data_1CDK
# 
_entry.id   1CDK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1CDK         
WWPDB D_1000172256 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1CDK 
_pdbx_database_status.recvd_initial_deposition_date   1994-07-04 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bossemeyer, D.' 1 
'Engh, R.A.'     2 
'Kinzel, V.'     3 
'Ponstingl, H.'  4 
'Huber, R.'      5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Phosphotransferase and substrate binding mechanism of the cAMP-dependent protein kinase catalytic subunit from porcine heart as deduced from the 2.0 A structure of the complex with Mn2+ adenylyl imidodiphosphate and inhibitor peptide PKI(5-24).
;
'EMBO J.'                  12  849  859 1993 EMJODG UK 0261-4189 0897 ? 8384554 ? 
1       
;2.2 Angstrom Refined Crystal Structure of the Catalytic Subunit of cAMP-Dependent Protein Kinase Complexed with Mnatp and a Peptide Inhibitor
;
'Acta Crystallogr.,Sect.D' 49  362  ?   1993 ABCRE6 DK 0907-4449 0766 ? ?       ? 
2       'Crystal Structures of the Myristylated Catalytic Subunit Ofcamp-Dependent Kinase Reveal Open and Closed Conformation' 
'Protein Sci.'             2   1559 ?   1993 PRCIEI US 0961-8368 0795 ? ?       ? 
3       'Crystal Structure of the Catalytic Subunit of Cyclic Adenosine Monophosphate Dependent-Protein Kinase' Science 253 407  ? 
1991 SCIEAS US 0036-8075 0038 ? ?       ? 
4       
'Structure of a Peptide Inhibitor Bound to the Catalytic Subunit of a Cyclic Adenosine Monophosphate-Dependent Protein Kinase' 
Science                    253 414  ?   1991 SCIEAS US 0036-8075 0038 ? ?       ? 
5       
'Regulation by Phosphorylation of Reversible Association of a Myristoylated Protein Kinase C Substrate with the Plasma Membrane' 
Nature                     351 320  ?   1991 NATUAS UK 0028-0836 0006 ? ?       ? 
6       'A Sequence Variant in the N-Terminal Region of the Catalytic Subunit of the cAMP-Dependent Protein Kinase' 'FEBS Lett.' 
256 115  ?   1989 FEBLAL NE 0014-5793 0165 ? ?       ? 
7       'Characterization of Genomic Clones Coding for the C-Alpha and C-Beta Subunits of Mouse Camp Dependent Protein Kinase' 
J.Biol.Chem.               263 5739 ?   1988 JBCHA3 US 0021-9258 0071 ? ?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bossemeyer, D.' 1  
primary 'Engh, R.A.'     2  
primary 'Kinzel, V.'     3  
primary 'Ponstingl, H.'  4  
primary 'Huber, R.'      5  
1       'Zheng, J.'      6  
1       'Trafny, E.A.'   7  
1       'Knighton, D.R.' 8  
1       'Xuong, N.-H.'   9  
1       'Taylor, S.S.'   10 
1       'Ten Eyck, L.F.' 11 
1       'Sowadski, J.M.' 12 
2       'Zheng, J.'      13 
2       'Knighton, D.R.' 14 
2       'Xuong, N.-H.'   15 
2       'Taylor, S.S.'   16 
2       'Sowadski, J.M.' 17 
2       'Ten Eyck, L.F.' 18 
3       'Knighton, D.R.' 19 
3       'Zheng, J.H.'    20 
3       'Ten Eyck, L.F.' 21 
3       'Ashford, V.A.'  22 
3       'Xuong, N.-H.'   23 
3       'Taylor, S.S.'   24 
3       'Sowadski, J.M.' 25 
4       'Knighton, D.R.' 26 
4       'Zheng, J.'      27 
4       'Ten Eyck, L.F.' 28 
4       'Xoung, N.-H.'   29 
4       'Taylor, S.S.'   30 
4       'Sowadski, J.M.' 31 
5       'Thelen, M.'     32 
5       'Rosen, A.'      33 
5       'Nairn, A.C.'    34 
5       'Aderem, A.'     35 
6       'Hotz, A.'       36 
6       'Konig, N.'      37 
6       'Kretschmer, J.' 38 
6       'Maier, G.'      39 
6       'Ponstingl, H.'  40 
6       'Kinzel, V.'     41 
7       'Chrivia, J.C.'  42 
7       'Uhler, M.D.'    43 
7       'Mcknight, G.S.' 44 
# 
_cell.entry_id           1CDK 
_cell.length_a           107.610 
_cell.length_b           80.600 
_cell.length_c           110.100 
_cell.angle_alpha        90.00 
_cell.angle_beta         88.59 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1CDK 
_symmetry.space_group_name_H-M             'I 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'CAMP-DEPENDENT PROTEIN KINASE'               40625.406 2   2.7.11.11 ? ? ? 
2 polymer     syn 'PROTEIN KINASE INHIBITOR'                    2226.411  2   ?         ? ? ? 
3 non-polymer syn 'MANGANESE (II) ION'                          54.938    4   ?         ? ? ? 
4 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' 506.196   2   ?         ? ? ? 
5 non-polymer syn 'MYRISTIC ACID'                               228.371   2   ?         ? ? ? 
6 water       nat water                                         18.015    312 ?         ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'PROTEIN KINASE A' 
2 'PKI(5-24)'        
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;GNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKVV
KLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSL
DLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTW(TPO)LCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYP
PFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKDGVNDIKNHKWFATTDWIAIYQRKVEAPFIP
KFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
;
;GNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKVV
KLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSL
DLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFA
DQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKDGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKG
PGDTSNFDDYEEEEIRVSINEKCGKEFSEF
;
A,B ? 
2 'polypeptide(L)' no no  TTYADFIASGRTGRRNAIHD TTYADFIASGRTGRRNAIHD I,J ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ASN n 
1 3   ALA n 
1 4   ALA n 
1 5   ALA n 
1 6   ALA n 
1 7   LYS n 
1 8   LYS n 
1 9   GLY n 
1 10  SER n 
1 11  GLU n 
1 12  GLN n 
1 13  GLU n 
1 14  SER n 
1 15  VAL n 
1 16  LYS n 
1 17  GLU n 
1 18  PHE n 
1 19  LEU n 
1 20  ALA n 
1 21  LYS n 
1 22  ALA n 
1 23  LYS n 
1 24  GLU n 
1 25  ASP n 
1 26  PHE n 
1 27  LEU n 
1 28  LYS n 
1 29  LYS n 
1 30  TRP n 
1 31  GLU n 
1 32  ASN n 
1 33  PRO n 
1 34  ALA n 
1 35  GLN n 
1 36  ASN n 
1 37  THR n 
1 38  ALA n 
1 39  HIS n 
1 40  LEU n 
1 41  ASP n 
1 42  GLN n 
1 43  PHE n 
1 44  GLU n 
1 45  ARG n 
1 46  ILE n 
1 47  LYS n 
1 48  THR n 
1 49  LEU n 
1 50  GLY n 
1 51  THR n 
1 52  GLY n 
1 53  SER n 
1 54  PHE n 
1 55  GLY n 
1 56  ARG n 
1 57  VAL n 
1 58  MET n 
1 59  LEU n 
1 60  VAL n 
1 61  LYS n 
1 62  HIS n 
1 63  LYS n 
1 64  GLU n 
1 65  THR n 
1 66  GLY n 
1 67  ASN n 
1 68  HIS n 
1 69  PHE n 
1 70  ALA n 
1 71  MET n 
1 72  LYS n 
1 73  ILE n 
1 74  LEU n 
1 75  ASP n 
1 76  LYS n 
1 77  GLN n 
1 78  LYS n 
1 79  VAL n 
1 80  VAL n 
1 81  LYS n 
1 82  LEU n 
1 83  LYS n 
1 84  GLN n 
1 85  ILE n 
1 86  GLU n 
1 87  HIS n 
1 88  THR n 
1 89  LEU n 
1 90  ASN n 
1 91  GLU n 
1 92  LYS n 
1 93  ARG n 
1 94  ILE n 
1 95  LEU n 
1 96  GLN n 
1 97  ALA n 
1 98  VAL n 
1 99  ASN n 
1 100 PHE n 
1 101 PRO n 
1 102 PHE n 
1 103 LEU n 
1 104 VAL n 
1 105 LYS n 
1 106 LEU n 
1 107 GLU n 
1 108 TYR n 
1 109 SER n 
1 110 PHE n 
1 111 LYS n 
1 112 ASP n 
1 113 ASN n 
1 114 SER n 
1 115 ASN n 
1 116 LEU n 
1 117 TYR n 
1 118 MET n 
1 119 VAL n 
1 120 MET n 
1 121 GLU n 
1 122 TYR n 
1 123 VAL n 
1 124 PRO n 
1 125 GLY n 
1 126 GLY n 
1 127 GLU n 
1 128 MET n 
1 129 PHE n 
1 130 SER n 
1 131 HIS n 
1 132 LEU n 
1 133 ARG n 
1 134 ARG n 
1 135 ILE n 
1 136 GLY n 
1 137 ARG n 
1 138 PHE n 
1 139 SER n 
1 140 GLU n 
1 141 PRO n 
1 142 HIS n 
1 143 ALA n 
1 144 ARG n 
1 145 PHE n 
1 146 TYR n 
1 147 ALA n 
1 148 ALA n 
1 149 GLN n 
1 150 ILE n 
1 151 VAL n 
1 152 LEU n 
1 153 THR n 
1 154 PHE n 
1 155 GLU n 
1 156 TYR n 
1 157 LEU n 
1 158 HIS n 
1 159 SER n 
1 160 LEU n 
1 161 ASP n 
1 162 LEU n 
1 163 ILE n 
1 164 TYR n 
1 165 ARG n 
1 166 ASP n 
1 167 LEU n 
1 168 LYS n 
1 169 PRO n 
1 170 GLU n 
1 171 ASN n 
1 172 LEU n 
1 173 LEU n 
1 174 ILE n 
1 175 ASP n 
1 176 GLN n 
1 177 GLN n 
1 178 GLY n 
1 179 TYR n 
1 180 ILE n 
1 181 GLN n 
1 182 VAL n 
1 183 THR n 
1 184 ASP n 
1 185 PHE n 
1 186 GLY n 
1 187 PHE n 
1 188 ALA n 
1 189 LYS n 
1 190 ARG n 
1 191 VAL n 
1 192 LYS n 
1 193 GLY n 
1 194 ARG n 
1 195 THR n 
1 196 TRP n 
1 197 TPO n 
1 198 LEU n 
1 199 CYS n 
1 200 GLY n 
1 201 THR n 
1 202 PRO n 
1 203 GLU n 
1 204 TYR n 
1 205 LEU n 
1 206 ALA n 
1 207 PRO n 
1 208 GLU n 
1 209 ILE n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 LYS n 
1 214 GLY n 
1 215 TYR n 
1 216 ASN n 
1 217 LYS n 
1 218 ALA n 
1 219 VAL n 
1 220 ASP n 
1 221 TRP n 
1 222 TRP n 
1 223 ALA n 
1 224 LEU n 
1 225 GLY n 
1 226 VAL n 
1 227 LEU n 
1 228 ILE n 
1 229 TYR n 
1 230 GLU n 
1 231 MET n 
1 232 ALA n 
1 233 ALA n 
1 234 GLY n 
1 235 TYR n 
1 236 PRO n 
1 237 PRO n 
1 238 PHE n 
1 239 PHE n 
1 240 ALA n 
1 241 ASP n 
1 242 GLN n 
1 243 PRO n 
1 244 ILE n 
1 245 GLN n 
1 246 ILE n 
1 247 TYR n 
1 248 GLU n 
1 249 LYS n 
1 250 ILE n 
1 251 VAL n 
1 252 SER n 
1 253 GLY n 
1 254 LYS n 
1 255 VAL n 
1 256 ARG n 
1 257 PHE n 
1 258 PRO n 
1 259 SER n 
1 260 HIS n 
1 261 PHE n 
1 262 SER n 
1 263 SER n 
1 264 ASP n 
1 265 LEU n 
1 266 LYS n 
1 267 ASP n 
1 268 LEU n 
1 269 LEU n 
1 270 ARG n 
1 271 ASN n 
1 272 LEU n 
1 273 LEU n 
1 274 GLN n 
1 275 VAL n 
1 276 ASP n 
1 277 LEU n 
1 278 THR n 
1 279 LYS n 
1 280 ARG n 
1 281 PHE n 
1 282 GLY n 
1 283 ASN n 
1 284 LEU n 
1 285 LYS n 
1 286 ASP n 
1 287 GLY n 
1 288 VAL n 
1 289 ASN n 
1 290 ASP n 
1 291 ILE n 
1 292 LYS n 
1 293 ASN n 
1 294 HIS n 
1 295 LYS n 
1 296 TRP n 
1 297 PHE n 
1 298 ALA n 
1 299 THR n 
1 300 THR n 
1 301 ASP n 
1 302 TRP n 
1 303 ILE n 
1 304 ALA n 
1 305 ILE n 
1 306 TYR n 
1 307 GLN n 
1 308 ARG n 
1 309 LYS n 
1 310 VAL n 
1 311 GLU n 
1 312 ALA n 
1 313 PRO n 
1 314 PHE n 
1 315 ILE n 
1 316 PRO n 
1 317 LYS n 
1 318 PHE n 
1 319 LYS n 
1 320 GLY n 
1 321 PRO n 
1 322 GLY n 
1 323 ASP n 
1 324 THR n 
1 325 SER n 
1 326 ASN n 
1 327 PHE n 
1 328 ASP n 
1 329 ASP n 
1 330 TYR n 
1 331 GLU n 
1 332 GLU n 
1 333 GLU n 
1 334 GLU n 
1 335 ILE n 
1 336 ARG n 
1 337 VAL n 
1 338 SER n 
1 339 ILE n 
1 340 ASN n 
1 341 GLU n 
1 342 LYS n 
1 343 CYS n 
1 344 GLY n 
1 345 LYS n 
1 346 GLU n 
1 347 PHE n 
1 348 SER n 
1 349 GLU n 
1 350 PHE n 
2 1   THR n 
2 2   THR n 
2 3   TYR n 
2 4   ALA n 
2 5   ASP n 
2 6   PHE n 
2 7   ILE n 
2 8   ALA n 
2 9   SER n 
2 10  GLY n 
2 11  ARG n 
2 12  THR n 
2 13  GLY n 
2 14  ARG n 
2 15  ARG n 
2 16  ASN n 
2 17  ALA n 
2 18  ILE n 
2 19  HIS n 
2 20  ASP n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                pig 
_entity_src_nat.pdbx_organism_scientific   'Sus scrofa' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9823 
_entity_src_nat.genus                      Sus 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     'HEART ISOFORM CA' 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 HEART 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP KAPA_BOVIN 1 P00517 1 
;GNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVV
KLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSL
DLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFA
DQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKG
PGDTSNFDDYEEEEIRVSINEKCGKEFSEF
;
? 
2 UNP IPKA_HUMAN 2 P61925 6 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1CDK A 1 ? 350 ? P00517 1 ? 350 ? 1 350 
2 2 1CDK I 1 ? 20  ? P61925 6 ? 25  ? 1 20  
3 1 1CDK B 1 ? 350 ? P00517 1 ? 350 ? 1 350 
4 2 1CDK J 1 ? 20  ? P61925 6 ? 25  ? 1 20  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1CDK LYS A 63  ? UNP P00517 MET 63  CONFLICT 63  1 
1 1CDK PHE A 69  ? UNP P00517 TYR 69  CONFLICT 69  2 
1 1CDK TYR A 108 ? UNP P00517 PHE 108 CONFLICT 108 3 
1 1CDK ASP A 286 ? UNP P00517 ASN 286 CONFLICT 286 4 
3 1CDK LYS B 63  ? UNP P00517 MET 63  CONFLICT 63  5 
3 1CDK PHE B 69  ? UNP P00517 TYR 69  CONFLICT 69  6 
3 1CDK TYR B 108 ? UNP P00517 PHE 108 CONFLICT 108 7 
3 1CDK ASP B 286 ? UNP P00517 ASN 286 CONFLICT 286 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ?                  'C3 H7 N O2'        89.093  
ANP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ?                  'C10 H17 N6 O12 P3' 506.196 
ARG 'L-peptide linking' y ARGININE                                      ?                  'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ?                  'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ?                  'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ?                  'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                     ?                  'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ?                  'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                       ?                  'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                     ?                  'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                         ?                  'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                    ?                  'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                       ?                  'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                        ?                  'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                    ?                  'C5 H11 N O2 S'     149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                          ?                  'Mn 2'              54.938  
MYR non-polymer         . 'MYRISTIC ACID'                               ?                  'C14 H28 O2'        228.371 
PHE 'L-peptide linking' y PHENYLALANINE                                 ?                  'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                       ?                  'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                        ?                  'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                     ?                  'C4 H9 N O3'        119.119 
TPO 'L-peptide linking' n PHOSPHOTHREONINE                              PHOSPHONOTHREONINE 'C4 H10 N O6 P'     199.099 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ?                  'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                      ?                  'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                        ?                  'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1CDK 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.79 
_exptl_crystal.density_percent_sol   55.90 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            280 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 5.6, temperature 280K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_reflns.entry_id                     1CDK 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            ? 
_reflns.number_obs                   58447 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 1CDK 
_refine.ls_number_reflns_obs                     49638 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          3.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             5.0 
_refine.ls_d_res_high                            2.0 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1970000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1970000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5971 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         78 
_refine_hist.number_atoms_solvent             312 
_refine_hist.number_atoms_total               6361 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        5.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.025 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             2.96  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   0.999700 
_struct_ncs_oper.matrix[1][2]   0.012500 
_struct_ncs_oper.matrix[1][3]   0.022200 
_struct_ncs_oper.matrix[2][1]   -0.012100 
_struct_ncs_oper.matrix[2][2]   0.999800 
_struct_ncs_oper.matrix[2][3]   -0.016800 
_struct_ncs_oper.matrix[3][1]   -0.022200 
_struct_ncs_oper.matrix[3][2]   0.016500 
_struct_ncs_oper.matrix[3][3]   0.999600 
_struct_ncs_oper.vector[1]      53.21820 
_struct_ncs_oper.vector[2]      28.02060 
_struct_ncs_oper.vector[3]      0.61260 
# 
_struct.entry_id                  1CDK 
_struct.title                     
;CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT (E.C.2.7.1.37) (PROTEIN KINASE A) COMPLEXED WITH PROTEIN KINASE INHIBITOR PEPTIDE FRAGMENT 5-24 (PKI(5-24) ISOELECTRIC VARIANT CA) AND MN2+ ADENYLYL IMIDODIPHOSPHATE (MNAMP-PNP) AT PH 5.6 AND 7C AND 4C
;
_struct.pdbx_descriptor           
'CAMP-DEPENDENT PROTEIN KINASE, PROTEIN KINASE INHIBITOR, PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER, MYRISTIC ACID' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1CDK 
_struct_keywords.pdbx_keywords   'TRANSFERASE/TRANSFERASE INHIBITOR' 
_struct_keywords.text            'COMPLEX (TRANSFERASE-INHIBITOR), TRANSFERASE-TRANSFERASE INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 3 ? 
J N N 3 ? 
K N N 4 ? 
L N N 5 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
P N N 6 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 
;MTRIX
 THE TRANSFORMATIONS PRESENTED ON MTRIX RECORDS BELOW
 DESCRIBE NON-CRYSTALLOGRAPHIC RELATIONSHIPS AMONG THE
 VARIOUS DOMAINS IN THIS ENTRY.  APPLYING THE APPROPRIATE
 MTRIX TRANSFORMATION TO THE RESIDUES LISTED FIRST WILL
 YIELD APPROXIMATE COORDINATES FOR THE RESIDUES LISTED
 SECOND.

           APPLIED TO           TRANSFORMED TO
 MTRIX      RESIDUES               RESIDUES         RMSD
   M1   B    8  ..  B  317     A    8  ..  A  317   0.265
   M1   B  322  ..  B  350     A  322  ..  A  350   0.347
;
? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  HAA SER A 10  ? GLU A 31  ? SER A 10  GLU A 31  1 ? 22 
HELX_P HELX_P2  ZAA LEU A 40  ? GLN A 42  ? LEU A 40  GLN A 42  5 ? 3  
HELX_P HELX_P3  HBA LYS A 76  ? LYS A 81  ? LYS A 76  LYS A 81  1 ? 6  
HELX_P HELX_P4  HCA ILE A 85  ? ALA A 97  ? ILE A 85  ALA A 97  1 ? 13 
HELX_P HELX_P5  HDA MET A 128 ? ILE A 135 ? MET A 128 ILE A 135 1 ? 8  
HELX_P HELX_P6  HEA GLU A 140 ? SER A 159 ? GLU A 140 SER A 159 1 ? 20 
HELX_P HELX_P7  HOA PRO A 207 ? LEU A 211 ? PRO A 207 LEU A 211 1 ? 5  
HELX_P HELX_P8  HFA ALA A 218 ? ALA A 233 ? ALA A 218 ALA A 233 1 ? 16 
HELX_P HELX_P9  HGA PRO A 243 ? SER A 252 ? PRO A 243 SER A 252 1 ? 10 
HELX_P HELX_P10 HHA SER A 263 ? LEU A 272 ? SER A 263 LEU A 272 1 ? 10 
HELX_P HELX_P11 HIA ASN A 289 ? LYS A 292 ? ASN A 289 LYS A 292 1 ? 4  
HELX_P HELX_P12 ZIA LYS A 295 ? PHE A 297 ? LYS A 295 PHE A 297 5 ? 3  
HELX_P HELX_P13 HJA TRP A 302 ? TYR A 306 ? TRP A 302 TYR A 306 1 ? 5  
HELX_P HELX_P14 HKA GLY A 344 ? PHE A 347 ? GLY A 344 PHE A 347 1 ? 4  
HELX_P HELX_P15 HAI THR B 2   ? ALA B 8   ? THR I 2   ALA I 8   1 ? 7  
HELX_P HELX_P16 HAB SER C 10  ? GLU C 31  ? SER B 10  GLU B 31  1 ? 22 
HELX_P HELX_P17 ZAB LEU C 40  ? GLN C 42  ? LEU B 40  GLN B 42  5 ? 3  
HELX_P HELX_P18 HBB LYS C 76  ? LYS C 81  ? LYS B 76  LYS B 81  1 ? 6  
HELX_P HELX_P19 HCB ILE C 85  ? ALA C 97  ? ILE B 85  ALA B 97  1 ? 13 
HELX_P HELX_P20 HDB MET C 128 ? ILE C 135 ? MET B 128 ILE B 135 1 ? 8  
HELX_P HELX_P21 HEB GLU C 140 ? SER C 159 ? GLU B 140 SER B 159 1 ? 20 
HELX_P HELX_P22 HOB PRO C 207 ? LEU C 211 ? PRO B 207 LEU B 211 1 ? 5  
HELX_P HELX_P23 HFB ALA C 218 ? ALA C 233 ? ALA B 218 ALA B 233 1 ? 16 
HELX_P HELX_P24 HGB PRO C 243 ? SER C 252 ? PRO B 243 SER B 252 1 ? 10 
HELX_P HELX_P25 HHB SER C 263 ? LEU C 272 ? SER B 263 LEU B 272 1 ? 10 
HELX_P HELX_P26 HIB ASN C 289 ? LYS C 292 ? ASN B 289 LYS B 292 1 ? 4  
HELX_P HELX_P27 ZIB LYS C 295 ? PHE C 297 ? LYS B 295 PHE B 297 5 ? 3  
HELX_P HELX_P28 HJB TRP C 302 ? TYR C 306 ? TRP B 302 TYR B 306 1 ? 5  
HELX_P HELX_P29 HKB GLY C 344 ? PHE C 347 ? GLY B 344 PHE B 347 1 ? 4  
HELX_P HELX_P30 HAJ THR D 2   ? ALA D 8   ? THR J 2   ALA J 8   1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASN 171 OD1 ? ? ? 1_555 E MN  .   MN  ? ? A ASN 171 A MN  401 1_555 ? ? ? ? ? ? ? 2.058 ? 
metalc2  metalc ? ? A ASP 184 OD1 ? ? ? 1_555 F MN  .   MN  ? ? A ASP 184 A MN  402 1_555 ? ? ? ? ? ? ? 2.108 ? 
metalc3  metalc ? ? A ASP 184 OD2 ? ? ? 1_555 F MN  .   MN  ? ? A ASP 184 A MN  402 1_555 ? ? ? ? ? ? ? 1.989 ? 
metalc4  metalc ? ? C ASN 171 OD1 ? ? ? 1_555 I MN  .   MN  ? ? B ASN 171 B MN  401 1_555 ? ? ? ? ? ? ? 2.108 ? 
metalc5  metalc ? ? C ASP 184 OD1 ? ? ? 1_555 J MN  .   MN  ? ? B ASP 184 B MN  402 1_555 ? ? ? ? ? ? ? 2.076 ? 
metalc6  metalc ? ? C ASP 184 OD2 ? ? ? 1_555 J MN  .   MN  ? ? B ASP 184 B MN  402 1_555 ? ? ? ? ? ? ? 1.971 ? 
metalc7  metalc ? ? E MN  .   MN  ? ? ? 1_555 G ANP .   O2G ? ? A MN  401 A ANP 400 1_555 ? ? ? ? ? ? ? 2.025 ? 
metalc8  metalc ? ? E MN  .   MN  ? ? ? 1_555 M HOH .   O   ? ? A MN  401 A HOH 451 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc9  metalc ? ? E MN  .   MN  ? ? ? 1_555 G ANP .   O2A ? ? A MN  401 A ANP 400 1_555 ? ? ? ? ? ? ? 2.015 ? 
metalc10 metalc ? ? F MN  .   MN  ? ? ? 1_555 M HOH .   O   ? ? A MN  402 A HOH 514 1_555 ? ? ? ? ? ? ? 2.272 ? 
metalc11 metalc ? ? F MN  .   MN  ? ? ? 1_555 M HOH .   O   ? ? A MN  402 A HOH 436 1_555 ? ? ? ? ? ? ? 2.189 ? 
metalc12 metalc ? ? F MN  .   MN  ? ? ? 1_555 G ANP .   O1G ? ? A MN  402 A ANP 400 1_555 ? ? ? ? ? ? ? 1.898 ? 
metalc13 metalc ? ? F MN  .   MN  ? ? ? 1_555 G ANP .   O2B ? ? A MN  402 A ANP 400 1_555 ? ? ? ? ? ? ? 2.108 ? 
metalc14 metalc ? ? I MN  .   MN  ? ? ? 1_555 K ANP .   O2G ? ? B MN  401 B ANP 400 1_555 ? ? ? ? ? ? ? 1.995 ? 
metalc15 metalc ? ? I MN  .   MN  ? ? ? 1_555 O HOH .   O   ? ? B MN  401 B HOH 449 1_555 ? ? ? ? ? ? ? 2.299 ? 
metalc16 metalc ? ? I MN  .   MN  ? ? ? 1_555 K ANP .   O2A ? ? B MN  401 B ANP 400 1_555 ? ? ? ? ? ? ? 2.020 ? 
metalc17 metalc ? ? J MN  .   MN  ? ? ? 1_555 O HOH .   O   ? ? B MN  402 B HOH 506 1_555 ? ? ? ? ? ? ? 2.295 ? 
metalc18 metalc ? ? J MN  .   MN  ? ? ? 1_555 K ANP .   O2B ? ? B MN  402 B ANP 400 1_555 ? ? ? ? ? ? ? 2.118 ? 
metalc19 metalc ? ? J MN  .   MN  ? ? ? 1_555 K ANP .   O1G ? ? B MN  402 B ANP 400 1_555 ? ? ? ? ? ? ? 1.906 ? 
metalc20 metalc ? ? J MN  .   MN  ? ? ? 1_555 O HOH .   O   ? ? B MN  402 B HOH 435 1_555 ? ? ? ? ? ? ? 2.273 ? 
covale1  covale ? ? A TRP 196 C   ? ? ? 1_555 A TPO 197 N   ? ? A TRP 196 A TPO 197 1_555 ? ? ? ? ? ? ? 1.341 ? 
covale2  covale ? ? A TPO 197 C   ? ? ? 1_555 A LEU 198 N   ? ? A TPO 197 A LEU 198 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale3  covale ? ? C TRP 196 C   ? ? ? 1_555 C TPO 197 N   ? ? B TRP 196 B TPO 197 1_555 ? ? ? ? ? ? ? 1.350 ? 
covale4  covale ? ? C TPO 197 C   ? ? ? 1_555 C LEU 198 N   ? ? B TPO 197 B LEU 198 1_555 ? ? ? ? ? ? ? 1.317 ? 
metalc21 metalc ? ? I MN  .   MN  ? ? ? 1_555 K ANP .   N3B ? ? B MN  401 B ANP 400 1_555 ? ? ? ? ? ? ? 2.416 ? 
metalc22 metalc ? ? C ASP 184 OD2 ? ? ? 1_555 I MN  .   MN  ? ? B ASP 184 B MN  401 1_555 ? ? ? ? ? ? ? 2.534 ? 
metalc23 metalc ? ? A ASP 184 OD2 ? ? ? 1_555 E MN  .   MN  ? ? A ASP 184 A MN  401 1_555 ? ? ? ? ? ? ? 2.551 ? 
metalc24 metalc ? ? E MN  .   MN  ? ? ? 1_555 G ANP .   N3B ? ? A MN  401 A ANP 400 1_555 ? ? ? ? ? ? ? 2.636 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
S1A ? 5 ? 
S2A ? 2 ? 
S1B ? 5 ? 
S2B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
S1A 1 2 ? anti-parallel 
S1A 2 3 ? anti-parallel 
S1A 3 4 ? anti-parallel 
S1A 4 5 ? anti-parallel 
S2A 1 2 ? anti-parallel 
S1B 1 2 ? anti-parallel 
S1B 2 3 ? anti-parallel 
S1B 3 4 ? anti-parallel 
S1B 4 5 ? anti-parallel 
S2B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1A 1 PHE A 43  ? GLY A 52  ? PHE A 43  GLY A 52  
S1A 2 GLY A 55  ? HIS A 62  ? GLY A 55  HIS A 62  
S1A 3 ASN A 67  ? ASP A 75  ? ASN A 67  ASP A 75  
S1A 4 ASN A 115 ? MET A 120 ? ASN A 115 MET A 120 
S1A 5 LEU A 106 ? LYS A 111 ? LEU A 106 LYS A 111 
S2A 1 LEU A 172 ? ILE A 174 ? LEU A 172 ILE A 174 
S2A 2 ILE A 180 ? VAL A 182 ? ILE A 180 VAL A 182 
S1B 1 PHE C 43  ? GLY C 52  ? PHE B 43  GLY B 52  
S1B 2 GLY C 55  ? HIS C 62  ? GLY B 55  HIS B 62  
S1B 3 ASN C 67  ? ASP C 75  ? ASN B 67  ASP B 75  
S1B 4 ASN C 115 ? MET C 120 ? ASN B 115 MET B 120 
S1B 5 LEU C 106 ? LYS C 111 ? LEU B 106 LYS B 111 
S2B 1 LEU C 172 ? ILE C 174 ? LEU B 172 ILE B 174 
S2B 2 ILE C 180 ? VAL C 182 ? ILE B 180 VAL B 182 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
S1A 1 2 N GLY A 52  ? N GLY A 52  O GLY A 55  ? O GLY A 55  
S1A 2 3 N VAL A 60  ? N VAL A 60  O PHE A 69  ? O PHE A 69  
S1A 3 4 N LYS A 72  ? N LYS A 72  O MET A 118 ? O MET A 118 
S1A 4 5 N VAL A 119 ? N VAL A 119 O TYR A 108 ? O TYR A 108 
S2A 1 2 O LEU A 173 ? O LEU A 173 N GLN A 181 ? N GLN A 181 
S1B 1 2 N GLY C 52  ? N GLY B 52  O GLY C 55  ? O GLY B 55  
S1B 2 3 N VAL C 60  ? N VAL B 60  O PHE C 69  ? O PHE B 69  
S1B 3 4 N LYS C 72  ? N LYS B 72  O MET C 118 ? O MET B 118 
S1B 4 5 N VAL C 119 ? N VAL B 119 O TYR C 108 ? O TYR B 108 
S2B 1 2 O LEU C 173 ? O LEU B 173 N GLN C 181 ? N GLN B 181 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MN A 401'                    
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MN A 402'                    
AC3 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE ANP A 400'                   
AC4 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MYR A 403'                   
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MN B 401'                    
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MN B 402'                    
AC7 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE ANP B 400'                   
AC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MYR B 403'                   
AC9 Software ? ? ? ? 54 'BINDING SITE FOR CHAIN I OF PROTEIN KINASE INHIBITOR' 
BC1 Software ? ? ? ? 52 'BINDING SITE FOR CHAIN J OF PROTEIN KINASE INHIBITOR' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4  ASN A 171 ? ASN A 171 . ? 1_555 ? 
2   AC1 4  ASP A 184 ? ASP A 184 . ? 1_555 ? 
3   AC1 4  ANP G .   ? ANP A 400 . ? 1_555 ? 
4   AC1 4  HOH M .   ? HOH A 451 . ? 1_555 ? 
5   AC2 4  ASP A 184 ? ASP A 184 . ? 1_555 ? 
6   AC2 4  ANP G .   ? ANP A 400 . ? 1_555 ? 
7   AC2 4  HOH M .   ? HOH A 436 . ? 1_555 ? 
8   AC2 4  HOH M .   ? HOH A 514 . ? 1_555 ? 
9   AC3 25 GLY A 52  ? GLY A 52  . ? 1_555 ? 
10  AC3 25 SER A 53  ? SER A 53  . ? 1_555 ? 
11  AC3 25 PHE A 54  ? PHE A 54  . ? 1_555 ? 
12  AC3 25 GLY A 55  ? GLY A 55  . ? 1_555 ? 
13  AC3 25 VAL A 57  ? VAL A 57  . ? 1_555 ? 
14  AC3 25 ALA A 70  ? ALA A 70  . ? 1_555 ? 
15  AC3 25 LYS A 72  ? LYS A 72  . ? 1_555 ? 
16  AC3 25 VAL A 104 ? VAL A 104 . ? 1_555 ? 
17  AC3 25 MET A 120 ? MET A 120 . ? 1_555 ? 
18  AC3 25 GLU A 121 ? GLU A 121 . ? 1_555 ? 
19  AC3 25 VAL A 123 ? VAL A 123 . ? 1_555 ? 
20  AC3 25 GLU A 127 ? GLU A 127 . ? 1_555 ? 
21  AC3 25 ASP A 166 ? ASP A 166 . ? 1_555 ? 
22  AC3 25 LYS A 168 ? LYS A 168 . ? 1_555 ? 
23  AC3 25 GLU A 170 ? GLU A 170 . ? 1_555 ? 
24  AC3 25 ASN A 171 ? ASN A 171 . ? 1_555 ? 
25  AC3 25 LEU A 173 ? LEU A 173 . ? 1_555 ? 
26  AC3 25 THR A 183 ? THR A 183 . ? 1_555 ? 
27  AC3 25 ASP A 184 ? ASP A 184 . ? 1_555 ? 
28  AC3 25 MN  E .   ? MN  A 401 . ? 1_555 ? 
29  AC3 25 MN  F .   ? MN  A 402 . ? 1_555 ? 
30  AC3 25 HOH M .   ? HOH A 436 . ? 1_555 ? 
31  AC3 25 HOH M .   ? HOH A 451 . ? 1_555 ? 
32  AC3 25 ARG B 14  ? ARG I 14  . ? 1_555 ? 
33  AC3 25 ALA B 17  ? ALA I 17  . ? 1_555 ? 
34  AC4 1  PHE A 18  ? PHE A 18  . ? 1_555 ? 
35  AC5 4  ASN C 171 ? ASN B 171 . ? 1_555 ? 
36  AC5 4  ASP C 184 ? ASP B 184 . ? 1_555 ? 
37  AC5 4  ANP K .   ? ANP B 400 . ? 1_555 ? 
38  AC5 4  HOH O .   ? HOH B 449 . ? 1_555 ? 
39  AC6 4  ASP C 184 ? ASP B 184 . ? 1_555 ? 
40  AC6 4  ANP K .   ? ANP B 400 . ? 1_555 ? 
41  AC6 4  HOH O .   ? HOH B 435 . ? 1_555 ? 
42  AC6 4  HOH O .   ? HOH B 506 . ? 1_555 ? 
43  AC7 26 THR C 51  ? THR B 51  . ? 1_555 ? 
44  AC7 26 GLY C 52  ? GLY B 52  . ? 1_555 ? 
45  AC7 26 SER C 53  ? SER B 53  . ? 1_555 ? 
46  AC7 26 PHE C 54  ? PHE B 54  . ? 1_555 ? 
47  AC7 26 GLY C 55  ? GLY B 55  . ? 1_555 ? 
48  AC7 26 VAL C 57  ? VAL B 57  . ? 1_555 ? 
49  AC7 26 ALA C 70  ? ALA B 70  . ? 1_555 ? 
50  AC7 26 LYS C 72  ? LYS B 72  . ? 1_555 ? 
51  AC7 26 VAL C 104 ? VAL B 104 . ? 1_555 ? 
52  AC7 26 MET C 120 ? MET B 120 . ? 1_555 ? 
53  AC7 26 GLU C 121 ? GLU B 121 . ? 1_555 ? 
54  AC7 26 VAL C 123 ? VAL B 123 . ? 1_555 ? 
55  AC7 26 GLU C 127 ? GLU B 127 . ? 1_555 ? 
56  AC7 26 ASP C 166 ? ASP B 166 . ? 1_555 ? 
57  AC7 26 LYS C 168 ? LYS B 168 . ? 1_555 ? 
58  AC7 26 GLU C 170 ? GLU B 170 . ? 1_555 ? 
59  AC7 26 ASN C 171 ? ASN B 171 . ? 1_555 ? 
60  AC7 26 LEU C 173 ? LEU B 173 . ? 1_555 ? 
61  AC7 26 THR C 183 ? THR B 183 . ? 1_555 ? 
62  AC7 26 ASP C 184 ? ASP B 184 . ? 1_555 ? 
63  AC7 26 PHE C 327 ? PHE B 327 . ? 1_555 ? 
64  AC7 26 MN  I .   ? MN  B 401 . ? 1_555 ? 
65  AC7 26 MN  J .   ? MN  B 402 . ? 1_555 ? 
66  AC7 26 HOH O .   ? HOH B 449 . ? 1_555 ? 
67  AC7 26 ARG D 14  ? ARG J 14  . ? 1_555 ? 
68  AC7 26 ALA D 17  ? ALA J 17  . ? 1_555 ? 
69  AC8 2  LEU C 152 ? LEU B 152 . ? 1_555 ? 
70  AC8 2  GLU C 155 ? GLU B 155 . ? 1_555 ? 
71  AC9 54 THR A 51  ? THR A 51  . ? 1_555 ? 
72  AC9 54 GLY A 52  ? GLY A 52  . ? 1_555 ? 
73  AC9 54 SER A 53  ? SER A 53  . ? 1_555 ? 
74  AC9 54 PHE A 54  ? PHE A 54  . ? 1_555 ? 
75  AC9 54 LEU A 82  ? LEU A 82  . ? 1_555 ? 
76  AC9 54 GLU A 86  ? GLU A 86  . ? 4_655 ? 
77  AC9 54 LEU A 89  ? LEU A 89  . ? 4_655 ? 
78  AC9 54 ARG A 93  ? ARG A 93  . ? 4_655 ? 
79  AC9 54 GLU A 127 ? GLU A 127 . ? 1_555 ? 
80  AC9 54 PHE A 129 ? PHE A 129 . ? 1_555 ? 
81  AC9 54 ARG A 133 ? ARG A 133 . ? 1_555 ? 
82  AC9 54 LYS A 168 ? LYS A 168 . ? 1_555 ? 
83  AC9 54 PRO A 169 ? PRO A 169 . ? 1_555 ? 
84  AC9 54 GLU A 170 ? GLU A 170 . ? 1_555 ? 
85  AC9 54 PHE A 187 ? PHE A 187 . ? 1_555 ? 
86  AC9 54 LYS A 189 ? LYS A 189 . ? 4_655 ? 
87  AC9 54 ARG A 190 ? ARG A 190 . ? 4_655 ? 
88  AC9 54 VAL A 191 ? VAL A 191 . ? 4_655 ? 
89  AC9 54 LYS A 192 ? LYS A 192 . ? 4_655 ? 
90  AC9 54 LEU A 198 ? LEU A 198 . ? 1_555 ? 
91  AC9 54 GLY A 200 ? GLY A 200 . ? 1_555 ? 
92  AC9 54 THR A 201 ? THR A 201 . ? 1_555 ? 
93  AC9 54 PRO A 202 ? PRO A 202 . ? 1_555 ? 
94  AC9 54 GLU A 203 ? GLU A 203 . ? 1_555 ? 
95  AC9 54 GLU A 230 ? GLU A 230 . ? 1_555 ? 
96  AC9 54 TYR A 235 ? TYR A 235 . ? 1_555 ? 
97  AC9 54 PHE A 239 ? PHE A 239 . ? 1_555 ? 
98  AC9 54 ALA A 240 ? ALA A 240 . ? 1_555 ? 
99  AC9 54 ASP A 241 ? ASP A 241 . ? 1_555 ? 
100 AC9 54 TYR A 330 ? TYR A 330 . ? 1_555 ? 
101 AC9 54 GLU A 349 ? GLU A 349 . ? 4_655 ? 
102 AC9 54 ANP G .   ? ANP A 400 . ? 1_555 ? 
103 AC9 54 HOH M .   ? HOH A 411 . ? 4_655 ? 
104 AC9 54 HOH M .   ? HOH A 440 . ? 4_655 ? 
105 AC9 54 HOH M .   ? HOH A 453 . ? 4_655 ? 
106 AC9 54 HOH M .   ? HOH A 500 . ? 1_555 ? 
107 AC9 54 HOH M .   ? HOH A 507 . ? 4_655 ? 
108 AC9 54 HOH M .   ? HOH A 526 . ? 1_555 ? 
109 AC9 54 HOH M .   ? HOH A 532 . ? 1_555 ? 
110 AC9 54 HOH N .   ? HOH I 49  . ? 1_555 ? 
111 AC9 54 HOH N .   ? HOH I 54  . ? 1_555 ? 
112 AC9 54 HOH N .   ? HOH I 63  . ? 1_555 ? 
113 AC9 54 HOH N .   ? HOH I 73  . ? 1_555 ? 
114 AC9 54 HOH N .   ? HOH I 75  . ? 1_555 ? 
115 AC9 54 HOH N .   ? HOH I 76  . ? 1_555 ? 
116 AC9 54 HOH N .   ? HOH I 77  . ? 1_555 ? 
117 AC9 54 HOH N .   ? HOH I 79  . ? 1_555 ? 
118 AC9 54 HOH N .   ? HOH I 88  . ? 1_555 ? 
119 AC9 54 HOH N .   ? HOH I 110 . ? 1_555 ? 
120 AC9 54 HOH N .   ? HOH I 111 . ? 1_555 ? 
121 AC9 54 HOH N .   ? HOH I 129 . ? 1_555 ? 
122 AC9 54 HOH N .   ? HOH I 146 . ? 1_555 ? 
123 AC9 54 HOH N .   ? HOH I 147 . ? 1_555 ? 
124 AC9 54 HOH N .   ? HOH I 148 . ? 1_555 ? 
125 BC1 52 THR C 51  ? THR B 51  . ? 1_555 ? 
126 BC1 52 GLY C 52  ? GLY B 52  . ? 1_555 ? 
127 BC1 52 SER C 53  ? SER B 53  . ? 1_555 ? 
128 BC1 52 PHE C 54  ? PHE B 54  . ? 1_555 ? 
129 BC1 52 GLU C 86  ? GLU B 86  . ? 4_555 ? 
130 BC1 52 LEU C 89  ? LEU B 89  . ? 4_555 ? 
131 BC1 52 ARG C 93  ? ARG B 93  . ? 4_555 ? 
132 BC1 52 GLU C 127 ? GLU B 127 . ? 1_555 ? 
133 BC1 52 PHE C 129 ? PHE B 129 . ? 1_555 ? 
134 BC1 52 ARG C 133 ? ARG B 133 . ? 1_555 ? 
135 BC1 52 LYS C 168 ? LYS B 168 . ? 1_555 ? 
136 BC1 52 PRO C 169 ? PRO B 169 . ? 1_555 ? 
137 BC1 52 GLU C 170 ? GLU B 170 . ? 1_555 ? 
138 BC1 52 ARG C 190 ? ARG B 190 . ? 4_555 ? 
139 BC1 52 VAL C 191 ? VAL B 191 . ? 4_555 ? 
140 BC1 52 LYS C 192 ? LYS B 192 . ? 4_555 ? 
141 BC1 52 GLY C 200 ? GLY B 200 . ? 1_555 ? 
142 BC1 52 THR C 201 ? THR B 201 . ? 1_555 ? 
143 BC1 52 PRO C 202 ? PRO B 202 . ? 1_555 ? 
144 BC1 52 GLU C 203 ? GLU B 203 . ? 1_555 ? 
145 BC1 52 GLU C 230 ? GLU B 230 . ? 1_555 ? 
146 BC1 52 GLY C 234 ? GLY B 234 . ? 1_555 ? 
147 BC1 52 TYR C 235 ? TYR B 235 . ? 1_555 ? 
148 BC1 52 PRO C 236 ? PRO B 236 . ? 1_555 ? 
149 BC1 52 PHE C 239 ? PHE B 239 . ? 1_555 ? 
150 BC1 52 ALA C 240 ? ALA B 240 . ? 1_555 ? 
151 BC1 52 ASP C 241 ? ASP B 241 . ? 1_555 ? 
152 BC1 52 ILE C 246 ? ILE B 246 . ? 1_555 ? 
153 BC1 52 TYR C 330 ? TYR B 330 . ? 1_555 ? 
154 BC1 52 GLU C 349 ? GLU B 349 . ? 4_555 ? 
155 BC1 52 ANP K .   ? ANP B 400 . ? 1_555 ? 
156 BC1 52 HOH O .   ? HOH B 412 . ? 4_555 ? 
157 BC1 52 HOH O .   ? HOH B 451 . ? 4_555 ? 
158 BC1 52 HOH O .   ? HOH B 456 . ? 4_555 ? 
159 BC1 52 HOH O .   ? HOH B 500 . ? 4_555 ? 
160 BC1 52 HOH O .   ? HOH B 527 . ? 1_555 ? 
161 BC1 52 HOH P .   ? HOH J 196 . ? 1_555 ? 
162 BC1 52 HOH P .   ? HOH J 210 . ? 1_555 ? 
163 BC1 52 HOH P .   ? HOH J 211 . ? 1_555 ? 
164 BC1 52 HOH P .   ? HOH J 218 . ? 1_555 ? 
165 BC1 52 HOH P .   ? HOH J 221 . ? 1_555 ? 
166 BC1 52 HOH P .   ? HOH J 222 . ? 1_555 ? 
167 BC1 52 HOH P .   ? HOH J 223 . ? 1_555 ? 
168 BC1 52 HOH P .   ? HOH J 224 . ? 1_555 ? 
169 BC1 52 HOH P .   ? HOH J 225 . ? 1_555 ? 
170 BC1 52 HOH P .   ? HOH J 254 . ? 1_555 ? 
171 BC1 52 HOH P .   ? HOH J 256 . ? 1_555 ? 
172 BC1 52 HOH P .   ? HOH J 257 . ? 1_555 ? 
173 BC1 52 HOH P .   ? HOH J 258 . ? 1_555 ? 
174 BC1 52 HOH P .   ? HOH J 288 . ? 1_555 ? 
175 BC1 52 HOH P .   ? HOH J 296 . ? 1_555 ? 
176 BC1 52 HOH P .   ? HOH J 312 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1CDK 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1CDK 
_atom_sites.fract_transf_matrix[1][1]   0.009293 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   -0.000229 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012407 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009085 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . LYS A 1 8   ? 102.753 19.263  48.674 0.00 49.76 ? 8   LYS A N     1 
ATOM   2    C  CA    . LYS A 1 8   ? 104.199 19.203  49.020 0.00 50.81 ? 8   LYS A CA    1 
ATOM   3    C  C     . LYS A 1 8   ? 104.692 18.048  49.909 0.00 47.31 ? 8   LYS A C     1 
ATOM   4    O  O     . LYS A 1 8   ? 104.859 18.165  51.117 0.00 46.05 ? 8   LYS A O     1 
ATOM   5    C  CG    . LYS A 1 8   ? 104.890 21.596  48.419 0.00 67.46 ? 8   LYS A CG    1 
ATOM   6    C  CD    . LYS A 1 8   ? 103.556 22.101  47.880 0.00 77.24 ? 8   LYS A CD    1 
ATOM   7    C  CE    . LYS A 1 8   ? 103.650 22.475  46.409 0.00 84.04 ? 8   LYS A CE    1 
ATOM   8    N  NZ    . LYS A 1 8   ? 103.729 21.265  45.536 0.00 90.07 ? 8   LYS A NZ    1 
ATOM   9    N  N     . GLY A 1 9   ? 104.769 16.907  49.239 1.00 40.74 ? 9   GLY A N     1 
ATOM   10   C  CA    . GLY A 1 9   ? 105.288 15.618  49.693 1.00 33.43 ? 9   GLY A CA    1 
ATOM   11   C  C     . GLY A 1 9   ? 104.348 15.200  50.808 1.00 30.98 ? 9   GLY A C     1 
ATOM   12   O  O     . GLY A 1 9   ? 103.410 14.480  50.590 1.00 36.75 ? 9   GLY A O     1 
ATOM   13   N  N     . SER A 1 10  ? 104.556 15.693  52.014 1.00 30.95 ? 10  SER A N     1 
ATOM   14   C  CA    . SER A 1 10  ? 103.674 15.515  53.154 1.00 38.56 ? 10  SER A CA    1 
ATOM   15   C  C     . SER A 1 10  ? 102.312 16.087  52.773 1.00 41.74 ? 10  SER A C     1 
ATOM   16   O  O     . SER A 1 10  ? 101.334 15.387  52.975 1.00 43.52 ? 10  SER A O     1 
ATOM   17   C  CB    . SER A 1 10  ? 104.210 16.275  54.370 1.00 38.13 ? 10  SER A CB    1 
ATOM   18   O  OG    . SER A 1 10  ? 103.198 16.404  55.354 1.00 46.59 ? 10  SER A OG    1 
ATOM   19   N  N     . GLU A 1 11  ? 102.278 17.245  52.095 1.00 43.06 ? 11  GLU A N     1 
ATOM   20   C  CA    . GLU A 1 11  ? 101.046 17.902  51.609 1.00 41.44 ? 11  GLU A CA    1 
ATOM   21   C  C     . GLU A 1 11  ? 100.307 17.169  50.460 1.00 44.19 ? 11  GLU A C     1 
ATOM   22   O  O     . GLU A 1 11  ? 99.052  17.230  50.349 1.00 41.27 ? 11  GLU A O     1 
ATOM   23   C  CB    . GLU A 1 11  ? 101.363 19.336  51.250 1.00 38.16 ? 11  GLU A CB    1 
ATOM   24   C  CG    . GLU A 1 11  ? 101.540 20.182  52.519 1.00 44.35 ? 11  GLU A CG    1 
ATOM   25   C  CD    . GLU A 1 11  ? 102.202 21.560  52.301 1.00 50.54 ? 11  GLU A CD    1 
ATOM   26   O  OE1   . GLU A 1 11  ? 102.572 21.960  51.155 1.00 49.69 ? 11  GLU A OE1   1 
ATOM   27   O  OE2   . GLU A 1 11  ? 102.360 22.265  53.332 1.00 55.55 ? 11  GLU A OE2   1 
ATOM   28   N  N     . GLN A 1 12  ? 101.086 16.434  49.647 1.00 42.10 ? 12  GLN A N     1 
ATOM   29   C  CA    . GLN A 1 12  ? 100.537 15.633  48.559 1.00 41.67 ? 12  GLN A CA    1 
ATOM   30   C  C     . GLN A 1 12  ? 99.837  14.447  49.213 1.00 42.37 ? 12  GLN A C     1 
ATOM   31   O  O     . GLN A 1 12  ? 98.723  14.123  48.853 1.00 43.71 ? 12  GLN A O     1 
ATOM   32   C  CB    . GLN A 1 12  ? 101.600 15.168  47.567 1.00 44.13 ? 12  GLN A CB    1 
ATOM   33   C  CG    . GLN A 1 12  ? 102.249 16.281  46.703 1.00 56.40 ? 12  GLN A CG    1 
ATOM   34   C  CD    . GLN A 1 12  ? 103.360 15.806  45.719 1.00 63.25 ? 12  GLN A CD    1 
ATOM   35   O  OE1   . GLN A 1 12  ? 103.677 16.528  44.741 1.00 71.35 ? 12  GLN A OE1   1 
ATOM   36   N  NE2   . GLN A 1 12  ? 103.969 14.628  45.973 1.00 61.72 ? 12  GLN A NE2   1 
ATOM   37   N  N     . GLU A 1 13  ? 100.404 13.924  50.298 1.00 38.89 ? 13  GLU A N     1 
ATOM   38   C  CA    . GLU A 1 13  ? 99.830  12.797  51.018 1.00 37.58 ? 13  GLU A CA    1 
ATOM   39   C  C     . GLU A 1 13  ? 98.561  13.258  51.703 1.00 39.05 ? 13  GLU A C     1 
ATOM   40   O  O     . GLU A 1 13  ? 97.567  12.532  51.639 1.00 44.22 ? 13  GLU A O     1 
ATOM   41   C  CB    . GLU A 1 13  ? 100.785 12.278  52.088 1.00 34.31 ? 13  GLU A CB    1 
ATOM   42   C  CG    . GLU A 1 13  ? 101.931 11.560  51.458 1.00 36.86 ? 13  GLU A CG    1 
ATOM   43   C  CD    . GLU A 1 13  ? 103.020 11.249  52.435 1.00 43.88 ? 13  GLU A CD    1 
ATOM   44   O  OE1   . GLU A 1 13  ? 103.117 11.775  53.561 1.00 45.22 ? 13  GLU A OE1   1 
ATOM   45   O  OE2   . GLU A 1 13  ? 103.832 10.405  52.047 1.00 54.96 ? 13  GLU A OE2   1 
ATOM   46   N  N     . SER A 1 14  ? 98.594  14.429  52.339 1.00 32.28 ? 14  SER A N     1 
ATOM   47   C  CA    . SER A 1 14  ? 97.439  14.973  53.025 1.00 33.09 ? 14  SER A CA    1 
ATOM   48   C  C     . SER A 1 14  ? 96.287  15.172  52.050 1.00 33.82 ? 14  SER A C     1 
ATOM   49   O  O     . SER A 1 14  ? 95.161  14.886  52.417 1.00 34.07 ? 14  SER A O     1 
ATOM   50   C  CB    . SER A 1 14  ? 97.761  16.347  53.630 1.00 33.69 ? 14  SER A CB    1 
ATOM   51   O  OG    . SER A 1 14  ? 98.546  16.220  54.787 1.00 32.97 ? 14  SER A OG    1 
ATOM   52   N  N     . VAL A 1 15  ? 96.599  15.566  50.808 1.00 35.66 ? 15  VAL A N     1 
ATOM   53   C  CA    . VAL A 1 15  ? 95.600  15.847  49.758 1.00 34.63 ? 15  VAL A CA    1 
ATOM   54   C  C     . VAL A 1 15  ? 94.960  14.543  49.293 1.00 35.32 ? 15  VAL A C     1 
ATOM   55   O  O     . VAL A 1 15  ? 93.720  14.488  49.282 1.00 31.86 ? 15  VAL A O     1 
ATOM   56   C  CB    . VAL A 1 15  ? 96.134  16.725  48.559 1.00 32.69 ? 15  VAL A CB    1 
ATOM   57   C  CG1   . VAL A 1 15  ? 95.106  16.783  47.395 1.00 22.96 ? 15  VAL A CG1   1 
ATOM   58   C  CG2   . VAL A 1 15  ? 96.447  18.158  49.057 1.00 30.15 ? 15  VAL A CG2   1 
ATOM   59   N  N     . LYS A 1 16  ? 95.814  13.540  49.032 1.00 34.11 ? 16  LYS A N     1 
ATOM   60   C  CA    . LYS A 1 16  ? 95.461  12.179  48.614 1.00 33.43 ? 16  LYS A CA    1 
ATOM   61   C  C     . LYS A 1 16  ? 94.537  11.567  49.684 1.00 31.14 ? 16  LYS A C     1 
ATOM   62   O  O     . LYS A 1 16  ? 93.417  11.204  49.337 1.00 27.96 ? 16  LYS A O     1 
ATOM   63   C  CB    . LYS A 1 16  ? 96.727  11.337  48.436 1.00 39.06 ? 16  LYS A CB    1 
ATOM   64   C  CG    . LYS A 1 16  ? 96.479  9.970   47.755 1.00 51.40 ? 16  LYS A CG    1 
ATOM   65   C  CD    . LYS A 1 16  ? 97.747  9.168   47.379 1.00 58.27 ? 16  LYS A CD    1 
ATOM   66   C  CE    . LYS A 1 16  ? 98.723  10.046  46.533 1.00 65.57 ? 16  LYS A CE    1 
ATOM   67   N  NZ    . LYS A 1 16  ? 99.978  9.458   45.960 1.00 66.55 ? 16  LYS A NZ    1 
ATOM   68   N  N     . GLU A 1 17  ? 94.925  11.651  50.962 1.00 28.55 ? 17  GLU A N     1 
ATOM   69   C  CA    . GLU A 1 17  ? 94.144  11.167  52.078 1.00 29.42 ? 17  GLU A CA    1 
ATOM   70   C  C     . GLU A 1 17  ? 92.857  11.966  52.198 1.00 32.76 ? 17  GLU A C     1 
ATOM   71   O  O     . GLU A 1 17  ? 91.798  11.349  52.294 1.00 34.42 ? 17  GLU A O     1 
ATOM   72   C  CB    . GLU A 1 17  ? 94.915  11.201  53.384 1.00 35.10 ? 17  GLU A CB    1 
ATOM   73   C  CG    . GLU A 1 17  ? 94.962  9.905   54.220 1.00 34.46 ? 17  GLU A CG    1 
ATOM   74   C  CD    . GLU A 1 17  ? 95.477  10.097  55.666 1.00 37.89 ? 17  GLU A CD    1 
ATOM   75   O  OE1   . GLU A 1 17  ? 96.374  10.897  56.000 1.00 37.98 ? 17  GLU A OE1   1 
ATOM   76   O  OE2   . GLU A 1 17  ? 94.949  9.435   56.576 1.00 46.85 ? 17  GLU A OE2   1 
ATOM   77   N  N     . PHE A 1 18  ? 92.884  13.291  52.036 1.00 34.94 ? 18  PHE A N     1 
ATOM   78   C  CA    . PHE A 1 18  ? 91.638  14.124  52.043 1.00 35.20 ? 18  PHE A CA    1 
ATOM   79   C  C     . PHE A 1 18  ? 90.516  13.646  51.056 1.00 29.27 ? 18  PHE A C     1 
ATOM   80   O  O     . PHE A 1 18  ? 89.356  13.638  51.398 1.00 25.45 ? 18  PHE A O     1 
ATOM   81   C  CB    . PHE A 1 18  ? 91.984  15.605  51.729 1.00 41.04 ? 18  PHE A CB    1 
ATOM   82   C  CG    . PHE A 1 18  ? 90.776  16.534  51.640 1.00 38.73 ? 18  PHE A CG    1 
ATOM   83   C  CD1   . PHE A 1 18  ? 90.123  16.945  52.824 1.00 38.39 ? 18  PHE A CD1   1 
ATOM   84   C  CD2   . PHE A 1 18  ? 90.219  16.840  50.378 1.00 33.18 ? 18  PHE A CD2   1 
ATOM   85   C  CE1   . PHE A 1 18  ? 88.887  17.619  52.722 1.00 42.20 ? 18  PHE A CE1   1 
ATOM   86   C  CE2   . PHE A 1 18  ? 89.006  17.512  50.255 1.00 34.28 ? 18  PHE A CE2   1 
ATOM   87   C  CZ    . PHE A 1 18  ? 88.322  17.897  51.405 1.00 35.16 ? 18  PHE A CZ    1 
ATOM   88   N  N     . LEU A 1 19  ? 90.906  13.556  49.788 1.00 22.93 ? 19  LEU A N     1 
ATOM   89   C  CA    . LEU A 1 19  ? 90.162  13.168  48.643 1.00 20.04 ? 19  LEU A CA    1 
ATOM   90   C  C     . LEU A 1 19  ? 89.621  11.746  48.760 1.00 25.63 ? 19  LEU A C     1 
ATOM   91   O  O     . LEU A 1 19  ? 88.492  11.546  48.294 1.00 23.87 ? 19  LEU A O     1 
ATOM   92   C  CB    . LEU A 1 19  ? 91.058  13.337  47.408 1.00 20.07 ? 19  LEU A CB    1 
ATOM   93   C  CG    . LEU A 1 19  ? 91.398  14.753  46.912 1.00 20.50 ? 19  LEU A CG    1 
ATOM   94   C  CD1   . LEU A 1 19  ? 92.083  14.647  45.499 1.00 22.76 ? 19  LEU A CD1   1 
ATOM   95   C  CD2   . LEU A 1 19  ? 90.125  15.653  46.850 1.00 19.14 ? 19  LEU A CD2   1 
ATOM   96   N  N     . ALA A 1 20  ? 90.377  10.811  49.367 1.00 21.72 ? 20  ALA A N     1 
ATOM   97   C  CA    . ALA A 1 20  ? 89.932  9.423   49.635 1.00 26.41 ? 20  ALA A CA    1 
ATOM   98   C  C     . ALA A 1 20  ? 88.694  9.463   50.550 1.00 25.28 ? 20  ALA A C     1 
ATOM   99   O  O     . ALA A 1 20  ? 87.634  8.938   50.171 1.00 27.42 ? 20  ALA A O     1 
ATOM   100  C  CB    . ALA A 1 20  ? 90.996  8.633   50.297 1.00 24.14 ? 20  ALA A CB    1 
ATOM   101  N  N     . LYS A 1 21  ? 88.747  10.354  51.540 1.00 22.00 ? 21  LYS A N     1 
ATOM   102  C  CA    . LYS A 1 21  ? 87.650  10.499  52.479 1.00 25.41 ? 21  LYS A CA    1 
ATOM   103  C  C     . LYS A 1 21  ? 86.468  11.316  51.899 1.00 30.52 ? 21  LYS A C     1 
ATOM   104  O  O     . LYS A 1 21  ? 85.300  10.950  52.054 1.00 34.40 ? 21  LYS A O     1 
ATOM   105  C  CB    . LYS A 1 21  ? 88.195  11.137  53.733 1.00 26.60 ? 21  LYS A CB    1 
ATOM   106  C  CG    . LYS A 1 21  ? 89.424  10.463  54.334 1.00 42.15 ? 21  LYS A CG    1 
ATOM   107  C  CD    . LYS A 1 21  ? 89.133  9.065   54.941 1.00 52.22 ? 21  LYS A CD    1 
ATOM   108  C  CE    . LYS A 1 21  ? 90.341  8.083   54.820 1.00 59.14 ? 21  LYS A CE    1 
ATOM   109  N  NZ    . LYS A 1 21  ? 90.584  7.529   53.430 1.00 60.45 ? 21  LYS A NZ    1 
ATOM   110  N  N     . ALA A 1 22  ? 86.725  12.392  51.162 1.00 28.04 ? 22  ALA A N     1 
ATOM   111  C  CA    . ALA A 1 22  ? 85.663  13.177  50.534 1.00 26.47 ? 22  ALA A CA    1 
ATOM   112  C  C     . ALA A 1 22  ? 84.899  12.313  49.560 1.00 25.92 ? 22  ALA A C     1 
ATOM   113  O  O     . ALA A 1 22  ? 83.712  12.597  49.316 1.00 31.78 ? 22  ALA A O     1 
ATOM   114  C  CB    . ALA A 1 22  ? 86.226  14.426  49.763 1.00 24.55 ? 22  ALA A CB    1 
ATOM   115  N  N     . LYS A 1 23  ? 85.593  11.359  48.915 1.00 26.50 ? 23  LYS A N     1 
ATOM   116  C  CA    . LYS A 1 23  ? 84.999  10.463  47.921 1.00 22.39 ? 23  LYS A CA    1 
ATOM   117  C  C     . LYS A 1 23  ? 83.930  9.557   48.556 1.00 25.35 ? 23  LYS A C     1 
ATOM   118  O  O     . LYS A 1 23  ? 82.790  9.602   48.124 1.00 27.19 ? 23  LYS A O     1 
ATOM   119  C  CB    . LYS A 1 23  ? 86.086  9.789   47.083 1.00 24.64 ? 23  LYS A CB    1 
ATOM   120  C  CG    . LYS A 1 23  ? 85.691  8.634   46.179 1.00 24.91 ? 23  LYS A CG    1 
ATOM   121  C  CD    . LYS A 1 23  ? 85.179  8.860   44.795 1.00 27.63 ? 23  LYS A CD    1 
ATOM   122  C  CE    . LYS A 1 23  ? 86.236  8.476   43.804 1.00 32.48 ? 23  LYS A CE    1 
ATOM   123  N  NZ    . LYS A 1 23  ? 85.659  8.429   42.426 1.00 34.98 ? 23  LYS A NZ    1 
ATOM   124  N  N     . GLU A 1 24  ? 84.211  9.118   49.782 1.00 26.56 ? 24  GLU A N     1 
ATOM   125  C  CA    . GLU A 1 24  ? 83.306  8.335   50.642 1.00 30.07 ? 24  GLU A CA    1 
ATOM   126  C  C     . GLU A 1 24  ? 82.095  9.199   50.965 1.00 28.50 ? 24  GLU A C     1 
ATOM   127  O  O     . GLU A 1 24  ? 80.958  8.736   50.747 1.00 34.12 ? 24  GLU A O     1 
ATOM   128  C  CB    . GLU A 1 24  ? 83.955  7.839   51.948 1.00 33.19 ? 24  GLU A CB    1 
ATOM   129  C  CG    . GLU A 1 24  ? 84.884  6.644   51.832 1.00 45.76 ? 24  GLU A CG    1 
ATOM   130  C  CD    . GLU A 1 24  ? 85.913  6.589   52.978 1.00 54.95 ? 24  GLU A CD    1 
ATOM   131  O  OE1   . GLU A 1 24  ? 85.482  6.461   54.153 1.00 50.73 ? 24  GLU A OE1   1 
ATOM   132  O  OE2   . GLU A 1 24  ? 87.151  6.703   52.722 1.00 60.86 ? 24  GLU A OE2   1 
ATOM   133  N  N     . ASP A 1 25  ? 82.280  10.474  51.288 1.00 26.02 ? 25  ASP A N     1 
ATOM   134  C  CA    . ASP A 1 25  ? 81.080  11.286  51.449 1.00 26.21 ? 25  ASP A CA    1 
ATOM   135  C  C     . ASP A 1 25  ? 80.279  11.570  50.215 1.00 25.22 ? 25  ASP A C     1 
ATOM   136  O  O     . ASP A 1 25  ? 79.047  11.452  50.244 1.00 27.23 ? 25  ASP A O     1 
ATOM   137  C  CB    . ASP A 1 25  ? 81.251  12.511  52.297 1.00 36.72 ? 25  ASP A CB    1 
ATOM   138  C  CG    . ASP A 1 25  ? 81.496  12.117  53.740 1.00 51.88 ? 25  ASP A CG    1 
ATOM   139  O  OD1   . ASP A 1 25  ? 80.661  11.378  54.361 1.00 59.51 ? 25  ASP A OD1   1 
ATOM   140  O  OD2   . ASP A 1 25  ? 82.582  12.519  54.216 1.00 56.99 ? 25  ASP A OD2   1 
ATOM   141  N  N     . PHE A 1 26  ? 80.965  11.721  49.090 1.00 23.86 ? 26  PHE A N     1 
ATOM   142  C  CA    . PHE A 1 26  ? 80.253  11.976  47.876 1.00 22.77 ? 26  PHE A CA    1 
ATOM   143  C  C     . PHE A 1 26  ? 79.369  10.760  47.498 1.00 24.87 ? 26  PHE A C     1 
ATOM   144  O  O     . PHE A 1 26  ? 78.240  10.931  47.037 1.00 26.09 ? 26  PHE A O     1 
ATOM   145  C  CB    . PHE A 1 26  ? 81.235  12.277  46.739 1.00 22.55 ? 26  PHE A CB    1 
ATOM   146  C  CG    . PHE A 1 26  ? 80.572  12.310  45.366 1.00 17.68 ? 26  PHE A CG    1 
ATOM   147  C  CD1   . PHE A 1 26  ? 79.718  13.376  45.021 1.00 17.47 ? 26  PHE A CD1   1 
ATOM   148  C  CD2   . PHE A 1 26  ? 80.745  11.261  44.484 1.00 12.21 ? 26  PHE A CD2   1 
ATOM   149  C  CE1   . PHE A 1 26  ? 79.050  13.413  43.806 1.00 12.70 ? 26  PHE A CE1   1 
ATOM   150  C  CE2   . PHE A 1 26  ? 80.078  11.253  43.234 1.00 20.82 ? 26  PHE A CE2   1 
ATOM   151  C  CZ    . PHE A 1 26  ? 79.204  12.357  42.874 1.00 24.75 ? 26  PHE A CZ    1 
ATOM   152  N  N     . LEU A 1 27  ? 79.913  9.554   47.658 1.00 25.80 ? 27  LEU A N     1 
ATOM   153  C  CA    . LEU A 1 27  ? 79.255  8.317   47.205 1.00 27.25 ? 27  LEU A CA    1 
ATOM   154  C  C     . LEU A 1 27  ? 77.957  7.983   47.923 1.00 25.36 ? 27  LEU A C     1 
ATOM   155  O  O     . LEU A 1 27  ? 76.948  7.671   47.260 1.00 27.69 ? 27  LEU A O     1 
ATOM   156  C  CB    . LEU A 1 27  ? 80.242  7.147   47.261 1.00 24.99 ? 27  LEU A CB    1 
ATOM   157  C  CG    . LEU A 1 27  ? 81.291  7.086   46.151 1.00 26.57 ? 27  LEU A CG    1 
ATOM   158  C  CD1   . LEU A 1 27  ? 82.175  5.877   46.460 1.00 26.67 ? 27  LEU A CD1   1 
ATOM   159  C  CD2   . LEU A 1 27  ? 80.812  7.094   44.725 1.00 24.11 ? 27  LEU A CD2   1 
ATOM   160  N  N     . LYS A 1 28  ? 77.965  8.265   49.224 1.00 22.44 ? 28  LYS A N     1 
ATOM   161  C  CA    . LYS A 1 28  ? 76.803  8.086   50.086 1.00 24.35 ? 28  LYS A CA    1 
ATOM   162  C  C     . LYS A 1 28  ? 75.626  8.938   49.650 1.00 25.77 ? 28  LYS A C     1 
ATOM   163  O  O     . LYS A 1 28  ? 74.535  8.415   49.512 1.00 27.88 ? 28  LYS A O     1 
ATOM   164  C  CB    . LYS A 1 28  ? 77.167  8.375   51.540 1.00 23.42 ? 28  LYS A CB    1 
ATOM   165  C  CG    . LYS A 1 28  ? 75.986  7.946   52.443 1.00 30.52 ? 28  LYS A CG    1 
ATOM   166  C  CD    . LYS A 1 28  ? 76.365  7.710   53.934 1.00 37.13 ? 28  LYS A CD    1 
ATOM   167  C  CE    . LYS A 1 28  ? 77.026  8.958   54.607 0.00 33.21 ? 28  LYS A CE    1 
ATOM   168  N  NZ    . LYS A 1 28  ? 76.173  10.041  55.269 0.00 29.82 ? 28  LYS A NZ    1 
ATOM   169  N  N     . LYS A 1 29  ? 75.893  10.169  49.175 1.00 29.18 ? 29  LYS A N     1 
ATOM   170  C  CA    . LYS A 1 29  ? 74.831  11.104  48.728 1.00 22.92 ? 29  LYS A CA    1 
ATOM   171  C  C     . LYS A 1 29  ? 74.499  10.898  47.324 1.00 18.98 ? 29  LYS A C     1 
ATOM   172  O  O     . LYS A 1 29  ? 73.370  11.132  46.962 1.00 24.81 ? 29  LYS A O     1 
ATOM   173  C  CB    . LYS A 1 29  ? 75.193  12.581  48.934 1.00 26.65 ? 29  LYS A CB    1 
ATOM   174  C  CG    . LYS A 1 29  ? 75.886  12.848  50.256 1.00 21.63 ? 29  LYS A CG    1 
ATOM   175  C  CD    . LYS A 1 29  ? 75.537  14.260  50.635 1.00 30.59 ? 29  LYS A CD    1 
ATOM   176  C  CE    . LYS A 1 29  ? 75.976  14.639  52.018 1.00 28.49 ? 29  LYS A CE    1 
ATOM   177  N  NZ    . LYS A 1 29  ? 77.479  14.608  51.724 1.00 44.04 ? 29  LYS A NZ    1 
ATOM   178  N  N     . TRP A 1 30  ? 75.468  10.518  46.494 1.00 20.11 ? 30  TRP A N     1 
ATOM   179  C  CA    . TRP A 1 30  ? 75.198  10.207  45.078 1.00 19.95 ? 30  TRP A CA    1 
ATOM   180  C  C     . TRP A 1 30  ? 74.241  8.954   44.940 1.00 26.23 ? 30  TRP A C     1 
ATOM   181  O  O     . TRP A 1 30  ? 73.445  8.861   43.995 1.00 22.05 ? 30  TRP A O     1 
ATOM   182  C  CB    . TRP A 1 30  ? 76.549  9.975   44.365 1.00 24.72 ? 30  TRP A CB    1 
ATOM   183  C  CG    . TRP A 1 30  ? 76.561  9.230   43.045 1.00 23.45 ? 30  TRP A CG    1 
ATOM   184  C  CD1   . TRP A 1 30  ? 76.797  7.894   42.879 1.00 27.43 ? 30  TRP A CD1   1 
ATOM   185  C  CD2   . TRP A 1 30  ? 76.260  9.740   41.743 1.00 30.04 ? 30  TRP A CD2   1 
ATOM   186  N  NE1   . TRP A 1 30  ? 76.584  7.508   41.584 1.00 27.06 ? 30  TRP A NE1   1 
ATOM   187  C  CE2   . TRP A 1 30  ? 76.236  8.611   40.853 1.00 30.81 ? 30  TRP A CE2   1 
ATOM   188  C  CE3   . TRP A 1 30  ? 75.983  11.033  41.234 1.00 28.68 ? 30  TRP A CE3   1 
ATOM   189  C  CZ2   . TRP A 1 30  ? 75.904  8.730   39.485 1.00 34.08 ? 30  TRP A CZ2   1 
ATOM   190  C  CZ3   . TRP A 1 30  ? 75.643  11.174  39.876 1.00 26.35 ? 30  TRP A CZ3   1 
ATOM   191  C  CH2   . TRP A 1 30  ? 75.592  10.012  39.007 1.00 36.50 ? 30  TRP A CH2   1 
ATOM   192  N  N     . GLU A 1 31  ? 74.527  7.923   45.740 1.00 26.47 ? 31  GLU A N     1 
ATOM   193  C  CA    . GLU A 1 31  ? 73.795  6.661   45.825 1.00 32.87 ? 31  GLU A CA    1 
ATOM   194  C  C     . GLU A 1 31  ? 72.434  6.927   46.500 1.00 28.57 ? 31  GLU A C     1 
ATOM   195  O  O     . GLU A 1 31  ? 71.474  6.392   46.018 1.00 30.72 ? 31  GLU A O     1 
ATOM   196  C  CB    . GLU A 1 31  ? 74.675  5.639   46.571 1.00 37.23 ? 31  GLU A CB    1 
ATOM   197  C  CG    . GLU A 1 31  ? 75.617  4.773   45.692 1.00 49.20 ? 31  GLU A CG    1 
ATOM   198  C  CD    . GLU A 1 31  ? 77.143  4.696   46.056 1.00 61.29 ? 31  GLU A CD    1 
ATOM   199  O  OE1   . GLU A 1 31  ? 77.529  4.286   47.183 1.00 63.78 ? 31  GLU A OE1   1 
ATOM   200  O  OE2   . GLU A 1 31  ? 78.018  4.922   45.171 1.00 61.24 ? 31  GLU A OE2   1 
ATOM   201  N  N     . ASN A 1 32  ? 72.317  7.779   47.523 1.00 30.26 ? 32  ASN A N     1 
ATOM   202  C  CA    . ASN A 1 32  ? 71.033  8.166   48.141 1.00 35.11 ? 32  ASN A CA    1 
ATOM   203  C  C     . ASN A 1 32  ? 70.683  9.696   47.997 1.00 35.76 ? 32  ASN A C     1 
ATOM   204  O  O     . ASN A 1 32  ? 70.829  10.487  48.973 1.00 33.60 ? 32  ASN A O     1 
ATOM   205  C  CB    . ASN A 1 32  ? 70.983  7.787   49.627 1.00 37.30 ? 32  ASN A CB    1 
ATOM   206  C  CG    . ASN A 1 32  ? 71.451  6.386   49.888 1.00 47.72 ? 32  ASN A CG    1 
ATOM   207  O  OD1   . ASN A 1 32  ? 70.719  5.414   49.570 1.00 54.61 ? 32  ASN A OD1   1 
ATOM   208  N  ND2   . ASN A 1 32  ? 72.718  6.253   50.329 1.00 44.73 ? 32  ASN A ND2   1 
ATOM   209  N  N     . PRO A 1 33  ? 70.160  10.118  46.828 1.00 30.41 ? 33  PRO A N     1 
ATOM   210  C  CA    . PRO A 1 33  ? 69.842  11.542  46.661 1.00 37.09 ? 33  PRO A CA    1 
ATOM   211  C  C     . PRO A 1 33  ? 68.655  11.992  47.495 1.00 38.24 ? 33  PRO A C     1 
ATOM   212  O  O     . PRO A 1 33  ? 67.857  11.157  47.868 1.00 45.60 ? 33  PRO A O     1 
ATOM   213  C  CB    . PRO A 1 33  ? 69.519  11.658  45.160 1.00 30.66 ? 33  PRO A CB    1 
ATOM   214  C  CG    . PRO A 1 33  ? 70.235  10.473  44.551 1.00 30.95 ? 33  PRO A CG    1 
ATOM   215  C  CD    . PRO A 1 33  ? 69.892  9.426   45.560 1.00 33.08 ? 33  PRO A CD    1 
ATOM   216  N  N     . ALA A 1 34  ? 68.668  13.231  47.969 1.00 40.05 ? 34  ALA A N     1 
ATOM   217  C  CA    . ALA A 1 34  ? 67.551  13.842  48.705 1.00 35.83 ? 34  ALA A CA    1 
ATOM   218  C  C     . ALA A 1 34  ? 66.577  14.392  47.652 1.00 38.85 ? 34  ALA A C     1 
ATOM   219  O  O     . ALA A 1 34  ? 67.058  14.890  46.612 1.00 39.86 ? 34  ALA A O     1 
ATOM   220  C  CB    . ALA A 1 34  ? 68.094  14.952  49.530 1.00 33.72 ? 34  ALA A CB    1 
ATOM   221  N  N     . GLN A 1 35  ? 65.258  14.237  47.872 1.00 35.87 ? 35  GLN A N     1 
ATOM   222  C  CA    . GLN A 1 35  ? 64.188  14.749  46.989 1.00 37.96 ? 35  GLN A CA    1 
ATOM   223  C  C     . GLN A 1 35  ? 63.157  15.661  47.712 1.00 37.80 ? 35  GLN A C     1 
ATOM   224  O  O     . GLN A 1 35  ? 63.012  15.510  48.927 1.00 40.40 ? 35  GLN A O     1 
ATOM   225  C  CB    . GLN A 1 35  ? 63.413  13.616  46.326 1.00 38.73 ? 35  GLN A CB    1 
ATOM   226  C  CG    . GLN A 1 35  ? 64.079  12.904  45.215 1.00 43.80 ? 35  GLN A CG    1 
ATOM   227  C  CD    . GLN A 1 35  ? 63.103  11.902  44.635 1.00 49.34 ? 35  GLN A CD    1 
ATOM   228  O  OE1   . GLN A 1 35  ? 62.267  12.226  43.776 1.00 49.99 ? 35  GLN A OE1   1 
ATOM   229  N  NE2   . GLN A 1 35  ? 63.157  10.675  45.156 1.00 53.59 ? 35  GLN A NE2   1 
ATOM   230  N  N     . ASN A 1 36  ? 62.338  16.432  46.980 1.00 37.12 ? 36  ASN A N     1 
ATOM   231  C  CA    . ASN A 1 36  ? 61.325  17.415  47.481 1.00 35.04 ? 36  ASN A CA    1 
ATOM   232  C  C     . ASN A 1 36  ? 61.431  17.877  48.892 1.00 33.41 ? 36  ASN A C     1 
ATOM   233  O  O     . ASN A 1 36  ? 60.858  17.335  49.817 1.00 32.24 ? 36  ASN A O     1 
ATOM   234  C  CB    . ASN A 1 36  ? 59.846  17.050  47.218 1.00 40.92 ? 36  ASN A CB    1 
ATOM   235  C  CG    . ASN A 1 36  ? 59.574  16.692  45.639 0.00 33.65 ? 36  ASN A CG    1 
ATOM   236  O  OD1   . ASN A 1 36  ? 58.819  17.439  45.012 0.00 33.06 ? 36  ASN A OD1   1 
ATOM   237  N  ND2   . ASN A 1 36  ? 60.213  15.590  45.022 0.00 33.06 ? 36  ASN A ND2   1 
ATOM   238  N  N     . THR A 1 37  ? 62.443  18.692  49.057 1.00 35.16 ? 37  THR A N     1 
ATOM   239  C  CA    . THR A 1 37  ? 62.822  19.256  50.334 1.00 39.01 ? 37  THR A CA    1 
ATOM   240  C  C     . THR A 1 37  ? 62.080  20.608  50.628 1.00 38.41 ? 37  THR A C     1 
ATOM   241  O  O     . THR A 1 37  ? 62.305  21.184  51.700 1.00 40.12 ? 37  THR A O     1 
ATOM   242  C  CB    . THR A 1 37  ? 64.393  19.263  50.269 1.00 40.20 ? 37  THR A CB    1 
ATOM   243  O  OG1   . THR A 1 37  ? 64.808  17.920  49.980 1.00 44.30 ? 37  THR A OG1   1 
ATOM   244  C  CG2   . THR A 1 37  ? 65.051  19.605  51.583 1.00 49.46 ? 37  THR A CG2   1 
ATOM   245  N  N     . ALA A 1 38  ? 61.255  21.114  49.690 1.00 34.59 ? 38  ALA A N     1 
ATOM   246  C  CA    . ALA A 1 38  ? 60.450  22.328  49.866 1.00 35.81 ? 38  ALA A CA    1 
ATOM   247  C  C     . ALA A 1 38  ? 59.230  22.398  48.921 1.00 36.52 ? 38  ALA A C     1 
ATOM   248  O  O     . ALA A 1 38  ? 58.879  21.412  48.269 1.00 38.17 ? 38  ALA A O     1 
ATOM   249  C  CB    . ALA A 1 38  ? 61.359  23.597  49.715 1.00 37.59 ? 38  ALA A CB    1 
ATOM   250  N  N     . HIS A 1 39  ? 58.463  23.483  48.956 1.00 35.42 ? 39  HIS A N     1 
ATOM   251  C  CA    . HIS A 1 39  ? 57.379  23.717  47.987 1.00 40.82 ? 39  HIS A CA    1 
ATOM   252  C  C     . HIS A 1 39  ? 57.453  25.217  47.666 1.00 40.76 ? 39  HIS A C     1 
ATOM   253  O  O     . HIS A 1 39  ? 57.820  26.015  48.557 1.00 39.42 ? 39  HIS A O     1 
ATOM   254  C  CB    . HIS A 1 39  ? 55.944  23.311  48.423 1.00 48.12 ? 39  HIS A CB    1 
ATOM   255  C  CG    . HIS A 1 39  ? 55.496  23.795  49.784 1.00 51.35 ? 39  HIS A CG    1 
ATOM   256  N  ND1   . HIS A 1 39  ? 55.898  23.199  50.967 1.00 53.40 ? 39  HIS A ND1   1 
ATOM   257  C  CD2   . HIS A 1 39  ? 54.621  24.766  50.143 1.00 50.26 ? 39  HIS A CD2   1 
ATOM   258  C  CE1   . HIS A 1 39  ? 55.288  23.772  51.991 1.00 49.83 ? 39  HIS A CE1   1 
ATOM   259  N  NE2   . HIS A 1 39  ? 54.523  24.738  51.517 1.00 48.57 ? 39  HIS A NE2   1 
ATOM   260  N  N     . LEU A 1 40  ? 56.938  25.560  46.478 1.00 38.05 ? 40  LEU A N     1 
ATOM   261  C  CA    . LEU A 1 40  ? 56.912  26.910  45.894 1.00 39.04 ? 40  LEU A CA    1 
ATOM   262  C  C     . LEU A 1 40  ? 56.391  28.020  46.747 1.00 42.25 ? 40  LEU A C     1 
ATOM   263  O  O     . LEU A 1 40  ? 57.027  29.071  46.818 1.00 46.15 ? 40  LEU A O     1 
ATOM   264  C  CB    . LEU A 1 40  ? 56.142  27.006  44.587 1.00 30.88 ? 40  LEU A CB    1 
ATOM   265  C  CG    . LEU A 1 40  ? 56.234  28.272  43.717 1.00 32.54 ? 40  LEU A CG    1 
ATOM   266  C  CD1   . LEU A 1 40  ? 57.635  28.814  43.411 1.00 34.18 ? 40  LEU A CD1   1 
ATOM   267  C  CD2   . LEU A 1 40  ? 55.585  27.963  42.398 1.00 33.45 ? 40  LEU A CD2   1 
ATOM   268  N  N     . ASP A 1 41  ? 55.355  27.690  47.520 1.00 45.51 ? 41  ASP A N     1 
ATOM   269  C  CA    . ASP A 1 41  ? 54.671  28.665  48.370 1.00 43.31 ? 41  ASP A CA    1 
ATOM   270  C  C     . ASP A 1 41  ? 55.207  29.149  49.680 1.00 38.46 ? 41  ASP A C     1 
ATOM   271  O  O     . ASP A 1 41  ? 54.848  30.183  50.177 1.00 37.79 ? 41  ASP A O     1 
ATOM   272  C  CB    . ASP A 1 41  ? 53.166  28.726  48.084 1.00 50.37 ? 41  ASP A CB    1 
ATOM   273  C  CG    . ASP A 1 41  ? 52.908  29.209  46.650 1.00 57.43 ? 41  ASP A CG    1 
ATOM   274  O  OD1   . ASP A 1 41  ? 53.716  30.042  46.167 1.00 58.74 ? 41  ASP A OD1   1 
ATOM   275  O  OD2   . ASP A 1 41  ? 52.021  28.690  45.929 1.00 62.88 ? 41  ASP A OD2   1 
ATOM   276  N  N     . GLN A 1 42  ? 56.332  28.568  50.006 1.00 35.48 ? 42  GLN A N     1 
ATOM   277  C  CA    . GLN A 1 42  ? 57.094  28.989  51.152 1.00 39.62 ? 42  GLN A CA    1 
ATOM   278  C  C     . GLN A 1 42  ? 58.016  30.138  50.712 1.00 33.24 ? 42  GLN A C     1 
ATOM   279  O  O     . GLN A 1 42  ? 58.808  30.584  51.516 1.00 35.39 ? 42  GLN A O     1 
ATOM   280  C  CB    . GLN A 1 42  ? 57.985  27.814  51.552 1.00 43.44 ? 42  GLN A CB    1 
ATOM   281  C  CG    . GLN A 1 42  ? 57.215  26.602  51.966 1.00 53.60 ? 42  GLN A CG    1 
ATOM   282  C  CD    . GLN A 1 42  ? 58.130  25.439  52.190 1.00 56.57 ? 42  GLN A CD    1 
ATOM   283  O  OE1   . GLN A 1 42  ? 58.264  24.606  51.297 1.00 55.23 ? 42  GLN A OE1   1 
ATOM   284  N  NE2   . GLN A 1 42  ? 58.744  25.354  53.374 1.00 56.16 ? 42  GLN A NE2   1 
ATOM   285  N  N     . PHE A 1 43  ? 57.974  30.561  49.452 1.00 30.46 ? 43  PHE A N     1 
ATOM   286  C  CA    . PHE A 1 43  ? 58.927  31.555  48.983 1.00 33.63 ? 43  PHE A CA    1 
ATOM   287  C  C     . PHE A 1 43  ? 58.205  32.691  48.342 1.00 31.77 ? 43  PHE A C     1 
ATOM   288  O  O     . PHE A 1 43  ? 57.392  32.514  47.432 1.00 30.48 ? 43  PHE A O     1 
ATOM   289  C  CB    . PHE A 1 43  ? 59.942  31.025  47.916 1.00 36.00 ? 43  PHE A CB    1 
ATOM   290  C  CG    . PHE A 1 43  ? 60.781  29.837  48.344 1.00 31.60 ? 43  PHE A CG    1 
ATOM   291  C  CD1   . PHE A 1 43  ? 61.847  30.022  49.232 1.00 32.54 ? 43  PHE A CD1   1 
ATOM   292  C  CD2   . PHE A 1 43  ? 60.352  28.514  48.021 1.00 33.54 ? 43  PHE A CD2   1 
ATOM   293  C  CE1   . PHE A 1 43  ? 62.471  28.914  49.839 1.00 36.55 ? 43  PHE A CE1   1 
ATOM   294  C  CE2   . PHE A 1 43  ? 60.946  27.391  48.614 1.00 23.30 ? 43  PHE A CE2   1 
ATOM   295  C  CZ    . PHE A 1 43  ? 61.993  27.595  49.524 1.00 30.14 ? 43  PHE A CZ    1 
ATOM   296  N  N     . GLU A 1 44  ? 58.736  33.857  48.681 1.00 36.81 ? 44  GLU A N     1 
ATOM   297  C  CA    . GLU A 1 44  ? 58.358  35.130  48.068 1.00 37.77 ? 44  GLU A CA    1 
ATOM   298  C  C     . GLU A 1 44  ? 59.460  35.433  47.007 1.00 32.06 ? 44  GLU A C     1 
ATOM   299  O  O     . GLU A 1 44  ? 60.638  35.379  47.313 1.00 29.26 ? 44  GLU A O     1 
ATOM   300  C  CB    . GLU A 1 44  ? 58.338  36.152  49.191 1.00 42.47 ? 44  GLU A CB    1 
ATOM   301  C  CG    . GLU A 1 44  ? 57.959  37.590  48.826 1.00 49.85 ? 44  GLU A CG    1 
ATOM   302  C  CD    . GLU A 1 44  ? 58.182  38.538  50.024 1.00 61.25 ? 44  GLU A CD    1 
ATOM   303  O  OE1   . GLU A 1 44  ? 58.426  38.069  51.196 1.00 60.02 ? 44  GLU A OE1   1 
ATOM   304  O  OE2   . GLU A 1 44  ? 58.141  39.778  49.746 1.00 64.63 ? 44  GLU A OE2   1 
ATOM   305  N  N     . ARG A 1 45  ? 59.054  35.578  45.757 1.00 29.30 ? 45  ARG A N     1 
ATOM   306  C  CA    . ARG A 1 45  ? 59.960  35.878  44.671 1.00 36.52 ? 45  ARG A CA    1 
ATOM   307  C  C     . ARG A 1 45  ? 60.259  37.369  44.490 1.00 35.41 ? 45  ARG A C     1 
ATOM   308  O  O     . ARG A 1 45  ? 59.361  38.050  44.027 1.00 34.18 ? 45  ARG A O     1 
ATOM   309  C  CB    . ARG A 1 45  ? 59.454  35.269  43.360 1.00 42.52 ? 45  ARG A CB    1 
ATOM   310  C  CG    . ARG A 1 45  ? 58.080  35.678  42.911 0.00 49.14 ? 45  ARG A CG    1 
ATOM   311  C  CD    . ARG A 1 45  ? 57.717  34.876  41.686 0.00 56.55 ? 45  ARG A CD    1 
ATOM   312  N  NE    . ARG A 1 45  ? 57.362  33.499  42.020 0.00 65.89 ? 45  ARG A NE    1 
ATOM   313  C  CZ    . ARG A 1 45  ? 56.147  33.003  41.824 0.00 70.09 ? 45  ARG A CZ    1 
ATOM   314  N  NH1   . ARG A 1 45  ? 55.209  33.776  41.296 0.00 74.30 ? 45  ARG A NH1   1 
ATOM   315  N  NH2   . ARG A 1 45  ? 55.870  31.745  42.148 0.00 74.30 ? 45  ARG A NH2   1 
ATOM   316  N  N     . ILE A 1 46  ? 61.395  37.841  45.029 1.00 35.59 ? 46  ILE A N     1 
ATOM   317  C  CA    . ILE A 1 46  ? 61.919  39.220  44.958 1.00 33.88 ? 46  ILE A CA    1 
ATOM   318  C  C     . ILE A 1 46  ? 62.222  39.593  43.492 1.00 36.09 ? 46  ILE A C     1 
ATOM   319  O  O     . ILE A 1 46  ? 61.257  40.006  42.825 1.00 38.13 ? 46  ILE A O     1 
ATOM   320  C  CB    . ILE A 1 46  ? 63.107  39.407  45.883 1.00 34.16 ? 46  ILE A CB    1 
ATOM   321  C  CG1   . ILE A 1 46  ? 62.874  38.858  47.298 1.00 39.66 ? 46  ILE A CG1   1 
ATOM   322  C  CG2   . ILE A 1 46  ? 63.685  40.827  45.842 1.00 41.70 ? 46  ILE A CG2   1 
ATOM   323  C  CD1   . ILE A 1 46  ? 61.586  39.213  48.042 1.00 46.63 ? 46  ILE A CD1   1 
ATOM   324  N  N     . LYS A 1 47  ? 63.437  39.343  42.953 1.00 35.42 ? 47  LYS A N     1 
ATOM   325  C  CA    . LYS A 1 47  ? 63.796  39.592  41.539 1.00 30.37 ? 47  LYS A CA    1 
ATOM   326  C  C     . LYS A 1 47  ? 64.764  38.654  40.833 1.00 31.10 ? 47  LYS A C     1 
ATOM   327  O  O     . LYS A 1 47  ? 65.570  38.018  41.474 1.00 32.51 ? 47  LYS A O     1 
ATOM   328  C  CB    . LYS A 1 47  ? 64.324  40.989  41.326 1.00 33.37 ? 47  LYS A CB    1 
ATOM   329  C  CG    . LYS A 1 47  ? 65.586  41.348  42.031 1.00 39.11 ? 47  LYS A CG    1 
ATOM   330  C  CD    . LYS A 1 47  ? 66.485  42.228  41.170 1.00 40.78 ? 47  LYS A CD    1 
ATOM   331  C  CE    . LYS A 1 47  ? 65.783  43.282  40.300 1.00 43.47 ? 47  LYS A CE    1 
ATOM   332  N  NZ    . LYS A 1 47  ? 66.644  43.612  39.135 1.00 40.61 ? 47  LYS A NZ    1 
ATOM   333  N  N     . THR A 1 48  ? 64.834  38.725  39.510 1.00 32.52 ? 48  THR A N     1 
