR D . n 
D 2 37  SER 37  37  37  SER SER D . n 
D 2 38  PHE 38  38  38  PHE PHE D . n 
D 2 39  ILE 39  39  39  ILE ILE D . n 
D 2 40  LEU 40  40  40  LEU LEU D . n 
D 2 41  LYS 41  41  41  LYS LYS D . n 
D 2 42  SER 42  42  42  SER SER D . n 
D 2 43  PHE 43  43  43  PHE PHE D . n 
D 2 44  ARG 44  44  44  ARG ARG D . n 
D 2 45  SER 45  45  45  SER SER D . n 
D 2 46  ARG 46  46  46  ARG ARG D . n 
D 2 47  ALA 47  47  47  ALA ALA D . n 
D 2 48  ASP 48  48  48  ASP ASP D . n 
D 2 49  CYS 49  49  49  CYS CYS D . n 
D 2 50  GLN 50  50  50  GLN GLN D . n 
D 2 51  TYR 51  51  51  TYR TYR D . n 
D 2 52  GLN 52  52  52  GLN GLN D . n 
D 2 53  GLY 53  53  53  GLY GLY D . n 
D 2 54  ASP 54  54  54  ASP ASP D . n 
D 2 55  THR 55  55  55  THR THR D . n 
D 2 56  ILE 56  56  56  ILE ILE D . n 
D 2 57  PRO 57  57  57  PRO PRO D . n 
D 2 58  ASP 58  58  58  ASP ASP D . n 
D 2 59  CYS 59  59  59  CYS CYS D . n 
D 2 60  VAL 60  60  60  VAL VAL D . n 
D 2 61  ALA 61  61  61  ALA ALA D . n 
D 2 62  LYS 62  62  62  LYS LYS D . n 
D 2 63  LYS 63  63  63  LYS LYS D . n 
D 2 64  ARG 64  64  64  ARG ARG D . n 
D 2 65  GLN 65  65  65  GLN GLN D . n 
D 2 66  ASN 66  66  66  ASN ASN D . n 
D 2 67  ASN 67  67  67  ASN ASN D . n 
D 2 68  CYS 68  68  68  CYS CYS D . n 
D 2 69  SER 69  69  69  SER SER D . n 
D 2 70  ILE 70  70  70  ILE ILE D . n 
D 2 71  PRO 71  71  71  PRO PRO D . n 
D 2 72  ARG 72  72  72  ARG ARG D . n 
D 2 73  LYS 73  73  73  LYS LYS D . n 
D 2 74  ASN 74  74  74  ASN ASN D . n 
D 2 75  LEU 75  75  75  LEU LEU D . n 
D 2 76  LEU 76  76  76  LEU LEU D . n 
D 2 77  LEU 77  77  77  LEU LEU D . n 
D 2 78  TYR 78  78  78  TYR TYR D . n 
D 2 79  GLN 79  79  79  GLN GLN D . n 
D 2 80  TYR 80  80  80  TYR TYR D . n 
D 2 81  MET 81  81  81  MET MET D . n 
D 2 82  ALA 82  82  82  ALA ALA D . n 
D 2 83  ILE 83  83  83  ILE ILE D . n 
D 2 84  TRP 84  84  84  TRP TRP D . n 
D 2 85  VAL 85  85  85  VAL VAL D . n 
D 2 86  GLN 86  86  86  GLN GLN D . n 
D 2 87  ALA 87  87  87  ALA ALA D . n 
D 2 88  GLU 88  88  88  GLU GLU D . n 
D 2 89  ASN 89  89  89  ASN ASN D . n 
D 2 90  MET 90  90  90  MET MET D . n 
D 2 91  LEU 91  91  91  LEU LEU D . n 
D 2 92  GLY 92  92  92  GLY GLY D . n 
D 2 93  SER 93  93  93  SER SER D . n 
D 2 94  SER 94  94  94  SER SER D . n 
D 2 95  GLU 95  95  95  GLU GLU D . n 
D 2 96  SER 96  96  96  SER SER D . n 
D 2 97  PRO 97  97  97  PRO PRO D . n 
D 2 98  LYS 98  98  98  LYS LYS D . n 
D 2 99  LEU 99  99  99  LEU LEU D . n 
D 2 100 CYS 100 100 100 CYS CYS D . n 
D 2 101 LEU 101 101 101 LEU LEU D . n 
D 2 102 ASP 102 102 102 ASP ASP D . n 
D 2 103 PRO 103 103 103 PRO PRO D . n 
D 2 104 MET 104 104 104 MET MET D . n 
D 2 105 ASP 105 105 105 ASP ASP D . n 
D 2 106 VAL 106 106 106 VAL VAL D . n 
D 2 107 VAL 107 107 107 VAL VAL D . n 
D 2 108 LYS 108 108 108 LYS LYS D . n 
D 2 109 LEU 109 109 109 LEU LEU D . n 
D 2 110 GLU 110 110 110 GLU GLU D . n 
D 2 111 PRO 111 111 111 PRO PRO D . n 
D 2 112 PRO 112 112 112 PRO PRO D . n 
D 2 113 MET 113 113 113 MET MET D . n 
D 2 114 LEU 114 114 114 LEU LEU D . n 
D 2 115 GLN 115 115 115 GLN GLN D . n 
D 2 116 ALA 116 116 116 ALA ALA D . n 
D 2 117 LEU 117 117 117 LEU LEU D . n 
D 2 118 ASP 118 118 118 ASP ASP D . n 
D 2 119 ILE 119 119 ?   ?   ?   D . n 
D 2 120 GLY 120 120 ?   ?   ?   D . n 
D 2 121 PRO 121 121 ?   ?   ?   D . n 
D 2 122 ASP 122 122 ?   ?   ?   D . n 
D 2 123 VAL 123 123 ?   ?   ?   D . n 
D 2 124 VAL 124 124 ?   ?   ?   D . n 
D 2 125 SER 125 125 ?   ?   ?   D . n 
D 2 126 HIS 126 126 ?   ?   ?   D . n 
D 2 127 GLN 127 127 127 GLN GLN D . n 
D 2 128 PRO 128 128 128 PRO PRO D . n 
D 2 129 GLY 129 129 129 GLY GLY D . n 
D 2 130 CYS 130 130 130 CYS CYS D . n 
D 2 131 LEU 131 131 131 LEU LEU D . n 
D 2 132 TRP 132 132 132 TRP TRP D . n 
D 2 133 LEU 133 133 133 LEU LEU D . n 
D 2 134 SER 134 134 134 SER SER D . n 
D 2 135 TRP 135 135 135 TRP TRP D . n 
D 2 136 LYS 136 136 136 LYS LYS D . n 
D 2 137 PRO 137 137 137 PRO PRO D . n 
D 2 138 TRP 138 138 138 TRP TRP D . n 
D 2 139 LYS 139 139 139 LYS LYS D . n 
D 2 140 PRO 140 140 140 PRO PRO D . n 
D 2 141 SER 141 141 141 SER SER D . n 
D 2 142 GLU 142 142 142 GLU GLU D . n 
D 2 143 TYR 143 143 143 TYR TYR D . n 
D 2 144 MET 144 144 144 MET MET D . n 
D 2 145 GLU 145 145 145 GLU GLU D . n 
D 2 146 GLN 146 146 146 GLN GLN D . n 
D 2 147 GLU 147 147 147 GLU GLU D . n 
D 2 148 CYS 148 148 148 CYS CYS D . n 
D 2 149 GLU 149 149 149 GLU GLU D . n 
D 2 150 LEU 150 150 150 LEU LEU D . n 
D 2 151 ARG 151 151 151 ARG ARG D . n 
D 2 152 TYR 152 152 152 TYR TYR D . n 
D 2 153 GLN 153 153 153 GLN GLN D . n 
D 2 154 PRO 154 154 154 PRO PRO D . n 
D 2 155 GLN 155 155 155 GLN GLN D . n 
D 2 156 LEU 156 156 156 LEU LEU D . n 
D 2 157 LYS 157 157 157 LYS LYS D . n 
D 2 158 GLY 158 158 158 GLY GLY D . n 
D 2 159 ALA 159 159 159 ALA ALA D . n 
D 2 160 ASN 160 160 160 ASN ASN D . n 
D 2 161 TRP 161 161 161 TRP TRP D . n 
D 2 162 THR 162 162 162 THR THR D . n 
D 2 163 LEU 163 163 163 LEU LEU D . n 
D 2 164 VAL 164 164 164 VAL VAL D . n 
D 2 165 PHE 165 165 165 PHE PHE D . n 
D 2 166 HIS 166 166 166 HIS HIS D . n 
D 2 167 LEU 167 167 167 LEU LEU D . n 
D 2 168 PRO 168 168 168 PRO PRO D . n 
D 2 169 SER 169 169 169 SER SER D . n 
D 2 170 SER 170 170 170 SER SER D . n 
D 2 171 LYS 171 171 171 LYS LYS D . n 
D 2 172 ASP 172 172 172 ASP ASP D . n 
D 2 173 GLN 173 173 173 GLN GLN D . n 
D 2 174 PHE 174 174 174 PHE PHE D . n 
D 2 175 GLU 175 175 175 GLU GLU D . n 
D 2 176 LEU 176 176 176 LEU LEU D . n 
D 2 177 CYS 177 177 177 CYS CYS D . n 
D 2 178 GLY 178 178 178 GLY GLY D . n 
D 2 179 LEU 179 179 179 LEU LEU D . n 
D 2 180 HIS 180 180 180 HIS HIS D . n 