ATOM   334  C  CA    . THR A 1 48  ? 65.667  37.837  38.694 1.00 31.01 ? 48  THR A CA    1 
ATOM   335  C  C     . THR A 1 48  ? 67.105  38.280  38.751 1.00 30.67 ? 48  THR A C     1 
ATOM   336  O  O     . THR A 1 48  ? 67.398  39.378  38.300 1.00 31.88 ? 48  THR A O     1 
ATOM   337  C  CB    . THR A 1 48  ? 65.160  37.784  37.229 1.00 30.82 ? 48  THR A CB    1 
ATOM   338  O  OG1   . THR A 1 48  ? 63.898  37.104  37.119 1.00 32.69 ? 48  THR A OG1   1 
ATOM   339  C  CG2   . THR A 1 48  ? 66.155  37.101  36.302 1.00 30.64 ? 48  THR A CG2   1 
ATOM   340  N  N     . LEU A 1 49  ? 67.964  37.421  39.304 1.00 30.25 ? 49  LEU A N     1 
ATOM   341  C  CA    . LEU A 1 49  ? 69.438  37.598  39.366 1.00 24.03 ? 49  LEU A CA    1 
ATOM   342  C  C     . LEU A 1 49  ? 70.199  37.320  38.082 1.00 27.24 ? 49  LEU A C     1 
ATOM   343  O  O     . LEU A 1 49  ? 71.351  37.731  37.964 1.00 29.62 ? 49  LEU A O     1 
ATOM   344  C  CB    . LEU A 1 49  ? 70.073  36.670  40.386 1.00 20.59 ? 49  LEU A CB    1 
ATOM   345  C  CG    . LEU A 1 49  ? 69.458  36.888  41.743 1.00 26.77 ? 49  LEU A CG    1 
ATOM   346  C  CD1   . LEU A 1 49  ? 69.937  35.759  42.710 1.00 22.01 ? 49  LEU A CD1   1 
ATOM   347  C  CD2   . LEU A 1 49  ? 69.734  38.327  42.229 1.00 20.06 ? 49  LEU A CD2   1 
ATOM   348  N  N     . GLY A 1 50  ? 69.623  36.488  37.214 1.00 27.02 ? 50  GLY A N     1 
ATOM   349  C  CA    . GLY A 1 50  ? 70.274  36.104  35.987 1.00 21.97 ? 50  GLY A CA    1 
ATOM   350  C  C     . GLY A 1 50  ? 69.533  35.060  35.248 1.00 25.61 ? 50  GLY A C     1 
ATOM   351  O  O     . GLY A 1 50  ? 68.704  34.363  35.798 1.00 23.56 ? 50  GLY A O     1 
ATOM   352  N  N     . THR A 1 51  ? 69.827  34.984  33.959 1.00 25.92 ? 51  THR A N     1 
ATOM   353  C  CA    . THR A 1 51  ? 69.165  33.991  33.135 1.00 30.35 ? 51  THR A CA    1 
ATOM   354  C  C     . THR A 1 51  ? 70.216  33.242  32.289 1.00 28.71 ? 51  THR A C     1 
ATOM   355  O  O     . THR A 1 51  ? 71.289  33.808  32.050 1.00 29.02 ? 51  THR A O     1 
ATOM   356  C  CB    . THR A 1 51  ? 68.134  34.617  32.190 1.00 29.94 ? 51  THR A CB    1 
ATOM   357  O  OG1   . THR A 1 51  ? 68.837  35.535  31.358 1.00 29.72 ? 51  THR A OG1   1 
ATOM   358  C  CG2   . THR A 1 51  ? 66.973  35.222  32.904 1.00 31.39 ? 51  THR A CG2   1 
ATOM   359  N  N     . GLY A 1 52  ? 69.750  32.234  31.554 1.00 24.01 ? 52  GLY A N     1 
ATOM   360  C  CA    . GLY A 1 52  ? 70.618  31.441  30.728 1.00 24.96 ? 52  GLY A CA    1 
ATOM   361  C  C     . GLY A 1 52  ? 69.849  30.830  29.605 1.00 22.18 ? 52  GLY A C     1 
ATOM   362  O  O     . GLY A 1 52  ? 68.764  31.248  29.312 1.00 19.65 ? 52  GLY A O     1 
ATOM   363  N  N     . SER A 1 53  ? 70.455  29.882  28.884 1.00 26.12 ? 53  SER A N     1 
ATOM   364  C  CA    . SER A 1 53  ? 69.761  29.208  27.772 1.00 20.41 ? 53  SER A CA    1 
ATOM   365  C  C     . SER A 1 53  ? 68.638  28.280  28.240 1.00 25.55 ? 53  SER A C     1 
ATOM   366  O  O     . SER A 1 53  ? 67.737  27.957  27.461 1.00 25.85 ? 53  SER A O     1 
ATOM   367  C  CB    . SER A 1 53  ? 70.745  28.302  27.057 1.00 17.18 ? 53  SER A CB    1 
ATOM   368  O  OG    . SER A 1 53  ? 71.371  28.892  25.928 1.00 22.20 ? 53  SER A OG    1 
ATOM   369  N  N     . PHE A 1 54  ? 68.711  27.883  29.514 1.00 25.41 ? 54  PHE A N     1 
ATOM   370  C  CA    . PHE A 1 54  ? 67.855  26.886  30.080 1.00 27.38 ? 54  PHE A CA    1 
ATOM   371  C  C     . PHE A 1 54  ? 66.950  27.427  31.171 1.00 30.84 ? 54  PHE A C     1 
ATOM   372  O  O     . PHE A 1 54  ? 65.772  27.101  31.155 1.00 30.88 ? 54  PHE A O     1 
ATOM   373  C  CB    . PHE A 1 54  ? 68.760  25.748  30.642 1.00 22.20 ? 54  PHE A CB    1 
ATOM   374  C  CG    . PHE A 1 54  ? 69.598  25.110  29.590 1.00 21.84 ? 54  PHE A CG    1 
ATOM   375  C  CD1   . PHE A 1 54  ? 69.014  24.535  28.442 1.00 18.05 ? 54  PHE A CD1   1 
ATOM   376  C  CD2   . PHE A 1 54  ? 70.988  25.292  29.618 1.00 18.74 ? 54  PHE A CD2   1 
ATOM   377  C  CE1   . PHE A 1 54  ? 69.782  24.195  27.349 1.00 16.25 ? 54  PHE A CE1   1 
ATOM   378  C  CE2   . PHE A 1 54  ? 71.805  24.922  28.495 1.00 13.64 ? 54  PHE A CE2   1 
ATOM   379  C  CZ    . PHE A 1 54  ? 71.217  24.408  27.391 1.00 10.53 ? 54  PHE A CZ    1 
ATOM   380  N  N     . GLY A 1 55  ? 67.567  28.028  32.184 1.00 25.35 ? 55  GLY A N     1 
ATOM   381  C  CA    . GLY A 1 55  ? 66.872  28.513  33.360 1.00 30.64 ? 55  GLY A CA    1 
ATOM   382  C  C     . GLY A 1 55  ? 66.892  29.995  33.696 1.00 26.96 ? 55  GLY A C     1 
ATOM   383  O  O     . GLY A 1 55  ? 67.346  30.798  32.894 1.00 28.90 ? 55  GLY A O     1 
ATOM   384  N  N     . ARG A 1 56  ? 66.131  30.342  34.720 1.00 26.04 ? 56  ARG A N     1 
ATOM   385  C  CA    . ARG A 1 56  ? 66.026  31.708  35.251 1.00 25.51 ? 56  ARG A CA    1 
ATOM   386  C  C     . ARG A 1 56  ? 66.286  31.591  36.739 1.00 22.94 ? 56  ARG A C     1 
ATOM   387  O  O     . ARG A 1 56  ? 65.708  30.666  37.311 1.00 25.28 ? 56  ARG A O     1 
ATOM   388  C  CB    . ARG A 1 56  ? 64.633  32.274  34.990 1.00 26.12 ? 56  ARG A CB    1 
ATOM   389  C  CG    . ARG A 1 56  ? 64.336  33.512  35.845 1.00 37.66 ? 56  ARG A CG    1 
ATOM   390  C  CD    . ARG A 1 56  ? 62.954  34.070  35.521 1.00 44.11 ? 56  ARG A CD    1 
ATOM   391  N  NE    . ARG A 1 56  ? 62.800  34.524  34.125 1.00 48.21 ? 56  ARG A NE    1 
ATOM   392  C  CZ    . ARG A 1 56  ? 62.837  35.788  33.710 1.00 45.41 ? 56  ARG A CZ    1 
ATOM   393  N  NH1   . ARG A 1 56  ? 63.067  36.807  34.534 1.00 44.11 ? 56  ARG A NH1   1 
ATOM   394  N  NH2   . ARG A 1 56  ? 62.686  36.014  32.425 1.00 44.33 ? 56  ARG A NH2   1 
ATOM   395  N  N     . VAL A 1 57  ? 67.327  32.249  37.270 1.00 15.39 ? 57  VAL A N     1 
ATOM   396  C  CA    . VAL A 1 57  ? 67.588  32.263  38.699 1.00 13.26 ? 57  VAL A CA    1 
ATOM   397  C  C     . VAL A 1 57  ? 66.974  33.557  39.305 1.00 23.31 ? 57  VAL A C     1 
ATOM   398  O  O     . VAL A 1 57  ? 67.310  34.712  38.851 1.00 18.38 ? 57  VAL A O     1 
ATOM   399  C  CB    . VAL A 1 57  ? 69.076  32.200  38.961 1.00 16.20 ? 57  VAL A CB    1 
ATOM   400  C  CG1   . VAL A 1 57  ? 69.476  32.205  40.466 1.00 15.24 ? 57  VAL A CG1   1 
ATOM   401  C  CG2   . VAL A 1 57  ? 69.583  30.871  38.417 1.00 25.93 ? 57  VAL A CG2   1 
ATOM   402  N  N     . MET A 1 58  ? 66.304  33.371  40.448 1.00 20.63 ? 58  MET A N     1 
ATOM   403  C  CA    . MET A 1 58  ? 65.602  34.457  41.129 1.00 20.51 ? 58  MET A CA    1 
ATOM   404  C  C     . MET A 1 58  ? 66.022  34.582  42.525 1.00 19.38 ? 58  MET A C     1 
ATOM   405  O  O     . MET A 1 58  ? 66.372  33.599  43.120 1.00 22.29 ? 58  MET A O     1 
ATOM   406  C  CB    . MET A 1 58  ? 64.095  34.232  41.064 1.00 21.20 ? 58  MET A CB    1 
ATOM   407  C  CG    . MET A 1 58  ? 63.528  34.340  39.671 1.00 30.46 ? 58  MET A CG    1 
ATOM   408  S  SD    . MET A 1 58  ? 61.741  34.813  39.857 1.00 47.25 ? 58  MET A SD    1 
ATOM   409  C  CE    . MET A 1 58  ? 60.979  34.220  38.326 1.00 38.00 ? 58  MET A CE    1 
ATOM   410  N  N     . LEU A 1 59  ? 65.996  35.800  43.068 1.00 25.27 ? 59  LEU A N     1 
ATOM   411  C  CA    . LEU A 1 59  ? 66.271  36.065  44.472 1.00 25.89 ? 59  LEU A CA    1 
ATOM   412  C  C     . LEU A 1 59  ? 64.933  35.812  45.155 1.00 22.45 ? 59  LEU A C     1 
ATOM   413  O  O     . LEU A 1 59  ? 63.921  36.315  44.724 1.00 22.04 ? 59  LEU A O     1 
ATOM   414  C  CB    . LEU A 1 59  ? 66.730  37.493  44.764 1.00 29.67 ? 59  LEU A CB    1 
ATOM   415  C  CG    . LEU A 1 59  ? 67.026  37.681  46.274 1.00 32.51 ? 59  LEU A CG    1 
ATOM   416  C  CD1   . LEU A 1 59  ? 68.053  36.723  46.918 1.00 25.15 ? 59  LEU A CD1   1 
ATOM   417  C  CD2   . LEU A 1 59  ? 67.416  39.136  46.607 1.00 33.57 ? 59  LEU A CD2   1 
ATOM   418  N  N     . VAL A 1 60  ? 64.966  34.980  46.181 1.00 20.95 ? 60  VAL A N     1 
ATOM   419  C  CA    . VAL A 1 60  ? 63.758  34.563  46.840 1.00 28.35 ? 60  VAL A CA    1 
ATOM   420  C  C     . VAL A 1 60  ? 63.961  34.676  48.312 1.00 27.80 ? 60  VAL A C     1 
ATOM   421  O  O     . VAL A 1 60  ? 65.109  34.834  48.749 1.00 29.79 ? 60  VAL A O     1 
ATOM   422  C  CB    . VAL A 1 60  ? 63.306  33.068  46.514 1.00 27.78 ? 60  VAL A CB    1 
ATOM   423  C  CG1   . VAL A 1 60  ? 62.766  32.969  45.138 1.00 22.90 ? 60  VAL A CG1   1 
ATOM   424  C  CG2   . VAL A 1 60  ? 64.341  32.012  46.903 1.00 19.70 ? 60  VAL A CG2   1 
ATOM   425  N  N     . LYS A 1 61  ? 62.818  34.903  48.960 1.00 27.25 ? 61  LYS A N     1 
ATOM   426  C  CA    . LYS A 1 61  ? 62.754  34.870  50.414 1.00 32.74 ? 61  LYS A CA    1 
ATOM   427  C  C     . LYS A 1 61  ? 61.861  33.734  50.985 1.00 33.10 ? 61  LYS A C     1 
ATOM   428  O  O     . LYS A 1 61  ? 60.813  33.411  50.425 1.00 33.05 ? 61  LYS A O     1 
ATOM   429  C  CB    . LYS A 1 61  ? 62.285  36.207  51.013 1.00 36.85 ? 61  LYS A CB    1 
ATOM   430  C  CG    . LYS A 1 61  ? 62.743  36.361  52.459 1.00 39.85 ? 61  LYS A CG    1 
ATOM   431  C  CD    . LYS A 1 61  ? 62.645  37.782  52.882 1.00 46.47 ? 61  LYS A CD    1 
ATOM   432  C  CE    . LYS A 1 61  ? 61.584  37.939  53.921 1.00 45.64 ? 61  LYS A CE    1 
ATOM   433  N  NZ    . LYS A 1 61  ? 62.286  38.737  54.971 1.00 53.48 ? 61  LYS A NZ    1 
ATOM   434  N  N     . HIS A 1 62  ? 62.397  33.023  51.969 1.00 31.62 ? 62  HIS A N     1 
ATOM   435  C  CA    . HIS A 1 62  ? 61.603  32.084  52.724 1.00 39.77 ? 62  HIS A CA    1 
ATOM   436  C  C     . HIS A 1 62  ? 60.718  32.900  53.717 1.00 38.53 ? 62  HIS A C     1 
ATOM   437  O  O     . HIS A 1 62  ? 61.191  33.604  54.648 1.00 34.29 ? 62  HIS A O     1 
ATOM   438  C  CB    . HIS A 1 62  ? 62.437  31.066  53.498 1.00 47.18 ? 62  HIS A CB    1 
ATOM   439  C  CG    . HIS A 1 62  ? 61.725  29.768  53.781 1.00 54.95 ? 62  HIS A CG    1 
ATOM   440  N  ND1   . HIS A 1 62  ? 62.383  28.652  54.251 1.00 56.66 ? 62  HIS A ND1   1 
ATOM   441  C  CD2   . HIS A 1 62  ? 60.436  29.386  53.599 1.00 59.30 ? 62  HIS A CD2   1 
ATOM   442  C  CE1   . HIS A 1 62  ? 61.535  27.643  54.329 1.00 60.47 ? 62  HIS A CE1   1 
ATOM   443  N  NE2   . HIS A 1 62  ? 60.345  28.059  53.932 1.00 61.62 ? 62  HIS A NE2   1 
ATOM   444  N  N     . LYS A 1 63  ? 59.421  32.751  53.426 1.00 36.14 ? 63  LYS A N     1 
ATOM   445  C  CA    . LYS A 1 63  ? 58.293  33.274  54.172 1.00 39.05 ? 63  LYS A CA    1 
ATOM   446  C  C     . LYS A 1 63  ? 58.369  32.863  55.639 1.00 44.03 ? 63  LYS A C     1 
ATOM   447  O  O     . LYS A 1 63  ? 58.537  33.734  56.500 1.00 53.08 ? 63  LYS A O     1 
ATOM   448  C  CB    . LYS A 1 63  ? 56.981  32.822  53.576 1.00 29.74 ? 63  LYS A CB    1 
ATOM   449  C  CG    . LYS A 1 63  ? 56.774  33.328  52.189 1.00 28.60 ? 63  LYS A CG    1 
ATOM   450  C  CD    . LYS A 1 63  ? 55.356  33.036  51.771 1.00 36.99 ? 63  LYS A CD    1 
ATOM   451  C  CE    . LYS A 1 63  ? 54.987  33.598  50.382 1.00 44.36 ? 63  LYS A CE    1 
ATOM   452  N  NZ    . LYS A 1 63  ? 53.863  32.805  49.742 1.00 49.56 ? 63  LYS A NZ    1 
ATOM   453  N  N     . GLU A 1 64  ? 58.623  31.591  55.894 1.00 46.04 ? 64  GLU A N     1 
ATOM   454  C  CA    . GLU A 1 64  ? 58.638  31.154  57.284 1.00 49.83 ? 64  GLU A CA    1 
ATOM   455  C  C     . GLU A 1 64  ? 59.896  31.432  58.053 1.00 49.72 ? 64  GLU A C     1 
ATOM   456  O  O     . GLU A 1 64  ? 59.860  31.310  59.288 1.00 51.95 ? 64  GLU A O     1 
ATOM   457  C  CB    . GLU A 1 64  ? 58.346  29.674  57.439 1.00 54.93 ? 64  GLU A CB    1 
ATOM   458  C  CG    . GLU A 1 64  ? 57.243  29.178  56.541 1.00 60.03 ? 64  GLU A CG    1 
ATOM   459  C  CD    . GLU A 1 64  ? 56.727  27.843  56.920 1.00 60.14 ? 64  GLU A CD    1 
ATOM   460  O  OE1   . GLU A 1 64  ? 57.420  27.034  57.577 1.00 63.38 ? 64  GLU A OE1   1 
ATOM   461  O  OE2   . GLU A 1 64  ? 55.607  27.605  56.448 1.00 64.96 ? 64  GLU A OE2   1 
ATOM   462  N  N     . THR A 1 65  ? 60.991  31.723  57.350 1.00 46.60 ? 65  THR A N     1 
ATOM   463  C  CA    . THR A 1 65  ? 62.240  31.945  58.064 1.00 46.52 ? 65  THR A CA    1 
ATOM   464  C  C     . THR A 1 65  ? 62.942  33.291  57.805 1.00 51.71 ? 65  THR A C     1 
ATOM   465  O  O     . THR A 1 65  ? 63.883  33.641  58.562 1.00 55.66 ? 65  THR A O     1 
ATOM   466  C  CB    . THR A 1 65  ? 63.146  30.686  57.987 1.00 41.99 ? 65  THR A CB    1 
ATOM   467  O  OG1   . THR A 1 65  ? 63.509  30.423  56.627 0.00 39.23 ? 65  THR A OG1   1 
ATOM   468  C  CG2   . THR A 1 65  ? 62.445  29.461  58.599 0.00 39.23 ? 65  THR A CG2   1 
ATOM   469  N  N     . GLY A 1 66  ? 62.424  34.089  56.851 1.00 51.74 ? 66  GLY A N     1 
ATOM   470  C  CA    . GLY A 1 66  ? 63.029  35.377  56.483 1.00 55.44 ? 66  GLY A CA    1 
ATOM   471  C  C     . GLY A 1 66  ? 64.337  35.378  55.683 1.00 57.10 ? 66  GLY A C     1 
ATOM   472  O  O     . GLY A 1 66  ? 64.823  36.441  55.229 1.00 60.59 ? 66  GLY A O     1 
ATOM   473  N  N     . ASN A 1 67  ? 64.848  34.157  55.466 1.00 53.49 ? 67  ASN A N     1 
ATOM   474  C  CA    . ASN A 1 67  ? 66.024  33.837  54.675 1.00 45.94 ? 67  ASN A CA    1 
ATOM   475  C  C     . ASN A 1 67  ? 65.968  33.911  53.158 1.00 35.26 ? 67  ASN A C     1 
ATOM   476  O  O     . ASN A 1 67  ? 65.002  33.499  52.546 1.00 31.46 ? 67  ASN A O     1 
ATOM   477  C  CB    . ASN A 1 67  ? 66.560  32.509  55.148 1.00 52.60 ? 67  ASN A CB    1 
ATOM   478  C  CG    . ASN A 1 67  ? 67.767  32.718  55.986 1.00 59.95 ? 67  ASN A CG    1 
ATOM   479  O  OD1   . ASN A 1 67  ? 68.850  32.957  55.439 1.00 66.45 ? 67  ASN A OD1   1 
ATOM   480  N  ND2   . ASN A 1 67  ? 67.548  32.933  57.276 1.00 63.65 ? 67  ASN A ND2   1 
ATOM   481  N  N     . HIS A 1 68  ? 66.956  34.555  52.558 1.00 32.15 ? 68  HIS A N     1 
ATOM   482  C  CA    . HIS A 1 68  ? 66.971  34.677  51.090 1.00 32.36 ? 68  HIS A CA    1 
ATOM   483  C  C     . HIS A 1 68  ? 67.905  33.586  50.546 1.00 25.26 ? 68  HIS A C     1 
ATOM   484  O  O     . HIS A 1 68  ? 68.951  33.309  51.121 1.00 23.34 ? 68  HIS A O     1 
ATOM   485  C  CB    . HIS A 1 68  ? 67.537  36.019  50.553 1.00 40.11 ? 68  HIS A CB    1 
ATOM   486  C  CG    . HIS A 1 68  ? 66.823  37.271  50.974 1.00 41.07 ? 68  HIS A CG    1 
ATOM   487  N  ND1   . HIS A 1 68  ? 66.956  37.818  52.237 1.00 41.89 ? 68  HIS A ND1   1 
ATOM   488  C  CD2   . HIS A 1 68  ? 65.962  38.066  50.297 1.00 38.89 ? 68  HIS A CD2   1 
ATOM   489  C  CE1   . HIS A 1 68  ? 66.156  38.864  52.334 1.00 42.52 ? 68  HIS A CE1   1 
ATOM   490  N  NE2   . HIS A 1 68  ? 65.555  39.044  51.170 1.00 37.60 ? 68  HIS A NE2   1 
ATOM   491  N  N     . PHE A 1 69  ? 67.578  33.144  49.346 1.00 22.89 ? 69  PHE A N     1 
ATOM   492  C  CA    . PHE A 1 69  ? 68.273  32.083  48.600 1.00 24.76 ? 69  PHE A CA    1 
ATOM   493  C  C     . PHE A 1 69  ? 68.196  32.521  47.146 1.00 24.22 ? 69  PHE A C     1 
ATOM   494  O  O     . PHE A 1 69  ? 67.525  33.515  46.781 1.00 25.14 ? 69  PHE A O     1 
ATOM   495  C  CB    . PHE A 1 69  ? 67.511  30.710  48.717 1.00 19.17 ? 69  PHE A CB    1 
ATOM   496  C  CG    . PHE A 1 69  ? 67.501  30.133  50.104 1.00 20.76 ? 69  PHE A CG    1 
ATOM   497  C  CD1   . PHE A 1 69  ? 68.672  29.608  50.659 1.00 26.19 ? 69  PHE A CD1   1 
ATOM   498  C  CD2   . PHE A 1 69  ? 66.367  30.303  50.932 1.00 27.91 ? 69  PHE A CD2   1 
ATOM   499  C  CE1   . PHE A 1 69  ? 68.777  29.292  52.015 1.00 28.83 ? 69  PHE A CE1   1 
ATOM   500  C  CE2   . PHE A 1 69  ? 66.438  29.994  52.327 1.00 27.63 ? 69  PHE A CE2   1 
ATOM   501  C  CZ    . PHE A 1 69  ? 67.654  29.502  52.863 1.00 31.58 ? 69  PHE A CZ    1 
ATOM   502  N  N     . ALA A 1 70  ? 68.875  31.759  46.295 1.00 24.27 ? 70  ALA A N     1 
ATOM   503  C  CA    . ALA A 1 70  ? 68.796  31.941  44.846 1.00 23.85 ? 70  ALA A CA    1 
ATOM   504  C  C     . ALA A 1 70  ? 68.066  30.653  44.353 1.00 25.42 ? 70  ALA A C     1 
ATOM   505  O  O     . ALA A 1 70  ? 68.490  29.547  44.658 1.00 24.11 ? 70  ALA A O     1 
ATOM   506  C  CB    . ALA A 1 70  ? 70.183  32.053  44.238 1.00 27.50 ? 70  ALA A CB    1 
ATOM   507  N  N     . MET A 1 71  ? 67.058  30.794  43.506 1.00 21.58 ? 71  MET A N     1 
ATOM   508  C  CA    . MET A 1 71  ? 66.269  29.680  43.080 1.00 22.14 ? 71  MET A CA    1 
ATOM   509  C  C     . MET A 1 71  ? 66.416  29.634  41.619 1.00 19.61 ? 71  MET A C     1 
ATOM   510  O  O     . MET A 1 71  ? 65.969  30.567  40.974 1.00 25.03 ? 71  MET A O     1 
ATOM   511  C  CB    . MET A 1 71  ? 64.786  29.925  43.443 1.00 27.57 ? 71  MET A CB    1 
ATOM   512  C  CG    . MET A 1 71  ? 63.716  28.837  43.052 1.00 33.64 ? 71  MET A CG    1 
ATOM   513  S  SD    . MET A 1 71  ? 61.990  29.061  43.788 1.00 31.19 ? 71  MET A SD    1 
ATOM   514  C  CE    . MET A 1 71  ? 61.516  30.164  42.488 1.00 26.27 ? 71  MET A CE    1 
ATOM   515  N  N     . LYS A 1 72  ? 66.825  28.482  41.096 1.00 14.65 ? 72  LYS A N     1 
ATOM   516  C  CA    . LYS A 1 72  ? 66.869  28.263  39.665 1.00 12.51 ? 72  LYS A CA    1 
ATOM   517  C  C     . LYS A 1 72  ? 65.526  27.610  39.344 1.00 16.88 ? 72  LYS A C     1 
ATOM   518  O  O     . LYS A 1 72  ? 65.099  26.701  40.060 1.00 22.63 ? 72  LYS A O     1 
ATOM   519  C  CB    . LYS A 1 72  ? 68.093  27.382  39.320 1.00 10.11 ? 72  LYS A CB    1 
ATOM   520  C  CG    . LYS A 1 72  ? 68.276  27.268  37.773 1.00 15.46 ? 72  LYS A CG    1 
ATOM   521  C  CD    . LYS A 1 72  ? 69.532  26.501  37.403 1.00 7.85  ? 72  LYS A CD    1 
ATOM   522  C  CE    . LYS A 1 72  ? 69.742  26.416  35.920 1.00 11.79 ? 72  LYS A CE    1 
ATOM   523  N  NZ    . LYS A 1 72  ? 71.003  25.687  35.770 1.00 12.19 ? 72  LYS A NZ    1 
ATOM   524  N  N     . ILE A 1 73  ? 64.911  28.008  38.234 1.00 17.46 ? 73  ILE A N     1 
ATOM   525  C  CA    . ILE A 1 73  ? 63.619  27.515  37.822 1.00 19.63 ? 73  ILE A CA    1 
ATOM   526  C  C     . ILE A 1 73  ? 63.815  26.973  36.413 1.00 20.94 ? 73  ILE A C     1 
ATOM   527  O  O     . ILE A 1 73  ? 64.403  27.657  35.555 1.00 17.64 ? 73  ILE A O     1 
ATOM   528  C  CB    . ILE A 1 73  ? 62.516  28.659  37.768 1.00 22.65 ? 73  ILE A CB    1 
ATOM   529  C  CG1   . ILE A 1 73  ? 62.535  29.468  39.077 1.00 22.08 ? 73  ILE A CG1   1 
ATOM   530  C  CG2   . ILE A 1 73  ? 61.116  28.106  37.460 1.00 22.13 ? 73  ILE A CG2   1 
ATOM   531  C  CD1   . ILE A 1 73  ? 61.840  30.814  38.935 1.00 28.40 ? 73  ILE A CD1   1 
ATOM   532  N  N     . LEU A 1 74  ? 63.406  25.700  36.202 1.00 19.30 ? 74  LEU A N     1 
ATOM   533  C  CA    . LEU A 1 74  ? 63.455  25.175  34.838 1.00 16.04 ? 74  LEU A CA    1 
ATOM   534  C  C     . LEU A 1 74  ? 62.082  24.738  34.401 1.00 16.19 ? 74  LEU A C     1 
ATOM   535  O  O     . LEU A 1 74  ? 61.444  24.027  35.139 1.00 22.79 ? 74  LEU A O     1 
ATOM   536  C  CB    . LEU A 1 74  ? 64.429  24.021  34.836 1.00 21.94 ? 74  LEU A CB    1 
ATOM   537  C  CG    . LEU A 1 74  ? 65.897  24.481  34.817 1.00 23.34 ? 74  LEU A CG    1 
ATOM   538  C  CD1   . LEU A 1 74  ? 66.714  23.400  35.534 1.00 20.34 ? 74  LEU A CD1   1 
ATOM   539  C  CD2   . LEU A 1 74  ? 66.312  24.577  33.333 1.00 24.75 ? 74  LEU A CD2   1 
ATOM   540  N  N     . ASP A 1 75  ? 61.681  25.044  33.181 1.00 21.37 ? 75  ASP A N     1 
ATOM   541  C  CA    . ASP A 1 75  ? 60.375  24.699  32.680 1.00 26.46 ? 75  ASP A CA    1 
ATOM   542  C  C     . ASP A 1 75  ? 60.646  23.303  32.044 1.00 31.55 ? 75  ASP A C     1 
ATOM   543  O  O     . ASP A 1 75  ? 61.451  23.147  31.075 1.00 25.52 ? 75  ASP A O     1 
ATOM   544  C  CB    . ASP A 1 75  ? 59.994  25.755  31.652 1.00 30.37 ? 75  ASP A CB    1 
ATOM   545  C  CG    . ASP A 1 75  ? 58.723  25.427  30.887 1.00 36.84 ? 75  ASP A CG    1 
ATOM   546  O  OD1   . ASP A 1 75  ? 58.595  24.416  30.191 1.00 32.50 ? 75  ASP A OD1   1 
ATOM   547  O  OD2   . ASP A 1 75  ? 57.896  26.325  30.732 1.00 43.73 ? 75  ASP A OD2   1 
ATOM   548  N  N     . LYS A 1 76  ? 59.858  22.335  32.538 1.00 30.84 ? 76  LYS A N     1 
ATOM   549  C  CA    . LYS A 1 76  ? 59.934  20.924  32.118 1.00 25.09 ? 76  LYS A CA    1 
ATOM   550  C  C     . LYS A 1 76  ? 59.670  20.732  30.667 1.00 25.29 ? 76  LYS A C     1 
ATOM   551  O  O     . LYS A 1 76  ? 60.491  20.079  30.015 1.00 29.66 ? 76  LYS A O     1 
ATOM   552  C  CB    . LYS A 1 76  ? 59.002  20.059  32.929 1.00 24.65 ? 76  LYS A CB    1 
ATOM   553  C  CG    . LYS A 1 76  ? 59.506  19.727  34.306 1.00 23.93 ? 76  LYS A CG    1 
ATOM   554  C  CD    . LYS A 1 76  ? 58.461  18.720  34.778 1.00 29.73 ? 76  LYS A CD    1 
ATOM   555  C  CE    . LYS A 1 76  ? 57.734  19.158  36.033 1.00 35.02 ? 76  LYS A CE    1 
ATOM   556  N  NZ    . LYS A 1 76  ? 56.385  18.502  35.997 1.00 36.67 ? 76  LYS A NZ    1 
ATOM   557  N  N     . GLN A 1 77  ? 58.740  21.512  30.106 1.00 24.00 ? 77  GLN A N     1 
ATOM   558  C  CA    . GLN A 1 77  ? 58.506  21.435  28.684 1.00 20.95 ? 77  GLN A CA    1 
ATOM   559  C  C     . GLN A 1 77  ? 59.709  21.982  27.935 1.00 30.74 ? 77  GLN A C     1 
ATOM   560  O  O     . GLN A 1 77  ? 59.961  21.442  26.828 1.00 27.57 ? 77  GLN A O     1 
ATOM   561  C  CB    . GLN A 1 77  ? 57.283  22.221  28.231 1.00 30.17 ? 77  GLN A CB    1 
ATOM   562  C  CG    . GLN A 1 77  ? 55.879  21.692  28.664 1.00 35.73 ? 77  GLN A CG    1 
ATOM   563  C  CD    . GLN A 1 77  ? 54.748  22.538  28.105 0.00 31.20 ? 77  GLN A CD    1 
ATOM   564  O  OE1   . GLN A 1 77  ? 54.668  23.741  28.357 0.00 32.56 ? 77  GLN A OE1   1 
ATOM   565  N  NE2   . GLN A 1 77  ? 53.861  21.911  27.344 0.00 32.56 ? 77  GLN A NE2   1 
ATOM   566  N  N     . LYS A 1 78  ? 60.507  22.900  28.544 1.00 27.56 ? 78  LYS A N     1 
ATOM   567  C  CA    . LYS A 1 78  ? 61.687  23.375  27.786 1.00 28.03 ? 78  LYS A CA    1 
ATOM   568  C  C     . LYS A 1 78  ? 62.866  22.455  27.865 1.00 24.87 ? 78  LYS A C     1 
ATOM   569  O  O     . LYS A 1 78  ? 63.424  22.163  26.817 1.00 31.06 ? 78  LYS A O     1 
ATOM   570  C  CB    . LYS A 1 78  ? 62.041  24.869  27.748 1.00 28.87 ? 78  LYS A CB    1 
ATOM   571  C  CG    . LYS A 1 78  ? 62.401  25.574  29.031 1.00 34.08 ? 78  LYS A CG    1 
ATOM   572  C  CD    . LYS A 1 78  ? 62.594  27.095  28.757 1.00 37.62 ? 78  LYS A CD    1 
ATOM   573  C  CE    . LYS A 1 78  ? 63.658  27.421  27.729 1.00 38.73 ? 78  LYS A CE    1 
ATOM   574  N  NZ    . LYS A 1 78  ? 64.692  28.488  28.019 1.00 41.85 ? 78  LYS A NZ    1 
ATOM   575  N  N     . VAL A 1 79  ? 63.015  21.785  29.013 1.00 26.80 ? 79  VAL A N     1 
ATOM   576  C  CA    . VAL A 1 79  ? 64.077  20.764  29.305 1.00 23.63 ? 79  VAL A CA    1 
ATOM   577  C  C     . VAL A 1 79  ? 63.963  19.642  28.292 1.00 26.66 ? 79  VAL A C     1 
ATOM   578  O  O     . VAL A 1 79  ? 64.918  19.436  27.527 1.00 26.32 ? 79  VAL A O     1 
ATOM   579  C  CB    . VAL A 1 79  ? 63.936  20.194  30.712 1.00 25.12 ? 79  VAL A CB    1 
ATOM   580  C  CG1   . VAL A 1 79  ? 64.992  19.104  30.995 1.00 19.65 ? 79  VAL A CG1   1 
ATOM   581  C  CG2   . VAL A 1 79  ? 64.066  21.363  31.724 1.00 28.90 ? 79  VAL A CG2   1 
ATOM   582  N  N     . VAL A 1 80  ? 62.701  19.232  28.084 1.00 23.58 ? 80  VAL A N     1 
ATOM   583  C  CA    . VAL A 1 80  ? 62.361  18.299  27.043 1.00 26.39 ? 80  VAL A CA    1 
ATOM   584  C  C     . VAL A 1 80  ? 62.673  18.753  25.599 1.00 29.99 ? 80  VAL A C     1 
ATOM   585  O  O     . VAL A 1 80  ? 63.577  18.126  24.951 1.00 26.52 ? 80  VAL A O     1 
ATOM   586  C  CB    . VAL A 1 80  ? 60.983  17.599  27.240 1.00 24.06 ? 80  VAL A CB    1 
ATOM   587  C  CG1   . VAL A 1 80  ? 60.722  16.573  26.118 1.00 22.81 ? 80  VAL A CG1   1 
ATOM   588  C  CG2   . VAL A 1 80  ? 60.940  17.013  28.644 1.00 24.02 ? 80  VAL A CG2   1 
ATOM   589  N  N     . LYS A 1 81  ? 62.128  19.897  25.154 1.00 28.15 ? 81  LYS A N     1 
ATOM   590  C  CA    . LYS A 1 81  ? 62.434  20.264  23.777 1.00 25.58 ? 81  LYS A CA    1 
ATOM   591  C  C     . LYS A 1 81  ? 63.928  20.545  23.486 1.00 24.42 ? 81  LYS A C     1 
ATOM   592  O  O     . LYS A 1 81  ? 64.437  20.346  22.381 1.00 25.06 ? 81  LYS A O     1 
ATOM   593  C  CB    . LYS A 1 81  ? 61.524  21.391  23.298 1.00 29.79 ? 81  LYS A CB    1 
ATOM   594  C  CG    . LYS A 1 81  ? 61.740  21.834  21.874 0.00 32.17 ? 81  LYS A CG    1 
ATOM   595  C  CD    . LYS A 1 81  ? 60.995  23.126  21.597 0.00 35.62 ? 81  LYS A CD    1 
ATOM   596  C  CE    . LYS A 1 81  ? 61.445  23.729  20.285 0.00 37.17 ? 81  LYS A CE    1 
ATOM   597  N  NZ    . LYS A 1 81  ? 62.926  23.839  20.242 0.00 40.61 ? 81  LYS A NZ    1 
ATOM   598  N  N     . LEU A 1 82  ? 64.658  20.918  24.523 1.00 25.90 ? 82  LEU A N     1 
ATOM   599  C  CA    . LEU A 1 82  ? 66.057  21.260  24.325 1.00 31.35 ? 82  LEU A CA    1 
ATOM   600  C  C     . LEU A 1 82  ? 67.032  20.082  24.492 1.00 29.57 ? 82  LEU A C     1 
ATOM   601  O  O     . LEU A 1 82  ? 68.241  20.311  24.460 1.00 33.04 ? 82  LEU A O     1 
ATOM   602  C  CB    . LEU A 1 82  ? 66.427  22.508  25.169 1.00 27.39 ? 82  LEU A CB    1 
ATOM   603  C  CG    . LEU A 1 82  ? 65.719  23.834  24.857 1.00 31.61 ? 82  LEU A CG    1 
ATOM   604  C  CD1   . LEU A 1 82  ? 66.094  24.893  25.866 1.00 33.98 ? 82  LEU A CD1   1 
ATOM   605  C  CD2   . LEU A 1 82  ? 65.969  24.295  23.479 1.00 29.40 ? 82  LEU A CD2   1 
ATOM   606  N  N     . LYS A 1 83  ? 66.510  18.877  24.800 1.00 30.31 ? 83  LYS A N     1 
ATOM   607  C  CA    . LYS A 1 83  ? 67.283  17.635  25.002 1.00 24.17 ? 83  LYS A CA    1 
ATOM   608  C  C     . LYS A 1 83  ? 68.122  17.660  26.264 1.00 27.95 ? 83  LYS A C     1 
ATOM   609  O  O     . LYS A 1 83  ? 69.253  17.144  26.307 1.00 31.26 ? 83  LYS A O     1 
ATOM   610  C  CB    . LYS A 1 83  ? 68.056  17.297  23.739 1.00 23.41 ? 83  LYS A CB    1 
ATOM   611  C  CG    . LYS A 1 83  ? 66.975  16.969  22.687 1.00 27.77 ? 83  LYS A CG    1 
ATOM   612  C  CD    . LYS A 1 83  ? 67.458  16.901  21.202 1.00 35.81 ? 83  LYS A CD    1 
ATOM   613  C  CE    . LYS A 1 83  ? 66.315  16.620  20.263 0.00 30.22 ? 83  LYS A CE    1 
ATOM   614  N  NZ    . LYS A 1 83  ? 65.380  17.758  20.272 0.00 26.78 ? 83  LYS A NZ    1 
ATOM   615  N  N     . GLN A 1 84  ? 67.503  18.199  27.343 1.00 22.92 ? 84  GLN A N     1 
ATOM   616  C  CA    . GLN A 1 84  ? 68.205  18.352  28.606 1.00 20.37 ? 84  GLN A CA    1 
ATOM   617  C  C     . GLN A 1 84  ? 67.703  17.510  29.732 1.00 18.76 ? 84  GLN A C     1 
ATOM   618  O  O     . GLN A 1 84  ? 68.101  17.773  30.893 1.00 17.56 ? 84  GLN A O     1 
ATOM   619  C  CB    . GLN A 1 84  ? 68.356  19.837  29.024 1.00 18.65 ? 84  GLN A CB    1 
ATOM   620  C  CG    . GLN A 1 84  ? 68.914  20.766  27.971 1.00 17.46 ? 84  GLN A CG    1 
ATOM   621  C  CD    . GLN A 1 84  ? 70.294  20.354  27.669 1.00 16.50 ? 84  GLN A CD    1 
ATOM   622  O  OE1   . GLN A 1 84  ? 71.131  20.229  28.578 1.00 16.87 ? 84  GLN A OE1   1 
ATOM   623  N  NE2   . GLN A 1 84  ? 70.542  20.113  26.399 1.00 16.16 ? 84  GLN A NE2   1 
ATOM   624  N  N     . ILE A 1 85  ? 66.882  16.486  29.411 1.00 20.86 ? 85  ILE A N     1 
ATOM   625  C  CA    . ILE A 1 85  ? 66.393  15.641  30.510 1.00 19.27 ? 85  ILE A CA    1 
ATOM   626  C  C     . ILE A 1 85  ? 67.515  15.007  31.322 1.00 17.14 ? 85  ILE A C     1 
ATOM   627  O  O     . ILE A 1 85  ? 67.617  15.284  32.527 1.00 15.48 ? 85  ILE A O     1 
ATOM   628  C  CB    . ILE A 1 85  ? 65.325  14.546  30.084 1.00 21.40 ? 85  ILE A CB    1 
ATOM   629  C  CG1   . ILE A 1 85  ? 64.106  15.191  29.423 1.00 25.58 ? 85  ILE A CG1   1 
ATOM   630  C  CG2   . ILE A 1 85  ? 64.932  13.743  31.378 1.00 21.05 ? 85  ILE A CG2   1 
ATOM   631  C  CD1   . ILE A 1 85  ? 63.301  14.259  28.532 1.00 28.30 ? 85  ILE A CD1   1 
ATOM   632  N  N     . GLU A 1 86  ? 68.369  14.182  30.685 1.00 19.68 ? 86  GLU A N     1 
ATOM   633  C  CA    . GLU A 1 86  ? 69.423  13.497  31.488 1.00 17.55 ? 86  GLU A CA    1 
ATOM   634  C  C     . GLU A 1 86  ? 70.381  14.536  32.117 1.00 15.76 ? 86  GLU A C     1 
ATOM   635  O  O     . GLU A 1 86  ? 70.715  14.431  33.299 1.00 23.10 ? 86  GLU A O     1 
ATOM   636  C  CB    . GLU A 1 86  ? 70.226  12.481  30.649 1.00 23.06 ? 86  GLU A CB    1 
ATOM   637  C  CG    . GLU A 1 86  ? 71.120  11.508  31.473 1.00 23.56 ? 86  GLU A CG    1 
ATOM   638  C  CD    . GLU A 1 86  ? 70.313  10.382  32.190 1.00 27.41 ? 86  GLU A CD    1 
ATOM   639  O  OE1   . GLU A 1 86  ? 69.427  9.764   31.569 1.00 34.35 ? 86  GLU A OE1   1 
ATOM   640  O  OE2   . GLU A 1 86  ? 70.464  10.114  33.394 1.00 25.07 ? 86  GLU A OE2   1 
ATOM   641  N  N     . HIS A 1 87  ? 70.675  15.624  31.390 1.00 16.50 ? 87  HIS A N     1 
ATOM   642  C  CA    . HIS A 1 87  ? 71.558  16.705  31.944 1.00 13.99 ? 87  HIS A CA    1 
ATOM   643  C  C     . HIS A 1 87  ? 70.946  17.337  33.249 1.00 12.39 ? 87  HIS A C     1 
ATOM   644  O  O     . HIS A 1 87  ? 71.631  17.485  34.261 1.00 18.69 ? 87  HIS A O     1 
ATOM   645  C  CB    . HIS A 1 87  ? 71.779  17.769  30.873 1.00 14.48 ? 87  HIS A CB    1 
ATOM   646  C  CG    . HIS A 1 87  ? 72.724  17.377  29.762 1.00 18.84 ? 87  HIS A CG    1 
ATOM   647  N  ND1   . HIS A 1 87  ? 72.821  18.111  28.603 1.00 22.58 ? 87  HIS A ND1   1 
ATOM   648  C  CD2   . HIS A 1 87  ? 73.662  16.402  29.654 1.00 19.96 ? 87  HIS A CD2   1 
ATOM   649  C  CE1   . HIS A 1 87  ? 73.766  17.606  27.822 1.00 27.37 ? 87  HIS A CE1   1 
ATOM   650  N  NE2   . HIS A 1 87  ? 74.292  16.569  28.439 1.00 20.71 ? 87  HIS A NE2   1 
ATOM   651  N  N     . THR A 1 88  ? 69.650  17.665  33.249 1.00 12.74 ? 88  THR A N     1 
ATOM   652  C  CA    . THR A 1 88  ? 69.021  18.302  34.441 1.00 17.28 ? 88  THR A CA    1 
ATOM   653  C  C     . THR A 1 88  ? 69.021  17.354  35.628 1.00 17.71 ? 88  THR A C     1 
ATOM   654  O  O     . THR A 1 88  ? 69.353  17.729  36.751 1.00 21.64 ? 88  THR A O     1 
ATOM   655  C  CB    . THR A 1 88  ? 67.579  18.729  34.085 1.00 18.77 ? 88  THR A CB    1 
ATOM   656  O  OG1   . THR A 1 88  ? 67.618  19.562  32.925 1.00 20.53 ? 88  THR A OG1   1 
ATOM   657  C  CG2   . THR A 1 88  ? 66.870  19.371  35.199 1.00 16.49 ? 88  THR A CG2   1 
ATOM   658  N  N     . LEU A 1 89  ? 68.884  16.053  35.328 1.00 23.91 ? 89  LEU A N     1 
ATOM   659  C  CA    . LEU A 1 89  ? 68.902  15.020  36.384 1.00 17.83 ? 89  LEU A CA    1 
ATOM   660  C  C     . LEU A 1 89  ? 70.329  14.914  36.899 1.00 14.75 ? 89  LEU A C     1 
ATOM   661  O  O     . LEU A 1 89  ? 70.470  14.888  38.118 1.00 21.02 ? 89  LEU A O     1 
ATOM   662  C  CB    . LEU A 1 89  ? 68.392  13.652  35.901 1.00 15.47 ? 89  LEU A CB    1 
ATOM   663  C  CG    . LEU A 1 89  ? 66.936  13.566  35.442 1.00 21.01 ? 89  LEU A CG    1 
ATOM   664  C  CD1   . LEU A 1 89  ? 66.772  12.134  34.904 1.00 20.75 ? 89  LEU A CD1   1 
ATOM   665  C  CD2   . LEU A 1 89  ? 65.958  13.812  36.623 1.00 20.99 ? 89  LEU A CD2   1 
ATOM   666  N  N     . ASN A 1 90  ? 71.350  15.026  36.021 1.00 16.12 ? 90  ASN A N     1 
ATOM   667  C  CA    . ASN A 1 90  ? 72.790  14.953  36.495 1.00 12.57 ? 90  ASN A CA    1 
ATOM   668  C  C     . ASN A 1 90  ? 73.102  16.163  37.417 1.00 14.23 ? 90  ASN A C     1 
ATOM   669  O  O     . ASN A 1 90  ? 73.557  16.055  38.590 1.00 18.65 ? 90  ASN A O     1 
ATOM   670  C  CB    . ASN A 1 90  ? 73.712  15.086  35.259 1.00 10.88 ? 90  ASN A CB    1 
ATOM   671  C  CG    . ASN A 1 90  ? 73.837  13.801  34.444 1.00 21.92 ? 90  ASN A CG    1 
ATOM   672  O  OD1   . ASN A 1 90  ? 73.697  12.736  35.036 1.00 21.65 ? 90  ASN A OD1   1 
ATOM   673  N  ND2   . ASN A 1 90  ? 74.190  13.881  33.114 1.00 19.79 ? 90  ASN A ND2   1 
ATOM   674  N  N     . GLU A 1 91  ? 72.619  17.325  36.941 1.00 17.99 ? 91  GLU A N     1 
ATOM   675  C  CA    . GLU A 1 91  ? 72.848  18.611  37.601 1.00 15.71 ? 91  GLU A CA    1 
ATOM   676  C  C     . GLU A 1 91  ? 72.445  18.598  39.037 1.00 11.03 ? 91  GLU A C     1 
ATOM   677  O  O     . GLU A 1 91  ? 73.208  18.898  39.993 1.00 11.20 ? 91  GLU A O     1 
ATOM   678  C  CB    . GLU A 1 91  ? 72.034  19.646  36.823 1.00 20.36 ? 91  GLU A CB    1 
ATOM   679  C  CG    . GLU A 1 91  ? 71.879  20.950  37.561 1.00 20.08 ? 91  GLU A CG    1 
ATOM   680  C  CD    . GLU A 1 91  ? 71.438  22.098  36.668 1.00 23.39 ? 91  GLU A CD    1 
ATOM   681  O  OE1   . GLU A 1 91  ? 70.766  21.921  35.632 1.00 17.68 ? 91  GLU A OE1   1 
ATOM   682  O  OE2   . GLU A 1 91  ? 71.752  23.226  37.107 1.00 25.02 ? 91  GLU A OE2   1 
ATOM   683  N  N     . LYS A 1 92  ? 71.224  18.073  39.192 1.00 17.88 ? 92  LYS A N     1 
ATOM   684  C  CA    . LYS A 1 92  ? 70.642  18.036  40.543 1.00 13.93 ? 92  LYS A CA    1 
ATOM   685  C  C     . LYS A 1 92  ? 71.286  16.978  41.432 1.00 14.76 ? 92  LYS A C     1 
ATOM   686  O  O     . LYS A 1 92  ? 71.637  17.253  42.602 1.00 18.46 ? 92  LYS A O     1 
ATOM   687  C  CB    . LYS A 1 92  ? 69.138  17.787  40.307 1.00 19.04 ? 92  LYS A CB    1 
ATOM   688  C  CG    . LYS A 1 92  ? 68.267  18.240  41.421 1.00 19.72 ? 92  LYS A CG    1 
ATOM   689  C  CD    . LYS A 1 92  ? 68.219  17.418  42.633 1.00 23.63 ? 92  LYS A CD    1 
ATOM   690  C  CE    . LYS A 1 92  ? 67.506  16.128  42.417 1.00 23.48 ? 92  LYS A CE    1 
ATOM   691  N  NZ    . LYS A 1 92  ? 67.513  15.649  43.847 1.00 24.82 ? 92  LYS A NZ    1 
ATOM   692  N  N     . ARG A 1 93  ? 71.456  15.778  40.854 1.00 20.22 ? 93  ARG A N     1 
ATOM   693  C  CA    . ARG A 1 93  ? 72.040  14.683  41.622 1.00 20.44 ? 93  ARG A CA    1 
ATOM   694  C  C     . ARG A 1 93  ? 73.467  14.966  42.094 1.00 18.22 ? 93  ARG A C     1 
ATOM   695  O  O     . ARG A 1 93  ? 73.816  14.658  43.246 1.00 20.08 ? 93  ARG A O     1 
ATOM   696  C  CB    . ARG A 1 93  ? 71.955  13.353  40.821 1.00 25.65 ? 93  ARG A CB    1 
ATOM   697  C  CG    . ARG A 1 93  ? 72.239  12.137  41.653 1.00 20.50 ? 93  ARG A CG    1 
ATOM   698  C  CD    . ARG A 1 93  ? 72.067  10.930  40.754 1.00 23.19 ? 93  ARG A CD    1 
ATOM   699  N  NE    . ARG A 1 93  ? 72.500  9.705   41.469 1.00 25.14 ? 93  ARG A NE    1 
ATOM   700  C  CZ    . ARG A 1 93  ? 72.608  8.492   40.887 1.00 28.59 ? 93  ARG A CZ    1 
ATOM   701  N  NH1   . ARG A 1 93  ? 72.362  8.246   39.559 1.00 16.49 ? 93  ARG A NH1   1 
ATOM   702  N  NH2   . ARG A 1 93  ? 73.153  7.548   41.636 1.00 25.20 ? 93  ARG A NH2   1 
ATOM   703  N  N     . ILE A 1 94  ? 74.292  15.535  41.212 1.00 20.42 ? 94  ILE A N     1 
ATOM   704  C  CA    . ILE A 1 94  ? 75.707  15.864  41.539 1.00 18.74 ? 94  ILE A CA    1 
ATOM   705  C  C     . ILE A 1 94  ? 75.739  17.018  42.549 1.00 16.88 ? 94  ILE A C     1 
ATOM   706  O  O     . ILE A 1 94  ? 76.228  16.859  43.625 1.00 22.49 ? 94  ILE A O     1 
ATOM   707  C  CB    . ILE A 1 94  ? 76.478  16.222  40.191 1.00 20.63 ? 94  ILE A CB    1 
ATOM   708  C  CG1   . ILE A 1 94  ? 76.480  14.979  39.236 1.00 19.29 ? 94  ILE A CG1   1 
ATOM   709  C  CG2   . ILE A 1 94  ? 77.899  16.728  40.512 1.00 20.61 ? 94  ILE A CG2   1 
ATOM   710  C  CD1   . ILE A 1 94  ? 76.866  15.168  37.850 1.00 20.19 ? 94  ILE A CD1   1 
ATOM   711  N  N     . LEU A 1 95  ? 75.030  18.114  42.267 1.00 21.33 ? 95  LEU A N     1 
ATOM   712  C  CA    . LEU A 1 95  ? 75.042  19.301  43.144 1.00 20.64 ? 95  LEU A CA    1 
ATOM   713  C  C     . LEU A 1 95  ? 74.628  19.024  44.566 1.00 19.70 ? 95  LEU A C     1 
ATOM   714  O  O     . LEU A 1 95  ? 75.314  19.492  45.475 1.00 20.61 ? 95  LEU A O     1 
ATOM   715  C  CB    . LEU A 1 95  ? 74.395  20.565  42.481 1.00 18.02 ? 95  LEU A CB    1 
ATOM   716  C  CG    . LEU A 1 95  ? 74.549  21.974  43.043 1.00 22.10 ? 95  LEU A CG    1 
ATOM   717  C  CD1   . LEU A 1 95  ? 75.948  22.539  43.022 1.00 25.89 ? 95  LEU A CD1   1 
ATOM   718  C  CD2   . LEU A 1 95  ? 73.653  22.870  42.246 1.00 23.31 ? 95  LEU A CD2   1 
ATOM   719  N  N     . GLN A 1 96  ? 73.608  18.196  44.809 1.00 19.36 ? 96  GLN A N     1 
ATOM   720  C  CA    . GLN A 1 96  ? 73.324  17.824  46.225 1.00 18.00 ? 96  GLN A CA    1 
ATOM   721  C  C     . GLN A 1 96  ? 74.416  16.893  46.832 1.00 20.51 ? 96  GLN A C     1 
ATOM   722  O  O     . GLN A 1 96  ? 74.576  16.893  48.048 1.00 24.31 ? 96  GLN A O     1 
ATOM   723  C  CB    . GLN A 1 96  ? 71.912  17.189  46.382 1.00 23.99 ? 96  GLN A CB    1 
ATOM   724  C  CG    . GLN A 1 96  ? 71.567  15.912  45.538 1.00 23.78 ? 96  GLN A CG    1 
ATOM   725  C  CD    . GLN A 1 96  ? 71.851  14.635  46.334 1.00 28.17 ? 96  GLN A CD    1 
ATOM   726  O  OE1   . GLN A 1 96  ? 71.510  14.512  47.556 1.00 21.21 ? 96  GLN A OE1   1 
ATOM   727  N  NE2   . GLN A 1 96  ? 72.528  13.697  45.665 1.00 21.88 ? 96  GLN A NE2   1 
ATOM   728  N  N     . ALA A 1 97  ? 75.181  16.120  46.030 1.00 19.19 ? 97  ALA A N     1 
ATOM   729  C  CA    . ALA A 1 97  ? 76.245  15.245  46.635 1.00 18.30 ? 97  ALA A CA    1 
ATOM   730  C  C     . ALA A 1 97  ? 77.615  15.897  46.858 1.00 22.12 ? 97  ALA A C     1 
ATOM   731  O  O     . ALA A 1 97  ? 78.431  15.341  47.538 1.00 20.40 ? 97  ALA A O     1 
ATOM   732  C  CB    . ALA A 1 97  ? 76.394  13.984  45.790 1.00 21.83 ? 97  ALA A CB    1 
ATOM   733  N  N     . VAL A 1 98  ? 77.902  17.044  46.211 1.00 20.50 ? 98  VAL A N     1 
ATOM   734  C  CA    . VAL A 1 98  ? 79.182  17.720  46.347 1.00 18.26 ? 98  VAL A CA    1 
ATOM   735  C  C     . VAL A 1 98  ? 79.357  18.609  47.546 1.00 22.99 ? 98  VAL A C     1 
ATOM   736  O  O     . VAL A 1 98  ? 78.406  18.958  48.221 1.00 23.61 ? 98  VAL A O     1 
ATOM   737  C  CB    . VAL A 1 98  ? 79.612  18.438  45.094 1.00 18.16 ? 98  VAL A CB    1 
ATOM   738  C  CG1   . VAL A 1 98  ? 79.888  17.439  44.075 1.00 15.41 ? 98  VAL A CG1   1 
ATOM   739  C  CG2   . VAL A 1 98  ? 78.601  19.487  44.620 1.00 22.36 ? 98  VAL A CG2   1 
ATOM   740  N  N     . ASN A 1 99  ? 80.592  18.665  48.029 1.00 23.34 ? 99  ASN A N     1 
ATOM   741  C  CA    . ASN A 1 99  ? 80.863  19.540  49.130 1.00 22.70 ? 99  ASN A CA    1 
ATOM   742  C  C     . ASN A 1 99  ? 82.311  20.022  49.098 1.00 25.61 ? 99  ASN A C     1 
ATOM   743  O  O     . ASN A 1 99  ? 83.189  19.235  49.455 1.00 26.89 ? 99  ASN A O     1 
ATOM   744  C  CB    . ASN A 1 99  ? 80.347  18.918  50.413 1.00 25.13 ? 99  ASN A CB    1 
ATOM   745  C  CG    . ASN A 1 99  ? 80.622  19.778  51.584 1.00 38.83 ? 99  ASN A CG    1 
ATOM   746  O  OD1   . ASN A 1 99  ? 80.072  20.861  51.661 1.00 48.28 ? 99  ASN A OD1   1 
ATOM   747  N  ND2   . ASN A 1 99  ? 81.567  19.385  52.440 1.00 46.65 ? 99  ASN A ND2   1 
ATOM   748  N  N     . PHE A 1 100 ? 82.524  21.254  48.588 1.00 23.97 ? 100 PHE A N     1 
ATOM   749  C  CA    . PHE A 1 100 ? 83.819  21.988  48.486 1.00 21.96 ? 100 PHE A CA    1 
ATOM   750  C  C     . PHE A 1 100 ? 83.683  23.501  48.802 1.00 26.47 ? 100 PHE A C     1 
ATOM   751  O  O     . PHE A 1 100 ? 82.610  24.056  48.458 1.00 18.23 ? 100 PHE A O     1 
ATOM   752  C  CB    . PHE A 1 100 ? 84.336  21.847  47.094 1.00 21.03 ? 100 PHE A CB    1 
ATOM   753  C  CG    . PHE A 1 100 ? 85.806  21.777  47.032 1.00 21.69 ? 100 PHE A CG    1 
ATOM   754  C  CD1   . PHE A 1 100 ? 86.523  20.862  47.849 1.00 22.35 ? 100 PHE A CD1   1 
ATOM   755  C  CD2   . PHE A 1 100 ? 86.498  22.665  46.225 1.00 17.24 ? 100 PHE A CD2   1 
ATOM   756  C  CE1   . PHE A 1 100 ? 87.924  20.839  47.873 1.00 23.61 ? 100 PHE A CE1   1 
ATOM   757  C  CE2   . PHE A 1 100 ? 87.894  22.654  46.242 1.00 20.79 ? 100 PHE A CE2   1 
ATOM   758  C  CZ    . PHE A 1 100 ? 88.620  21.756  47.061 1.00 20.35 ? 100 PHE A CZ    1 
ATOM   759  N  N     . PRO A 1 101 ? 84.704  24.206  49.419 1.00 25.88 ? 101 PRO A N     1 
ATOM   760  C  CA    . PRO A 1 101 ? 84.524  25.649  49.701 1.00 24.62 ? 101 PRO A CA    1 
ATOM   761  C  C     . PRO A 1 101 ? 84.176  26.562  48.539 1.00 22.93 ? 101 PRO A C     1 
ATOM   762  O  O     . PRO A 1 101 ? 83.360  27.417  48.760 1.00 25.45 ? 101 PRO A O     1 
ATOM   763  C  CB    . PRO A 1 101 ? 85.899  26.082  50.227 1.00 29.98 ? 101 PRO A CB    1 
ATOM   764  C  CG    . PRO A 1 101 ? 86.657  24.814  50.557 1.00 19.79 ? 101 PRO A CG    1 
ATOM   765  C  CD    . PRO A 1 101 ? 86.128  23.869  49.617 1.00 24.64 ? 101 PRO A CD    1 
ATOM   766  N  N     . PHE A 1 102 ? 84.584  26.196  47.313 1.00 17.82 ? 102 PHE A N     1 
ATOM   767  C  CA    . PHE A 1 102 ? 84.371  26.985  46.108 1.00 17.71 ? 102 PHE A CA    1 
ATOM   768  C  C     . PHE A 1 102 ? 83.183  26.598  45.260 1.00 17.66 ? 102 PHE A C     1 
ATOM   769  O  O     . PHE A 1 102 ? 83.064  27.047  44.120 1.00 20.70 ? 102 PHE A O     1 
ATOM   770  C  CB    . PHE A 1 102 ? 85.637  27.205  45.246 1.00 15.04 ? 102 PHE A CB    1 
ATOM   771  C  CG    . PHE A 1 102 ? 86.851  27.483  46.060 1.00 20.03 ? 102 PHE A CG    1 
ATOM   772  C  CD1   . PHE A 1 102 ? 86.864  28.583  46.951 1.00 18.09 ? 102 PHE A CD1   1 
ATOM   773  C  CD2   . PHE A 1 102 ? 87.912  26.548  46.096 1.00 21.96 ? 102 PHE A CD2   1 
ATOM   774  C  CE1   . PHE A 1 102 ? 87.888  28.764  47.905 1.00 20.86 ? 102 PHE A CE1   1 
ATOM   775  C  CE2   . PHE A 1 102 ? 88.978  26.707  47.050 1.00 25.25 ? 102 PHE A CE2   1 
ATOM   776  C  CZ    . PHE A 1 102 ? 88.951  27.824  47.963 1.00 26.20 ? 102 PHE A CZ    1 
ATOM   777  N  N     . LEU A 1 103 ? 82.265  25.795  45.787 1.00 17.04 ? 103 LEU A N     1 
ATOM   778  C  CA    . LEU A 1 103 ? 81.135  25.447  44.917 1.00 19.75 ? 103 LEU A CA    1 
ATOM   779  C  C     . LEU A 1 103 ? 79.864  25.925  45.594 1.00 18.85 ? 103 LEU A C     1 
ATOM   780  O  O     . LEU A 1 103 ? 79.728  25.760  46.794 1.00 21.37 ? 103 LEU A O     1 
ATOM   781  C  CB    . LEU A 1 103 ? 81.118  23.943  44.643 1.00 19.86 ? 103 LEU A CB    1 
ATOM   782  C  CG    . LEU A 1 103 ? 82.304  23.248  43.967 1.00 17.67 ? 103 LEU A CG    1 
ATOM   783  C  CD1   . LEU A 1 103 ? 82.045  21.700  44.140 1.00 19.83 ? 103 LEU A CD1   1 
ATOM   784  C  CD2   . LEU A 1 103 ? 82.381  23.634  42.540 1.00 13.37 ? 103 LEU A CD2   1 
ATOM   785  N  N     . VAL A 1 104 ? 78.858  26.270  44.825 1.00 20.77 ? 104 VAL A N     1 
ATOM   786  C  CA    . VAL A 1 104 ? 77.609  26.784  45.406 1.00 25.38 ? 104 VAL A CA    1 
ATOM   787  C  C     . VAL A 1 104 ? 76.823  25.700  46.168 1.00 26.57 ? 104 VAL A C     1 
ATOM   788  O  O     . VAL A 1 104 ? 76.922  24.531  45.797 1.00 24.62 ? 104 VAL A O     1 
ATOM   789  C  CB    . VAL A 1 104 ? 76.731  27.452  44.296 1.00 25.63 ? 104 VAL A CB    1 
ATOM   790  C  CG1   . VAL A 1 104 ? 75.797  26.444  43.530 1.00 28.82 ? 104 VAL A CG1   1 
ATOM   791  C  CG2   . VAL A 1 104 ? 75.859  28.493  44.893 1.00 32.19 ? 104 VAL A CG2   1 
ATOM   792  N  N     . LYS A 1 105 ? 76.229  26.052  47.308 1.00 28.48 ? 105 LYS A N     1 
ATOM   793  C  CA    . LYS A 1 105 ? 75.408  25.141  48.107 1.00 28.98 ? 105 LYS A CA    1 
ATOM   794  C  C     . LYS A 1 105 ? 73.940  24.979  47.769 1.00 26.82 ? 105 LYS A C     1 
ATOM   795  O  O     . LYS A 1 105 ? 73.211  25.969  47.705 1.00 27.22 ? 105 LYS A O     1 
ATOM   796  C  CB    . LYS A 1 105 ? 75.626  25.241  49.610 1.00 31.39 ? 105 LYS A CB    1 
ATOM   797  C  CG    . LYS A 1 105 ? 76.687  24.193  50.017 1.00 47.69 ? 105 LYS A CG    1 
ATOM   798  C  CD    . LYS A 1 105 ? 76.581  22.651  49.493 1.00 52.92 ? 105 LYS A CD    1 
ATOM   799  C  CE    . LYS A 1 105 ? 76.922  22.158  47.969 1.00 51.26 ? 105 LYS A CE    1 
ATOM   800  N  NZ    . LYS A 1 105 ? 75.773  21.769  47.004 1.00 31.27 ? 105 LYS A NZ    1 
ATOM   801  N  N     . LEU A 1 106 ? 73.562  23.744  47.419 1.00 26.09 ? 106 LEU A N     1 
ATOM   802  C  CA    . LEU A 1 106 ? 72.169  23.352  47.119 1.00 28.75 ? 106 LEU A CA    1 
ATOM   803  C  C     . LEU A 1 106 ? 71.394  23.112  48.392 1.00 30.97 ? 106 LEU A C     1 
ATOM   804  O  O     . LEU A 1 106 ? 71.761  22.252  49.189 1.00 37.96 ? 106 LEU A O     1 
ATOM   805  C  CB    . LEU A 1 106 ? 72.059  22.098  46.250 1.00 29.84 ? 106 LEU A CB    1 
ATOM   806  C  CG    . LEU A 1 106 ? 70.666  21.674  45.727 1.00 30.56 ? 106 LEU A CG    1 
ATOM   807  C  CD1   . LEU A 1 106 ? 69.906  22.778  45.024 1.00 22.54 ? 106 LEU A CD1   1 
ATOM   808  C  CD2   . LEU A 1 106 ? 70.901  20.605  44.654 1.00 26.61 ? 106 LEU A CD2   1 
ATOM   809  N  N     . GLU A 1 107 ? 70.507  24.034  48.731 1.00 35.07 ? 107 GLU A N     1 
ATOM   810  C  CA    . GLU A 1 107 ? 69.728  23.867  49.966 1.00 35.87 ? 107 GLU A CA    1 
ATOM   811  C  C     . GLU A 1 107 ? 68.551  22.921  49.825 1.00 31.84 ? 107 GLU A C     1 
ATOM   812  O  O     . GLU A 1 107 ? 68.514  21.961  50.570 1.00 37.07 ? 107 GLU A O     1 
ATOM   813  C  CB    . GLU A 1 107 ? 69.218  25.188  50.557 1.00 42.98 ? 107 GLU A CB    1 
ATOM   814  C  CG    . GLU A 1 107 ? 70.225  26.278  50.806 1.00 50.32 ? 107 GLU A CG    1 
ATOM   815  C  CD    . GLU A 1 107 ? 71.406  25.871  51.632 1.00 54.46 ? 107 GLU A CD    1 
ATOM   816  O  OE1   . GLU A 1 107 ? 71.317  25.003  52.519 1.00 61.91 ? 107 GLU A OE1   1 
ATOM   817  O  OE2   . GLU A 1 107 ? 72.451  26.498  51.405 1.00 62.69 ? 107 GLU A OE2   1 
ATOM   818  N  N     . TYR A 1 108 ? 67.664  23.155  48.864 1.00 26.06 ? 108 TYR A N     1 
ATOM   819  C  CA    . TYR A 1 108 ? 66.440  22.380  48.652 1.00 26.32 ? 108 TYR A CA    1 
ATOM   820  C  C     . TYR A 1 108 ? 66.244  22.286  47.168 1.00 26.59 ? 108 TYR A C     1 
ATOM   821  O  O     . TYR A 1 108 ? 66.925  22.986  46.416 1.00 24.46 ? 108 TYR A O     1 
ATOM   822  C  CB    . TYR A 1 108 ? 65.171  23.144  49.072 1.00 28.91 ? 108 TYR A CB    1 
ATOM   823  C  CG    . TYR A 1 108 ? 65.240  23.784  50.404 1.00 25.51 ? 108 TYR A CG    1 
ATOM   824  C  CD1   . TYR A 1 108 ? 65.298  22.968  51.535 1.00 37.78 ? 108 TYR A CD1   1 
ATOM   825  C  CD2   . TYR A 1 108 ? 65.423  25.189  50.556 1.00 37.35 ? 108 TYR A CD2   1 
ATOM   826  C  CE1   . TYR A 1 108 ? 65.567  23.491  52.844 1.00 40.36 ? 108 TYR A CE1   1 
ATOM   827  C  CE2   . TYR A 1 108 ? 65.681  25.764  51.870 1.00 35.74 ? 108 TYR A CE2   1 
ATOM   828  C  CZ    . TYR A 1 108 ? 65.755  24.871  52.977 1.00 42.56 ? 108 TYR A CZ    1 
ATOM   829  O  OH    . TYR A 1 108 ? 66.153  25.198  54.227 1.00 48.01 ? 108 TYR A OH    1 
ATOM   830  N  N     . SER A 1 109 ? 65.443  21.305  46.748 1.00 22.74 ? 109 SER A N     1 
ATOM   831  C  CA    . SER A 1 109 ? 64.993  21.171  45.344 1.00 22.73 ? 109 SER A CA    1 
ATOM   832  C  C     . SER A 1 109 ? 63.608  20.578  45.422 1.00 19.97 ? 109 SER A C     1 
ATOM   833  O  O     . SER A 1 109 ? 63.187  20.109  46.473 1.00 23.51 ? 109 SER A O     1 
ATOM   834  C  CB    . SER A 1 109 ? 65.927  20.356  44.437 1.00 31.18 ? 109 SER A CB    1 
ATOM   835  O  OG    . SER A 1 109 ? 66.517  19.309  45.167 1.00 42.28 ? 109 SER A OG    1 
ATOM   836  N  N     . PHE A 1 110 ? 62.827  20.767  44.387 1.00 15.62 ? 110 PHE A N     1 
ATOM   837  C  CA    . PHE A 1 110 ? 61.447  20.278  44.345 1.00 18.58 ? 110 PHE A CA    1 
ATOM   838  C  C     . PHE A 1 110 ? 60.995  20.563  42.985 1.00 15.37 ? 110 PHE A C     1 
ATOM   839  O  O     . PHE A 1 110 ? 61.746  21.083  42.200 1.00 23.17 ? 110 PHE A O     1 
ATOM   840  C  CB    . PHE A 1 110 ? 60.567  20.876  45.503 1.00 20.81 ? 110 PHE A CB    1 
ATOM   841  C  CG    . PHE A 1 110 ? 60.338  22.379  45.449 1.00 20.38 ? 110 PHE A CG    1 
ATOM   842  C  CD1   . PHE A 1 110 ? 61.267  23.270  46.031 1.00 23.74 ? 110 PHE A CD1   1 
ATOM   843  C  CD2   . PHE A 1 110 ? 59.266  22.884  44.693 1.00 21.99 ? 110 PHE A CD2   1 
ATOM   844  C  CE1   . PHE A 1 110 ? 61.164  24.678  45.831 1.00 22.92 ? 110 PHE A CE1   1 
ATOM   845  C  CE2   . PHE A 1 110 ? 59.122  24.267  44.483 1.00 26.05 ? 110 PHE A CE2   1 
ATOM   846  C  CZ    . PHE A 1 110 ? 60.090  25.171  45.044 1.00 25.50 ? 110 PHE A CZ    1 
ATOM   847  N  N     . LYS A 1 111 ? 59.822  20.076  42.613 1.00 19.22 ? 111 LYS A N     1 
ATOM   848  C  CA    . LYS A 1 111 ? 59.185  20.301  41.299 1.00 21.47 ? 111 LYS A CA    1 
ATOM   849  C  C     . LYS A 1 111 ? 57.659  20.448  41.471 1.00 18.69 ? 111 LYS A C     1 
ATOM   850  O  O     . LYS A 1 111 ? 57.124  20.239  42.554 1.00 24.15 ? 111 LYS A O     1 
ATOM   851  C  CB    . LYS A 1 111 ? 59.414  19.094  40.357 1.00 26.54 ? 111 LYS A CB    1 
ATOM   852  C  CG    . LYS A 1 111 ? 59.223  17.689  41.063 1.00 25.52 ? 111 LYS A CG    1 
ATOM   853  C  CD    . LYS A 1 111 ? 59.425  16.424  40.184 1.00 32.00 ? 111 LYS A CD    1 
ATOM   854  C  CE    . LYS A 1 111 ? 59.453  15.215  41.090 1.00 26.82 ? 111 LYS A CE    1 
ATOM   855  N  NZ    . LYS A 1 111 ? 59.501  13.896  40.419 1.00 34.21 ? 111 LYS A NZ    1 
ATOM   856  N  N     . ASP A 1 112 ? 56.940  20.761  40.432 1.00 14.43 ? 112 ASP A N     1 
ATOM   857  C  CA    . ASP A 1 112 ? 55.476  20.777  40.560 1.00 23.54 ? 112 ASP A CA    1 
ATOM   858  C  C     . ASP A 1 112 ? 54.944  20.456  39.185 1.00 28.77 ? 112 ASP A C     1 
ATOM   859  O  O     . ASP A 1 112 ? 55.785  20.034  38.350 1.00 34.07 ? 112 ASP A O     1 
ATOM   860  C  CB    . ASP A 1 112 ? 54.960  22.106  41.090 1.00 24.08 ? 112 ASP A CB    1 
ATOM   861  C  CG    . ASP A 1 112 ? 55.504  23.318  40.283 1.00 28.76 ? 112 ASP A CG    1 
ATOM   862  O  OD1   . ASP A 1 112 ? 55.733  23.342  39.048 1.00 25.72 ? 112 ASP A OD1   1 
ATOM   863  O  OD2   . ASP A 1 112 ? 55.611  24.334  40.953 1.00 32.25 ? 112 ASP A OD2   1 
ATOM   864  N  N     . ASN A 1 113 ? 53.707  20.861  38.831 1.00 25.31 ? 113 ASN A N     1 
ATOM   865  C  CA    . ASN A 1 113 ? 53.208  20.383  37.548 1.00 20.11 ? 113 ASN A CA    1 
ATOM   866  C  C     . ASN A 1 113 ? 54.004  20.899  36.405 1.00 25.91 ? 113 ASN A C     1 
ATOM   867  O  O     . ASN A 1 113 ? 54.082  20.209  35.389 1.00 25.30 ? 113 ASN A O     1 
ATOM   868  C  CB    . ASN A 1 113 ? 51.778  20.847  37.209 1.00 26.75 ? 113 ASN A CB    1 
ATOM   869  C  CG    . ASN A 1 113 ? 50.693  20.128  37.988 1.00 38.52 ? 113 ASN A CG    1 
ATOM   870  O  OD1   . ASN A 1 113 ? 50.962  19.521  39.027 1.00 39.71 ? 113 ASN A OD1   1 
ATOM   871  N  ND2   . ASN A 1 113 ? 49.438  20.289  37.546 1.00 36.49 ? 113 ASN A ND2   1 
ATOM   872  N  N     . SER A 1 114 ? 54.532  22.124  36.564 1.00 23.17 ? 114 SER A N     1 
ATOM   873  C  CA    . SER A 1 114 ? 55.174  22.724  35.415 1.00 24.09 ? 114 SER A CA    1 
ATOM   874  C  C     . SER A 1 114 ? 56.706  22.806  35.423 1.00 21.98 ? 114 SER A C     1 
ATOM   875  O  O     . SER A 1 114 ? 57.322  22.716  34.382 1.00 25.17 ? 114 SER A O     1 
ATOM   876  C  CB    . SER A 1 114 ? 54.624  24.128  35.298 1.00 26.44 ? 114 SER A CB    1 
ATOM   877  O  OG    . SER A 1 114 ? 53.408  24.070  34.566 1.00 35.08 ? 114 SER A OG    1 
ATOM   878  N  N     . ASN A 1 115 ? 57.300  22.951  36.591 1.00 19.89 ? 115 ASN A N     1 
ATOM   879  C  CA    . ASN A 1 115 ? 58.710  23.313  36.708 1.00 21.27 ? 115 ASN A CA    1 
ATOM   880  C  C     . ASN A 1 115 ? 59.505  22.445  37.660 1.00 24.24 ? 115 ASN A C     1 
ATOM   881  O  O     . ASN A 1 115 ? 58.910  21.793  38.527 1.00 22.20 ? 115 ASN A O     1 
ATOM   882  C  CB    . ASN A 1 115 ? 58.788  24.776  37.262 1.00 18.46 ? 115 ASN A CB    1 
ATOM   883  C  CG    . ASN A 1 115 ? 57.906  25.785  36.470 1.00 23.60 ? 115 ASN A CG    1 
ATOM   884  O  OD1   . ASN A 1 115 ? 57.993  25.850  35.274 1.00 19.08 ? 115 ASN A OD1   1 
ATOM   885  N  ND2   . ASN A 1 115 ? 57.073  26.570  37.141 1.00 23.79 ? 115 ASN A ND2   1 
ATOM   886  N  N     . LEU A 1 116 ? 60.830  22.649  37.659 1.00 22.26 ? 116 LEU A N     1 
ATOM   887  C  CA    . LEU A 1 116 ? 61.793  22.032  38.567 1.00 18.88 ? 116 LEU A CA    1 
ATOM   888  C  C     . LEU A 1 116 ? 62.450  23.209  39.262 1.00 21.01 ? 116 LEU A C     1 
ATOM   889  O  O     . LEU A 1 116 ? 62.841  24.194  38.608 1.00 23.84 ? 116 LEU A O     1 
ATOM   890  C  CB    . LEU A 1 116 ? 62.894  21.319  37.732 1.00 24.75 ? 116 LEU A CB    1 
ATOM   891  C  CG    . LEU A 1 116 ? 62.335  20.296  36.709 1.00 28.41 ? 116 LEU A CG    1 
ATOM   892  C  CD1   . LEU A 1 116 ? 63.298  19.809  35.656 1.00 20.81 ? 116 LEU A CD1   1 
ATOM   893  C  CD2   . LEU A 1 116 ? 61.668  19.113  37.521 1.00 30.26 ? 116 LEU A CD2   1 
ATOM   894  N  N     . TYR A 1 117 ? 62.758  23.040  40.539 1.00 20.94 ? 117 TYR A N     1 
ATOM   895  C  CA    . TYR A 1 117 ? 63.303  24.136  41.327 1.00 17.13 ? 117 TYR A CA    1 
ATOM   896  C  C     . TYR A 1 117 ? 64.469  23.720  42.131 1.00 20.15 ? 117 TYR A C     1 
ATOM   897  O  O     . TYR A 1 117 ? 64.427  22.661  42.762 1.00 21.48 ? 117 TYR A O     1 
ATOM   898  C  CB    . TYR A 1 117 ? 62.290  24.779  42.290 1.00 17.73 ? 117 TYR A CB    1 
ATOM   899  C  CG    . TYR A 1 117 ? 60.982  25.223  41.661 1.00 22.93 ? 117 TYR A CG    1 
ATOM   900  C  CD1   . TYR A 1 117 ? 60.830  26.485  41.085 1.00 26.84 ? 117 TYR A CD1   1 
ATOM   901  C  CD2   . TYR A 1 117 ? 59.895  24.349  41.597 1.00 25.69 ? 117 TYR A CD2   1 
ATOM   902  C  CE1   . TYR A 1 117 ? 59.580  26.872  40.433 1.00 30.37 ? 117 TYR A CE1   1 
ATOM   903  C  CE2   . TYR A 1 117 ? 58.655  24.701  40.995 1.00 25.50 ? 117 TYR A CE2   1 
ATOM   904  C  CZ    . TYR A 1 117 ? 58.480  25.973  40.416 1.00 30.00 ? 117 TYR A CZ    1 
ATOM   905  O  OH    . TYR A 1 117 ? 57.226  26.382  39.962 1.00 21.13 ? 117 TYR A OH    1 
ATOM   906  N  N     . MET A 1 118 ? 65.556  24.475  42.005 1.00 16.14 ? 118 MET A N     1 
ATOM   907  C  CA    . MET A 1 118 ? 66.696  24.203  42.861 1.00 17.52 ? 118 MET A CA    1 
ATOM   908  C  C     . MET A 1 118 ? 67.040  25.449  43.682 1.00 21.76 ? 118 MET A C     1 
ATOM   909  O  O     . MET A 1 118 ? 67.504  26.424  43.123 1.00 21.53 ? 118 MET A O     1 
ATOM   910  C  CB    . MET A 1 118 ? 67.859  23.734  41.985 1.00 21.58 ? 118 MET A CB    1 
ATOM   911  C  CG    . MET A 1 118 ? 67.667  22.513  41.083 1.00 19.80 ? 118 MET A CG    1 
ATOM   912  S  SD    . MET A 1 118 ? 69.160  22.161  40.061 1.00 29.50 ? 118 MET A SD    1 
ATOM   913  C  CE    . MET A 1 118 ? 68.281  22.702  38.684 1.00 17.10 ? 118 MET A CE    1 
ATOM   914  N  N     . VAL A 1 119 ? 67.085  25.345  44.999 1.00 17.16 ? 119 VAL A N     1 
ATOM   915  C  CA    . VAL A 1 119 ? 67.220  26.473  45.870 1.00 17.58 ? 119 VAL A CA    1 
ATOM   916  C  C     . VAL A 1 119 ? 68.586  26.447  46.469 1.00 24.63 ? 119 VAL A C     1 
ATOM   917  O  O     . VAL A 1 119 ? 68.886  25.542  47.267 1.00 23.05 ? 119 VAL A O     1 
ATOM   918  C  CB    . VAL A 1 119 ? 66.065  26.436  46.956 1.00 20.99 ? 119 VAL A CB    1 
ATOM   919  C  CG1   . VAL A 1 119 ? 66.318  27.513  47.993 1.00 20.63 ? 119 VAL A CG1   1 
ATOM   920  C  CG2   . VAL A 1 119 ? 64.578  26.611  46.275 1.00 17.23 ? 119 VAL A CG2   1 
ATOM   921  N  N     . MET A 1 120 ? 69.455  27.351  45.975 1.00 21.27 ? 120 MET A N     1 
ATOM   922  C  CA    . MET A 1 120 ? 70.855  27.428  46.418 1.00 19.47 ? 120 MET A CA    1 
ATOM   923  C  C     . MET A 1 120 ? 71.117  28.588  47.381 1.00 22.64 ? 120 MET A C     1 
ATOM   924  O  O     . MET A 1 120 ? 70.290  29.529  47.465 1.00 24.51 ? 120 MET A O     1 
ATOM   925  C  CB    . MET A 1 120 ? 71.710  27.730  45.175 1.00 23.22 ? 120 MET A CB    1 
ATOM   926  C  CG    . MET A 1 120 ? 71.642  26.807  44.051 1.00 16.89 ? 120 MET A CG    1 
ATOM   927  S  SD    . MET A 1 120 ? 72.357  27.365  42.528 1.00 24.73 ? 120 MET A SD    1 
ATOM   928  C  CE    . MET A 1 120 ? 71.079  28.216  41.677 1.00 19.57 ? 120 MET A CE    1 
ATOM   929  N  N     . GLU A 1 121 ? 72.287  28.581  48.022 1.00 23.57 ? 121 GLU A N     1 
ATOM   930  C  CA    . GLU A 1 121 ? 72.770  29.741  48.784 1.00 27.63 ? 121 GLU A CA    1 
ATOM   931  C  C     . GLU A 1 121 ? 72.917  30.908  47.774 1.00 23.61 ? 121 GLU A C     1 
ATOM   932  O  O     . GLU A 1 121 ? 73.287  30.679  46.600 1.00 24.17 ? 121 GLU A O     1 
ATOM   933  C  CB    . GLU A 1 121 ? 74.145  29.475  49.457 1.00 36.02 ? 121 GLU A CB    1 
ATOM   934  C  CG    . GLU A 1 121 ? 75.508  29.537  48.615 1.00 52.56 ? 121 GLU A CG    1 
ATOM   935  C  CD    . GLU A 1 121 ? 76.786  29.130  49.411 1.00 57.09 ? 121 GLU A CD    1 
ATOM   936  O  OE1   . GLU A 1 121 ? 76.868  29.482  50.614 1.00 63.51 ? 121 GLU A OE1   1 
ATOM   937  O  OE2   . GLU A 1 121 ? 77.646  28.343  48.933 1.00 48.89 ? 121 GLU A OE2   1 
ATOM   938  N  N     . TYR A 1 122 ? 72.358  32.072  48.129 1.00 26.55 ? 122 TYR A N     1 
ATOM   939  C  CA    . TYR A 1 122 ? 72.478  33.324  47.326 1.00 26.88 ? 122 TYR A CA    1 
ATOM   940  C  C     . TYR A 1 122 ? 73.914  33.877  47.498 1.00 26.22 ? 122 TYR A C     1 
ATOM   941  O  O     . TYR A 1 122 ? 74.416  34.064  48.625 1.00 27.88 ? 122 TYR A O     1 
ATOM   942  C  CB    . TYR A 1 122 ? 71.461  34.358  47.786 1.00 28.12 ? 122 TYR A CB    1 
ATOM   943  C  CG    . TYR A 1 122 ? 71.569  35.772  47.223 1.00 28.45 ? 122 TYR A CG    1 
ATOM   944  C  CD1   . TYR A 1 122 ? 71.677  35.965  45.837 1.00 27.77 ? 122 TYR A CD1   1 
ATOM   945  C  CD2   . TYR A 1 122 ? 71.642  36.918  48.083 1.00 27.88 ? 122 TYR A CD2   1 
ATOM   946  C  CE1   . TYR A 1 122 ? 71.876  37.239  45.268 1.00 29.81 ? 122 TYR A CE1   1 
ATOM   947  C  CE2   . TYR A 1 122 ? 71.823  38.266  47.517 1.00 26.89 ? 122 TYR A CE2   1 
ATOM   948  C  CZ    . TYR A 1 122 ? 71.940  38.382  46.120 1.00 32.53 ? 122 TYR A CZ    1 
ATOM   949  O  OH    . TYR A 1 122 ? 72.061  39.584  45.459 1.00 34.17 ? 122 TYR A OH    1 
ATOM   950  N  N     . VAL A 1 123 ? 74.590  34.021  46.364 1.00 27.23 ? 123 VAL A N     1 
ATOM   951  C  CA    . VAL A 1 123 ? 75.996  34.494  46.317 1.00 27.98 ? 123 VAL A CA    1 
ATOM   952  C  C     . VAL A 1 123 ? 75.834  35.959  45.860 1.00 27.20 ? 123 VAL A C     1 
ATOM   953  O  O     . VAL A 1 123 ? 75.598  36.226  44.681 1.00 25.81 ? 123 VAL A O     1 
ATOM   954  C  CB    . VAL A 1 123 ? 76.853  33.649  45.324 1.00 22.39 ? 123 VAL A CB    1 
ATOM   955  C  CG1   . VAL A 1 123 ? 78.330  33.946  45.529 1.00 22.68 ? 123 VAL A CG1   1 
ATOM   956  C  CG2   . VAL A 1 123 ? 76.657  32.170  45.604 1.00 22.50 ? 123 VAL A CG2   1 
ATOM   957  N  N     . PRO A 1 124 ? 75.939  36.925  46.795 1.00 29.81 ? 124 PRO A N     1 
ATOM   958  C  CA    . PRO A 1 124 ? 75.749  38.344  46.431 1.00 30.88 ? 124 PRO A CA    1 
ATOM   959  C  C     . PRO A 1 124 ? 76.719  39.224  45.590 1.00 32.80 ? 124 PRO A C     1 
ATOM   960  O  O     . PRO A 1 124 ? 76.253  40.194  44.940 1.00 34.10 ? 124 PRO A O     1 
ATOM   961  C  CB    . PRO A 1 124 ? 75.334  38.955  47.760 1.00 25.09 ? 124 PRO A CB    1 
ATOM   962  C  CG    . PRO A 1 124 ? 76.103  38.167  48.740 1.00 27.02 ? 124 PRO A CG    1 
ATOM   963  C  CD    . PRO A 1 124 ? 76.463  36.814  48.166 1.00 21.56 ? 124 PRO A CD    1 
ATOM   964  N  N     . GLY A 1 125 ? 77.975  38.807  45.419 1.00 29.81 ? 125 GLY A N     1 
ATOM   965  C  CA    . GLY A 1 125 ? 78.889  39.642  44.667 1.00 26.99 ? 125 GLY A CA    1 
ATOM   966  C  C     . GLY A 1 125 ? 78.736  39.793  43.164 1.00 30.41 ? 125 GLY A C     1 
ATOM   967  O  O     . GLY A 1 125 ? 79.442  40.623  42.604 1.00 34.99 ? 125 GLY A O     1 
ATOM   968  N  N     . GLY A 1 126 ? 77.838  39.081  42.489 1.00 20.30 ? 126 GLY A N     1 
ATOM   969  C  CA    . GLY A 1 126 ? 77.729  39.181  41.053 1.00 15.76 ? 126 GLY A CA    1 
ATOM   970  C  C     . GLY A 1 126 ? 78.549  38.071  40.429 1.00 18.22 ? 126 GLY A C     1 
ATOM   971  O  O     . GLY A 1 126 ? 79.341  37.338  41.063 1.00 17.26 ? 126 GLY A O     1 
ATOM   972  N  N     . GLU A 1 127 ? 78.407  38.018  39.115 1.00 19.64 ? 127 GLU A N     1 
ATOM   973  C  CA    . GLU A 1 127 ? 79.209  37.126  38.271 1.00 23.24 ? 127 GLU A CA    1 
ATOM   974  C  C     . GLU A 1 127 ? 80.547  37.796  38.173 1.00 25.94 ? 127 GLU A C     1 
ATOM   975  O  O     . GLU A 1 127 ? 80.640  39.020  37.996 1.00 31.35 ? 127 GLU A O     1 
ATOM   976  C  CB    . GLU A 1 127 ? 78.659  37.003  36.855 1.00 20.73 ? 127 GLU A CB    1 
ATOM   977  C  CG    . GLU A 1 127 ? 77.149  36.659  36.830 1.00 22.10 ? 127 GLU A CG    1 
ATOM   978  C  CD    . GLU A 1 127 ? 76.531  36.685  35.499 1.00 22.09 ? 127 GLU A CD    1 
ATOM   979  O  OE1   . GLU A 1 127 ? 77.172  37.161  34.560 1.00 28.75 ? 127 GLU A OE1   1 
ATOM   980  O  OE2   . GLU A 1 127 ? 75.351  36.297  35.294 1.00 25.79 ? 127 GLU A OE2   1 
ATOM   981  N  N     . MET A 1 128 ? 81.560  36.977  38.023 1.00 25.70 ? 128 MET A N     1 
ATOM   982  C  CA    . MET A 1 128 ? 82.905  37.449  37.800 1.00 22.90 ? 128 MET A CA    1 
ATOM   983  C  C     . MET A 1 128 ? 82.814  38.204  36.479 1.00 21.99 ? 128 MET A C     1 
ATOM   984  O  O     . MET A 1 128 ? 83.454  39.265  36.409 1.00 24.20 ? 128 MET A O     1 
ATOM   985  C  CB    . MET A 1 128 ? 83.894  36.308  37.553 1.00 23.35 ? 128 MET A CB    1 
ATOM   986  C  CG    . MET A 1 128 ? 85.357  36.833  37.236 1.00 20.16 ? 128 MET A CG    1 
ATOM   987  S  SD    . MET A 1 128 ? 86.296  35.306  37.442 1.00 35.57 ? 128 MET A SD    1 
ATOM   988  C  CE    . MET A 1 128 ? 86.408  35.440  35.889 1.00 2.00  ? 128 MET A CE    1 
ATOM   989  N  N     . PHE A 1 129 ? 81.922  37.788  35.570 1.00 13.03 ? 129 PHE A N     1 
ATOM   990  C  CA    . PHE A 1 129 ? 81.762  38.402  34.240 1.00 20.77 ? 129 PHE A CA    1 
ATOM   991  C  C     . PHE A 1 129 ? 81.640  39.980  34.294 1.00 28.61 ? 129 PHE A C     1 
ATOM   992  O  O     . PHE A 1 129 ? 82.233  40.685  33.439 1.00 26.82 ? 129 PHE A O     1 
ATOM   993  C  CB    . PHE A 1 129 ? 80.545  37.823  33.505 1.00 18.36 ? 129 PHE A CB    1 
ATOM   994  C  CG    . PHE A 1 129 ? 80.336  38.383  32.123 1.00 21.08 ? 129 PHE A CG    1 
ATOM   995  C  CD1   . PHE A 1 129 ? 81.043  37.838  31.029 1.00 23.14 ? 129 PHE A CD1   1 
ATOM   996  C  CD2   . PHE A 1 129 ? 79.435  39.442  31.899 1.00 19.30 ? 129 PHE A CD2   1 
ATOM   997  C  CE1   . PHE A 1 129 ? 80.862  38.305  29.680 1.00 17.50 ? 129 PHE A CE1   1 
ATOM   998  C  CE2   . PHE A 1 129 ? 79.260  39.942  30.585 1.00 11.76 ? 129 PHE A CE2   1 
ATOM   999  C  CZ    . PHE A 1 129 ? 79.937  39.401  29.474 1.00 16.97 ? 129 PHE A CZ    1 
ATOM   1000 N  N     . SER A 1 130 ? 80.714  40.415  35.162 1.00 21.49 ? 130 SER A N     1 
ATOM   1001 C  CA    . SER A 1 130 ? 80.387  41.783  35.507 1.00 25.11 ? 130 SER A CA    1 
ATOM   1002 C  C     . SER A 1 130 ? 81.523  42.757  35.810 1.00 23.49 ? 130 SER A C     1 
ATOM   1003 O  O     . SER A 1 130 ? 81.743  43.722  35.040 1.00 22.98 ? 130 SER A O     1 
ATOM   1004 C  CB    . SER A 1 130 ? 79.508  41.728  36.740 1.00 16.08 ? 130 SER A CB    1 
ATOM   1005 O  OG    . SER A 1 130 ? 78.328  41.654  36.018 1.00 34.64 ? 130 SER A OG    1 
ATOM   1006 N  N     . HIS A 1 131 ? 82.348  42.239  36.713 1.00 20.01 ? 131 HIS A N     1 
ATOM   1007 C  CA    . HIS A 1 131 ? 83.525  42.846  37.278 1.00 19.15 ? 131 HIS A CA    1 
ATOM   1008 C  C     . HIS A 1 131 ? 84.629  42.827  36.293 1.00 23.11 ? 131 HIS A C     1 
ATOM   1009 O  O     . HIS A 1 131 ? 85.159  43.883  36.021 1.00 23.32 ? 131 HIS A O     1 
ATOM   1010 C  CB    . HIS A 1 131 ? 83.956  42.188  38.580 1.00 21.47 ? 131 HIS A CB    1 
ATOM   1011 C  CG    . HIS A 1 131 ? 82.849  42.078  39.568 1.00 35.77 ? 131 HIS A CG    1 
ATOM   1012 N  ND1   . HIS A 1 131 ? 82.549  43.061  40.487 1.00 38.38 ? 131 HIS A ND1   1 
ATOM   1013 C  CD2   . HIS A 1 131 ? 81.978  41.064  39.804 1.00 39.79 ? 131 HIS A CD2   1 
ATOM   1014 C  CE1   . HIS A 1 131 ? 81.556  42.650  41.259 1.00 40.21 ? 131 HIS A CE1   1 
ATOM   1015 N  NE2   . HIS A 1 131 ? 81.181  41.449  40.852 1.00 38.21 ? 131 HIS A NE2   1 
ATOM   1016 N  N     . LEU A 1 132 ? 84.726  41.763  35.517 1.00 20.52 ? 132 LEU A N     1 
ATOM   1017 C  CA    . LEU A 1 132 ? 85.784  41.656  34.522 1.00 24.16 ? 132 LEU A CA    1 
ATOM   1018 C  C     . LEU A 1 132 ? 85.524  42.655  33.400 1.00 24.12 ? 132 LEU A C     1 
ATOM   1019 O  O     . LEU A 1 132 ? 86.463  43.335  33.011 1.00 24.79 ? 132 LEU A O     1 
ATOM   1020 C  CB    . LEU A 1 132 ? 85.884  40.213  33.939 1.00 25.88 ? 132 LEU A CB    1 
ATOM   1021 C  CG    . LEU A 1 132 ? 87.017  40.012  32.912 1.00 28.42 ? 132 LEU A CG    1 
ATOM   1022 C  CD1   . LEU A 1 132 ? 88.415  40.218  33.559 1.00 20.13 ? 132 LEU A CD1   1 
ATOM   1023 C  CD2   . LEU A 1 132 ? 86.806  38.685  32.165 1.00 31.68 ? 132 LEU A CD2   1 
ATOM   1024 N  N     . ARG A 1 133 ? 84.355  42.600  32.764 1.00 17.44 ? 133 ARG A N     1 
ATOM   1025 C  CA    . ARG A 1 133 ? 83.978  43.578  31.756 1.00 22.56 ? 133 ARG A CA    1 
ATOM   1026 C  C     . ARG A 1 133 ? 83.991  45.119  32.135 1.00 21.22 ? 133 ARG A C     1 
ATOM   1027 O  O     . ARG A 1 133 ? 84.439  45.911  31.297 1.00 19.92 ? 133 ARG A O     1 
ATOM   1028 C  CB    . ARG A 1 133 ? 82.634  43.159  31.144 1.00 25.54 ? 133 ARG A CB    1 
ATOM   1029 C  CG    . ARG A 1 133 ? 82.843  41.890  30.412 1.00 25.88 ? 133 ARG A CG    1 
ATOM   1030 C  CD    . ARG A 1 133 ? 83.072  42.147  28.920 1.00 25.33 ? 133 ARG A CD    1 
ATOM   1031 N  NE    . ARG A 1 133 ? 82.971  40.866  28.198 1.00 27.50 ? 133 ARG A NE    1 
ATOM   1032 C  CZ    . ARG A 1 133 ? 83.796  39.828  28.380 1.00 26.44 ? 133 ARG A CZ    1 
ATOM   1033 N  NH1   . ARG A 1 133 ? 84.970  39.991  29.038 1.00 20.32 ? 133 ARG A NH1   1 
ATOM   1034 N  NH2   . ARG A 1 133 ? 83.500  38.706  27.695 1.00 23.46 ? 133 ARG A NH2   1 
ATOM   1035 N  N     . ARG A 1 134 ? 83.677  45.473  33.390 1.00 20.75 ? 134 ARG A N     1 