D 2 181 GLN 181 181 181 GLN GLN D . n 
D 2 182 ALA 182 182 182 ALA ALA D . n 
D 2 183 PRO 183 183 183 PRO PRO D . n 
D 2 184 VAL 184 184 184 VAL VAL D . n 
D 2 185 TYR 185 185 185 TYR TYR D . n 
D 2 186 THR 186 186 186 THR THR D . n 
D 2 187 LEU 187 187 187 LEU LEU D . n 
D 2 188 GLN 188 188 188 GLN GLN D . n 
D 2 189 MET 189 189 189 MET MET D . n 
D 2 190 ARG 190 190 190 ARG ARG D . n 
D 2 191 CYS 191 191 191 CYS CYS D . n 
D 2 192 ILE 192 192 192 ILE ILE D . n 
D 2 193 ARG 193 193 193 ARG ARG D . n 
D 2 194 SER 194 194 194 SER SER D . n 
D 2 195 SER 195 195 195 SER SER D . n 
D 2 196 LEU 196 196 196 LEU LEU D . n 
D 2 197 PRO 197 197 197 PRO PRO D . n 
D 2 198 GLY 198 198 198 GLY GLY D . n 
D 2 199 PHE 199 199 199 PHE PHE D . n 
D 2 200 TRP 200 200 200 TRP TRP D . n 
D 2 201 SER 201 201 201 SER SER D . n 
D 2 202 PRO 202 202 202 PRO PRO D . n 
D 2 203 TRP 203 203 203 TRP TRP D . n 
D 2 204 SER 204 204 204 SER SER D . n 
D 2 205 PRO 205 205 205 PRO PRO D . n 
D 2 206 GLY 206 206 206 GLY GLY D . n 
D 2 207 LEU 207 207 207 LEU LEU D . n 
D 2 208 GLN 208 208 208 GLN GLN D . n 
D 2 209 LEU 209 209 209 LEU LEU D . n 
D 2 210 ARG 210 210 210 ARG ARG D . n 
D 2 211 PRO 211 211 211 PRO PRO D . n 
D 2 212 THR 212 212 212 THR THR D . n 
D 2 213 MET 213 213 213 MET MET D . n 
D 2 214 LYS 214 214 ?   ?   ?   D . n 
D 2 215 ALA 215 215 ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 NAG 1   323 323 NAG NAG B . 
F 3 NAG 1   923 923 NAG NAG D . 
G 4 HOH 1   176 1   HOH HOH A . 
G 4 HOH 2   177 2   HOH HOH A . 
G 4 HOH 3   178 5   HOH HOH A . 
G 4 HOH 4   179 6   HOH HOH A . 
G 4 HOH 5   180 7   HOH HOH A . 
G 4 HOH 6   181 9   HOH HOH A . 
G 4 HOH 7   182 10  HOH HOH A . 
G 4 HOH 8   183 11  HOH HOH A . 
G 4 HOH 9   184 12  HOH HOH A . 
G 4 HOH 10  185 13  HOH HOH A . 
G 4 HOH 11  186 14  HOH HOH A . 
G 4 HOH 12  187 15  HOH HOH A . 
G 4 HOH 13  188 16  HOH HOH A . 
G 4 HOH 14  189 38  HOH HOH A . 
G 4 HOH 15  190 70  HOH HOH A . 
G 4 HOH 16  191 78  HOH HOH A . 
G 4 HOH 17  192 93  HOH HOH A . 
G 4 HOH 18  193 95  HOH HOH A . 
G 4 HOH 19  194 101 HOH HOH A . 
G 4 HOH 20  195 103 HOH HOH A . 
G 4 HOH 21  196 104 HOH HOH A . 
G 4 HOH 22  197 105 HOH HOH A . 
G 4 HOH 23  198 109 HOH HOH A . 
G 4 HOH 24  199 113 HOH HOH A . 
G 4 HOH 25  200 117 HOH HOH A . 
G 4 HOH 26  201 144 HOH HOH A . 
G 4 HOH 27  202 147 HOH HOH A . 
G 4 HOH 28  203 151 HOH HOH A . 
G 4 HOH 29  204 156 HOH HOH A . 
G 4 HOH 30  205 163 HOH HOH A . 
G 4 HOH 31  206 170 HOH HOH A . 
G 4 HOH 32  207 171 HOH HOH A . 
G 4 HOH 33  208 176 HOH HOH A . 
G 4 HOH 34  209 178 HOH HOH A . 
G 4 HOH 35  210 179 HOH HOH A . 
G 4 HOH 36  211 182 HOH HOH A . 
G 4 HOH 37  212 183 HOH HOH A . 
G 4 HOH 38  213 212 HOH HOH A . 
G 4 HOH 39  214 223 HOH HOH A . 
G 4 HOH 40  215 224 HOH HOH A . 
G 4 HOH 41  216 228 HOH HOH A . 
G 4 HOH 42  217 229 HOH HOH A . 
G 4 HOH 43  218 239 HOH HOH A . 
G 4 HOH 44  219 247 HOH HOH A . 
G 4 HOH 45  220 251 HOH HOH A . 
G 4 HOH 46  221 258 HOH HOH A . 
H 4 HOH 1   324 8   HOH HOH B . 
H 4 HOH 2   325 18  HOH HOH B . 
H 4 HOH 3   326 19  HOH HOH B . 
H 4 HOH 4   327 20  HOH HOH B . 
H 4 HOH 5   328 21  HOH HOH B . 
H 4 HOH 6   329 22  HOH HOH B . 
H 4 HOH 7   330 23  HOH HOH B . 
H 4 HOH 8   331 24  HOH HOH B . 
H 4 HOH 9   332 25  HOH HOH B . 
H 4 HOH 10  333 27  HOH HOH B . 
H 4 HOH 11  334 30  HOH HOH B . 
H 4 HOH 12  335 31  HOH HOH B . 
H 4 HOH 13  336 33  HOH HOH B . 
H 4 HOH 14  337 35  HOH HOH B . 
H 4 HOH 15  338 39  HOH HOH B . 
H 4 HOH 16  339 40  HOH HOH B . 
H 4 HOH 17  340 43  HOH HOH B . 
H 4 HOH 18  341 47  HOH HOH B . 
H 4 HOH 19  342 49  HOH HOH B . 
H 4 HOH 20  343 50  HOH HOH B . 
H 4 HOH 21  344 51  HOH HOH B . 
H 4 HOH 22  345 53  HOH HOH B . 
H 4 HOH 23  346 54  HOH HOH B . 
H 4 HOH 24  347 55  HOH HOH B . 
H 4 HOH 25  348 56  HOH HOH B . 
H 4 HOH 26  349 57  HOH HOH B . 
H 4 HOH 27  350 58  HOH HOH B . 
H 4 HOH 28  351 61  HOH HOH B . 
H 4 HOH 29  352 62  HOH HOH B . 
H 4 HOH 30  353 63  HOH HOH B . 
H 4 HOH 31  354 65  HOH HOH B . 
H 4 HOH 32  355 66  HOH HOH B . 
H 4 HOH 33  356 68  HOH HOH B . 
H 4 HOH 34  357 71  HOH HOH B . 
H 4 HOH 35  358 73  HOH HOH B . 
H 4 HOH 36  359 76  HOH HOH B . 
H 4 HOH 37  360 77  HOH HOH B . 
H 4 HOH 38  361 84  HOH HOH B . 
H 4 HOH 39  362 85  HOH HOH B . 
H 4 HOH 40  363 87  HOH HOH B . 
H 4 HOH 41  364 88  HOH HOH B . 
H 4 HOH 42  365 89  HOH HOH B . 
H 4 HOH 43  366 92  HOH HOH B . 
H 4 HOH 44  367 96  HOH HOH B . 
H 4 HOH 45  368 97  HOH HOH B . 
H 4 HOH 46  369 106 HOH HOH B . 
H 4 HOH 47  370 107 HOH HOH B . 
H 4 HOH 48  371 108 HOH HOH B . 
H 4 HOH 49  372 111 HOH HOH B . 
H 4 HOH 50  373 112 HOH HOH B . 
H 4 HOH 51  374 115 HOH HOH B . 
H 4 HOH 52  375 116 HOH HOH B . 
H 4 HOH 53  376 118 HOH HOH B . 
H 4 HOH 54  377 122 HOH HOH B . 
H 4 HOH 55  378 123 HOH HOH B . 
H 4 HOH 56  379 125 HOH HOH B . 
H 4 HOH 57  380 128 HOH HOH B . 
H 4 HOH 58  381 130 HOH HOH B . 
H 4 HOH 59  382 131 HOH HOH B . 
H 4 HOH 60  383 133 HOH HOH B . 
H 4 HOH 61  384 134 HOH HOH B . 
H 4 HOH 62  385 135 HOH HOH B . 
H 4 HOH 63  386 139 HOH HOH B . 
H 4 HOH 64  387 142 HOH HOH B . 
H 4 HOH 65  388 148 HOH HOH B . 
H 4 HOH 66  389 149 HOH HOH B . 
H 4 HOH 67  390 150 HOH HOH B . 
H 4 HOH 68  391 157 HOH HOH B . 
H 4 HOH 69  392 158 HOH HOH B . 
H 4 HOH 70  393 160 HOH HOH B . 
H 4 HOH 71  394 165 HOH HOH B . 
H 4 HOH 72  395 172 HOH HOH B . 
H 4 HOH 73  396 173 HOH HOH B . 
H 4 HOH 74  397 175 HOH HOH B . 
H 4 HOH 75  398 177 HOH HOH B . 
H 4 HOH 76  399 180 HOH HOH B . 