ATOM   1036 C  CA    . ARG A 1 134 ? 83.662  46.824  33.936 1.00 22.30 ? 134 ARG A CA    1 
ATOM   1037 C  C     . ARG A 1 134 ? 85.097  47.318  34.004 1.00 28.88 ? 134 ARG A C     1 
ATOM   1038 O  O     . ARG A 1 134 ? 85.385  48.293  33.301 1.00 29.98 ? 134 ARG A O     1 
ATOM   1039 C  CB    . ARG A 1 134 ? 83.157  46.887  35.361 1.00 21.42 ? 134 ARG A CB    1 
ATOM   1040 C  CG    . ARG A 1 134 ? 83.026  48.358  35.821 1.00 27.46 ? 134 ARG A CG    1 
ATOM   1041 C  CD    . ARG A 1 134 ? 82.595  48.597  37.232 1.00 32.70 ? 134 ARG A CD    1 
ATOM   1042 N  NE    . ARG A 1 134 ? 83.346  47.753  38.189 1.00 53.01 ? 134 ARG A NE    1 
ATOM   1043 C  CZ    . ARG A 1 134 ? 82.863  46.662  38.812 1.00 57.44 ? 134 ARG A CZ    1 
ATOM   1044 N  NH1   . ARG A 1 134 ? 81.620  46.213  38.571 1.00 62.34 ? 134 ARG A NH1   1 
ATOM   1045 N  NH2   . ARG A 1 134 ? 83.631  45.968  39.645 1.00 54.32 ? 134 ARG A NH2   1 
ATOM   1046 N  N     . ILE A 1 135 ? 85.969  46.524  34.651 1.00 26.86 ? 135 ILE A N     1 
ATOM   1047 C  CA    . ILE A 1 135 ? 87.377  46.827  34.858 1.00 27.00 ? 135 ILE A CA    1 
ATOM   1048 C  C     . ILE A 1 135 ? 88.290  46.622  33.703 1.00 24.53 ? 135 ILE A C     1 
ATOM   1049 O  O     . ILE A 1 135 ? 89.312  47.299  33.608 1.00 29.34 ? 135 ILE A O     1 
ATOM   1050 C  CB    . ILE A 1 135 ? 88.057  46.325  36.165 1.00 32.99 ? 135 ILE A CB    1 
ATOM   1051 C  CG1   . ILE A 1 135 ? 88.609  44.918  36.086 1.00 32.58 ? 135 ILE A CG1   1 
ATOM   1052 C  CG2   . ILE A 1 135 ? 87.298  46.716  37.443 1.00 41.91 ? 135 ILE A CG2   1 
ATOM   1053 C  CD1   . ILE A 1 135 ? 89.455  44.740  37.335 1.00 35.66 ? 135 ILE A CD1   1 
ATOM   1054 N  N     . GLY A 1 136 ? 87.842  45.817  32.762 1.00 20.66 ? 136 GLY A N     1 
ATOM   1055 C  CA    . GLY A 1 136 ? 88.622  45.546  31.585 1.00 18.99 ? 136 GLY A CA    1 
ATOM   1056 C  C     . GLY A 1 136 ? 89.305  44.197  31.532 1.00 22.22 ? 136 GLY A C     1 
ATOM   1057 O  O     . GLY A 1 136 ? 89.049  43.477  30.567 1.00 23.45 ? 136 GLY A O     1 
ATOM   1058 N  N     . ARG A 1 137 ? 90.323  44.032  32.375 1.00 24.82 ? 137 ARG A N     1 
ATOM   1059 C  CA    . ARG A 1 137 ? 91.167  42.821  32.545 1.00 26.75 ? 137 ARG A CA    1 
ATOM   1060 C  C     . ARG A 1 137 ? 91.683  42.795  33.959 1.00 23.05 ? 137 ARG A C     1 
ATOM   1061 O  O     . ARG A 1 137 ? 91.647  43.836  34.626 1.00 30.67 ? 137 ARG A O     1 
ATOM   1062 C  CB    . ARG A 1 137 ? 92.373  42.881  31.613 1.00 31.26 ? 137 ARG A CB    1 
ATOM   1063 C  CG    . ARG A 1 137 ? 93.413  44.023  31.788 1.00 32.93 ? 137 ARG A CG    1 
ATOM   1064 C  CD    . ARG A 1 137 ? 94.253  43.911  30.541 1.00 42.09 ? 137 ARG A CD    1 
ATOM   1065 N  NE    . ARG A 1 137 ? 95.198  44.985  30.202 1.00 54.10 ? 137 ARG A NE    1 
ATOM   1066 C  CZ    . ARG A 1 137 ? 96.263  45.349  30.917 1.00 59.37 ? 137 ARG A CZ    1 
ATOM   1067 N  NH1   . ARG A 1 137 ? 96.527  44.811  32.110 1.00 58.87 ? 137 ARG A NH1   1 
ATOM   1068 N  NH2   . ARG A 1 137 ? 97.054  46.304  30.442 1.00 59.95 ? 137 ARG A NH2   1 
ATOM   1069 N  N     . PHE A 1 138 ? 92.038  41.648  34.514 1.00 20.85 ? 138 PHE A N     1 
ATOM   1070 C  CA    . PHE A 1 138 ? 92.600  41.556  35.879 1.00 22.33 ? 138 PHE A CA    1 
ATOM   1071 C  C     . PHE A 1 138 ? 94.142  41.505  35.788 1.00 19.66 ? 138 PHE A C     1 
ATOM   1072 O  O     . PHE A 1 138 ? 94.763  41.133  34.781 1.00 26.62 ? 138 PHE A O     1 
ATOM   1073 C  CB    . PHE A 1 138 ? 92.118  40.327  36.690 1.00 27.93 ? 138 PHE A CB    1 
ATOM   1074 C  CG    . PHE A 1 138 ? 90.637  40.235  36.930 1.00 28.62 ? 138 PHE A CG    1 
ATOM   1075 C  CD1   . PHE A 1 138 ? 89.856  41.357  37.221 1.00 31.85 ? 138 PHE A CD1   1 
ATOM   1076 C  CD2   . PHE A 1 138 ? 89.996  39.011  36.798 1.00 28.72 ? 138 PHE A CD2   1 
ATOM   1077 C  CE1   . PHE A 1 138 ? 88.458  41.280  37.347 1.00 30.04 ? 138 PHE A CE1   1 
ATOM   1078 C  CE2   . PHE A 1 138 ? 88.592  38.914  36.932 1.00 29.57 ? 138 PHE A CE2   1 
ATOM   1079 C  CZ    . PHE A 1 138 ? 87.826  40.064  37.199 1.00 30.70 ? 138 PHE A CZ    1 
ATOM   1080 N  N     . SER A 1 139 ? 94.793  41.896  36.861 1.00 20.76 ? 139 SER A N     1 
ATOM   1081 C  CA    . SER A 1 139 ? 96.243  41.844  36.886 1.00 24.45 ? 139 SER A CA    1 
ATOM   1082 C  C     . SER A 1 139 ? 96.644  40.377  37.068 1.00 28.13 ? 139 SER A C     1 
ATOM   1083 O  O     . SER A 1 139 ? 95.808  39.572  37.492 1.00 32.68 ? 139 SER A O     1 
ATOM   1084 C  CB    . SER A 1 139 ? 96.729  42.687  38.036 1.00 18.40 ? 139 SER A CB    1 
ATOM   1085 O  OG    . SER A 1 139 ? 96.216  42.184  39.249 1.00 27.31 ? 139 SER A OG    1 
ATOM   1086 N  N     . GLU A 1 140 ? 97.810  39.975  36.573 1.00 30.09 ? 140 GLU A N     1 
ATOM   1087 C  CA    . GLU A 1 140 ? 98.277  38.606  36.794 1.00 31.43 ? 140 GLU A CA    1 
ATOM   1088 C  C     . GLU A 1 140 ? 98.135  38.063  38.236 1.00 31.41 ? 140 GLU A C     1 
ATOM   1089 O  O     . GLU A 1 140 ? 97.487  37.046  38.368 1.00 26.68 ? 140 GLU A O     1 
ATOM   1090 C  CB    . GLU A 1 140 ? 99.648  38.344  36.240 1.00 22.54 ? 140 GLU A CB    1 
ATOM   1091 C  CG    . GLU A 1 140 ? 99.592  38.328  34.772 1.00 29.66 ? 140 GLU A CG    1 
ATOM   1092 C  CD    . GLU A 1 140 ? 100.896 37.885  34.189 1.00 34.50 ? 140 GLU A CD    1 
ATOM   1093 O  OE1   . GLU A 1 140 ? 101.603 37.022  34.789 1.00 34.62 ? 140 GLU A OE1   1 
ATOM   1094 O  OE2   . GLU A 1 140 ? 101.165 38.383  33.078 1.00 35.56 ? 140 GLU A OE2   1 
ATOM   1095 N  N     . PRO A 1 141 ? 98.449  38.854  39.282 1.00 30.79 ? 141 PRO A N     1 
ATOM   1096 C  CA    . PRO A 1 141 ? 98.266  38.293  40.616 1.00 28.37 ? 141 PRO A CA    1 
ATOM   1097 C  C     . PRO A 1 141 ? 96.795  38.134  40.989 1.00 28.84 ? 141 PRO A C     1 
ATOM   1098 O  O     . PRO A 1 141 ? 96.496  37.346  41.879 1.00 32.14 ? 141 PRO A O     1 
ATOM   1099 C  CB    . PRO A 1 141 ? 98.881  39.330  41.558 1.00 27.26 ? 141 PRO A CB    1 
ATOM   1100 C  CG    . PRO A 1 141 ? 99.916  40.013  40.739 1.00 32.21 ? 141 PRO A CG    1 
ATOM   1101 C  CD    . PRO A 1 141 ? 99.408  39.979  39.291 1.00 30.10 ? 141 PRO A CD    1 
ATOM   1102 N  N     . HIS A 1 142 ? 95.882  38.849  40.355 1.00 32.59 ? 142 HIS A N     1 
ATOM   1103 C  CA    . HIS A 1 142 ? 94.420  38.815  40.659 1.00 30.03 ? 142 HIS A CA    1 
ATOM   1104 C  C     . HIS A 1 142 ? 93.874  37.574  39.903 1.00 29.11 ? 142 HIS A C     1 
ATOM   1105 O  O     . HIS A 1 142 ? 93.164  36.775  40.526 1.00 23.49 ? 142 HIS A O     1 
ATOM   1106 C  CB    . HIS A 1 142 ? 93.797  40.127  40.109 1.00 39.87 ? 142 HIS A CB    1 
ATOM   1107 C  CG    . HIS A 1 142 ? 92.369  40.419  40.467 1.00 48.23 ? 142 HIS A CG    1 
ATOM   1108 N  ND1   . HIS A 1 142 ? 91.885  41.706  40.557 1.00 54.99 ? 142 HIS A ND1   1 
ATOM   1109 C  CD2   . HIS A 1 142 ? 91.288  39.622  40.645 1.00 56.52 ? 142 HIS A CD2   1 
ATOM   1110 C  CE1   . HIS A 1 142 ? 90.579  41.696  40.768 1.00 56.57 ? 142 HIS A CE1   1 
ATOM   1111 N  NE2   . HIS A 1 142 ? 90.191  40.435  40.835 1.00 59.23 ? 142 HIS A NE2   1 
ATOM   1112 N  N     . ALA A 1 143 ? 94.259  37.445  38.616 1.00 21.59 ? 143 ALA A N     1 
ATOM   1113 C  CA    . ALA A 1 143 ? 93.957  36.355  37.733 1.00 22.87 ? 143 ALA A CA    1 
ATOM   1114 C  C     . ALA A 1 143 ? 94.424  35.019  38.371 1.00 27.23 ? 143 ALA A C     1 
ATOM   1115 O  O     . ALA A 1 143 ? 93.601  34.174  38.655 1.00 29.81 ? 143 ALA A O     1 
ATOM   1116 C  CB    . ALA A 1 143 ? 94.585  36.590  36.460 1.00 18.59 ? 143 ALA A CB    1 
ATOM   1117 N  N     . ARG A 1 144 ? 95.656  34.934  38.858 1.00 22.91 ? 144 ARG A N     1 
ATOM   1118 C  CA    . ARG A 1 144 ? 96.187  33.804  39.583 1.00 26.78 ? 144 ARG A CA    1 
ATOM   1119 C  C     . ARG A 1 144 ? 95.369  33.433  40.839 1.00 29.49 ? 144 ARG A C     1 
ATOM   1120 O  O     . ARG A 1 144 ? 95.174  32.230  41.090 1.00 26.40 ? 144 ARG A O     1 
ATOM   1121 C  CB    . ARG A 1 144 ? 97.638  34.111  39.941 1.00 30.93 ? 144 ARG A CB    1 
ATOM   1122 C  CG    . ARG A 1 144 ? 98.332  33.109  40.842 1.00 40.77 ? 144 ARG A CG    1 
ATOM   1123 C  CD    . ARG A 1 144 ? 99.837  33.156  40.706 1.00 36.79 ? 144 ARG A CD    1 
ATOM   1124 N  NE    . ARG A 1 144 ? 100.327 34.432  41.207 1.00 42.28 ? 144 ARG A NE    1 
ATOM   1125 C  CZ    . ARG A 1 144 ? 100.999 35.341  40.494 1.00 36.64 ? 144 ARG A CZ    1 
ATOM   1126 N  NH1   . ARG A 1 144 ? 101.406 35.090  39.253 1.00 23.52 ? 144 ARG A NH1   1 
ATOM   1127 N  NH2   . ARG A 1 144 ? 101.355 36.458  41.120 1.00 38.26 ? 144 ARG A NH2   1 
ATOM   1128 N  N     . PHE A 1 145 ? 94.866  34.417  41.589 1.00 26.97 ? 145 PHE A N     1 
ATOM   1129 C  CA    . PHE A 1 145 ? 94.072  34.151  42.824 1.00 28.85 ? 145 PHE A CA    1 
ATOM   1130 C  C     . PHE A 1 145 ? 92.767  33.283  42.560 1.00 29.31 ? 145 PHE A C     1 
ATOM   1131 O  O     . PHE A 1 145 ? 92.314  32.445  43.388 1.00 23.14 ? 145 PHE A O     1 
ATOM   1132 C  CB    . PHE A 1 145 ? 93.729  35.492  43.478 1.00 22.49 ? 145 PHE A CB    1 
ATOM   1133 C  CG    . PHE A 1 145 ? 92.775  35.387  44.601 1.00 19.46 ? 145 PHE A CG    1 
ATOM   1134 C  CD1   . PHE A 1 145 ? 93.174  34.890  45.824 1.00 24.79 ? 145 PHE A CD1   1 
ATOM   1135 C  CD2   . PHE A 1 145 ? 91.457  35.776  44.430 1.00 23.45 ? 145 PHE A CD2   1 
ATOM   1136 C  CE1   . PHE A 1 145 ? 92.251  34.778  46.895 1.00 27.39 ? 145 PHE A CE1   1 
ATOM   1137 C  CE2   . PHE A 1 145 ? 90.502  35.682  45.512 1.00 20.61 ? 145 PHE A CE2   1 
ATOM   1138 C  CZ    . PHE A 1 145 ? 90.909  35.185  46.720 1.00 28.70 ? 145 PHE A CZ    1 
ATOM   1139 N  N     . TYR A 1 146 ? 92.116  33.673  41.466 1.00 26.25 ? 146 TYR A N     1 
ATOM   1140 C  CA    . TYR A 1 146 ? 90.950  33.003  41.006 1.00 25.77 ? 146 TYR A CA    1 
ATOM   1141 C  C     . TYR A 1 146 ? 91.329  31.689  40.298 1.00 26.29 ? 146 TYR A C     1 
ATOM   1142 O  O     . TYR A 1 146 ? 90.617  30.693  40.519 1.00 22.36 ? 146 TYR A O     1 
ATOM   1143 C  CB    . TYR A 1 146 ? 90.149  33.891  40.087 1.00 26.14 ? 146 TYR A CB    1 
ATOM   1144 C  CG    . TYR A 1 146 ? 89.460  35.107  40.678 1.00 22.22 ? 146 TYR A CG    1 
ATOM   1145 C  CD1   . TYR A 1 146 ? 88.947  35.161  41.986 1.00 25.07 ? 146 TYR A CD1   1 
ATOM   1146 C  CD2   . TYR A 1 146 ? 89.439  36.290  39.896 1.00 33.38 ? 146 TYR A CD2   1 
ATOM   1147 C  CE1   . TYR A 1 146 ? 88.440  36.414  42.544 1.00 32.39 ? 146 TYR A CE1   1 
ATOM   1148 C  CE2   . TYR A 1 146 ? 88.931  37.506  40.399 1.00 37.70 ? 146 TYR A CE2   1 
ATOM   1149 C  CZ    . TYR A 1 146 ? 88.452  37.584  41.714 1.00 38.19 ? 146 TYR A CZ    1 
ATOM   1150 O  OH    . TYR A 1 146 ? 88.102  38.865  42.118 1.00 38.01 ? 146 TYR A OH    1 
ATOM   1151 N  N     . ALA A 1 147 ? 92.384  31.662  39.471 1.00 20.32 ? 147 ALA A N     1 
ATOM   1152 C  CA    . ALA A 1 147 ? 92.781  30.444  38.754 1.00 23.36 ? 147 ALA A CA    1 
ATOM   1153 C  C     . ALA A 1 147 ? 93.091  29.343  39.730 1.00 23.38 ? 147 ALA A C     1 
ATOM   1154 O  O     . ALA A 1 147 ? 92.512  28.314  39.559 1.00 28.76 ? 147 ALA A O     1 
ATOM   1155 C  CB    . ALA A 1 147 ? 93.955  30.592  37.795 1.00 18.54 ? 147 ALA A CB    1 
ATOM   1156 N  N     . ALA A 1 148 ? 93.673  29.657  40.876 1.00 25.45 ? 148 ALA A N     1 
ATOM   1157 C  CA    . ALA A 1 148 ? 94.049  28.703  41.908 1.00 27.12 ? 148 ALA A CA    1 
ATOM   1158 C  C     . ALA A 1 148 ? 92.789  28.077  42.509 1.00 31.54 ? 148 ALA A C     1 
ATOM   1159 O  O     . ALA A 1 148 ? 92.823  26.888  42.817 1.00 33.25 ? 148 ALA A O     1 
ATOM   1160 C  CB    . ALA A 1 148 ? 94.875  29.372  43.046 1.00 21.61 ? 148 ALA A CB    1 
ATOM   1161 N  N     . GLN A 1 149 ? 91.713  28.861  42.663 1.00 29.41 ? 149 GLN A N     1 
ATOM   1162 C  CA    . GLN A 1 149 ? 90.468  28.351  43.217 1.00 28.31 ? 149 GLN A CA    1 
ATOM   1163 C  C     . GLN A 1 149 ? 89.872  27.309  42.296 1.00 25.94 ? 149 GLN A C     1 
ATOM   1164 O  O     . GLN A 1 149 ? 89.469  26.234  42.793 1.00 24.75 ? 149 GLN A O     1 
ATOM   1165 C  CB    . GLN A 1 149 ? 89.447  29.454  43.596 1.00 32.29 ? 149 GLN A CB    1 
ATOM   1166 C  CG    . GLN A 1 149 ? 89.902  30.320  44.828 1.00 33.67 ? 149 GLN A CG    1 
ATOM   1167 C  CD    . GLN A 1 149 ? 89.015  31.546  45.019 1.00 28.85 ? 149 GLN A CD    1 
ATOM   1168 O  OE1   . GLN A 1 149 ? 87.840  31.412  45.163 1.00 32.77 ? 149 GLN A OE1   1 
ATOM   1169 N  NE2   . GLN A 1 149 ? 89.561  32.737  44.936 1.00 32.96 ? 149 GLN A NE2   1 
ATOM   1170 N  N     . ILE A 1 150 ? 89.806  27.641  41.008 1.00 20.96 ? 150 ILE A N     1 
ATOM   1171 C  CA    . ILE A 1 150 ? 89.334  26.718  39.963 1.00 25.10 ? 150 ILE A CA    1 
ATOM   1172 C  C     . ILE A 1 150 ? 90.262  25.484  39.804 1.00 28.05 ? 150 ILE A C     1 
ATOM   1173 O  O     . ILE A 1 150 ? 89.734  24.362  39.723 1.00 29.84 ? 150 ILE A O     1 
ATOM   1174 C  CB    . ILE A 1 150 ? 89.081  27.352  38.569 1.00 25.50 ? 150 ILE A CB    1 
ATOM   1175 C  CG1   . ILE A 1 150 ? 88.301  28.689  38.635 1.00 22.83 ? 150 ILE A CG1   1 
ATOM   1176 C  CG2   . ILE A 1 150 ? 88.467  26.297  37.573 1.00 21.34 ? 150 ILE A CG2   1 
ATOM   1177 C  CD1   . ILE A 1 150 ? 86.995  28.649  39.377 1.00 30.04 ? 150 ILE A CD1   1 
ATOM   1178 N  N     . VAL A 1 151 ? 91.575  25.640  40.010 1.00 24.41 ? 151 VAL A N     1 
ATOM   1179 C  CA    . VAL A 1 151 ? 92.502  24.519  39.977 1.00 22.21 ? 151 VAL A CA    1 
ATOM   1180 C  C     . VAL A 1 151 ? 92.157  23.520  41.093 1.00 25.33 ? 151 VAL A C     1 
ATOM   1181 O  O     . VAL A 1 151 ? 91.852  22.396  40.771 1.00 28.04 ? 151 VAL A O     1 
ATOM   1182 C  CB    . VAL A 1 151 ? 93.947  24.939  40.002 1.00 18.61 ? 151 VAL A CB    1 
ATOM   1183 C  CG1   . VAL A 1 151 ? 94.838  23.638  40.133 1.00 20.64 ? 151 VAL A CG1   1 
ATOM   1184 C  CG2   . VAL A 1 151 ? 94.274  25.604  38.660 1.00 21.24 ? 151 VAL A CG2   1 
ATOM   1185 N  N     . LEU A 1 152 ? 91.934  23.973  42.311 1.00 23.26 ? 152 LEU A N     1 
ATOM   1186 C  CA    . LEU A 1 152 ? 91.518  23.142  43.427 1.00 26.36 ? 152 LEU A CA    1 
ATOM   1187 C  C     . LEU A 1 152 ? 90.119  22.523  43.203 1.00 26.54 ? 152 LEU A C     1 
ATOM   1188 O  O     . LEU A 1 152 ? 89.907  21.374  43.496 1.00 30.01 ? 152 LEU A O     1 
ATOM   1189 C  CB    . LEU A 1 152 ? 91.610  23.872  44.774 1.00 16.14 ? 152 LEU A CB    1 
ATOM   1190 C  CG    . LEU A 1 152 ? 93.064  24.253  45.129 1.00 20.74 ? 152 LEU A CG    1 
ATOM   1191 C  CD1   . LEU A 1 152 ? 93.199  25.130  46.283 1.00 20.46 ? 152 LEU A CD1   1 
ATOM   1192 C  CD2   . LEU A 1 152 ? 93.758  23.049  45.646 1.00 23.50 ? 152 LEU A CD2   1 
ATOM   1193 N  N     . THR A 1 153 ? 89.173  23.273  42.694 1.00 26.39 ? 153 THR A N     1 
ATOM   1194 C  CA    . THR A 1 153 ? 87.853  22.778  42.374 1.00 20.98 ? 153 THR A CA    1 
ATOM   1195 C  C     . THR A 1 153 ? 87.868  21.623  41.383 1.00 20.14 ? 153 THR A C     1 
ATOM   1196 O  O     . THR A 1 153 ? 87.087  20.711  41.515 1.00 18.61 ? 153 THR A O     1 
ATOM   1197 C  CB    . THR A 1 153 ? 87.017  23.996  41.872 1.00 25.28 ? 153 THR A CB    1 
ATOM   1198 O  OG1   . THR A 1 153 ? 86.828  24.853  43.013 1.00 24.23 ? 153 THR A OG1   1 
ATOM   1199 C  CG2   . THR A 1 153 ? 85.625  23.563  41.382 1.00 23.35 ? 153 THR A CG2   1 
ATOM   1200 N  N     . PHE A 1 154 ? 88.599  21.748  40.293 1.00 18.70 ? 154 PHE A N     1 
ATOM   1201 C  CA    . PHE A 1 154 ? 88.702  20.716  39.287 1.00 18.55 ? 154 PHE A CA    1 
ATOM   1202 C  C     . PHE A 1 154 ? 89.400  19.479  39.832 1.00 19.34 ? 154 PHE A C     1 
ATOM   1203 O  O     . PHE A 1 154 ? 88.957  18.378  39.542 1.00 18.21 ? 154 PHE A O     1 
ATOM   1204 C  CB    . PHE A 1 154 ? 89.276  21.219  37.963 1.00 20.95 ? 154 PHE A CB    1 
ATOM   1205 C  CG    . PHE A 1 154 ? 88.317  22.078  37.135 1.00 21.66 ? 154 PHE A CG    1 
ATOM   1206 C  CD1   . PHE A 1 154 ? 86.960  22.225  37.471 1.00 26.03 ? 154 PHE A CD1   1 
ATOM   1207 C  CD2   . PHE A 1 154 ? 88.775  22.715  35.989 1.00 26.97 ? 154 PHE A CD2   1 
ATOM   1208 C  CE1   . PHE A 1 154 ? 86.064  22.999  36.672 1.00 21.36 ? 154 PHE A CE1   1 
ATOM   1209 C  CE2   . PHE A 1 154 ? 87.906  23.482  35.191 1.00 27.18 ? 154 PHE A CE2   1 
ATOM   1210 C  CZ    . PHE A 1 154 ? 86.549  23.605  35.558 1.00 26.53 ? 154 PHE A CZ    1 
ATOM   1211 N  N     . GLU A 1 155 ? 90.454  19.648  40.611 1.00 20.36 ? 155 GLU A N     1 
ATOM   1212 C  CA    . GLU A 1 155 ? 91.151  18.542  41.259 1.00 27.02 ? 155 GLU A CA    1 
ATOM   1213 C  C     . GLU A 1 155 ? 90.113  17.744  42.105 1.00 30.69 ? 155 GLU A C     1 
ATOM   1214 O  O     . GLU A 1 155 ? 90.025  16.497  42.000 1.00 31.44 ? 155 GLU A O     1 
ATOM   1215 C  CB    . GLU A 1 155 ? 92.254  19.104  42.153 1.00 26.07 ? 155 GLU A CB    1 
ATOM   1216 C  CG    . GLU A 1 155 ? 92.820  18.039  43.114 1.00 35.24 ? 155 GLU A CG    1 
ATOM   1217 C  CD    . GLU A 1 155 ? 94.213  18.249  43.604 1.00 39.99 ? 155 GLU A CD    1 
ATOM   1218 O  OE1   . GLU A 1 155 ? 94.534  19.392  43.987 1.00 50.47 ? 155 GLU A OE1   1 
ATOM   1219 O  OE2   . GLU A 1 155 ? 94.944  17.237  43.698 1.00 46.83 ? 155 GLU A OE2   1 
ATOM   1220 N  N     . TYR A 1 156 ? 89.318  18.477  42.904 1.00 26.64 ? 156 TYR A N     1 
ATOM   1221 C  CA    . TYR A 1 156 ? 88.252  17.888  43.694 1.00 26.54 ? 156 TYR A CA    1 
ATOM   1222 C  C     . TYR A 1 156 ? 87.185  17.139  42.827 1.00 26.75 ? 156 TYR A C     1 
ATOM   1223 O  O     . TYR A 1 156 ? 86.932  15.945  43.012 1.00 21.86 ? 156 TYR A O     1 
ATOM   1224 C  CB    . TYR A 1 156 ? 87.648  18.882  44.678 1.00 25.26 ? 156 TYR A CB    1 
ATOM   1225 C  CG    . TYR A 1 156 ? 86.347  18.363  45.292 1.00 23.11 ? 156 TYR A CG    1 
ATOM   1226 C  CD1   . TYR A 1 156 ? 86.392  17.515  46.425 1.00 17.86 ? 156 TYR A CD1   1 
ATOM   1227 C  CD2   . TYR A 1 156 ? 85.087  18.709  44.733 1.00 21.94 ? 156 TYR A CD2   1 
ATOM   1228 C  CE1   . TYR A 1 156 ? 85.217  17.021  46.986 1.00 18.87 ? 156 TYR A CE1   1 
ATOM   1229 C  CE2   . TYR A 1 156 ? 83.879  18.234  45.330 1.00 23.61 ? 156 TYR A CE2   1 
ATOM   1230 C  CZ    . TYR A 1 156 ? 83.953  17.402  46.447 1.00 20.09 ? 156 TYR A CZ    1 
ATOM   1231 O  OH    . TYR A 1 156 ? 82.796  17.019  47.092 1.00 25.45 ? 156 TYR A OH    1 
ATOM   1232 N  N     . LEU A 1 157 ? 86.622  17.821  41.839 1.00 20.13 ? 157 LEU A N     1 
ATOM   1233 C  CA    . LEU A 1 157 ? 85.592  17.253  41.020 1.00 23.93 ? 157 LEU A CA    1 
ATOM   1234 C  C     . LEU A 1 157 ? 86.028  16.005  40.197 1.00 27.27 ? 157 LEU A C     1 
ATOM   1235 O  O     . LEU A 1 157 ? 85.242  15.074  39.953 1.00 25.54 ? 157 LEU A O     1 
ATOM   1236 C  CB    . LEU A 1 157 ? 85.078  18.380  40.071 1.00 19.77 ? 157 LEU A CB    1 
ATOM   1237 C  CG    . LEU A 1 157 ? 84.178  19.432  40.713 1.00 22.11 ? 157 LEU A CG    1 
ATOM   1238 C  CD1   . LEU A 1 157 ? 83.781  20.207  39.457 1.00 17.02 ? 157 LEU A CD1   1 
ATOM   1239 C  CD2   . LEU A 1 157 ? 82.881  18.835  41.459 1.00 19.85 ? 157 LEU A CD2   1 
ATOM   1240 N  N     . HIS A 1 158 ? 87.236  16.092  39.639 1.00 21.82 ? 158 HIS A N     1 
ATOM   1241 C  CA    . HIS A 1 158 ? 87.715  15.092  38.726 1.00 21.18 ? 158 HIS A CA    1 
ATOM   1242 C  C     . HIS A 1 158 ? 88.042  13.816  39.485 1.00 18.65 ? 158 HIS A C     1 
ATOM   1243 O  O     . HIS A 1 158 ? 87.811  12.756  38.921 1.00 15.86 ? 158 HIS A O     1 
ATOM   1244 C  CB    . HIS A 1 158 ? 88.915  15.597  37.954 1.00 24.00 ? 158 HIS A CB    1 
ATOM   1245 C  CG    . HIS A 1 158 ? 88.657  16.749  37.033 1.00 27.70 ? 158 HIS A CG    1 
ATOM   1246 N  ND1   . HIS A 1 158 ? 89.692  17.345  36.344 1.00 23.75 ? 158 HIS A ND1   1 
ATOM   1247 C  CD2   . HIS A 1 158 ? 87.514  17.275  36.525 1.00 23.31 ? 158 HIS A CD2   1 
ATOM   1248 C  CE1   . HIS A 1 158 ? 89.198  18.159  35.424 1.00 30.41 ? 158 HIS A CE1   1 
ATOM   1249 N  NE2   . HIS A 1 158 ? 87.880  18.115  35.497 1.00 23.55 ? 158 HIS A NE2   1 
ATOM   1250 N  N     . SER A 1 159 ? 88.448  13.936  40.742 1.00 16.61 ? 159 SER A N     1 
ATOM   1251 C  CA    . SER A 1 159 ? 88.727  12.775  41.546 1.00 21.39 ? 159 SER A CA    1 
ATOM   1252 C  C     . SER A 1 159 ? 87.469  11.972  41.900 1.00 27.71 ? 159 SER A C     1 
ATOM   1253 O  O     . SER A 1 159 ? 87.603  10.800  42.263 1.00 29.33 ? 159 SER A O     1 
ATOM   1254 C  CB    . SER A 1 159 ? 89.466  13.147  42.813 1.00 20.28 ? 159 SER A CB    1 
ATOM   1255 O  OG    . SER A 1 159 ? 88.624  13.812  43.738 1.00 21.58 ? 159 SER A OG    1 
ATOM   1256 N  N     . LEU A 1 160 ? 86.288  12.602  41.782 1.00 25.57 ? 160 LEU A N     1 
ATOM   1257 C  CA    . LEU A 1 160 ? 84.959  12.019  42.013 1.00 19.87 ? 160 LEU A CA    1 
ATOM   1258 C  C     . LEU A 1 160 ? 84.409  11.487  40.700 1.00 19.93 ? 160 LEU A C     1 
ATOM   1259 O  O     . LEU A 1 160 ? 83.214  11.104  40.658 1.00 23.13 ? 160 LEU A O     1 
ATOM   1260 C  CB    . LEU A 1 160 ? 83.952  13.073  42.566 1.00 17.50 ? 160 LEU A CB    1 
ATOM   1261 C  CG    . LEU A 1 160 ? 84.221  13.759  43.910 1.00 18.44 ? 160 LEU A CG    1 
ATOM   1262 C  CD1   . LEU A 1 160 ? 83.090  14.741  44.386 1.00 15.63 ? 160 LEU A CD1   1 
ATOM   1263 C  CD2   . LEU A 1 160 ? 84.668  12.747  44.987 1.00 20.52 ? 160 LEU A CD2   1 
ATOM   1264 N  N     . ASP A 1 161 ? 85.214  11.510  39.622 1.00 14.20 ? 161 ASP A N     1 
ATOM   1265 C  CA    . ASP A 1 161 ? 84.862  11.070  38.257 1.00 16.18 ? 161 ASP A CA    1 
ATOM   1266 C  C     . ASP A 1 161 ? 83.874  11.997  37.547 1.00 18.34 ? 161 ASP A C     1 
ATOM   1267 O  O     . ASP A 1 161 ? 83.273  11.613  36.517 1.00 17.49 ? 161 ASP A O     1 
ATOM   1268 C  CB    . ASP A 1 161 ? 84.308  9.605   38.176 1.00 19.25 ? 161 ASP A CB    1 
ATOM   1269 C  CG    . ASP A 1 161 ? 85.156  8.622   38.971 1.00 23.09 ? 161 ASP A CG    1 
ATOM   1270 O  OD1   . ASP A 1 161 ? 86.336  8.547   38.588 1.00 25.78 ? 161 ASP A OD1   1 
ATOM   1271 O  OD2   . ASP A 1 161 ? 84.711  8.064   39.999 1.00 30.19 ? 161 ASP A OD2   1 
ATOM   1272 N  N     . LEU A 1 162 ? 83.913  13.282  37.947 1.00 18.46 ? 162 LEU A N     1 
ATOM   1273 C  CA    . LEU A 1 162 ? 83.053  14.364  37.352 1.00 21.87 ? 162 LEU A CA    1 
ATOM   1274 C  C     . LEU A 1 162 ? 83.715  15.338  36.384 1.00 21.04 ? 162 LEU A C     1 
ATOM   1275 O  O     . LEU A 1 162 ? 84.883  15.690  36.568 1.00 21.88 ? 162 LEU A O     1 
ATOM   1276 C  CB    . LEU A 1 162 ? 82.356  15.205  38.467 1.00 22.65 ? 162 LEU A CB    1 
ATOM   1277 C  CG    . LEU A 1 162 ? 81.712  14.533  39.691 1.00 23.78 ? 162 LEU A CG    1 
ATOM   1278 C  CD1   . LEU A 1 162 ? 81.540  15.612  40.758 1.00 19.10 ? 162 LEU A CD1   1 
ATOM   1279 C  CD2   . LEU A 1 162 ? 80.384  13.947  39.329 1.00 20.79 ? 162 LEU A CD2   1 
ATOM   1280 N  N     . ILE A 1 163 ? 83.087  15.600  35.252 1.00 18.68 ? 163 ILE A N     1 
ATOM   1281 C  CA    . ILE A 1 163 ? 83.599  16.593  34.303 1.00 22.55 ? 163 ILE A CA    1 
ATOM   1282 C  C     . ILE A 1 163 ? 82.571  17.738  34.604 1.00 24.61 ? 163 ILE A C     1 
ATOM   1283 O  O     . ILE A 1 163 ? 81.360  17.481  34.699 1.00 20.62 ? 163 ILE A O     1 
ATOM   1284 C  CB    . ILE A 1 163 ? 83.452  16.293  32.777 1.00 27.69 ? 163 ILE A CB    1 
ATOM   1285 C  CG1   . ILE A 1 163 ? 83.616  14.853  32.317 1.00 34.29 ? 163 ILE A CG1   1 
ATOM   1286 C  CG2   . ILE A 1 163 ? 84.368  17.210  31.935 1.00 28.04 ? 163 ILE A CG2   1 
ATOM   1287 C  CD1   . ILE A 1 163 ? 83.301  14.701  30.764 1.00 33.83 ? 163 ILE A CD1   1 
ATOM   1288 N  N     . TYR A 1 164 ? 83.026  18.997  34.527 1.00 20.32 ? 164 TYR A N     1 
ATOM   1289 C  CA    . TYR A 1 164 ? 82.209  20.129  34.870 1.00 15.75 ? 164 TYR A CA    1 
ATOM   1290 C  C     . TYR A 1 164 ? 81.578  20.640  33.565 1.00 18.56 ? 164 TYR A C     1 
ATOM   1291 O  O     . TYR A 1 164 ? 80.380  20.923  33.544 1.00 19.99 ? 164 TYR A O     1 
ATOM   1292 C  CB    . TYR A 1 164 ? 83.087  21.097  35.672 1.00 18.60 ? 164 TYR A CB    1 
ATOM   1293 C  CG    . TYR A 1 164 ? 82.375  22.422  35.888 1.00 24.48 ? 164 TYR A CG    1 
ATOM   1294 C  CD1   . TYR A 1 164 ? 81.173  22.475  36.646 1.00 18.46 ? 164 TYR A CD1   1 
ATOM   1295 C  CD2   . TYR A 1 164 ? 82.764  23.582  35.129 1.00 23.08 ? 164 TYR A CD2   1 
ATOM   1296 C  CE1   . TYR A 1 164 ? 80.346  23.609  36.580 1.00 24.10 ? 164 TYR A CE1   1 
ATOM   1297 C  CE2   . TYR A 1 164 ? 81.983  24.743  35.135 1.00 17.33 ? 164 TYR A CE2   1 
ATOM   1298 C  CZ    . TYR A 1 164 ? 80.770  24.743  35.843 1.00 25.51 ? 164 TYR A CZ    1 
ATOM   1299 O  OH    . TYR A 1 164 ? 80.011  25.865  35.868 1.00 21.63 ? 164 TYR A OH    1 
ATOM   1300 N  N     . ARG A 1 165 ? 82.412  20.981  32.565 1.00 16.52 ? 165 ARG A N     1 
ATOM   1301 C  CA    . ARG A 1 165 ? 81.970  21.293  31.228 1.00 19.24 ? 165 ARG A CA    1 
ATOM   1302 C  C     . ARG A 1 165 ? 81.346  22.692  30.901 1.00 16.84 ? 165 ARG A C     1 
ATOM   1303 O  O     . ARG A 1 165 ? 80.767  22.814  29.819 1.00 15.52 ? 165 ARG A O     1 
ATOM   1304 C  CB    . ARG A 1 165 ? 81.070  20.149  30.644 1.00 17.17 ? 165 ARG A CB    1 
ATOM   1305 C  CG    . ARG A 1 165 ? 81.632  18.764  30.676 1.00 26.83 ? 165 ARG A CG    1 
ATOM   1306 C  CD    . ARG A 1 165 ? 80.977  17.866  29.613 1.00 23.05 ? 165 ARG A CD    1 
ATOM   1307 N  NE    . ARG A 1 165 ? 79.745  17.291  30.133 1.00 17.59 ? 165 ARG A NE    1 
ATOM   1308 C  CZ    . ARG A 1 165 ? 78.948  16.423  29.511 1.00 19.52 ? 165 ARG A CZ    1 
ATOM   1309 N  NH1   . ARG A 1 165 ? 79.256  15.923  28.311 1.00 13.85 ? 165 ARG A NH1   1 
ATOM   1310 N  NH2   . ARG A 1 165 ? 77.691  16.341  29.970 1.00 16.90 ? 165 ARG A NH2   1 
ATOM   1311 N  N     . ASP A 1 166 ? 81.154  23.578  31.864 1.00 13.66 ? 166 ASP A N     1 
ATOM   1312 C  CA    . ASP A 1 166 ? 80.708  24.901  31.386 1.00 18.90 ? 166 ASP A CA    1 
ATOM   1313 C  C     . ASP A 1 166 ? 81.468  26.050  32.064 1.00 21.52 ? 166 ASP A C     1 
ATOM   1314 O  O     . ASP A 1 166 ? 80.773  26.826  32.754 1.00 16.01 ? 166 ASP A O     1 
ATOM   1315 C  CB    . ASP A 1 166 ? 79.172  25.124  31.563 1.00 19.20 ? 166 ASP A CB    1 
ATOM   1316 C  CG    . ASP A 1 166 ? 78.611  26.188  30.624 1.00 26.70 ? 166 ASP A CG    1 
ATOM   1317 O  OD1   . ASP A 1 166 ? 79.235  26.510  29.577 1.00 21.45 ? 166 ASP A OD1   1 
ATOM   1318 O  OD2   . ASP A 1 166 ? 77.415  26.520  30.806 1.00 23.87 ? 166 ASP A OD2   1 
ATOM   1319 N  N     . LEU A 1 167 ? 82.805  25.908  32.236 1.00 20.76 ? 167 LEU A N     1 
ATOM   1320 C  CA    . LEU A 1 167 ? 83.649  26.987  32.832 1.00 21.43 ? 167 LEU A CA    1 
ATOM   1321 C  C     . LEU A 1 167 ? 83.633  28.256  31.951 1.00 16.29 ? 167 LEU A C     1 
ATOM   1322 O  O     . LEU A 1 167 ? 83.667  28.164  30.732 1.00 10.79 ? 167 LEU A O     1 
ATOM   1323 C  CB    . LEU A 1 167 ? 85.113  26.592  33.059 1.00 21.23 ? 167 LEU A CB    1 
ATOM   1324 C  CG    . LEU A 1 167 ? 85.984  27.522  33.888 1.00 21.16 ? 167 LEU A CG    1 
ATOM   1325 C  CD1   . LEU A 1 167 ? 85.558  27.554  35.375 1.00 22.24 ? 167 LEU A CD1   1 
ATOM   1326 C  CD2   . LEU A 1 167 ? 87.384  26.975  33.871 1.00 18.35 ? 167 LEU A CD2   1 
ATOM   1327 N  N     . LYS A 1 168 ? 83.195  29.337  32.605 1.00 19.49 ? 168 LYS A N     1 
ATOM   1328 C  CA    . LYS A 1 168 ? 83.044  30.679  31.999 1.00 16.64 ? 168 LYS A CA    1 
ATOM   1329 C  C     . LYS A 1 168 ? 82.760  31.681  33.129 1.00 19.59 ? 168 LYS A C     1 
ATOM   1330 O  O     . LYS A 1 168 ? 82.253  31.311  34.223 1.00 17.98 ? 168 LYS A O     1 
ATOM   1331 C  CB    . LYS A 1 168 ? 81.945  30.705  30.935 1.00 14.82 ? 168 LYS A CB    1 
ATOM   1332 C  CG    . LYS A 1 168 ? 80.519  30.407  31.443 1.00 17.76 ? 168 LYS A CG    1 
ATOM   1333 C  CD    . LYS A 1 168 ? 79.529  30.447  30.282 1.00 12.78 ? 168 LYS A CD    1 
ATOM   1334 C  CE    . LYS A 1 168 ? 78.169  30.066  30.782 1.00 11.53 ? 168 LYS A CE    1 
ATOM   1335 N  NZ    . LYS A 1 168 ? 77.392  30.043  29.518 1.00 8.57  ? 168 LYS A NZ    1 
ATOM   1336 N  N     . PRO A 1 169 ? 83.238  32.967  32.980 1.00 23.28 ? 169 PRO A N     1 
ATOM   1337 C  CA    . PRO A 1 169 ? 83.028  34.010  34.019 1.00 17.75 ? 169 PRO A CA    1 
ATOM   1338 C  C     . PRO A 1 169 ? 81.533  34.192  34.476 1.00 17.73 ? 169 PRO A C     1 
ATOM   1339 O  O     . PRO A 1 169 ? 81.305  34.435  35.687 1.00 17.07 ? 169 PRO A O     1 
ATOM   1340 C  CB    . PRO A 1 169 ? 83.562  35.273  33.346 1.00 22.77 ? 169 PRO A CB    1 
ATOM   1341 C  CG    . PRO A 1 169 ? 84.502  34.799  32.362 1.00 21.44 ? 169 PRO A CG    1 
ATOM   1342 C  CD    . PRO A 1 169 ? 83.896  33.541  31.789 1.00 19.23 ? 169 PRO A CD    1 
ATOM   1343 N  N     . GLU A 1 170 ? 80.587  33.959  33.529 1.00 13.91 ? 170 GLU A N     1 
ATOM   1344 C  CA    . GLU A 1 170 ? 79.139  33.976  33.766 1.00 18.13 ? 170 GLU A CA    1 
ATOM   1345 C  C     . GLU A 1 170 ? 78.601  32.923  34.752 1.00 18.87 ? 170 GLU A C     1 
ATOM   1346 O  O     . GLU A 1 170 ? 77.500  33.121  35.329 1.00 23.52 ? 170 GLU A O     1 
ATOM   1347 C  CB    . GLU A 1 170 ? 78.376  33.821  32.474 1.00 10.81 ? 170 GLU A CB    1 
ATOM   1348 C  CG    . GLU A 1 170 ? 78.758  34.989  31.576 1.00 17.79 ? 170 GLU A CG    1 
ATOM   1349 C  CD    . GLU A 1 170 ? 79.708  34.692  30.458 1.00 12.14 ? 170 GLU A CD    1 
ATOM   1350 O  OE1   . GLU A 1 170 ? 80.787  34.169  30.763 1.00 15.77 ? 170 GLU A OE1   1 
ATOM   1351 O  OE2   . GLU A 1 170 ? 79.490  35.121  29.319 1.00 15.57 ? 170 GLU A OE2   1 
ATOM   1352 N  N     . ASN A 1 171 ? 79.367  31.834  34.974 1.00 16.77 ? 171 ASN A N     1 
ATOM   1353 C  CA    . ASN A 1 171 ? 79.052  30.726  35.896 1.00 15.99 ? 171 ASN A CA    1 
ATOM   1354 C  C     . ASN A 1 171 ? 79.898  30.805  37.143 1.00 21.47 ? 171 ASN A C     1 
ATOM   1355 O  O     . ASN A 1 171 ? 79.815  29.893  37.978 1.00 24.24 ? 171 ASN A O     1 
ATOM   1356 C  CB    . ASN A 1 171 ? 79.204  29.325  35.254 1.00 12.56 ? 171 ASN A CB    1 
ATOM   1357 C  CG    . ASN A 1 171 ? 78.136  29.010  34.207 1.00 19.55 ? 171 ASN A CG    1 
ATOM   1358 O  OD1   . ASN A 1 171 ? 77.012  29.582  34.172 1.00 11.51 ? 171 ASN A OD1   1 
ATOM   1359 N  ND2   . ASN A 1 171 ? 78.413  27.947  33.424 1.00 15.91 ? 171 ASN A ND2   1 
ATOM   1360 N  N     . LEU A 1 172 ? 80.688  31.874  37.319 1.00 21.36 ? 172 LEU A N     1 
ATOM   1361 C  CA    . LEU A 1 172 ? 81.504  32.006  38.545 1.00 26.07 ? 172 LEU A CA    1 
ATOM   1362 C  C     . LEU A 1 172 ? 81.004  33.236  39.250 1.00 22.81 ? 172 LEU A C     1 
ATOM   1363 O  O     . LEU A 1 172 ? 80.818  34.242  38.602 1.00 23.66 ? 172 LEU A O     1 
ATOM   1364 C  CB    . LEU A 1 172 ? 83.033  32.093  38.256 1.00 24.08 ? 172 LEU A CB    1 
ATOM   1365 C  CG    . LEU A 1 172 ? 83.587  30.988  37.328 1.00 30.84 ? 172 LEU A CG    1 
ATOM   1366 C  CD1   . LEU A 1 172 ? 84.931  31.476  36.826 1.00 24.83 ? 172 LEU A CD1   1 
ATOM   1367 C  CD2   . LEU A 1 172 ? 83.663  29.644  38.076 1.00 23.14 ? 172 LEU A CD2   1 
ATOM   1368 N  N     . LEU A 1 173 ? 80.709  33.121  40.532 1.00 24.21 ? 173 LEU A N     1 
ATOM   1369 C  CA    . LEU A 1 173 ? 80.121  34.236  41.271 1.00 23.67 ? 173 LEU A CA    1 
ATOM   1370 C  C     . LEU A 1 173 ? 81.052  34.659  42.366 1.00 22.35 ? 173 LEU A C     1 
ATOM   1371 O  O     . LEU A 1 173 ? 81.870  33.879  42.797 1.00 26.58 ? 173 LEU A O     1 
ATOM   1372 C  CB    . LEU A 1 173 ? 78.737  33.880  41.876 1.00 19.04 ? 173 LEU A CB    1 
ATOM   1373 C  CG    . LEU A 1 173 ? 77.662  33.327  40.952 1.00 18.71 ? 173 LEU A CG    1 
ATOM   1374 C  CD1   . LEU A 1 173 ? 76.731  32.551  41.842 1.00 19.31 ? 173 LEU A CD1   1 
ATOM   1375 C  CD2   . LEU A 1 173 ? 76.910  34.440  40.260 1.00 25.04 ? 173 LEU A CD2   1 
ATOM   1376 N  N     . ILE A 1 174 ? 80.912  35.877  42.863 1.00 25.47 ? 174 ILE A N     1 
ATOM   1377 C  CA    . ILE A 1 174 ? 81.856  36.360  43.874 1.00 28.17 ? 174 ILE A CA    1 
ATOM   1378 C  C     . ILE A 1 174 ? 81.137  36.457  45.192 1.00 29.42 ? 174 ILE A C     1 
ATOM   1379 O  O     . ILE A 1 174 ? 80.070  37.062  45.298 1.00 28.58 ? 174 ILE A O     1 
ATOM   1380 C  CB    . ILE A 1 174 ? 82.372  37.775  43.577 1.00 26.97 ? 174 ILE A CB    1 
ATOM   1381 C  CG1   . ILE A 1 174 ? 82.716  37.948  42.104 1.00 25.06 ? 174 ILE A CG1   1 
ATOM   1382 C  CG2   . ILE A 1 174 ? 83.509  38.084  44.570 1.00 30.15 ? 174 ILE A CG2   1 
ATOM   1383 C  CD1   . ILE A 1 174 ? 84.047  37.284  41.753 1.00 28.21 ? 174 ILE A CD1   1 
ATOM   1384 N  N     . ASP A 1 175 ? 81.684  35.766  46.164 1.00 27.89 ? 175 ASP A N     1 
ATOM   1385 C  CA    . ASP A 1 175 ? 81.074  35.862  47.464 1.00 34.65 ? 175 ASP A CA    1 
ATOM   1386 C  C     . ASP A 1 175 ? 81.536  37.146  48.231 1.00 38.99 ? 175 ASP A C     1 
ATOM   1387 O  O     . ASP A 1 175 ? 82.439  37.934  47.790 1.00 37.56 ? 175 ASP A O     1 
ATOM   1388 C  CB    . ASP A 1 175 ? 81.193  34.507  48.187 1.00 26.25 ? 175 ASP A CB    1 
ATOM   1389 C  CG    . ASP A 1 175 ? 82.561  34.211  48.718 1.00 33.41 ? 175 ASP A CG    1 
ATOM   1390 O  OD1   . ASP A 1 175 ? 83.507  35.010  48.853 1.00 30.75 ? 175 ASP A OD1   1 
ATOM   1391 O  OD2   . ASP A 1 175 ? 82.654  33.121  49.269 1.00 39.71 ? 175 ASP A OD2   1 
ATOM   1392 N  N     . GLN A 1 176 ? 80.965  37.226  49.431 1.00 38.80 ? 176 GLN A N     1 
ATOM   1393 C  CA    . GLN A 1 176 ? 81.233  38.239  50.428 1.00 40.86 ? 176 GLN A CA    1 
ATOM   1394 C  C     . GLN A 1 176 ? 82.737  38.508  50.693 1.00 40.34 ? 176 GLN A C     1 
ATOM   1395 O  O     . GLN A 1 176 ? 83.185  39.646  50.516 1.00 44.01 ? 176 GLN A O     1 
ATOM   1396 C  CB    . GLN A 1 176 ? 80.467  37.812  51.681 1.00 42.49 ? 176 GLN A CB    1 
ATOM   1397 C  CG    . GLN A 1 176 ? 79.023  38.184  51.567 1.00 48.46 ? 176 GLN A CG    1 
ATOM   1398 C  CD    . GLN A 1 176 ? 78.324  38.218  52.900 1.00 59.07 ? 176 GLN A CD    1 
ATOM   1399 O  OE1   . GLN A 1 176 ? 78.910  38.583  53.925 1.00 64.00 ? 176 GLN A OE1   1 
ATOM   1400 N  NE2   . GLN A 1 176 ? 77.048  37.820  52.906 1.00 66.27 ? 176 GLN A NE2   1 
ATOM   1401 N  N     . GLN A 1 177 ? 83.514  37.449  50.914 1.00 34.88 ? 177 GLN A N     1 
ATOM   1402 C  CA    . GLN A 1 177 ? 84.959  37.448  51.144 1.00 35.25 ? 177 GLN A CA    1 
ATOM   1403 C  C     . GLN A 1 177 ? 85.755  37.701  49.858 1.00 29.99 ? 177 GLN A C     1 
ATOM   1404 O  O     . GLN A 1 177 ? 86.990  37.660  49.916 1.00 35.81 ? 177 GLN A O     1 
ATOM   1405 C  CB    . GLN A 1 177 ? 85.477  36.078  51.694 1.00 43.25 ? 177 GLN A CB    1 
ATOM   1406 C  CG    . GLN A 1 177 ? 85.027  35.513  53.089 1.00 55.13 ? 177 GLN A CG    1 
ATOM   1407 C  CD    . GLN A 1 177 ? 85.882  34.302  53.635 1.00 59.42 ? 177 GLN A CD    1 
ATOM   1408 O  OE1   . GLN A 1 177 ? 85.329  33.238  53.963 1.00 60.16 ? 177 GLN A OE1   1 
ATOM   1409 N  NE2   . GLN A 1 177 ? 87.214  34.486  53.779 1.00 59.33 ? 177 GLN A NE2   1 
ATOM   1410 N  N     . GLY A 1 178 ? 85.114  37.760  48.697 1.00 26.35 ? 178 GLY A N     1 
ATOM   1411 C  CA    . GLY A 1 178 ? 85.824  37.897  47.412 1.00 30.63 ? 178 GLY A CA    1 
ATOM   1412 C  C     . GLY A 1 178 ? 86.322  36.604  46.732 1.00 30.22 ? 178 GLY A C     1 
ATOM   1413 O  O     . GLY A 1 178 ? 87.161  36.623  45.805 1.00 24.97 ? 178 GLY A O     1 
ATOM   1414 N  N     . TYR A 1 179 ? 85.961  35.470  47.371 1.00 29.34 ? 179 TYR A N     1 
ATOM   1415 C  CA    . TYR A 1 179 ? 86.185  34.080  46.930 1.00 25.73 ? 179 TYR A CA    1 
ATOM   1416 C  C     . TYR A 1 179 ? 85.055  33.561  45.990 1.00 22.93 ? 179 TYR A C     1 
ATOM   1417 O  O     . TYR A 1 179 ? 83.981  34.106  45.978 1.00 24.10 ? 179 TYR A O     1 
ATOM   1418 C  CB    . TYR A 1 179 ? 86.332  33.262  48.190 1.00 23.22 ? 179 TYR A CB    1 
ATOM   1419 C  CG    . TYR A 1 179 ? 87.711  33.306  48.774 1.00 26.59 ? 179 TYR A CG    1 
ATOM   1420 C  CD1   . TYR A 1 179 ? 88.664  32.349  48.355 1.00 19.68 ? 179 TYR A CD1   1 
ATOM   1421 C  CD2   . TYR A 1 179 ? 88.092  34.283  49.733 1.00 23.12 ? 179 TYR A CD2   1 
ATOM   1422 C  CE1   . TYR A 1 179 ? 89.987  32.348  48.890 1.00 23.38 ? 179 TYR A CE1   1 
ATOM   1423 C  CE2   . TYR A 1 179 ? 89.472  34.324  50.272 1.00 23.63 ? 179 TYR A CE2   1 
ATOM   1424 C  CZ    . TYR A 1 179 ? 90.379  33.333  49.839 1.00 25.82 ? 179 TYR A CZ    1 
ATOM   1425 O  OH    . TYR A 1 179 ? 91.667  33.193  50.316 1.00 31.61 ? 179 TYR A OH    1 
ATOM   1426 N  N     . ILE A 1 180 ? 85.411  32.798  44.973 1.00 21.37 ? 180 ILE A N     1 
ATOM   1427 C  CA    . ILE A 1 180 ? 84.538  32.257  43.923 1.00 23.66 ? 180 ILE A CA    1 
ATOM   1428 C  C     . ILE A 1 180 ? 83.615  31.142  44.368 1.00 22.78 ? 180 ILE A C     1 
ATOM   1429 O  O     . ILE A 1 180 ? 83.915  30.459  45.339 1.00 27.80 ? 180 ILE A O     1 
ATOM   1430 C  CB    . ILE A 1 180 ? 85.409  31.705  42.781 1.00 24.53 ? 180 ILE A CB    1 
ATOM   1431 C  CG1   . ILE A 1 180 ? 85.934  32.909  42.014 1.00 30.54 ? 180 ILE A CG1   1 
ATOM   1432 C  CG2   . ILE A 1 180 ? 84.669  30.794  41.746 1.00 27.30 ? 180 ILE A CG2   1 
ATOM   1433 C  CD1   . ILE A 1 180 ? 87.025  32.456  41.171 1.00 30.26 ? 180 ILE A CD1   1 
ATOM   1434 N  N     . GLN A 1 181 ? 82.426  31.101  43.782 1.00 21.30 ? 181 GLN A N     1 
ATOM   1435 C  CA    . GLN A 1 181 ? 81.495  30.026  44.017 1.00 21.96 ? 181 GLN A CA    1 
ATOM   1436 C  C     . GLN A 1 181 ? 81.042  29.660  42.624 1.00 22.80 ? 181 GLN A C     1 
ATOM   1437 O  O     . GLN A 1 181 ? 80.454  30.474  41.898 1.00 24.15 ? 181 GLN A O     1 
ATOM   1438 C  CB    . GLN A 1 181 ? 80.304  30.513  44.779 1.00 26.77 ? 181 GLN A CB    1 
ATOM   1439 C  CG    . GLN A 1 181 ? 80.670  31.012  46.101 1.00 32.57 ? 181 GLN A CG    1 
ATOM   1440 C  CD    . GLN A 1 181 ? 80.574  29.909  47.088 1.00 34.75 ? 181 GLN A CD    1 
ATOM   1441 O  OE1   . GLN A 1 181 ? 79.479  29.501  47.382 1.00 35.44 ? 181 GLN A OE1   1 
ATOM   1442 N  NE2   . GLN A 1 181 ? 81.694  29.426  47.598 1.00 38.97 ? 181 GLN A NE2   1 
ATOM   1443 N  N     . VAL A 1 182 ? 81.376  28.422  42.232 1.00 21.25 ? 182 VAL A N     1 
ATOM   1444 C  CA    . VAL A 1 182 ? 80.993  27.854  40.926 1.00 19.30 ? 182 VAL A CA    1 
ATOM   1445 C  C     . VAL A 1 182 ? 79.514  27.479  40.947 1.00 17.15 ? 182 VAL A C     1 
ATOM   1446 O  O     . VAL A 1 182 ? 79.051  26.794  41.846 1.00 23.54 ? 182 VAL A O     1 
ATOM   1447 C  CB    . VAL A 1 182 ? 81.825  26.542  40.573 1.00 17.70 ? 182 VAL A CB    1 
ATOM   1448 C  CG1   . VAL A 1 182 ? 81.380  25.963  39.221 1.00 11.68 ? 182 VAL A CG1   1 
ATOM   1449 C  CG2   . VAL A 1 182 ? 83.284  26.834  40.583 1.00 17.39 ? 182 VAL A CG2   1 
ATOM   1450 N  N     . THR A 1 183 ? 78.755  28.010  40.023 1.00 14.33 ? 183 THR A N     1 
ATOM   1451 C  CA    . THR A 1 183 ? 77.361  27.626  39.911 1.00 15.92 ? 183 THR A CA    1 
ATOM   1452 C  C     . THR A 1 183 ? 77.158  26.873  38.561 1.00 14.56 ? 183 THR A C     1 
ATOM   1453 O  O     . THR A 1 183 ? 78.138  26.623  37.849 1.00 18.26 ? 183 THR A O     1 
ATOM   1454 C  CB    . THR A 1 183 ? 76.439  28.847  40.146 1.00 23.10 ? 183 THR A CB    1 
ATOM   1455 O  OG1   . THR A 1 183 ? 75.097  28.367  40.322 1.00 22.28 ? 183 THR A OG1   1 
ATOM   1456 C  CG2   . THR A 1 183 ? 76.444  29.857  38.903 1.00 17.58 ? 183 THR A CG2   1 
ATOM   1457 N  N     . ASP A 1 184 ? 75.913  26.669  38.111 1.00 13.02 ? 184 ASP A N     1 
ATOM   1458 C  CA    . ASP A 1 184 ? 75.549  25.982  36.878 1.00 16.15 ? 184 ASP A CA    1 
ATOM   1459 C  C     . ASP A 1 184 ? 76.258  24.635  36.636 1.00 19.92 ? 184 ASP A C     1 
ATOM   1460 O  O     . ASP A 1 184 ? 76.933  24.454  35.566 1.00 13.25 ? 184 ASP A O     1 
ATOM   1461 C  CB    . ASP A 1 184 ? 75.727  26.856  35.630 1.00 13.21 ? 184 ASP A CB    1 
ATOM   1462 C  CG    . ASP A 1 184 ? 74.991  26.390  34.411 1.00 13.67 ? 184 ASP A CG    1 
ATOM   1463 O  OD1   . ASP A 1 184 ? 74.132  25.547  34.398 1.00 20.14 ? 184 ASP A OD1   1 
ATOM   1464 O  OD2   . ASP A 1 184 ? 75.281  26.869  33.317 1.00 16.88 ? 184 ASP A OD2   1 
ATOM   1465 N  N     . PHE A 1 185 ? 75.671  23.650  37.348 1.00 19.71 ? 185 PHE A N     1 
ATOM   1466 C  CA    . PHE A 1 185 ? 76.060  22.240  37.109 1.00 22.74 ? 185 PHE A CA    1 
ATOM   1467 C  C     . PHE A 1 185 ? 75.313  21.550  35.974 1.00 22.51 ? 185 PHE A C     1 
ATOM   1468 O  O     . PHE A 1 185 ? 75.457  20.337  35.893 1.00 27.52 ? 185 PHE A O     1 
ATOM   1469 C  CB    . PHE A 1 185 ? 76.061  21.401  38.398 1.00 18.63 ? 185 PHE A CB    1 
ATOM   1470 C  CG    . PHE A 1 185 ? 77.266  21.567  39.189 1.00 22.18 ? 185 PHE A CG    1 
ATOM   1471 C  CD1   . PHE A 1 185 ? 77.686  22.864  39.637 1.00 26.30 ? 185 PHE A CD1   1 
ATOM   1472 C  CD2   . PHE A 1 185 ? 78.036  20.435  39.504 1.00 27.24 ? 185 PHE A CD2   1 
ATOM   1473 C  CE1   . PHE A 1 185 ? 78.830  23.033  40.365 1.00 25.32 ? 185 PHE A CE1   1 
ATOM   1474 C  CE2   . PHE A 1 185 ? 79.264  20.571  40.244 1.00 31.01 ? 185 PHE A CE2   1 
ATOM   1475 C  CZ    . PHE A 1 185 ? 79.663  21.888  40.675 1.00 29.80 ? 185 PHE A CZ    1 
ATOM   1476 N  N     . GLY A 1 186 ? 74.630  22.279  35.076 1.00 15.36 ? 186 GLY A N     1 
ATOM   1477 C  CA    . GLY A 1 186 ? 73.799  21.758  34.007 1.00 12.53 ? 186 GLY A CA    1 
ATOM   1478 C  C     . GLY A 1 186 ? 74.368  20.770  32.986 1.00 23.33 ? 186 GLY A C     1 
ATOM   1479 O  O     . GLY A 1 186 ? 73.601  19.953  32.478 1.00 20.23 ? 186 GLY A O     1 
ATOM   1480 N  N     . PHE A 1 187 ? 75.685  20.822  32.717 1.00 22.36 ? 187 PHE A N     1 
ATOM   1481 C  CA    . PHE A 1 187 ? 76.467  19.914  31.874 1.00 18.62 ? 187 PHE A CA    1 
ATOM   1482 C  C     . PHE A 1 187 ? 77.418  18.967  32.675 1.00 16.61 ? 187 PHE A C     1 
ATOM   1483 O  O     . PHE A 1 187 ? 78.086  18.128  32.090 1.00 22.00 ? 187 PHE A O     1 
ATOM   1484 C  CB    . PHE A 1 187 ? 77.322  20.684  30.855 1.00 13.75 ? 187 PHE A CB    1 
ATOM   1485 C  CG    . PHE A 1 187 ? 76.542  21.526  29.933 1.00 15.22 ? 187 PHE A CG    1 
ATOM   1486 C  CD1   . PHE A 1 187 ? 75.189  21.213  29.646 1.00 21.07 ? 187 PHE A CD1   1 
ATOM   1487 C  CD2   . PHE A 1 187 ? 77.146  22.632  29.312 1.00 19.18 ? 187 PHE A CD2   1 
ATOM   1488 C  CE1   . PHE A 1 187 ? 74.438  22.004  28.724 1.00 26.42 ? 187 PHE A CE1   1 
ATOM   1489 C  CE2   . PHE A 1 187 ? 76.407  23.420  28.388 1.00 19.83 ? 187 PHE A CE2   1 
ATOM   1490 C  CZ    . PHE A 1 187 ? 75.052  23.088  28.112 1.00 18.83 ? 187 PHE A CZ    1 
ATOM   1491 N  N     . ALA A 1 188 ? 77.444  19.046  33.989 1.00 17.64 ? 188 ALA A N     1 
ATOM   1492 C  CA    . ALA A 1 188 ? 78.277  18.221  34.852 1.00 19.69 ? 188 ALA A CA    1 
ATOM   1493 C  C     . ALA A 1 188 ? 77.874  16.726  34.757 1.00 23.09 ? 188 ALA A C     1 
ATOM   1494 O  O     . ALA A 1 188 ? 76.695  16.427  34.644 1.00 23.16 ? 188 ALA A O     1 
ATOM   1495 C  CB    . ALA A 1 188 ? 78.117  18.732  36.256 1.00 9.09  ? 188 ALA A CB    1 
ATOM   1496 N  N     . LYS A 1 189 ? 78.810  15.786  34.759 1.00 21.12 ? 189 LYS A N     1 
ATOM   1497 C  CA    . LYS A 1 189 ? 78.456  14.374  34.518 1.00 20.83 ? 189 LYS A CA    1 
ATOM   1498 C  C     . LYS A 1 189 ? 79.493  13.506  35.201 1.00 20.42 ? 189 LYS A C     1 
ATOM   1499 O  O     . LYS A 1 189 ? 80.647  13.880  35.247 1.00 17.02 ? 189 LYS A O     1 
ATOM   1500 C  CB    . LYS A 1 189 ? 78.512  14.115  33.007 1.00 21.72 ? 189 LYS A CB    1 
ATOM   1501 C  CG    . LYS A 1 189 ? 77.845  12.830  32.469 1.00 20.29 ? 189 LYS A CG    1 
ATOM   1502 C  CD    . LYS A 1 189 ? 78.297  12.403  31.105 1.00 19.46 ? 189 LYS A CD    1 
ATOM   1503 C  CE    . LYS A 1 189 ? 77.628  11.087  30.713 1.00 20.42 ? 189 LYS A CE    1 
ATOM   1504 N  NZ    . LYS A 1 189 ? 77.247  10.938  29.278 1.00 18.35 ? 189 LYS A NZ    1 
ATOM   1505 N  N     . ARG A 1 190 ? 79.043  12.441  35.873 1.00 22.10 ? 190 ARG A N     1 
ATOM   1506 C  CA    . ARG A 1 190 ? 79.904  11.421  36.498 1.00 18.38 ? 190 ARG A CA    1 
ATOM   1507 C  C     . ARG A 1 190 ? 80.156  10.393  35.383 1.00 21.95 ? 190 ARG A C     1 
ATOM   1508 O  O     . ARG A 1 190 ? 79.232  9.825   34.792 1.00 23.79 ? 190 ARG A O     1 
ATOM   1509 C  CB    . ARG A 1 190 ? 79.187  10.801  37.678 1.00 20.16 ? 190 ARG A CB    1 
ATOM   1510 C  CG    . ARG A 1 190 ? 80.269  10.170  38.505 1.00 21.59 ? 190 ARG A CG    1 
ATOM   1511 C  CD    . ARG A 1 190 ? 79.753  9.887   39.880 1.00 22.80 ? 190 ARG A CD    1 
ATOM   1512 N  NE    . ARG A 1 190 ? 80.890  9.271   40.540 1.00 25.08 ? 190 ARG A NE    1 
ATOM   1513 C  CZ    . ARG A 1 190 ? 80.950  7.968   40.821 1.00 30.06 ? 190 ARG A CZ    1 
ATOM   1514 N  NH1   . ARG A 1 190 ? 79.836  7.260   40.870 1.00 29.25 ? 190 ARG A NH1   1 
ATOM   1515 N  NH2   . ARG A 1 190 ? 82.043  7.439   41.327 1.00 25.03 ? 190 ARG A NH2   1 
ATOM   1516 N  N     . VAL A 1 191 ? 81.378  10.320  34.897 1.00 21.31 ? 191 VAL A N     1 
ATOM   1517 C  CA    . VAL A 1 191 ? 81.670  9.401   33.774 1.00 21.30 ? 191 VAL A CA    1 
ATOM   1518 C  C     . VAL A 1 191 ? 83.132  8.889   33.903 1.00 27.60 ? 191 VAL A C     1 
ATOM   1519 O  O     . VAL A 1 191 ? 84.049  9.642   34.388 1.00 19.65 ? 191 VAL A O     1 
ATOM   1520 C  CB    . VAL A 1 191 ? 81.341  10.029  32.430 1.00 20.05 ? 191 VAL A CB    1 
ATOM   1521 C  CG1   . VAL A 1 191 ? 82.180  11.241  32.145 1.00 23.53 ? 191 VAL A CG1   1 
ATOM   1522 C  CG2   . VAL A 1 191 ? 81.642  9.086   31.292 1.00 22.85 ? 191 VAL A CG2   1 
ATOM   1523 N  N     . LYS A 1 192 ? 83.265  7.548   33.904 1.00 29.66 ? 192 LYS A N     1 
ATOM   1524 C  CA    . LYS A 1 192 ? 84.636  7.063   33.898 1.00 30.89 ? 192 LYS A CA    1 
ATOM   1525 C  C     . LYS A 1 192 ? 85.385  6.955   32.574 1.00 31.19 ? 192 LYS A C     1 
ATOM   1526 O  O     . LYS A 1 192 ? 86.538  7.355   32.517 1.00 39.62 ? 192 LYS A O     1 
ATOM   1527 C  CB    . LYS A 1 192 ? 85.200  6.364   35.113 1.00 27.86 ? 192 LYS A CB    1 
ATOM   1528 C  CG    . LYS A 1 192 ? 84.328  5.344   35.660 1.00 37.02 ? 192 LYS A CG    1 
ATOM   1529 C  CD    . LYS A 1 192 ? 84.108  5.707   37.113 1.00 41.34 ? 192 LYS A CD    1 
ATOM   1530 C  CE    . LYS A 1 192 ? 85.110  5.055   38.040 1.00 48.89 ? 192 LYS A CE    1 
ATOM   1531 N  NZ    . LYS A 1 192 ? 84.491  4.970   39.411 1.00 56.27 ? 192 LYS A NZ    1 
ATOM   1532 N  N     . GLY A 1 193 ? 84.670  6.728   31.494 1.00 24.93 ? 193 GLY A N     1 
ATOM   1533 C  CA    . GLY A 1 193 ? 85.329  6.664   30.210 1.00 26.89 ? 193 GLY A CA    1 
ATOM   1534 C  C     . GLY A 1 193 ? 85.323  7.963   29.457 1.00 26.95 ? 193 GLY A C     1 
ATOM   1535 O  O     . GLY A 1 193 ? 85.715  8.953   30.035 1.00 32.52 ? 193 GLY A O     1 
ATOM   1536 N  N     . ARG A 1 194 ? 85.013  7.884   28.178 1.00 25.11 ? 194 ARG A N     1 
ATOM   1537 C  CA    . ARG A 1 194 ? 84.832  8.977   27.228 1.00 31.09 ? 194 ARG A CA    1 
ATOM   1538 C  C     . ARG A 1 194 ? 83.331  9.374   27.198 1.00 29.03 ? 194 ARG A C     1 
ATOM   1539 O  O     . ARG A 1 194 ? 82.460  8.545   27.464 1.00 34.38 ? 194 ARG A O     1 
ATOM   1540 C  CB    . ARG A 1 194 ? 85.101  8.527   25.787 1.00 30.97 ? 194 ARG A CB    1 
ATOM   1541 C  CG    . ARG A 1 194 ? 86.246  7.609   25.627 1.00 42.08 ? 194 ARG A CG    1 
ATOM   1542 C  CD    . ARG A 1 194 ? 86.997  7.858   24.349 1.00 46.41 ? 194 ARG A CD    1 
ATOM   1543 N  NE    . ARG A 1 194 ? 86.617  6.901   23.331 1.00 45.18 ? 194 ARG A NE    1 
ATOM   1544 C  CZ    . ARG A 1 194 ? 86.992  5.635   23.279 1.00 43.84 ? 194 ARG A CZ    1 
ATOM   1545 N  NH1   . ARG A 1 194 ? 87.762  5.037   24.177 1.00 42.94 ? 194 ARG A NH1   1 
ATOM   1546 N  NH2   . ARG A 1 194 ? 86.693  5.011   22.175 1.00 43.47 ? 194 ARG A NH2   1 
ATOM   1547 N  N     . THR A 1 195 ? 83.044  10.569  26.684 1.00 25.42 ? 195 THR A N     1 
ATOM   1548 C  CA    . THR A 1 195 ? 81.725  11.134  26.568 1.00 19.24 ? 195 THR A CA    1 
ATOM   1549 C  C     . THR A 1 195 ? 81.647  11.926  25.281 1.00 22.52 ? 195 THR A C     1 
ATOM   1550 O  O     . THR A 1 195 ? 82.664  12.222  24.711 1.00 20.89 ? 195 THR A O     1 
ATOM   1551 C  CB    . THR A 1 195 ? 81.208  11.749  27.874 1.00 25.11 ? 195 THR A CB    1 
ATOM   1552 O  OG1   . THR A 1 195 ? 79.777  11.718  27.829 1.00 27.21 ? 195 THR A OG1   1 
ATOM   1553 C  CG2   . THR A 1 195 ? 81.672  13.147  27.970 1.00 18.87 ? 195 THR A CG2   1 
ATOM   1554 N  N     . TRP A 1 196 ? 80.452  12.041  24.705 1.00 17.51 ? 196 TRP A N     1 
ATOM   1555 C  CA    . TRP A 1 196 ? 80.356  12.560  23.371 1.00 22.58 ? 196 TRP A CA    1 
ATOM   1556 C  C     . TRP A 1 196 ? 79.410  13.708  23.212 1.00 22.81 ? 196 TRP A C     1 
ATOM   1557 O  O     . TRP A 1 196 ? 79.235  14.106  22.049 1.00 24.85 ? 196 TRP A O     1 
ATOM   1558 C  CB    . TRP A 1 196 ? 79.836  11.439  22.441 1.00 26.92 ? 196 TRP A CB    1 
ATOM   1559 C  CG    . TRP A 1 196 ? 80.843  10.303  22.177 1.00 30.36 ? 196 TRP A CG    1 
ATOM   1560 C  CD1   . TRP A 1 196 ? 81.795  10.241  21.180 1.00 25.32 ? 196 TRP A CD1   1 
ATOM   1561 C  CD2   . TRP A 1 196 ? 81.084  9.193   23.036 1.00 22.25 ? 196 TRP A CD2   1 
ATOM   1562 N  NE1   . TRP A 1 196 ? 82.652  9.187   21.415 1.00 29.83 ? 196 TRP A NE1   1 
ATOM   1563 C  CE2   . TRP A 1 196 ? 82.236  8.523   22.539 1.00 25.94 ? 196 TRP A CE2   1 
ATOM   1564 C  CE3   . TRP A 1 196 ? 80.452  8.710   24.187 1.00 26.72 ? 196 TRP A CE3   1 
ATOM   1565 C  CZ2   . TRP A 1 196 ? 82.772  7.389   23.163 1.00 31.06 ? 196 TRP A CZ2   1 
ATOM   1566 C  CZ3   . TRP A 1 196 ? 81.001  7.566   24.855 1.00 31.04 ? 196 TRP A CZ3   1 
ATOM   1567 C  CH2   . TRP A 1 196 ? 82.152  6.919   24.327 1.00 31.67 ? 196 TRP A CH2   1 
HETATM 1568 N  N     . TPO A 1 197 ? 78.787  14.201  24.292 1.00 19.00 ? 197 TPO A N     1 
HETATM 1569 C  CA    . TPO A 1 197 ? 77.757  15.223  24.008 1.00 20.21 ? 197 TPO A CA    1 
HETATM 1570 C  CB    . TPO A 1 197 ? 76.814  15.487  25.223 1.00 20.21 ? 197 TPO A CB    1 
HETATM 1571 C  CG2   . TPO A 1 197 ? 75.636  16.356  24.830 1.00 12.40 ? 197 TPO A CG2   1 
HETATM 1572 O  OG1   . TPO A 1 197 ? 76.421  14.175  25.759 1.00 16.70 ? 197 TPO A OG1   1 
HETATM 1573 P  P     . TPO A 1 197 ? 76.792  13.712  27.199 1.00 28.30 ? 197 TPO A P     1 
HETATM 1574 O  O1P   . TPO A 1 197 ? 76.095  12.309  27.352 1.00 28.41 ? 197 TPO A O1P   1 
HETATM 1575 O  O2P   . TPO A 1 197 ? 76.227  14.513  28.335 1.00 24.11 ? 197 TPO A O2P   1 
HETATM 1576 O  O3P   . TPO A 1 197 ? 78.273  13.660  26.987 1.00 19.96 ? 197 TPO A O3P   1 
HETATM 1577 C  C     . TPO A 1 197 ? 78.368  16.562  23.524 1.00 20.34 ? 197 TPO A C     1 
HETATM 1578 O  O     . TPO A 1 197 ? 79.363  16.981  24.141 1.00 19.66 ? 197 TPO A O     1 
ATOM   1579 N  N     . LEU A 1 198 ? 77.936  17.084  22.373 1.00 19.44 ? 198 LEU A N     1 
ATOM   1580 C  CA    . LEU A 1 198 ? 78.329  18.464  22.024 1.00 30.29 ? 198 LEU A CA    1 
ATOM   1581 C  C     . LEU A 1 198 ? 77.609  19.464  23.037 1.00 31.75 ? 198 LEU A C     1 
ATOM   1582 O  O     . LEU A 1 198 ? 76.389  19.741  22.923 1.00 33.44 ? 198 LEU A O     1 
ATOM   1583 C  CB    . LEU A 1 198 ? 77.891  18.787  20.601 1.00 28.97 ? 198 LEU A CB    1 
ATOM   1584 C  CG    . LEU A 1 198 ? 78.311  20.041  19.804 1.00 32.79 ? 198 LEU A CG    1 
ATOM   1585 C  CD1   . LEU A 1 198 ? 77.062  20.777  19.409 1.00 33.99 ? 198 LEU A CD1   1 
ATOM   1586 C  CD2   . LEU A 1 198 ? 79.351  20.955  20.414 1.00 21.36 ? 198 LEU A CD2   1 
ATOM   1587 N  N     . CYS A 1 199 ? 78.332  19.920  24.061 1.00 25.50 ? 199 CYS A N     1 
ATOM   1588 C  CA    . CYS A 1 199 ? 77.774  20.833  25.043 1.00 26.70 ? 199 CYS A CA    1 
ATOM   1589 C  C     . CYS A 1 199 ? 78.913  21.725  25.598 1.00 27.30 ? 199 CYS A C     1 
ATOM   1590 O  O     . CYS A 1 199 ? 80.079  21.342  25.480 1.00 24.55 ? 199 CYS A O     1 
ATOM   1591 C  CB    . CYS A 1 199 ? 76.981  20.082  26.133 1.00 20.83 ? 199 CYS A CB    1 
ATOM   1592 S  SG    . CYS A 1 199 ? 78.047  19.248  27.233 1.00 29.47 ? 199 CYS A SG    1 
ATOM   1593 N  N     . GLY A 1 200 ? 78.543  22.925  26.097 1.00 26.23 ? 200 GLY A N     1 
ATOM   1594 C  CA    . GLY A 1 200 ? 79.423  23.977  26.640 1.00 19.73 ? 200 GLY A CA    1 
ATOM   1595 C  C     . GLY A 1 200 ? 78.968  25.339  26.145 1.00 21.36 ? 200 GLY A C     1 
ATOM   1596 O  O     . GLY A 1 200 ? 77.825  25.463  25.682 1.00 20.34 ? 200 GLY A O     1 
ATOM   1597 N  N     . THR A 1 201 ? 79.893  26.305  26.070 1.00 20.89 ? 201 THR A N     1 
ATOM   1598 C  CA    . THR A 1 201 ? 79.663  27.692  25.569 1.00 15.04 ? 201 THR A CA    1 
ATOM   1599 C  C     . THR A 1 201 ? 80.717  27.891  24.461 1.00 15.95 ? 201 THR A C     1 
ATOM   1600 O  O     . THR A 1 201 ? 81.896  27.773  24.797 1.00 17.94 ? 201 THR A O     1 
ATOM   1601 C  CB    . THR A 1 201 ? 79.834  28.608  26.766 1.00 18.09 ? 201 THR A CB    1 
ATOM   1602 O  OG1   . THR A 1 201 ? 78.801  28.229  27.720 1.00 18.11 ? 201 THR A OG1   1 
ATOM   1603 C  CG2   . THR A 1 201 ? 79.681  30.128  26.379 1.00 13.22 ? 201 THR A CG2   1 
ATOM   1604 N  N     . PRO A 1 202 ? 80.352  28.480  23.295 1.00 18.59 ? 202 PRO A N     1 
ATOM   1605 C  CA    . PRO A 1 202 ? 81.300  28.617  22.179 1.00 17.90 ? 202 PRO A CA    1 
ATOM   1606 C  C     . PRO A 1 202 ? 82.769  28.884  22.346 1.00 22.01 ? 202 PRO A C     1 
ATOM   1607 O  O     . PRO A 1 202 ? 83.538  27.942  22.160 1.00 24.20 ? 202 PRO A O     1 
ATOM   1608 C  CB    . PRO A 1 202 ? 80.574  29.495  21.121 1.00 14.06 ? 202 PRO A CB    1 
ATOM   1609 C  CG    . PRO A 1 202 ? 79.072  29.119  21.388 1.00 15.94 ? 202 PRO A CG    1 
ATOM   1610 C  CD    . PRO A 1 202 ? 79.043  29.072  22.910 1.00 12.43 ? 202 PRO A CD    1 
ATOM   1611 N  N     . GLU A 1 203 ? 83.086  29.910  23.122 1.00 16.46 ? 203 GLU A N     1 
ATOM   1612 C  CA    . GLU A 1 203 ? 84.489  30.387  23.141 1.00 21.18 ? 203 GLU A CA    1 
ATOM   1613 C  C     . GLU A 1 203 ? 85.389  29.395  23.916 1.00 23.44 ? 203 GLU A C     1 
ATOM   1614 O  O     . GLU A 1 203 ? 86.617  29.573  24.059 1.00 22.16 ? 203 GLU A O     1 
ATOM   1615 C  CB    . GLU A 1 203 ? 84.525  31.797  23.859 1.00 18.25 ? 203 GLU A CB    1 
ATOM   1616 C  CG    . GLU A 1 203 ? 84.040  32.982  23.037 1.00 23.39 ? 203 GLU A CG    1 
ATOM   1617 C  CD    . GLU A 1 203 ? 82.536  33.222  22.899 1.00 29.06 ? 203 GLU A CD    1 
ATOM   1618 O  OE1   . GLU A 1 203 ? 81.641  32.413  23.269 1.00 26.67 ? 203 GLU A OE1   1 
ATOM   1619 O  OE2   . GLU A 1 203 ? 82.211  34.286  22.319 1.00 29.22 ? 203 GLU A OE2   1 
ATOM   1620 N  N     . TYR A 1 204 ? 84.692  28.670  24.797 1.00 22.92 ? 204 TYR A N     1 
ATOM   1621 C  CA    . TYR A 1 204 ? 85.332  27.812  25.782 1.00 21.69 ? 204 TYR A CA    1 
ATOM   1622 C  C     . TYR A 1 204 ? 85.446  26.319  25.380 1.00 22.65 ? 204 TYR A C     1 
ATOM   1623 O  O     . TYR A 1 204 ? 86.142  25.561  26.075 1.00 24.26 ? 204 TYR A O     1 
ATOM   1624 C  CB    . TYR A 1 204 ? 84.593  28.016  27.098 1.00 11.21 ? 204 TYR A CB    1 
ATOM   1625 C  CG    . TYR A 1 204 ? 84.925  29.242  27.894 1.00 16.22 ? 204 TYR A CG    1 
ATOM   1626 C  CD1   . TYR A 1 204 ? 84.456  30.512  27.511 1.00 16.40 ? 204 TYR A CD1   1 
ATOM   1627 C  CD2   . TYR A 1 204 ? 85.856  29.181  28.922 1.00 21.49 ? 204 TYR A CD2   1 
ATOM   1628 C  CE1   . TYR A 1 204 ? 84.936  31.722  28.153 1.00 14.70 ? 204 TYR A CE1   1 
ATOM   1629 C  CE2   . TYR A 1 204 ? 86.390  30.368  29.555 1.00 16.43 ? 204 TYR A CE2   1 
ATOM   1630 C  CZ    . TYR A 1 204 ? 85.891  31.632  29.149 1.00 19.03 ? 204 TYR A CZ    1 
ATOM   1631 O  OH    . TYR A 1 204 ? 86.305  32.721  29.893 1.00 24.05 ? 204 TYR A OH    1 
ATOM   1632 N  N     . LEU A 1 205 ? 84.851  25.971  24.236 1.00 22.82 ? 205 LEU A N     1 
ATOM   1633 C  CA    . LEU A 1 205 ? 84.847  24.624  23.694 1.00 24.93 ? 205 LEU A CA    1 
ATOM   1634 C  C     . LEU A 1 205 ? 86.234  24.115  23.310 1.00 25.40 ? 205 LEU A C     1 
ATOM   1635 O  O     . LEU A 1 205 ? 86.903  24.814  22.533 1.00 22.03 ? 205 LEU A O     1 
ATOM   1636 C  CB    . LEU A 1 205 ? 83.947  24.539  22.465 1.00 23.57 ? 205 LEU A CB    1 
ATOM   1637 C  CG    . LEU A 1 205 ? 82.420  24.501  22.585 1.00 23.16 ? 205 LEU A CG    1 
ATOM   1638 C  CD1   . LEU A 1 205 ? 81.998  23.732  21.387 1.00 24.36 ? 205 LEU A CD1   1 
ATOM   1639 C  CD2   . LEU A 1 205 ? 81.895  23.811  23.850 1.00 21.03 ? 205 LEU A CD2   1 
ATOM   1640 N  N     . ALA A 1 206 ? 86.654  22.971  23.877 1.00 18.92 ? 206 ALA A N     1 
ATOM   1641 C  CA    . ALA A 1 206 ? 87.910  22.334  23.478 1.00 16.14 ? 206 ALA A CA    1 
ATOM   1642 C  C     . ALA A 1 206 ? 87.748  21.768  22.049 1.00 20.99 ? 206 ALA A C     1 
ATOM   1643 O  O     . ALA A 1 206 ? 86.601  21.565  21.567 1.00 17.76 ? 206 ALA A O     1 
ATOM   1644 C  CB    . ALA A 1 206 ? 88.349  21.244  24.565 1.00 18.91 ? 206 ALA A CB    1 
ATOM   1645 N  N     . PRO A 1 207 ? 88.839  21.821  21.219 1.00 24.35 ? 207 PRO A N     1 
ATOM   1646 C  CA    . PRO A 1 207 ? 88.794  21.299  19.827 1.00 23.81 ? 207 PRO A CA    1 
ATOM   1647 C  C     . PRO A 1 207 ? 88.289  19.844  19.705 1.00 22.03 ? 207 PRO A C     1 
ATOM   1648 O  O     . PRO A 1 207 ? 87.522  19.597  18.801 1.00 26.39 ? 207 PRO A O     1 
ATOM   1649 C  CB    . PRO A 1 207 ? 90.216  21.430  19.293 1.00 23.86 ? 207 PRO A CB    1 
ATOM   1650 C  CG    . PRO A 1 207 ? 91.075  21.491  20.591 1.00 27.88 ? 207 PRO A CG    1 
ATOM   1651 C  CD    . PRO A 1 207 ? 90.215  22.090  21.678 1.00 26.66 ? 207 PRO A CD    1 
ATOM   1652 N  N     . GLU A 1 208 ? 88.539  18.975  20.687 1.00 22.36 ? 208 GLU A N     1 
ATOM   1653 C  CA    . GLU A 1 208 ? 87.991  17.595  20.700 1.00 25.08 ? 208 GLU A CA    1 
ATOM   1654 C  C     . GLU A 1 208 ? 86.482  17.514  20.772 1.00 26.19 ? 208 GLU A C     1 
ATOM   1655 O  O     . GLU A 1 208 ? 85.890  16.694  20.039 1.00 30.43 ? 208 GLU A O     1 
ATOM   1656 C  CB    . GLU A 1 208 ? 88.540  16.690  21.768 1.00 18.86 ? 208 GLU A CB    1 
ATOM   1657 C  CG    . GLU A 1 208 ? 88.518  17.171  23.167 1.00 18.10 ? 208 GLU A CG    1 
ATOM   1658 C  CD    . GLU A 1 208 ? 89.788  17.814  23.648 1.00 21.64 ? 208 GLU A CD    1 
ATOM   1659 O  OE1   . GLU A 1 208 ? 90.445  18.600  22.933 1.00 27.82 ? 208 GLU A OE1   1 
ATOM   1660 O  OE2   . GLU A 1 208 ? 89.999  17.749  24.869 1.00 22.02 ? 208 GLU A OE2   1 
ATOM   1661 N  N     . ILE A 1 209 ? 85.857  18.496  21.431 1.00 23.23 ? 209 ILE A N     1 
ATOM   1662 C  CA    . ILE A 1 209 ? 84.391  18.552  21.430 1.00 23.88 ? 209 ILE A CA    1 
ATOM   1663 C  C     . ILE A 1 209 ? 83.881  18.942  20.066 1.00 24.58 ? 209 ILE A C     1 
ATOM   1664 O  O     . ILE A 1 209 ? 82.938  18.357  19.530 1.00 26.18 ? 209 ILE A O     1 
ATOM   1665 C  CB    . ILE A 1 209 ? 83.806  19.504  22.500 1.00 19.83 ? 209 ILE A CB    1 
ATOM   1666 C  CG1   . ILE A 1 209 ? 84.252  19.052  23.855 1.00 14.70 ? 209 ILE A CG1   1 
ATOM   1667 C  CG2   . ILE A 1 209 ? 82.311  19.436  22.468 1.00 15.97 ? 209 ILE A CG2   1 
ATOM   1668 C  CD1   . ILE A 1 209 ? 83.744  19.950  25.016 1.00 21.30 ? 209 ILE A CD1   1 
ATOM   1669 N  N     . ILE A 1 210 ? 84.549  19.931  19.490 1.00 28.86 ? 210 ILE A N     1 
ATOM   1670 C  CA    . ILE A 1 210 ? 84.145  20.456  18.188 1.00 26.89 ? 210 ILE A CA    1 
ATOM   1671 C  C     . ILE A 1 210 ? 84.216  19.442  17.079 1.00 26.06 ? 210 ILE A C     1 
ATOM   1672 O  O     . ILE A 1 210 ? 83.361  19.436  16.162 1.00 26.99 ? 210 ILE A O     1 
ATOM   1673 C  CB    . ILE A 1 210 ? 84.949  21.756  17.825 1.00 30.49 ? 210 ILE A CB    1 
ATOM   1674 C  CG1   . ILE A 1 210 ? 84.598  22.934  18.761 1.00 25.23 ? 210 ILE A CG1   1 
ATOM   1675 C  CG2   . ILE A 1 210 ? 84.717  22.195  16.375 1.00 23.71 ? 210 ILE A CG2   1 
ATOM   1676 C  CD1   . ILE A 1 210 ? 85.627  24.053  18.581 1.00 18.35 ? 210 ILE A CD1   1 
ATOM   1677 N  N     . LEU A 1 211 ? 85.295  18.668  17.160 1.00 28.79 ? 211 LEU A N     1 
ATOM   1678 C  CA    . LEU A 1 211 ? 85.654  17.631  16.198 1.00 31.84 ? 211 LEU A CA    1 
ATOM   1679 C  C     . LEU A 1 211 ? 84.823  16.340  16.240 1.00 35.80 ? 211 LEU A C     1 
ATOM   1680 O  O     . LEU A 1 211 ? 85.102  15.450  15.459 1.00 39.76 ? 211 LEU A O     1 
ATOM   1681 C  CB    . LEU A 1 211 ? 87.167  17.376  16.298 1.00 29.50 ? 211 LEU A CB    1 
ATOM   1682 C  CG    . LEU A 1 211 ? 88.000  18.534  15.675 1.00 29.11 ? 211 LEU A CG    1 
ATOM   1683 C  CD1   . LEU A 1 211 ? 89.470  18.374  15.713 1.00 30.38 ? 211 LEU A CD1   1 
ATOM   1684 C  CD2   . LEU A 1 211 ? 87.700  18.750  14.246 1.00 30.86 ? 211 LEU A CD2   1 
ATOM   1685 N  N     . SER A 1 212 ? 83.941  16.184  17.234 1.00 34.49 ? 212 SER A N     1 
ATOM   1686 C  CA    . SER A 1 212 ? 83.044  15.071  17.430 1.00 36.45 ? 212 SER A CA    1 
ATOM   1687 C  C     . SER A 1 212 ? 83.787  13.821  17.773 1.00 39.75 ? 212 SER A C     1 
ATOM   1688 O  O     . SER A 1 212 ? 83.607  12.766  17.120 1.00 39.86 ? 212 SER A O     1 
ATOM   1689 C  CB    . SER A 1 212 ? 82.160  14.832  16.224 1.00 36.15 ? 212 SER A CB    1 
ATOM   1690 O  OG    . SER A 1 212 ? 81.216  15.838  16.296 1.00 47.69 ? 212 SER A OG    1 
ATOM   1691 N  N     . LYS A 1 213 ? 84.707  14.023  18.714 1.00 38.88 ? 213 LYS A N     1 
ATOM   1692 C  CA    . LYS A 1 213 ? 85.526  12.947  19.276 1.00 42.60 ? 213 LYS A CA    1 
ATOM   1693 C  C     . LYS A 1 213 ? 85.013  12.693  20.706 1.00 43.01 ? 213 LYS A C     1 
ATOM   1694 O  O     . LYS A 1 213 ? 84.331  13.530  21.326 1.00 43.20 ? 213 LYS A O     1 
ATOM   1695 C  CB    . LYS A 1 213 ? 86.995  13.373  19.346 1.00 44.91 ? 213 LYS A CB    1 
ATOM   1696 C  CG    . LYS A 1 213 ? 87.507  13.965  18.033 1.00 57.19 ? 213 LYS A CG    1 
ATOM   1697 C  CD    . LYS A 1 213 ? 89.018  14.147  17.963 1.00 65.33 ? 213 LYS A CD    1 
ATOM   1698 C  CE    . LYS A 1 213 ? 89.324  15.590  18.254 1.00 71.17 ? 213 LYS A CE    1 
ATOM   1699 N  NZ    . LYS A 1 213 ? 90.632  16.225  17.905 1.00 78.38 ? 213 LYS A NZ    1 
ATOM   1700 N  N     . GLY A 1 214 ? 85.284  11.499  21.223 1.00 41.99 ? 214 GLY A N     1 
ATOM   1701 C  CA    . GLY A 1 214 ? 84.999  11.252  22.628 1.00 39.64 ? 214 GLY A CA    1 
ATOM   1702 C  C     . GLY A 1 214 ? 86.000  12.141  23.379 1.00 38.24 ? 214 GLY A C     1 
ATOM   1703 O  O     . GLY A 1 214 ? 86.992  12.623  22.809 1.00 43.92 ? 214 GLY A O     1 
ATOM   1704 N  N     . TYR A 1 215 ? 85.643  12.577  24.572 1.00 30.39 ? 215 TYR A N     1 
ATOM   1705 C  CA    . TYR A 1 215 ? 86.505  13.420  25.367 1.00 21.58 ? 215 TYR A CA    1 
ATOM   1706 C  C     . TYR A 1 215 ? 86.350  12.986  26.789 1.00 24.24 ? 215 TYR A C     1 
ATOM   1707 O  O     . TYR A 1 215 ? 85.556  12.131  27.111 1.00 28.23 ? 215 TYR A O     1 
ATOM   1708 C  CB    . TYR A 1 215 ? 86.208  14.880  25.097 1.00 22.32 ? 215 TYR A CB    1 
ATOM   1709 C  CG    . TYR A 1 215 ? 84.749  15.279  25.205 1.00 21.17 ? 215 TYR A CG    1 
ATOM   1710 C  CD1   . TYR A 1 215 ? 84.288  15.698  26.463 1.00 22.93 ? 215 TYR A CD1   1 
ATOM   1711 C  CD2   . TYR A 1 215 ? 83.848  15.275  24.080 1.00 17.49 ? 215 TYR A CD2   1 
ATOM   1712 C  CE1   . TYR A 1 215 ? 83.028  16.190  26.641 1.00 18.84 ? 215 TYR A CE1   1 
ATOM   1713 C  CE2   . TYR A 1 215 ? 82.474  15.653  24.272 1.00 18.24 ? 215 TYR A CE2   1 
ATOM   1714 C  CZ    . TYR A 1 215 ? 82.129  16.151  25.572 1.00 20.05 ? 215 TYR A CZ    1 
ATOM   1715 O  OH    . TYR A 1 215 ? 80.990  16.799  25.989 1.00 22.23 ? 215 TYR A OH    1 
ATOM   1716 N  N     . ASN A 1 216 ? 87.235  13.514  27.602 1.00 24.60 ? 216 ASN A N     1 
ATOM   1717 C  CA    . ASN A 1 216 ? 87.428  13.183  28.999 1.00 29.09 ? 216 ASN A CA    1 
ATOM   1718 C  C     . ASN A 1 216 ? 87.528  14.516  29.751 1.00 24.06 ? 216 ASN A C     1 
ATOM   1719 O  O     . ASN A 1 216 ? 87.388  15.582  29.181 1.00 22.17 ? 216 ASN A O     1 
ATOM   1720 C  CB    . ASN A 1 216 ? 88.748  12.336  29.133 1.00 36.61 ? 216 ASN A CB    1 
ATOM   1721 C  CG    . ASN A 1 216 ? 90.075  13.119  28.860 1.00 32.51 ? 216 ASN A CG    1 
ATOM   1722 O  OD1   . ASN A 1 216 ? 90.110  14.188  28.275 1.00 39.31 ? 216 ASN A OD1   1 
ATOM   1723 N  ND2   . ASN A 1 216 ? 91.156  12.606  29.369 1.00 39.64 ? 216 ASN A ND2   1 
ATOM   1724 N  N     . LYS A 1 217 ? 88.078  14.416  30.939 1.00 24.87 ? 217 LYS A N     1 
ATOM   1725 C  CA    . LYS A 1 217 ? 88.216  15.517  31.852 1.00 24.66 ? 217 LYS A CA    1 
ATOM   1726 C  C     . LYS A 1 217 ? 89.154  16.658  31.373 1.00 28.08 ? 217 LYS A C     1 
ATOM   1727 O  O     . LYS A 1 217 ? 89.122  17.751  31.977 1.00 27.58 ? 217 LYS A O     1 
ATOM   1728 C  CB    . LYS A 1 217 ? 88.577  14.923  33.196 1.00 21.28 ? 217 LYS A CB    1 
ATOM   1729 C  CG    . LYS A 1 217 ? 90.029  14.928  33.618 1.00 33.01 ? 217 LYS A CG    1 
ATOM   1730 C  CD    . LYS A 1 217 ? 90.784  13.830  32.918 1.00 49.43 ? 217 LYS A CD    1 
ATOM   1731 C  CE    . LYS A 1 217 ? 92.289  13.957  33.143 1.00 53.35 ? 217 LYS A CE    1 
ATOM   1732 N  NZ    . LYS A 1 217 ? 92.872  15.053  32.299 1.00 55.05 ? 217 LYS A NZ    1 
ATOM   1733 N  N     . ALA A 1 218 ? 89.951  16.387  30.326 1.00 21.79 ? 218 ALA A N     1 
ATOM   1734 C  CA    . ALA A 1 218 ? 90.869  17.382  29.717 1.00 24.79 ? 218 ALA A CA    1 
ATOM   1735 C  C     . ALA A 1 218 ? 90.146  18.597  29.161 1.00 22.27 ? 218 ALA A C     1 
ATOM   1736 O  O     . ALA A 1 218 ? 90.806  19.520  28.724 1.00 22.44 ? 218 ALA A O     1 
ATOM   1737 C  CB    . ALA A 1 218 ? 91.729  16.784  28.603 1.00 21.69 ? 218 ALA A CB    1 
ATOM   1738 N  N     . VAL A 1 219 ? 88.872  18.429  28.823 1.00 18.88 ? 219 VAL A N     1 
ATOM   1739 C  CA    . VAL A 1 219 ? 88.095  19.566  28.320 1.00 21.66 ? 219 VAL A CA    1 
ATOM   1740 C  C     . VAL A 1 219 ? 88.075  20.738  29.345 1.00 22.32 ? 219 VAL A C     1 
ATOM   1741 O  O     . VAL A 1 219 ? 88.191  21.889  28.955 1.00 18.32 ? 219 VAL A O     1 
ATOM   1742 C  CB    . VAL A 1 219 ? 86.669  19.211  27.765 1.00 15.34 ? 219 VAL A CB    1 
ATOM   1743 C  CG1   . VAL A 1 219 ? 86.766  18.305  26.642 1.00 13.62 ? 219 VAL A CG1   1 
ATOM   1744 C  CG2   . VAL A 1 219 ? 85.689  18.859  28.870 1.00 15.95 ? 219 VAL A CG2   1 
ATOM   1745 N  N     . ASP A 1 220 ? 88.046  20.406  30.633 1.00 15.01 ? 220 ASP A N     1 
ATOM   1746 C  CA    . ASP A 1 220 ? 87.995  21.361  31.718 1.00 20.55 ? 220 ASP A CA    1 
ATOM   1747 C  C     . ASP A 1 220 ? 89.306  22.191  31.838 1.00 22.67 ? 220 ASP A C     1 
ATOM   1748 O  O     . ASP A 1 220 ? 89.379  23.195  32.547 1.00 20.41 ? 220 ASP A O     1 
ATOM   1749 C  CB    . ASP A 1 220 ? 87.674  20.603  33.048 1.00 17.82 ? 220 ASP A CB    1 
ATOM   1750 C  CG    . ASP A 1 220 ? 86.161  20.224  33.214 1.00 15.59 ? 220 ASP A CG    1 
ATOM   1751 O  OD1   . ASP A 1 220 ? 85.295  20.456  32.357 1.00 18.61 ? 220 ASP A OD1   1 
ATOM   1752 O  OD2   . ASP A 1 220 ? 85.794  19.526  34.183 1.00 13.78 ? 220 ASP A OD2   1 
ATOM   1753 N  N     . TRP A 1 221 ? 90.408  21.506  31.554 1.00 23.08 ? 221 TRP A N     1 
ATOM   1754 C  CA    . TRP A 1 221 ? 91.750  22.082  31.624 1.00 18.73 ? 221 TRP A CA    1 
ATOM   1755 C  C     . TRP A 1 221 ? 91.917  22.992  30.427 1.00 23.89 ? 221 TRP A C     1 
ATOM   1756 O  O     . TRP A 1 221 ? 92.617  24.004  30.563 1.00 24.93 ? 221 TRP A O     1 
ATOM   1757 C  CB    . TRP A 1 221 ? 92.838  21.000  31.716 1.00 20.68 ? 221 TRP A CB    1 
ATOM   1758 C  CG    . TRP A 1 221 ? 92.717  20.221  32.984 1.00 15.59 ? 221 TRP A CG    1 
ATOM   1759 C  CD1   . TRP A 1 221 ? 92.604  18.873  33.066 1.00 18.79 ? 221 TRP A CD1   1 
ATOM   1760 C  CD2   . TRP A 1 221 ? 92.731  20.729  34.331 1.00 20.39 ? 221 TRP A CD2   1 
ATOM   1761 N  NE1   . TRP A 1 221 ? 92.575  18.490  34.398 1.00 15.05 ? 221 TRP A NE1   1 
ATOM   1762 C  CE2   . TRP A 1 221 ? 92.646  19.599  35.204 1.00 22.40 ? 221 TRP A CE2   1 
ATOM   1763 C  CE3   . TRP A 1 221 ? 92.757  22.039  34.917 1.00 24.85 ? 221 TRP A CE3   1 
ATOM   1764 C  CZ2   . TRP A 1 221 ? 92.608  19.735  36.650 1.00 21.29 ? 221 TRP A CZ2   1 
ATOM   1765 C  CZ3   . TRP A 1 221 ? 92.710  22.187  36.378 1.00 20.29 ? 221 TRP A CZ3   1 
ATOM   1766 C  CH2   . TRP A 1 221 ? 92.653  21.009  37.219 1.00 22.93 ? 221 TRP A CH2   1 
ATOM   1767 N  N     . TRP A 1 222 ? 91.411  22.591  29.259 1.00 16.26 ? 222 TRP A N     1 
ATOM   1768 C  CA    . TRP A 1 222 ? 91.418  23.500  28.139 1.00 21.59 ? 222 TRP A CA    1 
ATOM   1769 C  C     . TRP A 1 222 ? 90.645  24.767  28.590 1.00 25.73 ? 222 TRP A C     1 
ATOM   1770 O  O     . TRP A 1 222 ? 91.226  25.833  28.513 1.00 23.53 ? 222 TRP A O     1 
ATOM   1771 C  CB    . TRP A 1 222 ? 90.731  22.845  26.951 1.00 19.36 ? 222 TRP A CB    1 
ATOM   1772 C  CG    . TRP A 1 222 ? 90.615  23.758  25.781 1.00 21.16 ? 222 TRP A CG    1 
ATOM   1773 C  CD1   . TRP A 1 222 ? 89.627  24.659  25.604 1.00 20.57 ? 222 TRP A CD1   1 
ATOM   1774 C  CD2   . TRP A 1 222 ? 91.541  23.957  24.711 1.00 23.90 ? 222 TRP A CD2   1 
ATOM   1775 N  NE1   . TRP A 1 222 ? 89.904  25.463  24.535 1.00 27.00 ? 222 TRP A NE1   1 
ATOM   1776 C  CE2   . TRP A 1 222 ? 91.071  25.056  23.955 1.00 25.91 ? 222 TRP A CE2   1 
ATOM   1777 C  CE3   . TRP A 1 222 ? 92.682  23.266  24.241 1.00 25.72 ? 222 TRP A CE3   1 
ATOM   1778 C  CZ2   . TRP A 1 222 ? 91.723  25.497  22.758 1.00 28.49 ? 222 TRP A CZ2   1 
ATOM   1779 C  CZ3   . TRP A 1 222 ? 93.299  23.670  23.043 1.00 19.46 ? 222 TRP A CZ3   1 
ATOM   1780 C  CH2   . TRP A 1 222 ? 92.828  24.782  22.319 1.00 23.26 ? 222 TRP A CH2   1 
ATOM   1781 N  N     . ALA A 1 223 ? 89.435  24.621  29.157 1.00 21.00 ? 223 ALA A N     1 
ATOM   1782 C  CA    . ALA A 1 223 ? 88.538  25.685  29.618 1.00 22.21 ? 223 ALA A CA    1 
ATOM   1783 C  C     . ALA A 1 223 ? 89.222  26.625  30.614 1.00 20.13 ? 223 ALA A C     1 
ATOM   1784 O  O     . ALA A 1 223 ? 89.047  27.840  30.548 1.00 21.34 ? 223 ALA A O     1 
ATOM   1785 C  CB    . ALA A 1 223 ? 87.277  25.101  30.226 1.00 14.61 ? 223 ALA A CB    1 
ATOM   1786 N  N     . LEU A 1 224 ? 90.034  26.089  31.497 1.00 14.97 ? 224 LEU A N     1 
ATOM   1787 C  CA    . LEU A 1 224 ? 90.848  26.893  32.405 1.00 18.94 ? 224 LEU A CA    1 
ATOM   1788 C  C     . LEU A 1 224 ? 91.905  27.818  31.662 1.00 20.28 ? 224 LEU A C     1 
ATOM   1789 O  O     . LEU A 1 224 ? 92.042  28.934  32.070 1.00 17.54 ? 224 LEU A O     1 
ATOM   1790 C  CB    . LEU A 1 224 ? 91.466  26.019  33.490 1.00 17.57 ? 224 LEU A CB    1 
ATOM   1791 C  CG    . LEU A 1 224 ? 92.283  26.806  34.492 1.00 27.74 ? 224 LEU A CG    1 
ATOM   1792 C  CD1   . LEU A 1 224 ? 91.516  27.657  35.532 1.00 23.75 ? 224 LEU A CD1   1 
ATOM   1793 C  CD2   . LEU A 1 224 ? 93.348  25.836  35.018 1.00 28.17 ? 224 LEU A CD2   1 
ATOM   1794 N  N     . GLY A 1 225 ? 92.478  27.368  30.549 1.00 18.58 ? 225 GLY A N     1 
ATOM   1795 C  CA    . GLY A 1 225 ? 93.397  28.056  29.687 1.00 23.67 ? 225 GLY A CA    1 
ATOM   1796 C  C     . GLY A 1 225 ? 92.614  29.218  29.132 1.00 24.31 ? 225 GLY A C     1 
ATOM   1797 O  O     . GLY A 1 225 ? 93.123  30.360  29.146 1.00 27.15 ? 225 GLY A O     1 
ATOM   1798 N  N     . VAL A 1 226 ? 91.425  28.942  28.595 1.00 24.41 ? 226 VAL A N     1 
ATOM   1799 C  CA    . VAL A 1 226 ? 90.543  29.978  28.037 1.00 25.30 ? 226 VAL A CA    1 
ATOM   1800 C  C     . VAL A 1 226 ? 90.142  31.068  29.122 1.00 25.20 ? 226 VAL A C     1 
ATOM   1801 O  O     . VAL A 1 226 ? 90.299  32.289  28.891 1.00 27.25 ? 226 VAL A O     1 
ATOM   1802 C  CB    . VAL A 1 226 ? 89.341  29.341  27.270 1.00 22.18 ? 226 VAL A CB    1 
ATOM   1803 C  CG1   . VAL A 1 226 ? 88.480  30.414  26.514 1.00 27.70 ? 226 VAL A CG1   1 
ATOM   1804 C  CG2   . VAL A 1 226 ? 89.836  28.535  26.113 1.00 18.81 ? 226 VAL A CG2   1 
ATOM   1805 N  N     . LEU A 1 227 ? 89.896  30.619  30.355 1.00 19.44 ? 227 LEU A N     1 
ATOM   1806 C  CA    . LEU A 1 227 ? 89.472  31.458  31.442 1.00 19.04 ? 227 LEU A CA    1 
ATOM   1807 C  C     . LEU A 1 227 ? 90.652  32.353  31.897 1.00 24.63 ? 227 LEU A C     1 
ATOM   1808 O  O     . LEU A 1 227 ? 90.441  33.539  32.008 1.00 23.61 ? 227 LEU A O     1 
ATOM   1809 C  CB    . LEU A 1 227 ? 88.782  30.680  32.580 1.00 13.34 ? 227 LEU A CB    1 
ATOM   1810 C  CG    . LEU A 1 227 ? 88.385  31.525  33.798 1.00 14.58 ? 227 LEU A CG    1 
ATOM   1811 C  CD1   . LEU A 1 227 ? 87.101  32.302  33.560 1.00 13.52 ? 227 LEU A CD1   1 
ATOM   1812 C  CD2   . LEU A 1 227 ? 88.275  30.739  35.071 1.00 18.99 ? 227 LEU A CD2   1 
ATOM   1813 N  N     . ILE A 1 228 ? 91.834  31.812  32.198 1.00 23.29 ? 228 ILE A N     1 
ATOM   1814 C  CA    . ILE A 1 228 ? 93.048  32.581  32.533 1.00 25.10 ? 228 ILE A CA    1 
ATOM   1815 C  C     . ILE A 1 228 ? 93.421  33.609  31.436 1.00 24.33 ? 228 ILE A C     1 
ATOM   1816 O  O     . ILE A 1 228 ? 93.647  34.782  31.818 1.00 25.90 ? 228 ILE A O     1 
ATOM   1817 C  CB    . ILE A 1 228 ? 94.252  31.708  32.884 1.00 22.84 ? 228 ILE A CB    1 
ATOM   1818 C  CG1   . ILE A 1 228 ? 93.821  30.718  34.003 1.00 22.45 ? 228 ILE A CG1   1 
ATOM   1819 C  CG2   . ILE A 1 228 ? 95.417  32.608  33.376 1.00 18.96 ? 228 ILE A CG2   1 
ATOM   1820 C  CD1   . ILE A 1 228 ? 94.864  29.647  34.402 1.00 14.11 ? 228 ILE A CD1   1 
ATOM   1821 N  N     . TYR A 1 229 ? 93.338  33.215  30.149 1.00 21.37 ? 229 TYR A N     1 
ATOM   1822 C  CA    . TYR A 1 229 ? 93.600  34.120  29.070 1.00 21.81 ? 229 TYR A CA    1 
ATOM   1823 C  C     . TYR A 1 229 ? 92.576  35.289  29.161 1.00 30.58 ? 229 TYR A C     1 
ATOM   1824 O  O     . TYR A 1 229 ? 92.998  36.447  29.270 1.00 28.13 ? 229 TYR A O     1 
ATOM   1825 C  CB    . TYR A 1 229 ? 93.563  33.459  27.733 1.00 18.09 ? 229 TYR A CB    1 
ATOM   1826 C  CG    . TYR A 1 229 ? 93.970  34.350  26.559 1.00 27.25 ? 229 TYR A CG    1 
ATOM   1827 C  CD1   . TYR A 1 229 ? 93.189  35.464  26.148 1.00 26.87 ? 229 TYR A CD1   1 
ATOM   1828 C  CD2   . TYR A 1 229 ? 95.073  34.016  25.747 1.00 24.57 ? 229 TYR A CD2   1 
ATOM   1829 C  CE1   . TYR A 1 229 ? 93.467  36.195  24.961 1.00 23.74 ? 229 TYR A CE1   1 
ATOM   1830 C  CE2   . TYR A 1 229 ? 95.368  34.725  24.590 1.00 25.19 ? 229 TYR A CE2   1 
ATOM   1831 C  CZ    . TYR A 1 229 ? 94.552  35.804  24.214 1.00 25.23 ? 229 TYR A CZ    1 
ATOM   1832 O  OH    . TYR A 1 229 ? 94.746  36.451  23.025 1.00 23.93 ? 229 TYR A OH    1 
ATOM   1833 N  N     . GLU A 1 230 ? 91.275  34.990  29.182 1.00 30.58 ? 230 GLU A N     1 
ATOM   1834 C  CA    . GLU A 1 230 ? 90.236  36.004  29.282 1.00 29.53 ? 230 GLU A CA    1 
ATOM   1835 C  C     . GLU A 1 230 ? 90.353  36.942  30.498 1.00 26.51 ? 230 GLU A C     1 
ATOM   1836 O  O     . GLU A 1 230 ? 90.144  38.148  30.353 1.00 26.68 ? 230 GLU A O     1 
ATOM   1837 C  CB    . GLU A 1 230 ? 88.857  35.371  29.125 1.00 24.70 ? 230 GLU A CB    1 
ATOM   1838 C  CG    . GLU A 1 230 ? 87.723  36.398  29.363 1.00 29.86 ? 230 GLU A CG    1 
ATOM   1839 C  CD    . GLU A 1 230 ? 86.378  36.090  28.769 1.00 22.54 ? 230 GLU A CD    1 
ATOM   1840 O  OE1   . GLU A 1 230 ? 86.157  35.117  28.083 1.00 36.50 ? 230 GLU A OE1   1 
ATOM   1841 O  OE2   . GLU A 1 230 ? 85.526  36.944  28.758 1.00 27.02 ? 230 GLU A OE2   1 
ATOM   1842 N  N     . MET A 1 231 ? 90.709  36.428  31.658 1.00 22.68 ? 231 MET A N     1 
ATOM   1843 C  CA    . MET A 1 231 ? 90.849  37.251  32.872 1.00 24.02 ? 231 MET A CA    1 
ATOM   1844 C  C     . MET A 1 231 ? 92.080  38.222  32.815 1.00 31.23 ? 231 MET A C     1 
ATOM   1845 O  O     . MET A 1 231 ? 91.952  39.382  33.142 1.00 28.40 ? 231 MET A O     1 
ATOM   1846 C  CB    . MET A 1 231 ? 90.982  36.386  34.109 1.00 22.41 ? 231 MET A CB    1 
ATOM   1847 C  CG    . MET A 1 231 ? 89.755  35.605  34.536 1.00 16.51 ? 231 MET A CG    1 
ATOM   1848 S  SD    . MET A 1 231 ? 89.979  34.981  36.145 1.00 21.50 ? 231 MET A SD    1 
ATOM   1849 C  CE    . MET A 1 231 ? 91.262  33.715  35.815 1.00 14.85 ? 231 MET A CE    1 
ATOM   1850 N  N     . ALA A 1 232 ? 93.173  37.811  32.175 1.00 28.75 ? 232 ALA A N     1 
ATOM   1851 C  CA    . ALA A 1 232 ? 94.333  38.646  32.102 1.00 26.98 ? 232 ALA A CA    1 
ATOM   1852 C  C     . ALA A 1 232 ? 94.430  39.457  30.805 1.00 28.00 ? 232 ALA A C     1 
ATOM   1853 O  O     . ALA A 1 232 ? 95.217  40.389  30.763 1.00 30.17 ? 232 ALA A O     1 
ATOM   1854 C  CB    . ALA A 1 232 ? 95.553  37.825  32.412 1.00 28.18 ? 232 ALA A CB    1 
ATOM   1855 N  N     . ALA A 1 233 ? 93.768  39.103  29.711 1.00 21.64 ? 233 ALA A N     1 
ATOM   1856 C  CA    . ALA A 1 233 ? 93.810  39.930  28.525 1.00 22.73 ? 233 ALA A CA    1 
ATOM   1857 C  C     . ALA A 1 233 ? 92.556  40.843  28.498 1.00 28.75 ? 233 ALA A C     1 
ATOM   1858 O  O     . ALA A 1 233 ? 92.537  41.906  27.864 1.00 28.08 ? 233 ALA A O     1 
ATOM   1859 C  CB    . ALA A 1 233 ? 93.893  39.059  27.278 1.00 19.39 ? 233 ALA A CB    1 
ATOM   1860 N  N     . GLY A 1 234 ? 91.451  40.367  29.076 1.00 28.26 ? 234 GLY A N     1 
ATOM   1861 C  CA    . GLY A 1 234 ? 90.206  41.100  29.041 1.00 22.68 ? 234 GLY A CA    1 
ATOM   1862 C  C     . GLY A 1 234 ? 89.400  40.698  27.820 1.00 26.64 ? 234 GLY A C     1 
ATOM   1863 O  O     . GLY A 1 234 ? 88.407  41.328  27.531 1.00 28.40 ? 234 GLY A O     1 
ATOM   1864 N  N     . TYR A 1 235 ? 89.872  39.796  26.986 1.00 20.89 ? 235 TYR A N     1 
ATOM   1865 C  CA    . TYR A 1 235 ? 89.082  39.273  25.882 1.00 22.90 ? 235 TYR A CA    1 
ATOM   1866 C  C     . TYR A 1 235 ? 89.490  37.776  25.807 1.00 28.33 ? 235 TYR A C     1 
ATOM   1867 O  O     . TYR A 1 235 ? 90.497  37.385  26.436 1.00 23.56 ? 235 TYR A O     1 
ATOM   1868 C  CB    . TYR A 1 235 ? 89.213  39.990  24.516 1.00 22.56 ? 235 TYR A CB    1 
ATOM   1869 C  CG    . TYR A 1 235 ? 90.571  40.457  24.187 1.00 27.11 ? 235 TYR A CG    1 
ATOM   1870 C  CD1   . TYR A 1 235 ? 91.152  41.599  24.837 1.00 31.88 ? 235 TYR A CD1   1 
ATOM   1871 C  CD2   . TYR A 1 235 ? 91.392  39.608  23.447 1.00 30.77 ? 235 TYR A CD2   1 
ATOM   1872 C  CE1   . TYR A 1 235 ? 92.592  41.849  24.745 1.00 30.24 ? 235 TYR A CE1   1 
ATOM   1873 C  CE2   . TYR A 1 235 ? 92.786  39.829  23.327 1.00 32.69 ? 235 TYR A CE2   1 
ATOM   1874 C  CZ    . TYR A 1 235 ? 93.354  40.945  23.951 1.00 32.30 ? 235 TYR A CZ    1 
ATOM   1875 O  OH    . TYR A 1 235 ? 94.627  41.139  23.537 1.00 34.22 ? 235 TYR A OH    1 
ATOM   1876 N  N     . PRO A 1 236 ? 88.595  36.928  25.228 1.00 27.61 ? 236 PRO A N     1 
ATOM   1877 C  CA    . PRO A 1 236 ? 88.913  35.511  25.102 1.00 27.91 ? 236 PRO A CA    1 
ATOM   1878 C  C     . PRO A 1 236 ? 89.913  35.293  23.960 1.00 27.72 ? 236 PRO A C     1 
ATOM   1879 O  O     . PRO A 1 236 ? 89.856  36.029  22.992 1.00 25.97 ? 236 PRO A O     1 
ATOM   1880 C  CB    . PRO A 1 236 ? 87.539  34.886  24.807 1.00 27.79 ? 236 PRO A CB    1 
ATOM   1881 C  CG    . PRO A 1 236 ? 86.743  36.019  24.129 1.00 27.97 ? 236 PRO A CG    1 
ATOM   1882 C  CD    . PRO A 1 236 ? 87.152  37.162  24.941 1.00 25.73 ? 236 PRO A CD    1 
ATOM   1883 N  N     . PRO A 1 237 ? 90.692  34.181  23.979 1.00 26.56 ? 237 PRO A N     1 
ATOM   1884 C  CA    . PRO A 1 237 ? 91.652  33.971  22.878 1.00 26.45 ? 237 PRO A CA    1 
ATOM   1885 C  C     . PRO A 1 237 ? 91.019  33.766  21.510 1.00 29.42 ? 237 PRO A C     1 
ATOM   1886 O  O     . PRO A 1 237 ? 91.660  33.991  20.456 1.00 25.60 ? 237 PRO A O     1 
ATOM   1887 C  CB    . PRO A 1 237 ? 92.510  32.739  23.322 1.00 28.59 ? 237 PRO A CB    1 
ATOM   1888 C  CG    . PRO A 1 237 ? 91.597  32.025  24.347 1.00 28.59 ? 237 PRO A CG    1 
ATOM   1889 C  CD    . PRO A 1 237 ? 90.792  33.133  25.036 1.00 27.11 ? 237 PRO A CD    1 
ATOM   1890 N  N     . PHE A 1 238 ? 89.754  33.352  21.503 1.00 25.08 ? 238 PHE A N     1 
ATOM   1891 C  CA    . PHE A 1 238 ? 89.187  33.041  20.202 1.00 25.72 ? 238 PHE A CA    1 
ATOM   1892 C  C     . PHE A 1 238 ? 87.857  33.764  20.265 1.00 26.42 ? 238 PHE A C     1 
ATOM   1893 O  O     . PHE A 1 238 ? 86.960  33.346  21.040 1.00 29.40 ? 238 PHE A O     1 
ATOM   1894 C  CB    . PHE A 1 238 ? 88.946  31.526  19.991 1.00 20.38 ? 238 PHE A CB    1 
ATOM   1895 C  CG    . PHE A 1 238 ? 90.144  30.672  20.211 1.00 26.53 ? 238 PHE A CG    1 
ATOM   1896 C  CD1   . PHE A 1 238 ? 91.129  30.554  19.209 1.00 20.17 ? 238 PHE A CD1   1 
ATOM   1897 C  CD2   . PHE A 1 238 ? 90.312  30.005  21.404 1.00 26.21 ? 238 PHE A CD2   1 
ATOM   1898 C  CE1   . PHE A 1 238 ? 92.269  29.804  19.412 1.00 20.52 ? 238 PHE A CE1   1 
ATOM   1899 C  CE2   . PHE A 1 238 ? 91.482  29.221  21.629 1.00 29.25 ? 238 PHE A CE2   1 
ATOM   1900 C  CZ    . PHE A 1 238 ? 92.456  29.143  20.622 1.00 23.14 ? 238 PHE A CZ    1 
ATOM   1901 N  N     . PHE A 1 239 ? 87.685  34.691  19.324 1.00 27.21 ? 239 PHE A N     1 
ATOM   1902 C  CA    . PHE A 1 239 ? 86.477  35.491  19.260 1.00 25.12 ? 239 PHE A CA    1 
ATOM   1903 C  C     . PHE A 1 239 ? 86.189  35.875  17.871 1.00 25.75 ? 239 PHE A C     1 
ATOM   1904 O  O     . PHE A 1 239 ? 87.040  35.740  17.032 1.00 25.61 ? 239 PHE A O     1 
ATOM   1905 C  CB    . PHE A 1 239 ? 86.356  36.580  20.336 1.00 25.33 ? 239 PHE A CB    1 
ATOM   1906 C  CG    . PHE A 1 239 ? 87.152  37.815  20.074 1.00 30.75 ? 239 PHE A CG    1 
ATOM   1907 C  CD1   . PHE A 1 239 ? 86.668  38.785  19.153 1.00 25.85 ? 239 PHE A CD1   1 
ATOM   1908 C  CD2   . PHE A 1 239 ? 88.504  37.875  20.537 1.00 29.23 ? 239 PHE A CD2   1 
ATOM   1909 C  CE1   . PHE A 1 239 ? 87.589  39.755  18.655 1.00 26.65 ? 239 PHE A CE1   1 
ATOM   1910 C  CE2   . PHE A 1 239 ? 89.399  38.842  20.041 1.00 27.34 ? 239 PHE A CE2   1 
ATOM   1911 C  CZ    . PHE A 1 239 ? 88.920  39.767  19.080 1.00 20.99 ? 239 PHE A CZ    1 
ATOM   1912 N  N     . ALA A 1 240 ? 84.898  36.073  17.656 1.00 27.10 ? 240 ALA A N     1 
ATOM   1913 C  CA    . ALA A 1 240 ? 84.271  36.494  16.422 1.00 29.54 ? 240 ALA A CA    1 
ATOM   1914 C  C     . ALA A 1 240 ? 82.778  36.764  16.694 1.00 31.87 ? 240 ALA A C     1 
ATOM   1915 O  O     . ALA A 1 240 ? 82.350  36.908  17.871 1.00 34.10 ? 240 ALA A O     1 
ATOM   1916 C  CB    . ALA A 1 240 ? 84.550  35.512  15.236 1.00 30.84 ? 240 ALA A CB    1 
ATOM   1917 N  N     . ASP A 1 241 ? 82.053  37.063  15.625 1.00 32.32 ? 241 ASP A N     1 
ATOM   1918 C  CA    . ASP A 1 241 ? 80.663  37.446  15.737 1.00 40.46 ? 241 ASP A CA    1 
ATOM   1919 C  C     . ASP A 1 241 ? 79.741  36.275  15.751 1.00 43.17 ? 241 ASP A C     1 
ATOM   1920 O  O     . ASP A 1 241 ? 78.661  36.410  16.340 1.00 46.01 ? 241 ASP A O     1 
ATOM   1921 C  CB    . ASP A 1 241 ? 80.198  38.453  14.684 1.00 41.98 ? 241 ASP A CB    1 
ATOM   1922 C  CG    . ASP A 1 241 ? 80.931  39.773  14.769 1.00 47.27 ? 241 ASP A CG    1 
ATOM   1923 O  OD1   . ASP A 1 241 ? 81.353  40.206  15.869 1.00 43.73 ? 241 ASP A OD1   1 
ATOM   1924 O  OD2   . ASP A 1 241 ? 81.225  40.312  13.676 1.00 51.47 ? 241 ASP A OD2   1 
ATOM   1925 N  N     . GLN A 1 242 ? 80.063  35.293  14.912 1.00 43.19 ? 242 GLN A N     1 
ATOM   1926 C  CA    . GLN A 1 242 ? 79.325  34.026  14.833 1.00 44.42 ? 242 GLN A CA    1 
ATOM   1927 C  C     . GLN A 1 242 ? 80.117  32.823  15.384 1.00 43.31 ? 242 GLN A C     1 
ATOM   1928 O  O     . GLN A 1 242 ? 81.346  32.741  15.179 1.00 42.39 ? 242 GLN A O     1 
ATOM   1929 C  CB    . GLN A 1 242 ? 78.978  33.741  13.388 1.00 41.73 ? 242 GLN A CB    1 
ATOM   1930 C  CG    . GLN A 1 242 ? 77.846  34.627  12.844 1.00 50.04 ? 242 GLN A CG    1 
ATOM   1931 C  CD    . GLN A 1 242 ? 76.488  33.957  12.940 0.00 47.71 ? 242 GLN A CD    1 
ATOM   1932 O  OE1   . GLN A 1 242 ? 76.380  32.735  12.859 0.00 49.33 ? 242 GLN A OE1   1 
ATOM   1933 N  NE2   . GLN A 1 242 ? 75.444  34.754  13.103 0.00 49.33 ? 242 GLN A NE2   1 
ATOM   1934 N  N     . PRO A 1 243 ? 79.435  31.869  16.071 1.00 40.93 ? 243 PRO A N     1 
ATOM   1935 C  CA    . PRO A 1 243 ? 80.005  30.625  16.653 1.00 37.60 ? 243 PRO A CA    1 
ATOM   1936 C  C     . PRO A 1 243 ? 80.822  29.729  15.697 1.00 32.50 ? 243 PRO A C     1 
ATOM   1937 O  O     . PRO A 1 243 ? 81.962  29.432  15.958 1.00 23.09 ? 243 PRO A O     1 
ATOM   1938 C  CB    . PRO A 1 243 ? 78.739  29.919  17.136 1.00 38.00 ? 243 PRO A CB    1 
ATOM   1939 C  CG    . PRO A 1 243 ? 78.052  31.102  17.825 1.00 35.69 ? 243 PRO A CG    1 
ATOM   1940 C  CD    . PRO A 1 243 ? 78.096  32.092  16.663 1.00 39.67 ? 243 PRO A CD    1 
ATOM   1941 N  N     . ILE A 1 244 ? 80.378  29.738  14.446 1.00 32.20 ? 244 ILE A N     1 
ATOM   1942 C  CA    . ILE A 1 244 ? 80.936  29.028  13.315 1.00 36.87 ? 244 ILE A CA    1 
ATOM   1943 C  C     . ILE A 1 244 ? 82.369  29.512  13.079 1.00 37.62 ? 244 ILE A C     1 
ATOM   1944 O  O     . ILE A 1 244 ? 83.271  28.705  12.911 1.00 37.40 ? 244 ILE A O     1 
ATOM   1945 C  CB    . ILE A 1 244 ? 80.065  29.188  12.040 1.00 38.15 ? 244 ILE A CB    1 
ATOM   1946 C  CG1   . ILE A 1 244 ? 78.519  29.031  12.243 1.00 44.72 ? 244 ILE A CG1   1 
ATOM   1947 C  CG2   . ILE A 1 244 ? 80.409  28.022  11.156 1.00 40.12 ? 244 ILE A CG2   1 
ATOM   1948 C  CD1   . ILE A 1 244 ? 77.688  30.005  13.247 1.00 34.72 ? 244 ILE A CD1   1 
ATOM   1949 N  N     . GLN A 1 245 ? 82.600  30.792  13.383 1.00 42.45 ? 245 GLN A N     1 
ATOM   1950 C  CA    . GLN A 1 245 ? 83.907  31.453  13.209 1.00 39.68 ? 245 GLN A CA    1 
ATOM   1951 C  C     . GLN A 1 245 ? 84.767  31.183  14.390 1.00 31.23 ? 245 GLN A C     1 
ATOM   1952 O  O     . GLN A 1 245 ? 85.951  31.020  14.211 1.00 37.11 ? 245 GLN A O     1 
ATOM   1953 C  CB    . GLN A 1 245 ? 83.829  32.966  12.921 1.00 46.69 ? 245 GLN A CB    1 
ATOM   1954 C  CG    . GLN A 1 245 ? 82.734  33.403  11.910 1.00 55.76 ? 245 GLN A CG    1 
ATOM   1955 C  CD    . GLN A 1 245 ? 82.274  34.878  12.018 1.00 61.07 ? 245 GLN A CD    1 
ATOM   1956 O  OE1   . GLN A 1 245 ? 82.178  35.497  13.088 1.00 59.12 ? 245 GLN A OE1   1 
ATOM   1957 N  NE2   . GLN A 1 245 ? 81.893  35.416  10.873 1.00 67.40 ? 245 GLN A NE2   1 
ATOM   1958 N  N     . ILE A 1 246 ? 84.226  31.168  15.594 1.00 27.03 ? 246 ILE A N     1 
ATOM   1959 C  CA    . ILE A 1 246 ? 85.048  30.808  16.742 1.00 27.24 ? 246 ILE A CA    1 
ATOM   1960 C  C     . ILE A 1 246 ? 85.613  29.348  16.659 1.00 27.56 ? 246 ILE A C     1 
ATOM   1961 O  O     . ILE A 1 246 ? 86.733  29.076  17.126 1.00 25.65 ? 246 ILE A O     1 
ATOM   1962 C  CB    . ILE A 1 246 ? 84.277  31.014  18.073 1.00 26.16 ? 246 ILE A CB    1 
ATOM   1963 C  CG1   . ILE A 1 246 ? 83.663  32.423  18.147 1.00 28.84 ? 246 ILE A CG1   1 
ATOM   1964 C  CG2   . ILE A 1 246 ? 85.125  30.644  19.342 1.00 22.84 ? 246 ILE A CG2   1 
ATOM   1965 C  CD1   . ILE A 1 246 ? 82.977  32.735  19.483 1.00 24.87 ? 246 ILE A CD1   1 
ATOM   1966 N  N     . TYR A 1 247 ? 84.770  28.398  16.236 1.00 26.28 ? 247 TYR A N     1 
ATOM   1967 C  CA    . TYR A 1 247 ? 85.113  26.968  16.192 1.00 28.29 ? 247 TYR A CA    1 
ATOM   1968 C  C     . TYR A 1 247 ? 86.273  26.766  15.242 1.00 31.83 ? 247 TYR A C     1 
ATOM   1969 O  O     . TYR A 1 247 ? 87.329  26.194  15.625 1.00 35.50 ? 247 TYR A O     1 
ATOM   1970 C  CB    . TYR A 1 247 ? 83.895  26.134  15.756 1.00 30.38 ? 247 TYR A CB    1 
ATOM   1971 C  CG    . TYR A 1 247 ? 82.641  26.293  16.610 1.00 27.53 ? 247 TYR A CG    1 
ATOM   1972 C  CD1   . TYR A 1 247 ? 82.760  26.519  17.979 1.00 22.93 ? 247 TYR A CD1   1 
ATOM   1973 C  CD2   . TYR A 1 247 ? 81.346  26.226  16.049 1.00 27.73 ? 247 TYR A CD2   1 
ATOM   1974 C  CE1   . TYR A 1 247 ? 81.671  26.673  18.809 1.00 22.98 ? 247 TYR A CE1   1 
ATOM   1975 C  CE2   . TYR A 1 247 ? 80.195  26.368  16.910 1.00 31.57 ? 247 TYR A CE2   1 
ATOM   1976 C  CZ    . TYR A 1 247 ? 80.399  26.573  18.299 1.00 26.11 ? 247 TYR A CZ    1 
ATOM   1977 O  OH    . TYR A 1 247 ? 79.436  26.442  19.275 1.00 34.28 ? 247 TYR A OH    1 
ATOM   1978 N  N     . GLU A 1 248 ? 86.113  27.451  14.094 1.00 36.23 ? 248 GLU A N     1 
ATOM   1979 C  CA    . GLU A 1 248 ? 87.092  27.545  13.000 1.00 36.63 ? 248 GLU A CA    1 
ATOM   1980 C  C     . GLU A 1 248 ? 88.408  28.012  13.579 1.00 37.21 ? 248 GLU A C     1 
ATOM   1981 O  O     . GLU A 1 248 ? 89.413  27.311  13.394 1.00 44.61 ? 248 GLU A O     1 
ATOM   1982 C  CB    . GLU A 1 248 ? 86.613  28.484  11.916 1.00 41.16 ? 248 GLU A CB    1 
ATOM   1983 C  CG    . GLU A 1 248 ? 85.441  27.935  11.145 1.00 53.17 ? 248 GLU A CG    1 
ATOM   1984 C  CD    . GLU A 1 248 ? 85.126  28.704  9.870  1.00 58.92 ? 248 GLU A CD    1 
ATOM   1985 O  OE1   . GLU A 1 248 ? 84.644  29.855  9.967  1.00 65.16 ? 248 GLU A OE1   1 
ATOM   1986 O  OE2   . GLU A 1 248 ? 85.319  28.131  8.766  1.00 62.24 ? 248 GLU A OE2   1 
ATOM   1987 N  N     . LYS A 1 249 ? 88.358  28.973  14.502 1.00 29.18 ? 249 LYS A N     1 
ATOM   1988 C  CA    . LYS A 1 249 ? 89.557  29.421  15.158 1.00 29.83 ? 249 LYS A CA    1 
ATOM   1989 C  C     . LYS A 1 249 ? 90.112  28.476  16.178 1.00 33.63 ? 249 LYS A C     1 
ATOM   1990 O  O     . LYS A 1 249 ? 91.359  28.377  16.275 1.00 33.73 ? 249 LYS A O     1 
ATOM   1991 C  CB    . LYS A 1 249 ? 89.398  30.772  15.807 1.00 30.59 ? 249 LYS A CB    1 
ATOM   1992 C  CG    . LYS A 1 249 ? 89.244  31.823  14.789 1.00 32.42 ? 249 LYS A CG    1 
ATOM   1993 C  CD    . LYS A 1 249 ? 89.100  33.026  15.658 1.00 43.99 ? 249 LYS A CD    1 
ATOM   1994 C  CE    . LYS A 1 249 ? 89.070  34.323  14.836 1.00 52.43 ? 249 LYS A CE    1 
ATOM   1995 N  NZ    . LYS A 1 249 ? 87.840  34.415  13.984 1.00 48.45 ? 249 LYS A NZ    1 
ATOM   1996 N  N     . ILE A 1 250 ? 89.221  27.799  16.928 1.00 30.65 ? 250 ILE A N     1 
ATOM   1997 C  CA    . ILE A 1 250 ? 89.667  26.879  18.018 1.00 29.85 ? 250 ILE A CA    1 
ATOM   1998 C  C     . ILE A 1 250 ? 90.558  25.739  17.534 1.00 29.55 ? 250 ILE A C     1 
ATOM   1999 O  O     . ILE A 1 250 ? 91.551  25.470  18.200 1.00 25.74 ? 250 ILE A O     1 
ATOM   2000 C  CB    . ILE A 1 250 ? 88.499  26.351  18.977 1.00 23.30 ? 250 ILE A CB    1 
ATOM   2001 C  CG1   . ILE A 1 250 ? 88.043  27.572  19.840 1.00 27.76 ? 250 ILE A CG1   1 
ATOM   2002 C  CG2   . ILE A 1 250 ? 88.979  25.288  20.033 1.00 18.87 ? 250 ILE A CG2   1 
ATOM   2003 C  CD1   . ILE A 1 250 ? 86.607  27.634  20.127 1.00 33.10 ? 250 ILE A CD1   1 
ATOM   2004 N  N     . VAL A 1 251 ? 90.047  25.075  16.489 1.00 30.61 ? 251 VAL A N     1 
ATOM   2005 C  CA    . VAL A 1 251 ? 90.623  23.922  15.815 1.00 37.10 ? 251 VAL A CA    1 
ATOM   2006 C  C     . VAL A 1 251 ? 91.948  24.209  15.101 1.00 42.04 ? 251 VAL A C     1 
ATOM   2007 O  O     . VAL A 1 251 ? 92.889  23.419  15.293 1.00 43.50 ? 251 VAL A O     1 
ATOM   2008 C  CB    . VAL A 1 251 ? 89.581  23.069  15.013 1.00 35.69 ? 251 VAL A CB    1 
ATOM   2009 C  CG1   . VAL A 1 251 ? 88.399  22.669  15.893 1.00 26.61 ? 251 VAL A CG1   1 
ATOM   2010 C  CG2   . VAL A 1 251 ? 89.036  23.759  13.841 1.00 30.69 ? 251 VAL A CG2   1 
ATOM   2011 N  N     . SER A 1 252 ? 92.065  25.386  14.478 1.00 43.02 ? 252 SER A N     1 
ATOM   2012 C  CA    . SER A 1 252 ? 93.329  25.920  13.937 1.00 50.44 ? 252 SER A CA    1 
ATOM   2013 C  C     . SER A 1 252 ? 94.506  25.846  14.974 1.00 54.30 ? 252 SER A C     1 
ATOM   2014 O  O     . SER A 1 252 ? 95.649  25.498  14.629 1.00 54.74 ? 252 SER A O     1 
ATOM   2015 C  CB    . SER A 1 252 ? 93.116  27.383  13.479 1.00 50.17 ? 252 SER A CB    1 
ATOM   2016 O  OG    . SER A 1 252 ? 93.489  28.373  14.436 1.00 53.09 ? 252 SER A OG    1 
ATOM   2017 N  N     . GLY A 1 253 ? 94.194  26.180  16.234 1.00 57.59 ? 253 GLY A N     1 
ATOM   2018 C  CA    . GLY A 1 253 ? 95.131  26.114  17.348 1.00 59.62 ? 253 GLY A CA    1 
ATOM   2019 C  C     . GLY A 1 253 ? 96.041  27.313  17.604 1.00 61.80 ? 253 GLY A C     1 
ATOM   2020 O  O     . GLY A 1 253 ? 96.663  27.366  18.671 1.00 67.47 ? 253 GLY A O     1 
ATOM   2021 N  N     . LYS A 1 254 ? 95.992  28.326  16.736 1.00 55.25 ? 254 LYS A N     1 
ATOM   2022 C  CA    . LYS A 1 254 ? 96.842  29.511  16.782 1.00 50.72 ? 254 LYS A CA    1 
ATOM   2023 C  C     . LYS A 1 254 ? 96.451  30.552  17.842 1.00 48.22 ? 254 LYS A C     1 
ATOM   2024 O  O     . LYS A 1 254 ? 95.388  31.159  17.779 1.00 50.01 ? 254 LYS A O     1 
ATOM   2025 C  CB    . LYS A 1 254 ? 96.824  30.100  15.383 1.00 51.22 ? 254 LYS A CB    1 
ATOM   2026 C  CG    . LYS A 1 254 ? 97.187  29.089  14.290 1.00 58.21 ? 254 LYS A CG    1 
ATOM   2027 C  CD    . LYS A 1 254 ? 97.735  29.705  13.020 0.00 58.44 ? 254 LYS A CD    1 
ATOM   2028 C  CE    . LYS A 1 254 ? 96.631  30.293  12.182 0.00 58.97 ? 254 LYS A CE    1 
ATOM   2029 N  NZ    . LYS A 1 254 ? 95.935  31.311  12.980 0.00 57.35 ? 254 LYS A NZ    1 
ATOM   2030 N  N     . VAL A 1 255 ? 97.290  30.730  18.846 1.00 44.33 ? 255 VAL A N     1 
ATOM   2031 C  CA    . VAL A 1 255 ? 97.010  31.636  19.965 1.00 46.38 ? 255 VAL A CA    1 
ATOM   2032 C  C     . VAL A 1 255 ? 98.001  32.802  19.833 1.00 45.73 ? 255 VAL A C     1 
ATOM   2033 O  O     . VAL A 1 255 ? 99.128  32.558  19.404 1.00 45.82 ? 255 VAL A O     1 
ATOM   2034 C  CB    . VAL A 1 255 ? 97.181  30.911  21.394 1.00 43.37 ? 255 VAL A CB    1 
ATOM   2035 C  CG1   . VAL A 1 255 ? 96.841  31.813  22.557 1.00 39.83 ? 255 VAL A CG1   1 
ATOM   2036 C  CG2   . VAL A 1 255 ? 96.236  29.755  21.556 1.00 47.14 ? 255 VAL A CG2   1 
ATOM   2037 N  N     . ARG A 1 256 ? 97.562  34.052  20.047 1.00 41.72 ? 256 ARG A N     1 
ATOM   2038 C  CA    . ARG A 1 256 ? 98.467  35.220  20.073 1.00 36.00 ? 256 ARG A CA    1 
ATOM   2039 C  C     . ARG A 1 256 ? 98.373  35.852  21.454 1.00 29.80 ? 256 ARG A C     1 
ATOM   2040 O  O     . ARG A 1 256 ? 97.294  36.033  21.966 1.00 33.67 ? 256 ARG A O     1 
ATOM   2041 C  CB    . ARG A 1 256 ? 98.080  36.207  18.976 1.00 37.19 ? 256 ARG A CB    1 
ATOM   2042 C  CG    . ARG A 1 256 ? 98.517  35.811  17.585 1.00 43.52 ? 256 ARG A CG    1 
ATOM   2043 C  CD    . ARG A 1 256 ? 98.238  36.862  16.589 0.00 52.89 ? 256 ARG A CD    1 
ATOM   2044 N  NE    . ARG A 1 256 ? 99.247  37.903  16.648 0.00 59.03 ? 256 ARG A NE    1 
ATOM   2045 C  CZ    . ARG A 1 256 ? 99.250  38.946  15.835 0.00 62.93 ? 256 ARG A CZ    1 
ATOM   2046 N  NH1   . ARG A 1 256 ? 98.302  39.062  14.915 0.00 63.71 ? 256 ARG A NH1   1 
ATOM   2047 N  NH2   . ARG A 1 256 ? 100.197 39.859  15.943 0.00 63.71 ? 256 ARG A NH2   1 
ATOM   2048 N  N     . PHE A 1 257 ? 99.438  35.928  22.210 1.00 25.89 ? 257 PHE A N     1 
ATOM   2049 C  CA    . PHE A 1 257 ? 99.310  36.538  23.513 1.00 32.95 ? 257 PHE A CA    1 
ATOM   2050 C  C     . PHE A 1 257 ? 99.565  38.083  23.543 1.00 37.51 ? 257 PHE A C     1 
ATOM   2051 O  O     . PHE A 1 257 ? 100.364 38.648  22.754 1.00 38.51 ? 257 PHE A O     1 
ATOM   2052 C  CB    . PHE A 1 257 ? 100.257 35.877  24.523 1.00 37.00 ? 257 PHE A CB    1 
ATOM   2053 C  CG    . PHE A 1 257 ? 100.108 34.406  24.654 1.00 46.58 ? 257 PHE A CG    1 
ATOM   2054 C  CD1   . PHE A 1 257 ? 98.977  33.833  25.287 1.00 46.74 ? 257 PHE A CD1   1 
ATOM   2055 C  CD2   . PHE A 1 257 ? 101.111 33.547  24.142 1.00 51.89 ? 257 PHE A CD2   1 
ATOM   2056 C  CE1   . PHE A 1 257 ? 98.831  32.435  25.410 1.00 41.44 ? 257 PHE A CE1   1 
ATOM   2057 C  CE2   . PHE A 1 257 ? 100.985 32.103  24.256 1.00 46.57 ? 257 PHE A CE2   1 
ATOM   2058 C  CZ    . PHE A 1 257 ? 99.837  31.572  24.897 1.00 46.35 ? 257 PHE A CZ    1 
ATOM   2059 N  N     . PRO A 1 258 ? 98.837  38.807  24.418 1.00 36.44 ? 258 PRO A N     1 
ATOM   2060 C  CA    . PRO A 1 258 ? 99.103  40.245  24.516 1.00 39.28 ? 258 PRO A CA    1 
ATOM   2061 C  C     . PRO A 1 258 ? 100.562 40.412  24.985 1.00 40.44 ? 258 PRO A C     1 
ATOM   2062 O  O     . PRO A 1 258 ? 101.106 39.510  25.623 1.00 41.81 ? 258 PRO A O     1 
ATOM   2063 C  CB    . PRO A 1 258 ? 98.140  40.664  25.645 1.00 40.38 ? 258 PRO A CB    1 
ATOM   2064 C  CG    . PRO A 1 258 ? 96.979  39.815  25.439 1.00 34.76 ? 258 PRO A CG    1 
ATOM   2065 C  CD    . PRO A 1 258 ? 97.589  38.475  25.130 1.00 30.48 ? 258 PRO A CD    1 
ATOM   2066 N  N     . SER A 1 259 ? 101.224 41.494  24.577 1.00 41.05 ? 259 SER A N     1 
ATOM   2067 C  CA    . SER A 1 259 ? 102.617 41.815  24.970 1.00 37.65 ? 259 SER A CA    1 
ATOM   2068 C  C     . SER A 1 259 ? 102.867 41.883  26.466 1.00 36.14 ? 259 SER A C     1 
ATOM   2069 O  O     . SER A 1 259 ? 103.899 41.383  26.918 1.00 37.88 ? 259 SER A O     1 
ATOM   2070 C  CB    . SER A 1 259 ? 103.140 43.091  24.296 1.00 35.11 ? 259 SER A CB    1 
ATOM   2071 O  OG    . SER A 1 259 ? 102.117 44.079  24.336 1.00 43.78 ? 259 SER A OG    1 
ATOM   2072 N  N     . HIS A 1 260 ? 101.861 42.320  27.233 1.00 33.09 ? 260 HIS A N     1 
ATOM   2073 C  CA    . HIS A 1 260 ? 101.959 42.438  28.682 1.00 30.83 ? 260 HIS A CA    1 
ATOM   2074 C  C     . HIS A 1 260 ? 101.904 41.119  29.462 1.00 29.47 ? 260 HIS A C     1 
ATOM   2075 O  O     . HIS A 1 260 ? 102.090 41.164  30.685 1.00 29.62 ? 260 HIS A O     1 
ATOM   2076 C  CB    . HIS A 1 260 ? 100.898 43.388  29.259 1.00 32.61 ? 260 HIS A CB    1 
ATOM   2077 C  CG    . HIS A 1 260 ? 99.499  42.856  29.159 1.00 37.64 ? 260 HIS A CG    1 
ATOM   2078 N  ND1   . HIS A 1 260 ? 98.937  42.094  30.163 1.00 40.37 ? 260 HIS A ND1   1 
ATOM   2079 C  CD2   . HIS A 1 260 ? 98.515  43.082  28.252 1.00 37.83 ? 260 HIS A CD2   1 
ATOM   2080 C  CE1   . HIS A 1 260 ? 97.658  41.911  29.899 1.00 43.45 ? 260 HIS A CE1   1 
ATOM   2081 N  NE2   . HIS A 1 260 ? 97.376  42.504  28.750 1.00 42.57 ? 260 HIS A NE2   1 
ATOM   2082 N  N     . PHE A 1 261 ? 101.553 39.990  28.833 1.00 29.75 ? 261 PHE A N     1 
ATOM   2083 C  CA    . PHE A 1 261 ? 101.529 38.723  29.607 1.00 32.00 ? 261 PHE A CA    1 
ATOM   2084 C  C     . PHE A 1 261 ? 102.970 38.338  29.912 1.00 32.05 ? 261 PHE A C     1 
ATOM   2085 O  O     . PHE A 1 261 ? 103.794 38.353  28.983 1.00 30.73 ? 261 PHE A O     1 
ATOM   2086 C  CB    . PHE A 1 261 ? 100.995 37.540  28.784 1.00 33.60 ? 261 PHE A CB    1 
ATOM   2087 C  CG    . PHE A 1 261 ? 99.502  37.395  28.737 1.00 32.31 ? 261 PHE A CG    1 
ATOM   2088 C  CD1   . PHE A 1 261 ? 98.626  38.411  29.158 1.00 33.42 ? 261 PHE A CD1   1 
ATOM   2089 C  CD2   . PHE A 1 261 ? 98.962  36.211  28.195 1.00 35.13 ? 261 PHE A CD2   1 
ATOM   2090 C  CE1   . PHE A 1 261 ? 97.207  38.250  29.054 1.00 36.52 ? 261 PHE A CE1   1 
ATOM   2091 C  CE2   . PHE A 1 261 ? 97.522  36.019  28.058 1.00 28.79 ? 261 PHE A CE2   1 
ATOM   2092 C  CZ    . PHE A 1 261 ? 96.638  37.049  28.501 1.00 34.74 ? 261 PHE A CZ    1 
ATOM   2093 N  N     . SER A 1 262 ? 103.223 37.909  31.140 1.00 28.77 ? 262 SER A N     1 
ATOM   2094 C  CA    . SER A 1 262 ? 104.515 37.378  31.504 1.00 32.74 ? 262 SER A CA    1 
ATOM   2095 C  C     . SER A 1 262 ? 104.855 36.134  30.688 1.00 35.33 ? 262 SER A C     1 
ATOM   2096 O  O     . SER A 1 262 ? 104.027 35.556  29.991 1.00 37.83 ? 262 SER A O     1 
ATOM   2097 C  CB    . SER A 1 262 ? 104.569 37.065  32.986 1.00 36.88 ? 262 SER A CB    1 
ATOM   2098 O  OG    . SER A 1 262 ? 103.641 36.043  33.298 1.00 40.73 ? 262 SER A OG    1 
ATOM   2099 N  N     . SER A 1 263 ? 106.141 35.824  30.600 1.00 39.17 ? 263 SER A N     1 
ATOM   2100 C  CA    . SER A 1 263 ? 106.609 34.638  29.869 1.00 36.57 ? 263 SER A CA    1 
ATOM   2101 C  C     . SER A 1 263 ? 106.143 33.414  30.662 1.00 30.28 ? 263 SER A C     1 
ATOM   2102 O  O     . SER A 1 263 ? 105.783 32.463  30.010 1.00 33.33 ? 263 SER A O     1 
ATOM   2103 C  CB    . SER A 1 263 ? 108.119 34.655  29.634 1.00 37.38 ? 263 SER A CB    1 
ATOM   2104 O  OG    . SER A 1 263 ? 108.710 35.536  30.593 1.00 52.49 ? 263 SER A OG    1 
ATOM   2105 N  N     . ASP A 1 264 ? 106.070 33.494  32.001 1.00 27.46 ? 264 ASP A N     1 
ATOM   2106 C  CA    . ASP A 1 264 ? 105.516 32.435  32.851 1.00 30.27 ? 264 ASP A CA    1 
ATOM   2107 C  C     . ASP A 1 264 ? 104.007 32.233  32.549 1.00 32.78 ? 264 ASP A C     1 
ATOM   2108 O  O     . ASP A 1 264 ? 103.591 31.072  32.455 1.00 31.86 ? 264 ASP A O     1 
ATOM   2109 C  CB    . ASP A 1 264 ? 105.634 32.704  34.344 1.00 28.47 ? 264 ASP A CB    1 
ATOM   2110 C  CG    . ASP A 1 264 ? 107.025 32.483  34.896 1.00 40.91 ? 264 ASP A CG    1 
ATOM   2111 O  OD1   . ASP A 1 264 ? 107.743 31.537  34.474 1.00 41.54 ? 264 ASP A OD1   1 
ATOM   2112 O  OD2   . ASP A 1 264 ? 107.363 33.235  35.842 1.00 39.67 ? 264 ASP A OD2   1 
ATOM   2113 N  N     . LEU A 1 265 ? 103.262 33.308  32.225 1.00 29.54 ? 265 LEU A N     1 
ATOM   2114 C  CA    . LEU A 1 265 ? 101.868 33.172  31.888 1.00 26.35 ? 265 LEU A CA    1 
ATOM   2115 C  C     . LEU A 1 265 ? 101.712 32.571  30.516 1.00 29.78 ? 265 LEU A C     1 
ATOM   2116 O  O     . LEU A 1 265 ? 100.975 31.609  30.332 1.00 28.93 ? 265 LEU A O     1 
ATOM   2117 C  CB    . LEU A 1 265 ? 101.083 34.464  32.073 1.00 30.64 ? 265 LEU A CB    1 
ATOM   2118 C  CG    . LEU A 1 265 ? 99.588  34.417  31.682 1.00 37.06 ? 265 LEU A CG    1 
ATOM   2119 C  CD1   . LEU A 1 265 ? 98.939  33.301  32.540 1.00 41.90 ? 265 LEU A CD1   1 
ATOM   2120 C  CD2   . LEU A 1 265 ? 98.792  35.740  31.869 1.00 37.20 ? 265 LEU A CD2   1 
ATOM   2121 N  N     . LYS A 1 266 ? 102.544 32.992  29.581 1.00 30.40 ? 266 LYS A N     1 
ATOM   2122 C  CA    . LYS A 1 266 ? 102.456 32.496  28.223 1.00 30.40 ? 266 LYS A CA    1 
ATOM   2123 C  C     . LYS A 1 266 ? 102.831 31.000  28.204 1.00 31.46 ? 266 LYS A C     1 
ATOM   2124 O  O     . LYS A 1 266 ? 102.251 30.214  27.444 1.00 34.03 ? 266 LYS A O     1 
ATOM   2125 C  CB    . LYS A 1 266 ? 103.357 33.321  27.257 1.00 36.56 ? 266 LYS A CB    1 
ATOM   2126 C  CG    . LYS A 1 266 ? 102.986 34.786  26.935 1.00 38.53 ? 266 LYS A CG    1 
ATOM   2127 C  CD    . LYS A 1 266 ? 104.051 35.435  26.059 1.00 47.86 ? 266 LYS A CD    1 
ATOM   2128 C  CE    . LYS A 1 266 ? 103.651 36.700  25.192 1.00 57.47 ? 266 LYS A CE    1 
ATOM   2129 N  NZ    . LYS A 1 266 ? 103.836 38.196  25.509 1.00 54.15 ? 266 LYS A NZ    1 
ATOM   2130 N  N     . ASP A 1 267 ? 103.751 30.605  29.075 1.00 30.39 ? 267 ASP A N     1 
ATOM   2131 C  CA    . ASP A 1 267 ? 104.230 29.228  29.117 1.00 31.94 ? 267 ASP A CA    1 
ATOM   2132 C  C     . ASP A 1 267 ? 103.118 28.244  29.530 1.00 30.22 ? 267 ASP A C     1 
ATOM   2133 O  O     . ASP A 1 267 ? 102.845 27.227  28.842 1.00 27.88 ? 267 ASP A O     1 
ATOM   2134 C  CB    . ASP A 1 267 ? 105.375 29.217  30.120 1.00 37.33 ? 267 ASP A CB    1 
ATOM   2135 C  CG    . ASP A 1 267 ? 106.129 27.899  30.140 1.00 41.71 ? 267 ASP A CG    1 
ATOM   2136 O  OD1   . ASP A 1 267 ? 106.411 27.258  29.098 1.00 35.51 ? 267 ASP A OD1   1 
ATOM   2137 O  OD2   . ASP A 1 267 ? 106.562 27.607  31.264 1.00 48.88 ? 267 ASP A OD2   1 
ATOM   2138 N  N     . LEU A 1 268 ? 102.508 28.581  30.669 1.00 28.67 ? 268 LEU A N     1 
ATOM   2139 C  CA    . LEU A 1 268 ? 101.367 27.863  31.200 1.00 29.85 ? 268 LEU A CA    1 
ATOM   2140 C  C     . LEU A 1 268 ? 100.197 27.762  30.189 1.00 34.03 ? 268 LEU A C     1 
ATOM   2141 O  O     . LEU A 1 268 ? 99.671  26.657  29.935 1.00 41.15 ? 268 LEU A O     1 
ATOM   2142 C  CB    . LEU A 1 268 ? 100.933 28.475  32.524 1.00 27.38 ? 268 LEU A CB    1 
ATOM   2143 C  CG    . LEU A 1 268 ? 99.661  27.786  33.110 1.00 32.97 ? 268 LEU A CG    1 
ATOM   2144 C  CD1   . LEU A 1 268 ? 99.889  26.267  33.558 1.00 24.17 ? 268 LEU A CD1   1 
ATOM   2145 C  CD2   . LEU A 1 268 ? 99.078  28.751  34.224 1.00 22.16 ? 268 LEU A CD2   1 
ATOM   2146 N  N     . LEU A 1 269 ? 99.827  28.867  29.550 1.00 30.74 ? 269 LEU A N     1 
ATOM   2147 C  CA    . LEU A 1 269 ? 98.731  28.862  28.594 1.00 24.22 ? 269 LEU A CA    1 
ATOM   2148 C  C     . LEU A 1 269 ? 99.010  28.056  27.371 1.00 27.17 ? 269 LEU A C     1 
ATOM   2149 O  O     . LEU A 1 269 ? 98.077  27.518  26.784 1.00 22.63 ? 269 LEU A O     1 
ATOM   2150 C  CB    . LEU A 1 269 ? 98.393  30.296  28.182 1.00 27.81 ? 269 LEU A CB    1 
ATOM   2151 C  CG    . LEU A 1 269 ? 97.819  31.163  29.294 1.00 31.15 ? 269 LEU A CG    1 
ATOM   2152 C  CD1   . LEU A 1 269 ? 97.494  32.520  28.694 1.00 27.33 ? 269 LEU A CD1   1 
ATOM   2153 C  CD2   . LEU A 1 269 ? 96.544  30.486  29.904 1.00 31.68 ? 269 LEU A CD2   1 
ATOM   2154 N  N     . ARG A 1 270 ? 100.271 28.050  26.905 1.00 28.87 ? 270 ARG A N     1 
ATOM   2155 C  CA    . ARG A 1 270 ? 100.634 27.205  25.752 1.00 28.54 ? 270 ARG A CA    1 
ATOM   2156 C  C     . ARG A 1 270 ? 100.472 25.718  26.135 1.00 26.32 ? 270 ARG A C     1 
ATOM   2157 O  O     . ARG A 1 270 ? 100.045 24.921  25.307 1.00 32.44 ? 270 ARG A O     1 
ATOM   2158 C  CB    . ARG A 1 270 ? 102.059 27.430  25.278 1.00 28.95 ? 270 ARG A CB    1 
ATOM   2159 C  CG    . ARG A 1 270 ? 102.247 28.737  24.692 1.00 37.22 ? 270 ARG A CG    1 
ATOM   2160 C  CD    . ARG A 1 270 ? 103.658 29.141  24.988 1.00 41.56 ? 270 ARG A CD    1 
ATOM   2161 N  NE    . ARG A 1 270 ? 104.005 30.151  24.004 1.00 45.26 ? 270 ARG A NE    1 
ATOM   2162 C  CZ    . ARG A 1 270 ? 104.843 31.163  24.177 1.00 44.41 ? 270 ARG A CZ    1 
ATOM   2163 N  NH1   . ARG A 1 270 ? 105.582 31.293  25.268 1.00 46.05 ? 270 ARG A NH1   1 
ATOM   2164 N  NH2   . ARG A 1 270 ? 105.004 31.980  23.157 1.00 48.56 ? 270 ARG A NH2   1 
ATOM   2165 N  N     . ASN A 1 271 ? 100.714 25.404  27.407 1.00 26.85 ? 271 ASN A N     1 
ATOM   2166 C  CA    . ASN A 1 271 ? 100.503 24.093  27.987 1.00 29.36 ? 271 ASN A CA    1 
ATOM   2167 C  C     . ASN A 1 271 ? 99.050  23.632  28.209 1.00 35.46 ? 271 ASN A C     1 
ATOM   2168 O  O     . ASN A 1 271 ? 98.753  22.453  28.019 1.00 37.40 ? 271 ASN A O     1 
ATOM   2169 C  CB    . ASN A 1 271 ? 101.360 23.978  29.217 1.00 27.51 ? 271 ASN A CB    1 
ATOM   2170 C  CG    . ASN A 1 271 ? 102.828 23.745  28.836 1.00 34.64 ? 271 ASN A CG    1 
ATOM   2171 O  OD1   . ASN A 1 271 ? 103.752 24.445  29.267 1.00 33.78 ? 271 ASN A OD1   1 
ATOM   2172 N  ND2   . ASN A 1 271 ? 103.022 22.829  27.907 1.00 28.57 ? 271 ASN A ND2   1 
ATOM   2173 N  N     . LEU A 1 272 ? 98.122  24.584  28.360 1.00 35.52 ? 272 LEU A N     1 
ATOM   2174 C  CA    . LEU A 1 272 ? 96.706  24.319  28.590 1.00 26.40 ? 272 LEU A CA    1 
ATOM   2175 C  C     . LEU A 1 272 ? 95.965  24.431  27.333 1.00 25.45 ? 272 LEU A C     1 
ATOM   2176 O  O     . LEU A 1 272 ? 95.058  23.635  27.119 1.00 21.98 ? 272 LEU A O     1 
ATOM   2177 C  CB    . LEU A 1 272 ? 96.112  25.296  29.584 1.00 30.05 ? 272 LEU A CB    1 
ATOM   2178 C  CG    . LEU A 1 272 ? 96.669  25.322  30.974 1.00 26.73 ? 272 LEU A CG    1 
ATOM   2179 C  CD1   . LEU A 1 272 ? 96.129  26.505  31.785 1.00 29.26 ? 272 LEU A CD1   1 
ATOM   2180 C  CD2   . LEU A 1 272 ? 96.242  23.973  31.536 1.00 30.03 ? 272 LEU A CD2   1 
ATOM   2181 N  N     . LEU A 1 273 ? 96.336  25.417  26.509 1.00 26.69 ? 273 LEU A N     1 
ATOM   2182 C  CA    . LEU A 1 273 ? 95.745  25.645  25.184 1.00 27.43 ? 273 LEU A CA    1 
ATOM   2183 C  C     . LEU A 1 273 ? 96.431  24.832  24.093 1.00 29.82 ? 273 LEU A C     1 
ATOM   2184 O  O     . LEU A 1 273 ? 96.308  25.099  22.909 1.00 31.42 ? 273 LEU A O     1 
ATOM   2185 C  CB    . LEU A 1 273 ? 95.581  27.140  24.843 1.00 31.38 ? 273 LEU A CB    1 
ATOM   2186 C  CG    . LEU A 1 273 ? 94.748  27.987  25.846 1.00 34.75 ? 273 LEU A CG    1 
ATOM   2187 C  CD1   . LEU A 1 273 ? 94.755  29.478  25.575 1.00 28.23 ? 273 LEU A CD1   1 
ATOM   2188 C  CD2   . LEU A 1 273 ? 93.298  27.440  25.933 1.00 31.26 ? 273 LEU A CD2   1 
ATOM   2189 N  N     . GLN A 1 274 ? 96.742  23.609  24.528 1.00 32.87 ? 274 GLN A N     1 
ATOM   2190 C  CA    . GLN A 1 274 ? 97.344  22.544  23.773 1.00 26.74 ? 274 GLN A CA    1 
ATOM   2191 C  C     . GLN A 1 274 ? 96.281  21.719  23.073 1.00 23.15 ? 274 GLN A C     1 
ATOM   2192 O  O     . GLN A 1 274 ? 95.548  21.018  23.688 1.00 32.45 ? 274 GLN A O     1 
ATOM   2193 C  CB    . GLN A 1 274 ? 98.181  21.763  24.766 1.00 33.20 ? 274 GLN A CB    1 
ATOM   2194 C  CG    . GLN A 1 274 ? 98.861  20.599  24.150 1.00 41.03 ? 274 GLN A CG    1 
ATOM   2195 C  CD    . GLN A 1 274 ? 99.890  21.000  23.149 1.00 36.02 ? 274 GLN A CD    1 
ATOM   2196 O  OE1   . GLN A 1 274 ? 99.633  21.047  21.926 1.00 38.40 ? 274 GLN A OE1   1 
ATOM   2197 N  NE2   . GLN A 1 274 ? 101.013 21.411  23.679 1.00 36.70 ? 274 GLN A NE2   1 
ATOM   2198 N  N     . VAL A 1 275 ? 96.202  21.812  21.766 1.00 24.47 ? 275 VAL A N     1 
ATOM   2199 C  CA    . VAL A 1 275 ? 95.207  21.204  20.913 1.00 33.87 ? 275 VAL A CA    1 
ATOM   2200 C  C     . VAL A 1 275 ? 95.254  19.645  20.869 1.00 39.04 ? 275 VAL A C     1 
ATOM   2201 O  O     . VAL A 1 275 ? 94.203  19.013  20.762 1.00 41.52 ? 275 VAL A O     1 
ATOM   2202 C  CB    . VAL A 1 275 ? 95.274  21.944  19.567 1.00 28.97 ? 275 VAL A CB    1 
ATOM   2203 C  CG1   . VAL A 1 275 ? 96.158  21.249  18.579 1.00 35.85 ? 275 VAL A CG1   1 
ATOM   2204 C  CG2   . VAL A 1 275 ? 93.956  22.143  18.929 1.00 35.07 ? 275 VAL A CG2   1 
ATOM   2205 N  N     . ASP A 1 276 ? 96.430  19.096  21.191 1.00 40.28 ? 276 ASP A N     1 
ATOM   2206 C  CA    . ASP A 1 276 ? 96.788  17.698  21.211 1.00 41.14 ? 276 ASP A CA    1 
ATOM   2207 C  C     . ASP A 1 276 ? 96.570  17.359  22.669 1.00 39.73 ? 276 ASP A C     1 
ATOM   2208 O  O     . ASP A 1 276 ? 97.383  17.748  23.514 1.00 37.29 ? 276 ASP A O     1 
ATOM   2209 C  CB    . ASP A 1 276 ? 98.266  17.645  20.798 1.00 50.30 ? 276 ASP A CB    1 
ATOM   2210 C  CG    . ASP A 1 276 ? 98.904  16.249  20.892 1.00 59.70 ? 276 ASP A CG    1 
ATOM   2211 O  OD1   . ASP A 1 276 ? 98.229  15.252  20.506 1.00 61.95 ? 276 ASP A OD1   1 
ATOM   2212 O  OD2   . ASP A 1 276 ? 100.100 16.174  21.318 1.00 61.82 ? 276 ASP A OD2   1 
ATOM   2213 N  N     . LEU A 1 277 ? 95.419  16.734  22.972 1.00 44.77 ? 277 LEU A N     1 
ATOM   2214 C  CA    . LEU A 1 277 ? 94.992  16.346  24.351 1.00 45.80 ? 277 LEU A CA    1 
ATOM   2215 C  C     . LEU A 1 277 ? 95.977  15.448  25.138 1.00 47.81 ? 277 LEU A C     1 
ATOM   2216 O  O     . LEU A 1 277 ? 95.933  15.414  26.369 1.00 47.01 ? 277 LEU A O     1 
ATOM   2217 C  CB    . LEU A 1 277 ? 93.518  15.903  24.446 1.00 39.31 ? 277 LEU A CB    1 
ATOM   2218 C  CG    . LEU A 1 277 ? 93.219  14.462  24.051 1.00 37.04 ? 277 LEU A CG    1 
ATOM   2219 C  CD1   . LEU A 1 277 ? 93.032  13.690  25.304 1.00 43.33 ? 277 LEU A CD1   1 
ATOM   2220 C  CD2   . LEU A 1 277 ? 91.960  14.260  23.197 1.00 37.27 ? 277 LEU A CD2   1 
ATOM   2221 N  N     . THR A 1 278 ? 96.932  14.912  24.370 1.00 48.64 ? 278 THR A N     1 
ATOM   2222 C  CA    . THR A 1 278 ? 98.092  14.098  24.713 1.00 53.23 ? 278 THR A CA    1 
ATOM   2223 C  C     . THR A 1 278 ? 99.160  14.931  25.410 1.00 53.31 ? 278 THR A C     1 
ATOM   2224 O  O     . THR A 1 278 ? 99.918  14.388  26.221 1.00 53.83 ? 278 THR A O     1 
ATOM   2225 C  CB    . THR A 1 278 ? 98.702  13.615  23.362 1.00 58.70 ? 278 THR A CB    1 
ATOM   2226 O  OG1   . THR A 1 278 ? 97.792  12.683  22.760 1.00 64.70 ? 278 THR A OG1   1 
ATOM   2227 C  CG2   . THR A 1 278 ? 100.214 13.175  23.359 1.00 53.98 ? 278 THR A CG2   1 
ATOM   2228 N  N     . LYS A 1 279 ? 99.409  16.118  24.844 1.00 52.64 ? 279 LYS A N     1 
ATOM   2229 C  CA    . LYS A 1 279 ? 100.373 17.075  25.370 1.00 45.94 ? 279 LYS A CA    1 
ATOM   2230 C  C     . LYS A 1 279 ? 99.803  18.044  26.377 1.00 41.82 ? 279 LYS A C     1 
ATOM   2231 O  O     . LYS A 1 279 ? 100.623 18.649  27.060 1.00 39.47 ? 279 LYS A O     1 
ATOM   2232 C  CB    . LYS A 1 279 ? 101.043 17.830  24.237 1.00 50.45 ? 279 LYS A CB    1 
ATOM   2233 C  CG    . LYS A 1 279 ? 102.117 17.026  23.541 0.00 53.69 ? 279 LYS A CG    1 
ATOM   2234 C  CD    . LYS A 1 279 ? 102.738 17.774  22.380 0.00 56.81 ? 279 LYS A CD    1 
ATOM   2235 C  CE    . LYS A 1 279 ? 103.716 16.874  21.645 0.00 58.29 ? 279 LYS A CE    1 
ATOM   2236 N  NZ    . LYS A 1 279 ? 104.317 17.539  20.466 0.00 59.91 ? 279 LYS A NZ    1 
ATOM   2237 N  N     . ARG A 1 280 ? 98.458  18.132  26.494 1.00 37.78 ? 280 ARG A N     1 
ATOM   2238 C  CA    . ARG A 1 280 ? 97.719  19.034  27.405 1.00 30.12 ? 280 ARG A CA    1 
ATOM   2239 C  C     . ARG A 1 280 ? 97.971  18.852  28.870 1.00 30.31 ? 280 ARG A C     1 
ATOM   2240 O  O     . ARG A 1 280 ? 97.745  17.764  29.404 1.00 38.98 ? 280 ARG A O     1 
ATOM   2241 C  CB    . ARG A 1 280 ? 96.195  19.021  27.174 1.00 29.85 ? 280 ARG A CB    1 
ATOM   2242 C  CG    . ARG A 1 280 ? 95.493  20.300  27.728 1.00 21.94 ? 280 ARG A CG    1 
ATOM   2243 C  CD    . ARG A 1 280 ? 94.009  20.546  27.366 1.00 14.43 ? 280 ARG A CD    1 
ATOM   2244 N  NE    . ARG A 1 280 ? 93.860  20.350  25.926 1.00 17.70 ? 280 ARG A NE    1 
ATOM   2245 C  CZ    . ARG A 1 280 ? 92.858  19.711  25.356 1.00 20.55 ? 280 ARG A CZ    1 
ATOM   2246 N  NH1   . ARG A 1 280 ? 91.782  19.386  26.091 1.00 24.69 ? 280 ARG A NH1   1 
ATOM   2247 N  NH2   . ARG A 1 280 ? 92.872  19.549  24.046 1.00 17.97 ? 280 ARG A NH2   1 
ATOM   2248 N  N     . PHE A 1 281 ? 98.365  19.922  29.550 1.00 25.89 ? 281 PHE A N     1 
ATOM   2249 C  CA    . PHE A 1 281 ? 98.609  19.896  30.960 1.00 24.98 ? 281 PHE A CA    1 
ATOM   2250 C  C     . PHE A 1 281 ? 97.295  19.511  31.633 1.00 31.31 ? 281 PHE A C     1 
ATOM   2251 O  O     . PHE A 1 281 ? 96.248  19.915  31.079 1.00 28.09 ? 281 PHE A O     1 
ATOM   2252 C  CB    . PHE A 1 281 ? 98.992  21.300  31.414 1.00 27.98 ? 281 PHE A CB    1 
ATOM   2253 C  CG    . PHE A 1 281 ? 100.472 21.458  31.725 1.00 32.61 ? 281 PHE A CG    1 
ATOM   2254 C  CD1   . PHE A 1 281 ? 101.470 20.794  30.929 1.00 31.98 ? 281 PHE A CD1   1 
ATOM   2255 C  CD2   . PHE A 1 281 ? 100.854 22.271  32.806 1.00 26.97 ? 281 PHE A CD2   1 
ATOM   2256 C  CE1   . PHE A 1 281 ? 102.830 20.931  31.238 1.00 35.17 ? 281 PHE A CE1   1 
ATOM   2257 C  CE2   . PHE A 1 281 ? 102.213 22.427  33.142 1.00 33.90 ? 281 PHE A CE2   1 
ATOM   2258 C  CZ    . PHE A 1 281 ? 103.210 21.751  32.377 1.00 27.20 ? 281 PHE A CZ    1 
ATOM   2259 N  N     . GLY A 1 282 ? 97.362  18.884  32.821 1.00 26.75 ? 282 GLY A N     1 
ATOM   2260 C  CA    . GLY A 1 282 ? 96.195  18.352  33.508 1.00 28.54 ? 282 GLY A CA    1 
ATOM   2261 C  C     . GLY A 1 282 ? 95.739  16.957  33.026 1.00 29.86 ? 282 GLY A C     1 
ATOM   2262 O  O     . GLY A 1 282 ? 95.120  16.274  33.839 1.00 32.94 ? 282 GLY A O     1 
ATOM   2263 N  N     . ASN A 1 283 ? 96.095  16.537  31.804 1.00 32.55 ? 283 ASN A N     1 
ATOM   2264 C  CA    . ASN A 1 283 ? 95.901  15.211  31.191 1.00 36.20 ? 283 ASN A CA    1 
ATOM   2265 C  C     . ASN A 1 283 ? 97.186  14.346  31.018 1.00 39.21 ? 283 ASN A C     1 
ATOM   2266 O  O     . ASN A 1 283 ? 97.261  13.420  30.204 1.00 39.03 ? 283 ASN A O     1 
ATOM   2267 C  CB    . ASN A 1 283 ? 95.316  15.386  29.810 1.00 32.11 ? 283 ASN A CB    1 
ATOM   2268 C  CG    . ASN A 1 283 ? 94.553  14.168  29.347 1.00 31.73 ? 283 ASN A CG    1 
ATOM   2269 O  OD1   . ASN A 1 283 ? 94.681  13.789  28.194 1.00 34.78 ? 283 ASN A OD1   1 
ATOM   2270 N  ND2   . ASN A 1 283 ? 93.879  13.489  30.245 1.00 25.05 ? 283 ASN A ND2   1 
ATOM   2271 N  N     . LEU A 1 284 ? 98.289  14.763  31.630 1.00 44.55 ? 284 LEU A N     1 
ATOM   2272 C  CA    . LEU A 1 284 ? 99.543  14.011  31.536 1.00 42.92 ? 284 LEU A CA    1 
ATOM   2273 C  C     . LEU A 1 284 ? 99.646  13.096  32.783 1.00 45.49 ? 284 LEU A C     1 
ATOM   2274 O  O     . LEU A 1 284 ? 98.794  13.154  33.712 1.00 40.91 ? 284 LEU A O     1 
ATOM   2275 C  CB    . LEU A 1 284 ? 100.736 14.957  31.295 1.00 38.24 ? 284 LEU A CB    1 
ATOM   2276 C  CG    . LEU A 1 284 ? 100.699 15.895  30.076 1.00 28.72 ? 284 LEU A CG    1 
ATOM   2277 C  CD1   . LEU A 1 284 ? 101.748 16.895  30.241 1.00 35.69 ? 284 LEU A CD1   1 
ATOM   2278 C  CD2   . LEU A 1 284 ? 101.006 15.319  28.814 1.00 31.16 ? 284 LEU A CD2   1 
ATOM   2279 N  N     . LYS A 1 285 ? 100.678 12.237  32.772 1.00 46.32 ? 285 LYS A N     1 
ATOM   2280 C  CA    . LYS A 1 285 ? 100.911 11.226  33.803 1.00 44.53 ? 285 LYS A CA    1 
ATOM   2281 C  C     . LYS A 1 285 ? 100.803 11.782  35.188 1.00 43.27 ? 285 LYS A C     1 
ATOM   2282 O  O     . LYS A 1 285 ? 100.091 11.179  35.998 1.00 44.40 ? 285 LYS A O     1 
ATOM   2283 C  CB    . LYS A 1 285 ? 102.237 10.468  33.625 1.00 50.45 ? 285 LYS A CB    1 
ATOM   2284 C  CG    . LYS A 1 285 ? 102.900 10.591  32.260 0.00 53.19 ? 285 LYS A CG    1 
ATOM   2285 C  CD    . LYS A 1 285 ? 102.032 10.026  31.160 0.00 56.34 ? 285 LYS A CD    1 
ATOM   2286 C  CE    . LYS A 1 285 ? 102.641 10.311  29.805 0.00 57.65 ? 285 LYS A CE    1 
ATOM   2287 N  NZ    . LYS A 1 285 ? 101.708 9.913   28.724 0.00 59.31 ? 285 LYS A NZ    1 
ATOM   2288 N  N     . ASP A 1 286 ? 101.298 13.012  35.343 1.00 39.59 ? 286 ASP A N     1 
ATOM   2289 C  CA    . ASP A 1 286 ? 101.270 13.731  36.617 1.00 40.71 ? 286 ASP A CA    1 
ATOM   2290 C  C     . ASP A 1 286 ? 99.984  14.496  36.895 1.00 38.31 ? 286 ASP A C     1 
ATOM   2291 O  O     . ASP A 1 286 ? 99.821  15.014  37.995 1.00 35.08 ? 286 ASP A O     1 
ATOM   2292 C  CB    . ASP A 1 286 ? 102.362 14.763  36.664 1.00 47.02 ? 286 ASP A CB    1 
ATOM   2293 C  CG    . ASP A 1 286 ? 103.510 14.327  37.440 1.00 52.20 ? 286 ASP A CG    1 
ATOM   2294 O  OD1   . ASP A 1 286 ? 104.313 13.580  36.830 1.00 53.08 ? 286 ASP A OD1   1 
ATOM   2295 O  OD2   . ASP A 1 286 ? 103.572 14.807  38.594 1.00 55.38 ? 286 ASP A OD2   1 
ATOM   2296 N  N     . GLY A 1 287 ? 99.151  14.652  35.867 1.00 39.12 ? 287 GLY A N     1 
ATOM   2297 C  CA    . GLY A 1 287 ? 97.867  15.314  36.035 1.00 41.78 ? 287 GLY A CA    1 
ATOM   2298 C  C     . GLY A 1 287 ? 97.966  16.770  36.436 1.00 41.30 ? 287 GLY A C     1 
ATOM   2299 O  O     . GLY A 1 287 ? 98.950  17.401  36.063 1.00 46.50 ? 287 GLY A O     1 
ATOM   2300 N  N     . VAL A 1 288 ? 97.277  17.058  37.534 1.00 38.57 ? 288 VAL A N     1 
ATOM   2301 C  CA    . VAL A 1 288 ? 97.097  18.388  38.150 1.00 34.79 ? 288 VAL A CA    1 
ATOM   2302 C  C     . VAL A 1 288 ? 98.371  18.925  38.698 1.00 37.18 ? 288 VAL A C     1 
ATOM   2303 O  O     . VAL A 1 288 ? 98.524  20.136  38.671 1.00 38.60 ? 288 VAL A O     1 
ATOM   2304 C  CB    . VAL A 1 288 ? 96.008  18.426  39.296 1.00 28.68 ? 288 VAL A CB    1 
ATOM   2305 C  CG1   . VAL A 1 288 ? 95.581  19.803  39.713 1.00 30.93 ? 288 VAL A CG1   1 
ATOM   2306 C  CG2   . VAL A 1 288 ? 94.717  17.955  38.643 1.00 43.61 ? 288 VAL A CG2   1 
ATOM   2307 N  N     . ASN A 1 289 ? 99.305  18.064  39.094 1.00 33.42 ? 289 ASN A N     1 
ATOM   2308 C  CA    . ASN A 1 289 ? 100.522 18.593  39.697 1.00 32.68 ? 289 ASN A CA    1 
ATOM   2309 C  C     . ASN A 1 289 ? 101.364 19.365  38.677 1.00 31.78 ? 289 ASN A C     1 
ATOM   2310 O  O     . ASN A 1 289 ? 102.051 20.284  39.096 1.00 32.76 ? 289 ASN A O     1 
ATOM   2311 C  CB    . ASN A 1 289 ? 101.256 17.528  40.491 1.00 35.43 ? 289 ASN A CB    1 
ATOM   2312 C  CG    . ASN A 1 289 ? 100.472 17.062  41.708 1.00 39.86 ? 289 ASN A CG    1 
ATOM   2313 O  OD1   . ASN A 1 289 ? 100.298 15.861  41.950 1.00 49.84 ? 289 ASN A OD1   1 
ATOM   2314 N  ND2   . ASN A 1 289 ? 99.983  17.998  42.475 1.00 42.92 ? 289 ASN A ND2   1 
ATOM   2315 N  N     . ASP A 1 290 ? 101.156 19.122  37.374 1.00 30.09 ? 290 ASP A N     1 
ATOM   2316 C  CA    . ASP A 1 290 ? 101.800 19.877  36.292 1.00 35.94 ? 290 ASP A CA    1 
ATOM   2317 C  C     . ASP A 1 290 ? 101.434 21.360  36.403 1.00 38.49 ? 290 ASP A C     1 
ATOM   2318 O  O     . ASP A 1 290 ? 102.322 22.181  36.699 1.00 39.77 ? 290 ASP A O     1 
ATOM   2319 C  CB    . ASP A 1 290 ? 101.390 19.356  34.899 1.00 36.75 ? 290 ASP A CB    1 
ATOM   2320 C  CG    . ASP A 1 290 ? 102.199 18.148  34.436 1.00 43.13 ? 290 ASP A CG    1 
ATOM   2321 O  OD1   . ASP A 1 290 ? 103.104 17.684  35.177 1.00 45.02 ? 290 ASP A OD1   1 
ATOM   2322 O  OD2   . ASP A 1 290 ? 101.900 17.597  33.354 1.00 40.31 ? 290 ASP A OD2   1 
ATOM   2323 N  N     . ILE A 1 291 ? 100.118 21.602  36.545 1.00 36.90 ? 291 ILE A N     1 
ATOM   2324 C  CA    . ILE A 1 291 ? 99.536  22.947  36.687 1.00 30.52 ? 291 ILE A CA    1 
ATOM   2325 C  C     . ILE A 1 291 ? 99.920  23.541  38.002 1.00 31.82 ? 291 ILE A C     1 
ATOM   2326 O  O     . ILE A 1 291 ? 100.315 24.698  38.003 1.00 38.96 ? 291 ILE A O     1 
ATOM   2327 C  CB    . ILE A 1 291 ? 97.991  22.931  36.609 1.00 33.68 ? 291 ILE A CB    1 
ATOM   2328 C  CG1   . ILE A 1 291 ? 97.565  22.462  35.225 1.00 23.02 ? 291 ILE A CG1   1 
ATOM   2329 C  CG2   . ILE A 1 291 ? 97.356  24.304  36.990 1.00 27.06 ? 291 ILE A CG2   1 
ATOM   2330 C  CD1   . ILE A 1 291 ? 96.392  21.594  35.195 1.00 28.67 ? 291 ILE A CD1   1 
ATOM   2331 N  N     . LYS A 1 292 ? 99.846  22.773  39.087 1.00 31.32 ? 292 LYS A N     1 
ATOM   2332 C  CA    . LYS A 1 292 ? 100.162 23.261  40.443 1.00 32.08 ? 292 LYS A CA    1 
ATOM   2333 C  C     . LYS A 1 292 ? 101.613 23.621  40.751 1.00 37.03 ? 292 LYS A C     1 
ATOM   2334 O  O     . LYS A 1 292 ? 101.904 24.411  41.652 1.00 35.80 ? 292 LYS A O     1 
ATOM   2335 C  CB    . LYS A 1 292 ? 99.624  22.342  41.533 1.00 30.08 ? 292 LYS A CB    1 
ATOM   2336 C  CG    . LYS A 1 292 ? 98.077  22.179  41.561 1.00 32.14 ? 292 LYS A CG    1 
ATOM   2337 C  CD    . LYS A 1 292 ? 97.830  21.149  42.636 1.00 30.67 ? 292 LYS A CD    1 
ATOM   2338 C  CE    . LYS A 1 292 ? 96.864  21.615  43.665 1.00 28.75 ? 292 LYS A CE    1 
ATOM   2339 N  NZ    . LYS A 1 292 ? 96.945  20.714  44.842 1.00 27.96 ? 292 LYS A NZ    1 
ATOM   2340 N  N     . ASN A 1 293 ? 102.502 22.907  40.071 1.00 40.85 ? 293 ASN A N     1 
ATOM   2341 C  CA    . ASN A 1 293 ? 103.939 23.071  40.195 1.00 43.83 ? 293 ASN A CA    1 
ATOM   2342 C  C     . ASN A 1 293 ? 104.448 23.958  39.060 1.00 47.12 ? 293 ASN A C     1 
ATOM   2343 O  O     . ASN A 1 293 ? 105.694 24.028  38.909 1.00 51.73 ? 293 ASN A O     1 
ATOM   2344 C  CB    . ASN A 1 293 ? 104.681 21.721  40.184 1.00 42.90 ? 293 ASN A CB    1 
ATOM   2345 C  CG    . ASN A 1 293 ? 104.232 20.785  41.275 1.00 44.15 ? 293 ASN A CG    1 
ATOM   2346 O  OD1   . ASN A 1 293 ? 104.024 21.157  42.428 1.00 43.62 ? 293 ASN A OD1   1 
ATOM   2347 N  ND2   . ASN A 1 293 ? 104.069 19.538  40.903 1.00 43.23 ? 293 ASN A ND2   1 
ATOM   2348 N  N     . HIS A 1 294 ? 103.563 24.488  38.185 1.00 41.51 ? 294 HIS A N     1 
ATOM   2349 C  CA    . HIS A 1 294 ? 104.028 25.480  37.220 1.00 36.54 ? 294 HIS A CA    1 
ATOM   2350 C  C     . HIS A 1 294 ? 104.544 26.736  37.958 1.00 34.77 ? 294 HIS A C     1 
ATOM   2351 O  O     . HIS A 1 294 ? 104.191 27.025  39.084 1.00 32.19 ? 294 HIS A O     1 
ATOM   2352 C  CB    . HIS A 1 294 ? 103.013 25.834  36.165 1.00 32.51 ? 294 HIS A CB    1 
ATOM   2353 C  CG    . HIS A 1 294 ? 103.600 26.392  34.897 1.00 34.36 ? 294 HIS A CG    1 
ATOM   2354 N  ND1   . HIS A 1 294 ? 103.854 27.736  34.717 1.00 33.27 ? 294 HIS A ND1   1 
ATOM   2355 C  CD2   . HIS A 1 294 ? 103.912 25.804  33.713 1.00 36.41 ? 294 HIS A CD2   1 
ATOM   2356 C  CE1   . HIS A 1 294 ? 104.310 27.944  33.495 1.00 32.65 ? 294 HIS A CE1   1 
ATOM   2357 N  NE2   . HIS A 1 294 ? 104.361 26.786  32.867 1.00 32.86 ? 294 HIS A NE2   1 
ATOM   2358 N  N     . LYS A 1 295 ? 105.629 27.259  37.391 1.00 40.88 ? 295 LYS A N     1 
ATOM   2359 C  CA    . LYS A 1 295 ? 106.406 28.481  37.729 1.00 40.03 ? 295 LYS A CA    1 
ATOM   2360 C  C     . LYS A 1 295 ? 105.430 29.673  37.886 1.00 37.53 ? 295 LYS A C     1 
ATOM   2361 O  O     . LYS A 1 295 ? 105.558 30.334  38.911 1.00 37.64 ? 295 LYS A O     1 
ATOM   2362 C  CB    . LYS A 1 295 ? 107.462 28.752  36.630 1.00 44.47 ? 295 LYS A CB    1 
ATOM   2363 C  CG    . LYS A 1 295 ? 108.136 27.491  35.962 1.00 47.97 ? 295 LYS A CG    1 
ATOM   2364 C  CD    . LYS A 1 295 ? 107.290 26.570  35.021 1.00 44.86 ? 295 LYS A CD    1 
ATOM   2365 C  CE    . LYS A 1 295 ? 107.137 25.081  35.456 1.00 49.55 ? 295 LYS A CE    1 
ATOM   2366 N  NZ    . LYS A 1 295 ? 106.532 24.118  34.412 1.00 50.01 ? 295 LYS A NZ    1 
ATOM   2367 N  N     . TRP A 1 296 ? 104.400 29.799  37.011 1.00 33.17 ? 296 TRP A N     1 
ATOM   2368 C  CA    . TRP A 1 296 ? 103.293 30.742  37.167 1.00 30.00 ? 296 TRP A CA    1 
ATOM   2369 C  C     . TRP A 1 296 ? 102.571 30.640  38.505 1.00 31.38 ? 296 TRP A C     1 
ATOM   2370 O  O     . TRP A 1 296 ? 102.205 31.688  39.046 1.00 35.78 ? 296 TRP A O     1 
ATOM   2371 C  CB    . TRP A 1 296 ? 102.271 30.689  36.064 1.00 32.08 ? 296 TRP A CB    1 
ATOM   2372 C  CG    . TRP A 1 296 ? 101.481 31.983  35.948 1.00 37.75 ? 296 TRP A CG    1 
ATOM   2373 C  CD1   . TRP A 1 296 ? 101.900 33.170  35.381 1.00 43.05 ? 296 TRP A CD1   1 
ATOM   2374 C  CD2   . TRP A 1 296 ? 100.094 32.196  36.293 1.00 39.45 ? 296 TRP A CD2   1 
ATOM   2375 N  NE1   . TRP A 1 296 ? 100.849 34.084  35.312 1.00 40.82 ? 296 TRP A NE1   1 
ATOM   2376 C  CE2   . TRP A 1 296 ? 99.741  33.523  35.872 1.00 37.46 ? 296 TRP A CE2   1 
ATOM   2377 C  CE3   . TRP A 1 296 ? 99.102  31.381  36.872 1.00 29.43 ? 296 TRP A CE3   1 
ATOM   2378 C  CZ2   . TRP A 1 296 ? 98.437  34.043  36.014 1.00 40.17 ? 296 TRP A CZ2   1 
ATOM   2379 C  CZ3   . TRP A 1 296 ? 97.792  31.892  36.997 1.00 34.14 ? 296 TRP A CZ3   1 
ATOM   2380 C  CH2   . TRP A 1 296 ? 97.475  33.214  36.566 1.00 38.23 ? 296 TRP A CH2   1 
ATOM   2381 N  N     . PHE A 1 297 ? 102.510 29.466  39.140 1.00 30.74 ? 297 PHE A N     1 
ATOM   2382 C  CA    . PHE A 1 297 ? 101.914 29.379  40.494 1.00 31.95 ? 297 PHE A CA    1 
ATOM   2383 C  C     . PHE A 1 297 ? 102.890 29.232  41.665 1.00 34.43 ? 297 PHE A C     1 
ATOM   2384 O  O     . PHE A 1 297 ? 102.404 28.968  42.779 1.00 34.81 ? 297 PHE A O     1 
ATOM   2385 C  CB    . PHE A 1 297 ? 100.898 28.248  40.617 1.00 29.68 ? 297 PHE A CB    1 
ATOM   2386 C  CG    . PHE A 1 297 ? 99.681  28.409  39.768 1.00 23.38 ? 297 PHE A CG    1 
ATOM   2387 C  CD1   . PHE A 1 297 ? 98.604  29.174  40.214 1.00 21.30 ? 297 PHE A CD1   1 
ATOM   2388 C  CD2   . PHE A 1 297 ? 99.590  27.717  38.567 1.00 21.08 ? 297 PHE A CD2   1 
ATOM   2389 C  CE1   . PHE A 1 297 ? 97.405  29.259  39.498 1.00 18.49 ? 297 PHE A CE1   1 
ATOM   2390 C  CE2   . PHE A 1 297 ? 98.362  27.789  37.788 1.00 27.45 ? 297 PHE A CE2   1 
ATOM   2391 C  CZ    . PHE A 1 297 ? 97.270  28.568  38.288 1.00 22.52 ? 297 PHE A CZ    1 
ATOM   2392 N  N     . ALA A 1 298 ? 104.167 29.650  41.497 1.00 34.29 ? 298 ALA A N     1 
ATOM   2393 C  CA    . ALA A 1 298 ? 105.255 29.435  42.479 1.00 27.27 ? 298 ALA A CA    1 
ATOM   2394 C  C     . ALA A 1 298 ? 105.069 30.118  43.793 1.00 31.93 ? 298 ALA A C     1 
ATOM   2395 O  O     . ALA A 1 298 ? 105.508 29.629  44.843 1.00 36.75 ? 298 ALA A O     1 
ATOM   2396 C  CB    . ALA A 1 298 ? 106.542 29.807  41.887 1.00 31.95 ? 298 ALA A CB    1 
ATOM   2397 N  N     . THR A 1 299 ? 104.265 31.168  43.752 1.00 30.75 ? 299 THR A N     1 
ATOM   2398 C  CA    . THR A 1 299 ? 103.948 32.031  44.889 1.00 39.52 ? 299 THR A CA    1 
ATOM   2399 C  C     . THR A 1 299 ? 102.687 31.529  45.629 1.00 39.10 ? 299 THR A C     1 
ATOM   2400 O  O     . THR A 1 299 ? 102.400 32.014  46.723 1.00 44.34 ? 299 THR A O     1 
ATOM   2401 C  CB    . THR A 1 299 ? 103.580 33.484  44.357 1.00 44.16 ? 299 THR A CB    1 
ATOM   2402 O  OG1   . THR A 1 299 ? 103.706 33.599  42.916 1.00 52.23 ? 299 THR A OG1   1 
ATOM   2403 C  CG2   . THR A 1 299 ? 104.319 34.552  45.078 1.00 46.75 ? 299 THR A CG2   1 
ATOM   2404 N  N     . THR A 1 300 ? 101.840 30.744  44.955 1.00 38.14 ? 300 THR A N     1 
ATOM   2405 C  CA    . THR A 1 300 ? 100.572 30.240  45.484 1.00 35.80 ? 300 THR A CA    1 
ATOM   2406 C  C     . THR A 1 300 ? 100.737 29.180  46.551 1.00 36.09 ? 300 THR A C     1 
ATOM   2407 O  O     . THR A 1 300 ? 101.266 28.103  46.289 1.00 39.99 ? 300 THR A O     1 
ATOM   2408 C  CB    . THR A 1 300 ? 99.689  29.684  44.342 1.00 37.45 ? 300 THR A CB    1 
ATOM   2409 O  OG1   . THR A 1 300 ? 99.551  30.694  43.318 1.00 39.28 ? 300 THR A OG1   1 
ATOM   2410 C  CG2   . THR A 1 300 ? 98.345  29.112  44.857 1.00 24.12 ? 300 THR A CG2   1 
ATOM   2411 N  N     . ASP A 1 301 ? 100.139 29.477  47.700 1.00 39.10 ? 301 ASP A N     1 
ATOM   2412 C  CA    . ASP A 1 301 ? 100.068 28.613  48.886 1.00 36.11 ? 301 ASP A CA    1 
ATOM   2413 C  C     . ASP A 1 301 ? 98.665  28.045  48.831 1.00 35.12 ? 301 ASP A C     1 
ATOM   2414 O  O     . ASP A 1 301 ? 97.707  28.539  49.501 1.00 28.43 ? 301 ASP A O     1 
ATOM   2415 C  CB    . ASP A 1 301 ? 100.225 29.486  50.103 1.00 40.13 ? 301 ASP A CB    1 
ATOM   2416 C  CG    . ASP A 1 301 ? 100.292 28.734  51.374 1.00 44.90 ? 301 ASP A CG    1 
ATOM   2417 O  OD1   . ASP A 1 301 ? 99.403  27.888  51.611 1.00 45.30 ? 301 ASP A OD1   1 
ATOM   2418 O  OD2   . ASP A 1 301 ? 101.184 29.116  52.187 1.00 52.06 ? 301 ASP A OD2   1 
ATOM   2419 N  N     . TRP A 1 302 ? 98.689  26.866  48.194 1.00 35.61 ? 302 TRP A N     1 
ATOM   2420 C  CA    . TRP A 1 302 ? 97.518  26.011  47.883 1.00 32.94 ? 302 TRP A CA    1 
ATOM   2421 C  C     . TRP A 1 302 ? 96.623  25.682  49.077 1.00 33.38 ? 302 TRP A C     1 
ATOM   2422 O  O     . TRP A 1 302 ? 95.410  25.928  48.986 1.00 35.49 ? 302 TRP A O     1 
ATOM   2423 C  CB    . TRP A 1 302 ? 97.970  24.778  47.102 1.00 29.15 ? 302 TRP A CB    1 
ATOM   2424 C  CG    . TRP A 1 302 ? 98.605  25.077  45.775 1.00 22.93 ? 302 TRP A CG    1 
ATOM   2425 C  CD1   . TRP A 1 302 ? 99.918  24.982  45.490 1.00 25.92 ? 302 TRP A CD1   1 
ATOM   2426 C  CD2   . TRP A 1 302 ? 97.942  25.397  44.527 1.00 24.38 ? 302 TRP A CD2   1 
ATOM   2427 N  NE1   . TRP A 1 302 ? 100.145 25.207  44.127 1.00 28.23 ? 302 TRP A NE1   1 
ATOM   2428 C  CE2   . TRP A 1 302 ? 98.949  25.504  43.526 1.00 22.99 ? 302 TRP A CE2   1 
ATOM   2429 C  CE3   . TRP A 1 302 ? 96.594  25.585  44.154 1.00 19.31 ? 302 TRP A CE3   1 
ATOM   2430 C  CZ2   . TRP A 1 302 ? 98.664  25.828  42.196 1.00 19.33 ? 302 TRP A CZ2   1 
ATOM   2431 C  CZ3   . TRP A 1 302 ? 96.293  25.877  42.825 1.00 21.57 ? 302 TRP A CZ3   1 
ATOM   2432 C  CH2   . TRP A 1 302 ? 97.334  26.006  41.845 1.00 21.45 ? 302 TRP A CH2   1 
ATOM   2433 N  N     . ILE A 1 303 ? 97.272  25.582  50.247 1.00 34.75 ? 303 ILE A N     1 
ATOM   2434 C  CA    . ILE A 1 303 ? 96.621  25.329  51.525 1.00 37.24 ? 303 ILE A CA    1 
ATOM   2435 C  C     . ILE A 1 303 ? 95.862  26.542  52.081 1.00 39.63 ? 303 ILE A C     1 
ATOM   2436 O  O     . ILE A 1 303 ? 94.664  26.411  52.403 1.00 37.45 ? 303 ILE A O     1 
ATOM   2437 C  CB    . ILE A 1 303 ? 97.518  24.538  52.571 1.00 38.54 ? 303 ILE A CB    1 
ATOM   2438 C  CG1   . ILE A 1 303 ? 97.641  23.072  52.161 1.00 40.40 ? 303 ILE A CG1   1 
ATOM   2439 C  CG2   . ILE A 1 303 ? 96.764  24.219  53.858 1.00 35.45 ? 303 ILE A CG2   1 