H 4 HOH 77  400 185 HOH HOH B . 
H 4 HOH 78  401 187 HOH HOH B . 
H 4 HOH 79  402 188 HOH HOH B . 
H 4 HOH 80  403 189 HOH HOH B . 
H 4 HOH 81  404 191 HOH HOH B . 
H 4 HOH 82  405 192 HOH HOH B . 
H 4 HOH 83  406 193 HOH HOH B . 
H 4 HOH 84  407 194 HOH HOH B . 
H 4 HOH 85  408 196 HOH HOH B . 
H 4 HOH 86  409 197 HOH HOH B . 
H 4 HOH 87  410 202 HOH HOH B . 
H 4 HOH 88  411 203 HOH HOH B . 
H 4 HOH 89  412 204 HOH HOH B . 
H 4 HOH 90  413 205 HOH HOH B . 
H 4 HOH 91  414 207 HOH HOH B . 
H 4 HOH 92  415 211 HOH HOH B . 
H 4 HOH 93  416 216 HOH HOH B . 
H 4 HOH 94  417 217 HOH HOH B . 
H 4 HOH 95  418 218 HOH HOH B . 
H 4 HOH 96  419 219 HOH HOH B . 
H 4 HOH 97  420 220 HOH HOH B . 
H 4 HOH 98  421 225 HOH HOH B . 
H 4 HOH 99  422 227 HOH HOH B . 
H 4 HOH 100 423 232 HOH HOH B . 
H 4 HOH 101 424 236 HOH HOH B . 
H 4 HOH 102 425 240 HOH HOH B . 
H 4 HOH 103 426 242 HOH HOH B . 
H 4 HOH 104 427 246 HOH HOH B . 
H 4 HOH 105 428 249 HOH HOH B . 
H 4 HOH 106 429 254 HOH HOH B . 
H 4 HOH 107 430 259 HOH HOH B . 
H 4 HOH 108 431 260 HOH HOH B . 
I 4 HOH 1   176 42  HOH HOH C . 
I 4 HOH 2   177 45  HOH HOH C . 
I 4 HOH 3   178 46  HOH HOH C . 
I 4 HOH 4   179 48  HOH HOH C . 
I 4 HOH 5   180 60  HOH HOH C . 
I 4 HOH 6   181 67  HOH HOH C . 
I 4 HOH 7   182 69  HOH HOH C . 
I 4 HOH 8   183 74  HOH HOH C . 
I 4 HOH 9   184 75  HOH HOH C . 
I 4 HOH 10  185 79  HOH HOH C . 
I 4 HOH 11  186 80  HOH HOH C . 
I 4 HOH 12  187 83  HOH HOH C . 
I 4 HOH 13  188 91  HOH HOH C . 
I 4 HOH 14  189 94  HOH HOH C . 
I 4 HOH 15  190 98  HOH HOH C . 
I 4 HOH 16  191 100 HOH HOH C . 
I 4 HOH 17  192 120 HOH HOH C . 
I 4 HOH 18  193 121 HOH HOH C . 
I 4 HOH 19  194 129 HOH HOH C . 
I 4 HOH 20  195 138 HOH HOH C . 
I 4 HOH 21  196 141 HOH HOH C . 
I 4 HOH 22  197 146 HOH HOH C . 
I 4 HOH 23  198 153 HOH HOH C . 
I 4 HOH 24  199 154 HOH HOH C . 
I 4 HOH 25  200 164 HOH HOH C . 
I 4 HOH 26  201 167 HOH HOH C . 
I 4 HOH 27  202 168 HOH HOH C . 
I 4 HOH 28  203 190 HOH HOH C . 
I 4 HOH 29  204 206 HOH HOH C . 
I 4 HOH 30  205 213 HOH HOH C . 
I 4 HOH 31  206 214 HOH HOH C . 
I 4 HOH 32  207 215 HOH HOH C . 
I 4 HOH 33  208 221 HOH HOH C . 
I 4 HOH 34  209 230 HOH HOH C . 
I 4 HOH 35  210 233 HOH HOH C . 
I 4 HOH 36  211 241 HOH HOH C . 
I 4 HOH 37  212 245 HOH HOH C . 
J 4 HOH 1   924 3   HOH HOH D . 
J 4 HOH 2   925 4   HOH HOH D . 
J 4 HOH 3   926 17  HOH HOH D . 
J 4 HOH 4   927 26  HOH HOH D . 
J 4 HOH 5   928 28  HOH HOH D . 
J 4 HOH 6   929 29  HOH HOH D . 
J 4 HOH 7   930 32  HOH HOH D . 
J 4 HOH 8   931 34  HOH HOH D . 
J 4 HOH 9   932 36  HOH HOH D . 
J 4 HOH 10  933 37  HOH HOH D . 
J 4 HOH 11  934 41  HOH HOH D . 