ATOM   2440 C  CD1   . ILE A 1 303 ? 98.938  22.652  51.540 1.00 46.45 ? 303 ILE A CD1   1 
ATOM   2441 N  N     . ALA A 1 304 ? 96.487  27.725  52.013 1.00 37.60 ? 304 ALA A N     1 
ATOM   2442 C  CA    . ALA A 1 304 ? 95.899  29.005  52.478 1.00 35.59 ? 304 ALA A CA    1 
ATOM   2443 C  C     . ALA A 1 304 ? 94.685  29.312  51.608 1.00 27.93 ? 304 ALA A C     1 
ATOM   2444 O  O     . ALA A 1 304 ? 93.711  29.743  52.159 1.00 31.15 ? 304 ALA A O     1 
ATOM   2445 C  CB    . ALA A 1 304 ? 96.918  30.214  52.438 1.00 31.06 ? 304 ALA A CB    1 
ATOM   2446 N  N     . ILE A 1 305 ? 94.813  29.259  50.280 1.00 29.24 ? 305 ILE A N     1 
ATOM   2447 C  CA    . ILE A 1 305 ? 93.686  29.424  49.342 1.00 29.47 ? 305 ILE A CA    1 
ATOM   2448 C  C     . ILE A 1 305 ? 92.529  28.440  49.677 1.00 30.33 ? 305 ILE A C     1 
ATOM   2449 O  O     . ILE A 1 305 ? 91.394  28.912  49.869 1.00 28.31 ? 305 ILE A O     1 
ATOM   2450 C  CB    . ILE A 1 305 ? 94.150  29.403  47.850 1.00 31.54 ? 305 ILE A CB    1 
ATOM   2451 C  CG1   . ILE A 1 305 ? 94.808  30.775  47.554 1.00 29.68 ? 305 ILE A CG1   1 
ATOM   2452 C  CG2   . ILE A 1 305 ? 92.933  29.039  46.848 1.00 29.40 ? 305 ILE A CG2   1 
ATOM   2453 C  CD1   . ILE A 1 305 ? 94.890  31.284  46.109 1.00 28.33 ? 305 ILE A CD1   1 
ATOM   2454 N  N     . TYR A 1 306 ? 92.845  27.149  49.880 1.00 31.37 ? 306 TYR A N     1 
ATOM   2455 C  CA    . TYR A 1 306 ? 91.837  26.158  50.311 1.00 36.01 ? 306 TYR A CA    1 
ATOM   2456 C  C     . TYR A 1 306 ? 91.168  26.557  51.633 1.00 36.81 ? 306 TYR A C     1 
ATOM   2457 O  O     . TYR A 1 306 ? 89.936  26.476  51.766 1.00 40.84 ? 306 TYR A O     1 
ATOM   2458 C  CB    . TYR A 1 306 ? 92.420  24.728  50.449 1.00 37.28 ? 306 TYR A CB    1 
ATOM   2459 C  CG    . TYR A 1 306 ? 91.449  23.706  51.061 1.00 35.55 ? 306 TYR A CG    1 
ATOM   2460 C  CD1   . TYR A 1 306 ? 90.323  23.221  50.318 1.00 34.04 ? 306 TYR A CD1   1 
ATOM   2461 C  CD2   . TYR A 1 306 ? 91.558  23.342  52.422 1.00 32.81 ? 306 TYR A CD2   1 
ATOM   2462 C  CE1   . TYR A 1 306 ? 89.343  22.412  50.933 1.00 28.91 ? 306 TYR A CE1   1 
ATOM   2463 C  CE2   . TYR A 1 306 ? 90.559  22.563  53.058 1.00 29.24 ? 306 TYR A CE2   1 
ATOM   2464 C  CZ    . TYR A 1 306 ? 89.459  22.126  52.288 1.00 33.01 ? 306 TYR A CZ    1 
ATOM   2465 O  OH    . TYR A 1 306 ? 88.391  21.559  52.939 1.00 38.53 ? 306 TYR A OH    1 
ATOM   2466 N  N     . GLN A 1 307 ? 91.970  27.047  52.569 1.00 35.54 ? 307 GLN A N     1 
ATOM   2467 C  CA    . GLN A 1 307 ? 91.437  27.425  53.865 1.00 36.98 ? 307 GLN A CA    1 
ATOM   2468 C  C     . GLN A 1 307 ? 90.836  28.796  53.916 1.00 38.22 ? 307 GLN A C     1 
ATOM   2469 O  O     . GLN A 1 307 ? 90.412  29.188  55.001 1.00 38.94 ? 307 GLN A O     1 
ATOM   2470 C  CB    . GLN A 1 307 ? 92.485  27.337  54.965 1.00 40.70 ? 307 GLN A CB    1 
ATOM   2471 C  CG    . GLN A 1 307 ? 92.996  25.954  55.240 1.00 47.88 ? 307 GLN A CG    1 
ATOM   2472 C  CD    . GLN A 1 307 ? 94.277  25.992  56.028 1.00 56.10 ? 307 GLN A CD    1 
ATOM   2473 O  OE1   . GLN A 1 307 ? 95.103  26.873  55.806 1.00 62.06 ? 307 GLN A OE1   1 
ATOM   2474 N  NE2   . GLN A 1 307 ? 94.499  25.001  56.894 1.00 57.76 ? 307 GLN A NE2   1 
ATOM   2475 N  N     . ARG A 1 308 ? 90.880  29.531  52.791 1.00 40.54 ? 308 ARG A N     1 
ATOM   2476 C  CA    . ARG A 1 308 ? 90.400  30.916  52.680 1.00 39.06 ? 308 ARG A CA    1 
ATOM   2477 C  C     . ARG A 1 308 ? 91.117  31.948  53.577 1.00 38.28 ? 308 ARG A C     1 
ATOM   2478 O  O     . ARG A 1 308 ? 90.576  32.945  53.988 1.00 38.20 ? 308 ARG A O     1 
ATOM   2479 C  CB    . ARG A 1 308 ? 88.873  30.964  52.746 1.00 36.54 ? 308 ARG A CB    1 
ATOM   2480 C  CG    . ARG A 1 308 ? 88.291  30.321  51.496 1.00 35.24 ? 308 ARG A CG    1 
ATOM   2481 C  CD    . ARG A 1 308 ? 86.949  29.734  51.803 1.00 33.68 ? 308 ARG A CD    1 
ATOM   2482 N  NE    . ARG A 1 308 ? 86.025  30.831  52.018 1.00 33.02 ? 308 ARG A NE    1 
ATOM   2483 C  CZ    . ARG A 1 308 ? 85.140  31.262  51.132 1.00 33.46 ? 308 ARG A CZ    1 
ATOM   2484 N  NH1   . ARG A 1 308 ? 84.779  30.555  50.057 1.00 30.10 ? 308 ARG A NH1   1 
ATOM   2485 N  NH2   . ARG A 1 308 ? 84.447  32.336  51.472 1.00 36.02 ? 308 ARG A NH2   1 
ATOM   2486 N  N     . LYS A 1 309 ? 92.397  31.697  53.801 1.00 43.66 ? 309 LYS A N     1 
ATOM   2487 C  CA    . LYS A 1 309 ? 93.332  32.474  54.612 1.00 45.44 ? 309 LYS A CA    1 
ATOM   2488 C  C     . LYS A 1 309 ? 93.979  33.618  53.820 1.00 42.70 ? 309 LYS A C     1 
ATOM   2489 O  O     . LYS A 1 309 ? 94.640  34.442  54.444 1.00 47.26 ? 309 LYS A O     1 
ATOM   2490 C  CB    . LYS A 1 309 ? 94.409  31.527  55.178 1.00 48.35 ? 309 LYS A CB    1 
ATOM   2491 C  CG    . LYS A 1 309 ? 94.025  31.048  56.581 1.00 56.64 ? 309 LYS A CG    1 
ATOM   2492 C  CD    . LYS A 1 309 ? 94.811  29.840  57.113 1.00 60.68 ? 309 LYS A CD    1 
ATOM   2493 C  CE    . LYS A 1 309 ? 94.351  29.462  58.553 1.00 65.45 ? 309 LYS A CE    1 
ATOM   2494 N  NZ    . LYS A 1 309 ? 94.120  28.001  58.910 1.00 63.53 ? 309 LYS A NZ    1 
ATOM   2495 N  N     . VAL A 1 310 ? 93.944  33.567  52.485 1.00 37.27 ? 310 VAL A N     1 
ATOM   2496 C  CA    . VAL A 1 310 ? 94.438  34.633  51.611 1.00 37.67 ? 310 VAL A CA    1 
ATOM   2497 C  C     . VAL A 1 310 ? 93.427  35.824  51.508 1.00 40.44 ? 310 VAL A C     1 
ATOM   2498 O  O     . VAL A 1 310 ? 92.195  35.612  51.402 1.00 36.00 ? 310 VAL A O     1 
ATOM   2499 C  CB    . VAL A 1 310 ? 94.752  34.089  50.207 1.00 34.73 ? 310 VAL A CB    1 
ATOM   2500 C  CG1   . VAL A 1 310 ? 95.128  35.197  49.287 1.00 37.95 ? 310 VAL A CG1   1 
ATOM   2501 C  CG2   . VAL A 1 310 ? 95.880  33.048  50.235 1.00 37.46 ? 310 VAL A CG2   1 
ATOM   2502 N  N     . GLU A 1 311 ? 93.932  37.064  51.626 1.00 41.38 ? 311 GLU A N     1 
ATOM   2503 C  CA    . GLU A 1 311 ? 93.093  38.279  51.437 1.00 38.14 ? 311 GLU A CA    1 
ATOM   2504 C  C     . GLU A 1 311 ? 92.811  38.452  49.956 1.00 33.42 ? 311 GLU A C     1 
ATOM   2505 O  O     . GLU A 1 311 ? 93.712  38.265  49.094 1.00 31.54 ? 311 GLU A O     1 
ATOM   2506 C  CB    . GLU A 1 311 ? 93.660  39.571  52.035 1.00 38.12 ? 311 GLU A CB    1 
ATOM   2507 C  CG    . GLU A 1 311 ? 93.982  39.506  53.534 0.00 41.86 ? 311 GLU A CG    1 
ATOM   2508 C  CD    . GLU A 1 311 ? 95.186  38.638  53.845 0.00 43.82 ? 311 GLU A CD    1 
ATOM   2509 O  OE1   . GLU A 1 311 ? 96.313  39.018  53.464 0.00 44.13 ? 311 GLU A OE1   1 
ATOM   2510 O  OE2   . GLU A 1 311 ? 95.008  37.573  54.469 0.00 44.13 ? 311 GLU A OE2   1 
ATOM   2511 N  N     . ALA A 1 312 ? 91.505  38.583  49.692 1.00 34.62 ? 312 ALA A N     1 
ATOM   2512 C  CA    . ALA A 1 312 ? 91.040  38.703  48.313 1.00 39.00 ? 312 ALA A CA    1 
ATOM   2513 C  C     . ALA A 1 312 ? 91.350  40.077  47.778 1.00 43.86 ? 312 ALA A C     1 
ATOM   2514 O  O     . ALA A 1 312 ? 91.076  41.056  48.502 1.00 41.22 ? 312 ALA A O     1 
ATOM   2515 C  CB    . ALA A 1 312 ? 89.561  38.440  48.158 1.00 39.26 ? 312 ALA A CB    1 
ATOM   2516 N  N     . PRO A 1 313 ? 91.811  40.161  46.497 1.00 44.43 ? 313 PRO A N     1 
ATOM   2517 C  CA    . PRO A 1 313 ? 92.162  41.390  45.788 1.00 45.19 ? 313 PRO A CA    1 
ATOM   2518 C  C     . PRO A 1 313 ? 90.989  42.330  45.618 1.00 43.63 ? 313 PRO A C     1 
ATOM   2519 O  O     . PRO A 1 313 ? 91.191  43.486  45.304 1.00 47.76 ? 313 PRO A O     1 
ATOM   2520 C  CB    . PRO A 1 313 ? 92.538  40.872  44.404 1.00 45.55 ? 313 PRO A CB    1 
ATOM   2521 C  CG    . PRO A 1 313 ? 91.722  39.629  44.254 1.00 47.52 ? 313 PRO A CG    1 
ATOM   2522 C  CD    . PRO A 1 313 ? 92.033  39.038  45.568 1.00 45.53 ? 313 PRO A CD    1 
ATOM   2523 N  N     . PHE A 1 314 ? 89.786  41.799  45.742 1.00 42.01 ? 314 PHE A N     1 
ATOM   2524 C  CA    . PHE A 1 314 ? 88.580  42.549  45.488 1.00 44.04 ? 314 PHE A CA    1 
ATOM   2525 C  C     . PHE A 1 314 ? 87.444  41.990  46.352 1.00 43.10 ? 314 PHE A C     1 
ATOM   2526 O  O     . PHE A 1 314 ? 87.280  40.766  46.425 1.00 41.66 ? 314 PHE A O     1 
ATOM   2527 C  CB    . PHE A 1 314 ? 88.318  42.523  43.958 1.00 47.65 ? 314 PHE A CB    1 
ATOM   2528 C  CG    . PHE A 1 314 ? 86.974  43.050  43.546 1.00 48.33 ? 314 PHE A CG    1 
ATOM   2529 C  CD1   . PHE A 1 314 ? 86.696  44.414  43.657 1.00 47.35 ? 314 PHE A CD1   1 
ATOM   2530 C  CD2   . PHE A 1 314 ? 85.924  42.146  43.264 1.00 51.49 ? 314 PHE A CD2   1 
ATOM   2531 C  CE1   . PHE A 1 314 ? 85.384  44.892  43.522 1.00 49.09 ? 314 PHE A CE1   1 
ATOM   2532 C  CE2   . PHE A 1 314 ? 84.584  42.588  43.132 1.00 50.45 ? 314 PHE A CE2   1 
ATOM   2533 C  CZ    . PHE A 1 314 ? 84.309  43.972  43.269 1.00 53.08 ? 314 PHE A CZ    1 
ATOM   2534 N  N     . ILE A 1 315 ? 86.792  42.886  47.101 1.00 37.12 ? 315 ILE A N     1 
ATOM   2535 C  CA    . ILE A 1 315 ? 85.667  42.554  47.957 1.00 42.69 ? 315 ILE A CA    1 
ATOM   2536 C  C     . ILE A 1 315 ? 84.454  43.321  47.498 1.00 46.47 ? 315 ILE A C     1 
ATOM   2537 O  O     . ILE A 1 315 ? 84.624  44.425  47.029 1.00 50.95 ? 315 ILE A O     1 
ATOM   2538 C  CB    . ILE A 1 315 ? 85.958  42.633  49.442 1.00 39.06 ? 315 ILE A CB    1 
ATOM   2539 C  CG1   . ILE A 1 315 ? 87.007  41.577  49.784 1.00 38.40 ? 315 ILE A CG1   1 
ATOM   2540 C  CG2   . ILE A 1 315 ? 84.686  42.396  50.251 1.00 39.27 ? 315 ILE A CG2   1 
ATOM   2541 C  CD1   . ILE A 1 315 ? 87.253  41.322  51.258 1.00 49.79 ? 315 ILE A CD1   1 
ATOM   2542 N  N     . PRO A 1 316 ? 83.368  42.605  47.191 1.00 53.81 ? 316 PRO A N     1 
ATOM   2543 C  CA    . PRO A 1 316 ? 82.209  43.390  46.744 1.00 58.90 ? 316 PRO A CA    1 
ATOM   2544 C  C     . PRO A 1 316 ? 81.497  43.988  47.937 1.00 62.12 ? 316 PRO A C     1 
ATOM   2545 O  O     . PRO A 1 316 ? 81.586  43.469  49.052 1.00 62.06 ? 316 PRO A O     1 
ATOM   2546 C  CB    . PRO A 1 316 ? 81.362  42.376  45.947 1.00 59.75 ? 316 PRO A CB    1 
ATOM   2547 C  CG    . PRO A 1 316 ? 82.381  41.400  45.437 1.00 59.63 ? 316 PRO A CG    1 
ATOM   2548 C  CD    . PRO A 1 316 ? 83.260  41.222  46.680 1.00 57.29 ? 316 PRO A CD    1 
ATOM   2549 N  N     . LYS A 1 317 ? 80.870  45.129  47.692 1.00 68.29 ? 317 LYS A N     1 
ATOM   2550 C  CA    . LYS A 1 317 ? 80.160  45.833  48.749 1.00 75.24 ? 317 LYS A CA    1 
ATOM   2551 C  C     . LYS A 1 317 ? 78.661  45.657  48.540 1.00 76.45 ? 317 LYS A C     1 
ATOM   2552 O  O     . LYS A 1 317 ? 78.214  45.648  47.392 1.00 76.01 ? 317 LYS A O     1 
ATOM   2553 C  CB    . LYS A 1 317 ? 80.621  47.298  48.758 1.00 78.10 ? 317 LYS A CB    1 
ATOM   2554 C  CG    . LYS A 1 317 ? 80.808  47.952  47.384 0.00 80.15 ? 317 LYS A CG    1 
ATOM   2555 C  CD    . LYS A 1 317 ? 79.487  48.279  46.699 0.00 81.59 ? 317 LYS A CD    1 
ATOM   2556 C  CE    . LYS A 1 317 ? 79.384  47.593  45.344 0.00 82.29 ? 317 LYS A CE    1 
ATOM   2557 N  NZ    . LYS A 1 317 ? 78.055  47.806  44.711 0.00 82.63 ? 317 LYS A NZ    1 
ATOM   2558 N  N     . PHE A 1 318 ? 77.939  45.466  49.638 0.00 82.50 ? 318 PHE A N     1 
ATOM   2559 C  CA    . PHE A 1 318 ? 76.496  45.286  49.633 0.00 86.82 ? 318 PHE A CA    1 
ATOM   2560 C  C     . PHE A 1 318 ? 75.973  46.168  50.755 0.00 88.58 ? 318 PHE A C     1 
ATOM   2561 O  O     . PHE A 1 318 ? 76.734  46.562  51.639 0.00 88.94 ? 318 PHE A O     1 
ATOM   2562 C  CB    . PHE A 1 318 ? 76.131  43.826  49.940 0.00 89.68 ? 318 PHE A CB    1 
ATOM   2563 C  CG    . PHE A 1 318 ? 77.076  42.824  49.341 0.00 92.43 ? 318 PHE A CG    1 
ATOM   2564 C  CD1   . PHE A 1 318 ? 77.079  42.579  47.973 0.00 93.31 ? 318 PHE A CD1   1 
ATOM   2565 C  CD2   . PHE A 1 318 ? 77.967  42.128  50.149 0.00 93.31 ? 318 PHE A CD2   1 
ATOM   2566 C  CE1   . PHE A 1 318 ? 77.971  41.665  47.418 0.00 94.23 ? 318 PHE A CE1   1 
ATOM   2567 C  CE2   . PHE A 1 318 ? 78.862  41.212  49.603 0.00 94.23 ? 318 PHE A CE2   1 
ATOM   2568 C  CZ    . PHE A 1 318 ? 78.858  40.975  48.236 0.00 94.55 ? 318 PHE A CZ    1 
ATOM   2569 N  N     . LYS A 1 319 ? 74.679  46.472  50.733 0.00 90.71 ? 319 LYS A N     1 
ATOM   2570 C  CA    . LYS A 1 319 ? 74.098  47.308  51.772 0.00 92.52 ? 319 LYS A CA    1 
ATOM   2571 C  C     . LYS A 1 319 ? 72.898  46.601  52.392 0.00 92.43 ? 319 LYS A C     1 
ATOM   2572 O  O     . LYS A 1 319 ? 71.773  47.094  52.352 0.00 93.03 ? 319 LYS A O     1 
ATOM   2573 C  CB    . LYS A 1 319 ? 73.702  48.675  51.201 0.00 94.20 ? 319 LYS A CB    1 
ATOM   2574 C  CG    . LYS A 1 319 ? 73.534  49.764  52.255 0.00 96.34 ? 319 LYS A CG    1 
ATOM   2575 C  CD    . LYS A 1 319 ? 74.799  49.934  53.095 0.00 97.97 ? 319 LYS A CD    1 
ATOM   2576 C  CE    . LYS A 1 319 ? 75.993  50.349  52.246 0.00 98.99 ? 319 LYS A CE    1 
ATOM   2577 N  NZ    . LYS A 1 319 ? 77.258  50.352  53.031 0.00 99.56 ? 319 LYS A NZ    1 
ATOM   2578 N  N     . GLY A 1 320 ? 73.159  45.427  52.967 0.00 91.41 ? 320 GLY A N     1 
ATOM   2579 C  CA    . GLY A 1 320 ? 72.107  44.658  53.593 0.00 89.20 ? 320 GLY A CA    1 
ATOM   2580 C  C     . GLY A 1 320 ? 71.667  43.487  52.735 0.00 86.34 ? 320 GLY A C     1 
ATOM   2581 O  O     . GLY A 1 320 ? 72.017  43.422  51.550 0.00 87.97 ? 320 GLY A O     1 
ATOM   2582 N  N     . PRO A 1 321 ? 70.917  42.535  53.305 0.00 82.86 ? 321 PRO A N     1 
ATOM   2583 C  CA    . PRO A 1 321 ? 70.440  41.362  52.566 0.00 78.76 ? 321 PRO A CA    1 
ATOM   2584 C  C     . PRO A 1 321 ? 69.495  41.711  51.420 0.00 73.51 ? 321 PRO A C     1 
ATOM   2585 O  O     . PRO A 1 321 ? 68.626  42.573  51.549 0.00 73.11 ? 321 PRO A O     1 
ATOM   2586 C  CB    . PRO A 1 321 ? 69.739  40.542  53.652 0.00 80.51 ? 321 PRO A CB    1 
ATOM   2587 C  CG    . PRO A 1 321 ? 69.250  41.589  54.604 0.00 82.29 ? 321 PRO A CG    1 
ATOM   2588 C  CD    . PRO A 1 321 ? 70.442  42.504  54.697 0.00 83.27 ? 321 PRO A CD    1 
ATOM   2589 N  N     . GLY A 1 322 ? 69.663  41.003  50.309 0.00 67.95 ? 322 GLY A N     1 
ATOM   2590 C  CA    . GLY A 1 322 ? 68.849  41.213  49.126 1.00 57.36 ? 322 GLY A CA    1 
ATOM   2591 C  C     . GLY A 1 322 ? 68.825  42.501  48.321 1.00 49.65 ? 322 GLY A C     1 
ATOM   2592 O  O     . GLY A 1 322 ? 68.046  42.657  47.382 1.00 51.28 ? 322 GLY A O     1 
ATOM   2593 N  N     . ASP A 1 323 ? 70.082  42.746  48.675 0.00 52.16 ? 323 ASP A N     1 
ATOM   2594 C  CA    . ASP A 1 323 ? 70.773  43.607  48.066 1.00 46.65 ? 323 ASP A CA    1 
ATOM   2595 C  C     . ASP A 1 323 ? 71.367  42.870  46.848 1.00 45.45 ? 323 ASP A C     1 
ATOM   2596 O  O     . ASP A 1 323 ? 72.353  42.131  47.025 1.00 47.26 ? 323 ASP A O     1 
ATOM   2597 C  CB    . ASP A 1 323 ? 71.584  44.832  48.523 1.00 48.41 ? 323 ASP A CB    1 
ATOM   2598 C  CG    . ASP A 1 323 ? 72.607  45.325  47.524 1.00 48.82 ? 323 ASP A CG    1 
ATOM   2599 O  OD1   . ASP A 1 323 ? 72.185  45.845  46.488 1.00 52.84 ? 323 ASP A OD1   1 
ATOM   2600 O  OD2   . ASP A 1 323 ? 73.810  45.154  47.747 1.00 52.43 ? 323 ASP A OD2   1 
ATOM   2601 N  N     . THR A 1 324 ? 70.872  43.304  45.681 1.00 35.79 ? 324 THR A N     1 
ATOM   2602 C  CA    . THR A 1 324 ? 71.177  42.796  44.352 1.00 33.39 ? 324 THR A CA    1 
ATOM   2603 C  C     . THR A 1 324 ? 71.917  43.750  43.396 1.00 33.78 ? 324 THR A C     1 
ATOM   2604 O  O     . THR A 1 324 ? 71.866  43.553  42.164 1.00 32.00 ? 324 THR A O     1 
ATOM   2605 C  CB    . THR A 1 324 ? 69.907  42.244  43.616 1.00 29.17 ? 324 THR A CB    1 
ATOM   2606 O  OG1   . THR A 1 324 ? 69.084  43.308  43.161 1.00 31.78 ? 324 THR A OG1   1 
ATOM   2607 C  CG2   . THR A 1 324 ? 69.142  41.170  44.362 1.00 20.13 ? 324 THR A CG2   1 
ATOM   2608 N  N     . SER A 1 325 ? 72.626  44.742  43.950 1.00 33.98 ? 325 SER A N     1 
ATOM   2609 C  CA    . SER A 1 325 ? 73.265  45.803  43.139 1.00 37.61 ? 325 SER A CA    1 
ATOM   2610 C  C     . SER A 1 325 ? 74.375  45.281  42.241 1.00 35.59 ? 325 SER A C     1 
ATOM   2611 O  O     . SER A 1 325 ? 74.516  45.730  41.089 1.00 33.12 ? 325 SER A O     1 
ATOM   2612 C  CB    . SER A 1 325 ? 73.849  46.921  44.004 1.00 43.69 ? 325 SER A CB    1 
ATOM   2613 O  OG    . SER A 1 325 ? 74.620  46.363  45.058 1.00 46.20 ? 325 SER A OG    1 
ATOM   2614 N  N     . ASN A 1 326 ? 74.957  44.167  42.695 1.00 31.94 ? 326 ASN A N     1 
ATOM   2615 C  CA    . ASN A 1 326 ? 75.988  43.515  41.931 1.00 28.10 ? 326 ASN A CA    1 
ATOM   2616 C  C     . ASN A 1 326 ? 75.580  42.714  40.698 1.00 26.97 ? 326 ASN A C     1 
ATOM   2617 O  O     . ASN A 1 326 ? 76.487  42.254  39.999 1.00 31.56 ? 326 ASN A O     1 
ATOM   2618 C  CB    . ASN A 1 326 ? 76.794  42.681  42.869 1.00 29.73 ? 326 ASN A CB    1 
ATOM   2619 C  CG    . ASN A 1 326 ? 77.730  43.485  43.643 1.00 30.22 ? 326 ASN A CG    1 
ATOM   2620 O  OD1   . ASN A 1 326 ? 77.798  43.390  44.888 1.00 36.00 ? 326 ASN A OD1   1 
ATOM   2621 N  ND2   . ASN A 1 326 ? 78.615  44.126  42.917 1.00 29.80 ? 326 ASN A ND2   1 
ATOM   2622 N  N     . PHE A 1 327 ? 74.291  42.654  40.376 1.00 15.17 ? 327 PHE A N     1 
ATOM   2623 C  CA    . PHE A 1 327 ? 73.679  41.931  39.237 1.00 21.30 ? 327 PHE A CA    1 
ATOM   2624 C  C     . PHE A 1 327 ? 72.963  42.873  38.299 1.00 25.39 ? 327 PHE A C     1 
ATOM   2625 O  O     . PHE A 1 327 ? 72.426  43.889  38.753 1.00 29.75 ? 327 PHE A O     1 
ATOM   2626 C  CB    . PHE A 1 327 ? 72.597  40.877  39.759 1.00 20.06 ? 327 PHE A CB    1 
ATOM   2627 C  CG    . PHE A 1 327 ? 73.232  39.734  40.593 1.00 11.27 ? 327 PHE A CG    1 
ATOM   2628 C  CD1   . PHE A 1 327 ? 73.440  39.904  41.952 1.00 12.99 ? 327 PHE A CD1   1 
ATOM   2629 C  CD2   . PHE A 1 327 ? 73.753  38.525  39.938 1.00 18.06 ? 327 PHE A CD2   1 
ATOM   2630 C  CE1   . PHE A 1 327 ? 74.161  38.928  42.737 1.00 18.36 ? 327 PHE A CE1   1 
ATOM   2631 C  CE2   . PHE A 1 327 ? 74.475  37.485  40.709 1.00 9.09  ? 327 PHE A CE2   1 
ATOM   2632 C  CZ    . PHE A 1 327 ? 74.675  37.714  42.101 1.00 18.15 ? 327 PHE A CZ    1 
ATOM   2633 N  N     . ASP A 1 328 ? 72.930  42.556  37.019 1.00 21.82 ? 328 ASP A N     1 
ATOM   2634 C  CA    . ASP A 1 328 ? 72.194  43.284  36.019 1.00 19.79 ? 328 ASP A CA    1 
ATOM   2635 C  C     . ASP A 1 328 ? 70.733  43.095  36.243 1.00 27.45 ? 328 ASP A C     1 
ATOM   2636 O  O     . ASP A 1 328 ? 70.303  42.142  36.892 1.00 32.56 ? 328 ASP A O     1 
ATOM   2637 C  CB    . ASP A 1 328 ? 72.428  42.760  34.610 1.00 22.68 ? 328 ASP A CB    1 
ATOM   2638 C  CG    . ASP A 1 328 ? 73.734  43.200  34.007 1.00 29.67 ? 328 ASP A CG    1 
ATOM   2639 O  OD1   . ASP A 1 328 ? 74.553  43.869  34.693 1.00 31.83 ? 328 ASP A OD1   1 
ATOM   2640 O  OD2   . ASP A 1 328 ? 73.936  42.826  32.830 1.00 30.91 ? 328 ASP A OD2   1 
ATOM   2641 N  N     . ASP A 1 329 ? 69.962  43.970  35.625 1.00 27.09 ? 329 ASP A N     1 
ATOM   2642 C  CA    . ASP A 1 329 ? 68.528  43.926  35.790 1.00 28.52 ? 329 ASP A CA    1 
ATOM   2643 C  C     . ASP A 1 329 ? 67.996  43.179  34.641 1.00 27.61 ? 329 ASP A C     1 
ATOM   2644 O  O     . ASP A 1 329 ? 68.620  43.198  33.587 1.00 30.78 ? 329 ASP A O     1 
ATOM   2645 C  CB    . ASP A 1 329 ? 67.987  45.352  35.861 1.00 31.37 ? 329 ASP A CB    1 
ATOM   2646 C  CG    . ASP A 1 329 ? 67.952  45.852  37.284 1.00 35.45 ? 329 ASP A CG    1 
ATOM   2647 O  OD1   . ASP A 1 329 ? 68.865  45.732  38.154 1.00 43.18 ? 329 ASP A OD1   1 
ATOM   2648 O  OD2   . ASP A 1 329 ? 66.822  46.175  37.615 1.00 49.15 ? 329 ASP A OD2   1 
ATOM   2649 N  N     . TYR A 1 330 ? 66.934  42.405  34.875 1.00 24.88 ? 330 TYR A N     1 
ATOM   2650 C  CA    . TYR A 1 330 ? 66.354  41.599  33.787 1.00 22.87 ? 330 TYR A CA    1 
ATOM   2651 C  C     . TYR A 1 330 ? 64.867  41.831  33.750 1.00 21.26 ? 330 TYR A C     1 
ATOM   2652 O  O     . TYR A 1 330 ? 64.291  42.057  34.822 1.00 24.92 ? 330 TYR A O     1 
ATOM   2653 C  CB    . TYR A 1 330 ? 66.602  40.072  34.065 1.00 27.91 ? 330 TYR A CB    1 
ATOM   2654 C  CG    . TYR A 1 330 ? 68.054  39.595  34.027 1.00 21.75 ? 330 TYR A CG    1 
ATOM   2655 C  CD1   . TYR A 1 330 ? 68.867  39.779  35.103 1.00 21.40 ? 330 TYR A CD1   1 
ATOM   2656 C  CD2   . TYR A 1 330 ? 68.619  39.075  32.862 1.00 21.11 ? 330 TYR A CD2   1 
ATOM   2657 C  CE1   . TYR A 1 330 ? 70.237  39.473  35.014 1.00 25.95 ? 330 TYR A CE1   1 
ATOM   2658 C  CE2   . TYR A 1 330 ? 69.947  38.742  32.769 1.00 21.92 ? 330 TYR A CE2   1 
ATOM   2659 C  CZ    . TYR A 1 330 ? 70.758  38.948  33.846 1.00 22.67 ? 330 TYR A CZ    1 
ATOM   2660 O  OH    . TYR A 1 330 ? 72.117  38.686  33.763 1.00 26.47 ? 330 TYR A OH    1 
ATOM   2661 N  N     . GLU A 1 331 ? 64.254  41.626  32.598 1.00 19.88 ? 331 GLU A N     1 
ATOM   2662 C  CA    . GLU A 1 331 ? 62.793  41.700  32.553 1.00 25.20 ? 331 GLU A CA    1 
ATOM   2663 C  C     . GLU A 1 331 ? 62.117  40.602  33.383 1.00 29.76 ? 331 GLU A C     1 
ATOM   2664 O  O     . GLU A 1 331 ? 62.711  39.540  33.488 1.00 34.80 ? 331 GLU A O     1 
ATOM   2665 C  CB    . GLU A 1 331 ? 62.306  41.700  31.121 1.00 30.97 ? 331 GLU A CB    1 
ATOM   2666 C  CG    . GLU A 1 331 ? 62.300  40.344  30.399 1.00 43.28 ? 331 GLU A CG    1 
ATOM   2667 C  CD    . GLU A 1 331 ? 61.679  40.433  29.018 0.00 36.59 ? 331 GLU A CD    1 
ATOM   2668 O  OE1   . GLU A 1 331 ? 60.448  40.638  28.924 0.00 38.23 ? 331 GLU A OE1   1 
ATOM   2669 O  OE2   . GLU A 1 331 ? 62.418  40.296  28.023 0.00 38.23 ? 331 GLU A OE2   1 
ATOM   2670 N  N     . GLU A 1 332 ? 61.136  40.929  34.221 1.00 32.18 ? 332 GLU A N     1 
ATOM   2671 C  CA    . GLU A 1 332 ? 60.436  39.900  34.974 1.00 31.46 ? 332 GLU A CA    1 
ATOM   2672 C  C     . GLU A 1 332 ? 59.275  39.228  34.260 1.00 33.03 ? 332 GLU A C     1 
ATOM   2673 O  O     . GLU A 1 332 ? 58.667  39.774  33.344 1.00 39.52 ? 332 GLU A O     1 
ATOM   2674 C  CB    . GLU A 1 332 ? 60.014  40.361  36.341 1.00 29.71 ? 332 GLU A CB    1 
ATOM   2675 C  CG    . GLU A 1 332 ? 61.023  41.140  37.071 1.00 33.02 ? 332 GLU A CG    1 
ATOM   2676 C  CD    . GLU A 1 332 ? 62.100  40.312  37.703 1.00 40.53 ? 332 GLU A CD    1 
ATOM   2677 O  OE1   . GLU A 1 332 ? 61.895  39.184  38.228 1.00 41.29 ? 332 GLU A OE1   1 
ATOM   2678 O  OE2   . GLU A 1 332 ? 63.206  40.869  37.727 1.00 41.21 ? 332 GLU A OE2   1 
ATOM   2679 N  N     . GLU A 1 333 ? 59.349  37.915  34.318 1.00 36.93 ? 333 GLU A N     1 
ATOM   2680 C  CA    . GLU A 1 333 ? 58.323  37.038  33.790 1.00 43.51 ? 333 GLU A CA    1 
ATOM   2681 C  C     . GLU A 1 333 ? 57.486  36.508  34.933 1.00 45.42 ? 333 GLU A C     1 
ATOM   2682 O  O     . GLU A 1 333 ? 57.948  36.364  36.074 1.00 47.73 ? 333 GLU A O     1 
ATOM   2683 C  CB    . GLU A 1 333 ? 58.970  35.850  33.085 1.00 40.01 ? 333 GLU A CB    1 
ATOM   2684 C  CG    . GLU A 1 333 ? 59.553  36.270  31.776 1.00 46.75 ? 333 GLU A CG    1 
ATOM   2685 C  CD    . GLU A 1 333 ? 59.982  35.079  30.930 0.00 45.31 ? 333 GLU A CD    1 
ATOM   2686 O  OE1   . GLU A 1 333 ? 59.264  34.055  30.926 0.00 46.46 ? 333 GLU A OE1   1 
ATOM   2687 O  OE2   . GLU A 1 333 ? 61.040  35.173  30.281 0.00 46.46 ? 333 GLU A OE2   1 
ATOM   2688 N  N     . GLU A 1 334 ? 56.205  36.343  34.641 1.00 49.60 ? 334 GLU A N     1 
ATOM   2689 C  CA    . GLU A 1 334 ? 55.325  35.688  35.611 1.00 51.26 ? 334 GLU A CA    1 
ATOM   2690 C  C     . GLU A 1 334 ? 55.515  34.177  35.384 1.00 47.44 ? 334 GLU A C     1 
ATOM   2691 O  O     . GLU A 1 334 ? 55.669  33.693  34.259 1.00 49.00 ? 334 GLU A O     1 
ATOM   2692 C  CB    . GLU A 1 334 ? 53.860  36.056  35.393 0.00 57.12 ? 334 GLU A CB    1 
ATOM   2693 C  CG    . GLU A 1 334 ? 53.457  37.389  35.996 0.00 61.15 ? 334 GLU A CG    1 
ATOM   2694 C  CD    . GLU A 1 334 ? 52.128  37.316  36.731 0.00 61.30 ? 334 GLU A CD    1 
ATOM   2695 O  OE1   . GLU A 1 334 ? 51.081  37.150  36.071 0.00 59.40 ? 334 GLU A OE1   1 
ATOM   2696 O  OE2   . GLU A 1 334 ? 52.131  37.420  37.974 0.00 59.40 ? 334 GLU A OE2   1 
ATOM   2697 N  N     . ILE A 1 335 ? 55.627  33.449  36.470 1.00 45.40 ? 335 ILE A N     1 
ATOM   2698 C  CA    . ILE A 1 335 ? 55.726  32.018  36.382 1.00 48.28 ? 335 ILE A CA    1 
ATOM   2699 C  C     . ILE A 1 335 ? 54.363  31.369  36.618 1.00 48.66 ? 335 ILE A C     1 
ATOM   2700 O  O     . ILE A 1 335 ? 53.823  31.389  37.743 1.00 51.96 ? 335 ILE A O     1 
ATOM   2701 C  CB    . ILE A 1 335 ? 56.733  31.456  37.406 1.00 51.78 ? 335 ILE A CB    1 
ATOM   2702 C  CG1   . ILE A 1 335 ? 57.268  32.539  38.346 0.00 47.84 ? 335 ILE A CG1   1 
ATOM   2703 C  CG2   . ILE A 1 335 ? 57.904  30.805  36.686 0.00 50.24 ? 335 ILE A CG2   1 
ATOM   2704 C  CD1   . ILE A 1 335 ? 58.295  32.025  39.328 0.00 44.72 ? 335 ILE A CD1   1 
ATOM   2705 N  N     . ARG A 1 336 ? 53.842  30.777  35.546 1.00 47.07 ? 336 ARG A N     1 
ATOM   2706 C  CA    . ARG A 1 336 ? 52.618  29.985  35.589 1.00 48.72 ? 336 ARG A CA    1 
ATOM   2707 C  C     . ARG A 1 336 ? 52.857  28.524  36.035 1.00 46.88 ? 336 ARG A C     1 
ATOM   2708 O  O     . ARG A 1 336 ? 53.877  27.961  35.658 1.00 48.52 ? 336 ARG A O     1 
ATOM   2709 C  CB    . ARG A 1 336 ? 51.932  30.016  34.204 1.00 50.49 ? 336 ARG A CB    1 
ATOM   2710 C  CG    . ARG A 1 336 ? 52.224  28.952  33.104 1.00 53.40 ? 336 ARG A CG    1 
ATOM   2711 C  CD    . ARG A 1 336 ? 51.247  27.749  33.041 1.00 60.15 ? 336 ARG A CD    1 
ATOM   2712 N  NE    . ARG A 1 336 ? 49.921  27.731  32.364 1.00 52.46 ? 336 ARG A NE    1 
ATOM   2713 C  CZ    . ARG A 1 336 ? 48.870  28.537  32.544 1.00 51.51 ? 336 ARG A CZ    1 
ATOM   2714 N  NH1   . ARG A 1 336 ? 48.926  29.629  33.293 1.00 52.39 ? 336 ARG A NH1   1 
ATOM   2715 N  NH2   . ARG A 1 336 ? 47.670  27.950  32.540 1.00 46.00 ? 336 ARG A NH2   1 
ATOM   2716 N  N     . VAL A 1 337 ? 52.014  27.962  36.912 1.00 44.24 ? 337 VAL A N     1 
ATOM   2717 C  CA    . VAL A 1 337 ? 52.043  26.511  37.202 1.00 39.77 ? 337 VAL A CA    1 
ATOM   2718 C  C     . VAL A 1 337 ? 50.812  25.870  36.548 1.00 37.20 ? 337 VAL A C     1 
ATOM   2719 O  O     . VAL A 1 337 ? 49.759  26.302  36.980 1.00 40.83 ? 337 VAL A O     1 
ATOM   2720 C  CB    . VAL A 1 337 ? 52.067  26.180  38.679 1.00 34.77 ? 337 VAL A CB    1 
ATOM   2721 C  CG1   . VAL A 1 337 ? 52.108  24.662  38.839 1.00 34.84 ? 337 VAL A CG1   1 
ATOM   2722 C  CG2   . VAL A 1 337 ? 53.292  26.815  39.342 1.00 32.90 ? 337 VAL A CG2   1 
ATOM   2723 N  N     . SER A 1 338 ? 50.887  25.023  35.505 1.00 33.16 ? 338 SER A N     1 
ATOM   2724 C  CA    . SER A 1 338 ? 49.699  24.365  34.875 1.00 36.89 ? 338 SER A CA    1 
ATOM   2725 C  C     . SER A 1 338 ? 48.868  23.484  35.852 1.00 38.41 ? 338 SER A C     1 
ATOM   2726 O  O     . SER A 1 338 ? 49.277  23.073  36.947 1.00 32.32 ? 338 SER A O     1 
ATOM   2727 C  CB    . SER A 1 338 ? 49.879  23.645  33.460 1.00 35.81 ? 338 SER A CB    1 
ATOM   2728 O  OG    . SER A 1 338 ? 48.785  23.580  32.451 1.00 32.96 ? 338 SER A OG    1 
ATOM   2729 N  N     . ILE A 1 339 ? 47.579  23.436  35.537 1.00 43.13 ? 339 ILE A N     1 
ATOM   2730 C  CA    . ILE A 1 339 ? 46.626  22.611  36.275 1.00 47.90 ? 339 ILE A CA    1 
ATOM   2731 C  C     . ILE A 1 339 ? 46.839  21.075  36.021 1.00 51.37 ? 339 ILE A C     1 
ATOM   2732 O  O     . ILE A 1 339 ? 46.450  20.234  36.828 1.00 56.43 ? 339 ILE A O     1 
ATOM   2733 C  CB    . ILE A 1 339 ? 45.190  23.259  36.125 1.00 46.82 ? 339 ILE A CB    1 
ATOM   2734 C  CG1   . ILE A 1 339 ? 44.238  22.717  37.191 1.00 49.52 ? 339 ILE A CG1   1 
ATOM   2735 C  CG2   . ILE A 1 339 ? 44.593  23.030  34.728 1.00 43.47 ? 339 ILE A CG2   1 
ATOM   2736 C  CD1   . ILE A 1 339 ? 44.737  22.623  38.636 1.00 48.46 ? 339 ILE A CD1   1 
ATOM   2737 N  N     . ASN A 1 340 ? 47.613  20.731  34.990 1.00 53.86 ? 340 ASN A N     1 
ATOM   2738 C  CA    . ASN A 1 340 ? 48.032  19.370  34.629 1.00 54.58 ? 340 ASN A CA    1 
ATOM   2739 C  C     . ASN A 1 340 ? 49.544  19.204  34.721 1.00 50.64 ? 340 ASN A C     1 
ATOM   2740 O  O     . ASN A 1 340 ? 50.263  20.093  34.276 1.00 48.71 ? 340 ASN A O     1 
ATOM   2741 C  CB    . ASN A 1 340 ? 47.725  19.014  33.170 1.00 57.07 ? 340 ASN A CB    1 
ATOM   2742 C  CG    . ASN A 1 340 ? 46.252  19.022  32.851 1.00 62.96 ? 340 ASN A CG    1 
ATOM   2743 O  OD1   . ASN A 1 340 ? 45.465  18.227  33.378 1.00 61.20 ? 340 ASN A OD1   1 
ATOM   2744 N  ND2   . ASN A 1 340 ? 45.879  19.920  31.941 1.00 64.72 ? 340 ASN A ND2   1 
ATOM   2745 N  N     . GLU A 1 341 ? 49.993  18.122  35.367 1.00 49.49 ? 341 GLU A N     1 
ATOM   2746 C  CA    . GLU A 1 341 ? 51.404  17.683  35.438 1.00 46.37 ? 341 GLU A CA    1 
ATOM   2747 C  C     . GLU A 1 341 ? 51.948  17.367  34.034 1.00 43.85 ? 341 GLU A C     1 
ATOM   2748 O  O     . GLU A 1 341 ? 51.215  16.939  33.136 1.00 41.43 ? 341 GLU A O     1 
ATOM   2749 C  CB    . GLU A 1 341 ? 51.533  16.506  36.378 1.00 45.24 ? 341 GLU A CB    1 
ATOM   2750 C  CG    . GLU A 1 341 ? 52.925  15.997  36.694 1.00 48.88 ? 341 GLU A CG    1 
ATOM   2751 C  CD    . GLU A 1 341 ? 52.867  14.549  37.168 1.00 54.31 ? 341 GLU A CD    1 
ATOM   2752 O  OE1   . GLU A 1 341 ? 52.579  13.665  36.298 1.00 56.71 ? 341 GLU A OE1   1 
ATOM   2753 O  OE2   . GLU A 1 341 ? 53.038  14.302  38.395 1.00 50.70 ? 341 GLU A OE2   1 
ATOM   2754 N  N     . LYS A 1 342 ? 53.076  18.013  33.755 1.00 44.33 ? 342 LYS A N     1 
ATOM   2755 C  CA    . LYS A 1 342 ? 53.780  17.928  32.473 1.00 42.74 ? 342 LYS A CA    1 
ATOM   2756 C  C     . LYS A 1 342 ? 55.004  17.087  32.755 1.00 43.24 ? 342 LYS A C     1 
ATOM   2757 O  O     . LYS A 1 342 ? 55.763  17.342  33.714 1.00 43.39 ? 342 LYS A O     1 
ATOM   2758 C  CB    . LYS A 1 342 ? 54.326  19.298  32.028 1.00 45.83 ? 342 LYS A CB    1 
ATOM   2759 C  CG    . LYS A 1 342 ? 53.321  20.436  31.998 1.00 47.19 ? 342 LYS A CG    1 
ATOM   2760 C  CD    . LYS A 1 342 ? 52.109  20.033  31.195 1.00 42.06 ? 342 LYS A CD    1 
ATOM   2761 C  CE    . LYS A 1 342 ? 51.081  21.082  31.243 1.00 35.88 ? 342 LYS A CE    1 
ATOM   2762 N  NZ    . LYS A 1 342 ? 51.116  21.607  29.853 1.00 40.82 ? 342 LYS A NZ    1 
ATOM   2763 N  N     . CYS A 1 343 ? 55.213  16.163  31.829 1.00 42.83 ? 343 CYS A N     1 
ATOM   2764 C  CA    . CYS A 1 343 ? 56.339  15.216  31.775 1.00 45.29 ? 343 CYS A CA    1 
ATOM   2765 C  C     . CYS A 1 343 ? 56.753  14.555  33.081 1.00 41.42 ? 343 CYS A C     1 
ATOM   2766 O  O     . CYS A 1 343 ? 57.932  14.500  33.398 1.00 47.43 ? 343 CYS A O     1 
ATOM   2767 C  CB    . CYS A 1 343 ? 57.515  15.871  31.015 1.00 46.62 ? 343 CYS A CB    1 
ATOM   2768 S  SG    . CYS A 1 343 ? 56.968  16.598  29.409 1.00 54.27 ? 343 CYS A SG    1 
ATOM   2769 N  N     . GLY A 1 344 ? 55.767  14.155  33.881 1.00 39.82 ? 344 GLY A N     1 
ATOM   2770 C  CA    . GLY A 1 344 ? 55.986  13.549  35.182 1.00 37.19 ? 344 GLY A CA    1 
ATOM   2771 C  C     . GLY A 1 344 ? 56.888  12.300  35.149 1.00 38.79 ? 344 GLY A C     1 
ATOM   2772 O  O     . GLY A 1 344 ? 57.804  12.237  35.961 1.00 41.49 ? 344 GLY A O     1 
ATOM   2773 N  N     . LYS A 1 345 ? 56.773  11.436  34.137 1.00 34.74 ? 345 LYS A N     1 
ATOM   2774 C  CA    . LYS A 1 345 ? 57.583  10.212  34.035 1.00 36.70 ? 345 LYS A CA    1 
ATOM   2775 C  C     . LYS A 1 345 ? 59.097  10.508  33.948 1.00 31.00 ? 345 LYS A C     1 
ATOM   2776 O  O     . LYS A 1 345 ? 59.757  10.257  34.911 1.00 24.02 ? 345 LYS A O     1 
ATOM   2777 C  CB    . LYS A 1 345 ? 57.192  9.394   32.792 1.00 42.33 ? 345 LYS A CB    1 
ATOM   2778 C  CG    . LYS A 1 345 ? 57.404  7.895   33.004 1.00 50.34 ? 345 LYS A CG    1 
ATOM   2779 C  CD    . LYS A 1 345 ? 57.901  7.253   31.717 0.00 49.98 ? 345 LYS A CD    1 
ATOM   2780 C  CE    . LYS A 1 345 ? 58.396  5.836   31.947 0.00 51.06 ? 345 LYS A CE    1 
ATOM   2781 N  NZ    . LYS A 1 345 ? 57.308  4.846   32.173 0.00 49.74 ? 345 LYS A NZ    1 
ATOM   2782 N  N     . GLU A 1 346 ? 59.486  11.393  33.044 1.00 26.98 ? 346 GLU A N     1 
ATOM   2783 C  CA    . GLU A 1 346 ? 60.872  11.789  32.815 1.00 32.82 ? 346 GLU A CA    1 
ATOM   2784 C  C     . GLU A 1 346 ? 61.579  12.425  33.984 1.00 33.97 ? 346 GLU A C     1 
ATOM   2785 O  O     . GLU A 1 346 ? 62.839  12.411  34.015 1.00 34.22 ? 346 GLU A O     1 
ATOM   2786 C  CB    . GLU A 1 346 ? 60.994  12.731  31.622 1.00 36.75 ? 346 GLU A CB    1 
ATOM   2787 C  CG    . GLU A 1 346 ? 60.500  12.104  30.353 1.00 48.39 ? 346 GLU A CG    1 
ATOM   2788 C  CD    . GLU A 1 346 ? 59.054  12.463  29.997 1.00 57.67 ? 346 GLU A CD    1 
ATOM   2789 O  OE1   . GLU A 1 346 ? 58.131  12.491  30.861 1.00 54.17 ? 346 GLU A OE1   1 
ATOM   2790 O  OE2   . GLU A 1 346 ? 58.855  12.695  28.772 1.00 66.19 ? 346 GLU A OE2   1 
ATOM   2791 N  N     . PHE A 1 347 ? 60.778  13.014  34.897 1.00 30.84 ? 347 PHE A N     1 
ATOM   2792 C  CA    . PHE A 1 347 ? 61.385  13.665  36.060 1.00 26.49 ? 347 PHE A CA    1 
ATOM   2793 C  C     . PHE A 1 347 ? 61.078  12.996  37.341 1.00 24.62 ? 347 PHE A C     1 
ATOM   2794 O  O     . PHE A 1 347 ? 61.444  13.548  38.379 1.00 24.49 ? 347 PHE A O     1 
ATOM   2795 C  CB    . PHE A 1 347 ? 61.239  15.227  36.156 1.00 28.12 ? 347 PHE A CB    1 
ATOM   2796 C  CG    . PHE A 1 347 ? 61.629  15.951  34.898 1.00 26.07 ? 347 PHE A CG    1 
ATOM   2797 C  CD1   . PHE A 1 347 ? 62.970  16.260  34.631 1.00 22.25 ? 347 PHE A CD1   1 
ATOM   2798 C  CD2   . PHE A 1 347 ? 60.671  16.194  33.920 1.00 25.64 ? 347 PHE A CD2   1 
ATOM   2799 C  CE1   . PHE A 1 347 ? 63.329  16.812  33.394 1.00 24.52 ? 347 PHE A CE1   1 
ATOM   2800 C  CE2   . PHE A 1 347 ? 61.007  16.729  32.667 1.00 26.22 ? 347 PHE A CE2   1 
ATOM   2801 C  CZ    . PHE A 1 347 ? 62.352  17.046  32.407 1.00 22.61 ? 347 PHE A CZ    1 
ATOM   2802 N  N     . SER A 1 348 ? 60.658  11.734  37.317 1.00 24.19 ? 348 SER A N     1 
ATOM   2803 C  CA    . SER A 1 348 ? 60.403  11.093  38.618 1.00 25.08 ? 348 SER A CA    1 
ATOM   2804 C  C     . SER A 1 348 ? 61.518  11.072  39.655 1.00 21.59 ? 348 SER A C     1 
ATOM   2805 O  O     . SER A 1 348 ? 61.187  11.177  40.836 1.00 23.99 ? 348 SER A O     1 
ATOM   2806 C  CB    . SER A 1 348 ? 59.898  9.671   38.510 1.00 31.03 ? 348 SER A CB    1 
ATOM   2807 O  OG    . SER A 1 348 ? 59.472  9.455   37.202 1.00 36.37 ? 348 SER A OG    1 
ATOM   2808 N  N     . GLU A 1 349 ? 62.806  11.023  39.285 1.00 23.23 ? 349 GLU A N     1 
ATOM   2809 C  CA    . GLU A 1 349 ? 63.801  10.997  40.373 1.00 19.71 ? 349 GLU A CA    1 
ATOM   2810 C  C     . GLU A 1 349 ? 64.177  12.333  40.941 1.00 20.97 ? 349 GLU A C     1 
ATOM   2811 O  O     . GLU A 1 349 ? 64.917  12.376  41.886 1.00 21.75 ? 349 GLU A O     1 
ATOM   2812 C  CB    . GLU A 1 349 ? 65.106  10.311  39.999 1.00 24.98 ? 349 GLU A CB    1 
ATOM   2813 C  CG    . GLU A 1 349 ? 65.895  10.914  38.842 1.00 32.96 ? 349 GLU A CG    1 
ATOM   2814 C  CD    . GLU A 1 349 ? 67.261  10.219  38.650 1.00 34.55 ? 349 GLU A CD    1 
ATOM   2815 O  OE1   . GLU A 1 349 ? 67.322  8.959   38.568 1.00 27.09 ? 349 GLU A OE1   1 
ATOM   2816 O  OE2   . GLU A 1 349 ? 68.279  10.928  38.768 1.00 23.75 ? 349 GLU A OE2   1 
ATOM   2817 N  N     . PHE A 1 350 ? 63.940  13.384  40.163 1.00 25.17 ? 350 PHE A N     1 
ATOM   2818 C  CA    . PHE A 1 350 ? 64.225  14.777  40.557 1.00 22.00 ? 350 PHE A CA    1 
ATOM   2819 C  C     . PHE A 1 350 ? 63.575  15.051  41.881 1.00 20.02 ? 350 PHE A C     1 
ATOM   2820 O  O     . PHE A 1 350 ? 64.245  15.347  42.874 1.00 23.71 ? 350 PHE A O     1 
ATOM   2821 C  CB    . PHE A 1 350 ? 63.646  15.755  39.523 1.00 24.04 ? 350 PHE A CB    1 
ATOM   2822 C  CG    . PHE A 1 350 ? 64.152  17.165  39.681 1.00 30.16 ? 350 PHE A CG    1 
ATOM   2823 C  CD1   . PHE A 1 350 ? 63.626  18.003  40.701 1.00 27.75 ? 350 PHE A CD1   1 
ATOM   2824 C  CD2   . PHE A 1 350 ? 65.306  17.577  38.949 1.00 26.95 ? 350 PHE A CD2   1 
ATOM   2825 C  CE1   . PHE A 1 350 ? 64.263  19.263  41.026 1.00 32.67 ? 350 PHE A CE1   1 
ATOM   2826 C  CE2   . PHE A 1 350 ? 65.944  18.815  39.241 1.00 26.07 ? 350 PHE A CE2   1 
ATOM   2827 C  CZ    . PHE A 1 350 ? 65.437  19.670  40.287 1.00 31.00 ? 350 PHE A CZ    1 
ATOM   2828 O  OXT   . PHE A 1 350 ? 62.376  14.784  41.955 1.00 29.74 ? 350 PHE A OXT   1 
ATOM   2829 N  N     . THR B 2 1   ? 93.526  47.852  17.812 1.00 16.29 ? 1   THR I N     1 
ATOM   2830 C  CA    . THR B 2 1   ? 94.163  47.060  18.892 1.00 14.43 ? 1   THR I CA    1 
ATOM   2831 C  C     . THR B 2 1   ? 93.159  45.884  19.063 1.00 24.42 ? 1   THR I C     1 
ATOM   2832 O  O     . THR B 2 1   ? 91.994  46.002  18.610 1.00 23.04 ? 1   THR I O     1 
ATOM   2833 C  CB    . THR B 2 1   ? 94.264  47.755  20.136 1.00 19.01 ? 1   THR I CB    1 
ATOM   2834 O  OG1   . THR B 2 1   ? 92.947  48.007  20.669 1.00 23.36 ? 1   THR I OG1   1 
ATOM   2835 C  CG2   . THR B 2 1   ? 95.154  49.053  20.015 1.00 21.98 ? 1   THR I CG2   1 
ATOM   2836 N  N     . THR B 2 2   ? 93.596  44.752  19.631 1.00 23.11 ? 2   THR I N     1 
ATOM   2837 C  CA    . THR B 2 2   ? 92.698  43.578  19.788 1.00 28.51 ? 2   THR I CA    1 
ATOM   2838 C  C     . THR B 2 2   ? 91.558  43.886  20.733 1.00 23.40 ? 2   THR I C     1 
ATOM   2839 O  O     . THR B 2 2   ? 90.442  43.487  20.390 1.00 26.50 ? 2   THR I O     1 
ATOM   2840 C  CB    . THR B 2 2   ? 93.366  42.260  20.321 1.00 28.03 ? 2   THR I CB    1 
ATOM   2841 O  OG1   . THR B 2 2   ? 94.574  42.112  19.599 1.00 31.94 ? 2   THR I OG1   1 
ATOM   2842 C  CG2   . THR B 2 2   ? 92.485  41.065  19.934 1.00 22.92 ? 2   THR I CG2   1 
ATOM   2843 N  N     . TYR B 2 3   ? 91.827  44.631  21.810 1.00 20.51 ? 3   TYR I N     1 
ATOM   2844 C  CA    . TYR B 2 3   ? 90.751  45.076  22.714 1.00 25.43 ? 3   TYR I CA    1 
ATOM   2845 C  C     . TYR B 2 3   ? 89.684  45.827  21.906 1.00 25.37 ? 3   TYR I C     1 
ATOM   2846 O  O     . TYR B 2 3   ? 88.488  45.593  22.140 1.00 29.56 ? 3   TYR I O     1 
ATOM   2847 C  CB    . TYR B 2 3   ? 91.270  45.975  23.843 1.00 29.27 ? 3   TYR I CB    1 
ATOM   2848 C  CG    . TYR B 2 3   ? 90.224  46.739  24.656 1.00 37.46 ? 3   TYR I CG    1 
ATOM   2849 C  CD1   . TYR B 2 3   ? 89.584  46.140  25.773 1.00 38.67 ? 3   TYR I CD1   1 
ATOM   2850 C  CD2   . TYR B 2 3   ? 89.801  48.041  24.254 1.00 45.40 ? 3   TYR I CD2   1 
ATOM   2851 C  CE1   . TYR B 2 3   ? 88.536  46.800  26.490 1.00 41.97 ? 3   TYR I CE1   1 
ATOM   2852 C  CE2   . TYR B 2 3   ? 88.725  48.710  24.934 1.00 47.85 ? 3   TYR I CE2   1 
ATOM   2853 C  CZ    . TYR B 2 3   ? 88.093  48.079  26.048 1.00 49.35 ? 3   TYR I CZ    1 
ATOM   2854 O  OH    . TYR B 2 3   ? 86.956  48.686  26.587 1.00 50.80 ? 3   TYR I OH    1 
ATOM   2855 N  N     . ALA B 2 4   ? 90.102  46.694  20.970 1.00 21.89 ? 4   ALA I N     1 
ATOM   2856 C  CA    . ALA B 2 4   ? 89.184  47.480  20.164 1.00 16.06 ? 4   ALA I CA    1 
ATOM   2857 C  C     . ALA B 2 4   ? 88.345  46.565  19.311 1.00 16.02 ? 4   ALA I C     1 
ATOM   2858 O  O     . ALA B 2 4   ? 87.154  46.872  19.104 1.00 18.92 ? 4   ALA I O     1 
ATOM   2859 C  CB    . ALA B 2 4   ? 89.929  48.417  19.238 1.00 13.70 ? 4   ALA I CB    1 
ATOM   2860 N  N     . ASP B 2 5   ? 88.969  45.631  18.586 1.00 15.41 ? 5   ASP I N     1 
ATOM   2861 C  CA    . ASP B 2 5   ? 88.152  44.747  17.748 1.00 17.44 ? 5   ASP I CA    1 
ATOM   2862 C  C     . ASP B 2 5   ? 87.147  43.880  18.568 1.00 17.93 ? 5   ASP I C     1 
ATOM   2863 O  O     . ASP B 2 5   ? 85.968  43.762  18.208 1.00 20.06 ? 5   ASP I O     1 
ATOM   2864 C  CB    . ASP B 2 5   ? 89.028  43.896  16.826 1.00 22.22 ? 5   ASP I CB    1 
ATOM   2865 C  CG    . ASP B 2 5   ? 89.919  44.723  15.902 1.00 31.26 ? 5   ASP I CG    1 
ATOM   2866 O  OD1   . ASP B 2 5   ? 89.559  45.840  15.402 1.00 28.52 ? 5   ASP I OD1   1 
ATOM   2867 O  OD2   . ASP B 2 5   ? 90.992  44.155  15.608 1.00 30.99 ? 5   ASP I OD2   1 
ATOM   2868 N  N     . PHE B 2 6   ? 87.546  43.505  19.781 1.00 18.96 ? 6   PHE I N     1 
ATOM   2869 C  CA    . PHE B 2 6   ? 86.680  42.705  20.612 1.00 20.85 ? 6   PHE I CA    1 
ATOM   2870 C  C     . PHE B 2 6   ? 85.522  43.551  21.094 1.00 26.93 ? 6   PHE I C     1 
ATOM   2871 O  O     . PHE B 2 6   ? 84.386  43.108  20.903 1.00 29.85 ? 6   PHE I O     1 
ATOM   2872 C  CB    . PHE B 2 6   ? 87.423  42.116  21.780 1.00 19.63 ? 6   PHE I CB    1 
ATOM   2873 C  CG    . PHE B 2 6   ? 86.542  41.268  22.686 1.00 14.87 ? 6   PHE I CG    1 
ATOM   2874 C  CD1   . PHE B 2 6   ? 85.760  40.246  22.154 1.00 18.69 ? 6   PHE I CD1   1 
ATOM   2875 C  CD2   . PHE B 2 6   ? 86.388  41.618  24.035 1.00 17.38 ? 6   PHE I CD2   1 
ATOM   2876 C  CE1   . PHE B 2 6   ? 84.804  39.574  22.940 1.00 17.46 ? 6   PHE I CE1   1 
ATOM   2877 C  CE2   . PHE B 2 6   ? 85.430  40.929  24.871 1.00 20.53 ? 6   PHE I CE2   1 
ATOM   2878 C  CZ    . PHE B 2 6   ? 84.665  39.927  24.262 1.00 12.55 ? 6   PHE I CZ    1 
ATOM   2879 N  N     . ILE B 2 7   ? 85.768  44.775  21.571 1.00 24.59 ? 7   ILE I N     1 
ATOM   2880 C  CA    . ILE B 2 7   ? 84.683  45.669  22.066 1.00 24.07 ? 7   ILE I CA    1 
ATOM   2881 C  C     . ILE B 2 7   ? 83.626  46.045  21.006 1.00 17.69 ? 7   ILE I C     1 
ATOM   2882 O  O     . ILE B 2 7   ? 82.477  46.298  21.311 1.00 15.37 ? 7   ILE I O     1 
ATOM   2883 C  CB    . ILE B 2 7   ? 85.301  46.879  22.863 1.00 27.87 ? 7   ILE I CB    1 
ATOM   2884 C  CG1   . ILE B 2 7   ? 85.878  46.284  24.136 1.00 26.76 ? 7   ILE I CG1   1 
ATOM   2885 C  CG2   . ILE B 2 7   ? 84.236  47.890  23.284 1.00 28.44 ? 7   ILE I CG2   1 
ATOM   2886 C  CD1   . ILE B 2 7   ? 84.825  45.580  25.046 1.00 30.97 ? 7   ILE I CD1   1 
ATOM   2887 N  N     . ALA B 2 8   ? 84.014  45.946  19.744 1.00 12.26 ? 8   ALA I N     1 
ATOM   2888 C  CA    . ALA B 2 8   ? 83.141  46.288  18.659 1.00 17.35 ? 8   ALA I CA    1 
ATOM   2889 C  C     . ALA B 2 8   ? 82.386  45.050  18.132 1.00 21.60 ? 8   ALA I C     1 
ATOM   2890 O  O     . ALA B 2 8   ? 81.554  45.131  17.186 1.00 16.61 ? 8   ALA I O     1 
ATOM   2891 C  CB    . ALA B 2 8   ? 84.048  46.851  17.578 1.00 15.30 ? 8   ALA I CB    1 
ATOM   2892 N  N     . SER B 2 9   ? 82.783  43.867  18.623 1.00 22.79 ? 9   SER I N     1 
ATOM   2893 C  CA    . SER B 2 9   ? 82.154  42.574  18.166 1.00 24.95 ? 9   SER I CA    1 
ATOM   2894 C  C     . SER B 2 9   ? 80.750  42.356  18.657 1.00 19.36 ? 9   SER I C     1 
ATOM   2895 O  O     . SER B 2 9   ? 80.358  42.882  19.699 1.00 18.93 ? 9   SER I O     1 
ATOM   2896 C  CB    . SER B 2 9   ? 82.984  41.410  18.724 1.00 24.54 ? 9   SER I CB    1 
ATOM   2897 O  OG    . SER B 2 9   ? 84.070  41.238  17.831 1.00 43.57 ? 9   SER I OG    1 
ATOM   2898 N  N     . GLY B 2 10  ? 80.189  41.258  18.191 1.00 19.30 ? 10  GLY I N     1 
ATOM   2899 C  CA    . GLY B 2 10  ? 78.849  40.879  18.615 1.00 24.43 ? 10  GLY I CA    1 
ATOM   2900 C  C     . GLY B 2 10  ? 78.706  40.097  19.929 1.00 24.22 ? 10  GLY I C     1 
ATOM   2901 O  O     . GLY B 2 10  ? 77.671  40.170  20.620 1.00 26.84 ? 10  GLY I O     1 
ATOM   2902 N  N     . ARG B 2 11  ? 79.802  39.530  20.396 1.00 23.87 ? 11  ARG I N     1 
ATOM   2903 C  CA    . ARG B 2 11  ? 79.756  38.702  21.601 1.00 24.36 ? 11  ARG I CA    1 
ATOM   2904 C  C     . ARG B 2 11  ? 80.522  39.266  22.824 1.00 25.29 ? 11  ARG I C     1 
ATOM   2905 O  O     . ARG B 2 11  ? 81.366  38.585  23.466 1.00 25.78 ? 11  ARG I O     1 
ATOM   2906 C  CB    . ARG B 2 11  ? 80.186  37.281  21.172 1.00 28.91 ? 11  ARG I CB    1 
ATOM   2907 C  CG    . ARG B 2 11  ? 79.477  36.646  19.915 1.00 21.27 ? 11  ARG I CG    1 
ATOM   2908 C  CD    . ARG B 2 11  ? 79.842  35.199  19.557 1.00 20.32 ? 11  ARG I CD    1 
ATOM   2909 N  NE    . ARG B 2 11  ? 79.905  34.382  20.778 1.00 23.38 ? 11  ARG I NE    1 
ATOM   2910 C  CZ    . ARG B 2 11  ? 78.891  33.692  21.286 1.00 19.58 ? 11  ARG I CZ    1 
ATOM   2911 N  NH1   . ARG B 2 11  ? 77.726  33.747  20.676 1.00 18.19 ? 11  ARG I NH1   1 
ATOM   2912 N  NH2   . ARG B 2 11  ? 79.026  33.000  22.408 1.00 21.20 ? 11  ARG I NH2   1 
ATOM   2913 N  N     . THR B 2 12  ? 80.166  40.498  23.214 1.00 18.62 ? 12  THR I N     1 
ATOM   2914 C  CA    . THR B 2 12  ? 80.820  41.107  24.384 1.00 21.35 ? 12  THR I CA    1 
ATOM   2915 C  C     . THR B 2 12  ? 79.925  41.054  25.631 1.00 17.90 ? 12  THR I C     1 
ATOM   2916 O  O     . THR B 2 12  ? 80.386  41.430  26.739 1.00 17.90 ? 12  THR I O     1 
ATOM   2917 C  CB    . THR B 2 12  ? 81.204  42.602  24.185 1.00 29.21 ? 12  THR I CB    1 
ATOM   2918 O  OG1   . THR B 2 12  ? 79.987  43.310  23.894 1.00 32.52 ? 12  THR I OG1   1 
ATOM   2919 C  CG2   . THR B 2 12  ? 82.239  42.847  23.071 1.00 20.77 ? 12  THR I CG2   1 
ATOM   2920 N  N     . GLY B 2 13  ? 78.672  40.632  25.393 1.00 18.96 ? 13  GLY I N     1 
ATOM   2921 C  CA    . GLY B 2 13  ? 77.604  40.499  26.417 1.00 21.30 ? 13  GLY I CA    1 
ATOM   2922 C  C     . GLY B 2 13  ? 77.571  39.087  27.000 1.00 23.46 ? 13  GLY I C     1 
ATOM   2923 O  O     . GLY B 2 13  ? 78.323  38.216  26.463 1.00 24.28 ? 13  GLY I O     1 
ATOM   2924 N  N     . ARG B 2 14  ? 76.805  38.829  28.069 1.00 20.19 ? 14  ARG I N     1 
ATOM   2925 C  CA    . ARG B 2 14  ? 76.751  37.477  28.686 1.00 9.99  ? 14  ARG I CA    1 
ATOM   2926 C  C     . ARG B 2 14  ? 76.476  36.357  27.686 1.00 15.71 ? 14  ARG I C     1 
ATOM   2927 O  O     . ARG B 2 14  ? 75.772  36.544  26.670 1.00 17.56 ? 14  ARG I O     1 
ATOM   2928 C  CB    . ARG B 2 14  ? 75.790  37.398  29.814 1.00 13.67 ? 14  ARG I CB    1 
ATOM   2929 C  CG    . ARG B 2 14  ? 76.168  38.135  30.971 1.00 17.32 ? 14  ARG I CG    1 
ATOM   2930 C  CD    . ARG B 2 14  ? 75.002  38.068  31.958 1.00 22.70 ? 14  ARG I CD    1 
ATOM   2931 N  NE    . ARG B 2 14  ? 74.799  36.788  32.674 1.00 26.03 ? 14  ARG I NE    1 
ATOM   2932 C  CZ    . ARG B 2 14  ? 73.803  35.916  32.437 1.00 17.82 ? 14  ARG I CZ    1 
ATOM   2933 N  NH1   . ARG B 2 14  ? 72.918  36.086  31.461 1.00 8.20  ? 14  ARG I NH1   1 
ATOM   2934 N  NH2   . ARG B 2 14  ? 73.478  35.120  33.428 1.00 14.89 ? 14  ARG I NH2   1 
ATOM   2935 N  N     . ARG B 2 15  ? 77.366  35.367  27.745 1.00 15.46 ? 15  ARG I N     1 
ATOM   2936 C  CA    . ARG B 2 15  ? 77.325  34.228  26.765 1.00 15.84 ? 15  ARG I CA    1 
ATOM   2937 C  C     . ARG B 2 15  ? 76.619  32.963  27.348 1.00 14.08 ? 15  ARG I C     1 
ATOM   2938 O  O     . ARG B 2 15  ? 76.796  32.576  28.486 1.00 14.00 ? 15  ARG I O     1 
ATOM   2939 C  CB    . ARG B 2 15  ? 78.746  33.837  26.359 1.00 21.35 ? 15  ARG I CB    1 
ATOM   2940 C  CG    . ARG B 2 15  ? 79.529  34.847  25.494 1.00 15.40 ? 15  ARG I CG    1 
ATOM   2941 C  CD    . ARG B 2 15  ? 81.025  34.636  25.768 1.00 8.28  ? 15  ARG I CD    1 
ATOM   2942 N  NE    . ARG B 2 15  ? 81.414  34.808  27.186 1.00 12.26 ? 15  ARG I NE    1 
ATOM   2943 C  CZ    . ARG B 2 15  ? 82.651  35.035  27.610 1.00 11.31 ? 15  ARG I CZ    1 
ATOM   2944 N  NH1   . ARG B 2 15  ? 83.628  35.182  26.732 1.00 15.59 ? 15  ARG I NH1   1 
ATOM   2945 N  NH2   . ARG B 2 15  ? 82.956  34.933  28.892 1.00 10.17 ? 15  ARG I NH2   1 
ATOM   2946 N  N     . ASN B 2 16  ? 75.496  32.667  26.727 1.00 14.78 ? 16  ASN I N     1 
ATOM   2947 C  CA    . ASN B 2 16  ? 74.651  31.523  27.115 1.00 18.11 ? 16  ASN I CA    1 
ATOM   2948 C  C     . ASN B 2 16  ? 75.220  30.227  26.447 1.00 20.07 ? 16  ASN I C     1 
ATOM   2949 O  O     . ASN B 2 16  ? 75.796  30.239  25.340 1.00 13.32 ? 16  ASN I O     1 
ATOM   2950 C  CB    . ASN B 2 16  ? 73.196  31.779  26.633 1.00 13.25 ? 16  ASN I CB    1 
ATOM   2951 C  CG    . ASN B 2 16  ? 72.424  32.814  27.497 1.00 16.39 ? 16  ASN I CG    1 
ATOM   2952 O  OD1   . ASN B 2 16  ? 71.226  32.884  27.259 1.00 29.99 ? 16  ASN I OD1   1 
ATOM   2953 N  ND2   . ASN B 2 16  ? 72.928  33.228  28.661 1.00 17.07 ? 16  ASN I ND2   1 
ATOM   2954 N  N     . ALA B 2 17  ? 74.965  29.103  27.120 1.00 23.38 ? 17  ALA I N     1 
ATOM   2955 C  CA    . ALA B 2 17  ? 75.408  27.762  26.703 1.00 25.04 ? 17  ALA I CA    1 
ATOM   2956 C  C     . ALA B 2 17  ? 74.814  27.308  25.405 1.00 23.64 ? 17  ALA I C     1 
ATOM   2957 O  O     . ALA B 2 17  ? 73.747  27.803  25.058 1.00 23.16 ? 17  ALA I O     1 
ATOM   2958 C  CB    . ALA B 2 17  ? 75.024  26.731  27.808 1.00 23.53 ? 17  ALA I CB    1 
ATOM   2959 N  N     . ILE B 2 18  ? 75.510  26.446  24.658 1.00 26.34 ? 18  ILE I N     1 
ATOM   2960 C  CA    . ILE B 2 18  ? 74.929  25.866  23.441 1.00 35.88 ? 18  ILE I CA    1 
ATOM   2961 C  C     . ILE B 2 18  ? 73.813  24.802  23.738 1.00 44.78 ? 18  ILE I C     1 
ATOM   2962 O  O     . ILE B 2 18  ? 73.985  23.881  24.576 1.00 44.13 ? 18  ILE I O     1 
ATOM   2963 C  CB    . ILE B 2 18  ? 75.961  25.338  22.414 1.00 35.98 ? 18  ILE I CB    1 
ATOM   2964 C  CG1   . ILE B 2 18  ? 76.657  24.039  22.839 1.00 39.11 ? 18  ILE I CG1   1 
ATOM   2965 C  CG2   . ILE B 2 18  ? 76.924  26.409  22.063 1.00 33.85 ? 18  ILE I CG2   1 
ATOM   2966 C  CD1   . ILE B 2 18  ? 77.944  23.642  22.046 1.00 38.51 ? 18  ILE I CD1   1 
ATOM   2967 N  N     . HIS B 2 19  ? 72.710  24.902  22.981 1.00 52.73 ? 19  HIS I N     1 
ATOM   2968 C  CA    . HIS B 2 19  ? 71.533  24.044  23.176 1.00 60.10 ? 19  HIS I CA    1 
ATOM   2969 C  C     . HIS B 2 19  ? 70.869  23.586  21.914 1.00 64.77 ? 19  HIS I C     1 
ATOM   2970 O  O     . HIS B 2 19  ? 69.852  22.858  21.967 1.00 64.75 ? 19  HIS I O     1 
ATOM   2971 C  CB    . HIS B 2 19  ? 70.466  24.740  24.029 1.00 61.71 ? 19  HIS I CB    1 
ATOM   2972 C  CG    . HIS B 2 19  ? 69.980  26.047  23.489 1.00 61.04 ? 19  HIS I CG    1 
ATOM   2973 N  ND1   . HIS B 2 19  ? 70.568  27.250  23.818 1.00 61.84 ? 19  HIS I ND1   1 
ATOM   2974 C  CD2   . HIS B 2 19  ? 68.905  26.348  22.730 1.00 61.72 ? 19  HIS I CD2   1 
ATOM   2975 C  CE1   . HIS B 2 19  ? 69.865  28.236  23.300 1.00 60.66 ? 19  HIS I CE1   1 
ATOM   2976 N  NE2   . HIS B 2 19  ? 68.850  27.716  22.635 1.00 65.51 ? 19  HIS I NE2   1 
ATOM   2977 N  N     . ASP B 2 20  ? 71.339  24.197  20.827 1.00 69.39 ? 20  ASP I N     1 
ATOM   2978 C  CA    . ASP B 2 20  ? 70.829  23.903  19.488 1.00 74.65 ? 20  ASP I CA    1 
ATOM   2979 C  C     . ASP B 2 20  ? 72.050  23.503  18.681 0.00 75.26 ? 20  ASP I C     1 
ATOM   2980 O  O     . ASP B 2 20  ? 71.928  22.699  17.738 0.00 75.15 ? 20  ASP I O     1 
ATOM   2981 C  CB    . ASP B 2 20  ? 70.191  25.146  18.864 0.00 76.48 ? 20  ASP I CB    1 
ATOM   2982 C  CG    . ASP B 2 20  ? 68.811  25.435  19.403 0.00 79.04 ? 20  ASP I CG    1 
ATOM   2983 O  OD1   . ASP B 2 20  ? 68.068  24.472  19.674 0.00 79.75 ? 20  ASP I OD1   1 
ATOM   2984 O  OD2   . ASP B 2 20  ? 68.465  26.617  19.562 0.00 79.75 ? 20  ASP I OD2   1 
ATOM   2985 O  OXT   . ASP B 2 20  ? 73.148  23.980  19.061 0.00 75.15 ? 20  ASP I OXT   1 
ATOM   2986 N  N     . LYS C 1 8   ? 51.303  -8.057  46.969 0.00 81.55 ? 8   LYS B N     1 
ATOM   2987 C  CA    . LYS C 1 8   ? 51.248  -7.694  48.418 0.00 81.51 ? 8   LYS B CA    1 
ATOM   2988 C  C     . LYS C 1 8   ? 50.724  -9.003  48.955 0.00 79.70 ? 8   LYS B C     1 
ATOM   2989 O  O     . LYS C 1 8   ? 49.537  -9.284  48.825 0.00 80.97 ? 8   LYS B O     1 
ATOM   2990 C  CB    . LYS C 1 8   ? 50.210  -6.586  48.636 0.00 84.49 ? 8   LYS B CB    1 
ATOM   2991 C  CG    . LYS C 1 8   ? 50.173  -5.557  47.516 0.00 88.56 ? 8   LYS B CG    1 
ATOM   2992 C  CD    . LYS C 1 8   ? 48.943  -4.670  47.606 0.00 92.40 ? 8   LYS B CD    1 
ATOM   2993 C  CE    . LYS C 1 8   ? 48.656  -4.008  46.266 0.00 95.18 ? 8   LYS B CE    1 
ATOM   2994 N  NZ    . LYS C 1 8   ? 48.340  -5.023  45.217 0.00 97.36 ? 8   LYS B NZ    1 
ATOM   2995 N  N     . GLY C 1 9   ? 51.586  -9.806  49.567 0.00 77.26 ? 9   GLY B N     1 
ATOM   2996 C  CA    . GLY C 1 9   ? 51.115  -11.116 49.980 1.00 71.43 ? 9   GLY B CA    1 
ATOM   2997 C  C     . GLY C 1 9   ? 50.215  -11.528 51.121 1.00 70.48 ? 9   GLY B C     1 
ATOM   2998 O  O     . GLY C 1 9   ? 49.574  -12.552 51.023 1.00 69.78 ? 9   GLY B O     1 
ATOM   2999 N  N     . SER C 1 10  ? 50.249  -10.778 52.219 1.00 72.20 ? 10  SER B N     1 
ATOM   3000 C  CA    . SER C 1 10  ? 49.446  -10.974 53.433 1.00 73.16 ? 10  SER B CA    1 
ATOM   3001 C  C     . SER C 1 10  ? 48.090  -10.259 53.343 1.00 75.16 ? 10  SER B C     1 
ATOM   3002 O  O     . SER C 1 10  ? 47.199  -10.509 54.175 1.00 75.84 ? 10  SER B O     1 
ATOM   3003 C  CB    . SER C 1 10  ? 50.211  -10.461 54.666 0.00 72.69 ? 10  SER B CB    1 
ATOM   3004 O  OG    . SER C 1 10  ? 49.472  -10.639 55.871 0.00 68.58 ? 10  SER B OG    1 
ATOM   3005 N  N     . GLU C 1 11  ? 48.040  -9.252  52.457 1.00 75.23 ? 11  GLU B N     1 
ATOM   3006 C  CA    . GLU C 1 11  ? 46.856  -8.469  52.067 1.00 72.09 ? 11  GLU B CA    1 
ATOM   3007 C  C     . GLU C 1 11  ? 46.121  -9.369  51.072 1.00 70.05 ? 11  GLU B C     1 
ATOM   3008 O  O     . GLU C 1 11  ? 44.925  -9.610  51.273 1.00 69.14 ? 11  GLU B O     1 
ATOM   3009 C  CB    . GLU C 1 11  ? 47.217  -7.118  51.439 1.00 70.73 ? 11  GLU B CB    1 
ATOM   3010 C  CG    . GLU C 1 11  ? 48.180  -6.259  52.259 0.00 72.95 ? 11  GLU B CG    1 
ATOM   3011 C  CD    . GLU C 1 11  ? 47.518  -5.567  53.437 0.00 72.92 ? 11  GLU B CD    1 
ATOM   3012 O  OE1   . GLU C 1 11  ? 47.239  -6.240  54.452 0.00 72.42 ? 11  GLU B OE1   1 
ATOM   3013 O  OE2   . GLU C 1 11  ? 47.290  -4.342  53.351 0.00 72.42 ? 11  GLU B OE2   1 
ATOM   3014 N  N     . GLN C 1 12  ? 46.891  -10.014 50.177 1.00 66.00 ? 12  GLN B N     1 
ATOM   3015 C  CA    . GLN C 1 12  ? 46.434  -10.998 49.185 1.00 63.40 ? 12  GLN B CA    1 
ATOM   3016 C  C     . GLN C 1 12  ? 45.806  -12.228 49.860 1.00 61.91 ? 12  GLN B C     1 
ATOM   3017 O  O     . GLN C 1 12  ? 44.786  -12.761 49.397 1.00 57.29 ? 12  GLN B O     1 
ATOM   3018 C  CB    . GLN C 1 12  ? 47.602  -11.359 48.264 1.00 65.45 ? 12  GLN B CB    1 
ATOM   3019 C  CG    . GLN C 1 12  ? 47.498  -12.594 47.359 1.00 66.31 ? 12  GLN B CG    1 
ATOM   3020 C  CD    . GLN C 1 12  ? 46.480  -12.324 46.211 0.00 66.64 ? 12  GLN B CD    1 
ATOM   3021 O  OE1   . GLN C 1 12  ? 45.848  -11.265 46.179 0.00 66.88 ? 12  GLN B OE1   1 
ATOM   3022 N  NE2   . GLN C 1 12  ? 46.327  -13.267 45.278 0.00 66.88 ? 12  GLN B NE2   1 
ATOM   3023 N  N     . GLU C 1 13  ? 46.341  -12.531 51.045 1.00 62.19 ? 13  GLU B N     1 
ATOM   3024 C  CA    . GLU C 1 13  ? 45.906  -13.591 51.941 1.00 61.15 ? 13  GLU B CA    1 
ATOM   3025 C  C     . GLU C 1 13  ? 44.505  -13.215 52.417 1.00 60.55 ? 13  GLU B C     1 
ATOM   3026 O  O     . GLU C 1 13  ? 43.556  -13.892 52.033 1.00 59.42 ? 13  GLU B O     1 
ATOM   3027 C  CB    . GLU C 1 13  ? 46.861  -13.729 53.124 0.00 65.19 ? 13  GLU B CB    1 
ATOM   3028 C  CG    . GLU C 1 13  ? 47.351  -15.153 53.356 0.00 67.57 ? 13  GLU B CG    1 
ATOM   3029 C  CD    . GLU C 1 13  ? 48.073  -15.731 52.147 0.00 68.08 ? 13  GLU B CD    1 
ATOM   3030 O  OE1   . GLU C 1 13  ? 49.232  -15.336 51.898 0.00 67.26 ? 13  GLU B OE1   1 
ATOM   3031 O  OE2   . GLU C 1 13  ? 47.480  -16.577 51.446 0.00 67.26 ? 13  GLU B OE2   1 
ATOM   3032 N  N     . SER C 1 14  ? 44.367  -12.005 52.962 1.00 58.14 ? 14  SER B N     1 
ATOM   3033 C  CA    . SER C 1 14  ? 43.103  -11.503 53.523 1.00 56.17 ? 14  SER B CA    1 
ATOM   3034 C  C     . SER C 1 14  ? 41.949  -11.326 52.509 1.00 53.10 ? 14  SER B C     1 
ATOM   3035 O  O     . SER C 1 14  ? 40.771  -11.615 52.822 1.00 44.02 ? 14  SER B O     1 
ATOM   3036 C  CB    . SER C 1 14  ? 43.379  -10.225 54.341 1.00 56.51 ? 14  SER B CB    1 
ATOM   3037 O  OG    . SER C 1 14  ? 44.292  -10.446 55.421 1.00 56.97 ? 14  SER B OG    1 
ATOM   3038 N  N     . VAL C 1 15  ? 42.332  -10.916 51.291 1.00 50.94 ? 15  VAL B N     1 
ATOM   3039 C  CA    . VAL C 1 15  ? 41.416  -10.739 50.154 1.00 50.82 ? 15  VAL B CA    1 
ATOM   3040 C  C     . VAL C 1 15  ? 40.801  -12.106 49.891 1.00 52.45 ? 15  VAL B C     1 
ATOM   3041 O  O     . VAL C 1 15  ? 39.569  -12.189 49.952 1.00 51.04 ? 15  VAL B O     1 
ATOM   3042 C  CB    . VAL C 1 15  ? 42.052  -10.230 48.816 1.00 52.10 ? 15  VAL B CB    1 
ATOM   3043 C  CG1   . VAL C 1 15  ? 40.936  -10.109 47.706 1.00 46.73 ? 15  VAL B CG1   1 
ATOM   3044 C  CG2   . VAL C 1 15  ? 42.832  -8.904  49.013 1.00 46.83 ? 15  VAL B CG2   1 
ATOM   3045 N  N     . LYS C 1 16  ? 41.661  -13.140 49.785 1.00 52.72 ? 16  LYS B N     1 
ATOM   3046 C  CA    . LYS C 1 16  ? 41.275  -14.553 49.573 1.00 53.25 ? 16  LYS B CA    1 
ATOM   3047 C  C     . LYS C 1 16  ? 40.238  -15.095 50.592 1.00 48.01 ? 16  LYS B C     1 
ATOM   3048 O  O     . LYS C 1 16  ? 39.163  -15.529 50.210 1.00 47.83 ? 16  LYS B O     1 
ATOM   3049 C  CB    . LYS C 1 16  ? 42.492  -15.483 49.437 1.00 53.77 ? 16  LYS B CB    1 
ATOM   3050 C  CG    . LYS C 1 16  ? 42.993  -15.690 48.016 0.00 58.65 ? 16  LYS B CG    1 
ATOM   3051 C  CD    . LYS C 1 16  ? 44.062  -16.771 47.996 0.00 60.22 ? 16  LYS B CD    1 
ATOM   3052 C  CE    . LYS C 1 16  ? 44.417  -17.196 46.584 0.00 61.05 ? 16  LYS B CE    1 
ATOM   3053 N  NZ    . LYS C 1 16  ? 45.404  -18.312 46.595 0.00 62.16 ? 16  LYS B NZ    1 
ATOM   3054 N  N     . GLU C 1 17  ? 40.446  -14.838 51.870 1.00 44.65 ? 17  GLU B N     1 
ATOM   3055 C  CA    . GLU C 1 17  ? 39.510  -15.288 52.869 1.00 46.72 ? 17  GLU B CA    1 
ATOM   3056 C  C     . GLU C 1 17  ? 38.204  -14.501 52.795 1.00 50.31 ? 17  GLU B C     1 
ATOM   3057 O  O     . GLU C 1 17  ? 37.111  -15.129 52.864 1.00 50.76 ? 17  GLU B O     1 
ATOM   3058 C  CB    . GLU C 1 17  ? 40.120  -15.193 54.257 1.00 49.23 ? 17  GLU B CB    1 
ATOM   3059 C  CG    . GLU C 1 17  ? 41.274  -16.160 54.499 0.00 52.27 ? 17  GLU B CG    1 
ATOM   3060 C  CD    . GLU C 1 17  ? 41.758  -16.144 55.935 0.00 53.70 ? 17  GLU B CD    1 
ATOM   3061 O  OE1   . GLU C 1 17  ? 40.980  -16.538 56.829 0.00 53.14 ? 17  GLU B OE1   1 
ATOM   3062 O  OE2   . GLU C 1 17  ? 42.915  -15.740 56.172 0.00 53.14 ? 17  GLU B OE2   1 
ATOM   3063 N  N     . PHE C 1 18  ? 38.320  -13.189 52.490 1.00 48.91 ? 18  PHE B N     1 
ATOM   3064 C  CA    . PHE C 1 18  ? 37.159  -12.265 52.384 1.00 44.22 ? 18  PHE B CA    1 
ATOM   3065 C  C     . PHE C 1 18  ? 36.191  -12.789 51.337 1.00 35.29 ? 18  PHE B C     1 
ATOM   3066 O  O     . PHE C 1 18  ? 35.011  -12.948 51.597 1.00 35.24 ? 18  PHE B O     1 
ATOM   3067 C  CB    . PHE C 1 18  ? 37.534  -10.767 52.118 1.00 45.76 ? 18  PHE B CB    1 
ATOM   3068 C  CG    . PHE C 1 18  ? 36.358  -9.895  51.706 1.00 42.41 ? 18  PHE B CG    1 
ATOM   3069 C  CD1   . PHE C 1 18  ? 35.395  -9.507  52.659 1.00 45.21 ? 18  PHE B CD1   1 
ATOM   3070 C  CD2   . PHE C 1 18  ? 36.078  -9.690  50.334 1.00 41.19 ? 18  PHE B CD2   1 
ATOM   3071 C  CE1   . PHE C 1 18  ? 34.129  -8.931  52.240 1.00 48.72 ? 18  PHE B CE1   1 
ATOM   3072 C  CE2   . PHE C 1 18  ? 34.823  -9.127  49.883 1.00 46.05 ? 18  PHE B CE2   1 
ATOM   3073 C  CZ    . PHE C 1 18  ? 33.835  -8.742  50.838 1.00 38.99 ? 18  PHE B CZ    1 
ATOM   3074 N  N     . LEU C 1 19  ? 36.759  -13.054 50.177 1.00 31.02 ? 19  LEU B N     1 
ATOM   3075 C  CA    . LEU C 1 19  ? 36.036  -13.502 49.022 1.00 32.46 ? 19  LEU B CA    1 
ATOM   3076 C  C     . LEU C 1 19  ? 35.360  -14.853 49.275 1.00 38.46 ? 19  LEU B C     1 
ATOM   3077 O  O     . LEU C 1 19  ? 34.184  -15.028 48.899 1.00 34.25 ? 19  LEU B O     1 
ATOM   3078 C  CB    . LEU C 1 19  ? 37.023  -13.503 47.873 1.00 29.41 ? 19  LEU B CB    1 
ATOM   3079 C  CG    . LEU C 1 19  ? 37.320  -12.134 47.233 1.00 34.85 ? 19  LEU B CG    1 
ATOM   3080 C  CD1   . LEU C 1 19  ? 38.165  -12.352 45.981 1.00 32.01 ? 19  LEU B CD1   1 
ATOM   3081 C  CD2   . LEU C 1 19  ? 36.091  -11.342 46.817 1.00 34.31 ? 19  LEU B CD2   1 
ATOM   3082 N  N     . ALA C 1 20  ? 36.058  -15.698 50.061 1.00 39.32 ? 20  ALA B N     1 
ATOM   3083 C  CA    . ALA C 1 20  ? 35.632  -17.032 50.493 1.00 41.17 ? 20  ALA B CA    1 
ATOM   3084 C  C     . ALA C 1 20  ? 34.313  -16.994 51.282 1.00 41.33 ? 20  ALA B C     1 
ATOM   3085 O  O     . ALA C 1 20  ? 33.269  -17.487 50.804 1.00 41.79 ? 20  ALA B O     1 
ATOM   3086 C  CB    . ALA C 1 20  ? 36.762  -17.716 51.260 1.00 41.65 ? 20  ALA B CB    1 
ATOM   3087 N  N     . LYS C 1 21  ? 34.295  -16.162 52.313 1.00 40.28 ? 21  LYS B N     1 
ATOM   3088 C  CA    . LYS C 1 21  ? 33.061  -15.986 53.081 1.00 42.72 ? 21  LYS B CA    1 
ATOM   3089 C  C     . LYS C 1 21  ? 31.946  -15.216 52.299 1.00 40.03 ? 21  LYS B C     1 
ATOM   3090 O  O     . LYS C 1 21  ? 30.760  -15.591 52.295 1.00 39.21 ? 21  LYS B O     1 
ATOM   3091 C  CB    . LYS C 1 21  ? 33.416  -15.351 54.431 1.00 47.44 ? 21  LYS B CB    1 
ATOM   3092 C  CG    . LYS C 1 21  ? 34.021  -16.343 55.481 1.00 59.62 ? 21  LYS B CG    1 
ATOM   3093 C  CD    . LYS C 1 21  ? 35.017  -17.483 54.993 1.00 65.15 ? 21  LYS B CD    1 
ATOM   3094 C  CE    . LYS C 1 21  ? 36.530  -17.164 55.161 1.00 67.27 ? 21  LYS B CE    1 
ATOM   3095 N  NZ    . LYS C 1 21  ? 37.510  -18.243 54.805 1.00 61.78 ? 21  LYS B NZ    1 
ATOM   3096 N  N     . ALA C 1 22  ? 32.369  -14.277 51.450 1.00 34.64 ? 22  ALA B N     1 
ATOM   3097 C  CA    . ALA C 1 22  ? 31.460  -13.467 50.629 1.00 32.95 ? 22  ALA B CA    1 
ATOM   3098 C  C     . ALA C 1 22  ? 30.731  -14.387 49.679 1.00 30.88 ? 22  ALA B C     1 
ATOM   3099 O  O     . ALA C 1 22  ? 29.542  -14.223 49.476 1.00 35.11 ? 22  ALA B O     1 
ATOM   3100 C  CB    . ALA C 1 22  ? 32.267  -12.405 49.818 1.00 32.92 ? 22  ALA B CB    1 
ATOM   3101 N  N     . LYS C 1 23  ? 31.413  -15.415 49.189 1.00 29.34 ? 23  LYS B N     1 
ATOM   3102 C  CA    . LYS C 1 23  ? 30.832  -16.346 48.244 1.00 35.21 ? 23  LYS B CA    1 
ATOM   3103 C  C     . LYS C 1 23  ? 29.793  -17.235 48.950 1.00 36.18 ? 23  LYS B C     1 
ATOM   3104 O  O     . LYS C 1 23  ? 28.704  -17.398 48.399 1.00 38.76 ? 23  LYS B O     1 
ATOM   3105 C  CB    . LYS C 1 23  ? 31.914  -17.033 47.423 1.00 32.77 ? 23  LYS B CB    1 
ATOM   3106 C  CG    . LYS C 1 23  ? 31.555  -18.378 46.770 1.00 44.13 ? 23  LYS B CG    1 
ATOM   3107 C  CD    . LYS C 1 23  ? 30.832  -18.336 45.425 1.00 43.79 ? 23  LYS B CD    1 
ATOM   3108 C  CE    . LYS C 1 23  ? 31.815  -18.863 44.430 1.00 45.56 ? 23  LYS B CE    1 
ATOM   3109 N  NZ    . LYS C 1 23  ? 31.345  -18.844 43.045 1.00 47.16 ? 23  LYS B NZ    1 
ATOM   3110 N  N     . GLU C 1 24  ? 30.009  -17.605 50.214 1.00 39.81 ? 24  GLU B N     1 
ATOM   3111 C  CA    . GLU C 1 24  ? 29.011  -18.394 50.965 1.00 41.27 ? 24  GLU B CA    1 
ATOM   3112 C  C     . GLU C 1 24  ? 27.731  -17.603 51.142 1.00 42.73 ? 24  GLU B C     1 
ATOM   3113 O  O     . GLU C 1 24  ? 26.700  -18.072 50.663 1.00 43.83 ? 24  GLU B O     1 
ATOM   3114 C  CB    . GLU C 1 24  ? 29.501  -18.913 52.314 1.00 45.60 ? 24  GLU B CB    1 
ATOM   3115 C  CG    . GLU C 1 24  ? 30.600  -19.982 52.219 1.00 54.88 ? 24  GLU B CG    1 
ATOM   3116 C  CD    . GLU C 1 24  ? 31.514  -20.035 53.442 1.00 61.15 ? 24  GLU B CD    1 
ATOM   3117 O  OE1   . GLU C 1 24  ? 31.036  -19.868 54.599 1.00 63.41 ? 24  GLU B OE1   1 
ATOM   3118 O  OE2   . GLU C 1 24  ? 32.743  -20.206 53.236 1.00 64.73 ? 24  GLU B OE2   1 
ATOM   3119 N  N     . ASP C 1 25  ? 27.857  -16.329 51.535 1.00 44.22 ? 25  ASP B N     1 
ATOM   3120 C  CA    . ASP C 1 25  ? 26.728  -15.384 51.741 1.00 43.06 ? 25  ASP B CA    1 
ATOM   3121 C  C     . ASP C 1 25  ? 25.881  -15.254 50.474 1.00 37.24 ? 25  ASP B C     1 
ATOM   3122 O  O     . ASP C 1 25  ? 24.670  -15.522 50.487 1.00 37.66 ? 25  ASP B O     1 
ATOM   3123 C  CB    . ASP C 1 25  ? 27.212  -13.976 52.144 1.00 48.81 ? 25  ASP B CB    1 
ATOM   3124 C  CG    . ASP C 1 25  ? 28.369  -13.977 53.159 1.00 61.63 ? 25  ASP B CG    1 
ATOM   3125 O  OD1   . ASP C 1 25  ? 28.463  -14.888 54.030 1.00 66.73 ? 25  ASP B OD1   1 
ATOM   3126 O  OD2   . ASP C 1 25  ? 29.224  -13.053 53.086 1.00 68.27 ? 25  ASP B OD2   1 
ATOM   3127 N  N     . PHE C 1 26  ? 26.562  -14.974 49.362 1.00 31.95 ? 26  PHE B N     1 
ATOM   3128 C  CA    . PHE C 1 26  ? 25.907  -14.875 48.078 1.00 28.92 ? 26  PHE B CA    1 
ATOM   3129 C  C     . PHE C 1 26  ? 25.149  -16.157 47.717 1.00 27.51 ? 26  PHE B C     1 
ATOM   3130 O  O     . PHE C 1 26  ? 24.082  -16.052 47.118 1.00 22.01 ? 26  PHE B O     1 
ATOM   3131 C  CB    . PHE C 1 26  ? 26.914  -14.524 46.988 1.00 29.04 ? 26  PHE B CB    1 
ATOM   3132 C  CG    . PHE C 1 26  ? 26.351  -14.608 45.568 1.00 21.34 ? 26  PHE B CG    1 
ATOM   3133 C  CD1   . PHE C 1 26  ? 25.526  -13.617 45.067 1.00 19.09 ? 26  PHE B CD1   1 
ATOM   3134 C  CD2   . PHE C 1 26  ? 26.644  -15.696 44.764 1.00 21.05 ? 26  PHE B CD2   1 
ATOM   3135 C  CE1   . PHE C 1 26  ? 25.008  -13.667 43.766 1.00 18.62 ? 26  PHE B CE1   1 
ATOM   3136 C  CE2   . PHE C 1 26  ? 26.115  -15.788 43.468 1.00 20.37 ? 26  PHE B CE2   1 
ATOM   3137 C  CZ    . PHE C 1 26  ? 25.285  -14.739 42.954 1.00 21.47 ? 26  PHE B CZ    1 
ATOM   3138 N  N     . LEU C 1 27  ? 25.828  -17.305 47.880 1.00 31.29 ? 27  LEU B N     1 
ATOM   3139 C  CA    . LEU C 1 27  ? 25.298  -18.657 47.586 1.00 34.85 ? 27  LEU B CA    1 
ATOM   3140 C  C     . LEU C 1 27  ? 23.943  -18.964 48.212 1.00 34.87 ? 27  LEU B C     1 
ATOM   3141 O  O     . LEU C 1 27  ? 22.999  -19.186 47.418 1.00 33.66 ? 27  LEU B O     1 