J 4 HOH 12  935 44  HOH HOH D . 
J 4 HOH 13  936 52  HOH HOH D . 
J 4 HOH 14  937 59  HOH HOH D . 
J 4 HOH 15  938 64  HOH HOH D . 
J 4 HOH 16  939 72  HOH HOH D . 
J 4 HOH 17  940 81  HOH HOH D . 
J 4 HOH 18  941 82  HOH HOH D . 
J 4 HOH 19  942 86  HOH HOH D . 
J 4 HOH 20  943 90  HOH HOH D . 
J 4 HOH 21  944 99  HOH HOH D . 
J 4 HOH 22  945 102 HOH HOH D . 
J 4 HOH 23  946 110 HOH HOH D . 
J 4 HOH 24  947 114 HOH HOH D . 
J 4 HOH 25  948 119 HOH HOH D . 
J 4 HOH 26  949 124 HOH HOH D . 
J 4 HOH 27  950 126 HOH HOH D . 
J 4 HOH 28  951 127 HOH HOH D . 
J 4 HOH 29  952 132 HOH HOH D . 
J 4 HOH 30  953 136 HOH HOH D . 
J 4 HOH 31  954 137 HOH HOH D . 
J 4 HOH 32  955 140 HOH HOH D . 
J 4 HOH 33  956 143 HOH HOH D . 
J 4 HOH 34  957 145 HOH HOH D . 
J 4 HOH 35  958 152 HOH HOH D . 
J 4 HOH 36  959 155 HOH HOH D . 
J 4 HOH 37  960 159 HOH HOH D . 
J 4 HOH 38  961 161 HOH HOH D . 
J 4 HOH 39  962 162 HOH HOH D . 
J 4 HOH 40  963 166 HOH HOH D . 
J 4 HOH 41  964 169 HOH HOH D . 
J 4 HOH 42  965 174 HOH HOH D . 
J 4 HOH 43  966 181 HOH HOH D . 
J 4 HOH 44  967 184 HOH HOH D . 
J 4 HOH 45  968 186 HOH HOH D . 
J 4 HOH 46  969 195 HOH HOH D . 
J 4 HOH 47  970 198 HOH HOH D . 
J 4 HOH 48  971 199 HOH HOH D . 
J 4 HOH 49  972 200 HOH HOH D . 
J 4 HOH 50  973 201 HOH HOH D . 
J 4 HOH 51  974 208 HOH HOH D . 
J 4 HOH 52  975 209 HOH HOH D . 
J 4 HOH 53  976 210 HOH HOH D . 
J 4 HOH 54  977 222 HOH HOH D . 
J 4 HOH 55  978 226 HOH HOH D . 
J 4 HOH 56  979 231 HOH HOH D . 
J 4 HOH 57  980 234 HOH HOH D . 
J 4 HOH 58  981 235 HOH HOH D . 
J 4 HOH 59  982 237 HOH HOH D . 
J 4 HOH 60  983 238 HOH HOH D . 
J 4 HOH 61  984 243 HOH HOH D . 
J 4 HOH 62  985 244 HOH HOH D . 
J 4 HOH 63  986 248 HOH HOH D . 
J 4 HOH 64  987 250 HOH HOH D . 
J 4 HOH 65  988 252 HOH HOH D . 
J 4 HOH 66  989 253 HOH HOH D . 
J 4 HOH 67  990 255 HOH HOH D . 
J 4 HOH 68  991 256 HOH HOH D . 
J 4 HOH 69  992 257 HOH HOH D . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 B ASN 10 B ASN 10 ? ASN 'GLYCOSYLATION SITE' 
2 D ASN 10 D ASN 10 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-03-08 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Database references'       
6 4 'Structure model' 'Derived calculations'      
7 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' chem_comp                 
2 4 'Structure model' entity                    
3 4 'Structure model' pdbx_chem_comp_identifier 
4 4 'Structure model' pdbx_entity_nonpoly       
5 4 'Structure model' struct_conn               
6 4 'Structure model' struct_ref_seq_dif        
7 4 'Structure model' struct_site               
8 4 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_chem_comp.name'                     
2  4 'Structure model' '_chem_comp.type'                     
3  4 'Structure model' '_entity.pdbx_description'            
4  4 'Structure model' '_pdbx_entity_nonpoly.name'           
5  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
6  4 'Structure model' '_struct_conn.pdbx_role'              
7  4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'     
8  4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'      
9  4 'Structure model' '_struct_conn.ptnr1_label_asym_id'    
10 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'    
11 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'    
12 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'     
13 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'     
14 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'      
15 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'    
16 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'    
17 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'    
18 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'     
19 4 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
MLPHARE   phasing          . ? 3 
REFMAC    refinement       . ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  A MET 138 ? ? N  A PRO 139 ? ? CA A PRO 139 ? ? 130.29 119.30 10.99 1.50 Y 
2 1 CA B CYS 177 ? ? CB B CYS 177 ? ? SG B CYS 177 ? ? 121.03 114.20 6.83  1.10 N 
3 1 CA C CYS 65  ? ? CB C CYS 65  ? ? SG C CYS 65  ? ? 121.05 114.20 6.85  1.10 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 6   ? ? -73.32  48.43   
2  1 LYS A 41  ? ? 36.53   31.32   
3  1 LEU A 62  ? ? -141.03 27.71   
4  1 GLN A 68  ? ? -170.82 144.41  
5  1 ALA A 69  ? ? -122.49 -52.51  
6  1 GLU A 94  ? ? 36.46   46.88   
7  1 ILE A 96  ? ? 66.60   -63.42  
8  1 ALA A 128 ? ? -47.67  109.72  
9  1 PRO A 133 ? ? -49.89  109.50  
10 1 GLN A 135 ? ? -34.26  124.25  
11 1 HIS B 33  ? ? 84.24   -1.40   
12 1 SER B 45  ? ? -142.31 -151.54 
13 1 ASP B 48  ? ? 71.54   -2.16   
14 1 ARG B 64  ? ? 61.77   -6.15   
15 1 ASN B 66  ? ? -104.24 44.32   
16 1 TYR B 78  ? ? 71.36   31.66   
17 1 LYS B 157 ? ? -65.95  99.65   
18 1 LYS C 41  ? ? 36.75   28.75   
19 1 SER C 63  ? ? -58.75  70.74   
20 1 SER C 64  ? ? 33.04   82.79   
21 1 CYS C 65  ? ? -96.19  40.72   
22 1 SER C 67  ? ? -177.39 118.51  
23 1 GLN C 68  ? ? -113.18 -153.87 
24 1 LEU C 72  ? ? 98.48   -27.63  
25 1 GLU C 94  ? ? 28.53   49.24   
26 1 ILE C 96  ? ? 70.74   -61.33  
27 1 PRO D 30  ? ? -39.15  121.36  
28 1 PRO D 35  ? ? -55.53  90.40   
29 1 SER D 45  ? ? -149.23 -156.16 
30 1 ASP D 48  ? ? 72.72   -1.44   
31 1 TYR D 51  ? ? 159.77  98.07   
32 1 ASN D 66  ? ? -105.70 68.25   
33 1 ALA D 159 ? ? -60.75  85.52   
34 1 HIS D 180 ? ? -153.59 87.29   
35 1 GLN D 181 ? ? -156.60 -2.08   