ATOM   3142 C  CB    . LEU C 1 27  ? 26.315  -19.841 47.708 1.00 29.91 ? 27  LEU B CB    1 
ATOM   3143 C  CG    . LEU C 1 27  ? 27.313  -19.832 46.538 1.00 22.81 ? 27  LEU B CG    1 
ATOM   3144 C  CD1   . LEU C 1 27  ? 28.501  -20.691 46.810 1.00 27.87 ? 27  LEU B CD1   1 
ATOM   3145 C  CD2   . LEU C 1 27  ? 26.690  -20.130 45.208 1.00 23.04 ? 27  LEU B CD2   1 
ATOM   3146 N  N     . LYS C 1 28  ? 23.807  -18.705 49.524 1.00 33.79 ? 28  LYS B N     1 
ATOM   3147 C  CA    . LYS C 1 28  ? 22.507  -18.921 50.164 1.00 33.70 ? 28  LYS B CA    1 
ATOM   3148 C  C     . LYS C 1 28  ? 21.394  -18.019 49.641 1.00 35.43 ? 28  LYS B C     1 
ATOM   3149 O  O     . LYS C 1 28  ? 20.380  -18.566 49.168 1.00 36.18 ? 28  LYS B O     1 
ATOM   3150 C  CB    . LYS C 1 28  ? 22.502  -18.976 51.688 1.00 34.49 ? 28  LYS B CB    1 
ATOM   3151 C  CG    . LYS C 1 28  ? 23.648  -18.308 52.335 1.00 45.78 ? 28  LYS B CG    1 
ATOM   3152 C  CD    . LYS C 1 28  ? 24.760  -19.319 52.585 1.00 53.71 ? 28  LYS B CD    1 
ATOM   3153 C  CE    . LYS C 1 28  ? 25.589  -18.916 53.829 1.00 54.87 ? 28  LYS B CE    1 
ATOM   3154 N  NZ    . LYS C 1 28  ? 26.718  -19.742 54.255 0.00 54.38 ? 28  LYS B NZ    1 
ATOM   3155 N  N     . LYS C 1 29  ? 21.714  -16.746 49.345 1.00 30.46 ? 29  LYS B N     1 
ATOM   3156 C  CA    . LYS C 1 29  ? 20.672  -15.834 48.868 1.00 26.26 ? 29  LYS B CA    1 
ATOM   3157 C  C     . LYS C 1 29  ? 20.358  -16.133 47.421 1.00 26.70 ? 29  LYS B C     1 
ATOM   3158 O  O     . LYS C 1 29  ? 19.162  -16.047 47.010 1.00 26.32 ? 29  LYS B O     1 
ATOM   3159 C  CB    . LYS C 1 29  ? 21.159  -14.386 49.062 1.00 31.65 ? 29  LYS B CB    1 
ATOM   3160 C  CG    . LYS C 1 29  ? 21.388  -13.930 50.514 1.00 26.87 ? 29  LYS B CG    1 
ATOM   3161 C  CD    . LYS C 1 29  ? 22.044  -12.599 50.477 1.00 33.44 ? 29  LYS B CD    1 
ATOM   3162 C  CE    . LYS C 1 29  ? 22.517  -12.230 51.846 1.00 44.68 ? 29  LYS B CE    1 
ATOM   3163 N  NZ    . LYS C 1 29  ? 23.588  -13.179 52.391 1.00 55.01 ? 29  LYS B NZ    1 
ATOM   3164 N  N     . TRP C 1 30  ? 21.402  -16.552 46.679 1.00 21.78 ? 30  TRP B N     1 
ATOM   3165 C  CA    . TRP C 1 30  ? 21.240  -16.901 45.263 1.00 27.86 ? 30  TRP B CA    1 
ATOM   3166 C  C     . TRP C 1 30  ? 20.294  -18.079 45.129 1.00 31.83 ? 30  TRP B C     1 
ATOM   3167 O  O     . TRP C 1 30  ? 19.475  -18.114 44.192 1.00 33.63 ? 30  TRP B O     1 
ATOM   3168 C  CB    . TRP C 1 30  ? 22.563  -17.220 44.519 1.00 32.74 ? 30  TRP B CB    1 
ATOM   3169 C  CG    . TRP C 1 30  ? 22.467  -17.881 43.062 1.00 34.63 ? 30  TRP B CG    1 
ATOM   3170 C  CD1   . TRP C 1 30  ? 22.668  -19.221 42.737 1.00 34.95 ? 30  TRP B CD1   1 
ATOM   3171 C  CD2   . TRP C 1 30  ? 22.159  -17.229 41.817 1.00 28.73 ? 30  TRP B CD2   1 
ATOM   3172 N  NE1   . TRP C 1 30  ? 22.476  -19.437 41.370 1.00 30.78 ? 30  TRP B NE1   1 
ATOM   3173 C  CE2   . TRP C 1 30  ? 22.176  -18.239 40.782 1.00 35.07 ? 30  TRP B CE2   1 
ATOM   3174 C  CE3   . TRP C 1 30  ? 21.870  -15.904 41.468 1.00 28.08 ? 30  TRP B CE3   1 
ATOM   3175 C  CZ2   . TRP C 1 30  ? 21.890  -17.950 39.412 1.00 29.00 ? 30  TRP B CZ2   1 
ATOM   3176 C  CZ3   . TRP C 1 30  ? 21.578  -15.614 40.107 1.00 28.10 ? 30  TRP B CZ3   1 
ATOM   3177 C  CH2   . TRP C 1 30  ? 21.585  -16.639 39.097 1.00 31.96 ? 30  TRP B CH2   1 
ATOM   3178 N  N     . GLU C 1 31  ? 20.550  -19.082 45.972 1.00 34.01 ? 31  GLU B N     1 
ATOM   3179 C  CA    . GLU C 1 31  ? 19.740  -20.302 45.958 1.00 41.06 ? 31  GLU B CA    1 
ATOM   3180 C  C     . GLU C 1 31  ? 18.353  -20.128 46.515 1.00 34.83 ? 31  GLU B C     1 
ATOM   3181 O  O     . GLU C 1 31  ? 17.436  -20.709 45.959 1.00 35.25 ? 31  GLU B O     1 
ATOM   3182 C  CB    . GLU C 1 31  ? 20.388  -21.466 46.703 1.00 47.83 ? 31  GLU B CB    1 
ATOM   3183 C  CG    . GLU C 1 31  ? 21.859  -21.743 46.398 1.00 56.70 ? 31  GLU B CG    1 
ATOM   3184 C  CD    . GLU C 1 31  ? 22.208  -22.293 45.045 1.00 64.36 ? 31  GLU B CD    1 
ATOM   3185 O  OE1   . GLU C 1 31  ? 21.309  -22.599 44.192 1.00 63.57 ? 31  GLU B OE1   1 
ATOM   3186 O  OE2   . GLU C 1 31  ? 23.462  -22.373 44.886 1.00 66.96 ? 31  GLU B OE2   1 
ATOM   3187 N  N     . ASN C 1 32  ? 18.230  -19.208 47.468 1.00 33.83 ? 32  ASN B N     1 
ATOM   3188 C  CA    . ASN C 1 32  ? 16.990  -18.898 48.164 1.00 37.26 ? 32  ASN B CA    1 
ATOM   3189 C  C     . ASN C 1 32  ? 16.651  -17.391 48.019 1.00 34.34 ? 32  ASN B C     1 
ATOM   3190 O  O     . ASN C 1 32  ? 16.851  -16.630 48.954 1.00 28.75 ? 32  ASN B O     1 
ATOM   3191 C  CB    . ASN C 1 32  ? 17.111  -19.346 49.634 1.00 42.00 ? 32  ASN B CB    1 
ATOM   3192 C  CG    . ASN C 1 32  ? 17.559  -20.789 49.777 1.00 45.22 ? 32  ASN B CG    1 
ATOM   3193 O  OD1   . ASN C 1 32  ? 16.875  -21.693 49.257 1.00 52.82 ? 32  ASN B OD1   1 
ATOM   3194 N  ND2   . ASN C 1 32  ? 18.755  -21.006 50.356 1.00 43.82 ? 32  ASN B ND2   1 
ATOM   3195 N  N     . PRO C 1 33  ? 16.133  -16.943 46.863 1.00 33.10 ? 33  PRO B N     1 
ATOM   3196 C  CA    . PRO C 1 33  ? 15.838  -15.512 46.720 1.00 37.48 ? 33  PRO B CA    1 
ATOM   3197 C  C     . PRO C 1 33  ? 14.567  -14.964 47.407 1.00 37.64 ? 33  PRO B C     1 
ATOM   3198 O  O     . PRO C 1 33  ? 13.528  -15.624 47.296 1.00 42.64 ? 33  PRO B O     1 
ATOM   3199 C  CB    . PRO C 1 33  ? 15.737  -15.336 45.182 1.00 37.12 ? 33  PRO B CB    1 
ATOM   3200 C  CG    . PRO C 1 33  ? 16.185  -16.620 44.590 1.00 33.92 ? 33  PRO B CG    1 
ATOM   3201 C  CD    . PRO C 1 33  ? 15.677  -17.597 45.630 1.00 34.05 ? 33  PRO B CD    1 
ATOM   3202 N  N     . ALA C 1 34  ? 14.650  -13.802 48.077 1.00 32.84 ? 34  ALA B N     1 
ATOM   3203 C  CA    . ALA C 1 34  ? 13.494  -13.077 48.622 1.00 30.53 ? 34  ALA B CA    1 
ATOM   3204 C  C     . ALA C 1 34  ? 12.526  -12.723 47.513 1.00 33.16 ? 34  ALA B C     1 
ATOM   3205 O  O     . ALA C 1 34  ? 12.964  -12.373 46.399 1.00 37.55 ? 34  ALA B O     1 
ATOM   3206 C  CB    . ALA C 1 34  ? 13.932  -11.766 49.208 1.00 29.89 ? 34  ALA B CB    1 
ATOM   3207 N  N     . GLN C 1 35  ? 11.225  -12.724 47.793 1.00 30.08 ? 35  GLN B N     1 
ATOM   3208 C  CA    . GLN C 1 35  ? 10.230  -12.362 46.770 1.00 34.69 ? 35  GLN B CA    1 
ATOM   3209 C  C     . GLN C 1 35  ? 9.032   -11.585 47.397 1.00 37.33 ? 35  GLN B C     1 
ATOM   3210 O  O     . GLN C 1 35  ? 8.816   -11.679 48.610 1.00 38.03 ? 35  GLN B O     1 
ATOM   3211 C  CB    . GLN C 1 35  ? 9.892   -13.635 45.983 1.00 33.37 ? 35  GLN B CB    1 
ATOM   3212 C  CG    . GLN C 1 35  ? 8.490   -13.938 45.534 1.00 41.96 ? 35  GLN B CG    1 
ATOM   3213 C  CD    . GLN C 1 35  ? 8.398   -15.070 44.481 1.00 47.06 ? 35  GLN B CD    1 
ATOM   3214 O  OE1   . GLN C 1 35  ? 7.496   -15.107 43.617 1.00 49.78 ? 35  GLN B OE1   1 
ATOM   3215 N  NE2   . GLN C 1 35  ? 9.260   -16.061 44.631 1.00 49.23 ? 35  GLN B NE2   1 
ATOM   3216 N  N     . ASN C 1 36  ? 8.454   -10.655 46.649 1.00 34.04 ? 36  ASN B N     1 
ATOM   3217 C  CA    . ASN C 1 36  ? 7.310   -9.847  47.033 1.00 39.49 ? 36  ASN B CA    1 
ATOM   3218 C  C     . ASN C 1 36  ? 7.299   -9.307  48.478 1.00 39.89 ? 36  ASN B C     1 
ATOM   3219 O  O     . ASN C 1 36  ? 6.411   -9.577  49.275 1.00 43.08 ? 36  ASN B O     1 
ATOM   3220 C  CB    . ASN C 1 36  ? 5.987   -10.525 46.594 1.00 49.31 ? 36  ASN B CB    1 
ATOM   3221 C  CG    . ASN C 1 36  ? 6.080   -11.257 45.207 1.00 61.02 ? 36  ASN B CG    1 
ATOM   3222 O  OD1   . ASN C 1 36  ? 5.553   -12.379 45.068 1.00 69.67 ? 36  ASN B OD1   1 
ATOM   3223 N  ND2   . ASN C 1 36  ? 6.703   -10.638 44.190 1.00 56.85 ? 36  ASN B ND2   1 
ATOM   3224 N  N     . THR C 1 37  ? 8.285   -8.495  48.818 1.00 36.17 ? 37  THR B N     1 
ATOM   3225 C  CA    . THR C 1 37  ? 8.439   -8.025  50.178 1.00 30.33 ? 37  THR B CA    1 
ATOM   3226 C  C     . THR C 1 37  ? 7.798   -6.651  50.385 1.00 27.29 ? 37  THR B C     1 
ATOM   3227 O  O     . THR C 1 37  ? 8.161   -5.991  51.348 1.00 29.78 ? 37  THR B O     1 
ATOM   3228 C  CB    . THR C 1 37  ? 9.966   -8.053  50.604 1.00 36.51 ? 37  THR B CB    1 
ATOM   3229 O  OG1   . THR C 1 37  ? 10.732  -7.361  49.620 1.00 33.29 ? 37  THR B OG1   1 
ATOM   3230 C  CG2   . THR C 1 37  ? 10.582  -9.509  50.637 1.00 36.45 ? 37  THR B CG2   1 
ATOM   3231 N  N     . ALA C 1 38  ? 6.915   -6.170  49.512 1.00 24.57 ? 38  ALA B N     1 
ATOM   3232 C  CA    . ALA C 1 38  ? 6.222   -4.885  49.765 1.00 25.85 ? 38  ALA B CA    1 
ATOM   3233 C  C     . ALA C 1 38  ? 5.083   -4.698  48.807 1.00 26.01 ? 38  ALA B C     1 
ATOM   3234 O  O     . ALA C 1 38  ? 4.798   -5.594  48.029 1.00 30.38 ? 38  ALA B O     1 
ATOM   3235 C  CB    . ALA C 1 38  ? 7.228   -3.663  49.652 1.00 29.36 ? 38  ALA B CB    1 
ATOM   3236 N  N     . HIS C 1 39  ? 4.373   -3.590  48.886 1.00 24.19 ? 39  HIS B N     1 
ATOM   3237 C  CA    . HIS C 1 39  ? 3.346   -3.351  47.873 1.00 33.22 ? 39  HIS B CA    1 
ATOM   3238 C  C     . HIS C 1 39  ? 3.408   -1.853  47.477 1.00 31.21 ? 39  HIS B C     1 
ATOM   3239 O  O     . HIS C 1 39  ? 3.954   -1.045  48.262 1.00 32.58 ? 39  HIS B O     1 
ATOM   3240 C  CB    . HIS C 1 39  ? 1.928   -3.861  48.292 1.00 39.68 ? 39  HIS B CB    1 
ATOM   3241 C  CG    . HIS C 1 39  ? 1.512   -3.510  49.693 1.00 40.92 ? 39  HIS B CG    1 
ATOM   3242 N  ND1   . HIS C 1 39  ? 0.928   -2.306  50.024 1.00 44.45 ? 39  HIS B ND1   1 
ATOM   3243 C  CD2   . HIS C 1 39  ? 1.631   -4.193  50.854 1.00 47.10 ? 39  HIS B CD2   1 
ATOM   3244 C  CE1   . HIS C 1 39  ? 0.690   -2.267  51.321 1.00 46.03 ? 39  HIS B CE1   1 
ATOM   3245 N  NE2   . HIS C 1 39  ? 1.110   -3.401  51.850 1.00 48.90 ? 39  HIS B NE2   1 
ATOM   3246 N  N     . LEU C 1 40  ? 2.780   -1.542  46.338 1.00 25.74 ? 40  LEU B N     1 
ATOM   3247 C  CA    . LEU C 1 40  ? 2.740   -0.231  45.703 1.00 31.32 ? 40  LEU B CA    1 
ATOM   3248 C  C     . LEU C 1 40  ? 2.113   0.890   46.503 1.00 35.77 ? 40  LEU B C     1 
ATOM   3249 O  O     . LEU C 1 40  ? 2.835   1.840   46.853 1.00 35.91 ? 40  LEU B O     1 
ATOM   3250 C  CB    . LEU C 1 40  ? 2.171   -0.267  44.316 1.00 23.64 ? 40  LEU B CB    1 
ATOM   3251 C  CG    . LEU C 1 40  ? 2.317   0.961   43.418 1.00 28.31 ? 40  LEU B CG    1 
ATOM   3252 C  CD1   . LEU C 1 40  ? 3.739   1.443   43.089 1.00 31.27 ? 40  LEU B CD1   1 
ATOM   3253 C  CD2   . LEU C 1 40  ? 1.602   0.629   42.153 1.00 29.39 ? 40  LEU B CD2   1 
ATOM   3254 N  N     . ASP C 1 41  ? 0.988   0.550   47.129 1.00 34.70 ? 41  ASP B N     1 
ATOM   3255 C  CA    . ASP C 1 41  ? 0.257   1.498   47.930 1.00 35.18 ? 41  ASP B CA    1 
ATOM   3256 C  C     . ASP C 1 41  ? 0.946   1.894   49.245 1.00 34.61 ? 41  ASP B C     1 
ATOM   3257 O  O     . ASP C 1 41  ? 0.576   2.845   49.934 1.00 35.51 ? 41  ASP B O     1 
ATOM   3258 C  CB    . ASP C 1 41  ? -1.223  1.072   47.960 1.00 48.34 ? 41  ASP B CB    1 
ATOM   3259 C  CG    . ASP C 1 41  ? -1.923  1.125   46.541 1.00 60.08 ? 41  ASP B CG    1 
ATOM   3260 O  OD1   . ASP C 1 41  ? -1.311  1.051   45.434 1.00 66.30 ? 41  ASP B OD1   1 
ATOM   3261 O  OD2   . ASP C 1 41  ? -3.174  1.216   46.492 1.00 68.30 ? 41  ASP B OD2   1 
ATOM   3262 N  N     . GLN C 1 42  ? 2.153   1.389   49.444 1.00 29.90 ? 42  GLN B N     1 
ATOM   3263 C  CA    . GLN C 1 42  ? 2.928   1.765   50.629 1.00 29.96 ? 42  GLN B CA    1 
ATOM   3264 C  C     . GLN C 1 42  ? 3.922   2.885   50.327 1.00 23.41 ? 42  GLN B C     1 
ATOM   3265 O  O     . GLN C 1 42  ? 4.655   3.328   51.206 1.00 27.57 ? 42  GLN B O     1 
ATOM   3266 C  CB    . GLN C 1 42  ? 3.751   0.571   51.034 1.00 30.05 ? 42  GLN B CB    1 
ATOM   3267 C  CG    . GLN C 1 42  ? 3.163   -0.205  52.135 1.00 41.16 ? 42  GLN B CG    1 
ATOM   3268 C  CD    . GLN C 1 42  ? 3.903   -1.503  52.306 1.00 45.40 ? 42  GLN B CD    1 
ATOM   3269 O  OE1   . GLN C 1 42  ? 4.436   -2.105  51.328 1.00 42.75 ? 42  GLN B OE1   1 
ATOM   3270 N  NE2   . GLN C 1 42  ? 3.994   -1.914  53.569 1.00 38.09 ? 42  GLN B NE2   1 
ATOM   3271 N  N     . PHE C 1 43  ? 3.981   3.293   49.073 1.00 24.92 ? 43  PHE B N     1 
ATOM   3272 C  CA    . PHE C 1 43  ? 4.973   4.270   48.617 1.00 27.50 ? 43  PHE B CA    1 
ATOM   3273 C  C     . PHE C 1 43  ? 4.278   5.480   48.027 1.00 23.60 ? 43  PHE B C     1 
ATOM   3274 O  O     . PHE C 1 43  ? 3.293   5.365   47.320 1.00 27.84 ? 43  PHE B O     1 
ATOM   3275 C  CB    . PHE C 1 43  ? 5.879   3.620   47.500 1.00 26.75 ? 43  PHE B CB    1 
ATOM   3276 C  CG    . PHE C 1 43  ? 6.810   2.521   48.007 1.00 21.01 ? 43  PHE B CG    1 
ATOM   3277 C  CD1   . PHE C 1 43  ? 7.801   2.836   48.923 1.00 17.95 ? 43  PHE B CD1   1 
ATOM   3278 C  CD2   . PHE C 1 43  ? 6.470   1.161   47.809 1.00 20.80 ? 43  PHE B CD2   1 
ATOM   3279 C  CE1   . PHE C 1 43  ? 8.459   1.835   49.698 1.00 22.94 ? 43  PHE B CE1   1 
ATOM   3280 C  CE2   . PHE C 1 43  ? 7.097   0.152   48.555 1.00 11.58 ? 43  PHE B CE2   1 
ATOM   3281 C  CZ    . PHE C 1 43  ? 8.087   0.484   49.510 1.00 16.20 ? 43  PHE B CZ    1 
ATOM   3282 N  N     . GLU C 1 44  ? 4.679   6.649   48.458 1.00 28.39 ? 44  GLU B N     1 
ATOM   3283 C  CA    . GLU C 1 44  ? 4.189   7.837   47.740 1.00 33.43 ? 44  GLU B CA    1 
ATOM   3284 C  C     . GLU C 1 44  ? 5.243   8.100   46.618 1.00 32.28 ? 44  GLU B C     1 
ATOM   3285 O  O     . GLU C 1 44  ? 6.457   8.112   46.853 1.00 26.64 ? 44  GLU B O     1 
ATOM   3286 C  CB    . GLU C 1 44  ? 4.112   8.990   48.724 1.00 37.31 ? 44  GLU B CB    1 
ATOM   3287 C  CG    . GLU C 1 44  ? 3.396   10.179  48.164 1.00 47.58 ? 44  GLU B CG    1 
ATOM   3288 C  CD    . GLU C 1 44  ? 4.031   11.449  48.652 1.00 59.96 ? 44  GLU B CD    1 
ATOM   3289 O  OE1   . GLU C 1 44  ? 4.357   11.582  49.880 1.00 63.42 ? 44  GLU B OE1   1 
ATOM   3290 O  OE2   . GLU C 1 44  ? 4.184   12.324  47.754 1.00 69.73 ? 44  GLU B OE2   1 
ATOM   3291 N  N     . ARG C 1 45  ? 4.778   8.282   45.404 1.00 31.53 ? 45  ARG B N     1 
ATOM   3292 C  CA    . ARG C 1 45  ? 5.697   8.458   44.284 1.00 36.27 ? 45  ARG B CA    1 
ATOM   3293 C  C     . ARG C 1 45  ? 5.829   9.959   44.004 1.00 36.89 ? 45  ARG B C     1 
ATOM   3294 O  O     . ARG C 1 45  ? 4.961   10.499  43.299 1.00 41.32 ? 45  ARG B O     1 
ATOM   3295 C  CB    . ARG C 1 45  ? 5.160   7.729   43.057 1.00 40.13 ? 45  ARG B CB    1 
ATOM   3296 C  CG    . ARG C 1 45  ? 5.225   6.191   43.050 1.00 51.66 ? 45  ARG B CG    1 
ATOM   3297 C  CD    . ARG C 1 45  ? 3.845   5.465   43.181 1.00 61.67 ? 45  ARG B CD    1 
ATOM   3298 N  NE    . ARG C 1 45  ? 2.701   6.126   42.525 1.00 72.15 ? 45  ARG B NE    1 
ATOM   3299 C  CZ    . ARG C 1 45  ? 2.588   6.482   41.237 1.00 75.74 ? 45  ARG B CZ    1 
ATOM   3300 N  NH1   . ARG C 1 45  ? 3.545   6.271   40.339 1.00 77.36 ? 45  ARG B NH1   1 
ATOM   3301 N  NH2   . ARG C 1 45  ? 1.489   7.106   40.836 1.00 80.79 ? 45  ARG B NH2   1 
ATOM   3302 N  N     . ILE C 1 46  ? 6.975   10.512  44.420 1.00 30.02 ? 46  ILE B N     1 
ATOM   3303 C  CA    . ILE C 1 46  ? 7.460   11.888  44.357 1.00 21.93 ? 46  ILE B CA    1 
ATOM   3304 C  C     . ILE C 1 46  ? 7.916   12.337  42.982 1.00 28.85 ? 46  ILE B C     1 
ATOM   3305 O  O     . ILE C 1 46  ? 7.255   13.244  42.476 1.00 29.93 ? 46  ILE B O     1 
ATOM   3306 C  CB    . ILE C 1 46  ? 8.512   12.056  45.425 1.00 24.34 ? 46  ILE B CB    1 
ATOM   3307 C  CG1   . ILE C 1 46  ? 7.922   11.662  46.786 1.00 22.58 ? 46  ILE B CG1   1 
ATOM   3308 C  CG2   . ILE C 1 46  ? 9.198   13.444  45.281 1.00 30.29 ? 46  ILE B CG2   1 
ATOM   3309 C  CD1   . ILE C 1 46  ? 8.873   11.604  47.962 1.00 26.01 ? 46  ILE B CD1   1 
ATOM   3310 N  N     . LYS C 1 47  ? 9.047   11.867  42.418 1.00 25.91 ? 47  LYS B N     1 
ATOM   3311 C  CA    . LYS C 1 47  ? 9.436   12.126  41.002 1.00 26.25 ? 47  LYS B CA    1 
ATOM   3312 C  C     . LYS C 1 47  ? 10.458  11.229  40.290 1.00 27.84 ? 47  LYS B C     1 
ATOM   3313 O  O     . LYS C 1 47  ? 11.386  10.785  40.926 1.00 26.80 ? 47  LYS B O     1 
ATOM   3314 C  CB    . LYS C 1 47  ? 9.992   13.532  40.790 1.00 27.29 ? 47  LYS B CB    1 
ATOM   3315 C  CG    . LYS C 1 47  ? 11.034  13.954  41.766 1.00 21.73 ? 47  LYS B CG    1 
ATOM   3316 C  CD    . LYS C 1 47  ? 11.677  15.260  41.173 1.00 34.42 ? 47  LYS B CD    1 
ATOM   3317 C  CE    . LYS C 1 47  ? 11.569  15.543  39.659 1.00 39.50 ? 47  LYS B CE    1 
ATOM   3318 N  NZ    . LYS C 1 47  ? 12.730  16.417  39.246 1.00 33.53 ? 47  LYS B NZ    1 
ATOM   3319 N  N     . THR C 1 48  ? 10.450  11.270  38.962 1.00 24.78 ? 48  THR B N     1 
ATOM   3320 C  CA    . THR C 1 48  ? 11.367  10.527  38.132 1.00 25.44 ? 48  THR B CA    1 
ATOM   3321 C  C     . THR C 1 48  ? 12.788  11.046  38.190 1.00 26.59 ? 48  THR B C     1 
ATOM   3322 O  O     . THR C 1 48  ? 12.972  12.243  38.228 1.00 27.78 ? 48  THR B O     1 
ATOM   3323 C  CB    . THR C 1 48  ? 10.877  10.504  36.760 1.00 23.43 ? 48  THR B CB    1 
ATOM   3324 O  OG1   . THR C 1 48  ? 9.583   9.928   36.797 1.00 29.07 ? 48  THR B OG1   1 
ATOM   3325 C  CG2   . THR C 1 48  ? 11.738  9.626   35.868 1.00 32.12 ? 48  THR B CG2   1 
ATOM   3326 N  N     . LEU C 1 49  ? 13.689  10.135  38.563 1.00 25.82 ? 49  LEU B N     1 
ATOM   3327 C  CA    . LEU C 1 49  ? 15.136  10.362  38.695 1.00 21.32 ? 49  LEU B CA    1 
ATOM   3328 C  C     . LEU C 1 49  ? 15.937  10.083  37.433 1.00 21.31 ? 49  LEU B C     1 
ATOM   3329 O  O     . LEU C 1 49  ? 17.043  10.636  37.269 1.00 22.64 ? 49  LEU B O     1 
ATOM   3330 C  CB    . LEU C 1 49  ? 15.773  9.568   39.831 1.00 19.17 ? 49  LEU B CB    1 
ATOM   3331 C  CG    . LEU C 1 49  ? 15.154  9.867   41.178 1.00 24.39 ? 49  LEU B CG    1 
ATOM   3332 C  CD1   . LEU C 1 49  ? 15.484  8.717   42.224 1.00 21.65 ? 49  LEU B CD1   1 
ATOM   3333 C  CD2   . LEU C 1 49  ? 15.478  11.341  41.631 1.00 21.29 ? 49  LEU B CD2   1 
ATOM   3334 N  N     . GLY C 1 50  ? 15.434  9.187   36.595 1.00 17.38 ? 50  GLY B N     1 
ATOM   3335 C  CA    . GLY C 1 50  ? 16.150  8.815   35.406 1.00 14.41 ? 50  GLY B CA    1 
ATOM   3336 C  C     . GLY C 1 50  ? 15.298  7.807   34.708 1.00 22.32 ? 50  GLY B C     1 
ATOM   3337 O  O     . GLY C 1 50  ? 14.358  7.247   35.263 1.00 19.82 ? 50  GLY B O     1 
ATOM   3338 N  N     . THR C 1 51  ? 15.511  7.744   33.403 1.00 24.34 ? 51  THR B N     1 
ATOM   3339 C  CA    . THR C 1 51  ? 14.876  6.713   32.584 1.00 23.99 ? 51  THR B CA    1 
ATOM   3340 C  C     . THR C 1 51  ? 15.992  5.896   31.840 1.00 21.69 ? 51  THR B C     1 
ATOM   3341 O  O     . THR C 1 51  ? 17.167  6.268   31.895 1.00 17.89 ? 51  THR B O     1 
ATOM   3342 C  CB    . THR C 1 51  ? 14.042  7.397   31.543 1.00 21.99 ? 51  THR B CB    1 
ATOM   3343 O  OG1   . THR C 1 51  ? 14.909  8.375   30.943 1.00 28.23 ? 51  THR B OG1   1 
ATOM   3344 C  CG2   . THR C 1 51  ? 12.761  7.981   32.205 1.00 24.24 ? 51  THR B CG2   1 
ATOM   3345 N  N     . GLY C 1 52  ? 15.590  4.876   31.082 1.00 21.41 ? 52  GLY B N     1 
ATOM   3346 C  CA    . GLY C 1 52  ? 16.535  4.102   30.322 1.00 21.54 ? 52  GLY B CA    1 
ATOM   3347 C  C     . GLY C 1 52  ? 15.908  3.460   29.131 1.00 18.71 ? 52  GLY B C     1 
ATOM   3348 O  O     . GLY C 1 52  ? 14.788  3.799   28.798 1.00 18.69 ? 52  GLY B O     1 
ATOM   3349 N  N     . SER C 1 53  ? 16.609  2.534   28.472 1.00 19.08 ? 53  SER B N     1 
ATOM   3350 C  CA    . SER C 1 53  ? 15.970  1.760   27.400 1.00 15.67 ? 53  SER B CA    1 
ATOM   3351 C  C     . SER C 1 53  ? 14.868  0.797   27.959 1.00 18.31 ? 53  SER B C     1 
ATOM   3352 O  O     . SER C 1 53  ? 14.015  0.346   27.215 1.00 23.52 ? 53  SER B O     1 
ATOM   3353 C  CB    . SER C 1 53  ? 17.012  0.838   26.775 1.00 12.59 ? 53  SER B CB    1 
ATOM   3354 O  OG    . SER C 1 53  ? 17.610  1.395   25.645 1.00 19.72 ? 53  SER B OG    1 
ATOM   3355 N  N     . PHE C 1 54  ? 14.872  0.475   29.246 1.00 17.97 ? 54  PHE B N     1 
ATOM   3356 C  CA    . PHE C 1 54  ? 13.977  -0.534  29.743 1.00 24.22 ? 54  PHE B CA    1 
ATOM   3357 C  C     . PHE C 1 54  ? 12.987  -0.011  30.776 1.00 27.44 ? 54  PHE B C     1 
ATOM   3358 O  O     . PHE C 1 54  ? 11.788  -0.254  30.627 1.00 30.66 ? 54  PHE B O     1 
ATOM   3359 C  CB    . PHE C 1 54  ? 14.807  -1.737  30.267 1.00 14.13 ? 54  PHE B CB    1 
ATOM   3360 C  CG    . PHE C 1 54  ? 15.737  -2.287  29.199 1.00 22.50 ? 54  PHE B CG    1 
ATOM   3361 C  CD1   . PHE C 1 54  ? 15.233  -2.809  28.012 1.00 21.70 ? 54  PHE B CD1   1 
ATOM   3362 C  CD2   . PHE C 1 54  ? 17.126  -2.123  29.289 1.00 23.35 ? 54  PHE B CD2   1 
ATOM   3363 C  CE1   . PHE C 1 54  ? 16.055  -3.143  26.932 1.00 21.18 ? 54  PHE B CE1   1 
ATOM   3364 C  CE2   . PHE C 1 54  ? 17.994  -2.482  28.202 1.00 11.12 ? 54  PHE B CE2   1 
ATOM   3365 C  CZ    . PHE C 1 54  ? 17.458  -2.975  27.053 1.00 18.95 ? 54  PHE B CZ    1 
ATOM   3366 N  N     . GLY C 1 55  ? 13.498  0.688   31.772 1.00 24.57 ? 55  GLY B N     1 
ATOM   3367 C  CA    . GLY C 1 55  ? 12.693  1.226   32.843 1.00 26.69 ? 55  GLY B CA    1 
ATOM   3368 C  C     . GLY C 1 55  ? 12.849  2.692   33.230 1.00 26.30 ? 55  GLY B C     1 
ATOM   3369 O  O     . GLY C 1 55  ? 13.492  3.461   32.510 1.00 28.41 ? 55  GLY B O     1 
ATOM   3370 N  N     . ARG C 1 56  ? 12.160  3.040   34.317 1.00 22.57 ? 56  ARG B N     1 
ATOM   3371 C  CA    . ARG C 1 56  ? 12.036  4.390   34.858 1.00 24.11 ? 56  ARG B CA    1 
ATOM   3372 C  C     . ARG C 1 56  ? 12.304  4.245   36.324 1.00 20.95 ? 56  ARG B C     1 
ATOM   3373 O  O     . ARG C 1 56  ? 11.763  3.351   36.914 1.00 23.03 ? 56  ARG B O     1 
ATOM   3374 C  CB    . ARG C 1 56  ? 10.576  4.796   34.666 1.00 29.74 ? 56  ARG B CB    1 
ATOM   3375 C  CG    . ARG C 1 56  ? 10.099  5.980   35.508 1.00 41.14 ? 56  ARG B CG    1 
ATOM   3376 C  CD    . ARG C 1 56  ? 8.730   6.463   35.045 1.00 43.41 ? 56  ARG B CD    1 
ATOM   3377 N  NE    . ARG C 1 56  ? 8.656   6.951   33.651 1.00 43.55 ? 56  ARG B NE    1 
ATOM   3378 C  CZ    . ARG C 1 56  ? 8.691   8.238   33.288 1.00 38.45 ? 56  ARG B CZ    1 
ATOM   3379 N  NH1   . ARG C 1 56  ? 8.834   9.197   34.192 1.00 38.85 ? 56  ARG B NH1   1 
ATOM   3380 N  NH2   . ARG C 1 56  ? 8.585   8.572   32.014 1.00 32.47 ? 56  ARG B NH2   1 
ATOM   3381 N  N     . VAL C 1 57  ? 13.209  5.030   36.895 1.00 16.88 ? 57  VAL B N     1 
ATOM   3382 C  CA    . VAL C 1 57  ? 13.446  5.030   38.332 1.00 15.92 ? 57  VAL B CA    1 
ATOM   3383 C  C     . VAL C 1 57  ? 12.805  6.307   38.942 1.00 22.32 ? 57  VAL B C     1 
ATOM   3384 O  O     . VAL C 1 57  ? 13.007  7.419   38.376 1.00 20.31 ? 57  VAL B O     1 
ATOM   3385 C  CB    . VAL C 1 57  ? 14.890  4.988   38.541 1.00 12.09 ? 57  VAL B CB    1 
ATOM   3386 C  CG1   . VAL C 1 57  ? 15.184  4.903   39.957 1.00 10.90 ? 57  VAL B CG1   1 
ATOM   3387 C  CG2   . VAL C 1 57  ? 15.399  3.661   37.928 1.00 25.19 ? 57  VAL B CG2   1 
ATOM   3388 N  N     . MET C 1 58  ? 12.197  6.182   40.133 1.00 21.27 ? 58  MET B N     1 
ATOM   3389 C  CA    . MET C 1 58  ? 11.480  7.318   40.718 1.00 21.22 ? 58  MET B CA    1 
ATOM   3390 C  C     . MET C 1 58  ? 11.776  7.463   42.168 1.00 23.22 ? 58  MET B C     1 
ATOM   3391 O  O     . MET C 1 58  ? 11.927  6.429   42.803 1.00 27.48 ? 58  MET B O     1 
ATOM   3392 C  CB    . MET C 1 58  ? 9.960   7.124   40.608 1.00 21.68 ? 58  MET B CB    1 
ATOM   3393 C  CG    . MET C 1 58  ? 9.330   7.092   39.204 1.00 22.09 ? 58  MET B CG    1 
ATOM   3394 S  SD    . MET C 1 58  ? 7.512   7.437   39.643 1.00 34.28 ? 58  MET B SD    1 
ATOM   3395 C  CE    . MET C 1 58  ? 6.877   7.070   38.008 1.00 26.57 ? 58  MET B CE    1 
ATOM   3396 N  N     . LEU C 1 59  ? 11.897  8.700   42.682 1.00 20.92 ? 59  LEU B N     1 
ATOM   3397 C  CA    . LEU C 1 59  ? 12.049  8.956   44.119 1.00 23.33 ? 59  LEU B CA    1 
ATOM   3398 C  C     . LEU C 1 59  ? 10.678  8.734   44.751 1.00 16.31 ? 59  LEU B C     1 
ATOM   3399 O  O     . LEU C 1 59  ? 9.665   8.972   44.103 1.00 19.34 ? 59  LEU B O     1 
ATOM   3400 C  CB    . LEU C 1 59  ? 12.605  10.349  44.425 1.00 26.26 ? 59  LEU B CB    1 
ATOM   3401 C  CG    . LEU C 1 59  ? 12.709  10.687  45.900 1.00 23.49 ? 59  LEU B CG    1 
ATOM   3402 C  CD1   . LEU C 1 59  ? 13.885  10.076  46.625 1.00 18.77 ? 59  LEU B CD1   1 
ATOM   3403 C  CD2   . LEU C 1 59  ? 12.699  12.195  46.054 1.00 24.33 ? 59  LEU B CD2   1 
ATOM   3404 N  N     . VAL C 1 60  ? 10.670  7.972   45.816 1.00 13.93 ? 60  VAL B N     1 
ATOM   3405 C  CA    . VAL C 1 60  ? 9.423   7.584   46.470 1.00 19.86 ? 60  VAL B CA    1 
ATOM   3406 C  C     . VAL C 1 60  ? 9.699   7.722   47.932 1.00 22.76 ? 60  VAL B C     1 
ATOM   3407 O  O     . VAL C 1 60  ? 10.885  7.726   48.368 1.00 21.83 ? 60  VAL B O     1 
ATOM   3408 C  CB    . VAL C 1 60  ? 8.905   6.085   46.132 1.00 22.78 ? 60  VAL B CB    1 
ATOM   3409 C  CG1   . VAL C 1 60  ? 8.560   5.918   44.654 1.00 16.39 ? 60  VAL B CG1   1 
ATOM   3410 C  CG2   . VAL C 1 60  ? 9.968   4.989   46.471 1.00 18.84 ? 60  VAL B CG2   1 
ATOM   3411 N  N     . LYS C 1 61  ? 8.589   7.829   48.672 1.00 23.38 ? 61  LYS B N     1 
ATOM   3412 C  CA    . LYS C 1 61  ? 8.591   7.899   50.156 1.00 23.90 ? 61  LYS B CA    1 
ATOM   3413 C  C     . LYS C 1 61  ? 7.720   6.727   50.685 1.00 23.64 ? 61  LYS B C     1 
ATOM   3414 O  O     . LYS C 1 61  ? 6.726   6.384   50.067 1.00 26.71 ? 61  LYS B O     1 
ATOM   3415 C  CB    . LYS C 1 61  ? 8.000   9.248   50.662 1.00 22.67 ? 61  LYS B CB    1 
ATOM   3416 C  CG    . LYS C 1 61  ? 8.494   9.577   52.024 1.00 33.60 ? 61  LYS B CG    1 
ATOM   3417 C  CD    . LYS C 1 61  ? 7.822   10.795  52.724 1.00 44.48 ? 61  LYS B CD    1 
ATOM   3418 C  CE    . LYS C 1 61  ? 8.805   11.473  53.737 1.00 47.57 ? 61  LYS B CE    1 
ATOM   3419 N  NZ    . LYS C 1 61  ? 8.528   12.723  54.542 1.00 50.38 ? 61  LYS B NZ    1 
ATOM   3420 N  N     . HIS C 1 62  ? 8.231   5.984   51.657 1.00 21.25 ? 62  HIS B N     1 
ATOM   3421 C  CA    . HIS C 1 62  ? 7.501   4.911   52.239 1.00 25.23 ? 62  HIS B CA    1 
ATOM   3422 C  C     . HIS C 1 62  ? 6.653   5.580   53.309 1.00 24.85 ? 62  HIS B C     1 
ATOM   3423 O  O     . HIS C 1 62  ? 7.151   6.053   54.316 1.00 23.09 ? 62  HIS B O     1 
ATOM   3424 C  CB    . HIS C 1 62  ? 8.481   3.990   52.871 1.00 32.84 ? 62  HIS B CB    1 
ATOM   3425 C  CG    . HIS C 1 62  ? 7.874   2.760   53.468 1.00 40.64 ? 62  HIS B CG    1 
ATOM   3426 N  ND1   . HIS C 1 62  ? 7.354   1.740   52.707 1.00 41.49 ? 62  HIS B ND1   1 
ATOM   3427 C  CD2   . HIS C 1 62  ? 7.755   2.372   54.754 1.00 42.03 ? 62  HIS B CD2   1 
ATOM   3428 C  CE1   . HIS C 1 62  ? 6.948   0.769   53.495 1.00 45.03 ? 62  HIS B CE1   1 
ATOM   3429 N  NE2   . HIS C 1 62  ? 7.176   1.132   54.740 1.00 48.66 ? 62  HIS B NE2   1 
ATOM   3430 N  N     . LYS C 1 63  ? 5.350   5.371   53.143 1.00 27.01 ? 63  LYS B N     1 
ATOM   3431 C  CA    . LYS C 1 63  ? 4.262   5.888   53.982 1.00 28.76 ? 63  LYS B CA    1 
ATOM   3432 C  C     . LYS C 1 63  ? 4.343   5.568   55.435 1.00 32.39 ? 63  LYS B C     1 
ATOM   3433 O  O     . LYS C 1 63  ? 3.983   6.431   56.225 1.00 41.01 ? 63  LYS B O     1 
ATOM   3434 C  CB    . LYS C 1 63  ? 2.884   5.475   53.487 1.00 22.86 ? 63  LYS B CB    1 
ATOM   3435 C  CG    . LYS C 1 63  ? 2.640   6.209   52.248 1.00 19.80 ? 63  LYS B CG    1 
ATOM   3436 C  CD    . LYS C 1 63  ? 1.365   5.728   51.758 1.00 18.60 ? 63  LYS B CD    1 
ATOM   3437 C  CE    . LYS C 1 63  ? 1.254   6.051   50.328 1.00 24.20 ? 63  LYS B CE    1 
ATOM   3438 N  NZ    . LYS C 1 63  ? -0.159  5.652   49.918 1.00 37.06 ? 63  LYS B NZ    1 
ATOM   3439 N  N     . GLU C 1 64  ? 5.039   4.510   55.799 1.00 35.47 ? 64  GLU B N     1 
ATOM   3440 C  CA    . GLU C 1 64  ? 5.076   4.188   57.191 1.00 42.45 ? 64  GLU B CA    1 
ATOM   3441 C  C     . GLU C 1 64  ? 6.322   4.521   57.938 1.00 47.54 ? 64  GLU B C     1 
ATOM   3442 O  O     . GLU C 1 64  ? 6.309   4.291   59.150 1.00 57.84 ? 64  GLU B O     1 
ATOM   3443 C  CB    . GLU C 1 64  ? 4.711   2.733   57.430 1.00 45.79 ? 64  GLU B CB    1 
ATOM   3444 C  CG    . GLU C 1 64  ? 3.233   2.532   57.479 1.00 53.69 ? 64  GLU B CG    1 
ATOM   3445 C  CD    . GLU C 1 64  ? 2.813   1.270   56.790 1.00 58.29 ? 64  GLU B CD    1 
ATOM   3446 O  OE1   . GLU C 1 64  ? 2.806   0.224   57.486 1.00 62.14 ? 64  GLU B OE1   1 
ATOM   3447 O  OE2   . GLU C 1 64  ? 2.482   1.366   55.579 1.00 61.32 ? 64  GLU B OE2   1 
ATOM   3448 N  N     . THR C 1 65  ? 7.434   4.849   57.292 1.00 45.39 ? 65  THR B N     1 
ATOM   3449 C  CA    . THR C 1 65  ? 8.648   5.205   58.076 1.00 43.51 ? 65  THR B CA    1 
ATOM   3450 C  C     . THR C 1 65  ? 9.180   6.593   57.697 1.00 45.96 ? 65  THR B C     1 
ATOM   3451 O  O     . THR C 1 65  ? 10.160  7.047   58.286 1.00 46.19 ? 65  THR B O     1 
ATOM   3452 C  CB    . THR C 1 65  ? 9.766   4.177   57.875 1.00 45.50 ? 65  THR B CB    1 
ATOM   3453 O  OG1   . THR C 1 65  ? 10.244  4.242   56.510 1.00 44.86 ? 65  THR B OG1   1 
ATOM   3454 C  CG2   . THR C 1 65  ? 9.245   2.746   58.159 1.00 42.55 ? 65  THR B CG2   1 
ATOM   3455 N  N     . GLY C 1 66  ? 8.594   7.196   56.653 1.00 43.08 ? 66  GLY B N     1 
ATOM   3456 C  CA    . GLY C 1 66  ? 9.013   8.467   56.113 1.00 41.60 ? 66  GLY B CA    1 
ATOM   3457 C  C     . GLY C 1 66  ? 10.322  8.390   55.313 1.00 43.76 ? 66  GLY B C     1 
ATOM   3458 O  O     . GLY C 1 66  ? 10.730  9.413   54.736 1.00 43.89 ? 66  GLY B O     1 
ATOM   3459 N  N     . ASN C 1 67  ? 10.961  7.214   55.193 1.00 38.56 ? 67  ASN B N     1 
ATOM   3460 C  CA    . ASN C 1 67  ? 12.189  7.145   54.425 1.00 32.91 ? 67  ASN B CA    1 
ATOM   3461 C  C     . ASN C 1 67  ? 12.068  7.181   52.941 1.00 27.61 ? 67  ASN B C     1 
ATOM   3462 O  O     . ASN C 1 67  ? 11.071  6.737   52.404 1.00 24.18 ? 67  ASN B O     1 
ATOM   3463 C  CB    . ASN C 1 67  ? 13.044  5.989   54.881 1.00 41.91 ? 67  ASN B CB    1 
ATOM   3464 C  CG    . ASN C 1 67  ? 13.299  6.057   56.336 1.00 44.08 ? 67  ASN B CG    1 
ATOM   3465 O  OD1   . ASN C 1 67  ? 13.869  7.028   56.831 1.00 59.63 ? 67  ASN B OD1   1 
ATOM   3466 N  ND2   . ASN C 1 67  ? 12.701  5.155   57.058 1.00 52.99 ? 67  ASN B ND2   1 
ATOM   3467 N  N     . HIS C 1 68  ? 13.021  7.844   52.288 1.00 24.05 ? 68  HIS B N     1 
ATOM   3468 C  CA    . HIS C 1 68  ? 13.017  7.851   50.799 1.00 26.33 ? 68  HIS B CA    1 
ATOM   3469 C  C     . HIS C 1 68  ? 13.860  6.703   50.273 1.00 21.55 ? 68  HIS B C     1 
ATOM   3470 O  O     . HIS C 1 68  ? 14.801  6.288   50.985 1.00 24.49 ? 68  HIS B O     1 
ATOM   3471 C  CB    . HIS C 1 68  ? 13.637  9.128   50.258 1.00 26.50 ? 68  HIS B CB    1 
ATOM   3472 C  CG    . HIS C 1 68  ? 12.850  10.346  50.608 1.00 29.98 ? 68  HIS B CG    1 
ATOM   3473 N  ND1   . HIS C 1 68  ? 13.000  10.967  51.822 1.00 25.70 ? 68  HIS B ND1   1 
ATOM   3474 C  CD2   . HIS C 1 68  ? 11.854  10.992  49.956 1.00 27.98 ? 68  HIS B CD2   1 
ATOM   3475 C  CE1   . HIS C 1 68  ? 12.118  11.945  51.911 1.00 32.34 ? 68  HIS B CE1   1 
ATOM   3476 N  NE2   . HIS C 1 68  ? 11.420  11.986  50.791 1.00 26.35 ? 68  HIS B NE2   1 
ATOM   3477 N  N     . PHE C 1 69  ? 13.444  6.227   49.109 1.00 17.75 ? 69  PHE B N     1 
ATOM   3478 C  CA    . PHE C 1 69  ? 14.049  5.142   48.289 1.00 20.43 ? 69  PHE B CA    1 
ATOM   3479 C  C     . PHE C 1 69  ? 13.954  5.582   46.843 1.00 21.06 ? 69  PHE B C     1 
ATOM   3480 O  O     . PHE C 1 69  ? 13.250  6.556   46.505 1.00 20.75 ? 69  PHE B O     1 
ATOM   3481 C  CB    . PHE C 1 69  ? 13.223  3.817   48.372 1.00 19.32 ? 69  PHE B CB    1 
ATOM   3482 C  CG    . PHE C 1 69  ? 13.142  3.234   49.773 1.00 18.46 ? 69  PHE B CG    1 
ATOM   3483 C  CD1   . PHE C 1 69  ? 14.328  2.769   50.419 1.00 13.34 ? 69  PHE B CD1   1 
ATOM   3484 C  CD2   . PHE C 1 69  ? 11.958  3.422   50.548 1.00 20.60 ? 69  PHE B CD2   1 
ATOM   3485 C  CE1   . PHE C 1 69  ? 14.407  2.520   51.817 1.00 14.52 ? 69  PHE B CE1   1 
ATOM   3486 C  CE2   . PHE C 1 69  ? 11.989  3.198   51.935 1.00 15.43 ? 69  PHE B CE2   1 
ATOM   3487 C  CZ    . PHE C 1 69  ? 13.210  2.751   52.594 1.00 16.97 ? 69  PHE B CZ    1 
ATOM   3488 N  N     . ALA C 1 70  ? 14.568  4.801   45.947 1.00 23.30 ? 70  ALA B N     1 
ATOM   3489 C  CA    . ALA C 1 70  ? 14.454  5.029   44.494 1.00 19.74 ? 70  ALA B CA    1 
ATOM   3490 C  C     . ALA C 1 70  ? 13.881  3.699   43.968 1.00 19.76 ? 70  ALA B C     1 
ATOM   3491 O  O     . ALA C 1 70  ? 14.378  2.674   44.373 1.00 19.27 ? 70  ALA B O     1 
ATOM   3492 C  CB    . ALA C 1 70  ? 15.778  5.269   43.888 1.00 18.70 ? 70  ALA B CB    1 
ATOM   3493 N  N     . MET C 1 71  ? 12.779  3.717   43.224 1.00 22.72 ? 71  MET B N     1 
ATOM   3494 C  CA    . MET C 1 71  ? 12.118  2.533   42.717 1.00 17.68 ? 71  MET B CA    1 
ATOM   3495 C  C     . MET C 1 71  ? 12.223  2.430   41.232 1.00 14.46 ? 71  MET B C     1 
ATOM   3496 O  O     . MET C 1 71  ? 11.865  3.393   40.588 1.00 12.79 ? 71  MET B O     1 
ATOM   3497 C  CB    . MET C 1 71  ? 10.677  2.567   43.215 1.00 22.93 ? 71  MET B CB    1 
ATOM   3498 C  CG    . MET C 1 71  ? 9.528   1.743   42.516 1.00 23.35 ? 71  MET B CG    1 
ATOM   3499 S  SD    . MET C 1 71  ? 7.922   1.867   43.528 1.00 34.00 ? 71  MET B SD    1 
ATOM   3500 C  CE    . MET C 1 71  ? 7.212   2.672   42.145 1.00 20.29 ? 71  MET B CE    1 
ATOM   3501 N  N     . LYS C 1 72  ? 12.719  1.325   40.655 1.00 9.77  ? 72  LYS B N     1 
ATOM   3502 C  CA    . LYS C 1 72  ? 12.724  1.176   39.183 1.00 10.99 ? 72  LYS B CA    1 
ATOM   3503 C  C     . LYS C 1 72  ? 11.416  0.475   38.908 1.00 10.39 ? 72  LYS B C     1 
ATOM   3504 O  O     . LYS C 1 72  ? 11.094  -0.459  39.676 1.00 19.45 ? 72  LYS B O     1 
ATOM   3505 C  CB    . LYS C 1 72  ? 13.878  0.233   38.781 1.00 12.64 ? 72  LYS B CB    1 
ATOM   3506 C  CG    . LYS C 1 72  ? 14.115  0.087   37.269 1.00 15.32 ? 72  LYS B CG    1 
ATOM   3507 C  CD    . LYS C 1 72  ? 15.473  -0.606  37.082 1.00 8.16  ? 72  LYS B CD    1 
ATOM   3508 C  CE    . LYS C 1 72  ? 15.587  -0.769  35.641 1.00 11.03 ? 72  LYS B CE    1 
ATOM   3509 N  NZ    . LYS C 1 72  ? 16.893  -1.425  35.366 1.00 16.37 ? 72  LYS B NZ    1 
ATOM   3510 N  N     . ILE C 1 73  ? 10.794  0.735   37.769 1.00 13.56 ? 73  ILE B N     1 
ATOM   3511 C  CA    . ILE C 1 73  ? 9.505   0.111   37.391 1.00 17.37 ? 73  ILE B CA    1 
ATOM   3512 C  C     . ILE C 1 73  ? 9.753   -0.272  35.969 1.00 22.20 ? 73  ILE B C     1 
ATOM   3513 O  O     . ILE C 1 73  ? 10.226  0.535   35.153 1.00 23.94 ? 73  ILE B O     1 
ATOM   3514 C  CB    . ILE C 1 73  ? 8.315   1.138   37.377 1.00 26.18 ? 73  ILE B CB    1 
ATOM   3515 C  CG1   . ILE C 1 73  ? 8.224   1.884   38.729 1.00 27.66 ? 73  ILE B CG1   1 
ATOM   3516 C  CG2   . ILE C 1 73  ? 6.974   0.530   36.931 1.00 18.19 ? 73  ILE B CG2   1 
ATOM   3517 C  CD1   . ILE C 1 73  ? 8.151   3.442   38.651 1.00 26.69 ? 73  ILE B CD1   1 
ATOM   3518 N  N     . LEU C 1 74  ? 9.382   -1.519  35.664 1.00 22.86 ? 74  LEU B N     1 
ATOM   3519 C  CA    . LEU C 1 74  ? 9.493   -2.080  34.331 1.00 19.46 ? 74  LEU B CA    1 
ATOM   3520 C  C     . LEU C 1 74  ? 8.095   -2.578  34.027 1.00 24.54 ? 74  LEU B C     1 
ATOM   3521 O  O     . LEU C 1 74  ? 7.527   -3.340  34.820 1.00 24.25 ? 74  LEU B O     1 
ATOM   3522 C  CB    . LEU C 1 74  ? 10.460  -3.290  34.405 1.00 26.60 ? 74  LEU B CB    1 
ATOM   3523 C  CG    . LEU C 1 74  ? 11.973  -3.179  34.729 1.00 28.50 ? 74  LEU B CG    1 
ATOM   3524 C  CD1   . LEU C 1 74  ? 12.788  -4.497  34.771 1.00 23.99 ? 74  LEU B CD1   1 
ATOM   3525 C  CD2   . LEU C 1 74  ? 12.545  -2.405  33.530 1.00 32.33 ? 74  LEU B CD2   1 
ATOM   3526 N  N     . ASP C 1 75  ? 7.603   -2.278  32.836 1.00 22.63 ? 75  ASP B N     1 
ATOM   3527 C  CA    . ASP C 1 75  ? 6.300   -2.728  32.363 1.00 28.65 ? 75  ASP B CA    1 
ATOM   3528 C  C     . ASP C 1 75  ? 6.593   -4.133  31.784 1.00 32.86 ? 75  ASP B C     1 
ATOM   3529 O  O     . ASP C 1 75  ? 7.367   -4.229  30.813 1.00 32.09 ? 75  ASP B O     1 
ATOM   3530 C  CB    . ASP C 1 75  ? 5.952   -1.767  31.251 1.00 32.96 ? 75  ASP B CB    1 
ATOM   3531 C  CG    . ASP C 1 75  ? 4.740   -2.143  30.448 1.00 41.67 ? 75  ASP B CG    1 
ATOM   3532 O  OD1   . ASP C 1 75  ? 4.703   -3.141  29.717 1.00 46.96 ? 75  ASP B OD1   1 
ATOM   3533 O  OD2   . ASP C 1 75  ? 3.906   -1.239  30.260 1.00 55.70 ? 75  ASP B OD2   1 
ATOM   3534 N  N     . LYS C 1 76  ? 5.764   -5.125  32.146 1.00 30.00 ? 76  LYS B N     1 
ATOM   3535 C  CA    . LYS C 1 76  ? 5.932   -6.539  31.709 1.00 29.39 ? 76  LYS B CA    1 
ATOM   3536 C  C     . LYS C 1 76  ? 5.846   -6.918  30.244 1.00 29.92 ? 76  LYS B C     1 
ATOM   3537 O  O     . LYS C 1 76  ? 6.726   -7.581  29.678 1.00 29.10 ? 76  LYS B O     1 
ATOM   3538 C  CB    . LYS C 1 76  ? 5.076   -7.491  32.508 1.00 26.09 ? 76  LYS B CB    1 
ATOM   3539 C  CG    . LYS C 1 76  ? 5.316   -7.506  33.972 1.00 23.54 ? 76  LYS B CG    1 
ATOM   3540 C  CD    . LYS C 1 76  ? 4.034   -8.254  34.368 1.00 31.07 ? 76  LYS B CD    1 
ATOM   3541 C  CE    . LYS C 1 76  ? 3.932   -8.609  35.828 1.00 31.83 ? 76  LYS B CE    1 
ATOM   3542 N  NZ    . LYS C 1 76  ? 2.538   -9.053  36.087 1.00 25.90 ? 76  LYS B NZ    1 
ATOM   3543 N  N     . GLN C 1 77  ? 4.899   -6.299  29.564 1.00 31.87 ? 77  GLN B N     1 
ATOM   3544 C  CA    . GLN C 1 77  ? 4.777   -6.507  28.140 1.00 33.68 ? 77  GLN B CA    1 
ATOM   3545 C  C     . GLN C 1 77  ? 5.912   -5.762  27.421 1.00 36.15 ? 77  GLN B C     1 
ATOM   3546 O  O     . GLN C 1 77  ? 6.198   -6.097  26.255 1.00 35.67 ? 77  GLN B O     1 
ATOM   3547 C  CB    . GLN C 1 77  ? 3.471   -5.906  27.672 1.00 39.43 ? 77  GLN B CB    1 
ATOM   3548 C  CG    . GLN C 1 77  ? 2.208   -6.476  28.301 1.00 49.60 ? 77  GLN B CG    1 
ATOM   3549 C  CD    . GLN C 1 77  ? 0.996   -6.072  27.465 1.00 57.66 ? 77  GLN B CD    1 
ATOM   3550 O  OE1   . GLN C 1 77  ? 0.211   -5.202  27.861 1.00 58.73 ? 77  GLN B OE1   1 
ATOM   3551 N  NE2   . GLN C 1 77  ? 0.887   -6.648  26.256 1.00 62.20 ? 77  GLN B NE2   1 
ATOM   3552 N  N     . LYS C 1 78  ? 6.489   -4.711  28.044 1.00 33.58 ? 78  LYS B N     1 
ATOM   3553 C  CA    . LYS C 1 78  ? 7.628   -3.989  27.479 1.00 29.47 ? 78  LYS B CA    1 
ATOM   3554 C  C     . LYS C 1 78  ? 8.838   -4.905  27.572 1.00 29.72 ? 78  LYS B C     1 
ATOM   3555 O  O     . LYS C 1 78  ? 9.453   -5.138  26.549 1.00 34.21 ? 78  LYS B O     1 
ATOM   3556 C  CB    . LYS C 1 78  ? 7.943   -2.660  28.160 1.00 30.91 ? 78  LYS B CB    1 
ATOM   3557 C  CG    . LYS C 1 78  ? 8.737   -1.837  27.194 1.00 36.98 ? 78  LYS B CG    1 
ATOM   3558 C  CD    . LYS C 1 78  ? 9.754   -0.924  27.824 1.00 46.33 ? 78  LYS B CD    1 
ATOM   3559 C  CE    . LYS C 1 78  ? 10.245  0.034   26.711 1.00 52.76 ? 78  LYS B CE    1 
ATOM   3560 N  NZ    . LYS C 1 78  ? 10.773  1.355   27.192 1.00 60.96 ? 78  LYS B NZ    1 
ATOM   3561 N  N     . VAL C 1 79  ? 9.116   -5.482  28.743 1.00 28.42 ? 79  VAL B N     1 
ATOM   3562 C  CA    . VAL C 1 79  ? 10.213  -6.434  28.953 1.00 27.27 ? 79  VAL B CA    1 
ATOM   3563 C  C     . VAL C 1 79  ? 10.133  -7.590  27.946 1.00 28.75 ? 79  VAL B C     1 
ATOM   3564 O  O     . VAL C 1 79  ? 11.158  -7.962  27.393 1.00 32.88 ? 79  VAL B O     1 
ATOM   3565 C  CB    . VAL C 1 79  ? 10.195  -6.997  30.391 1.00 25.21 ? 79  VAL B CB    1 
ATOM   3566 C  CG1   . VAL C 1 79  ? 11.252  -8.076  30.581 1.00 28.85 ? 79  VAL B CG1   1 
ATOM   3567 C  CG2   . VAL C 1 79  ? 10.397  -5.906  31.441 1.00 26.75 ? 79  VAL B CG2   1 
ATOM   3568 N  N     . VAL C 1 80  ? 8.948   -8.178  27.745 1.00 30.77 ? 80  VAL B N     1 
ATOM   3569 C  CA    . VAL C 1 80  ? 8.723   -9.261  26.768 1.00 23.26 ? 80  VAL B CA    1 
ATOM   3570 C  C     . VAL C 1 80  ? 9.013   -8.821  25.350 1.00 26.37 ? 80  VAL B C     1 
ATOM   3571 O  O     . VAL C 1 80  ? 9.704   -9.540  24.593 1.00 27.30 ? 80  VAL B O     1 
ATOM   3572 C  CB    . VAL C 1 80  ? 7.314   -9.855  26.880 1.00 23.70 ? 80  VAL B CB    1 
ATOM   3573 C  CG1   . VAL C 1 80  ? 6.831   -10.664 25.597 1.00 24.93 ? 80  VAL B CG1   1 
ATOM   3574 C  CG2   . VAL C 1 80  ? 7.214   -10.628 28.175 1.00 17.47 ? 80  VAL B CG2   1 
ATOM   3575 N  N     . LYS C 1 81  ? 8.438   -7.699  24.941 1.00 24.78 ? 81  LYS B N     1 
ATOM   3576 C  CA    . LYS C 1 81  ? 8.708   -7.250  23.591 1.00 24.73 ? 81  LYS B CA    1 
ATOM   3577 C  C     . LYS C 1 81  ? 10.226  -7.016  23.237 1.00 27.40 ? 81  LYS B C     1 
ATOM   3578 O  O     . LYS C 1 81  ? 10.701  -7.305  22.132 1.00 27.58 ? 81  LYS B O     1 
ATOM   3579 C  CB    . LYS C 1 81  ? 7.883   -6.003  23.396 1.00 27.17 ? 81  LYS B CB    1 
ATOM   3580 C  CG    . LYS C 1 81  ? 7.651   -5.624  21.938 1.00 30.25 ? 81  LYS B CG    1 
ATOM   3581 C  CD    . LYS C 1 81  ? 7.425   -4.103  21.945 1.00 40.68 ? 81  LYS B CD    1 
ATOM   3582 C  CE    . LYS C 1 81  ? 7.046   -3.536  20.563 1.00 50.81 ? 81  LYS B CE    1 
ATOM   3583 N  NZ    . LYS C 1 81  ? 6.864   -2.030  20.562 1.00 58.45 ? 81  LYS B NZ    1 
ATOM   3584 N  N     . LEU C 1 82  ? 10.998  -6.535  24.204 1.00 27.64 ? 82  LEU B N     1 
ATOM   3585 C  CA    . LEU C 1 82  ? 12.414  -6.205  24.036 1.00 25.97 ? 82  LEU B CA    1 
ATOM   3586 C  C     . LEU C 1 82  ? 13.361  -7.349  24.395 1.00 28.45 ? 82  LEU B C     1 
ATOM   3587 O  O     . LEU C 1 82  ? 14.532  -7.098  24.687 1.00 34.35 ? 82  LEU B O     1 
ATOM   3588 C  CB    . LEU C 1 82  ? 12.707  -4.951  24.891 1.00 31.69 ? 82  LEU B CB    1 
ATOM   3589 C  CG    . LEU C 1 82  ? 12.005  -3.607  24.591 1.00 32.01 ? 82  LEU B CG    1 
ATOM   3590 C  CD1   . LEU C 1 82  ? 12.466  -2.485  25.492 1.00 33.13 ? 82  LEU B CD1   1 
ATOM   3591 C  CD2   . LEU C 1 82  ? 12.062  -3.180  23.196 1.00 28.99 ? 82  LEU B CD2   1 
ATOM   3592 N  N     . LYS C 1 83  ? 12.847  -8.569  24.564 1.00 27.89 ? 83  LYS B N     1 
ATOM   3593 C  CA    . LYS C 1 83  ? 13.614  -9.807  24.833 1.00 23.17 ? 83  LYS B CA    1 
ATOM   3594 C  C     . LYS C 1 83  ? 14.439  -9.826  26.059 1.00 22.92 ? 83  LYS B C     1 
ATOM   3595 O  O     . LYS C 1 83  ? 15.466  -10.532 26.076 1.00 28.83 ? 83  LYS B O     1 
ATOM   3596 C  CB    . LYS C 1 83  ? 14.480  -10.285 23.657 1.00 20.05 ? 83  LYS B CB    1 
ATOM   3597 C  CG    . LYS C 1 83  ? 13.713  -10.446 22.363 1.00 25.73 ? 83  LYS B CG    1 
ATOM   3598 C  CD    . LYS C 1 83  ? 14.734  -10.713 21.242 1.00 40.86 ? 83  LYS B CD    1 
ATOM   3599 C  CE    . LYS C 1 83  ? 14.136  -10.643 19.828 1.00 48.95 ? 83  LYS B CE    1 
ATOM   3600 N  NZ    . LYS C 1 83  ? 13.414  -9.381  19.427 1.00 57.33 ? 83  LYS B NZ    1 
ATOM   3601 N  N     . GLN C 1 84  ? 13.871  -9.286  27.144 1.00 18.88 ? 84  GLN B N     1 
ATOM   3602 C  CA    . GLN C 1 84  ? 14.582  -9.161  28.420 1.00 16.46 ? 84  GLN B CA    1 
ATOM   3603 C  C     . GLN C 1 84  ? 14.005  -9.943  29.557 1.00 15.55 ? 84  GLN B C     1 
ATOM   3604 O  O     . GLN C 1 84  ? 14.356  -9.706  30.709 1.00 17.86 ? 84  GLN B O     1 
ATOM   3605 C  CB    . GLN C 1 84  ? 14.755  -7.678  28.890 1.00 18.74 ? 84  GLN B CB    1 
ATOM   3606 C  CG    . GLN C 1 84  ? 15.245  -6.682  27.817 1.00 14.44 ? 84  GLN B CG    1 
ATOM   3607 C  CD    . GLN C 1 84  ? 16.613  -7.053  27.472 1.00 14.23 ? 84  GLN B CD    1 
ATOM   3608 O  OE1   . GLN C 1 84  ? 17.444  -7.096  28.362 1.00 19.50 ? 84  GLN B OE1   1 
ATOM   3609 N  NE2   . GLN C 1 84  ? 16.883  -7.246  26.185 1.00 14.50 ? 84  GLN B NE2   1 
ATOM   3610 N  N     . ILE C 1 85  ? 13.139  -10.914 29.287 1.00 15.41 ? 85  ILE B N     1 
ATOM   3611 C  CA    . ILE C 1 85  ? 12.683  -11.791 30.409 1.00 15.02 ? 85  ILE B CA    1 
ATOM   3612 C  C     . ILE C 1 85  ? 13.755  -12.394 31.272 1.00 12.79 ? 85  ILE B C     1 
ATOM   3613 O  O     . ILE C 1 85  ? 13.760  -12.200 32.500 1.00 16.09 ? 85  ILE B O     1 
ATOM   3614 C  CB    . ILE C 1 85  ? 11.753  -12.973 29.922 1.00 18.05 ? 85  ILE B CB    1 
ATOM   3615 C  CG1   . ILE C 1 85  ? 10.578  -12.317 29.150 1.00 23.00 ? 85  ILE B CG1   1 
ATOM   3616 C  CG2   . ILE C 1 85  ? 11.382  -13.822 31.168 1.00 14.93 ? 85  ILE B CG2   1 
ATOM   3617 C  CD1   . ILE C 1 85  ? 9.634   -13.221 28.422 1.00 27.22 ? 85  ILE B CD1   1 
ATOM   3618 N  N     . GLU C 1 86  ? 14.623  -13.218 30.688 1.00 16.22 ? 86  GLU B N     1 
ATOM   3619 C  CA    . GLU C 1 86  ? 15.687  -13.840 31.507 1.00 15.74 ? 86  GLU B CA    1 
ATOM   3620 C  C     . GLU C 1 86  ? 16.640  -12.758 32.117 1.00 18.24 ? 86  GLU B C     1 
ATOM   3621 O  O     . GLU C 1 86  ? 17.009  -12.838 33.307 1.00 17.70 ? 86  GLU B O     1 
ATOM   3622 C  CB    . GLU C 1 86  ? 16.463  -14.767 30.556 1.00 20.69 ? 86  GLU B CB    1 
ATOM   3623 C  CG    . GLU C 1 86  ? 17.273  -15.782 31.359 1.00 27.21 ? 86  GLU B CG    1 
ATOM   3624 C  CD    . GLU C 1 86  ? 16.407  -16.910 31.979 1.00 27.06 ? 86  GLU B CD    1 
ATOM   3625 O  OE1   . GLU C 1 86  ? 15.344  -17.289 31.444 1.00 30.83 ? 86  GLU B OE1   1 
ATOM   3626 O  OE2   . GLU C 1 86  ? 16.756  -17.369 33.073 1.00 22.31 ? 86  GLU B OE2   1 
ATOM   3627 N  N     . HIS C 1 87  ? 16.895  -11.682 31.342 1.00 19.15 ? 87  HIS B N     1 
ATOM   3628 C  CA    . HIS C 1 87  ? 17.740  -10.553 31.787 1.00 18.10 ? 87  HIS B CA    1 
ATOM   3629 C  C     . HIS C 1 87  ? 17.142  -9.874  33.031 1.00 17.72 ? 87  HIS B C     1 
ATOM   3630 O  O     . HIS C 1 87  ? 17.820  -9.732  34.083 1.00 22.46 ? 87  HIS B O     1 
ATOM   3631 C  CB    . HIS C 1 87  ? 17.932  -9.546  30.660 1.00 12.80 ? 87  HIS B CB    1 
ATOM   3632 C  CG    . HIS C 1 87  ? 18.963  -9.929  29.622 1.00 17.36 ? 87  HIS B CG    1 
ATOM   3633 N  ND1   . HIS C 1 87  ? 19.057  -9.293  28.404 1.00 13.86 ? 87  HIS B ND1   1 
ATOM   3634 C  CD2   . HIS C 1 87  ? 19.893  -10.919 29.591 1.00 21.01 ? 87  HIS B CD2   1 
ATOM   3635 C  CE1   . HIS C 1 87  ? 19.976  -9.881  27.656 1.00 20.82 ? 87  HIS B CE1   1 
ATOM   3636 N  NE2   . HIS C 1 87  ? 20.512  -10.860 28.359 1.00 17.84 ? 87  HIS B NE2   1 
ATOM   3637 N  N     . THR C 1 88  ? 15.819  -9.658  32.984 1.00 16.02 ? 88  THR B N     1 
ATOM   3638 C  CA    . THR C 1 88  ? 15.103  -9.037  34.134 1.00 15.20 ? 88  THR B CA    1 
ATOM   3639 C  C     . THR C 1 88  ? 15.023  -9.923  35.399 1.00 12.58 ? 88  THR B C     1 
ATOM   3640 O  O     . THR C 1 88  ? 15.240  -9.491  36.560 1.00 19.70 ? 88  THR B O     1 
ATOM   3641 C  CB    . THR C 1 88  ? 13.700  -8.594  33.565 1.00 21.20 ? 88  THR B CB    1 
ATOM   3642 O  OG1   . THR C 1 88  ? 13.870  -7.600  32.520 1.00 19.66 ? 88  THR B OG1   1 
ATOM   3643 C  CG2   . THR C 1 88  ? 12.806  -8.077  34.631 1.00 10.47 ? 88  THR B CG2   1 
ATOM   3644 N  N     . LEU C 1 89  ? 14.847  -11.235 35.223 1.00 17.59 ? 89  LEU B N     1 
ATOM   3645 C  CA    . LEU C 1 89  ? 14.927  -12.188 36.387 1.00 16.66 ? 89  LEU B CA    1 
ATOM   3646 C  C     . LEU C 1 89  ? 16.365  -12.215 36.848 1.00 14.55 ? 89  LEU B C     1 
ATOM   3647 O  O     . LEU C 1 89  ? 16.576  -12.242 38.057 1.00 16.32 ? 89  LEU B O     1 
ATOM   3648 C  CB    . LEU C 1 89  ? 14.525  -13.646 36.005 1.00 22.97 ? 89  LEU B CB    1 
ATOM   3649 C  CG    . LEU C 1 89  ? 13.209  -13.812 35.227 1.00 21.88 ? 89  LEU B CG    1 
ATOM   3650 C  CD1   . LEU C 1 89  ? 13.027  -15.257 34.864 1.00 26.67 ? 89  LEU B CD1   1 
ATOM   3651 C  CD2   . LEU C 1 89  ? 11.951  -13.209 35.864 1.00 26.83 ? 89  LEU B CD2   1 
ATOM   3652 N  N     . ASN C 1 90  ? 17.335  -12.130 35.914 1.00 18.16 ? 90  ASN B N     1 
ATOM   3653 C  CA    . ASN C 1 90  ? 18.776  -12.125 36.328 1.00 20.23 ? 90  ASN B CA    1 
ATOM   3654 C  C     . ASN C 1 90  ? 19.064  -10.905 37.226 1.00 17.24 ? 90  ASN B C     1 
ATOM   3655 O  O     . ASN C 1 90  ? 19.574  -10.993 38.367 1.00 13.08 ? 90  ASN B O     1 
ATOM   3656 C  CB    . ASN C 1 90  ? 19.732  -12.089 35.132 1.00 18.06 ? 90  ASN B CB    1 
ATOM   3657 C  CG    . ASN C 1 90  ? 19.862  -13.427 34.381 1.00 27.81 ? 90  ASN B CG    1 
ATOM   3658 O  OD1   . ASN C 1 90  ? 19.523  -14.523 34.876 1.00 20.71 ? 90  ASN B OD1   1 
ATOM   3659 N  ND2   . ASN C 1 90  ? 20.227  -13.306 33.094 1.00 18.01 ? 90  ASN B ND2   1 
ATOM   3660 N  N     . GLU C 1 91  ? 18.616  -9.759  36.711 1.00 19.68 ? 91  GLU B N     1 
ATOM   3661 C  CA    . GLU C 1 91  ? 18.753  -8.454  37.429 1.00 20.23 ? 91  GLU B CA    1 
ATOM   3662 C  C     . GLU C 1 91  ? 18.280  -8.544  38.893 1.00 19.66 ? 91  GLU B C     1 
ATOM   3663 O  O     . GLU C 1 91  ? 19.091  -8.316  39.794 1.00 16.84 ? 91  GLU B O     1 
ATOM   3664 C  CB    . GLU C 1 91  ? 17.934  -7.385  36.653 1.00 14.79 ? 91  GLU B CB    1 
ATOM   3665 C  CG    . GLU C 1 91  ? 17.936  -6.037  37.284 1.00 15.52 ? 91  GLU B CG    1 
ATOM   3666 C  CD    . GLU C 1 91  ? 17.459  -4.923  36.394 1.00 16.72 ? 91  GLU B CD    1 
ATOM   3667 O  OE1   . GLU C 1 91  ? 16.896  -5.121  35.292 1.00 13.60 ? 91  GLU B OE1   1 
ATOM   3668 O  OE2   . GLU C 1 91  ? 17.718  -3.776  36.817 1.00 20.38 ? 91  GLU B OE2   1 
ATOM   3669 N  N     . LYS C 1 92  ? 17.026  -8.999  39.130 1.00 18.12 ? 92  LYS B N     1 
ATOM   3670 C  CA    . LYS C 1 92  ? 16.496  -9.106  40.501 1.00 18.35 ? 92  LYS B CA    1 
ATOM   3671 C  C     . LYS C 1 92  ? 17.185  -10.166 41.304 1.00 16.97 ? 92  LYS B C     1 
ATOM   3672 O  O     . LYS C 1 92  ? 17.437  -9.881  42.481 1.00 13.94 ? 92  LYS B O     1 
ATOM   3673 C  CB    . LYS C 1 92  ? 14.986  -9.459  40.505 1.00 17.54 ? 92  LYS B CB    1 
ATOM   3674 C  CG    . LYS C 1 92  ? 14.202  -9.143  41.753 1.00 19.26 ? 92  LYS B CG    1 
ATOM   3675 C  CD    . LYS C 1 92  ? 14.168  -10.153 42.859 1.00 27.77 ? 92  LYS B CD    1 
ATOM   3676 C  CE    . LYS C 1 92  ? 13.215  -11.226 42.521 1.00 25.57 ? 92  LYS B CE    1 
ATOM   3677 N  NZ    . LYS C 1 92  ? 12.866  -12.151 43.725 1.00 22.90 ? 92  LYS B NZ    1 
ATOM   3678 N  N     . ARG C 1 93  ? 17.471  -11.339 40.682 1.00 15.05 ? 93  ARG B N     1 
ATOM   3679 C  CA    . ARG C 1 93  ? 17.992  -12.447 41.514 1.00 14.33 ? 93  ARG B CA    1 
ATOM   3680 C  C     . ARG C 1 93  ? 19.421  -12.115 41.977 1.00 13.58 ? 93  ARG B C     1 
ATOM   3681 O  O     . ARG C 1 93  ? 19.811  -12.355 43.149 1.00 17.06 ? 93  ARG B O     1 
ATOM   3682 C  CB    . ARG C 1 93  ? 17.881  -13.771 40.739 1.00 17.69 ? 93  ARG B CB    1 
ATOM   3683 C  CG    . ARG C 1 93  ? 18.342  -15.011 41.482 1.00 19.03 ? 93  ARG B CG    1 
ATOM   3684 C  CD    . ARG C 1 93  ? 18.016  -16.235 40.620 1.00 22.32 ? 93  ARG B CD    1 
ATOM   3685 N  NE    . ARG C 1 93  ? 18.419  -17.480 41.319 1.00 31.13 ? 93  ARG B NE    1 
ATOM   3686 C  CZ    . ARG C 1 93  ? 18.526  -18.687 40.741 1.00 20.68 ? 93  ARG B CZ    1 
ATOM   3687 N  NH1   . ARG C 1 93  ? 18.219  -18.856 39.448 1.00 17.71 ? 93  ARG B NH1   1 
ATOM   3688 N  NH2   . ARG C 1 93  ? 19.189  -19.615 41.414 1.00 22.69 ? 93  ARG B NH2   1 
ATOM   3689 N  N     . ILE C 1 94  ? 20.174  -11.478 41.089 1.00 15.37 ? 94  ILE B N     1 
ATOM   3690 C  CA    . ILE C 1 94  ? 21.571  -11.106 41.431 1.00 15.99 ? 94  ILE B CA    1 
ATOM   3691 C  C     . ILE C 1 94  ? 21.603  -9.963  42.393 1.00 11.60 ? 94  ILE B C     1 
ATOM   3692 O  O     . ILE C 1 94  ? 22.283  -9.995  43.409 1.00 13.65 ? 94  ILE B O     1 
ATOM   3693 C  CB    . ILE C 1 94  ? 22.389  -10.787 40.135 1.00 20.43 ? 94  ILE B CB    1 
ATOM   3694 C  CG1   . ILE C 1 94  ? 22.640  -12.081 39.336 1.00 17.80 ? 94  ILE B CG1   1 
ATOM   3695 C  CG2   . ILE C 1 94  ? 23.756  -10.135 40.509 1.00 18.90 ? 94  ILE B CG2   1 
ATOM   3696 C  CD1   . ILE C 1 94  ? 23.040  -11.903 37.932 1.00 16.96 ? 94  ILE B CD1   1 
ATOM   3697 N  N     . LEU C 1 95  ? 20.827  -8.925  42.059 1.00 18.07 ? 95  LEU B N     1 
ATOM   3698 C  CA    . LEU C 1 95  ? 20.840  -7.702  42.911 1.00 20.35 ? 95  LEU B CA    1 
ATOM   3699 C  C     . LEU C 1 95  ? 20.476  -7.956  44.351 1.00 14.77 ? 95  LEU B C     1 
ATOM   3700 O  O     . LEU C 1 95  ? 21.276  -7.612  45.208 1.00 16.76 ? 95  LEU B O     1 
ATOM   3701 C  CB    . LEU C 1 95  ? 20.166  -6.511  42.217 1.00 24.60 ? 95  LEU B CB    1 
ATOM   3702 C  CG    . LEU C 1 95  ? 20.332  -5.151  42.905 1.00 32.19 ? 95  LEU B CG    1 
ATOM   3703 C  CD1   . LEU C 1 95  ? 21.750  -4.677  43.049 1.00 24.02 ? 95  LEU B CD1   1 
ATOM   3704 C  CD2   . LEU C 1 95  ? 19.508  -4.239  41.981 1.00 27.61 ? 95  LEU B CD2   1 
ATOM   3705 N  N     . GLN C 1 96  ? 19.483  -8.812  44.624 1.00 19.30 ? 96  GLN B N     1 
ATOM   3706 C  CA    . GLN C 1 96  ? 19.229  -9.200  46.032 1.00 16.79 ? 96  GLN B CA    1 
ATOM   3707 C  C     . GLN C 1 96  ? 20.276  -10.110 46.708 1.00 19.70 ? 96  GLN B C     1 
ATOM   3708 O  O     . GLN C 1 96  ? 20.360  -10.132 47.928 1.00 21.17 ? 96  GLN B O     1 
ATOM   3709 C  CB    . GLN C 1 96  ? 17.833  -9.810  46.215 1.00 18.64 ? 96  GLN B CB    1 
ATOM   3710 C  CG    . GLN C 1 96  ? 17.499  -11.106 45.445 1.00 28.08 ? 96  GLN B CG    1 
ATOM   3711 C  CD    . GLN C 1 96  ? 17.808  -12.399 46.249 1.00 25.78 ? 96  GLN B CD    1 
ATOM   3712 O  OE1   . GLN C 1 96  ? 17.401  -12.548 47.424 1.00 25.35 ? 96  GLN B OE1   1 
ATOM   3713 N  NE2   . GLN C 1 96  ? 18.503  -13.342 45.604 1.00 25.74 ? 96  GLN B NE2   1 
ATOM   3714 N  N     . ALA C 1 97  ? 21.151  -10.793 45.974 1.00 20.58 ? 97  ALA B N     1 
ATOM   3715 C  CA    . ALA C 1 97  ? 22.071  -11.749 46.643 1.00 16.27 ? 97  ALA B CA    1 
ATOM   3716 C  C     . ALA C 1 97  ? 23.436  -11.106 47.001 1.00 20.84 ? 97  ALA B C     1 
ATOM   3717 O  O     . ALA C 1 97  ? 24.173  -11.640 47.789 1.00 18.62 ? 97  ALA B O     1 
ATOM   3718 C  CB    . ALA C 1 97  ? 22.282  -12.823 45.589 1.00 18.85 ? 97  ALA B CB    1 
ATOM   3719 N  N     . VAL C 1 98  ? 23.825  -10.019 46.313 1.00 23.56 ? 98  VAL B N     1 
ATOM   3720 C  CA    . VAL C 1 98  ? 25.105  -9.286  46.453 1.00 20.03 ? 98  VAL B CA    1 
ATOM   3721 C  C     . VAL C 1 98  ? 25.242  -8.342  47.608 1.00 21.62 ? 98  VAL B C     1 
ATOM   3722 O  O     . VAL C 1 98  ? 24.258  -8.099  48.251 1.00 20.33 ? 98  VAL B O     1 
ATOM   3723 C  CB    . VAL C 1 98  ? 25.514  -8.625  45.127 1.00 24.49 ? 98  VAL B CB    1 
ATOM   3724 C  CG1   . VAL C 1 98  ? 25.729  -9.734  44.091 1.00 13.92 ? 98  VAL B CG1   1 
ATOM   3725 C  CG2   . VAL C 1 98  ? 24.486  -7.541  44.613 1.00 20.11 ? 98  VAL B CG2   1 
ATOM   3726 N  N     . ASN C 1 99  ? 26.432  -8.162  48.157 1.00 20.46 ? 99  ASN B N     1 
ATOM   3727 C  CA    . ASN C 1 99  ? 26.572  -7.182  49.206 1.00 20.68 ? 99  ASN B CA    1 
ATOM   3728 C  C     . ASN C 1 99  ? 27.970  -6.620  49.122 1.00 24.87 ? 99  ASN B C     1 
ATOM   3729 O  O     . ASN C 1 99  ? 28.918  -7.305  49.471 1.00 29.39 ? 99  ASN B O     1 
ATOM   3730 C  CB    . ASN C 1 99  ? 26.207  -7.788  50.551 1.00 27.22 ? 99  ASN B CB    1 
ATOM   3731 C  CG    . ASN C 1 99  ? 26.357  -6.842  51.688 1.00 33.10 ? 99  ASN B CG    1 
ATOM   3732 O  OD1   . ASN C 1 99  ? 25.380  -6.603  52.379 1.00 49.70 ? 99  ASN B OD1   1 
ATOM   3733 N  ND2   . ASN C 1 99  ? 27.579  -6.545  52.086 1.00 43.73 ? 99  ASN B ND2   1 
ATOM   3734 N  N     . PHE C 1 100 ? 28.137  -5.386  48.663 1.00 21.06 ? 100 PHE B N     1 
ATOM   3735 C  CA    . PHE C 1 100 ? 29.489  -4.825  48.575 1.00 23.25 ? 100 PHE B CA    1 
ATOM   3736 C  C     . PHE C 1 100 ? 29.373  -3.327  48.856 1.00 21.71 ? 100 PHE B C     1 
ATOM   3737 O  O     . PHE C 1 100 ? 28.334  -2.803  48.521 1.00 24.10 ? 100 PHE B O     1 
ATOM   3738 C  CB    . PHE C 1 100 ? 30.020  -5.080  47.154 1.00 23.85 ? 100 PHE B CB    1 
ATOM   3739 C  CG    . PHE C 1 100 ? 31.499  -5.105  47.061 1.00 21.38 ? 100 PHE B CG    1 
ATOM   3740 C  CD1   . PHE C 1 100 ? 32.259  -5.917  47.937 1.00 23.93 ? 100 PHE B CD1   1 
ATOM   3741 C  CD2   . PHE C 1 100 ? 32.132  -4.220  46.224 1.00 20.72 ? 100 PHE B CD2   1 
ATOM   3742 C  CE1   . PHE C 1 100 ? 33.674  -5.829  47.998 1.00 23.66 ? 100 PHE B CE1   1 
ATOM   3743 C  CE2   . PHE C 1 100 ? 33.591  -4.112  46.291 1.00 21.08 ? 100 PHE B CE2   1 
ATOM   3744 C  CZ    . PHE C 1 100 ? 34.351  -4.903  47.164 1.00 19.69 ? 100 PHE B CZ    1 
ATOM   3745 N  N     . PRO C 1 101 ? 30.372  -2.632  49.467 1.00 24.90 ? 101 PRO B N     1 
ATOM   3746 C  CA    . PRO C 1 101 ? 30.140  -1.184  49.687 1.00 25.29 ? 101 PRO B CA    1 
ATOM   3747 C  C     . PRO C 1 101 ? 29.792  -0.262  48.472 1.00 25.08 ? 101 PRO B C     1 
ATOM   3748 O  O     . PRO C 1 101 ? 29.247  0.819   48.666 1.00 28.63 ? 101 PRO B O     1 
ATOM   3749 C  CB    . PRO C 1 101 ? 31.461  -0.730  50.311 1.00 26.77 ? 101 PRO B CB    1 
ATOM   3750 C  CG    . PRO C 1 101 ? 32.192  -1.940  50.761 1.00 28.07 ? 101 PRO B CG    1 
ATOM   3751 C  CD    . PRO C 1 101 ? 31.812  -2.894  49.670 1.00 24.45 ? 101 PRO B CD    1 
ATOM   3752 N  N     . PHE C 1 102 ? 30.109  -0.686  47.251 1.00 17.61 ? 102 PHE B N     1 
ATOM   3753 C  CA    . PHE C 1 102 ? 29.912  0.100   46.038 1.00 19.80 ? 102 PHE B CA    1 
ATOM   3754 C  C     . PHE C 1 102 ? 28.797  -0.365  45.153 1.00 17.73 ? 102 PHE B C     1 
ATOM   3755 O  O     . PHE C 1 102 ? 28.723  -0.026  43.978 1.00 19.93 ? 102 PHE B O     1 
ATOM   3756 C  CB    . PHE C 1 102 ? 31.219  0.301   45.240 1.00 16.98 ? 102 PHE B CB    1 
ATOM   3757 C  CG    . PHE C 1 102 ? 32.412  0.544   46.123 1.00 24.76 ? 102 PHE B CG    1 
ATOM   3758 C  CD1   . PHE C 1 102 ? 32.423  1.630   47.012 1.00 22.85 ? 102 PHE B CD1   1 
ATOM   3759 C  CD2   . PHE C 1 102 ? 33.508  -0.339  46.096 1.00 30.62 ? 102 PHE B CD2   1 
ATOM   3760 C  CE1   . PHE C 1 102 ? 33.468  1.852   47.870 1.00 26.04 ? 102 PHE B CE1   1 
ATOM   3761 C  CE2   . PHE C 1 102 ? 34.600  -0.160  46.947 1.00 34.59 ? 102 PHE B CE2   1 
ATOM   3762 C  CZ    . PHE C 1 102 ? 34.567  0.958   47.852 1.00 35.13 ? 102 PHE B CZ    1 
ATOM   3763 N  N     . LEU C 1 103 ? 27.926  -1.183  45.728 1.00 19.41 ? 103 LEU B N     1 
ATOM   3764 C  CA    . LEU C 1 103 ? 26.813  -1.696  44.943 1.00 21.83 ? 103 LEU B CA    1 
ATOM   3765 C  C     . LEU C 1 103 ? 25.569  -1.114  45.622 1.00 20.33 ? 103 LEU B C     1 
ATOM   3766 O  O     . LEU C 1 103 ? 25.450  -1.251  46.838 1.00 17.62 ? 103 LEU B O     1 
ATOM   3767 C  CB    . LEU C 1 103 ? 26.842  -3.243  45.004 1.00 21.14 ? 103 LEU B CB    1 
ATOM   3768 C  CG    . LEU C 1 103 ? 27.974  -3.995  44.277 1.00 24.31 ? 103 LEU B CG    1 
ATOM   3769 C  CD1   . LEU C 1 103 ? 27.677  -5.462  44.293 1.00 23.13 ? 103 LEU B CD1   1 
ATOM   3770 C  CD2   . LEU C 1 103 ? 28.126  -3.504  42.823 1.00 10.09 ? 103 LEU B CD2   1 
ATOM   3771 N  N     . VAL C 1 104 ? 24.599  -0.685  44.814 1.00 21.75 ? 104 VAL B N     1 
ATOM   3772 C  CA    . VAL C 1 104 ? 23.297  -0.160  45.333 1.00 26.13 ? 104 VAL B CA    1 
ATOM   3773 C  C     . VAL C 1 104 ? 22.567  -1.298  46.129 1.00 24.27 ? 104 VAL B C     1 
ATOM   3774 O  O     . VAL C 1 104 ? 22.759  -2.479  45.829 1.00 24.72 ? 104 VAL B O     1 
ATOM   3775 C  CB    . VAL C 1 104 ? 22.422  0.445   44.141 1.00 27.74 ? 104 VAL B CB    1 
ATOM   3776 C  CG1   . VAL C 1 104 ? 21.654  -0.637  43.323 1.00 29.21 ? 104 VAL B CG1   1 
ATOM   3777 C  CG2   . VAL C 1 104 ? 21.425  1.499   44.627 1.00 35.13 ? 104 VAL B CG2   1 
ATOM   3778 N  N     . LYS C 1 105 ? 22.008  -0.984  47.298 1.00 24.55 ? 105 LYS B N     1 
ATOM   3779 C  CA    . LYS C 1 105 ? 21.276  -1.954  48.086 1.00 23.63 ? 105 LYS B CA    1 
ATOM   3780 C  C     . LYS C 1 105 ? 19.804  -2.073  47.660 1.00 21.15 ? 105 LYS B C     1 
ATOM   3781 O  O     . LYS C 1 105 ? 19.106  -1.071  47.527 1.00 21.57 ? 105 LYS B O     1 
ATOM   3782 C  CB    . LYS C 1 105 ? 21.490  -1.697  49.588 1.00 27.81 ? 105 LYS B CB    1 
ATOM   3783 C  CG    . LYS C 1 105 ? 22.967  -1.321  49.981 1.00 39.14 ? 105 LYS B CG    1 
ATOM   3784 C  CD    . LYS C 1 105 ? 24.058  -2.451  50.305 1.00 49.37 ? 105 LYS B CD    1 
ATOM   3785 C  CE    . LYS C 1 105 ? 24.414  -3.602  49.252 1.00 44.79 ? 105 LYS B CE    1 
ATOM   3786 N  NZ    . LYS C 1 105 ? 25.710  -3.718  48.468 1.00 28.03 ? 105 LYS B NZ    1 
ATOM   3787 N  N     . LEU C 1 106 ? 19.400  -3.262  47.195 1.00 21.59 ? 106 LEU B N     1 
ATOM   3788 C  CA    . LEU C 1 106 ? 18.004  -3.608  46.883 1.00 20.78 ? 106 LEU B CA    1 
ATOM   3789 C  C     . LEU C 1 106 ? 17.304  -3.846  48.198 1.00 27.12 ? 106 LEU B C     1 
ATOM   3790 O  O     . LEU C 1 106 ? 17.673  -4.710  48.988 1.00 33.33 ? 106 LEU B O     1 
ATOM   3791 C  CB    . LEU C 1 106 ? 17.798  -4.812  45.968 1.00 26.64 ? 106 LEU B CB    1 
ATOM   3792 C  CG    . LEU C 1 106 ? 16.392  -5.255  45.533 1.00 26.10 ? 106 LEU B CG    1 
ATOM   3793 C  CD1   . LEU C 1 106 ? 15.546  -4.158  44.900 1.00 29.10 ? 106 LEU B CD1   1 
ATOM   3794 C  CD2   . LEU C 1 106 ? 16.535  -6.327  44.456 1.00 36.33 ? 106 LEU B CD2   1 
ATOM   3795 N  N     . GLU C 1 107 ? 16.355  -2.967  48.476 1.00 29.32 ? 107 GLU B N     1 
ATOM   3796 C  CA    . GLU C 1 107 ? 15.568  -3.065  49.702 1.00 30.38 ? 107 GLU B CA    1 
ATOM   3797 C  C     . GLU C 1 107 ? 14.282  -3.906  49.640 1.00 23.47 ? 107 GLU B C     1 
ATOM   3798 O  O     . GLU C 1 107 ? 14.093  -4.590  50.609 1.00 30.17 ? 107 GLU B O     1 
ATOM   3799 C  CB    . GLU C 1 107 ? 15.277  -1.668  50.285 1.00 35.61 ? 107 GLU B CB    1 
ATOM   3800 C  CG    . GLU C 1 107 ? 16.496  -0.813  50.770 1.00 43.22 ? 107 GLU B CG    1 
ATOM   3801 C  CD    . GLU C 1 107 ? 17.273  -1.404  51.918 1.00 46.88 ? 107 GLU B CD    1 
ATOM   3802 O  OE1   . GLU C 1 107 ? 16.834  -2.393  52.523 1.00 60.33 ? 107 GLU B OE1   1 
ATOM   3803 O  OE2   . GLU C 1 107 ? 18.344  -0.896  52.300 1.00 52.60 ? 107 GLU B OE2   1 
ATOM   3804 N  N     . TYR C 1 108 ? 13.493  -3.926  48.558 1.00 22.65 ? 108 TYR B N     1 
ATOM   3805 C  CA    . TYR C 1 108 ? 12.156  -4.592  48.355 1.00 19.51 ? 108 TYR B CA    1 
ATOM   3806 C  C     . TYR C 1 108 ? 11.914  -4.797  46.891 1.00 23.08 ? 108 TYR B C     1 
ATOM   3807 O  O     . TYR C 1 108 ? 12.540  -4.079  46.074 1.00 18.96 ? 108 TYR B O     1 
ATOM   3808 C  CB    . TYR C 1 108 ? 10.933  -3.703  48.660 1.00 19.36 ? 108 TYR B CB    1 
ATOM   3809 C  CG    . TYR C 1 108 ? 10.981  -3.046  50.029 1.00 21.43 ? 108 TYR B CG    1 
ATOM   3810 C  CD1   . TYR C 1 108 ? 10.957  -3.838  51.180 1.00 28.18 ? 108 TYR B CD1   1 
ATOM   3811 C  CD2   . TYR C 1 108 ? 11.245  -1.648  50.170 1.00 27.08 ? 108 TYR B CD2   1 
ATOM   3812 C  CE1   . TYR C 1 108 ? 11.193  -3.306  52.457 1.00 35.27 ? 108 TYR B CE1   1 
ATOM   3813 C  CE2   . TYR C 1 108 ? 11.518  -1.080  51.448 1.00 33.32 ? 108 TYR B CE2   1 
ATOM   3814 C  CZ    . TYR C 1 108 ? 11.468  -1.935  52.576 1.00 39.44 ? 108 TYR B CZ    1 
ATOM   3815 O  OH    . TYR C 1 108 ? 11.643  -1.485  53.860 1.00 52.78 ? 108 TYR B OH    1 
ATOM   3816 N  N     . SER C 1 109 ? 11.004  -5.713  46.518 1.00 16.89 ? 109 SER B N     1 
ATOM   3817 C  CA    . SER C 1 109 ? 10.707  -5.953  45.096 1.00 18.58 ? 109 SER B CA    1 
ATOM   3818 C  C     . SER C 1 109 ? 9.329   -6.576  45.086 1.00 19.72 ? 109 SER B C     1 
ATOM   3819 O  O     . SER C 1 109 ? 9.007   -7.271  46.032 1.00 20.28 ? 109 SER B O     1 
ATOM   3820 C  CB    . SER C 1 109 ? 11.724  -6.887  44.359 1.00 29.36 ? 109 SER B CB    1 
ATOM   3821 O  OG    . SER C 1 109 ? 12.016  -8.141  45.034 1.00 32.28 ? 109 SER B OG    1 
ATOM   3822 N  N     . PHE C 1 110 ? 8.554   -6.407  44.028 1.00 17.25 ? 110 PHE B N     1 
ATOM   3823 C  CA    . PHE C 1 110 ? 7.205   -6.928  44.019 1.00 17.30 ? 110 PHE B CA    1 
ATOM   3824 C  C     . PHE C 1 110 ? 6.771   -6.709  42.614 1.00 20.18 ? 110 PHE B C     1 
ATOM   3825 O  O     . PHE C 1 110 ? 7.488   -6.094  41.820 1.00 25.21 ? 110 PHE B O     1 
ATOM   3826 C  CB    . PHE C 1 110 ? 6.290   -6.268  45.106 1.00 21.38 ? 110 PHE B CB    1 
ATOM   3827 C  CG    . PHE C 1 110 ? 6.251   -4.732  45.108 1.00 23.23 ? 110 PHE B CG    1 
ATOM   3828 C  CD1   . PHE C 1 110 ? 7.189   -3.981  45.861 1.00 23.75 ? 110 PHE B CD1   1 
ATOM   3829 C  CD2   . PHE C 1 110 ? 5.318   -4.049  44.323 1.00 26.88 ? 110 PHE B CD2   1 
ATOM   3830 C  CE1   . PHE C 1 110 ? 7.237   -2.568  45.817 1.00 22.76 ? 110 PHE B CE1   1 
ATOM   3831 C  CE2   . PHE C 1 110 ? 5.318   -2.645  44.274 1.00 26.26 ? 110 PHE B CE2   1 
ATOM   3832 C  CZ    . PHE C 1 110 ? 6.286   -1.918  45.005 1.00 20.15 ? 110 PHE B CZ    1 
ATOM   3833 N  N     . LYS C 1 111 ? 5.562   -7.168  42.298 1.00 21.23 ? 111 LYS B N     1 
ATOM   3834 C  CA    . LYS C 1 111 ? 4.984   -7.121  40.954 1.00 23.15 ? 111 LYS B CA    1 
ATOM   3835 C  C     . LYS C 1 111 ? 3.493   -7.010  41.163 1.00 23.03 ? 111 LYS B C     1 
ATOM   3836 O  O     . LYS C 1 111 ? 3.026   -7.216  42.259 1.00 26.86 ? 111 LYS B O     1 
ATOM   3837 C  CB    . LYS C 1 111 ? 5.253   -8.376  40.103 1.00 31.30 ? 111 LYS B CB    1 
ATOM   3838 C  CG    . LYS C 1 111 ? 5.202   -9.794  40.815 1.00 33.72 ? 111 LYS B CG    1 
ATOM   3839 C  CD    . LYS C 1 111 ? 5.444   -10.892 39.772 1.00 33.96 ? 111 LYS B CD    1 
ATOM   3840 C  CE    . LYS C 1 111 ? 5.002   -12.255 40.269 1.00 31.44 ? 111 LYS B CE    1 
ATOM   3841 N  NZ    . LYS C 1 111 ? 5.947   -13.136 41.017 1.00 33.13 ? 111 LYS B NZ    1 
ATOM   3842 N  N     . ASP C 1 112 ? 2.805   -6.534  40.147 1.00 22.64 ? 112 ASP B N     1 
ATOM   3843 C  CA    . ASP C 1 112 ? 1.355   -6.451  40.142 1.00 26.85 ? 112 ASP B CA    1 
ATOM   3844 C  C     . ASP C 1 112 ? 0.913   -6.923  38.798 1.00 25.24 ? 112 ASP B C     1 
ATOM   3845 O  O     . ASP C 1 112 ? 1.750   -7.421  38.049 1.00 26.72 ? 112 ASP B O     1 
ATOM   3846 C  CB    . ASP C 1 112 ? 0.860   -5.033  40.460 1.00 27.82 ? 112 ASP B CB    1 
ATOM   3847 C  CG    . ASP C 1 112 ? 1.450   -3.933  39.574 1.00 28.42 ? 112 ASP B CG    1 
ATOM   3848 O  OD1   . ASP C 1 112 ? 1.681   -3.972  38.336 1.00 28.65 ? 112 ASP B OD1   1 
ATOM   3849 O  OD2   . ASP C 1 112 ? 1.411   -2.854  40.158 1.00 28.98 ? 112 ASP B OD2   1 
ATOM   3850 N  N     . ASN C 1 113 ? -0.316  -6.642  38.392 1.00 22.87 ? 113 ASN B N     1 
ATOM   3851 C  CA    . ASN C 1 113 ? -0.709  -7.117  37.074 1.00 26.36 ? 113 ASN B CA    1 
ATOM   3852 C  C     . ASN C 1 113 ? 0.128   -6.667  35.889 1.00 28.67 ? 113 ASN B C     1 
ATOM   3853 O  O     . ASN C 1 113 ? 0.254   -7.352  34.878 1.00 28.53 ? 113 ASN B O     1 
ATOM   3854 C  CB    . ASN C 1 113 ? -2.179  -6.713  36.760 1.00 35.32 ? 113 ASN B CB    1 
ATOM   3855 C  CG    . ASN C 1 113 ? -3.166  -7.502  37.567 1.00 40.39 ? 113 ASN B CG    1 
ATOM   3856 O  OD1   . ASN C 1 113 ? -2.823  -8.599  38.036 1.00 48.78 ? 113 ASN B OD1   1 
ATOM   3857 N  ND2   . ASN C 1 113 ? -4.345  -6.945  37.818 1.00 37.74 ? 113 ASN B ND2   1 
ATOM   3858 N  N     . SER C 1 114 ? 0.546   -5.410  35.983 1.00 31.08 ? 114 SER B N     1 
ATOM   3859 C  CA    . SER C 1 114 ? 1.212   -4.759  34.887 1.00 28.97 ? 114 SER B CA    1 
ATOM   3860 C  C     . SER C 1 114 ? 2.728   -4.607  34.911 1.00 24.18 ? 114 SER B C     1 
ATOM   3861 O  O     . SER C 1 114 ? 3.374   -4.731  33.881 1.00 26.53 ? 114 SER B O     1 
ATOM   3862 C  CB    . SER C 1 114 ? 0.506   -3.420  34.772 1.00 23.63 ? 114 SER B CB    1 
ATOM   3863 O  OG    . SER C 1 114 ? -0.484  -3.634  33.787 1.00 34.13 ? 114 SER B OG    1 
ATOM   3864 N  N     . ASN C 1 115 ? 3.265   -4.490  36.109 1.00 21.71 ? 115 ASN B N     1 
ATOM   3865 C  CA    . ASN C 1 115 ? 4.663   -4.048  36.285 1.00 25.39 ? 115 ASN B CA    1 
ATOM   3866 C  C     . ASN C 1 115 ? 5.519   -4.822  37.266 1.00 26.10 ? 115 ASN B C     1 
ATOM   3867 O  O     . ASN C 1 115 ? 4.939   -5.347  38.194 1.00 21.92 ? 115 ASN B O     1 
ATOM   3868 C  CB    . ASN C 1 115 ? 4.680   -2.559  36.804 1.00 23.83 ? 115 ASN B CB    1 
ATOM   3869 C  CG    . ASN C 1 115 ? 3.925   -1.592  35.894 1.00 28.31 ? 115 ASN B CG    1 
ATOM   3870 O  OD1   . ASN C 1 115 ? 4.053   -1.652  34.657 1.00 33.10 ? 115 ASN B OD1   1 
ATOM   3871 N  ND2   . ASN C 1 115 ? 3.119   -0.714  36.483 1.00 26.81 ? 115 ASN B ND2   1 
ATOM   3872 N  N     . LEU C 1 116 ? 6.861   -4.693  37.179 1.00 19.96 ? 116 LEU B N     1 
ATOM   3873 C  CA    . LEU C 1 116 ? 7.747   -5.231  38.199 1.00 20.65 ? 116 LEU B CA    1 
ATOM   3874 C  C     . LEU C 1 116 ? 8.375   -4.023  38.892 1.00 18.66 ? 116 LEU B C     1 
ATOM   3875 O  O     . LEU C 1 116 ? 8.831   -3.106  38.201 1.00 21.10 ? 116 LEU B O     1 
ATOM   3876 C  CB    . LEU C 1 116 ? 8.890   -6.079  37.534 1.00 26.92 ? 116 LEU B CB    1 
ATOM   3877 C  CG    . LEU C 1 116 ? 8.321   -6.962  36.414 1.00 30.82 ? 116 LEU B CG    1 
ATOM   3878 C  CD1   . LEU C 1 116 ? 9.299   -7.362  35.348 1.00 26.80 ? 116 LEU B CD1   1 
ATOM   3879 C  CD2   . LEU C 1 116 ? 7.588   -8.160  37.170 1.00 29.79 ? 116 LEU B CD2   1 
ATOM   3880 N  N     . TYR C 1 117 ? 8.686   -4.143  40.159 1.00 15.29 ? 117 TYR B N     1 
ATOM   3881 C  CA    . TYR C 1 117 ? 9.192   -3.007  40.899 1.00 24.40 ? 117 TYR B CA    1 
ATOM   3882 C  C     . TYR C 1 117 ? 10.372  -3.454  41.701 1.00 24.17 ? 117 TYR B C     1 
ATOM   3883 O  O     . TYR C 1 117 ? 10.295  -4.502  42.338 1.00 27.76 ? 117 TYR B O     1 
ATOM   3884 C  CB    . TYR C 1 117 ? 8.188   -2.413  41.937 1.00 24.68 ? 117 TYR B CB    1 
ATOM   3885 C  CG    . TYR C 1 117 ? 6.854   -1.993  41.344 1.00 29.52 ? 117 TYR B CG    1 
ATOM   3886 C  CD1   . TYR C 1 117 ? 5.796   -2.945  41.167 1.00 28.99 ? 117 TYR B CD1   1 
ATOM   3887 C  CD2   . TYR C 1 117 ? 6.651   -0.671  40.858 1.00 34.53 ? 117 TYR B CD2   1 
ATOM   3888 C  CE1   . TYR C 1 117 ? 4.560   -2.621  40.530 1.00 23.77 ? 117 TYR B CE1   1 
ATOM   3889 C  CE2   . TYR C 1 117 ? 5.405   -0.313  40.152 1.00 31.61 ? 117 TYR B CE2   1 
ATOM   3890 C  CZ    . TYR C 1 117 ? 4.382   -1.299  40.020 1.00 32.89 ? 117 TYR B CZ    1 
ATOM   3891 O  OH    . TYR C 1 117 ? 3.201   -0.922  39.433 1.00 28.36 ? 117 TYR B OH    1 
ATOM   3892 N  N     . MET C 1 118 ? 11.441  -2.659  41.685 1.00 21.06 ? 118 MET B N     1 
ATOM   3893 C  CA    . MET C 1 118 ? 12.583  -2.936  42.543 1.00 24.94 ? 118 MET B CA    1 
ATOM   3894 C  C     . MET C 1 118 ? 12.865  -1.621  43.278 1.00 24.83 ? 118 MET B C     1 
ATOM   3895 O  O     . MET C 1 118 ? 13.261  -0.629  42.670 1.00 26.85 ? 118 MET B O     1 
ATOM   3896 C  CB    . MET C 1 118 ? 13.790  -3.398  41.737 1.00 25.42 ? 118 MET B CB    1 
ATOM   3897 C  CG    . MET C 1 118 ? 13.637  -4.712  41.006 1.00 26.59 ? 118 MET B CG    1 
ATOM   3898 S  SD    . MET C 1 118 ? 15.169  -5.076  40.155 1.00 29.10 ? 118 MET B SD    1 
ATOM   3899 C  CE    . MET C 1 118 ? 14.548  -4.961  38.627 1.00 10.91 ? 118 MET B CE    1 
ATOM   3900 N  N     . VAL C 1 119 ? 12.841  -1.679  44.600 1.00 19.90 ? 119 VAL B N     1 
ATOM   3901 C  CA    . VAL C 1 119 ? 12.960  -0.514  45.423 1.00 21.69 ? 119 VAL B CA    1 
ATOM   3902 C  C     . VAL C 1 119 ? 14.313  -0.599  46.095 1.00 23.59 ? 119 VAL B C     1 
ATOM   3903 O  O     . VAL C 1 119 ? 14.576  -1.500  46.931 1.00 20.12 ? 119 VAL B O     1 
ATOM   3904 C  CB    . VAL C 1 119 ? 11.789  -0.536  46.466 1.00 22.05 ? 119 VAL B CB    1 
ATOM   3905 C  CG1   . VAL C 1 119 ? 11.986  0.583   47.438 1.00 17.94 ? 119 VAL B CG1   1 
ATOM   3906 C  CG2   . VAL C 1 119 ? 10.403  -0.410  45.743 1.00 8.44  ? 119 VAL B CG2   1 
ATOM   3907 N  N     . MET C 1 120 ? 15.150  0.371   45.733 1.00 19.34 ? 120 MET B N     1 
ATOM   3908 C  CA    . MET C 1 120 ? 16.531  0.414   46.255 1.00 19.68 ? 120 MET B CA    1 
ATOM   3909 C  C     . MET C 1 120 ? 16.744  1.615   47.180 1.00 20.17 ? 120 MET B C     1 
ATOM   3910 O  O     . MET C 1 120 ? 15.894  2.525   47.239 1.00 23.35 ? 120 MET B O     1 
ATOM   3911 C  CB    . MET C 1 120 ? 17.528  0.569   45.074 1.00 20.62 ? 120 MET B CB    1 
ATOM   3912 C  CG    . MET C 1 120 ? 17.382  -0.283  43.809 1.00 21.73 ? 120 MET B CG    1 
ATOM   3913 S  SD    . MET C 1 120 ? 18.007  0.356   42.253 1.00 26.88 ? 120 MET B SD    1 
ATOM   3914 C  CE    . MET C 1 120 ? 16.638  1.130   41.411 1.00 19.72 ? 120 MET B CE    1 
ATOM   3915 N  N     . GLU C 1 121 ? 17.916  1.642   47.805 1.00 18.20 ? 121 GLU B N     1 
ATOM   3916 C  CA    . GLU C 1 121 ? 18.371  2.847   48.469 1.00 24.73 ? 121 GLU B CA    1 
ATOM   3917 C  C     . GLU C 1 121 ? 18.533  4.009   47.447 1.00 25.56 ? 121 GLU B C     1 
ATOM   3918 O  O     . GLU C 1 121 ? 18.811  3.768   46.246 1.00 19.34 ? 121 GLU B O     1 
ATOM   3919 C  CB    . GLU C 1 121 ? 19.647  2.609   49.223 1.00 28.25 ? 121 GLU B CB    1 
ATOM   3920 C  CG    . GLU C 1 121 ? 20.899  2.541   48.398 1.00 50.59 ? 121 GLU B CG    1 
ATOM   3921 C  CD    . GLU C 1 121 ? 22.172  2.472   49.263 1.00 60.40 ? 121 GLU B CD    1 
ATOM   3922 O  OE1   . GLU C 1 121 ? 22.163  2.911   50.465 1.00 58.52 ? 121 GLU B OE1   1 
ATOM   3923 O  OE2   . GLU C 1 121 ? 23.137  1.887   48.700 1.00 58.85 ? 121 GLU B OE2   1 
ATOM   3924 N  N     . TYR C 1 122 ? 18.111  5.220   47.871 1.00 24.70 ? 122 TYR B N     1 
ATOM   3925 C  CA    . TYR C 1 122 ? 18.245  6.418   47.049 1.00 20.07 ? 122 TYR B CA    1 
ATOM   3926 C  C     . TYR C 1 122 ? 19.723  6.926   47.153 1.00 17.81 ? 122 TYR B C     1 
ATOM   3927 O  O     . TYR C 1 122 ? 20.226  7.230   48.249 1.00 17.68 ? 122 TYR B O     1 
ATOM   3928 C  CB    . TYR C 1 122 ? 17.212  7.474   47.545 1.00 22.92 ? 122 TYR B CB    1 
ATOM   3929 C  CG    . TYR C 1 122 ? 17.308  8.844   46.922 1.00 20.79 ? 122 TYR B CG    1 
ATOM   3930 C  CD1   . TYR C 1 122 ? 17.489  9.004   45.532 1.00 22.68 ? 122 TYR B CD1   1 
ATOM   3931 C  CD2   . TYR C 1 122 ? 17.407  9.984   47.750 1.00 26.07 ? 122 TYR B CD2   1 
ATOM   3932 C  CE1   . TYR C 1 122 ? 17.756  10.246  44.942 1.00 25.08 ? 122 TYR B CE1   1 
ATOM   3933 C  CE2   . TYR C 1 122 ? 17.689  11.277  47.162 1.00 27.02 ? 122 TYR B CE2   1 
ATOM   3934 C  CZ    . TYR C 1 122 ? 17.824  11.398  45.781 1.00 26.80 ? 122 TYR B CZ    1 
ATOM   3935 O  OH    . TYR C 1 122 ? 17.734  12.636  45.185 1.00 28.04 ? 122 TYR B OH    1 
ATOM   3936 N  N     . VAL C 1 123 ? 20.372  7.087   45.994 1.00 17.07 ? 123 VAL B N     1 
ATOM   3937 C  CA    . VAL C 1 123 ? 21.756  7.606   45.944 1.00 16.91 ? 123 VAL B CA    1 
ATOM   3938 C  C     . VAL C 1 123 ? 21.551  9.065   45.505 1.00 12.59 ? 123 VAL B C     1 
ATOM   3939 O  O     . VAL C 1 123 ? 21.295  9.377   44.305 1.00 13.98 ? 123 VAL B O     1 
ATOM   3940 C  CB    . VAL C 1 123 ? 22.727  6.680   45.110 1.00 19.12 ? 123 VAL B CB    1 
ATOM   3941 C  CG1   . VAL C 1 123 ? 24.206  7.071   45.419 1.00 17.12 ? 123 VAL B CG1   1 
ATOM   3942 C  CG2   . VAL C 1 123 ? 22.573  5.188   45.681 1.00 21.91 ? 123 VAL B CG2   1 
ATOM   3943 N  N     . PRO C 1 124 ? 21.589  9.988   46.489 1.00 20.45 ? 124 PRO B N     1 
ATOM   3944 C  CA    . PRO C 1 124 ? 21.300  11.421  46.193 1.00 20.53 ? 124 PRO B CA    1 
ATOM   3945 C  C     . PRO C 1 124 ? 22.265  12.312  45.408 1.00 24.23 ? 124 PRO B C     1 
ATOM   3946 O  O     . PRO C 1 124 ? 21.753  13.254  44.756 1.00 23.78 ? 124 PRO B O     1 
ATOM   3947 C  CB    . PRO C 1 124 ? 20.939  11.968  47.562 1.00 17.62 ? 124 PRO B CB    1 
ATOM   3948 C  CG    . PRO C 1 124 ? 21.972  11.225  48.480 1.00 20.12 ? 124 PRO B CG    1 
ATOM   3949 C  CD    . PRO C 1 124 ? 22.062  9.826   47.889 1.00 22.17 ? 124 PRO B CD    1 
ATOM   3950 N  N     . GLY C 1 125 ? 23.535  11.874  45.268 1.00 17.60 ? 125 GLY B N     1 
ATOM   3951 C  CA    . GLY C 1 125 ? 24.552  12.608  44.513 1.00 12.16 ? 125 GLY B CA    1 
ATOM   3952 C  C     . GLY C 1 125 ? 24.422  12.684  43.015 1.00 17.37 ? 125 GLY B C     1 
ATOM   3953 O  O     . GLY C 1 125 ? 25.207  13.432  42.431 1.00 20.16 ? 125 GLY B O     1 
ATOM   3954 N  N     . GLY C 1 126 ? 23.445  12.045  42.352 1.00 16.25 ? 126 GLY B N     1 
ATOM   3955 C  CA    . GLY C 1 126 ? 23.407  12.165  40.905 1.00 16.73 ? 126 GLY B CA    1 
ATOM   3956 C  C     . GLY C 1 126 ? 24.327  11.200  40.191 1.00 22.45 ? 126 GLY B C     1 
ATOM   3957 O  O     . GLY C 1 126 ? 25.011  10.340  40.865 1.00 21.99 ? 126 GLY B O     1 
ATOM   3958 N  N     . GLU C 1 127 ? 24.089  11.149  38.873 1.00 20.80 ? 127 GLU B N     1 
ATOM   3959 C  CA    . GLU C 1 127 ? 24.871  10.252  37.998 1.00 20.22 ? 127 GLU B CA    1 
ATOM   3960 C  C     . GLU C 1 127 ? 26.295  10.750  37.860 1.00 25.80 ? 127 GLU B C     1 
ATOM   3961 O  O     . GLU C 1 127 ? 26.508  11.961  37.773 1.00 23.28 ? 127 GLU B O     1 
ATOM   3962 C  CB    . GLU C 1 127 ? 24.348  10.152  36.602 1.00 16.07 ? 127 GLU B CB    1 
ATOM   3963 C  CG    . GLU C 1 127 ? 23.120  9.320   36.480 1.00 14.83 ? 127 GLU B CG    1 
ATOM   3964 C  CD    . GLU C 1 127 ? 22.439  9.492   35.173 1.00 18.77 ? 127 GLU B CD    1 
ATOM   3965 O  OE1   . GLU C 1 127 ? 23.046  10.120  34.307 1.00 17.28 ? 127 GLU B OE1   1 
ATOM   3966 O  OE2   . GLU C 1 127 ? 21.307  9.007   34.846 1.00 17.18 ? 127 GLU B OE2   1 
ATOM   3967 N  N     . MET C 1 128 ? 27.266  9.853   37.713 1.00 25.32 ? 128 MET B N     1 
ATOM   3968 C  CA    . MET C 1 128 ? 28.637  10.338  37.537 1.00 23.19 ? 128 MET B CA    1 
ATOM   3969 C  C     . MET C 1 128 ? 28.642  11.138  36.229 1.00 17.82 ? 128 MET B C     1 
ATOM   3970 O  O     . MET C 1 128 ? 29.264  12.205  36.174 1.00 18.52 ? 128 MET B O     1 
ATOM   3971 C  CB    . MET C 1 128 ? 29.660  9.195   37.477 1.00 25.32 ? 128 MET B CB    1 
ATOM   3972 C  CG    . MET C 1 128 ? 31.053  9.608   36.960 1.00 27.56 ? 128 MET B CG    1 
ATOM   3973 S  SD    . MET C 1 128 ? 32.261  8.290   37.003 1.00 24.27 ? 128 MET B SD    1 
ATOM   3974 C  CE    . MET C 1 128 ? 32.427  8.610   35.417 1.00 14.31 ? 128 MET B CE    1 
ATOM   3975 N  N     . PHE C 1 129 ? 27.708  10.774  35.337 1.00 13.68 ? 129 PHE B N     1 
ATOM   3976 C  CA    . PHE C 1 129 ? 27.590  11.304  33.984 1.00 17.22 ? 129 PHE B CA    1 
ATOM   3977 C  C     . PHE C 1 129 ? 27.407  12.849  34.060 1.00 21.53 ? 129 PHE B C     1 
ATOM   3978 O  O     . PHE C 1 129 ? 28.037  13.542  33.279 1.00 20.60 ? 129 PHE B O     1 
ATOM   3979 C  CB    . PHE C 1 129 ? 26.389  10.683  33.250 1.00 11.87 ? 129 PHE B CB    1 
ATOM   3980 C  CG    . PHE C 1 129 ? 26.206  11.241  31.882 1.00 20.97 ? 129 PHE B CG    1 
ATOM   3981 C  CD1   . PHE C 1 129 ? 26.952  10.700  30.813 1.00 19.02 ? 129 PHE B CD1   1 
ATOM   3982 C  CD2   . PHE C 1 129 ? 25.287  12.271  31.626 1.00 10.10 ? 129 PHE B CD2   1 
ATOM   3983 C  CE1   . PHE C 1 129 ? 26.734  11.162  29.503 1.00 17.66 ? 129 PHE B CE1   1 
ATOM   3984 C  CE2   . PHE C 1 129 ? 25.078  12.748  30.304 1.00 10.91 ? 129 PHE B CE2   1 
ATOM   3985 C  CZ    . PHE C 1 129 ? 25.797  12.176  29.261 1.00 15.08 ? 129 PHE B CZ    1 
ATOM   3986 N  N     . SER C 1 130 ? 26.477  13.279  34.930 1.00 19.67 ? 130 SER B N     1 
ATOM   3987 C  CA    . SER C 1 130 ? 26.069  14.648  35.179 1.00 21.31 ? 130 SER B CA    1 
ATOM   3988 C  C     . SER C 1 130 ? 27.282  15.472  35.596 1.00 19.28 ? 130 SER B C     1 
ATOM   3989 O  O     . SER C 1 130 ? 27.643  16.391  34.898 1.00 22.17 ? 130 SER B O     1 
ATOM   3990 C  CB    . SER C 1 130 ? 25.124  14.653  36.364 1.00 13.02 ? 130 SER B CB    1 
ATOM   3991 O  OG    . SER C 1 130 ? 23.952  14.165  35.729 1.00 33.87 ? 130 SER B OG    1 
ATOM   3992 N  N     . HIS C 1 131 ? 28.000  15.020  36.597 1.00 18.60 ? 131 HIS B N     1 
ATOM   3993 C  CA    . HIS C 1 131 ? 29.183  15.743  37.039 1.00 21.39 ? 131 HIS B CA    1 
ATOM   3994 C  C     . HIS C 1 131 ? 30.314  15.723  36.048 1.00 24.00 ? 131 HIS B C     1 
ATOM   3995 O  O     . HIS C 1 131 ? 30.881  16.771  35.864 1.00 22.60 ? 131 HIS B O     1 
ATOM   3996 C  CB    . HIS C 1 131 ? 29.636  15.244  38.382 1.00 25.54 ? 131 HIS B CB    1 
ATOM   3997 C  CG    . HIS C 1 131 ? 28.527  15.221  39.385 1.00 33.97 ? 131 HIS B CG    1 
ATOM   3998 N  ND1   . HIS C 1 131 ? 28.021  16.364  39.972 1.00 35.61 ? 131 HIS B ND1   1 
ATOM   3999 C  CD2   . HIS C 1 131 ? 27.799  14.190  39.879 1.00 35.66 ? 131 HIS B CD2   1 
ATOM   4000 C  CE1   . HIS C 1 131 ? 27.037  16.041  40.796 1.00 37.54 ? 131 HIS B CE1   1 
ATOM   4001 N  NE2   . HIS C 1 131 ? 26.880  14.728  40.748 1.00 37.61 ? 131 HIS B NE2   1 
ATOM   4002 N  N     . LEU C 1 132 ? 30.515  14.662  35.265 1.00 23.89 ? 132 LEU B N     1 
ATOM   4003 C  CA    . LEU C 1 132 ? 31.589  14.635  34.280 1.00 23.46 ? 132 LEU B CA    1 
ATOM   4004 C  C     . LEU C 1 132 ? 31.294  15.591  33.119 1.00 21.31 ? 132 LEU B C     1 
ATOM   4005 O  O     . LEU C 1 132 ? 32.227  16.160  32.552 1.00 23.84 ? 132 LEU B O     1 
ATOM   4006 C  CB    . LEU C 1 132 ? 31.786  13.215  33.659 1.00 20.67 ? 132 LEU B CB    1 
ATOM   4007 C  CG    . LEU C 1 132 ? 32.896  12.962  32.587 1.00 21.28 ? 132 LEU B CG    1 
ATOM   4008 C  CD1   . LEU C 1 132 ? 34.306  13.426  33.222 1.00 16.56 ? 132 LEU B CD1   1 
ATOM   4009 C  CD2   . LEU C 1 132 ? 32.758  11.491  32.143 1.00 16.04 ? 132 LEU B CD2   1 
ATOM   4010 N  N     . ARG C 1 133 ? 30.069  15.595  32.614 1.00 16.46 ? 133 ARG B N     1 
ATOM   4011 C  CA    . ARG C 1 133 ? 29.817  16.452  31.478 1.00 20.77 ? 133 ARG B CA    1 
ATOM   4012 C  C     . ARG C 1 133 ? 29.961  17.964  31.871 1.00 22.10 ? 133 ARG B C     1 
ATOM   4013 O  O     . ARG C 1 133 ? 30.527  18.715  31.104 1.00 29.47 ? 133 ARG B O     1 
ATOM   4014 C  CB    . ARG C 1 133 ? 28.425  16.162  30.921 1.00 16.89 ? 133 ARG B CB    1 
ATOM   4015 C  CG    . ARG C 1 133 ? 28.284  14.964  30.112 1.00 18.56 ? 133 ARG B CG    1 
ATOM   4016 C  CD    . ARG C 1 133 ? 28.917  15.087  28.701 1.00 22.07 ? 133 ARG B CD    1 
ATOM   4017 N  NE    . ARG C 1 133 ? 28.972  13.812  27.927 1.00 28.05 ? 133 ARG B NE    1 
ATOM   4018 C  CZ    . ARG C 1 133 ? 29.785  12.764  28.173 1.00 26.48 ? 133 ARG B CZ    1 
ATOM   4019 N  NH1   . ARG C 1 133 ? 30.839  12.793  29.018 1.00 17.76 ? 133 ARG B NH1   1 
ATOM   4020 N  NH2   . ARG C 1 133 ? 29.633  11.688  27.401 1.00 24.96 ? 133 ARG B NH2   1 
ATOM   4021 N  N     . ARG C 1 134 ? 29.550  18.342  33.083 1.00 22.16 ? 134 ARG B N     1 
ATOM   4022 C  CA    . ARG C 1 134 ? 29.535  19.686  33.627 1.00 19.27 ? 134 ARG B CA    1 
ATOM   4023 C  C     . ARG C 1 134 ? 30.952  20.134  33.826 1.00 27.37 ? 134 ARG B C     1 
ATOM   4024 O  O     . ARG C 1 134 ? 31.337  21.088  33.138 1.00 26.79 ? 134 ARG B O     1 
ATOM   4025 C  CB    . ARG C 1 134 ? 28.862  19.706  34.966 1.00 16.45 ? 134 ARG B CB    1 
ATOM   4026 C  CG    . ARG C 1 134 ? 28.941  21.093  35.657 1.00 26.07 ? 134 ARG B CG    1 
ATOM   4027 C  CD    . ARG C 1 134 ? 28.214  21.109  36.970 1.00 24.12 ? 134 ARG B CD    1 
ATOM   4028 N  NE    . ARG C 1 134 ? 28.981  20.394  38.003 1.00 42.72 ? 134 ARG B NE    1 
ATOM   4029 C  CZ    . ARG C 1 134 ? 28.555  19.471  38.888 1.00 42.31 ? 134 ARG B CZ    1 
ATOM   4030 N  NH1   . ARG C 1 134 ? 27.279  19.087  38.980 1.00 39.75 ? 134 ARG B NH1   1 
ATOM   4031 N  NH2   . ARG C 1 134 ? 29.422  18.969  39.776 1.00 33.47 ? 134 ARG B NH2   1 
ATOM   4032 N  N     . ILE C 1 135 ? 31.714  19.394  34.646 1.00 22.52 ? 135 ILE B N     1 
ATOM   4033 C  CA    . ILE C 1 135 ? 33.150  19.598  34.971 1.00 22.11 ? 135 ILE B CA    1 
ATOM   4034 C  C     . ILE C 1 135 ? 34.012  19.430  33.727 1.00 22.30 ? 135 ILE B C     1 
ATOM   4035 O  O     . ILE C 1 135 ? 34.902  20.248  33.533 1.00 28.14 ? 135 ILE B O     1 
ATOM   4036 C  CB    . ILE C 1 135 ? 33.550  18.623  36.090 1.00 26.13 ? 135 ILE B CB    1 
ATOM   4037 C  CG1   . ILE C 1 135 ? 32.760  19.022  37.338 1.00 32.51 ? 135 ILE B CG1   1 
ATOM   4038 C  CG2   . ILE C 1 135 ? 35.006  18.671  36.510 1.00 32.60 ? 135 ILE B CG2   1 
ATOM   4039 C  CD1   . ILE C 1 135 ? 32.412  17.902  38.312 1.00 40.32 ? 135 ILE B CD1   1 
ATOM   4040 N  N     . GLY C 1 136 ? 33.608  18.638  32.734 1.00 22.01 ? 136 GLY B N     1 
ATOM   4041 C  CA    . GLY C 1 136 ? 34.428  18.445  31.535 1.00 12.70 ? 136 GLY B CA    1 
ATOM   4042 C  C     . GLY C 1 136 ? 35.305  17.191  31.549 1.00 19.18 ? 136 GLY B C     1 
ATOM   4043 O  O     . GLY C 1 136 ? 35.115  16.320  30.699 1.00 21.78 ? 136 GLY B O     1 
ATOM   4044 N  N     . ARG C 1 137 ? 36.231  17.069  32.493 1.00 19.26 ? 137 ARG B N     1 
ATOM   4045 C  CA    . ARG C 1 137 ? 37.099  15.906  32.664 1.00 20.59 ? 137 ARG B CA    1 
ATOM   4046 C  C     . ARG C 1 137 ? 37.554  15.914  34.076 1.00 24.04 ? 137 ARG B C     1 
ATOM   4047 O  O     . ARG C 1 137 ? 37.477  16.994  34.689 1.00 24.53 ? 137 ARG B O     1 
ATOM   4048 C  CB    . ARG C 1 137 ? 38.311  15.948  31.777 1.00 20.24 ? 137 ARG B CB    1 
ATOM   4049 C  CG    . ARG C 1 137 ? 39.265  17.129  31.983 1.00 26.30 ? 137 ARG B CG    1 
ATOM   4050 C  CD    . ARG C 1 137 ? 40.372  16.789  31.030 1.00 33.34 ? 137 ARG B CD    1 
ATOM   4051 N  NE    . ARG C 1 137 ? 41.324  17.858  30.680 1.00 42.57 ? 137 ARG B NE    1 
ATOM   4052 C  CZ    . ARG C 1 137 ? 42.481  18.080  31.303 1.00 41.52 ? 137 ARG B CZ    1 
ATOM   4053 N  NH1   . ARG C 1 137 ? 42.842  17.332  32.360 1.00 35.90 ? 137 ARG B NH1   1 
ATOM   4054 N  NH2   . ARG C 1 137 ? 43.369  18.866  30.699 1.00 36.80 ? 137 ARG B NH2   1 
ATOM   4055 N  N     . PHE C 1 138 ? 37.777  14.726  34.661 1.00 21.76 ? 138 PHE B N     1 
ATOM   4056 C  CA    . PHE C 1 138 ? 38.300  14.583  36.021 1.00 20.47 ? 138 PHE B CA    1 
ATOM   4057 C  C     . PHE C 1 138 ? 39.871  14.650  35.991 1.00 22.73 ? 138 PHE B C     1 
ATOM   4058 O  O     . PHE C 1 138 ? 40.531  14.274  35.005 1.00 24.88 ? 138 PHE B O     1 
ATOM   4059 C  CB    . PHE C 1 138 ? 37.822  13.227  36.595 1.00 29.09 ? 138 PHE B CB    1 
ATOM   4060 C  CG    . PHE C 1 138 ? 36.356  13.130  36.880 1.00 32.28 ? 138 PHE B CG    1 
ATOM   4061 C  CD1   . PHE C 1 138 ? 35.522  14.276  37.054 1.00 35.06 ? 138 PHE B CD1   1 
ATOM   4062 C  CD2   . PHE C 1 138 ? 35.748  11.870  36.818 1.00 33.57 ? 138 PHE B CD2   1 
ATOM   4063 C  CE1   . PHE C 1 138 ? 34.081  14.164  37.117 1.00 33.89 ? 138 PHE B CE1   1 
ATOM   4064 C  CE2   . PHE C 1 138 ? 34.315  11.735  36.873 1.00 32.91 ? 138 PHE B CE2   1 
ATOM   4065 C  CZ    . PHE C 1 138 ? 33.494  12.877  37.012 1.00 31.29 ? 138 PHE B CZ    1 
ATOM   4066 N  N     . SER C 1 139 ? 40.536  15.017  37.065 1.00 21.98 ? 139 SER B N     1 
ATOM   4067 C  CA    . SER C 1 139 ? 41.997  14.995  36.958 1.00 24.84 ? 139 SER B CA    1 
ATOM   4068 C  C     . SER C 1 139 ? 42.419  13.519  37.105 1.00 33.24 ? 139 SER B C     1 
ATOM   4069 O  O     . SER C 1 139 ? 41.603  12.693  37.601 1.00 34.04 ? 139 SER B O     1 
ATOM   4070 C  CB    . SER C 1 139 ? 42.637  15.720  38.127 1.00 15.18 ? 139 SER B CB    1 
ATOM   4071 O  OG    . SER C 1 139 ? 42.114  15.335  39.363 1.00 20.07 ? 139 SER B OG    1 
ATOM   4072 N  N     . GLU C 1 140 ? 43.700  13.216  36.825 1.00 32.93 ? 140 GLU B N     1 
ATOM   4073 C  CA    . GLU C 1 140 ? 44.179  11.869  37.060 1.00 26.87 ? 140 GLU B CA    1 
ATOM   4074 C  C     . GLU C 1 140 ? 43.938  11.380  38.469 1.00 27.16 ? 140 GLU B C     1 
ATOM   4075 O  O     . GLU C 1 140 ? 43.167  10.455  38.558 1.00 30.44 ? 140 GLU B O     1 
ATOM   4076 C  CB    . GLU C 1 140 ? 45.498  11.559  36.450 1.00 19.56 ? 140 GLU B CB    1 
ATOM   4077 C  CG    . GLU C 1 140 ? 45.386  11.563  34.941 1.00 15.78 ? 140 GLU B CG    1 
ATOM   4078 C  CD    . GLU C 1 140 ? 46.731  11.206  34.342 1.00 21.79 ? 140 GLU B CD    1 
ATOM   4079 O  OE1   . GLU C 1 140 ? 47.459  10.408  34.979 1.00 28.15 ? 140 GLU B OE1   1 
ATOM   4080 O  OE2   . GLU C 1 140 ? 46.999  11.533  33.170 1.00 20.18 ? 140 GLU B OE2   1 
ATOM   4081 N  N     . PRO C 1 141 ? 44.284  12.110  39.538 1.00 27.75 ? 141 PRO B N     1 
ATOM   4082 C  CA    . PRO C 1 141 ? 43.953  11.547  40.857 1.00 27.15 ? 141 PRO B CA    1 
ATOM   4083 C  C     . PRO C 1 141 ? 42.448  11.320  41.136 1.00 28.55 ? 141 PRO B C     1 
ATOM   4084 O  O     . PRO C 1 141 ? 42.108  10.349  41.819 1.00 30.74 ? 141 PRO B O     1 
ATOM   4085 C  CB    . PRO C 1 141 ? 44.546  12.564  41.855 1.00 28.62 ? 141 PRO B CB    1 
ATOM   4086 C  CG    . PRO C 1 141 ? 45.733  13.056  41.114 1.00 28.54 ? 141 PRO B CG    1 
ATOM   4087 C  CD    . PRO C 1 141 ? 45.312  13.163  39.658 1.00 27.40 ? 141 PRO B CD    1 
ATOM   4088 N  N     . HIS C 1 142 ? 41.562  12.129  40.530 1.00 27.49 ? 142 HIS B N     1 
ATOM   4089 C  CA    . HIS C 1 142 ? 40.102  12.052  40.754 1.00 23.86 ? 142 HIS B CA    1 
ATOM   4090 C  C     . HIS C 1 142 ? 39.613  10.789  39.996 1.00 19.54 ? 142 HIS B C     1 
ATOM   4091 O  O     . HIS C 1 142 ? 38.864  10.059  40.581 1.00 18.88 ? 142 HIS B O     1 
ATOM   4092 C  CB    . HIS C 1 142 ? 39.439  13.350  40.263 1.00 27.04 ? 142 HIS B CB    1 
ATOM   4093 C  CG    . HIS C 1 142 ? 37.973  13.536  40.583 1.00 34.38 ? 142 HIS B CG    1 
ATOM   4094 N  ND1   . HIS C 1 142 ? 37.283  14.669  40.197 1.00 42.23 ? 142 HIS B ND1   1 
ATOM   4095 C  CD2   . HIS C 1 142 ? 37.036  12.724  41.132 1.00 39.62 ? 142 HIS B CD2   1 
ATOM   4096 C  CE1   . HIS C 1 142 ? 35.995  14.532  40.473 1.00 45.75 ? 142 HIS B CE1   1 
ATOM   4097 N  NE2   . HIS C 1 142 ? 35.814  13.357  41.046 1.00 38.79 ? 142 HIS B NE2   1 
ATOM   4098 N  N     . ALA C 1 143 ? 39.985  10.584  38.731 1.00 18.19 ? 143 ALA B N     1 
ATOM   4099 C  CA    . ALA C 1 143 ? 39.677  9.375   37.959 1.00 23.24 ? 143 ALA B CA    1 
ATOM   4100 C  C     . ALA C 1 143 ? 40.180  8.103   38.636 1.00 22.83 ? 143 ALA B C     1 
ATOM   4101 O  O     . ALA C 1 143 ? 39.370  7.244   38.920 1.00 28.40 ? 143 ALA B O     1 
ATOM   4102 C  CB    . ALA C 1 143 ? 40.185  9.438   36.575 1.00 16.03 ? 143 ALA B CB    1 
ATOM   4103 N  N     . ARG C 1 144 ? 41.342  8.177   39.264 1.00 22.48 ? 144 ARG B N     1 
ATOM   4104 C  CA    . ARG C 1 144 ? 41.970  7.067   39.934 1.00 23.63 ? 144 ARG B CA    1 
ATOM   4105 C  C     . ARG C 1 144 ? 41.185  6.547   41.104 1.00 29.56 ? 144 ARG B C     1 
ATOM   4106 O  O     . ARG C 1 144 ? 40.986  5.330   41.151 1.00 26.34 ? 144 ARG B O     1 
ATOM   4107 C  CB    . ARG C 1 144 ? 43.433  7.331   40.276 1.00 28.68 ? 144 ARG B CB    1 
ATOM   4108 C  CG    . ARG C 1 144 ? 44.142  6.232   41.070 1.00 30.58 ? 144 ARG B CG    1 
ATOM   4109 C  CD    . ARG C 1 144 ? 45.535  6.709   41.475 1.00 37.07 ? 144 ARG B CD    1 
ATOM   4110 N  NE    . ARG C 1 144 ? 46.258  7.224   40.307 1.00 38.93 ? 144 ARG B NE    1 
ATOM   4111 C  CZ    . ARG C 1 144 ? 46.868  8.403   40.214 1.00 38.08 ? 144 ARG B CZ    1 
ATOM   4112 N  NH1   . ARG C 1 144 ? 46.862  9.284   41.207 1.00 36.55 ? 144 ARG B NH1   1 
ATOM   4113 N  NH2   . ARG C 1 144 ? 47.653  8.595   39.173 1.00 35.86 ? 144 ARG B NH2   1 
ATOM   4114 N  N     . PHE C 1 145 ? 40.689  7.467   41.950 1.00 27.39 ? 145 PHE B N     1 
ATOM   4115 C  CA    . PHE C 1 145 ? 39.822  7.197   43.133 1.00 22.81 ? 145 PHE B CA    1 
ATOM   4116 C  C     . PHE C 1 145 ? 38.536  6.455   42.710 1.00 20.16 ? 145 PHE B C     1 
ATOM   4117 O  O     . PHE C 1 145 ? 38.123  5.544   43.375 1.00 22.34 ? 145 PHE B O     1 
ATOM   4118 C  CB    . PHE C 1 145 ? 39.411  8.528   43.760 1.00 21.45 ? 145 PHE B CB    1 
ATOM   4119 C  CG    . PHE C 1 145 ? 38.385  8.436   44.803 1.00 20.49 ? 145 PHE B CG    1 
ATOM   4120 C  CD1   . PHE C 1 145 ? 38.713  7.934   46.046 1.00 18.42 ? 145 PHE B CD1   1 
ATOM   4121 C  CD2   . PHE C 1 145 ? 37.090  8.890   44.533 1.00 16.98 ? 145 PHE B CD2   1 
ATOM   4122 C  CE1   . PHE C 1 145 ? 37.701  7.894   47.073 1.00 27.08 ? 145 PHE B CE1   1 
ATOM   4123 C  CE2   . PHE C 1 145 ? 36.063  8.853   45.551 1.00 17.55 ? 145 PHE B CE2   1 
ATOM   4124 C  CZ    . PHE C 1 145 ? 36.367  8.354   46.820 1.00 16.24 ? 145 PHE B CZ    1 
ATOM   4125 N  N     . TYR C 1 146 ? 37.977  6.796   41.561 1.00 20.11 ? 146 TYR B N     1 
ATOM   4126 C  CA    . TYR C 1 146 ? 36.725  6.200   41.114 1.00 23.05 ? 146 TYR B CA    1 
ATOM   4127 C  C     . TYR C 1 146 ? 36.981  4.778   40.599 1.00 24.31 ? 146 TYR B C     1 
ATOM   4128 O  O     . TYR C 1 146 ? 36.210  3.866   40.903 1.00 25.21 ? 146 TYR B O     1 
ATOM   4129 C  CB    . TYR C 1 146 ? 36.115  7.092   40.033 1.00 19.08 ? 146 TYR B CB    1 
ATOM   4130 C  CG    . TYR C 1 146 ? 35.377  8.333   40.553 1.00 23.94 ? 146 TYR B CG    1 
ATOM   4131 C  CD1   . TYR C 1 146 ? 34.742  8.366   41.854 1.00 27.41 ? 146 TYR B CD1   1 
ATOM   4132 C  CD2   . TYR C 1 146 ? 35.290  9.499   39.743 1.00 33.32 ? 146 TYR B CD2   1 
ATOM   4133 C  CE1   . TYR C 1 146 ? 34.033  9.517   42.344 1.00 24.79 ? 146 TYR B CE1   1 
ATOM   4134 C  CE2   . TYR C 1 146 ? 34.590  10.662  40.202 1.00 26.40 ? 146 TYR B CE2   1 
ATOM   4135 C  CZ    . TYR C 1 146 ? 33.987  10.664  41.498 1.00 31.64 ? 146 TYR B CZ    1 
ATOM   4136 O  OH    . TYR C 1 146 ? 33.544  11.874  41.992 1.00 26.15 ? 146 TYR B OH    1 
ATOM   4137 N  N     . ALA C 1 147 ? 37.961  4.697   39.692 1.00 21.83 ? 147 ALA B N     1 
ATOM   4138 C  CA    . ALA C 1 147 ? 38.452  3.502   39.025 1.00 21.66 ? 147 ALA B CA    1 
ATOM   4139 C  C     . ALA C 1 147 ? 38.897  2.443   40.013 1.00 21.28 ? 147 ALA B C     1 
ATOM   4140 O  O     . ALA C 1 147 ? 38.553  1.297   39.780 1.00 25.42 ? 147 ALA B O     1 
ATOM   4141 C  CB    . ALA C 1 147 ? 39.565  3.829   38.065 1.00 17.19 ? 147 ALA B CB    1 
ATOM   4142 N  N     . ALA C 1 148 ? 39.435  2.816   41.166 1.00 18.17 ? 148 ALA B N     1 
ATOM   4143 C  CA    . ALA C 1 148 ? 39.837  1.888   42.209 1.00 26.79 ? 148 ALA B CA    1 
ATOM   4144 C  C     . ALA C 1 148 ? 38.647  1.096   42.749 1.00 26.25 ? 148 ALA B C     1 
ATOM   4145 O  O     . ALA C 1 148 ? 38.774  -0.075  43.091 1.00 23.61 ? 148 ALA B O     1 
ATOM   4146 C  CB    . ALA C 1 148 ? 40.501  2.626   43.352 1.00 26.73 ? 148 ALA B CB    1 
ATOM   4147 N  N     . GLN C 1 149 ? 37.553  1.819   42.968 1.00 24.79 ? 149 GLN B N     1 
ATOM   4148 C  CA    . GLN C 1 149 ? 36.291  1.292   43.492 1.00 22.14 ? 149 GLN B CA    1 
ATOM   4149 C  C     . GLN C 1 149 ? 35.630  0.312   42.503 1.00 20.80 ? 149 GLN B C     1 
ATOM   4150 O  O     . GLN C 1 149 ? 35.084  -0.708  42.972 1.00 22.83 ? 149 GLN B O     1 
ATOM   4151 C  CB    . GLN C 1 149 ? 35.322  2.441   43.861 1.00 21.11 ? 149 GLN B CB    1 
ATOM   4152 C  CG    . GLN C 1 149 ? 35.724  3.296   45.098 1.00 25.29 ? 149 GLN B CG    1 
ATOM   4153 C  CD    . GLN C 1 149 ? 34.879  4.573   45.099 1.00 28.16 ? 149 GLN B CD    1 
ATOM   4154 O  OE1   . GLN C 1 149 ? 33.666  4.466   45.086 1.00 27.34 ? 149 GLN B OE1   1 
ATOM   4155 N  NE2   . GLN C 1 149 ? 35.492  5.726   44.820 1.00 23.97 ? 149 GLN B NE2   1 
ATOM   4156 N  N     . ILE C 1 150 ? 35.741  0.587   41.198 1.00 18.57 ? 150 ILE B N     1 
ATOM   4157 C  CA    . ILE C 1 150 ? 35.252  -0.297  40.141 1.00 19.49 ? 150 ILE B CA    1 
ATOM   4158 C  C     . ILE C 1 150 ? 36.123  -1.571  40.007 1.00 25.71 ? 150 ILE B C     1 
ATOM   4159 O  O     . ILE C 1 150 ? 35.551  -2.647  39.755 1.00 26.34 ? 150 ILE B O     1 
ATOM   4160 C  CB    . ILE C 1 150 ? 35.160  0.378   38.787 1.00 21.93 ? 150 ILE B CB    1 
ATOM   4161 C  CG1   . ILE C 1 150 ? 34.365  1.713   38.927 1.00 22.81 ? 150 ILE B CG1   1 
ATOM   4162 C  CG2   . ILE C 1 150 ? 34.481  -0.593  37.768 1.00 14.07 ? 150 ILE B CG2   1 
ATOM   4163 C  CD1   . ILE C 1 150 ? 32.907  1.583   39.000 1.00 25.84 ? 150 ILE B CD1   1 
ATOM   4164 N  N     . VAL C 1 151 ? 37.462  -1.429  40.046 1.00 21.76 ? 151 VAL B N     1 
ATOM   4165 C  CA    . VAL C 1 151 ? 38.407  -2.533  40.102 1.00 20.22 ? 151 VAL B CA    1 
ATOM   4166 C  C     . VAL C 1 151 ? 38.017  -3.495  41.247 1.00 25.42 ? 151 VAL B C     1 
ATOM   4167 O  O     . VAL C 1 151 ? 37.693  -4.645  40.938 1.00 29.10 ? 151 VAL B O     1 
ATOM   4168 C  CB    . VAL C 1 151 ? 39.801  -2.053  40.274 1.00 17.28 ? 151 VAL B CB    1 
ATOM   4169 C  CG1   . VAL C 1 151 ? 40.732  -3.302  40.492 1.00 15.32 ? 151 VAL B CG1   1 
ATOM   4170 C  CG2   . VAL C 1 151 ? 40.189  -1.418  38.948 1.00 13.50 ? 151 VAL B CG2   1 
ATOM   4171 N  N     . LEU C 1 152 ? 37.871  -3.023  42.486 1.00 20.85 ? 152 LEU B N     1 
ATOM   4172 C  CA    . LEU C 1 152 ? 37.444  -3.834  43.625 1.00 24.64 ? 152 LEU B CA    1 
ATOM   4173 C  C     . LEU C 1 152 ? 36.039  -4.463  43.434 1.00 24.85 ? 152 LEU B C     1 
ATOM   4174 O  O     . LEU C 1 152 ? 35.751  -5.600  43.844 1.00 20.98 ? 152 LEU B O     1 
ATOM   4175 C  CB    . LEU C 1 152 ? 37.489  -3.007  44.908 1.00 23.98 ? 152 LEU B CB    1 
ATOM   4176 C  CG    . LEU C 1 152 ? 38.837  -2.596  45.546 1.00 31.31 ? 152 LEU B CG    1 
ATOM   4177 C  CD1   . LEU C 1 152 ? 38.544  -1.523  46.645 1.00 18.53 ? 152 LEU B CD1   1 
ATOM   4178 C  CD2   . LEU C 1 152 ? 39.681  -3.802  46.130 1.00 29.54 ? 152 LEU B CD2   1 
ATOM   4179 N  N     . THR C 1 153 ? 35.170  -3.694  42.783 1.00 23.75 ? 153 THR B N     1 
ATOM   4180 C  CA    . THR C 1 153 ? 33.794  -4.111  42.513 1.00 22.97 ? 153 THR B CA    1 
ATOM   4181 C  C     . THR C 1 153 ? 33.746  -5.343  41.624 1.00 23.73 ? 153 THR B C     1 
ATOM   4182 O  O     . THR C 1 153 ? 33.127  -6.304  41.999 1.00 25.15 ? 153 THR B O     1 
ATOM   4183 C  CB    . THR C 1 153 ? 32.918  -2.905  42.051 1.00 23.11 ? 153 THR B CB    1 
ATOM   4184 O  OG1   . THR C 1 153 ? 32.767  -2.066  43.210 1.00 18.74 ? 153 THR B OG1   1 
ATOM   4185 C  CG2   . THR C 1 153 ? 31.500  -3.353  41.602 1.00 10.53 ? 153 THR B CG2   1 
ATOM   4186 N  N     . PHE C 1 154 ? 34.477  -5.276  40.521 1.00 20.51 ? 154 PHE B N     1 
ATOM   4187 C  CA    . PHE C 1 154 ? 34.637  -6.265  39.500 1.00 20.69 ? 154 PHE B CA    1 
ATOM   4188 C  C     . PHE C 1 154 ? 35.441  -7.462  40.100 1.00 24.02 ? 154 PHE B C     1 
ATOM   4189 O  O     . PHE C 1 154 ? 35.010  -8.578  39.835 1.00 24.56 ? 154 PHE B O     1 
ATOM   4190 C  CB    . PHE C 1 154 ? 35.351  -5.667  38.310 1.00 16.91 ? 154 PHE B CB    1 
ATOM   4191 C  CG    . PHE C 1 154 ? 34.498  -4.838  37.371 1.00 17.53 ? 154 PHE B CG    1 
ATOM   4192 C  CD1   . PHE C 1 154 ? 33.101  -4.685  37.488 1.00 20.93 ? 154 PHE B CD1   1 
ATOM   4193 C  CD2   . PHE C 1 154 ? 35.120  -4.284  36.271 1.00 13.45 ? 154 PHE B CD2   1 
ATOM   4194 C  CE1   . PHE C 1 154 ? 32.343  -4.008  36.492 1.00 15.27 ? 154 PHE B CE1   1 
ATOM   4195 C  CE2   . PHE C 1 154 ? 34.396  -3.622  35.271 1.00 16.52 ? 154 PHE B CE2   1 
ATOM   4196 C  CZ    . PHE C 1 154 ? 33.014  -3.491  35.366 1.00 11.86 ? 154 PHE B CZ    1 
ATOM   4197 N  N     . GLU C 1 155 ? 36.428  -7.262  40.987 1.00 19.22 ? 155 GLU B N     1 
ATOM   4198 C  CA    . GLU C 1 155 ? 37.175  -8.334  41.642 1.00 22.16 ? 155 GLU B CA    1 
ATOM   4199 C  C     . GLU C 1 155 ? 36.142  -9.172  42.440 1.00 29.02 ? 155 GLU B C     1 
ATOM   4200 O  O     . GLU C 1 155 ? 36.070  -10.403 42.295 1.00 29.01 ? 155 GLU B O     1 
ATOM   4201 C  CB    . GLU C 1 155 ? 38.261  -7.765  42.556 1.00 22.43 ? 155 GLU B CB    1 
ATOM   4202 C  CG    . GLU C 1 155 ? 39.026  -8.869  43.273 1.00 29.89 ? 155 GLU B CG    1 
ATOM   4203 C  CD    . GLU C 1 155 ? 40.242  -8.524  44.111 1.00 37.47 ? 155 GLU B CD    1 
ATOM   4204 O  OE1   . GLU C 1 155 ? 40.246  -7.498  44.811 1.00 44.87 ? 155 GLU B OE1   1 
ATOM   4205 O  OE2   . GLU C 1 155 ? 41.146  -9.390  44.247 1.00 41.46 ? 155 GLU B OE2   1 
ATOM   4206 N  N     . TYR C 1 156 ? 35.257  -8.482  43.177 1.00 28.71 ? 156 TYR B N     1 
ATOM   4207 C  CA    . TYR C 1 156 ? 34.133  -9.089  43.882 1.00 25.40 ? 156 TYR B CA    1 
ATOM   4208 C  C     . TYR C 1 156 ? 33.189  -9.814  42.912 1.00 25.89 ? 156 TYR B C     1 
ATOM   4209 O  O     . TYR C 1 156 ? 33.086  -11.040 43.019 1.00 26.92 ? 156 TYR B O     1 
ATOM   4210 C  CB    . TYR C 1 156 ? 33.364  -8.071  44.711 1.00 23.73 ? 156 TYR B CB    1 
ATOM   4211 C  CG    . TYR C 1 156 ? 32.115  -8.589  45.322 1.00 19.90 ? 156 TYR B CG    1 
ATOM   4212 C  CD1   . TYR C 1 156 ? 32.174  -9.378  46.489 1.00 17.78 ? 156 TYR B CD1   1 
ATOM   4213 C  CD2   . TYR C 1 156 ? 30.880  -8.236  44.785 1.00 21.66 ? 156 TYR B CD2   1 
ATOM   4214 C  CE1   . TYR C 1 156 ? 30.992  -9.816  47.105 1.00 18.96 ? 156 TYR B CE1   1 
ATOM   4215 C  CE2   . TYR C 1 156 ? 29.671  -8.651  45.422 1.00 22.65 ? 156 TYR B CE2   1 
ATOM   4216 C  CZ    . TYR C 1 156 ? 29.763  -9.432  46.554 1.00 16.19 ? 156 TYR B CZ    1 
ATOM   4217 O  OH    . TYR C 1 156 ? 28.622  -9.815  47.113 1.00 22.29 ? 156 TYR B OH    1 
ATOM   4218 N  N     . LEU C 1 157 ? 32.473  -9.094  42.056 1.00 18.93 ? 157 LEU B N     1 
ATOM   4219 C  CA    . LEU C 1 157 ? 31.529  -9.681  41.132 1.00 21.22 ? 157 LEU B CA    1 
ATOM   4220 C  C     . LEU C 1 157 ? 32.064  -10.904 40.375 1.00 22.38 ? 157 LEU B C     1 
ATOM   4221 O  O     . LEU C 1 157 ? 31.320  -11.844 40.249 1.00 21.69 ? 157 LEU B O     1 
ATOM   4222 C  CB    . LEU C 1 157 ? 30.886  -8.726  40.099 1.00 19.17 ? 157 LEU B CB    1 
ATOM   4223 C  CG    . LEU C 1 157 ? 29.945  -7.595  40.620 1.00 23.60 ? 157 LEU B CG    1 
ATOM   4224 C  CD1   . LEU C 1 157 ? 29.742  -6.569  39.460 1.00 19.52 ? 157 LEU B CD1   1 
ATOM   4225 C  CD2   . LEU C 1 157 ? 28.634  -8.070  41.353 1.00 20.93 ? 157 LEU B CD2   1 
ATOM   4226 N  N     . HIS C 1 158 ? 33.219  -10.779 39.710 1.00 26.78 ? 158 HIS B N     1 
ATOM   4227 C  CA    . HIS C 1 158 ? 33.814  -11.846 38.883 1.00 26.05 ? 158 HIS B CA    1 
ATOM   4228 C  C     . HIS C 1 158 ? 34.164  -13.110 39.743 1.00 22.95 ? 158 HIS B C     1 
ATOM   4229 O  O     . HIS C 1 158 ? 34.015  -14.214 39.238 1.00 21.90 ? 158 HIS B O     1 
ATOM   4230 C  CB    . HIS C 1 158 ? 35.071  -11.357 38.188 1.00 23.52 ? 158 HIS B CB    1 
ATOM   4231 C  CG    . HIS C 1 158 ? 34.945  -10.156 37.322 1.00 17.79 ? 158 HIS B CG    1 
ATOM   4232 N  ND1   . HIS C 1 158 ? 33.733  -9.756  36.803 1.00 24.85 ? 158 HIS B ND1   1 
ATOM   4233 C  CD2   . HIS C 1 158 ? 35.886  -9.574  36.534 1.00 13.18 ? 158 HIS B CD2   1 
ATOM   4234 C  CE1   . HIS C 1 158 ? 33.939  -9.077  35.688 1.00 12.34 ? 158 HIS B CE1   1 
ATOM   4235 N  NE2   . HIS C 1 158 ? 35.235  -8.951  35.493 1.00 15.45 ? 158 HIS B NE2   1 
ATOM   4236 N  N     . SER C 1 159 ? 34.380  -12.913 41.045 1.00 19.33 ? 159 SER B N     1 
ATOM   4237 C  CA    . SER C 1 159 ? 34.675  -13.973 41.964 1.00 21.19 ? 159 SER B CA    1 
ATOM   4238 C  C     . SER C 1 159 ? 33.467  -14.864 42.267 1.00 27.70 ? 159 SER B C     1 
ATOM   4239 O  O     . SER C 1 159 ? 33.656  -16.077 42.505 1.00 28.11 ? 159 SER B O     1 
ATOM   4240 C  CB    . SER C 1 159 ? 35.378  -13.431 43.200 1.00 17.70 ? 159 SER B CB    1 
ATOM   4241 O  OG    . SER C 1 159 ? 34.572  -13.098 44.321 1.00 25.28 ? 159 SER B OG    1 
ATOM   4242 N  N     . LEU C 1 160 ? 32.269  -14.348 41.971 1.00 21.67 ? 160 LEU B N     1 
ATOM   4243 C  CA    . LEU C 1 160 ? 30.979  -15.019 42.227 1.00 18.18 ? 160 LEU B CA    1 
ATOM   4244 C  C     . LEU C 1 160 ? 30.435  -15.478 40.937 1.00 14.03 ? 160 LEU B C     1 
ATOM   4245 O  O     . LEU C 1 160 ? 29.249  -15.828 40.878 1.00 20.49 ? 160 LEU B O     1 
ATOM   4246 C  CB    . LEU C 1 160 ? 29.914  -14.039 42.792 1.00 19.48 ? 160 LEU B CB    1 
ATOM   4247 C  CG    . LEU C 1 160 ? 30.188  -13.089 43.974 1.00 26.00 ? 160 LEU B CG    1 
ATOM   4248 C  CD1   . LEU C 1 160 ? 29.010  -12.135 44.328 1.00 26.71 ? 160 LEU B CD1   1 
ATOM   4249 C  CD2   . LEU C 1 160 ? 30.712  -13.743 45.179 1.00 27.11 ? 160 LEU B CD2   1 
ATOM   4250 N  N     . ASP C 1 161 ? 31.262  -15.519 39.890 1.00 17.04 ? 161 ASP B N     1 
ATOM   4251 C  CA    . ASP C 1 161 ? 30.840  -15.952 38.558 1.00 16.93 ? 161 ASP B CA    1 
ATOM   4252 C  C     . ASP C 1 161 ? 29.896  -14.948 37.857 1.00 24.45 ? 161 ASP B C     1 
ATOM   4253 O  O     . ASP C 1 161 ? 29.307  -15.261 36.781 1.00 23.70 ? 161 ASP B O     1 
ATOM   4254 C  CB    . ASP C 1 161 ? 30.294  -17.446 38.534 1.00 23.09 ? 161 ASP B CB    1 
ATOM   4255 C  CG    . ASP C 1 161 ? 31.214  -18.452 39.274 1.00 25.29 ? 161 ASP B CG    1 
ATOM   4256 O  OD1   . ASP C 1 161 ? 32.318  -18.631 38.745 1.00 25.56 ? 161 ASP B OD1   1 
ATOM   4257 O  OD2   . ASP C 1 161 ? 31.077  -18.825 40.471 1.00 22.46 ? 161 ASP B OD2   1 
ATOM   4258 N  N     . LEU C 1 162 ? 29.844  -13.693 38.357 1.00 25.54 ? 162 LEU B N     1 
ATOM   4259 C  CA    . LEU C 1 162 ? 29.006  -12.634 37.706 1.00 24.21 ? 162 LEU B CA    1 
ATOM   4260 C  C     . LEU C 1 162 ? 29.793  -11.773 36.715 1.00 21.97 ? 162 LEU B C     1 
ATOM   4261 O  O     . LEU C 1 162 ? 30.966  -11.492 36.973 1.00 24.82 ? 162 LEU B O     1 
ATOM   4262 C  CB    . LEU C 1 162 ? 28.381  -11.682 38.778 1.00 19.76 ? 162 LEU B CB    1 
ATOM   4263 C  CG    . LEU C 1 162 ? 27.591  -12.383 39.851 1.00 16.05 ? 162 LEU B CG    1 
ATOM   4264 C  CD1   . LEU C 1 162 ? 27.339  -11.539 41.068 1.00 14.45 ? 162 LEU B CD1   1 
ATOM   4265 C  CD2   . LEU C 1 162 ? 26.393  -13.003 39.186 1.00 15.35 ? 162 LEU B CD2   1 
ATOM   4266 N  N     . ILE C 1 163 ? 29.213  -11.508 35.561 1.00 18.63 ? 163 ILE B N     1 
ATOM   4267 C  CA    . ILE C 1 163 ? 29.719  -10.551 34.562 1.00 23.45 ? 163 ILE B CA    1 
ATOM   4268 C  C     . ILE C 1 163 ? 28.662  -9.347  34.707 1.00 24.83 ? 163 ILE B C     1 
ATOM   4269 O  O     . ILE C 1 163 ? 27.426  -9.556  34.719 1.00 17.29 ? 163 ILE B O     1 
ATOM   4270 C  CB    . ILE C 1 163 ? 29.648  -10.998 33.059 1.00 26.19 ? 163 ILE B CB    1 
ATOM   4271 C  CG1   . ILE C 1 163 ? 30.275  -12.339 32.722 1.00 32.94 ? 163 ILE B CG1   1 
ATOM   4272 C  CG2   . ILE C 1 163 ? 30.558  -10.080 32.186 1.00 22.12 ? 163 ILE B CG2   1 
ATOM   4273 C  CD1   . ILE C 1 163 ? 30.102  -12.581 31.171 1.00 34.77 ? 163 ILE B CD1   1 
ATOM   4274 N  N     . TYR C 1 164 ? 29.146  -8.104  34.671 1.00 22.32 ? 164 TYR B N     1 
ATOM   4275 C  CA    . TYR C 1 164 ? 28.303  -6.919  34.839 1.00 20.44 ? 164 TYR B CA    1 
ATOM   4276 C  C     . TYR C 1 164 ? 27.732  -6.486  33.500 1.00 19.23 ? 164 TYR B C     1 
ATOM   4277 O  O     . TYR C 1 164 ? 26.561  -6.211  33.366 1.00 17.39 ? 164 TYR B O     1 
ATOM   4278 C  CB    . TYR C 1 164 ? 29.159  -5.855  35.499 1.00 21.53 ? 164 TYR B CB    1 
ATOM   4279 C  CG    . TYR C 1 164 ? 28.349  -4.587  35.740 1.00 23.03 ? 164 TYR B CG    1 
ATOM   4280 C  CD1   . TYR C 1 164 ? 27.302  -4.565  36.641 1.00 20.18 ? 164 TYR B CD1   1 
ATOM   4281 C  CD2   . TYR C 1 164 ? 28.613  -3.414  34.986 1.00 27.40 ? 164 TYR B CD2   1 
ATOM   4282 C  CE1   . TYR C 1 164 ? 26.494  -3.389  36.801 1.00 25.72 ? 164 TYR B CE1   1 
ATOM   4283 C  CE2   . TYR C 1 164 ? 27.811  -2.247  35.130 1.00 23.08 ? 164 TYR B CE2   1 
ATOM   4284 C  CZ    . TYR C 1 164 ? 26.759  -2.238  36.027 1.00 24.09 ? 164 TYR B CZ    1 
ATOM   4285 O  OH    . TYR C 1 164 ? 25.957  -1.114  36.089 1.00 23.11 ? 164 TYR B OH    1 
ATOM   4286 N  N     . ARG C 1 165 ? 28.603  -6.211  32.537 1.00 16.21 ? 165 ARG B N     1 
ATOM   4287 C  CA    . ARG C 1 165 ? 28.145  -5.996  31.207 1.00 14.65 ? 165 ARG B CA    1 
ATOM   4288 C  C     . ARG C 1 165 ? 27.502  -4.645  30.844 1.00 14.76 ? 165 ARG B C     1 
ATOM   4289 O  O     . ARG C 1 165 ? 27.056  -4.512  29.703 1.00 13.22 ? 165 ARG B O     1 
ATOM   4290 C  CB    . ARG C 1 165 ? 27.277  -7.180  30.728 1.00 19.70 ? 165 ARG B CB    1 
ATOM   4291 C  CG    . ARG C 1 165 ? 28.012  -8.567  30.633 1.00 11.58 ? 165 ARG B CG    1 
ATOM   4292 C  CD    . ARG C 1 165 ? 27.272  -9.228  29.542 1.00 6.74  ? 165 ARG B CD    1 
ATOM   4293 N  NE    . ARG C 1 165 ? 26.017  -9.721  30.129 1.00 16.80 ? 165 ARG B NE    1 
ATOM   4294 C  CZ    . ARG C 1 165 ? 25.258  -10.704 29.600 1.00 22.99 ? 165 ARG B CZ    1 
ATOM   4295 N  NH1   . ARG C 1 165 ? 25.648  -11.290 28.481 1.00 22.72 ? 165 ARG B NH1   1 
ATOM   4296 N  NH2   . ARG C 1 165 ? 24.048  -10.997 30.080 1.00 18.21 ? 165 ARG B NH2   1 
ATOM   4297 N  N     . ASP C 1 166 ? 27.423  -3.706  31.773 1.00 14.14 ? 166 ASP B N     1 
ATOM   4298 C  CA    . ASP C 1 166 ? 26.913  -2.375  31.339 1.00 18.37 ? 166 ASP B CA    1 
ATOM   4299 C  C     . ASP C 1 166 ? 27.610  -1.135  31.951 1.00 19.86 ? 166 ASP B C     1 
ATOM   4300 O  O     . ASP C 1 166 ? 26.927  -0.317  32.592 1.00 19.79 ? 166 ASP B O     1 
ATOM   4301 C  CB    . ASP C 1 166 ? 25.388  -2.249  31.476 1.00 12.07 ? 166 ASP B CB    1 
ATOM   4302 C  CG    . ASP C 1 166 ? 24.842  -1.183  30.566 1.00 21.55 ? 166 ASP B CG    1 
ATOM   4303 O  OD1   . ASP C 1 166 ? 25.535  -0.801  29.556 1.00 15.72 ? 166 ASP B OD1   1 
ATOM   4304 O  OD2   . ASP C 1 166 ? 23.672  -0.801  30.869 1.00 25.84 ? 166 ASP B OD2   1 
ATOM   4305 N  N     . LEU C 1 167 ? 28.921  -1.261  32.174 1.00 15.21 ? 167 LEU B N     1 
ATOM   4306 C  CA    . LEU C 1 167 ? 29.714  -0.156  32.719 1.00 14.92 ? 167 LEU B CA    1 
ATOM   4307 C  C     . LEU C 1 167 ? 29.730  1.121   31.864 1.00 12.29 ? 167 LEU B C     1 
ATOM   4308 O  O     . LEU C 1 167 ? 29.870  1.052   30.640 1.00 14.22 ? 167 LEU B O     1 
ATOM   4309 C  CB    . LEU C 1 167 ? 31.107  -0.592  33.065 1.00 12.85 ? 167 LEU B CB    1 
ATOM   4310 C  CG    . LEU C 1 167 ? 31.938  0.485   33.780 1.00 15.36 ? 167 LEU B CG    1 
ATOM   4311 C  CD1   . LEU C 1 167 ? 31.473  0.527   35.271 1.00 13.08 ? 167 LEU B CD1   1 
ATOM   4312 C  CD2   . LEU C 1 167 ? 33.465  0.113   33.731 1.00 12.69 ? 167 LEU B CD2   1 
ATOM   4313 N  N     . LYS C 1 168 ? 29.146  2.179   32.467 1.00 15.94 ? 168 LYS B N     1 
ATOM   4314 C  CA    . LYS C 1 168 ? 29.016  3.526   31.843 1.00 7.87  ? 168 LYS B CA    1 
ATOM   4315 C  C     . LYS C 1 168 ? 28.755  4.539   32.930 1.00 13.42 ? 168 LYS B C     1 
ATOM   4316 O  O     . LYS C 1 168 ? 28.278  4.171   34.056 1.00 16.22 ? 168 LYS B O     1 
ATOM   4317 C  CB    . LYS C 1 168 ? 27.890  3.523   30.794 1.00 10.36 ? 168 LYS B CB    1 
ATOM   4318 C  CG    . LYS C 1 168 ? 26.496  3.125   31.395 1.00 8.41  ? 168 LYS B CG    1 
ATOM   4319 C  CD    . LYS C 1 168 ? 25.590  3.331   30.215 1.00 7.07  ? 168 LYS B CD    1 
ATOM   4320 C  CE    . LYS C 1 168 ? 24.277  2.697   30.609 1.00 7.51  ? 168 LYS B CE    1 
ATOM   4321 N  NZ    . LYS C 1 168 ? 23.382  2.597   29.381 1.00 11.27 ? 168 LYS B NZ    1 
ATOM   4322 N  N     . PRO C 1 169 ? 29.169  5.824   32.722 1.00 13.13 ? 169 PRO B N     1 
ATOM   4323 C  CA    . PRO C 1 169 ? 28.942  6.844   33.775 1.00 12.71 ? 169 PRO B CA    1 
ATOM   4324 C  C     . PRO C 1 169 ? 27.448  6.961   34.273 1.00 13.31 ? 169 PRO B C     1 
ATOM   4325 O  O     . PRO C 1 169 ? 27.228  7.262   35.470 1.00 13.52 ? 169 PRO B O     1 
ATOM   4326 C  CB    . PRO C 1 169 ? 29.341  8.150   33.017 1.00 13.97 ? 169 PRO B CB    1 
ATOM   4327 C  CG    . PRO C 1 169 ? 30.388  7.722   32.101 1.00 13.39 ? 169 PRO B CG    1 
ATOM   4328 C  CD    . PRO C 1 169 ? 29.832  6.433   31.536 1.00 10.73 ? 169 PRO B CD    1 
ATOM   4329 N  N     . GLU C 1 170 ? 26.510  6.733   33.330 1.00 11.80 ? 170 GLU B N     1 
ATOM   4330 C  CA    . GLU C 1 170 ? 25.072  6.753   33.543 1.00 15.77 ? 170 GLU B CA    1 
ATOM   4331 C  C     . GLU C 1 170 ? 24.527  5.740   34.525 1.00 16.66 ? 170 GLU B C     1 
ATOM   4332 O  O     . GLU C 1 170 ? 23.485  6.023   35.196 1.00 20.95 ? 170 GLU B O     1 
ATOM   4333 C  CB    . GLU C 1 170 ? 24.317  6.518   32.280 1.00 13.88 ? 170 GLU B CB    1 
ATOM   4334 C  CG    . GLU C 1 170 ? 24.451  7.695   31.329 1.00 14.98 ? 170 GLU B CG    1 
ATOM   4335 C  CD    . GLU C 1 170 ? 25.577  7.556   30.338 1.00 15.31 ? 170 GLU B CD    1 
ATOM   4336 O  OE1   . GLU C 1 170 ? 26.599  6.985   30.721 1.00 19.52 ? 170 GLU B OE1   1 
ATOM   4337 O  OE2   . GLU C 1 170 ? 25.463  7.823   29.131 1.00 8.14  ? 170 GLU B OE2   1 
ATOM   4338 N  N     . ASN C 1 171 ? 25.323  4.698   34.796 1.00 11.41 ? 171 ASN B N     1 
ATOM   4339 C  CA    . ASN C 1 171 ? 24.924  3.629   35.752 1.00 13.06 ? 171 ASN B CA    1 
ATOM   4340 C  C     . ASN C 1 171 ? 25.677  3.722   37.012 1.00 19.30 ? 171 ASN B C     1 
ATOM   4341 O  O     . ASN C 1 171 ? 25.594  2.785   37.801 1.00 20.39 ? 171 ASN B O     1 
ATOM   4342 C  CB    . ASN C 1 171 ? 25.107  2.239   35.131 1.00 7.60  ? 171 ASN B CB    1 
ATOM   4343 C  CG    . ASN C 1 171 ? 24.080  1.897   34.051 1.00 16.85 ? 171 ASN B CG    1 
ATOM   4344 O  OD1   . ASN C 1 171 ? 22.961  2.459   33.954 1.00 13.59 ? 171 ASN B OD1   1 
ATOM   4345 N  ND2   . ASN C 1 171 ? 24.387  0.778   33.307 1.00 14.07 ? 171 ASN B ND2   1 
ATOM   4346 N  N     . LEU C 1 172 ? 26.563  4.730   37.166 1.00 17.17 ? 172 LEU B N     1 
ATOM   4347 C  CA    . LEU C 1 172 ? 27.324  4.888   38.410 1.00 20.22 ? 172 LEU B CA    1 
ATOM   4348 C  C     . LEU C 1 172 ? 26.755  6.143   39.121 1.00 20.46 ? 172 LEU B C     1 
ATOM   4349 O  O     . LEU C 1 172 ? 26.531  7.205   38.496 1.00 18.22 ? 172 LEU B O     1 
ATOM   4350 C  CB    . LEU C 1 172 ? 28.804  5.095   38.042 1.00 21.28 ? 172 LEU B CB    1 
ATOM   4351 C  CG    . LEU C 1 172 ? 29.527  4.025   37.200 1.00 18.62 ? 172 LEU B CG    1 
ATOM   4352 C  CD1   . LEU C 1 172 ? 30.942  4.490   36.981 1.00 14.28 ? 172 LEU B CD1   1 
ATOM   4353 C  CD2   . LEU C 1 172 ? 29.521  2.832   38.180 1.00 17.98 ? 172 LEU B CD2   1 
ATOM   4354 N  N     . LEU C 1 173 ? 26.409  5.992   40.380 1.00 19.10 ? 173 LEU B N     1 
ATOM   4355 C  CA    . LEU C 1 173 ? 25.780  7.117   41.126 1.00 20.20 ? 173 LEU B CA    1 
ATOM   4356 C  C     . LEU C 1 173 ? 26.721  7.557   42.196 1.00 19.29 ? 173 LEU B C     1 
ATOM   4357 O  O     . LEU C 1 173 ? 27.621  6.787   42.580 1.00 18.81 ? 173 LEU B O     1 
ATOM   4358 C  CB    . LEU C 1 173 ? 24.456  6.685   41.770 1.00 20.24 ? 173 LEU B CB    1 
ATOM   4359 C  CG    . LEU C 1 173 ? 23.399  6.185   40.780 1.00 23.04 ? 173 LEU B CG    1 
ATOM   4360 C  CD1   . LEU C 1 173 ? 22.504  5.320   41.642 1.00 18.84 ? 173 LEU B CD1   1 
ATOM   4361 C  CD2   . LEU C 1 173 ? 22.713  7.341   39.970 1.00 28.17 ? 173 LEU B CD2   1 
ATOM   4362 N  N     . ILE C 1 174 ? 26.676  8.848   42.512 1.00 21.48 ? 174 ILE B N     1 
ATOM   4363 C  CA    . ILE C 1 174 ? 27.593  9.370   43.573 1.00 22.29 ? 174 ILE B CA    1 
ATOM   4364 C  C     . ILE C 1 174 ? 26.787  9.520   44.872 1.00 20.45 ? 174 ILE B C     1 
ATOM   4365 O  O     . ILE C 1 174 ? 25.634  9.934   44.865 1.00 25.80 ? 174 ILE B O     1 
ATOM   4366 C  CB    . ILE C 1 174 ? 28.255  10.730  43.194 1.00 20.90 ? 174 ILE B CB    1 
ATOM   4367 C  CG1   . ILE C 1 174 ? 28.776  10.689  41.746 1.00 29.71 ? 174 ILE B CG1   1 
ATOM   4368 C  CG2   . ILE C 1 174 ? 29.166  11.228  44.326 1.00 24.50 ? 174 ILE B CG2   1 
ATOM   4369 C  CD1   . ILE C 1 174 ? 30.014  9.778   41.509 1.00 30.72 ? 174 ILE B CD1   1 
ATOM   4370 N  N     . ASP C 1 175 ? 27.305  8.986   45.957 1.00 15.68 ? 175 ASP B N     1 
ATOM   4371 C  CA    . ASP C 1 175 ? 26.618  9.018   47.229 1.00 23.99 ? 175 ASP B CA    1 
ATOM   4372 C  C     . ASP C 1 175 ? 26.995  10.263  48.071 1.00 24.28 ? 175 ASP B C     1 
ATOM   4373 O  O     . ASP C 1 175 ? 27.983  10.940  47.712 1.00 23.81 ? 175 ASP B O     1 
ATOM   4374 C  CB    . ASP C 1 175 ? 26.806  7.645   47.926 1.00 18.79 ? 175 ASP B CB    1 
ATOM   4375 C  CG    . ASP C 1 175 ? 28.151  7.437   48.635 1.00 28.72 ? 175 ASP B CG    1 
ATOM   4376 O  OD1   . ASP C 1 175 ? 29.084  8.255   48.800 1.00 24.37 ? 175 ASP B OD1   1 
ATOM   4377 O  OD2   . ASP C 1 175 ? 28.267  6.303   49.149 1.00 34.08 ? 175 ASP B OD2   1 
ATOM   4378 N  N     . GLN C 1 176 ? 26.484  10.289  49.302 1.00 22.30 ? 176 GLN B N     1 
ATOM   4379 C  CA    . GLN C 1 176 ? 26.669  11.426  50.206 1.00 28.93 ? 176 GLN B CA    1 
ATOM   4380 C  C     . GLN C 1 176 ? 28.121  11.646  50.711 1.00 33.78 ? 176 GLN B C     1 
ATOM   4381 O  O     . GLN C 1 176 ? 28.461  12.623  51.412 1.00 33.95 ? 176 GLN B O     1 
ATOM   4382 C  CB    . GLN C 1 176 ? 25.719  11.209  51.367 1.00 27.48 ? 176 GLN B CB    1 
ATOM   4383 C  CG    . GLN C 1 176 ? 25.286  12.451  52.108 1.00 39.02 ? 176 GLN B CG    1 
ATOM   4384 C  CD    . GLN C 1 176 ? 24.260  12.171  53.184 0.00 31.25 ? 176 GLN B CD    1 
ATOM   4385 O  OE1   . GLN C 1 176 ? 23.603  11.130  53.188 0.00 32.64 ? 176 GLN B OE1   1 
ATOM   4386 N  NE2   . GLN C 1 176 ? 24.111  13.110  54.104 0.00 32.64 ? 176 GLN B NE2   1 
ATOM   4387 N  N     . GLN C 1 177 ? 28.952  10.623  50.545 1.00 30.26 ? 177 GLN B N     1 
ATOM   4388 C  CA    . GLN C 1 177 ? 30.349  10.738  50.926 1.00 26.93 ? 177 GLN B CA    1 
ATOM   4389 C  C     . GLN C 1 177 ? 31.250  10.812  49.713 1.00 25.15 ? 177 GLN B C     1 
ATOM   4390 O  O     . GLN C 1 177 ? 32.471  10.829  49.910 1.00 29.11 ? 177 GLN B O     1 
ATOM   4391 C  CB    . GLN C 1 177 ? 30.713  9.629   51.882 1.00 35.29 ? 177 GLN B CB    1 
ATOM   4392 C  CG    . GLN C 1 177 ? 29.747  9.707   53.095 1.00 43.97 ? 177 GLN B CG    1 
ATOM   4393 C  CD    . GLN C 1 177 ? 29.960  8.653   54.117 1.00 52.33 ? 177 GLN B CD    1 
ATOM   4394 O  OE1   . GLN C 1 177 ? 30.617  7.606   53.864 1.00 57.10 ? 177 GLN B OE1   1 
ATOM   4395 N  NE2   . GLN C 1 177 ? 29.387  8.897   55.309 1.00 54.21 ? 177 GLN B NE2   1 
ATOM   4396 N  N     . GLY C 1 178 ? 30.699  10.981  48.509 1.00 15.39 ? 178 GLY B N     1 
ATOM   4397 C  CA    . GLY C 1 178 ? 31.534  11.074  47.312 1.00 20.89 ? 178 GLY B CA    1 
ATOM   4398 C  C     . GLY C 1 178 ? 32.031  9.761   46.662 1.00 27.46 ? 178 GLY B C     1 
ATOM   4399 O  O     . GLY C 1 178 ? 32.880  9.780   45.779 1.00 25.11 ? 178 GLY B O     1 
ATOM   4400 N  N     . TYR C 1 179 ? 31.536  8.600   47.128 1.00 27.10 ? 179 TYR B N     1 
ATOM   4401 C  CA    . TYR C 1 179 ? 31.822  7.265   46.588 1.00 24.90 ? 179 TYR B CA    1 
ATOM   4402 C  C     . TYR C 1 179 ? 30.748  6.844   45.605 1.00 25.93 ? 179 TYR B C     1 
ATOM   4403 O  O     . TYR C 1 179 ? 29.611  7.394   45.552 1.00 25.77 ? 179 TYR B O     1 
ATOM   4404 C  CB    . TYR C 1 179 ? 31.851  6.257   47.673 1.00 16.89 ? 179 TYR B CB    1 
ATOM   4405 C  CG    . TYR C 1 179 ? 33.065  6.409   48.520 1.00 29.66 ? 179 TYR B CG    1 
ATOM   4406 C  CD1   . TYR C 1 179 ? 33.234  7.477   49.477 1.00 30.86 ? 179 TYR B CD1   1 
ATOM   4407 C  CD2   . TYR C 1 179 ? 34.098  5.486   48.372 1.00 25.85 ? 179 TYR B CD2   1 
ATOM   4408 C  CE1   . TYR C 1 179 ? 34.445  7.593   50.237 1.00 32.65 ? 179 TYR B CE1   1 
ATOM   4409 C  CE2   . TYR C 1 179 ? 35.314  5.606   49.122 1.00 27.35 ? 179 TYR B CE2   1 
ATOM   4410 C  CZ    . TYR C 1 179 ? 35.488  6.655   50.027 1.00 30.99 ? 179 TYR B CZ    1 
ATOM   4411 O  OH    . TYR C 1 179 ? 36.748  6.703   50.570 1.00 27.38 ? 179 TYR B OH    1 
ATOM   4412 N  N     . ILE C 1 180 ? 31.133  5.825   44.851 1.00 19.86 ? 180 ILE B N     1 
ATOM   4413 C  CA    . ILE C 1 180 ? 30.305  5.225   43.817 1.00 21.31 ? 180 ILE B CA    1 
ATOM   4414 C  C     . ILE C 1 180 ? 29.349  4.109   44.341 1.00 18.55 ? 180 ILE B C     1 
ATOM   4415 O  O     . ILE C 1 180 ? 29.507  3.529   45.407 1.00 21.56 ? 180 ILE B O     1 
ATOM   4416 C  CB    . ILE C 1 180 ? 31.278  4.671   42.722 1.00 29.01 ? 180 ILE B CB    1 
ATOM   4417 C  CG1   . ILE C 1 180 ? 31.921  5.836   41.977 1.00 30.34 ? 180 ILE B CG1   1 
ATOM   4418 C  CG2   . ILE C 1 180 ? 30.654  3.560   41.788 1.00 28.48 ? 180 ILE B CG2   1 
ATOM   4419 C  CD1   . ILE C 1 180 ? 33.044  5.280   41.177 1.00 38.93 ? 180 ILE B CD1   1 
ATOM   4420 N  N     . GLN C 1 181 ? 28.178  4.090   43.728 1.00 18.34 ? 181 GLN B N     1 
ATOM   4421 C  CA    . GLN C 1 181 ? 27.173  3.101   43.878 1.00 15.87 ? 181 GLN B CA    1 
ATOM   4422 C  C     . GLN C 1 181 ? 26.755  2.729   42.468 1.00 19.97 ? 181 GLN B C     1 
ATOM   4423 O  O     . GLN C 1 181 ? 26.166  3.498   41.676 1.00 20.54 ? 181 GLN B O     1 
ATOM   4424 C  CB    . GLN C 1 181 ? 26.007  3.601   44.662 1.00 25.10 ? 181 GLN B CB    1 
ATOM   4425 C  CG    . GLN C 1 181 ? 26.469  4.083   45.985 1.00 28.86 ? 181 GLN B CG    1 
ATOM   4426 C  CD    . GLN C 1 181 ? 26.422  2.980   46.996 1.00 34.03 ? 181 GLN B CD    1 
ATOM   4427 O  OE1   . GLN C 1 181 ? 25.363  2.395   47.187 1.00 34.47 ? 181 GLN B OE1   1 
ATOM   4428 N  NE2   . GLN C 1 181 ? 27.554  2.674   47.626 1.00 33.00 ? 181 GLN B NE2   1 
ATOM   4429 N  N     . VAL C 1 182 ? 27.150  1.507   42.102 1.00 19.23 ? 182 VAL B N     1 
ATOM   4430 C  CA    . VAL C 1 182 ? 26.756  0.909   40.811 1.00 13.76 ? 182 VAL B CA    1 
ATOM   4431 C  C     . VAL C 1 182 ? 25.243  0.518   40.885 1.00 15.48 ? 182 VAL B C     1 
ATOM   4432 O  O     . VAL C 1 182 ? 24.756  -0.183  41.817 1.00 16.80 ? 182 VAL B O     1 
ATOM   4433 C  CB    . VAL C 1 182 ? 27.649  -0.381  40.531 1.00 17.91 ? 182 VAL B CB    1 
ATOM   4434 C  CG1   . VAL C 1 182 ? 27.452  -0.853  39.117 1.00 15.99 ? 182 VAL B CG1   1 
ATOM   4435 C  CG2   . VAL C 1 182 ? 29.108  -0.066  40.696 1.00 17.55 ? 182 VAL B CG2   1 
ATOM   4436 N  N     . THR C 1 183 ? 24.540  0.875   39.817 1.00 12.31 ? 183 THR B N     1 
ATOM   4437 C  CA    . THR C 1 183 ? 23.143  0.525   39.672 1.00 16.72 ? 183 THR B CA    1 
ATOM   4438 C  C     . THR C 1 183 ? 23.016  -0.235  38.331 1.00 18.82 ? 183 THR B C     1 
ATOM   4439 O  O     . THR C 1 183 ? 24.022  -0.555  37.703 1.00 15.34 ? 183 THR B O     1 
ATOM   4440 C  CB    . THR C 1 183 ? 22.197  1.763   39.797 1.00 19.25 ? 183 THR B CB    1 
ATOM   4441 O  OG1   . THR C 1 183 ? 20.831  1.313   39.907 1.00 15.98 ? 183 THR B OG1   1 
ATOM   4442 C  CG2   . THR C 1 183 ? 22.254  2.649   38.488 1.00 11.89 ? 183 THR B CG2   1 
ATOM   4443 N  N     . ASP C 1 184 ? 21.778  -0.512  37.901 1.00 18.96 ? 184 ASP B N     1 
ATOM   4444 C  CA    . ASP C 1 184 ? 21.456  -1.227  36.677 1.00 24.73 ? 184 ASP B CA    1 
ATOM   4445 C  C     . ASP C 1 184 ? 22.201  -2.567  36.505 1.00 28.08 ? 184 ASP B C     1 
ATOM   4446 O  O     . ASP C 1 184 ? 23.219  -2.636  35.802 1.00 22.27 ? 184 ASP B O     1 
ATOM   4447 C  CB    . ASP C 1 184 ? 21.628  -0.378  35.422 1.00 14.82 ? 184 ASP B CB    1 
ATOM   4448 C  CG    . ASP C 1 184 ? 20.849  -0.845  34.254 1.00 15.91 ? 184 ASP B CG    1 
ATOM   4449 O  OD1   . ASP C 1 184 ? 20.091  -1.788  34.114 1.00 15.99 ? 184 ASP B OD1   1 
ATOM   4450 O  OD2   . ASP C 1 184 ? 21.108  -0.291  33.202 1.00 20.79 ? 184 ASP B OD2   1 
ATOM   4451 N  N     . PHE C 1 185 ? 21.715  -3.564  37.260 1.00 27.04 ? 185 PHE B N     1 
ATOM   4452 C  CA    . PHE C 1 185 ? 22.134  -4.943  37.039 1.00 25.81 ? 185 PHE B CA    1 
ATOM   4453 C  C     . PHE C 1 185 ? 21.316  -5.605  35.906 1.00 25.26 ? 185 PHE B C     1 
ATOM   4454 O  O     . PHE C 1 185 ? 21.392  -6.812  35.857 1.00 26.38 ? 185 PHE B O     1 
ATOM   4455 C  CB    . PHE C 1 185 ? 22.161  -5.740  38.331 1.00 20.92 ? 185 PHE B CB    1 
ATOM   4456 C  CG    . PHE C 1 185 ? 23.365  -5.489  39.158 1.00 27.74 ? 185 PHE B CG    1 
ATOM   4457 C  CD1   . PHE C 1 185 ? 23.654  -4.199  39.694 1.00 26.69 ? 185 PHE B CD1   1 
ATOM   4458 C  CD2   . PHE C 1 185 ? 24.246  -6.562  39.431 1.00 26.81 ? 185 PHE B CD2   1 
ATOM   4459 C  CE1   . PHE C 1 185 ? 24.800  -4.018  40.478 1.00 32.52 ? 185 PHE B CE1   1 
ATOM   4460 C  CE2   . PHE C 1 185 ? 25.426  -6.386  40.230 1.00 31.26 ? 185 PHE B CE2   1 
ATOM   4461 C  CZ    . PHE C 1 185 ? 25.698  -5.132  40.746 1.00 30.60 ? 185 PHE B CZ    1 
ATOM   4462 N  N     . GLY C 1 186 ? 20.598  -4.884  35.012 1.00 17.93 ? 186 GLY B N     1 
ATOM   4463 C  CA    . GLY C 1 186 ? 19.837  -5.445  33.889 1.00 15.68 ? 186 GLY B CA    1 
ATOM   4464 C  C     . GLY C 1 186 ? 20.533  -6.482  32.996 1.00 18.26 ? 186 GLY B C     1 
ATOM   4465 O  O     . GLY C 1 186 ? 19.832  -7.129  32.247 1.00 17.67 ? 186 GLY B O     1 
ATOM   4466 N  N     . PHE C 1 187 ? 21.866  -6.416  32.840 1.00 15.31 ? 187 PHE B N     1 
ATOM   4467 C  CA    . PHE C 1 187 ? 22.623  -7.295  31.999 1.00 16.74 ? 187 PHE B CA    1 
ATOM   4468 C  C     . PHE C 1 187 ? 23.524  -8.196  32.830 1.00 14.50 ? 187 PHE B C     1 
ATOM   4469 O  O     . PHE C 1 187 ? 24.253  -8.956  32.234 1.00 22.81 ? 187 PHE B O     1 
ATOM   4470 C  CB    . PHE C 1 187 ? 23.466  -6.578  30.943 1.00 15.57 ? 187 PHE B CB    1 
ATOM   4471 C  CG    . PHE C 1 187 ? 22.704  -5.802  29.991 1.00 20.73 ? 187 PHE B CG    1 
ATOM   4472 C  CD1   . PHE C 1 187 ? 21.370  -6.162  29.674 1.00 23.66 ? 187 PHE B CD1   1 
ATOM   4473 C  CD2   . PHE C 1 187 ? 23.334  -4.738  29.317 1.00 12.85 ? 187 PHE B CD2   1 
ATOM   4474 C  CE1   . PHE C 1 187 ? 20.643  -5.436  28.673 1.00 16.54 ? 187 PHE B CE1   1 
ATOM   4475 C  CE2   . PHE C 1 187 ? 22.638  -4.054  28.350 1.00 15.00 ? 187 PHE B CE2   1 
ATOM   4476 C  CZ    . PHE C 1 187 ? 21.290  -4.383  28.028 1.00 20.40 ? 187 PHE B CZ    1 
ATOM   4477 N  N     . ALA C 1 188 ? 23.644  -8.036  34.130 1.00 15.35 ? 188 ALA B N     1 
ATOM   4478 C  CA    . ALA C 1 188 ? 24.363  -8.943  35.001 1.00 18.06 ? 188 ALA B CA    1 
ATOM   4479 C  C     . ALA C 1 188 ? 23.924  -10.438 34.832 1.00 21.97 ? 188 ALA B C     1 
ATOM   4480 O  O     . ALA C 1 188 ? 22.747  -10.789 34.493 1.00 16.32 ? 188 ALA B O     1 
ATOM   4481 C  CB    . ALA C 1 188 ? 24.116  -8.507  36.394 1.00 15.68 ? 188 ALA B CB    1 
ATOM   4482 N  N     . LYS C 1 189 ? 24.914  -11.328 34.834 1.00 24.69 ? 189 LYS B N     1 
ATOM   4483 C  CA    . LYS C 1 189 ? 24.596  -12.755 34.603 1.00 23.94 ? 189 LYS B CA    1 
ATOM   4484 C  C     . LYS C 1 189 ? 25.642  -13.651 35.237 1.00 23.97 ? 189 LYS B C     1 
ATOM   4485 O  O     . LYS C 1 189 ? 26.798  -13.198 35.258 1.00 20.38 ? 189 LYS B O     1 
ATOM   4486 C  CB    . LYS C 1 189 ? 24.529  -12.971 33.074 1.00 29.91 ? 189 LYS B CB    1 
ATOM   4487 C  CG    . LYS C 1 189 ? 24.129  -14.377 32.627 1.00 28.63 ? 189 LYS B CG    1 
ATOM   4488 C  CD    . LYS C 1 189 ? 24.717  -14.689 31.271 1.00 21.60 ? 189 LYS B CD    1 
ATOM   4489 C  CE    . LYS C 1 189 ? 24.058  -16.048 30.835 1.00 19.42 ? 189 LYS B CE    1 
ATOM   4490 N  NZ    . LYS C 1 189 ? 23.521  -16.133 29.455 1.00 15.11 ? 189 LYS B NZ    1 
ATOM   4491 N  N     . ARG C 1 190 ? 25.201  -14.693 35.979 1.00 21.14 ? 190 ARG B N     1 
ATOM   4492 C  CA    . ARG C 1 190 ? 26.076  -15.715 36.565 1.00 21.38 ? 190 ARG B CA    1 
ATOM   4493 C  C     . ARG C 1 190 ? 26.367  -16.781 35.486 1.00 24.28 ? 190 ARG B C     1 
ATOM   4494 O  O     . ARG C 1 190 ? 25.493  -17.344 34.801 1.00 26.10 ? 190 ARG B O     1 
ATOM   4495 C  CB    . ARG C 1 190 ? 25.503  -16.295 37.822 1.00 17.85 ? 190 ARG B CB    1 
ATOM   4496 C  CG    . ARG C 1 190 ? 26.554  -16.885 38.719 1.00 18.55 ? 190 ARG B CG    1 
ATOM   4497 C  CD    . ARG C 1 190 ? 25.988  -17.146 40.073 1.00 21.45 ? 190 ARG B CD    1 
ATOM   4498 N  NE    . ARG C 1 190 ? 27.011  -17.847 40.807 1.00 27.35 ? 190 ARG B NE    1 
ATOM   4499 C  CZ    . ARG C 1 190 ? 26.975  -19.155 41.113 1.00 35.18 ? 190 ARG B CZ    1 
ATOM   4500 N  NH1   . ARG C 1 190 ? 25.849  -19.876 41.109 1.00 31.58 ? 190 ARG B NH1   1 
ATOM   4501 N  NH2   . ARG C 1 190 ? 28.007  -19.714 41.720 1.00 32.24 ? 190 ARG B NH2   1 
ATOM   4502 N  N     . VAL C 1 191 ? 27.625  -16.820 35.103 1.00 26.08 ? 191 VAL B N     1 
ATOM   4503 C  CA    . VAL C 1 191 ? 28.021  -17.670 33.989 1.00 27.65 ? 191 VAL B CA    1 
ATOM   4504 C  C     . VAL C 1 191 ? 29.532  -17.987 34.109 1.00 30.34 ? 191 VAL B C     1 
ATOM   4505 O  O     . VAL C 1 191 ? 30.362  -17.118 34.518 1.00 24.99 ? 191 VAL B O     1 
ATOM   4506 C  CB    . VAL C 1 191 ? 27.546  -17.080 32.666 1.00 28.92 ? 191 VAL B CB    1 
ATOM   4507 C  CG1   . VAL C 1 191 ? 28.231  -15.777 32.457 1.00 35.40 ? 191 VAL B CG1   1 
ATOM   4508 C  CG2   . VAL C 1 191 ? 27.848  -18.004 31.505 1.00 32.01 ? 191 VAL B CG2   1 
ATOM   4509 N  N     . LYS C 1 192 ? 29.653  -19.322 34.239 1.00 28.38 ? 192 LYS B N     1 
ATOM   4510 C  CA    . LYS C 1 192 ? 30.862  -20.110 34.427 1.00 29.74 ? 192 LYS B CA    1 
ATOM   4511 C  C     . LYS C 1 192 ? 31.696  -20.160 33.133 1.00 32.19 ? 192 LYS B C     1 
ATOM   4512 O  O     . LYS C 1 192 ? 32.923  -20.049 33.217 1.00 40.84 ? 192 LYS B O     1 
ATOM   4513 C  CB    . LYS C 1 192 ? 30.444  -21.488 34.943 1.00 31.13 ? 192 LYS B CB    1 
ATOM   4514 C  CG    . LYS C 1 192 ? 30.297  -21.553 36.438 1.00 32.19 ? 192 LYS B CG    1 
ATOM   4515 C  CD    . LYS C 1 192 ? 31.647  -21.578 37.097 1.00 34.95 ? 192 LYS B CD    1 
ATOM   4516 C  CE    . LYS C 1 192 ? 31.675  -22.550 38.293 1.00 45.06 ? 192 LYS B CE    1 
ATOM   4517 N  NZ    . LYS C 1 192 ? 30.544  -22.275 39.255 1.00 44.41 ? 192 LYS B NZ    1 
ATOM   4518 N  N     . GLY C 1 193 ? 31.091  -20.279 31.968 1.00 20.87 ? 193 GLY B N     1 
ATOM   4519 C  CA    . GLY C 1 193 ? 31.933  -20.154 30.811 1.00 25.39 ? 193 GLY B CA    1 
ATOM   4520 C  C     . GLY C 1 193 ? 31.843  -18.857 30.041 1.00 31.43 ? 193 GLY B C     1 
ATOM   4521 O  O     . GLY C 1 193 ? 31.904  -17.752 30.588 1.00 34.23 ? 193 GLY B O     1 
ATOM   4522 N  N     . ARG C 1 194 ? 31.468  -19.065 28.793 1.00 25.76 ? 194 ARG B N     1 
ATOM   4523 C  CA    . ARG C 1 194 ? 31.313  -18.081 27.755 1.00 29.40 ? 194 ARG B CA    1 
ATOM   4524 C  C     . ARG C 1 194 ? 29.852  -17.686 27.623 1.00 27.67 ? 194 ARG B C     1 
ATOM   4525 O  O     . ARG C 1 194 ? 28.987  -18.520 27.832 1.00 23.30 ? 194 ARG B O     1 
ATOM   4526 C  CB    . ARG C 1 194 ? 31.683  -18.709 26.411 1.00 30.48 ? 194 ARG B CB    1 
ATOM   4527 C  CG    . ARG C 1 194 ? 33.047  -18.310 25.884 1.00 38.95 ? 194 ARG B CG    1 
ATOM   4528 C  CD    . ARG C 1 194 ? 33.194  -18.923 24.471 1.00 42.09 ? 194 ARG B CD    1 
ATOM   4529 N  NE    . ARG C 1 194 ? 33.201  -20.389 24.476 1.00 45.00 ? 194 ARG B NE    1 
ATOM   4530 C  CZ    . ARG C 1 194 ? 34.089  -21.143 23.825 1.00 50.01 ? 194 ARG B CZ    1 
ATOM   4531 N  NH1   . ARG C 1 194 ? 35.043  -20.598 23.076 1.00 57.58 ? 194 ARG B NH1   1 
ATOM   4532 N  NH2   . ARG C 1 194 ? 34.153  -22.443 24.074 1.00 52.28 ? 194 ARG B NH2   1 
ATOM   4533 N  N     . THR C 1 195 ? 29.621  -16.557 26.946 1.00 21.91 ? 195 THR B N     1 
ATOM   4534 C  CA    . THR C 1 195 ? 28.288  -16.017 26.761 1.00 17.70 ? 195 THR B CA    1 
ATOM   4535 C  C     . THR C 1 195 ? 28.243  -15.321 25.462 1.00 15.25 ? 195 THR B C     1 
ATOM   4536 O  O     . THR C 1 195 ? 29.225  -15.199 24.781 1.00 16.37 ? 195 THR B O     1 
ATOM   4537 C  CB    . THR C 1 195 ? 27.657  -15.336 28.040 1.00 27.72 ? 195 THR B CB    1 
ATOM   4538 O  OG1   . THR C 1 195 ? 26.247  -15.276 27.841 1.00 28.83 ? 195 THR B OG1   1 
ATOM   4539 C  CG2   . THR C 1 195 ? 28.143  -13.937 28.229 1.00 20.23 ? 195 THR B CG2   1 
ATOM   4540 N  N     . TRP C 1 196 ? 27.052  -15.233 24.906 1.00 16.70 ? 196 TRP B N     1 
ATOM   4541 C  CA    . TRP C 1 196 ? 26.893  -14.779 23.524 1.00 14.31 ? 196 TRP B CA    1 
ATOM   4542 C  C     . TRP C 1 196 ? 25.967  -13.624 23.278 1.00 14.87 ? 196 TRP B C     1 
ATOM   4543 O  O     . TRP C 1 196 ? 25.861  -13.219 22.105 1.00 17.55 ? 196 TRP B O     1 
ATOM   4544 C  CB    . TRP C 1 196 ? 26.290  -15.981 22.705 1.00 19.62 ? 196 TRP B CB    1 
ATOM   4545 C  CG    . TRP C 1 196 ? 27.415  -17.037 22.347 1.00 25.22 ? 196 TRP B CG    1 