36 1 SER D 195 ? ? 64.81   -0.26   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 71  ? CG  ? A GLN 71  CG  
2  1 Y 1 A GLN 71  ? CD  ? A GLN 71  CD  
3  1 Y 1 A GLN 71  ? OE1 ? A GLN 71  OE1 
4  1 Y 1 A GLN 71  ? NE2 ? A GLN 71  NE2 
5  1 Y 1 A LEU 131 ? CG  ? A LEU 131 CG  
6  1 Y 1 A LEU 131 ? CD1 ? A LEU 131 CD1 
7  1 Y 1 A LEU 131 ? CD2 ? A LEU 131 CD2 
8  1 Y 1 B LYS 63  ? CG  ? B LYS 63  CG  
9  1 Y 1 B LYS 63  ? CD  ? B LYS 63  CD  
10 1 Y 1 B LYS 63  ? CE  ? B LYS 63  CE  
11 1 Y 1 B LYS 63  ? NZ  ? B LYS 63  NZ  
12 1 Y 1 B ARG 64  ? CG  ? B ARG 64  CG  
13 1 Y 1 B ARG 64  ? CD  ? B ARG 64  CD  
14 1 Y 1 B ARG 64  ? NE  ? B ARG 64  NE  
15 1 Y 1 B ARG 64  ? CZ  ? B ARG 64  CZ  
16 1 Y 1 B ARG 64  ? NH1 ? B ARG 64  NH1 
17 1 Y 1 B ARG 64  ? NH2 ? B ARG 64  NH2 
18 1 Y 1 C HIS 53  ? CG  ? C HIS 53  CG  
19 1 Y 1 C HIS 53  ? ND1 ? C HIS 53  ND1 
20 1 Y 1 C HIS 53  ? CD2 ? C HIS 53  CD2 
21 1 Y 1 C HIS 53  ? CE1 ? C HIS 53  CE1 
22 1 Y 1 C HIS 53  ? NE2 ? C HIS 53  NE2 
23 1 Y 1 C TRP 59  ? CG  ? C TRP 59  CG  
24 1 Y 1 C TRP 59  ? CD1 ? C TRP 59  CD1 
25 1 Y 1 C TRP 59  ? CD2 ? C TRP 59  CD2 
26 1 Y 1 C TRP 59  ? NE1 ? C TRP 59  NE1 
27 1 Y 1 C TRP 59  ? CE2 ? C TRP 59  CE2 
28 1 Y 1 C TRP 59  ? CE3 ? C TRP 59  CE3 
29 1 Y 1 C TRP 59  ? CZ2 ? C TRP 59  CZ2 
30 1 Y 1 C TRP 59  ? CZ3 ? C TRP 59  CZ3 
31 1 Y 1 C TRP 59  ? CH2 ? C TRP 59  CH2 
32 1 Y 1 C GLN 68  ? CG  ? C GLN 68  CG  
33 1 Y 1 C GLN 68  ? CD  ? C GLN 68  CD  
34 1 Y 1 C GLN 68  ? OE1 ? C GLN 68  OE1 
35 1 Y 1 C GLN 68  ? NE2 ? C GLN 68  NE2 
36 1 Y 1 C LEU 70  ? CG  ? C LEU 70  CG  
37 1 Y 1 C LEU 70  ? CD1 ? C LEU 70  CD1 
38 1 Y 1 C LEU 70  ? CD2 ? C LEU 70  CD2 
39 1 Y 1 C GLN 71  ? CG  ? C GLN 71  CG  
40 1 Y 1 C GLN 71  ? CD  ? C GLN 71  CD  
41 1 Y 1 C GLN 71  ? OE1 ? C GLN 71  OE1 
42 1 Y 1 C GLN 71  ? NE2 ? C GLN 71  NE2 
43 1 Y 1 D LYS 62  ? CG  ? D LYS 62  CG  
44 1 Y 1 D LYS 62  ? CD  ? D LYS 62  CD  
45 1 Y 1 D LYS 62  ? CE  ? D LYS 62  CE  
46 1 Y 1 D LYS 62  ? NZ  ? D LYS 62  NZ  
47 1 Y 1 D LYS 63  ? CG  ? D LYS 63  CG  
48 1 Y 1 D LYS 63  ? CD  ? D LYS 63  CD  
49 1 Y 1 D LYS 63  ? CE  ? D LYS 63  CE  
50 1 Y 1 D LYS 63  ? NZ  ? D LYS 63  NZ  
51 1 Y 1 D ARG 64  ? CG  ? D ARG 64  CG  
52 1 Y 1 D ARG 64  ? CD  ? D ARG 64  CD  
53 1 Y 1 D ARG 64  ? NE  ? D ARG 64  NE  
54 1 Y 1 D ARG 64  ? CZ  ? D ARG 64  CZ  
55 1 Y 1 D ARG 64  ? NH1 ? D ARG 64  NH1 
56 1 Y 1 D ARG 64  ? NH2 ? D ARG 64  NH2 
57 1 Y 1 D GLN 127 ? CG  ? D GLN 127 CG  
58 1 Y 1 D GLN 127 ? CD  ? D GLN 127 CD  
59 1 Y 1 D GLN 127 ? OE1 ? D GLN 127 OE1 
60 1 Y 1 D GLN 127 ? NE2 ? D GLN 127 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A THR 2   ? A THR 2   
3  1 Y 1 A PRO 3   ? A PRO 3   
4  1 Y 1 A LEU 4   ? A LEU 4   
5  1 Y 1 B GLY 120 ? B GLY 120 
6  1 Y 1 B PRO 121 ? B PRO 121 
7  1 Y 1 B ASP 122 ? B ASP 122 
8  1 Y 1 B VAL 123 ? B VAL 123 
9  1 Y 1 B VAL 124 ? B VAL 124 
10 1 Y 1 B SER 125 ? B SER 125 
11 1 Y 1 B HIS 126 ? B HIS 126 
12 1 Y 1 B LYS 214 ? B LYS 214 
13 1 Y 1 B ALA 215 ? B ALA 215 
14 1 Y 1 C MET 1   ? C MET 1   
15 1 Y 1 C THR 2   ? C THR 2   
16 1 Y 1 C PRO 3   ? C PRO 3   
17 1 Y 1 C LEU 4   ? C LEU 4   
18 1 Y 1 C GLY 5   ? C GLY 5   
19 1 Y 1 C PRO 6   ? C PRO 6   
20 1 Y 1 D ALA 1   ? D ALA 1   
21 1 Y 1 D ILE 119 ? D ILE 119 
22 1 Y 1 D GLY 120 ? D GLY 120 
23 1 Y 1 D PRO 121 ? D PRO 121 
24 1 Y 1 D ASP 122 ? D ASP 122 
25 1 Y 1 D VAL 123 ? D VAL 123 
26 1 Y 1 D VAL 124 ? D VAL 124 
27 1 Y 1 D SER 125 ? D SER 125 
28 1 Y 1 D HIS 126 ? D HIS 126 
29 1 Y 1 D LYS 214 ? D LYS 214 
30 1 Y 1 D ALA 215 ? D ALA 215 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
4 water                                    HOH 
#