ATOM   4546 C  CD1   . TRP C 1 196 ? 28.350  -16.963 21.328 1.00 20.97 ? 196 TRP B CD1   1 
ATOM   4547 C  CD2   . TRP C 1 196 ? 27.793  -18.144 23.151 1.00 19.18 ? 196 TRP B CD2   1 
ATOM   4548 N  NE1   . TRP C 1 196 ? 29.308  -17.941 21.503 1.00 30.27 ? 196 TRP B NE1   1 
ATOM   4549 C  CE2   . TRP C 1 196 ? 28.992  -18.671 22.616 1.00 24.19 ? 196 TRP B CE2   1 
ATOM   4550 C  CE3   . TRP C 1 196 ? 27.222  -18.751 24.282 1.00 31.01 ? 196 TRP B CE3   1 
ATOM   4551 C  CZ2   . TRP C 1 196 ? 29.651  -19.766 23.180 1.00 31.01 ? 196 TRP B CZ2   1 
ATOM   4552 C  CZ3   . TRP C 1 196 ? 27.879  -19.901 24.885 1.00 36.15 ? 196 TRP B CZ3   1 
ATOM   4553 C  CH2   . TRP C 1 196 ? 29.099  -20.385 24.311 1.00 34.44 ? 196 TRP B CH2   1 
HETATM 4554 N  N     . TPO C 1 197 ? 25.279  -13.124 24.326 1.00 16.50 ? 197 TPO B N     1 
HETATM 4555 C  CA    . TPO C 1 197 ? 24.208  -12.154 23.972 1.00 16.79 ? 197 TPO B CA    1 
HETATM 4556 C  CB    . TPO C 1 197 ? 23.194  -11.989 25.119 1.00 20.98 ? 197 TPO B CB    1 
HETATM 4557 C  CG2   . TPO C 1 197 ? 21.954  -11.273 24.606 1.00 19.13 ? 197 TPO B CG2   1 
HETATM 4558 O  OG1   . TPO C 1 197 ? 22.981  -13.194 25.852 1.00 11.07 ? 197 TPO B OG1   1 
HETATM 4559 P  P     . TPO C 1 197 ? 23.168  -13.544 27.269 1.00 20.13 ? 197 TPO B P     1 
HETATM 4560 O  O1P   . TPO C 1 197 ? 22.668  -14.905 27.448 1.00 25.67 ? 197 TPO B O1P   1 
HETATM 4561 O  O2P   . TPO C 1 197 ? 22.577  -12.577 28.293 1.00 18.31 ? 197 TPO B O2P   1 
HETATM 4562 O  O3P   . TPO C 1 197 ? 24.622  -13.604 27.093 1.00 16.63 ? 197 TPO B O3P   1 
HETATM 4563 C  C     . TPO C 1 197 ? 24.817  -10.812 23.562 1.00 12.91 ? 197 TPO B C     1 
HETATM 4564 O  O     . TPO C 1 197 ? 25.714  -10.340 24.246 1.00 20.16 ? 197 TPO B O     1 
ATOM   4565 N  N     . LEU C 1 198 ? 24.262  -10.192 22.541 1.00 16.65 ? 198 LEU B N     1 
ATOM   4566 C  CA    . LEU C 1 198 ? 24.688  -8.906  22.069 1.00 20.11 ? 198 LEU B CA    1 
ATOM   4567 C  C     . LEU C 1 198 ? 24.019  -7.955  23.035 1.00 21.62 ? 198 LEU B C     1 
ATOM   4568 O  O     . LEU C 1 198 ? 22.814  -7.740  22.913 1.00 26.24 ? 198 LEU B O     1 
ATOM   4569 C  CB    . LEU C 1 198 ? 24.143  -8.579  20.658 1.00 27.88 ? 198 LEU B CB    1 
ATOM   4570 C  CG    . LEU C 1 198 ? 24.450  -7.116  20.206 1.00 32.02 ? 198 LEU B CG    1 
ATOM   4571 C  CD1   . LEU C 1 198 ? 25.894  -6.737  20.432 1.00 23.09 ? 198 LEU B CD1   1 
ATOM   4572 C  CD2   . LEU C 1 198 ? 24.050  -6.792  18.813 1.00 30.57 ? 198 LEU B CD2   1 
ATOM   4573 N  N     . CYS C 1 199 ? 24.781  -7.413  23.972 1.00 17.10 ? 199 CYS B N     1 
ATOM   4574 C  CA    . CYS C 1 199 ? 24.196  -6.411  24.862 1.00 21.40 ? 199 CYS B CA    1 
ATOM   4575 C  C     . CYS C 1 199 ? 25.235  -5.465  25.472 1.00 17.45 ? 199 CYS B C     1 
ATOM   4576 O  O     . CYS C 1 199 ? 26.381  -5.884  25.678 1.00 20.47 ? 199 CYS B O     1 
ATOM   4577 C  CB    . CYS C 1 199 ? 23.375  -7.092  25.969 1.00 12.08 ? 199 CYS B CB    1 
ATOM   4578 S  SG    . CYS C 1 199 ? 24.235  -8.065  27.143 1.00 21.35 ? 199 CYS B SG    1 
ATOM   4579 N  N     . GLY C 1 200 ? 24.739  -4.306  25.933 1.00 23.18 ? 200 GLY B N     1 
ATOM   4580 C  CA    . GLY C 1 200 ? 25.481  -3.188  26.575 1.00 26.77 ? 200 GLY B CA    1 
ATOM   4581 C  C     . GLY C 1 200 ? 25.034  -1.794  26.080 1.00 25.82 ? 200 GLY B C     1 
ATOM   4582 O  O     . GLY C 1 200 ? 23.905  -1.612  25.590 1.00 22.94 ? 200 GLY B O     1 
ATOM   4583 N  N     . THR C 1 201 ? 26.008  -0.909  25.910 1.00 25.35 ? 201 THR B N     1 
ATOM   4584 C  CA    . THR C 1 201 ? 25.810  0.504   25.431 1.00 22.37 ? 201 THR B CA    1 
ATOM   4585 C  C     . THR C 1 201 ? 26.951  0.642   24.439 1.00 20.35 ? 201 THR B C     1 
ATOM   4586 O  O     . THR C 1 201 ? 28.124  0.362   24.830 1.00 17.38 ? 201 THR B O     1 
ATOM   4587 C  CB    . THR C 1 201 ? 25.961  1.497   26.619 1.00 23.10 ? 201 THR B CB    1 
ATOM   4588 O  OG1   . THR C 1 201 ? 25.038  1.084   27.635 1.00 21.64 ? 201 THR B OG1   1 
ATOM   4589 C  CG2   . THR C 1 201 ? 25.722  2.960   26.195 1.00 16.62 ? 201 THR B CG2   1 
ATOM   4590 N  N     . PRO C 1 202 ? 26.644  1.164   23.230 1.00 19.22 ? 202 PRO B N     1 
ATOM   4591 C  CA    . PRO C 1 202 ? 27.614  1.295   22.142 1.00 19.59 ? 202 PRO B CA    1 
ATOM   4592 C  C     . PRO C 1 202 ? 29.082  1.606   22.393 1.00 22.54 ? 202 PRO B C     1 
ATOM   4593 O  O     . PRO C 1 202 ? 29.935  0.719   22.185 1.00 23.62 ? 202 PRO B O     1 
ATOM   4594 C  CB    . PRO C 1 202 ? 26.921  2.260   21.159 1.00 18.89 ? 202 PRO B CB    1 
ATOM   4595 C  CG    . PRO C 1 202 ? 25.460  1.973   21.354 1.00 16.87 ? 202 PRO B CG    1 
ATOM   4596 C  CD    . PRO C 1 202 ? 25.446  1.951   22.862 1.00 17.16 ? 202 PRO B CD    1 
ATOM   4597 N  N     . GLU C 1 203 ? 29.326  2.699   23.134 1.00 18.23 ? 203 GLU B N     1 
ATOM   4598 C  CA    . GLU C 1 203 ? 30.675  3.216   23.309 1.00 19.63 ? 203 GLU B CA    1 
ATOM   4599 C  C     . GLU C 1 203 ? 31.523  2.254   24.175 1.00 20.90 ? 203 GLU B C     1 
ATOM   4600 O  O     . GLU C 1 203 ? 32.766  2.382   24.261 1.00 15.04 ? 203 GLU B O     1 
ATOM   4601 C  CB    . GLU C 1 203 ? 30.580  4.603   23.968 1.00 23.29 ? 203 GLU B CB    1 
ATOM   4602 C  CG    . GLU C 1 203 ? 30.259  5.788   23.108 1.00 19.10 ? 203 GLU B CG    1 
ATOM   4603 C  CD    . GLU C 1 203 ? 28.823  6.010   22.855 1.00 26.41 ? 203 GLU B CD    1 
ATOM   4604 O  OE1   . GLU C 1 203 ? 27.959  5.226   23.296 1.00 26.01 ? 203 GLU B OE1   1 
ATOM   4605 O  OE2   . GLU C 1 203 ? 28.506  6.983   22.136 1.00 27.53 ? 203 GLU B OE2   1 
ATOM   4606 N  N     . TYR C 1 204 ? 30.840  1.501   25.066 1.00 22.50 ? 204 TYR B N     1 
ATOM   4607 C  CA    . TYR C 1 204 ? 31.541  0.612   26.011 1.00 14.66 ? 204 TYR B CA    1 
ATOM   4608 C  C     . TYR C 1 204 ? 31.665  -0.904  25.587 1.00 17.41 ? 204 TYR B C     1 
ATOM   4609 O  O     . TYR C 1 204 ? 32.273  -1.705  26.335 1.00 14.34 ? 204 TYR B O     1 
ATOM   4610 C  CB    . TYR C 1 204 ? 30.872  0.754   27.350 1.00 9.61  ? 204 TYR B CB    1 
ATOM   4611 C  CG    . TYR C 1 204 ? 31.246  2.036   28.049 1.00 16.94 ? 204 TYR B CG    1 
ATOM   4612 C  CD1   . TYR C 1 204 ? 30.731  3.329   27.612 1.00 21.67 ? 204 TYR B CD1   1 
ATOM   4613 C  CD2   . TYR C 1 204 ? 32.168  2.023   29.099 1.00 17.07 ? 204 TYR B CD2   1 
ATOM   4614 C  CE1   . TYR C 1 204 ? 31.152  4.561   28.250 1.00 9.99  ? 204 TYR B CE1   1 
ATOM   4615 C  CE2   . TYR C 1 204 ? 32.605  3.235   29.695 1.00 17.96 ? 204 TYR B CE2   1 
ATOM   4616 C  CZ    . TYR C 1 204 ? 32.074  4.485   29.237 1.00 15.95 ? 204 TYR B CZ    1 
ATOM   4617 O  OH    . TYR C 1 204 ? 32.564  5.644   29.811 1.00 20.40 ? 204 TYR B OH    1 
ATOM   4618 N  N     . LEU C 1 205 ? 31.185  -1.240  24.386 1.00 16.48 ? 205 LEU B N     1 
ATOM   4619 C  CA    . LEU C 1 205 ? 31.196  -2.611  23.864 1.00 24.58 ? 205 LEU B CA    1 
ATOM   4620 C  C     . LEU C 1 205 ? 32.570  -3.118  23.486 1.00 19.86 ? 205 LEU B C     1 
ATOM   4621 O  O     . LEU C 1 205 ? 33.076  -2.554  22.550 1.00 21.51 ? 205 LEU B O     1 
ATOM   4622 C  CB    . LEU C 1 205 ? 30.283  -2.839  22.653 1.00 20.67 ? 205 LEU B CB    1 
ATOM   4623 C  CG    . LEU C 1 205 ? 28.774  -2.760  22.822 1.00 23.26 ? 205 LEU B CG    1 
ATOM   4624 C  CD1   . LEU C 1 205 ? 28.153  -2.949  21.510 1.00 17.08 ? 205 LEU B CD1   1 
ATOM   4625 C  CD2   . LEU C 1 205 ? 28.253  -3.701  23.909 1.00 18.84 ? 205 LEU B CD2   1 
ATOM   4626 N  N     . ALA C 1 206 ? 33.057  -4.190  24.127 1.00 21.61 ? 206 ALA B N     1 
ATOM   4627 C  CA    . ALA C 1 206 ? 34.327  -4.899  23.821 1.00 22.18 ? 206 ALA B CA    1 
ATOM   4628 C  C     . ALA C 1 206 ? 34.226  -5.459  22.426 1.00 19.64 ? 206 ALA B C     1 
ATOM   4629 O  O     . ALA C 1 206 ? 33.071  -5.662  21.973 1.00 20.73 ? 206 ALA B O     1 
ATOM   4630 C  CB    . ALA C 1 206 ? 34.610  -6.046  24.807 1.00 23.26 ? 206 ALA B CB    1 
ATOM   4631 N  N     . PRO C 1 207 ? 35.343  -5.427  21.612 1.00 20.70 ? 207 PRO B N     1 
ATOM   4632 C  CA    . PRO C 1 207 ? 35.265  -5.991  20.243 1.00 18.55 ? 207 PRO B CA    1 
ATOM   4633 C  C     . PRO C 1 207 ? 34.755  -7.445  20.135 1.00 21.31 ? 207 PRO B C     1 
ATOM   4634 O  O     . PRO C 1 207 ? 34.006  -7.700  19.216 1.00 26.48 ? 207 PRO B O     1 
ATOM   4635 C  CB    . PRO C 1 207 ? 36.662  -5.916  19.702 1.00 21.61 ? 207 PRO B CB    1 
ATOM   4636 C  CG    . PRO C 1 207 ? 37.497  -5.274  20.756 1.00 23.53 ? 207 PRO B CG    1 
ATOM   4637 C  CD    . PRO C 1 207 ? 36.728  -5.164  22.022 1.00 22.06 ? 207 PRO B CD    1 
ATOM   4638 N  N     . GLU C 1 208 ? 34.999  -8.318  21.136 1.00 21.73 ? 208 GLU B N     1 
ATOM   4639 C  CA    . GLU C 1 208 ? 34.482  -9.704  21.091 1.00 24.45 ? 208 GLU B CA    1 
ATOM   4640 C  C     . GLU C 1 208 ? 32.959  -9.715  21.121 1.00 23.94 ? 208 GLU B C     1 
ATOM   4641 O  O     . GLU C 1 208 ? 32.406  -10.412 20.303 1.00 21.77 ? 208 GLU B O     1 
ATOM   4642 C  CB    . GLU C 1 208 ? 35.107  -10.650 22.118 1.00 14.84 ? 208 GLU B CB    1 
ATOM   4643 C  CG    . GLU C 1 208 ? 35.028  -10.166 23.537 1.00 13.49 ? 208 GLU B CG    1 
ATOM   4644 C  CD    . GLU C 1 208 ? 36.176  -9.296  23.982 1.00 15.66 ? 208 GLU B CD    1 
ATOM   4645 O  OE1   . GLU C 1 208 ? 36.805  -8.602  23.174 1.00 17.61 ? 208 GLU B OE1   1 
ATOM   4646 O  OE2   . GLU C 1 208 ? 36.398  -9.261  25.189 1.00 13.74 ? 208 GLU B OE2   1 
ATOM   4647 N  N     . ILE C 1 209 ? 32.324  -8.741  21.800 1.00 22.52 ? 209 ILE B N     1 
ATOM   4648 C  CA    . ILE C 1 209 ? 30.862  -8.622  21.708 1.00 23.74 ? 209 ILE B CA    1 
ATOM   4649 C  C     . ILE C 1 209 ? 30.375  -8.331  20.304 1.00 20.89 ? 209 ILE B C     1 
ATOM   4650 O  O     . ILE C 1 209 ? 29.513  -9.003  19.763 1.00 21.18 ? 209 ILE B O     1 
ATOM   4651 C  CB    . ILE C 1 209 ? 30.202  -7.646  22.753 1.00 21.86 ? 209 ILE B CB    1 
ATOM   4652 C  CG1   . ILE C 1 209 ? 30.649  -8.070  24.116 1.00 18.59 ? 209 ILE B CG1   1 
ATOM   4653 C  CG2   . ILE C 1 209 ? 28.676  -7.629  22.598 1.00 20.64 ? 209 ILE B CG2   1 
ATOM   4654 C  CD1   . ILE C 1 209 ? 30.113  -7.244  25.194 1.00 31.71 ? 209 ILE B CD1   1 
ATOM   4655 N  N     . ILE C 1 210 ? 30.981  -7.331  19.689 1.00 26.62 ? 210 ILE B N     1 
ATOM   4656 C  CA    . ILE C 1 210 ? 30.646  -6.896  18.328 1.00 30.16 ? 210 ILE B CA    1 
ATOM   4657 C  C     . ILE C 1 210 ? 30.871  -7.963  17.255 1.00 28.22 ? 210 ILE B C     1 
ATOM   4658 O  O     . ILE C 1 210 ? 30.121  -7.996  16.301 1.00 34.97 ? 210 ILE B O     1 
ATOM   4659 C  CB    . ILE C 1 210 ? 31.480  -5.579  17.968 1.00 33.70 ? 210 ILE B CB    1 
ATOM   4660 C  CG1   . ILE C 1 210 ? 31.061  -4.383  18.836 1.00 33.26 ? 210 ILE B CG1   1 
ATOM   4661 C  CG2   . ILE C 1 210 ? 31.425  -5.204  16.481 1.00 36.64 ? 210 ILE B CG2   1 
ATOM   4662 C  CD1   . ILE C 1 210 ? 32.212  -3.409  18.967 1.00 26.90 ? 210 ILE B CD1   1 
ATOM   4663 N  N     . LEU C 1 211 ? 31.941  -8.752  17.372 1.00 31.38 ? 211 LEU B N     1 
ATOM   4664 C  CA    . LEU C 1 211 ? 32.347  -9.812  16.438 1.00 33.25 ? 211 LEU B CA    1 
ATOM   4665 C  C     . LEU C 1 211 ? 31.657  -11.164 16.599 1.00 34.25 ? 211 LEU B C     1 
ATOM   4666 O  O     . LEU C 1 211 ? 31.830  -12.030 15.772 1.00 34.90 ? 211 LEU B O     1 
ATOM   4667 C  CB    . LEU C 1 211 ? 33.882  -9.980  16.531 1.00 29.81 ? 211 LEU B CB    1 
ATOM   4668 C  CG    . LEU C 1 211 ? 34.619  -8.706  16.040 1.00 26.60 ? 211 LEU B CG    1 
ATOM   4669 C  CD1   . LEU C 1 211 ? 35.968  -9.123  15.977 1.00 32.96 ? 211 LEU B CD1   1 
ATOM   4670 C  CD2   . LEU C 1 211 ? 34.225  -8.240  14.712 1.00 20.63 ? 211 LEU B CD2   1 
ATOM   4671 N  N     . SER C 1 212 ? 30.688  -11.192 17.509 1.00 37.11 ? 212 SER B N     1 
ATOM   4672 C  CA    . SER C 1 212 ? 29.821  -12.281 17.922 1.00 35.72 ? 212 SER B CA    1 
ATOM   4673 C  C     . SER C 1 212 ? 30.619  -13.513 18.221 1.00 36.44 ? 212 SER B C     1 
ATOM   4674 O  O     . SER C 1 212 ? 30.538  -14.508 17.499 1.00 40.65 ? 212 SER B O     1 
ATOM   4675 C  CB    . SER C 1 212 ? 28.620  -12.610 17.029 1.00 34.52 ? 212 SER B CB    1 
ATOM   4676 O  OG    . SER C 1 212 ? 28.407  -11.717 15.979 1.00 46.98 ? 212 SER B OG    1 
ATOM   4677 N  N     . LYS C 1 213 ? 31.682  -13.232 18.955 1.00 33.11 ? 213 LYS B N     1 
ATOM   4678 C  CA    . LYS C 1 213 ? 32.471  -14.290 19.528 1.00 33.01 ? 213 LYS B CA    1 
ATOM   4679 C  C     . LYS C 1 213 ? 31.714  -14.480 20.859 1.00 33.29 ? 213 LYS B C     1 
ATOM   4680 O  O     . LYS C 1 213 ? 30.808  -13.710 21.231 1.00 39.61 ? 213 LYS B O     1 
ATOM   4681 C  CB    . LYS C 1 213 ? 33.913  -13.775 19.728 1.00 38.03 ? 213 LYS B CB    1 
ATOM   4682 C  CG    . LYS C 1 213 ? 34.661  -13.539 18.376 1.00 46.17 ? 213 LYS B CG    1 
ATOM   4683 C  CD    . LYS C 1 213 ? 35.959  -12.681 18.365 1.00 52.48 ? 213 LYS B CD    1 
ATOM   4684 C  CE    . LYS C 1 213 ? 36.900  -12.974 19.564 1.00 59.62 ? 213 LYS B CE    1 
ATOM   4685 N  NZ    . LYS C 1 213 ? 38.091  -12.092 19.732 1.00 58.69 ? 213 LYS B NZ    1 
ATOM   4686 N  N     . GLY C 1 214 ? 31.867  -15.636 21.467 1.00 29.64 ? 214 GLY B N     1 
ATOM   4687 C  CA    . GLY C 1 214 ? 31.316  -15.814 22.786 1.00 29.62 ? 214 GLY B CA    1 
ATOM   4688 C  C     . GLY C 1 214 ? 32.371  -15.091 23.589 1.00 34.68 ? 214 GLY B C     1 
ATOM   4689 O  O     . GLY C 1 214 ? 33.558  -15.111 23.204 1.00 36.07 ? 214 GLY B O     1 
ATOM   4690 N  N     . TYR C 1 215 ? 31.994  -14.567 24.757 1.00 31.74 ? 215 TYR B N     1 
ATOM   4691 C  CA    . TYR C 1 215 ? 32.908  -13.771 25.564 1.00 21.54 ? 215 TYR B CA    1 
ATOM   4692 C  C     . TYR C 1 215 ? 32.750  -14.118 27.036 1.00 23.44 ? 215 TYR B C     1 
ATOM   4693 O  O     . TYR C 1 215 ? 31.940  -14.934 27.395 1.00 20.99 ? 215 TYR B O     1 
ATOM   4694 C  CB    . TYR C 1 215 ? 32.651  -12.318 25.133 1.00 19.81 ? 215 TYR B CB    1 
ATOM   4695 C  CG    . TYR C 1 215 ? 31.234  -11.876 25.426 1.00 14.13 ? 215 TYR B CG    1 
ATOM   4696 C  CD1   . TYR C 1 215 ? 30.866  -11.416 26.734 1.00 14.48 ? 215 TYR B CD1   1 
ATOM   4697 C  CD2   . TYR C 1 215 ? 30.283  -11.842 24.417 1.00 19.26 ? 215 TYR B CD2   1 
ATOM   4698 C  CE1   . TYR C 1 215 ? 29.557  -10.879 26.987 1.00 11.75 ? 215 TYR B CE1   1 
ATOM   4699 C  CE2   . TYR C 1 215 ? 28.964  -11.383 24.674 1.00 17.72 ? 215 TYR B CE2   1 
ATOM   4700 C  CZ    . TYR C 1 215 ? 28.650  -10.908 25.951 1.00 13.62 ? 215 TYR B CZ    1 
ATOM   4701 O  OH    . TYR C 1 215 ? 27.351  -10.556 26.162 1.00 19.66 ? 215 TYR B OH    1 
ATOM   4702 N  N     . ASN C 1 216 ? 33.610  -13.583 27.890 1.00 21.04 ? 216 ASN B N     1 
ATOM   4703 C  CA    . ASN C 1 216 ? 33.620  -13.847 29.300 1.00 24.88 ? 216 ASN B CA    1 
ATOM   4704 C  C     . ASN C 1 216 ? 33.853  -12.506 30.062 1.00 23.51 ? 216 ASN B C     1 
ATOM   4705 O  O     . ASN C 1 216 ? 33.697  -11.411 29.508 1.00 20.26 ? 216 ASN B O     1 
ATOM   4706 C  CB    . ASN C 1 216 ? 34.788  -14.820 29.548 1.00 29.51 ? 216 ASN B CB    1 
ATOM   4707 C  CG    . ASN C 1 216 ? 36.147  -14.299 28.997 1.00 31.83 ? 216 ASN B CG    1 
ATOM   4708 O  OD1   . ASN C 1 216 ? 36.342  -13.152 28.576 1.00 31.31 ? 216 ASN B OD1   1 
ATOM   4709 N  ND2   . ASN C 1 216 ? 37.094  -15.161 29.061 1.00 31.75 ? 216 ASN B ND2   1 
ATOM   4710 N  N     . LYS C 1 217 ? 34.202  -12.648 31.334 1.00 20.29 ? 217 LYS B N     1 
ATOM   4711 C  CA    . LYS C 1 217 ? 34.465  -11.575 32.244 1.00 26.18 ? 217 LYS B CA    1 
ATOM   4712 C  C     . LYS C 1 217 ? 35.359  -10.404 31.744 1.00 25.15 ? 217 LYS B C     1 
ATOM   4713 O  O     . LYS C 1 217 ? 35.133  -9.250  32.105 1.00 27.75 ? 217 LYS B O     1 
ATOM   4714 C  CB    . LYS C 1 217 ? 34.840  -12.156 33.602 1.00 27.50 ? 217 LYS B CB    1 
ATOM   4715 C  CG    . LYS C 1 217 ? 36.189  -12.808 33.680 1.00 35.06 ? 217 LYS B CG    1 
ATOM   4716 C  CD    . LYS C 1 217 ? 36.545  -13.180 35.145 1.00 50.08 ? 217 LYS B CD    1 
ATOM   4717 C  CE    . LYS C 1 217 ? 37.921  -13.813 35.325 1.00 53.67 ? 217 LYS B CE    1 
ATOM   4718 N  NZ    . LYS C 1 217 ? 39.017  -12.884 34.750 1.00 62.55 ? 217 LYS B NZ    1 
ATOM   4719 N  N     . ALA C 1 218 ? 36.204  -10.681 30.756 1.00 24.77 ? 218 ALA B N     1 
ATOM   4720 C  CA    . ALA C 1 218 ? 37.110  -9.692  30.134 1.00 24.59 ? 218 ALA B CA    1 
ATOM   4721 C  C     . ALA C 1 218 ? 36.381  -8.525  29.492 1.00 20.44 ? 218 ALA B C     1 
ATOM   4722 O  O     . ALA C 1 218 ? 37.059  -7.607  29.044 1.00 18.36 ? 218 ALA B O     1 
ATOM   4723 C  CB    . ALA C 1 218 ? 38.062  -10.356 29.037 1.00 23.15 ? 218 ALA B CB    1 
ATOM   4724 N  N     . VAL C 1 219 ? 35.159  -8.742  29.025 1.00 18.32 ? 219 VAL B N     1 
ATOM   4725 C  CA    . VAL C 1 219 ? 34.409  -7.547  28.517 1.00 23.02 ? 219 VAL B CA    1 
ATOM   4726 C  C     . VAL C 1 219 ? 34.284  -6.376  29.568 1.00 21.30 ? 219 VAL B C     1 
ATOM   4727 O  O     . VAL C 1 219 ? 34.313  -5.209  29.196 1.00 21.24 ? 219 VAL B O     1 
ATOM   4728 C  CB    . VAL C 1 219 ? 33.017  -7.845  27.911 1.00 20.35 ? 219 VAL B CB    1 
ATOM   4729 C  CG1   . VAL C 1 219 ? 33.150  -8.747  26.674 1.00 20.48 ? 219 VAL B CG1   1 
ATOM   4730 C  CG2   . VAL C 1 219 ? 32.067  -8.362  28.990 1.00 20.24 ? 219 VAL B CG2   1 
ATOM   4731 N  N     . ASP C 1 220 ? 34.192  -6.711  30.853 1.00 17.63 ? 220 ASP B N     1 
ATOM   4732 C  CA    . ASP C 1 220 ? 34.173  -5.772  31.945 1.00 18.14 ? 220 ASP B CA    1 
ATOM   4733 C  C     . ASP C 1 220 ? 35.485  -5.016  32.107 1.00 23.01 ? 220 ASP B C     1 
ATOM   4734 O  O     . ASP C 1 220 ? 35.490  -3.890  32.585 1.00 18.83 ? 220 ASP B O     1 
ATOM   4735 C  CB    . ASP C 1 220 ? 33.864  -6.486  33.293 1.00 16.27 ? 220 ASP B CB    1 
ATOM   4736 C  CG    . ASP C 1 220 ? 32.349  -6.826  33.442 1.00 16.80 ? 220 ASP B CG    1 
ATOM   4737 O  OD1   . ASP C 1 220 ? 31.472  -6.406  32.649 1.00 18.24 ? 220 ASP B OD1   1 
ATOM   4738 O  OD2   . ASP C 1 220 ? 32.026  -7.640  34.299 1.00 11.03 ? 220 ASP B OD2   1 
ATOM   4739 N  N     . TRP C 1 221 ? 36.604  -5.648  31.757 1.00 23.18 ? 221 TRP B N     1 
ATOM   4740 C  CA    . TRP C 1 221 ? 37.913  -5.018  31.895 1.00 17.10 ? 221 TRP B CA    1 
ATOM   4741 C  C     . TRP C 1 221 ? 38.109  -4.099  30.729 1.00 18.27 ? 221 TRP B C     1 
ATOM   4742 O  O     . TRP C 1 221 ? 38.682  -3.029  30.911 1.00 21.58 ? 221 TRP B O     1 
ATOM   4743 C  CB    . TRP C 1 221 ? 39.017  -6.030  32.072 1.00 18.26 ? 221 TRP B CB    1 
ATOM   4744 C  CG    . TRP C 1 221 ? 38.886  -6.766  33.344 1.00 13.07 ? 221 TRP B CG    1 
ATOM   4745 C  CD1   . TRP C 1 221 ? 38.742  -8.137  33.468 1.00 19.90 ? 221 TRP B CD1   1 
ATOM   4746 C  CD2   . TRP C 1 221 ? 38.880  -6.239  34.676 1.00 21.96 ? 221 TRP B CD2   1 
ATOM   4747 N  NE1   . TRP C 1 221 ? 38.622  -8.487  34.809 1.00 18.74 ? 221 TRP B NE1   1 
ATOM   4748 C  CE2   . TRP C 1 221 ? 38.718  -7.355  35.574 1.00 22.51 ? 221 TRP B CE2   1 
ATOM   4749 C  CE3   . TRP C 1 221 ? 38.968  -4.934  35.222 1.00 24.77 ? 221 TRP B CE3   1 
ATOM   4750 C  CZ2   . TRP C 1 221 ? 38.652  -7.196  36.997 1.00 20.08 ? 221 TRP B CZ2   1 
ATOM   4751 C  CZ3   . TRP C 1 221 ? 38.884  -4.779  36.663 1.00 17.99 ? 221 TRP B CZ3   1 
ATOM   4752 C  CH2   . TRP C 1 221 ? 38.735  -5.910  37.529 1.00 16.48 ? 221 TRP B CH2   1 
ATOM   4753 N  N     . TRP C 1 222 ? 37.628  -4.471  29.563 1.00 13.07 ? 222 TRP B N     1 
ATOM   4754 C  CA    . TRP C 1 222 ? 37.640  -3.559  28.476 1.00 18.16 ? 222 TRP B CA    1 
ATOM   4755 C  C     . TRP C 1 222 ? 36.799  -2.304  28.895 1.00 24.14 ? 222 TRP B C     1 
ATOM   4756 O  O     . TRP C 1 222 ? 37.200  -1.184  28.589 1.00 18.79 ? 222 TRP B O     1 
ATOM   4757 C  CB    . TRP C 1 222 ? 37.044  -4.214  27.256 1.00 15.23 ? 222 TRP B CB    1 
ATOM   4758 C  CG    . TRP C 1 222 ? 36.852  -3.276  26.125 1.00 16.73 ? 222 TRP B CG    1 
ATOM   4759 C  CD1   . TRP C 1 222 ? 35.721  -2.480  25.870 1.00 9.96  ? 222 TRP B CD1   1 
ATOM   4760 C  CD2   . TRP C 1 222 ? 37.743  -3.035  25.041 1.00 16.38 ? 222 TRP B CD2   1 
ATOM   4761 N  NE1   . TRP C 1 222 ? 35.850  -1.790  24.697 1.00 10.90 ? 222 TRP B NE1   1 
ATOM   4762 C  CE2   . TRP C 1 222 ? 37.090  -2.066  24.172 1.00 13.29 ? 222 TRP B CE2   1 
ATOM   4763 C  CE3   . TRP C 1 222 ? 38.992  -3.585  24.661 1.00 20.30 ? 222 TRP B CE3   1 
ATOM   4764 C  CZ2   . TRP C 1 222 ? 37.683  -1.597  22.950 1.00 16.11 ? 222 TRP B CZ2   1 
ATOM   4765 C  CZ3   . TRP C 1 222 ? 39.588  -3.146  23.398 1.00 19.15 ? 222 TRP B CZ3   1 
ATOM   4766 C  CH2   . TRP C 1 222 ? 38.928  -2.134  22.578 1.00 16.88 ? 222 TRP B CH2   1 
ATOM   4767 N  N     . ALA C 1 223 ? 35.564  -2.501  29.361 1.00 22.51 ? 223 ALA B N     1 
ATOM   4768 C  CA    . ALA C 1 223 ? 34.678  -1.405  29.789 1.00 22.59 ? 223 ALA B CA    1 
ATOM   4769 C  C     . ALA C 1 223 ? 35.303  -0.389  30.783 1.00 20.55 ? 223 ALA B C     1 
ATOM   4770 O  O     . ALA C 1 223 ? 35.146  0.847   30.599 1.00 22.25 ? 223 ALA B O     1 
ATOM   4771 C  CB    . ALA C 1 223 ? 33.337  -1.906  30.225 1.00 14.79 ? 223 ALA B CB    1 
ATOM   4772 N  N     . LEU C 1 224 ? 36.082  -0.908  31.724 1.00 16.11 ? 224 LEU B N     1 
ATOM   4773 C  CA    . LEU C 1 224 ? 36.894  -0.133  32.657 1.00 18.32 ? 224 LEU B CA    1 
ATOM   4774 C  C     . LEU C 1 224 ? 37.966  0.718   31.917 1.00 21.14 ? 224 LEU B C     1 
ATOM   4775 O  O     . LEU C 1 224 ? 37.966  1.892   32.159 1.00 20.11 ? 224 LEU B O     1 
ATOM   4776 C  CB    . LEU C 1 224 ? 37.534  -0.971  33.711 1.00 19.72 ? 224 LEU B CB    1 
ATOM   4777 C  CG    . LEU C 1 224 ? 38.362  -0.218  34.737 1.00 25.01 ? 224 LEU B CG    1 
ATOM   4778 C  CD1   . LEU C 1 224 ? 37.394  0.500   35.685 1.00 18.84 ? 224 LEU B CD1   1 
ATOM   4779 C  CD2   . LEU C 1 224 ? 39.433  -1.054  35.507 1.00 19.68 ? 224 LEU B CD2   1 
ATOM   4780 N  N     . GLY C 1 225 ? 38.488  0.253   30.788 1.00 19.58 ? 225 GLY B N     1 
ATOM   4781 C  CA    . GLY C 1 225 ? 39.476  0.940   29.999 1.00 20.20 ? 225 GLY B CA    1 
ATOM   4782 C  C     . GLY C 1 225 ? 38.763  2.115   29.391 1.00 24.71 ? 225 GLY B C     1 
ATOM   4783 O  O     . GLY C 1 225 ? 39.258  3.238   29.607 1.00 21.36 ? 225 GLY B O     1 
ATOM   4784 N  N     . VAL C 1 226 ? 37.559  1.876   28.839 1.00 21.52 ? 226 VAL B N     1 
ATOM   4785 C  CA    . VAL C 1 226 ? 36.705  2.922   28.269 1.00 18.79 ? 226 VAL B CA    1 
ATOM   4786 C  C     . VAL C 1 226 ? 36.246  3.953   29.346 1.00 22.11 ? 226 VAL B C     1 
ATOM   4787 O  O     . VAL C 1 226 ? 36.466  5.177   29.144 1.00 23.63 ? 226 VAL B O     1 
ATOM   4788 C  CB    . VAL C 1 226 ? 35.525  2.385   27.538 1.00 19.52 ? 226 VAL B CB    1 
ATOM   4789 C  CG1   . VAL C 1 226 ? 34.805  3.460   26.729 1.00 17.98 ? 226 VAL B CG1   1 
ATOM   4790 C  CG2   . VAL C 1 226 ? 35.936  1.279   26.580 1.00 21.05 ? 226 VAL B CG2   1 
ATOM   4791 N  N     . LEU C 1 227 ? 36.084  3.483   30.583 1.00 13.65 ? 227 LEU B N     1 
ATOM   4792 C  CA    . LEU C 1 227 ? 35.544  4.360   31.601 1.00 18.28 ? 227 LEU B CA    1 
ATOM   4793 C  C     . LEU C 1 227 ? 36.632  5.347   32.012 1.00 22.61 ? 227 LEU B C     1 
ATOM   4794 O  O     . LEU C 1 227 ? 36.341  6.554   32.076 1.00 19.69 ? 227 LEU B O     1 
ATOM   4795 C  CB    . LEU C 1 227 ? 34.995  3.658   32.831 1.00 11.84 ? 227 LEU B CB    1 
ATOM   4796 C  CG    . LEU C 1 227 ? 34.349  4.527   33.941 1.00 12.65 ? 227 LEU B CG    1 
ATOM   4797 C  CD1   . LEU C 1 227 ? 33.049  5.055   33.518 1.00 12.87 ? 227 LEU B CD1   1 
ATOM   4798 C  CD2   . LEU C 1 227 ? 34.196  3.776   35.220 1.00 14.67 ? 227 LEU B CD2   1 
ATOM   4799 N  N     . ILE C 1 228 ? 37.780  4.787   32.403 1.00 19.33 ? 228 ILE B N     1 
ATOM   4800 C  CA    . ILE C 1 228 ? 38.963  5.520   32.796 1.00 19.08 ? 228 ILE B CA    1 
ATOM   4801 C  C     . ILE C 1 228 ? 39.325  6.482   31.683 1.00 20.28 ? 228 ILE B C     1 
ATOM   4802 O  O     . ILE C 1 228 ? 39.533  7.633   32.077 1.00 28.23 ? 228 ILE B O     1 
ATOM   4803 C  CB    . ILE C 1 228 ? 40.183  4.631   33.117 1.00 22.55 ? 228 ILE B CB    1 
ATOM   4804 C  CG1   . ILE C 1 228 ? 39.835  3.643   34.261 1.00 21.28 ? 228 ILE B CG1   1 
ATOM   4805 C  CG2   . ILE C 1 228 ? 41.336  5.536   33.636 1.00 21.57 ? 228 ILE B CG2   1 
ATOM   4806 C  CD1   . ILE C 1 228 ? 40.958  2.972   34.942 1.00 16.19 ? 228 ILE B CD1   1 
ATOM   4807 N  N     . TYR C 1 229 ? 39.353  6.089   30.398 1.00 14.79 ? 229 TYR B N     1 
ATOM   4808 C  CA    . TYR C 1 229 ? 39.656  7.033   29.349 1.00 19.78 ? 229 TYR B CA    1 
ATOM   4809 C  C     . TYR C 1 229 ? 38.642  8.237   29.356 1.00 28.09 ? 229 TYR B C     1 
ATOM   4810 O  O     . TYR C 1 229 ? 39.056  9.408   29.207 1.00 22.99 ? 229 TYR B O     1 
ATOM   4811 C  CB    . TYR C 1 229 ? 39.717  6.397   27.993 1.00 13.53 ? 229 TYR B CB    1 
ATOM   4812 C  CG    . TYR C 1 229 ? 40.146  7.285   26.829 1.00 15.95 ? 229 TYR B CG    1 
ATOM   4813 C  CD1   . TYR C 1 229 ? 39.324  8.370   26.373 1.00 24.38 ? 229 TYR B CD1   1 
ATOM   4814 C  CD2   . TYR C 1 229 ? 41.340  7.005   26.062 1.00 17.50 ? 229 TYR B CD2   1 
ATOM   4815 C  CE1   . TYR C 1 229 ? 39.610  9.136   25.208 1.00 21.89 ? 229 TYR B CE1   1 
ATOM   4816 C  CE2   . TYR C 1 229 ? 41.650  7.737   24.888 1.00 21.32 ? 229 TYR B CE2   1 
ATOM   4817 C  CZ    . TYR C 1 229 ? 40.773  8.797   24.471 1.00 23.70 ? 229 TYR B CZ    1 
ATOM   4818 O  OH    . TYR C 1 229 ? 40.843  9.427   23.256 1.00 30.44 ? 229 TYR B OH    1 
ATOM   4819 N  N     . GLU C 1 230 ? 37.341  7.943   29.453 1.00 26.34 ? 230 GLU B N     1 
ATOM   4820 C  CA    . GLU C 1 230 ? 36.259  8.937   29.399 1.00 24.61 ? 230 GLU B CA    1 
ATOM   4821 C  C     . GLU C 1 230 ? 36.366  9.936   30.563 1.00 21.36 ? 230 GLU B C     1 
ATOM   4822 O  O     . GLU C 1 230 ? 36.222  11.115  30.311 1.00 23.32 ? 230 GLU B O     1 
ATOM   4823 C  CB    . GLU C 1 230 ? 34.867  8.284   29.267 1.00 16.31 ? 230 GLU B CB    1 
ATOM   4824 C  CG    . GLU C 1 230 ? 33.776  9.327   29.217 1.00 23.72 ? 230 GLU B CG    1 
ATOM   4825 C  CD    . GLU C 1 230 ? 32.439  8.933   28.666 1.00 22.30 ? 230 GLU B CD    1 
ATOM   4826 O  OE1   . GLU C 1 230 ? 32.166  7.806   28.320 1.00 29.14 ? 230 GLU B OE1   1 
ATOM   4827 O  OE2   . GLU C 1 230 ? 31.557  9.789   28.527 1.00 35.83 ? 230 GLU B OE2   1 
ATOM   4828 N  N     . MET C 1 231 ? 36.616  9.479   31.776 1.00 14.31 ? 231 MET B N     1 
ATOM   4829 C  CA    . MET C 1 231 ? 36.774  10.313  32.946 1.00 16.81 ? 231 MET B CA    1 
ATOM   4830 C  C     . MET C 1 231 ? 37.946  11.279  32.831 1.00 25.13 ? 231 MET B C     1 
ATOM   4831 O  O     . MET C 1 231 ? 37.782  12.442  33.121 1.00 28.16 ? 231 MET B O     1 
ATOM   4832 C  CB    . MET C 1 231 ? 36.964  9.500   34.220 1.00 12.70 ? 231 MET B CB    1 
ATOM   4833 C  CG    . MET C 1 231 ? 35.749  8.644   34.631 1.00 17.81 ? 231 MET B CG    1 
ATOM   4834 S  SD    . MET C 1 231 ? 35.923  7.867   36.239 1.00 22.37 ? 231 MET B SD    1 
ATOM   4835 C  CE    . MET C 1 231 ? 37.250  6.645   36.016 1.00 18.20 ? 231 MET B CE    1 
ATOM   4836 N  N     . ALA C 1 232 ? 39.116  10.791  32.438 1.00 25.65 ? 232 ALA B N     1 
ATOM   4837 C  CA    . ALA C 1 232 ? 40.340  11.583  32.320 1.00 22.86 ? 232 ALA B CA    1 
ATOM   4838 C  C     . ALA C 1 232 ? 40.402  12.424  31.047 1.00 19.10 ? 232 ALA B C     1 
ATOM   4839 O  O     . ALA C 1 232 ? 40.981  13.495  31.073 1.00 24.52 ? 232 ALA B O     1 
ATOM   4840 C  CB    . ALA C 1 232 ? 41.563  10.684  32.465 1.00 24.76 ? 232 ALA B CB    1 
ATOM   4841 N  N     . ALA C 1 233 ? 39.675  12.079  30.007 1.00 15.44 ? 233 ALA B N     1 
ATOM   4842 C  CA    . ALA C 1 233 ? 39.682  12.827  28.757 1.00 21.05 ? 233 ALA B CA    1 
ATOM   4843 C  C     . ALA C 1 233 ? 38.506  13.791  28.614 1.00 25.68 ? 233 ALA B C     1 
ATOM   4844 O  O     . ALA C 1 233 ? 38.595  14.800  27.920 1.00 21.88 ? 233 ALA B O     1 
ATOM   4845 C  CB    . ALA C 1 233 ? 39.765  11.899  27.511 1.00 15.26 ? 233 ALA B CB    1 
ATOM   4846 N  N     . GLY C 1 234 ? 37.364  13.371  29.164 1.00 26.20 ? 234 GLY B N     1 
ATOM   4847 C  CA    . GLY C 1 234 ? 36.122  14.086  29.039 1.00 18.56 ? 234 GLY B CA    1 
ATOM   4848 C  C     . GLY C 1 234 ? 35.319  13.509  27.889 1.00 26.03 ? 234 GLY B C     1 
ATOM   4849 O  O     . GLY C 1 234 ? 34.175  13.948  27.695 1.00 22.81 ? 234 GLY B O     1 
ATOM   4850 N  N     . TYR C 1 235 ? 35.893  12.671  27.025 1.00 17.97 ? 235 TYR B N     1 
ATOM   4851 C  CA    . TYR C 1 235 ? 35.153  12.061  25.926 1.00 16.94 ? 235 TYR B CA    1 
ATOM   4852 C  C     . TYR C 1 235 ? 35.580  10.595  25.800 1.00 23.16 ? 235 TYR B C     1 
ATOM   4853 O  O     . TYR C 1 235 ? 36.631  10.235  26.332 1.00 19.08 ? 235 TYR B O     1 
ATOM   4854 C  CB    . TYR C 1 235 ? 35.309  12.746  24.544 1.00 22.41 ? 235 TYR B CB    1 
ATOM   4855 C  CG    . TYR C 1 235 ? 36.712  13.118  24.181 1.00 29.06 ? 235 TYR B CG    1 
ATOM   4856 C  CD1   . TYR C 1 235 ? 37.253  14.370  24.641 1.00 28.98 ? 235 TYR B CD1   1 
ATOM   4857 C  CD2   . TYR C 1 235 ? 37.569  12.180  23.509 1.00 28.14 ? 235 TYR B CD2   1 
ATOM   4858 C  CE1   . TYR C 1 235 ? 38.646  14.663  24.446 1.00 30.27 ? 235 TYR B CE1   1 
ATOM   4859 C  CE2   . TYR C 1 235 ? 38.954  12.457  23.273 1.00 24.77 ? 235 TYR B CE2   1 
ATOM   4860 C  CZ    . TYR C 1 235 ? 39.464  13.715  23.752 1.00 32.40 ? 235 TYR B CZ    1 
ATOM   4861 O  OH    . TYR C 1 235 ? 40.728  14.095  23.423 1.00 37.37 ? 235 TYR B OH    1 
ATOM   4862 N  N     . PRO C 1 236 ? 34.670  9.710   25.313 1.00 28.34 ? 236 PRO B N     1 
ATOM   4863 C  CA    . PRO C 1 236 ? 35.098  8.307   25.183 1.00 27.36 ? 236 PRO B CA    1 
ATOM   4864 C  C     . PRO C 1 236 ? 36.126  8.155   24.034 1.00 25.15 ? 236 PRO B C     1 
ATOM   4865 O  O     . PRO C 1 236 ? 36.058  8.963   23.070 1.00 23.42 ? 236 PRO B O     1 
ATOM   4866 C  CB    . PRO C 1 236 ? 33.770  7.582   24.858 1.00 24.13 ? 236 PRO B CB    1 
ATOM   4867 C  CG    . PRO C 1 236 ? 32.993  8.609   24.064 1.00 27.60 ? 236 PRO B CG    1 
ATOM   4868 C  CD    . PRO C 1 236 ? 33.297  9.888   24.780 1.00 25.01 ? 236 PRO B CD    1 
ATOM   4869 N  N     . PRO C 1 237 ? 36.906  7.021   24.029 1.00 25.90 ? 237 PRO B N     1 
ATOM   4870 C  CA    . PRO C 1 237 ? 37.906  6.749   22.968 1.00 21.68 ? 237 PRO B CA    1 
ATOM   4871 C  C     . PRO C 1 237 ? 37.317  6.536   21.578 1.00 22.71 ? 237 PRO B C     1 
ATOM   4872 O  O     . PRO C 1 237 ? 37.976  6.724   20.564 1.00 23.66 ? 237 PRO B O     1 
ATOM   4873 C  CB    . PRO C 1 237 ? 38.624  5.475   23.468 1.00 20.74 ? 237 PRO B CB    1 
ATOM   4874 C  CG    . PRO C 1 237 ? 37.750  4.848   24.587 1.00 20.46 ? 237 PRO B CG    1 
ATOM   4875 C  CD    . PRO C 1 237 ? 37.009  6.036   25.153 1.00 27.18 ? 237 PRO B CD    1 
ATOM   4876 N  N     . PHE C 1 238 ? 36.070  6.065   21.475 1.00 22.59 ? 238 PHE B N     1 
ATOM   4877 C  CA    . PHE C 1 238 ? 35.547  5.785   20.123 1.00 22.21 ? 238 PHE B CA    1 
ATOM   4878 C  C     . PHE C 1 238 ? 34.183  6.454   20.226 1.00 23.54 ? 238 PHE B C     1 
ATOM   4879 O  O     . PHE C 1 238 ? 33.461  6.226   21.211 1.00 27.56 ? 238 PHE B O     1 
ATOM   4880 C  CB    . PHE C 1 238 ? 35.401  4.270   19.749 1.00 20.96 ? 238 PHE B CB    1 
ATOM   4881 C  CG    . PHE C 1 238 ? 36.522  3.358   20.257 1.00 21.20 ? 238 PHE B CG    1 
ATOM   4882 C  CD1   . PHE C 1 238 ? 36.481  2.890   21.599 1.00 23.23 ? 238 PHE B CD1   1 
ATOM   4883 C  CD2   . PHE C 1 238 ? 37.710  3.165   19.503 1.00 17.03 ? 238 PHE B CD2   1 
ATOM   4884 C  CE1   . PHE C 1 238 ? 37.629  2.255   22.236 1.00 22.40 ? 238 PHE B CE1   1 
ATOM   4885 C  CE2   . PHE C 1 238 ? 38.848  2.569   20.101 1.00 15.01 ? 238 PHE B CE2   1 
ATOM   4886 C  CZ    . PHE C 1 238 ? 38.841  2.112   21.462 1.00 24.58 ? 238 PHE B CZ    1 
ATOM   4887 N  N     . PHE C 1 239 ? 33.993  7.444   19.362 1.00 21.18 ? 239 PHE B N     1 
ATOM   4888 C  CA    . PHE C 1 239 ? 32.763  8.214   19.295 1.00 23.42 ? 239 PHE B CA    1 
ATOM   4889 C  C     . PHE C 1 239 ? 32.550  8.567   17.882 1.00 23.42 ? 239 PHE B C     1 
ATOM   4890 O  O     . PHE C 1 239 ? 33.436  8.432   17.055 1.00 24.32 ? 239 PHE B O     1 
ATOM   4891 C  CB    . PHE C 1 239 ? 32.733  9.412   20.295 1.00 25.36 ? 239 PHE B CB    1 
ATOM   4892 C  CG    . PHE C 1 239 ? 33.571  10.630  19.910 1.00 23.46 ? 239 PHE B CG    1 
ATOM   4893 C  CD1   . PHE C 1 239 ? 33.117  11.529  18.930 1.00 19.21 ? 239 PHE B CD1   1 
ATOM   4894 C  CD2   . PHE C 1 239 ? 34.846  10.806  20.494 1.00 25.93 ? 239 PHE B CD2   1 
ATOM   4895 C  CE1   . PHE C 1 239 ? 33.969  12.613  18.485 1.00 32.25 ? 239 PHE B CE1   1 
ATOM   4896 C  CE2   . PHE C 1 239 ? 35.708  11.877  20.082 1.00 26.32 ? 239 PHE B CE2   1 
ATOM   4897 C  CZ    . PHE C 1 239 ? 35.273  12.787  19.065 1.00 28.84 ? 239 PHE B CZ    1 
ATOM   4898 N  N     . ALA C 1 240 ? 31.269  8.755   17.618 1.00 23.48 ? 240 ALA B N     1 
ATOM   4899 C  CA    . ALA C 1 240 ? 30.701  9.144   16.334 1.00 24.56 ? 240 ALA B CA    1 
ATOM   4900 C  C     . ALA C 1 240 ? 29.195  9.491   16.515 1.00 29.94 ? 240 ALA B C     1 
ATOM   4901 O  O     . ALA C 1 240 ? 28.685  9.688   17.652 1.00 29.65 ? 240 ALA B O     1 
ATOM   4902 C  CB    . ALA C 1 240 ? 30.939  8.051   15.295 1.00 20.51 ? 240 ALA B CB    1 
ATOM   4903 N  N     . ASP C 1 241 ? 28.486  9.660   15.408 1.00 31.50 ? 241 ASP B N     1 
ATOM   4904 C  CA    . ASP C 1 241 ? 27.075  9.989   15.542 1.00 38.74 ? 241 ASP B CA    1 
ATOM   4905 C  C     . ASP C 1 241 ? 26.097  8.831   15.461 1.00 42.90 ? 241 ASP B C     1 
ATOM   4906 O  O     . ASP C 1 241 ? 24.956  8.956   15.928 1.00 44.56 ? 241 ASP B O     1 
ATOM   4907 C  CB    . ASP C 1 241 ? 26.687  11.098  14.568 1.00 38.77 ? 241 ASP B CB    1 
ATOM   4908 C  CG    . ASP C 1 241 ? 27.362  12.435  14.897 1.00 39.13 ? 241 ASP B CG    1 
ATOM   4909 O  OD1   . ASP C 1 241 ? 27.827  12.721  16.011 1.00 38.14 ? 241 ASP B OD1   1 
ATOM   4910 O  OD2   . ASP C 1 241 ? 27.378  13.266  14.003 1.00 39.15 ? 241 ASP B OD2   1 
ATOM   4911 N  N     . GLN C 1 242 ? 26.560  7.752   14.830 1.00 42.42 ? 242 GLN B N     1 
ATOM   4912 C  CA    . GLN C 1 242 ? 25.834  6.521   14.552 1.00 38.87 ? 242 GLN B CA    1 
ATOM   4913 C  C     . GLN C 1 242 ? 26.605  5.355   15.162 1.00 38.60 ? 242 GLN B C     1 
ATOM   4914 O  O     . GLN C 1 242 ? 27.833  5.279   14.989 1.00 32.74 ? 242 GLN B O     1 
ATOM   4915 C  CB    . GLN C 1 242 ? 25.806  6.386   13.058 1.00 44.35 ? 242 GLN B CB    1 
ATOM   4916 C  CG    . GLN C 1 242 ? 24.929  7.412   12.375 1.00 51.10 ? 242 GLN B CG    1 
ATOM   4917 C  CD    . GLN C 1 242 ? 23.513  7.283   12.833 1.00 54.95 ? 242 GLN B CD    1 
ATOM   4918 O  OE1   . GLN C 1 242 ? 22.756  6.505   12.250 1.00 66.62 ? 242 GLN B OE1   1 
ATOM   4919 N  NE2   . GLN C 1 242 ? 23.161  7.957   13.915 1.00 55.82 ? 242 GLN B NE2   1 
ATOM   4920 N  N     . PRO C 1 243 ? 25.919  4.474   15.959 1.00 38.78 ? 243 PRO B N     1 
ATOM   4921 C  CA    . PRO C 1 243 ? 26.520  3.304   16.646 1.00 32.07 ? 243 PRO B CA    1 
ATOM   4922 C  C     . PRO C 1 243 ? 27.396  2.436   15.721 1.00 29.24 ? 243 PRO B C     1 
ATOM   4923 O  O     . PRO C 1 243 ? 28.520  2.094   16.063 1.00 28.35 ? 243 PRO B O     1 
ATOM   4924 C  CB    . PRO C 1 243 ? 25.278  2.610   17.233 1.00 35.95 ? 243 PRO B CB    1 
ATOM   4925 C  CG    . PRO C 1 243 ? 24.379  3.776   17.646 1.00 29.34 ? 243 PRO B CG    1 
ATOM   4926 C  CD    . PRO C 1 243 ? 24.492  4.610   16.358 1.00 37.51 ? 243 PRO B CD    1 
ATOM   4927 N  N     . ILE C 1 244 ? 26.968  2.318   14.469 1.00 30.08 ? 244 ILE B N     1 
ATOM   4928 C  CA    . ILE C 1 244 ? 27.637  1.616   13.393 1.00 33.59 ? 244 ILE B CA    1 
ATOM   4929 C  C     . ILE C 1 244 ? 29.109  2.097   13.199 1.00 33.75 ? 244 ILE B C     1 
ATOM   4930 O  O     . ILE C 1 244 ? 30.107  1.314   13.092 1.00 31.49 ? 244 ILE B O     1 
ATOM   4931 C  CB    . ILE C 1 244 ? 26.810  1.824   12.098 1.00 35.60 ? 244 ILE B CB    1 
ATOM   4932 C  CG1   . ILE C 1 244 ? 25.291  1.531   12.253 1.00 45.82 ? 244 ILE B CG1   1 
ATOM   4933 C  CG2   . ILE C 1 244 ? 27.300  0.807   11.074 1.00 44.39 ? 244 ILE B CG2   1 
ATOM   4934 C  CD1   . ILE C 1 244 ? 24.255  2.565   12.988 1.00 42.26 ? 244 ILE B CD1   1 
ATOM   4935 N  N     . GLN C 1 245 ? 29.253  3.421   13.337 1.00 36.55 ? 245 GLN B N     1 
ATOM   4936 C  CA    . GLN C 1 245 ? 30.562  4.107   13.219 1.00 33.94 ? 245 GLN B CA    1 
ATOM   4937 C  C     . GLN C 1 245 ? 31.414  3.986   14.465 1.00 31.98 ? 245 GLN B C     1 
ATOM   4938 O  O     . GLN C 1 245 ? 32.641  4.081   14.358 1.00 32.09 ? 245 GLN B O     1 
ATOM   4939 C  CB    . GLN C 1 245 ? 30.430  5.556   12.787 1.00 38.22 ? 245 GLN B CB    1 
ATOM   4940 C  CG    . GLN C 1 245 ? 29.720  5.784   11.487 1.00 47.71 ? 245 GLN B CG    1 
ATOM   4941 C  CD    . GLN C 1 245 ? 28.877  7.048   11.491 1.00 55.91 ? 245 GLN B CD    1 
ATOM   4942 O  OE1   . GLN C 1 245 ? 29.181  8.053   12.144 1.00 59.30 ? 245 GLN B OE1   1 
ATOM   4943 N  NE2   . GLN C 1 245 ? 27.778  6.997   10.737 1.00 65.95 ? 245 GLN B NE2   1 
ATOM   4944 N  N     . ILE C 1 246 ? 30.773  3.805   15.629 1.00 26.87 ? 246 ILE B N     1 
ATOM   4945 C  CA    . ILE C 1 246 ? 31.500  3.503   16.858 1.00 24.46 ? 246 ILE B CA    1 
ATOM   4946 C  C     . ILE C 1 246 ? 32.030  2.032   16.803 1.00 24.47 ? 246 ILE B C     1 
ATOM   4947 O  O     . ILE C 1 246 ? 33.153  1.773   17.218 1.00 27.23 ? 246 ILE B O     1 
ATOM   4948 C  CB    . ILE C 1 246 ? 30.636  3.774   18.109 1.00 20.36 ? 246 ILE B CB    1 
ATOM   4949 C  CG1   . ILE C 1 246 ? 30.049  5.186   18.035 1.00 28.72 ? 246 ILE B CG1   1 
ATOM   4950 C  CG2   . ILE C 1 246 ? 31.396  3.485   19.427 1.00 18.88 ? 246 ILE B CG2   1 
ATOM   4951 C  CD1   . ILE C 1 246 ? 28.640  5.361   18.792 1.00 23.57 ? 246 ILE B CD1   1 
ATOM   4952 N  N     . TYR C 1 247 ? 31.249  1.067   16.317 1.00 27.03 ? 247 TYR B N     1 
ATOM   4953 C  CA    . TYR C 1 247 ? 31.709  -0.339  16.198 1.00 28.86 ? 247 TYR B CA    1 
ATOM   4954 C  C     . TYR C 1 247 ? 32.921  -0.523  15.268 1.00 27.72 ? 247 TYR B C     1 
ATOM   4955 O  O     . TYR C 1 247 ? 33.949  -1.034  15.737 1.00 25.94 ? 247 TYR B O     1 
ATOM   4956 C  CB    . TYR C 1 247 ? 30.560  -1.249  15.788 1.00 27.54 ? 247 TYR B CB    1 
ATOM   4957 C  CG    . TYR C 1 247 ? 29.375  -1.169  16.711 1.00 20.12 ? 247 TYR B CG    1 
ATOM   4958 C  CD1   . TYR C 1 247 ? 29.534  -0.799  18.045 1.00 22.15 ? 247 TYR B CD1   1 
ATOM   4959 C  CD2   . TYR C 1 247 ? 28.089  -1.292  16.182 1.00 23.69 ? 247 TYR B CD2   1 
ATOM   4960 C  CE1   . TYR C 1 247 ? 28.447  -0.548  18.871 1.00 25.14 ? 247 TYR B CE1   1 
ATOM   4961 C  CE2   . TYR C 1 247 ? 26.976  -1.020  16.980 1.00 29.58 ? 247 TYR B CE2   1 
ATOM   4962 C  CZ    . TYR C 1 247 ? 27.165  -0.664  18.337 1.00 31.51 ? 247 TYR B CZ    1 
ATOM   4963 O  OH    . TYR C 1 247 ? 26.054  -0.515  19.175 1.00 43.01 ? 247 TYR B OH    1 
ATOM   4964 N  N     . GLU C 1 248 ? 32.895  0.168   14.117 1.00 30.41 ? 248 GLU B N     1 
ATOM   4965 C  CA    . GLU C 1 248 ? 34.056  0.144   13.206 1.00 29.73 ? 248 GLU B CA    1 
ATOM   4966 C  C     . GLU C 1 248 ? 35.327  0.673   13.879 1.00 30.73 ? 248 GLU B C     1 
ATOM   4967 O  O     . GLU C 1 248 ? 36.409  0.044   13.851 1.00 31.86 ? 248 GLU B O     1 
ATOM   4968 C  CB    . GLU C 1 248 ? 33.739  0.978   11.994 1.00 29.34 ? 248 GLU B CB    1 
ATOM   4969 C  CG    . GLU C 1 248 ? 33.051  0.263   10.891 1.00 46.97 ? 248 GLU B CG    1 
ATOM   4970 C  CD    . GLU C 1 248 ? 32.367  1.212   9.901  1.00 58.02 ? 248 GLU B CD    1 
ATOM   4971 O  OE1   . GLU C 1 248 ? 33.123  1.981   9.236  1.00 64.20 ? 248 GLU B OE1   1 
ATOM   4972 O  OE2   . GLU C 1 248 ? 31.103  1.171   9.786  1.00 59.65 ? 248 GLU B OE2   1 
ATOM   4973 N  N     . LYS C 1 249 ? 35.100  1.643   14.771 1.00 29.53 ? 249 LYS B N     1 
ATOM   4974 C  CA    . LYS C 1 249 ? 36.185  2.282   15.493 1.00 29.49 ? 249 LYS B CA    1 
ATOM   4975 C  C     . LYS C 1 249 ? 36.742  1.337   16.535 1.00 30.27 ? 249 LYS B C     1 
ATOM   4976 O  O     . LYS C 1 249 ? 37.978  1.163   16.679 1.00 25.70 ? 249 LYS B O     1 
ATOM   4977 C  CB    . LYS C 1 249 ? 35.689  3.623   16.043 1.00 29.85 ? 249 LYS B CB    1 
ATOM   4978 C  CG    . LYS C 1 249 ? 35.644  4.693   14.954 1.00 30.36 ? 249 LYS B CG    1 
ATOM   4979 C  CD    . LYS C 1 249 ? 35.460  5.985   15.710 1.00 36.14 ? 249 LYS B CD    1 
ATOM   4980 C  CE    . LYS C 1 249 ? 35.442  7.237   14.853 1.00 39.05 ? 249 LYS B CE    1 
ATOM   4981 N  NZ    . LYS C 1 249 ? 34.252  7.326   13.947 1.00 43.03 ? 249 LYS B NZ    1 
ATOM   4982 N  N     . ILE C 1 250 ? 35.790  0.636   17.161 1.00 29.25 ? 250 ILE B N     1 
ATOM   4983 C  CA    . ILE C 1 250 ? 36.119  -0.346  18.209 1.00 32.28 ? 250 ILE B CA    1 
ATOM   4984 C  C     . ILE C 1 250 ? 36.947  -1.550  17.707 1.00 32.86 ? 250 ILE B C     1 
ATOM   4985 O  O     . ILE C 1 250 ? 38.019  -1.847  18.283 1.00 32.17 ? 250 ILE B O     1 
ATOM   4986 C  CB    . ILE C 1 250 ? 34.870  -0.749  19.062 1.00 27.21 ? 250 ILE B CB    1 
ATOM   4987 C  CG1   . ILE C 1 250 ? 34.465  0.474   19.945 1.00 20.83 ? 250 ILE B CG1   1 
ATOM   4988 C  CG2   . ILE C 1 250 ? 35.272  -1.870  20.030 1.00 14.84 ? 250 ILE B CG2   1 
ATOM   4989 C  CD1   . ILE C 1 250 ? 33.076  0.308   20.527 1.00 27.45 ? 250 ILE B CD1   1 
ATOM   4990 N  N     . VAL C 1 251 ? 36.457  -2.148  16.616 1.00 32.75 ? 251 VAL B N     1 
ATOM   4991 C  CA    . VAL C 1 251 ? 37.054  -3.342  16.018 1.00 37.42 ? 251 VAL B CA    1 
ATOM   4992 C  C     . VAL C 1 251 ? 38.473  -3.120  15.497 1.00 36.68 ? 251 VAL B C     1 
ATOM   4993 O  O     . VAL C 1 251 ? 39.364  -3.764  16.023 1.00 32.30 ? 251 VAL B O     1 
ATOM   4994 C  CB    . VAL C 1 251 ? 36.085  -4.145  15.145 1.00 39.93 ? 251 VAL B CB    1 
ATOM   4995 C  CG1   . VAL C 1 251 ? 34.874  -4.608  15.950 1.00 34.27 ? 251 VAL B CG1   1 
ATOM   4996 C  CG2   . VAL C 1 251 ? 35.608  -3.361  13.948 1.00 39.83 ? 251 VAL B CG2   1 
ATOM   4997 N  N     . SER C 1 252 ? 38.680  -2.046  14.736 1.00 37.90 ? 252 SER B N     1 
ATOM   4998 C  CA    . SER C 1 252 ? 40.013  -1.526  14.362 1.00 43.02 ? 252 SER B CA    1 
ATOM   4999 C  C     . SER C 1 252 ? 41.035  -1.501  15.539 1.00 44.14 ? 252 SER B C     1 
ATOM   5000 O  O     . SER C 1 252 ? 42.249  -1.606  15.335 1.00 41.96 ? 252 SER B O     1 
ATOM   5001 C  CB    . SER C 1 252 ? 39.831  -0.058  13.868 1.00 47.25 ? 252 SER B CB    1 
ATOM   5002 O  OG    . SER C 1 252 ? 40.119  0.952   14.848 1.00 45.15 ? 252 SER B OG    1 
ATOM   5003 N  N     . GLY C 1 253 ? 40.489  -1.092  16.696 1.00 49.50 ? 253 GLY B N     1 
ATOM   5004 C  CA    . GLY C 1 253 ? 41.134  -0.953  18.000 1.00 49.73 ? 253 GLY B CA    1 
ATOM   5005 C  C     . GLY C 1 253 ? 42.018  0.267   18.232 1.00 52.23 ? 253 GLY B C     1 
ATOM   5006 O  O     . GLY C 1 253 ? 42.475  0.448   19.383 1.00 52.98 ? 253 GLY B O     1 
ATOM   5007 N  N     . LYS C 1 254 ? 42.177  1.106   17.195 1.00 47.40 ? 254 LYS B N     1 
ATOM   5008 C  CA    . LYS C 1 254 ? 43.050  2.276   17.211 1.00 44.51 ? 254 LYS B CA    1 
ATOM   5009 C  C     . LYS C 1 254 ? 42.514  3.349   18.163 1.00 41.57 ? 254 LYS B C     1 
ATOM   5010 O  O     . LYS C 1 254 ? 41.352  3.703   18.128 1.00 44.96 ? 254 LYS B O     1 
ATOM   5011 C  CB    . LYS C 1 254 ? 43.188  2.809   15.791 1.00 46.06 ? 254 LYS B CB    1 
ATOM   5012 C  CG    . LYS C 1 254 ? 43.794  1.817   14.746 1.00 51.76 ? 254 LYS B CG    1 
ATOM   5013 C  CD    . LYS C 1 254 ? 43.948  2.445   13.362 0.00 52.95 ? 254 LYS B CD    1 
ATOM   5014 C  CE    . LYS C 1 254 ? 42.618  2.613   12.622 0.00 53.52 ? 254 LYS B CE    1 
ATOM   5015 N  NZ    . LYS C 1 254 ? 41.717  3.641   13.216 0.00 51.83 ? 254 LYS B NZ    1 
ATOM   5016 N  N     . VAL C 1 255 ? 43.317  3.704   19.148 1.00 39.38 ? 255 VAL B N     1 
ATOM   5017 C  CA    . VAL C 1 255 ? 42.989  4.677   20.181 1.00 37.66 ? 255 VAL B CA    1 
ATOM   5018 C  C     . VAL C 1 255 ? 44.026  5.778   20.087 1.00 39.06 ? 255 VAL B C     1 
ATOM   5019 O  O     . VAL C 1 255 ? 45.226  5.471   20.127 1.00 39.29 ? 255 VAL B O     1 
ATOM   5020 C  CB    . VAL C 1 255 ? 43.211  4.107   21.645 1.00 34.99 ? 255 VAL B CB    1 
ATOM   5021 C  CG1   . VAL C 1 255 ? 42.715  5.028   22.803 1.00 27.72 ? 255 VAL B CG1   1 
ATOM   5022 C  CG2   . VAL C 1 255 ? 42.665  2.756   21.805 1.00 41.22 ? 255 VAL B CG2   1 
ATOM   5023 N  N     . ARG C 1 256 ? 43.565  7.029   19.998 1.00 37.10 ? 256 ARG B N     1 
ATOM   5024 C  CA    . ARG C 1 256 ? 44.426  8.218   20.172 1.00 35.13 ? 256 ARG B CA    1 
ATOM   5025 C  C     . ARG C 1 256 ? 44.390  8.737   21.622 1.00 27.57 ? 256 ARG B C     1 
ATOM   5026 O  O     . ARG C 1 256 ? 43.336  8.761   22.246 1.00 29.27 ? 256 ARG B O     1 
ATOM   5027 C  CB    . ARG C 1 256 ? 44.057  9.318   19.176 1.00 38.39 ? 256 ARG B CB    1 
ATOM   5028 C  CG    . ARG C 1 256 ? 44.395  9.018   17.724 0.00 45.36 ? 256 ARG B CG    1 
ATOM   5029 C  CD    . ARG C 1 256 ? 44.182  10.259  16.867 0.00 52.68 ? 256 ARG B CD    1 
ATOM   5030 N  NE    . ARG C 1 256 ? 44.427  10.017  15.447 0.00 62.84 ? 256 ARG B NE    1 
ATOM   5031 C  CZ    . ARG C 1 256 ? 45.299  10.694  14.705 0.00 67.56 ? 256 ARG B CZ    1 
ATOM   5032 N  NH1   . ARG C 1 256 ? 46.036  11.658  15.247 0.00 72.26 ? 256 ARG B NH1   1 
ATOM   5033 N  NH2   . ARG C 1 256 ? 45.444  10.402  13.422 0.00 72.26 ? 256 ARG B NH2   1 
ATOM   5034 N  N     . PHE C 1 257 ? 45.510  8.828   22.304 1.00 22.68 ? 257 PHE B N     1 
ATOM   5035 C  CA    . PHE C 1 257 ? 45.514  9.430   23.629 1.00 24.43 ? 257 PHE B CA    1 
ATOM   5036 C  C     . PHE C 1 257 ? 45.711  10.961  23.645 1.00 32.04 ? 257 PHE B C     1 
ATOM   5037 O  O     . PHE C 1 257 ? 46.231  11.537  22.671 1.00 28.81 ? 257 PHE B O     1 
ATOM   5038 C  CB    . PHE C 1 257 ? 46.508  8.832   24.603 1.00 30.79 ? 257 PHE B CB    1 
ATOM   5039 C  CG    . PHE C 1 257 ? 46.313  7.367   24.821 1.00 40.67 ? 257 PHE B CG    1 
ATOM   5040 C  CD1   . PHE C 1 257 ? 45.333  6.899   25.713 1.00 31.79 ? 257 PHE B CD1   1 
ATOM   5041 C  CD2   . PHE C 1 257 ? 47.116  6.426   24.097 1.00 40.81 ? 257 PHE B CD2   1 
ATOM   5042 C  CE1   . PHE C 1 257 ? 45.132  5.542   25.900 1.00 30.87 ? 257 PHE B CE1   1 
ATOM   5043 C  CE2   . PHE C 1 257 ? 46.911  5.019   24.288 1.00 39.05 ? 257 PHE B CE2   1 
ATOM   5044 C  CZ    . PHE C 1 257 ? 45.913  4.587   25.200 1.00 33.49 ? 257 PHE B CZ    1 
ATOM   5045 N  N     . PRO C 1 258 ? 45.032  11.650  24.590 1.00 33.26 ? 258 PRO B N     1 
ATOM   5046 C  CA    . PRO C 1 258 ? 45.229  13.105  24.647 1.00 36.18 ? 258 PRO B CA    1 
ATOM   5047 C  C     . PRO C 1 258 ? 46.637  13.312  25.202 1.00 37.86 ? 258 PRO B C     1 
ATOM   5048 O  O     . PRO C 1 258 ? 47.073  12.535  26.077 1.00 32.87 ? 258 PRO B O     1 
ATOM   5049 C  CB    . PRO C 1 258 ? 44.194  13.530  25.716 1.00 33.32 ? 258 PRO B CB    1 
ATOM   5050 C  CG    . PRO C 1 258 ? 43.109  12.559  25.535 1.00 33.38 ? 258 PRO B CG    1 
ATOM   5051 C  CD    . PRO C 1 258 ? 43.878  11.296  25.436 1.00 31.29 ? 258 PRO B CD    1 
ATOM   5052 N  N     . SER C 1 259 ? 47.226  14.457  24.844 1.00 39.89 ? 259 SER B N     1 
ATOM   5053 C  CA    . SER C 1 259 ? 48.571  14.872  25.306 1.00 35.24 ? 259 SER B CA    1 
ATOM   5054 C  C     . SER C 1 259 ? 48.690  15.127  26.783 1.00 33.31 ? 259 SER B C     1 
ATOM   5055 O  O     . SER C 1 259 ? 49.818  14.939  27.320 1.00 37.44 ? 259 SER B O     1 
ATOM   5056 C  CB    . SER C 1 259 ? 49.130  16.081  24.553 1.00 39.80 ? 259 SER B CB    1 
ATOM   5057 O  OG    . SER C 1 259 ? 48.103  17.066  24.417 1.00 53.79 ? 259 SER B OG    1 
ATOM   5058 N  N     . HIS C 1 260 ? 47.559  15.355  27.477 1.00 23.18 ? 260 HIS B N     1 
ATOM   5059 C  CA    . HIS C 1 260 ? 47.727  15.599  28.886 1.00 20.29 ? 260 HIS B CA    1 
ATOM   5060 C  C     . HIS C 1 260 ? 47.795  14.250  29.579 1.00 21.08 ? 260 HIS B C     1 
ATOM   5061 O  O     . HIS C 1 260 ? 47.950  14.189  30.797 1.00 25.94 ? 260 HIS B O     1 
ATOM   5062 C  CB    . HIS C 1 260 ? 46.658  16.530  29.505 1.00 21.06 ? 260 HIS B CB    1 
ATOM   5063 C  CG    . HIS C 1 260 ? 45.246  16.052  29.272 1.00 27.17 ? 260 HIS B CG    1 
ATOM   5064 N  ND1   . HIS C 1 260 ? 44.519  15.362  30.227 1.00 27.38 ? 260 HIS B ND1   1 
ATOM   5065 C  CD2   . HIS C 1 260 ? 44.434  16.144  28.186 1.00 24.29 ? 260 HIS B CD2   1 
ATOM   5066 C  CE1   . HIS C 1 260 ? 43.330  15.045  29.733 1.00 19.44 ? 260 HIS B CE1   1 
ATOM   5067 N  NE2   . HIS C 1 260 ? 43.250  15.506  28.499 1.00 23.12 ? 260 HIS B NE2   1 
ATOM   5068 N  N     . PHE C 1 261 ? 47.495  13.144  28.896 1.00 28.44 ? 261 PHE B N     1 
ATOM   5069 C  CA    . PHE C 1 261 ? 47.561  11.828  29.566 1.00 25.98 ? 261 PHE B CA    1 
ATOM   5070 C  C     . PHE C 1 261 ? 48.976  11.446  30.006 1.00 26.05 ? 261 PHE B C     1 
ATOM   5071 O  O     . PHE C 1 261 ? 49.921  11.461  29.190 1.00 21.22 ? 261 PHE B O     1 
ATOM   5072 C  CB    . PHE C 1 261 ? 47.013  10.728  28.650 1.00 30.68 ? 261 PHE B CB    1 
ATOM   5073 C  CG    . PHE C 1 261 ? 45.522  10.425  28.818 1.00 28.96 ? 261 PHE B CG    1 
ATOM   5074 C  CD1   . PHE C 1 261 ? 44.616  11.409  29.255 1.00 23.99 ? 261 PHE B CD1   1 
ATOM   5075 C  CD2   . PHE C 1 261 ? 45.025  9.183   28.330 1.00 23.48 ? 261 PHE B CD2   1 
ATOM   5076 C  CE1   . PHE C 1 261 ? 43.191  11.177  29.183 1.00 30.71 ? 261 PHE B CE1   1 
ATOM   5077 C  CE2   . PHE C 1 261 ? 43.604  8.908   28.237 1.00 24.21 ? 261 PHE B CE2   1 
ATOM   5078 C  CZ    . PHE C 1 261 ? 42.665  9.919   28.661 1.00 17.30 ? 261 PHE B CZ    1 
ATOM   5079 N  N     . SER C 1 262 ? 49.124  11.240  31.309 1.00 24.06 ? 262 SER B N     1 
ATOM   5080 C  CA    . SER C 1 262 ? 50.373  10.693  31.819 1.00 29.79 ? 262 SER B CA    1 
ATOM   5081 C  C     . SER C 1 262 ? 50.836  9.389   31.153 1.00 31.65 ? 262 SER B C     1 
ATOM   5082 O  O     . SER C 1 262 ? 50.049  8.694   30.493 1.00 29.77 ? 262 SER B O     1 
ATOM   5083 C  CB    . SER C 1 262 ? 50.319  10.436  33.304 1.00 30.12 ? 262 SER B CB    1 
ATOM   5084 O  OG    . SER C 1 262 ? 49.688  9.201   33.534 1.00 29.63 ? 262 SER B OG    1 
ATOM   5085 N  N     . SER C 1 263 ? 52.095  9.052   31.453 1.00 32.43 ? 263 SER B N     1 
ATOM   5086 C  CA    . SER C 1 263 ? 52.767  7.872   30.943 1.00 31.29 ? 263 SER B CA    1 
ATOM   5087 C  C     . SER C 1 263 ? 52.171  6.608   31.473 1.00 27.28 ? 263 SER B C     1 
ATOM   5088 O  O     . SER C 1 263 ? 51.783  5.828   30.625 1.00 27.60 ? 263 SER B O     1 
ATOM   5089 C  CB    . SER C 1 263 ? 54.248  7.888   31.279 1.00 34.82 ? 263 SER B CB    1 
ATOM   5090 O  OG    . SER C 1 263 ? 54.844  8.255   30.050 1.00 46.24 ? 263 SER B OG    1 
ATOM   5091 N  N     . ASP C 1 264 ? 52.026  6.532   32.802 1.00 21.64 ? 264 ASP B N     1 
ATOM   5092 C  CA    . ASP C 1 264 ? 51.391  5.438   33.539 1.00 26.68 ? 264 ASP B CA    1 
ATOM   5093 C  C     . ASP C 1 264 ? 49.941  5.198   33.087 1.00 29.75 ? 264 ASP B C     1 
ATOM   5094 O  O     . ASP C 1 264 ? 49.627  4.073   32.695 1.00 37.09 ? 264 ASP B O     1 
ATOM   5095 C  CB    . ASP C 1 264 ? 51.510  5.665   35.040 1.00 27.93 ? 264 ASP B CB    1 
ATOM   5096 C  CG    . ASP C 1 264 ? 52.965  5.649   35.536 1.00 40.16 ? 264 ASP B CG    1 
ATOM   5097 O  OD1   . ASP C 1 264 ? 53.886  5.211   34.801 1.00 38.80 ? 264 ASP B OD1   1 
ATOM   5098 O  OD2   . ASP C 1 264 ? 53.239  6.037   36.700 1.00 39.57 ? 264 ASP B OD2   1 
ATOM   5099 N  N     . LEU C 1 265 ? 49.209  6.267   32.740 1.00 29.95 ? 265 LEU B N     1 
ATOM   5100 C  CA    . LEU C 1 265 ? 47.843  6.163   32.291 1.00 24.44 ? 265 LEU B CA    1 
ATOM   5101 C  C     . LEU C 1 265 ? 47.736  5.534   30.924 1.00 24.44 ? 265 LEU B C     1 
ATOM   5102 O  O     . LEU C 1 265 ? 47.020  4.566   30.751 1.00 25.83 ? 265 LEU B O     1 
ATOM   5103 C  CB    . LEU C 1 265 ? 47.113  7.491   32.368 1.00 28.96 ? 265 LEU B CB    1 
ATOM   5104 C  CG    . LEU C 1 265 ? 45.646  7.405   31.884 1.00 30.89 ? 265 LEU B CG    1 
ATOM   5105 C  CD1   . LEU C 1 265 ? 44.870  6.530   32.827 1.00 22.58 ? 265 LEU B CD1   1 
ATOM   5106 C  CD2   . LEU C 1 265 ? 45.025  8.747   31.945 1.00 32.31 ? 265 LEU B CD2   1 
ATOM   5107 N  N     . LYS C 1 266 ? 48.423  6.060   29.929 1.00 23.11 ? 266 LYS B N     1 
ATOM   5108 C  CA    . LYS C 1 266 ? 48.448  5.520   28.574 1.00 20.86 ? 266 LYS B CA    1 
ATOM   5109 C  C     . LYS C 1 266 ? 48.859  3.998   28.560 1.00 25.21 ? 266 LYS B C     1 
ATOM   5110 O  O     . LYS C 1 266 ? 48.459  3.302   27.638 1.00 28.26 ? 266 LYS B O     1 
ATOM   5111 C  CB    . LYS C 1 266 ? 49.476  6.301   27.747 1.00 18.81 ? 266 LYS B CB    1 
ATOM   5112 C  CG    . LYS C 1 266 ? 48.886  7.410   26.947 1.00 27.12 ? 266 LYS B CG    1 
ATOM   5113 C  CD    . LYS C 1 266 ? 49.839  8.050   25.963 1.00 28.41 ? 266 LYS B CD    1 
ATOM   5114 C  CE    . LYS C 1 266 ? 50.598  9.159   26.743 1.00 31.17 ? 266 LYS B CE    1 
ATOM   5115 N  NZ    . LYS C 1 266 ? 50.659  10.365  25.834 1.00 45.28 ? 266 LYS B NZ    1 
ATOM   5116 N  N     . ASP C 1 267 ? 49.800  3.584   29.413 1.00 26.88 ? 267 ASP B N     1 
ATOM   5117 C  CA    . ASP C 1 267 ? 50.279  2.218   29.507 1.00 30.72 ? 267 ASP B CA    1 
ATOM   5118 C  C     . ASP C 1 267 ? 49.115  1.307   29.997 1.00 29.53 ? 267 ASP B C     1 
ATOM   5119 O  O     . ASP C 1 267 ? 48.749  0.317   29.317 1.00 25.47 ? 267 ASP B O     1 
ATOM   5120 C  CB    . ASP C 1 267 ? 51.495  2.179   30.437 1.00 30.72 ? 267 ASP B CB    1 
ATOM   5121 C  CG    . ASP C 1 267 ? 52.178  0.778   30.482 1.00 34.19 ? 267 ASP B CG    1 
ATOM   5122 O  OD1   . ASP C 1 267 ? 52.761  0.334   29.467 1.00 32.36 ? 267 ASP B OD1   1 
ATOM   5123 O  OD2   . ASP C 1 267 ? 52.227  0.155   31.555 1.00 29.71 ? 267 ASP B OD2   1 
ATOM   5124 N  N     . LEU C 1 268 ? 48.542  1.684   31.142 1.00 27.99 ? 268 LEU B N     1 
ATOM   5125 C  CA    . LEU C 1 268 ? 47.336  1.037   31.675 1.00 26.79 ? 268 LEU B CA    1 
ATOM   5126 C  C     . LEU C 1 268 ? 46.191  0.897   30.639 1.00 28.28 ? 268 LEU B C     1 
ATOM   5127 O  O     . LEU C 1 268 ? 45.802  -0.231  30.288 1.00 32.87 ? 268 LEU B O     1 
ATOM   5128 C  CB    . LEU C 1 268 ? 46.882  1.685   32.980 1.00 23.33 ? 268 LEU B CB    1 
ATOM   5129 C  CG    . LEU C 1 268 ? 45.585  1.108   33.583 1.00 26.39 ? 268 LEU B CG    1 
ATOM   5130 C  CD1   . LEU C 1 268 ? 45.734  -0.348  34.243 1.00 28.86 ? 268 LEU B CD1   1 
ATOM   5131 C  CD2   . LEU C 1 268 ? 44.985  2.107   34.532 1.00 19.64 ? 268 LEU B CD2   1 
ATOM   5132 N  N     . LEU C 1 269 ? 45.922  1.937   29.871 1.00 23.58 ? 269 LEU B N     1 
ATOM   5133 C  CA    . LEU C 1 269 ? 44.832  1.865   28.945 1.00 23.62 ? 269 LEU B CA    1 
ATOM   5134 C  C     . LEU C 1 269 ? 45.205  1.064   27.762 1.00 23.24 ? 269 LEU B C     1 
ATOM   5135 O  O     . LEU C 1 269 ? 44.313  0.589   27.026 1.00 23.16 ? 269 LEU B O     1 
ATOM   5136 C  CB    . LEU C 1 269 ? 44.339  3.258   28.484 1.00 22.28 ? 269 LEU B CB    1 
ATOM   5137 C  CG    . LEU C 1 269 ? 43.761  4.147   29.580 1.00 26.47 ? 269 LEU B CG    1 
ATOM   5138 C  CD1   . LEU C 1 269 ? 43.444  5.425   28.950 1.00 15.39 ? 269 LEU B CD1   1 
ATOM   5139 C  CD2   . LEU C 1 269 ? 42.559  3.455   30.308 1.00 26.04 ? 269 LEU B CD2   1 
ATOM   5140 N  N     . ARG C 1 270 ? 46.498  1.064   27.429 1.00 25.60 ? 270 ARG B N     1 
ATOM   5141 C  CA    . ARG C 1 270 ? 46.856  0.246   26.247 1.00 28.31 ? 270 ARG B CA    1 
ATOM   5142 C  C     . ARG C 1 270 ? 46.667  -1.253  26.599 1.00 23.66 ? 270 ARG B C     1 
ATOM   5143 O  O     . ARG C 1 270 ? 46.321  -2.024  25.719 1.00 26.37 ? 270 ARG B O     1 
ATOM   5144 C  CB    . ARG C 1 270 ? 48.278  0.452   25.792 1.00 28.28 ? 270 ARG B CB    1 
ATOM   5145 C  CG    . ARG C 1 270 ? 48.427  1.584   24.925 1.00 35.22 ? 270 ARG B CG    1 
ATOM   5146 C  CD    . ARG C 1 270 ? 49.871  1.923   25.164 1.00 42.44 ? 270 ARG B CD    1 
ATOM   5147 N  NE    . ARG C 1 270 ? 50.180  3.103   24.375 1.00 47.82 ? 270 ARG B NE    1 
ATOM   5148 C  CZ    . ARG C 1 270 ? 51.013  4.064   24.750 1.00 45.61 ? 270 ARG B CZ    1 
ATOM   5149 N  NH1   . ARG C 1 270 ? 51.684  4.051   25.910 1.00 36.99 ? 270 ARG B NH1   1 
ATOM   5150 N  NH2   . ARG C 1 270 ? 51.088  5.077   23.905 1.00 50.43 ? 270 ARG B NH2   1 
ATOM   5151 N  N     . ASN C 1 271 ? 46.989  -1.595  27.846 1.00 21.30 ? 271 ASN B N     1 
ATOM   5152 C  CA    . ASN C 1 271 ? 46.826  -2.933  28.371 1.00 24.10 ? 271 ASN B CA    1 
ATOM   5153 C  C     . ASN C 1 271 ? 45.323  -3.310  28.591 1.00 29.76 ? 271 ASN B C     1 
ATOM   5154 O  O     . ASN C 1 271 ? 45.027  -4.505  28.533 1.00 33.49 ? 271 ASN B O     1 
ATOM   5155 C  CB    . ASN C 1 271 ? 47.639  -3.055  29.629 1.00 20.02 ? 271 ASN B CB    1 
ATOM   5156 C  CG    . ASN C 1 271 ? 49.141  -3.002  29.382 1.00 31.34 ? 271 ASN B CG    1 
ATOM   5157 O  OD1   . ASN C 1 271 ? 49.927  -2.583  30.224 1.00 34.39 ? 271 ASN B OD1   1 
ATOM   5158 N  ND2   . ASN C 1 271 ? 49.556  -3.686  28.367 1.00 29.80 ? 271 ASN B ND2   1 
ATOM   5159 N  N     . LEU C 1 272 ? 44.397  -2.344  28.765 1.00 26.13 ? 272 LEU B N     1 
ATOM   5160 C  CA    . LEU C 1 272 ? 42.955  -2.567  28.953 1.00 21.70 ? 272 LEU B CA    1 
ATOM   5161 C  C     . LEU C 1 272 ? 42.109  -2.527  27.701 1.00 24.35 ? 272 LEU B C     1 
ATOM   5162 O  O     . LEU C 1 272 ? 41.238  -3.403  27.473 1.00 25.12 ? 272 LEU B O     1 
ATOM   5163 C  CB    . LEU C 1 272 ? 42.390  -1.646  30.017 1.00 24.33 ? 272 LEU B CB    1 
ATOM   5164 C  CG    . LEU C 1 272 ? 42.731  -1.930  31.463 1.00 24.79 ? 272 LEU B CG    1 
ATOM   5165 C  CD1   . LEU C 1 272 ? 42.244  -0.760  32.348 1.00 23.08 ? 272 LEU B CD1   1 
ATOM   5166 C  CD2   . LEU C 1 272 ? 42.024  -3.242  31.817 1.00 27.98 ? 272 LEU B CD2   1 
ATOM   5167 N  N     . LEU C 1 273 ? 42.583  -1.728  26.744 1.00 20.59 ? 273 LEU B N     1 
ATOM   5168 C  CA    . LEU C 1 273 ? 41.915  -1.567  25.480 1.00 21.42 ? 273 LEU B CA    1 
ATOM   5169 C  C     . LEU C 1 273 ? 42.639  -2.397  24.440 1.00 24.73 ? 273 LEU B C     1 
ATOM   5170 O  O     . LEU C 1 273 ? 42.755  -2.062  23.267 1.00 21.87 ? 273 LEU B O     1 
ATOM   5171 C  CB    . LEU C 1 273 ? 41.727  -0.065  25.120 1.00 31.08 ? 273 LEU B CB    1 
ATOM   5172 C  CG    . LEU C 1 273 ? 40.981  0.838   26.147 1.00 31.57 ? 273 LEU B CG    1 
ATOM   5173 C  CD1   . LEU C 1 273 ? 41.136  2.340   25.867 1.00 28.40 ? 273 LEU B CD1   1 
ATOM   5174 C  CD2   . LEU C 1 273 ? 39.498  0.349   26.144 1.00 28.58 ? 273 LEU B CD2   1 
ATOM   5175 N  N     . GLN C 1 274 ? 42.953  -3.601  24.911 1.00 26.62 ? 274 GLN B N     1 
ATOM   5176 C  CA    . GLN C 1 274 ? 43.650  -4.623  24.160 1.00 25.48 ? 274 GLN B CA    1 
ATOM   5177 C  C     . GLN C 1 274 ? 42.619  -5.412  23.378 1.00 25.36 ? 274 GLN B C     1 
ATOM   5178 O  O     . GLN C 1 274 ? 41.729  -5.958  23.991 1.00 29.83 ? 274 GLN B O     1 
ATOM   5179 C  CB    . GLN C 1 274 ? 44.332  -5.454  25.259 1.00 34.67 ? 274 GLN B CB    1 
ATOM   5180 C  CG    . GLN C 1 274 ? 45.621  -6.228  24.984 1.00 38.27 ? 274 GLN B CG    1 
ATOM   5181 C  CD    . GLN C 1 274 ? 46.350  -5.865  23.706 1.00 39.97 ? 274 GLN B CD    1 
ATOM   5182 O  OE1   . GLN C 1 274 ? 45.975  -6.351  22.604 1.00 34.25 ? 274 GLN B OE1   1 
ATOM   5183 N  NE2   . GLN C 1 274 ? 47.193  -4.814  23.820 1.00 38.25 ? 274 GLN B NE2   1 
ATOM   5184 N  N     . VAL C 1 275 ? 42.604  -5.347  22.058 1.00 25.11 ? 275 VAL B N     1 
ATOM   5185 C  CA    . VAL C 1 275 ? 41.654  -6.065  21.222 1.00 34.41 ? 275 VAL B CA    1 
ATOM   5186 C  C     . VAL C 1 275 ? 41.787  -7.580  21.344 1.00 41.07 ? 275 VAL B C     1 
ATOM   5187 O  O     . VAL C 1 275 ? 40.769  -8.287  21.296 1.00 40.47 ? 275 VAL B O     1 
ATOM   5188 C  CB    . VAL C 1 275 ? 41.740  -5.642  19.760 1.00 33.68 ? 275 VAL B CB    1 
ATOM   5189 C  CG1   . VAL C 1 275 ? 40.950  -6.550  18.836 1.00 39.54 ? 275 VAL B CG1   1 
ATOM   5190 C  CG2   . VAL C 1 275 ? 41.109  -4.260  19.611 1.00 31.77 ? 275 VAL B CG2   1 
ATOM   5191 N  N     . ASP C 1 276 ? 43.012  -8.017  21.634 1.00 44.81 ? 276 ASP B N     1 
ATOM   5192 C  CA    . ASP C 1 276 ? 43.341  -9.413  21.790 1.00 47.90 ? 276 ASP B CA    1 
ATOM   5193 C  C     . ASP C 1 276 ? 43.154  -9.729  23.256 1.00 46.39 ? 276 ASP B C     1 
ATOM   5194 O  O     . ASP C 1 276 ? 43.977  -9.420  24.113 1.00 45.19 ? 276 ASP B O     1 
ATOM   5195 C  CB    . ASP C 1 276 ? 44.755  -9.633  21.222 1.00 56.89 ? 276 ASP B CB    1 
ATOM   5196 C  CG    . ASP C 1 276 ? 45.244  -11.071 21.331 1.00 62.57 ? 276 ASP B CG    1 
ATOM   5197 O  OD1   . ASP C 1 276 ? 44.582  -12.037 20.866 1.00 68.70 ? 276 ASP B OD1   1 
ATOM   5198 O  OD2   . ASP C 1 276 ? 46.326  -11.233 21.920 1.00 63.36 ? 276 ASP B OD2   1 
ATOM   5199 N  N     . LEU C 1 277 ? 42.028  -10.381 23.539 1.00 50.80 ? 277 LEU B N     1 
ATOM   5200 C  CA    . LEU C 1 277 ? 41.630  -10.783 24.916 1.00 50.57 ? 277 LEU B CA    1 
ATOM   5201 C  C     . LEU C 1 277 ? 42.505  -11.827 25.659 1.00 49.36 ? 277 LEU B C     1 
ATOM   5202 O  O     . LEU C 1 277 ? 42.339  -12.070 26.848 1.00 47.94 ? 277 LEU B O     1 
ATOM   5203 C  CB    . LEU C 1 277 ? 40.118  -11.041 25.020 1.00 46.63 ? 277 LEU B CB    1 
ATOM   5204 C  CG    . LEU C 1 277 ? 39.625  -12.237 24.235 1.00 41.57 ? 277 LEU B CG    1 
ATOM   5205 C  CD1   . LEU C 1 277 ? 38.707  -12.948 25.121 1.00 46.07 ? 277 LEU B CD1   1 
ATOM   5206 C  CD2   . LEU C 1 277 ? 38.952  -11.791 23.002 1.00 43.86 ? 277 LEU B CD2   1 
ATOM   5207 N  N     . THR C 1 278 ? 43.551  -12.211 24.942 1.00 48.21 ? 278 THR B N     1 
ATOM   5208 C  CA    . THR C 1 278 ? 44.668  -13.070 25.269 1.00 53.40 ? 278 THR B CA    1 
ATOM   5209 C  C     . THR C 1 278 ? 45.718  -12.187 25.942 1.00 53.72 ? 278 THR B C     1 
ATOM   5210 O  O     . THR C 1 278 ? 46.550  -12.745 26.696 1.00 60.23 ? 278 THR B O     1 
ATOM   5211 C  CB    . THR C 1 278 ? 45.271  -13.488 23.905 1.00 57.71 ? 278 THR B CB    1 
ATOM   5212 O  OG1   . THR C 1 278 ? 44.256  -14.153 23.135 1.00 64.58 ? 278 THR B OG1   1 
ATOM   5213 C  CG2   . THR C 1 278 ? 46.703  -14.109 23.890 1.00 45.16 ? 278 THR B CG2   1 
ATOM   5214 N  N     . LYS C 1 279 ? 45.865  -10.946 25.443 1.00 46.62 ? 279 LYS B N     1 
ATOM   5215 C  CA    . LYS C 1 279 ? 46.806  -9.939  25.982 1.00 40.91 ? 279 LYS B CA    1 
ATOM   5216 C  C     . LYS C 1 279 ? 46.186  -8.958  27.000 1.00 38.63 ? 279 LYS B C     1 
ATOM   5217 O  O     . LYS C 1 279 ? 46.920  -8.245  27.689 1.00 38.08 ? 279 LYS B O     1 
ATOM   5218 C  CB    . LYS C 1 279 ? 47.465  -9.154  24.842 1.00 37.28 ? 279 LYS B CB    1 
ATOM   5219 C  CG    . LYS C 1 279 ? 48.414  -9.907  23.931 1.00 36.52 ? 279 LYS B CG    1 
ATOM   5220 C  CD    . LYS C 1 279 ? 49.018  -9.095  22.820 0.00 41.54 ? 279 LYS B CD    1 
ATOM   5221 C  CE    . LYS C 1 279 ? 49.687  -10.056 21.854 0.00 41.98 ? 279 LYS B CE    1 
ATOM   5222 N  NZ    . LYS C 1 279 ? 50.669  -9.402  20.975 0.00 40.07 ? 279 LYS B NZ    1 
ATOM   5223 N  N     . ARG C 1 280 ? 44.852  -8.992  27.150 1.00 36.66 ? 280 ARG B N     1 
ATOM   5224 C  CA    . ARG C 1 280 ? 44.108  -8.103  28.043 1.00 26.35 ? 280 ARG B CA    1 
ATOM   5225 C  C     . ARG C 1 280 ? 44.296  -8.147  29.550 1.00 26.34 ? 280 ARG B C     1 
ATOM   5226 O  O     . ARG C 1 280 ? 44.031  -9.140  30.202 1.00 29.11 ? 280 ARG B O     1 
ATOM   5227 C  CB    . ARG C 1 280 ? 42.647  -8.087  27.604 1.00 22.59 ? 280 ARG B CB    1 
ATOM   5228 C  CG    . ARG C 1 280 ? 41.890  -6.803  28.051 1.00 24.87 ? 280 ARG B CG    1 
ATOM   5229 C  CD    . ARG C 1 280 ? 40.416  -6.695  27.702 1.00 12.94 ? 280 ARG B CD    1 
ATOM   5230 N  NE    . ARG C 1 280 ? 40.312  -6.803  26.259 1.00 15.21 ? 280 ARG B NE    1 
ATOM   5231 C  CZ    . ARG C 1 280 ? 39.215  -7.257  25.658 1.00 9.82  ? 280 ARG B CZ    1 
ATOM   5232 N  NH1   . ARG C 1 280 ? 38.275  -7.774  26.459 1.00 19.19 ? 280 ARG B NH1   1 
ATOM   5233 N  NH2   . ARG C 1 280 ? 39.146  -7.390  24.338 1.00 11.46 ? 280 ARG B NH2   1 
ATOM   5234 N  N     . PHE C 1 281 ? 44.773  -7.059  30.147 1.00 27.31 ? 281 PHE B N     1 
ATOM   5235 C  CA    . PHE C 1 281 ? 44.860  -6.940  31.591 1.00 25.29 ? 281 PHE B CA    1 
ATOM   5236 C  C     . PHE C 1 281 ? 43.531  -7.255  32.241 1.00 25.99 ? 281 PHE B C     1 
ATOM   5237 O  O     . PHE C 1 281 ? 42.470  -6.952  31.674 1.00 19.53 ? 281 PHE B O     1 
ATOM   5238 C  CB    . PHE C 1 281 ? 45.260  -5.509  31.955 1.00 31.59 ? 281 PHE B CB    1 
ATOM   5239 C  CG    . PHE C 1 281 ? 46.732  -5.355  32.262 1.00 37.62 ? 281 PHE B CG    1 
ATOM   5240 C  CD1   . PHE C 1 281 ? 47.717  -6.150  31.604 1.00 36.67 ? 281 PHE B CD1   1 
ATOM   5241 C  CD2   . PHE C 1 281 ? 47.155  -4.366  33.155 1.00 34.42 ? 281 PHE B CD2   1 
ATOM   5242 C  CE1   . PHE C 1 281 ? 49.072  -5.924  31.852 1.00 40.59 ? 281 PHE B CE1   1 
ATOM   5243 C  CE2   . PHE C 1 281 ? 48.526  -4.149  33.416 1.00 34.37 ? 281 PHE B CE2   1 
ATOM   5244 C  CZ    . PHE C 1 281 ? 49.469  -4.921  32.771 1.00 32.34 ? 281 PHE B CZ    1 
ATOM   5245 N  N     . GLY C 1 282 ? 43.648  -8.029  33.315 1.00 28.15 ? 282 GLY B N     1 
ATOM   5246 C  CA    . GLY C 1 282 ? 42.527  -8.585  34.086 1.00 30.22 ? 282 GLY B CA    1 
ATOM   5247 C  C     . GLY C 1 282 ? 42.170  -10.017 33.661 1.00 32.48 ? 282 GLY B C     1 
ATOM   5248 O  O     . GLY C 1 282 ? 41.459  -10.700 34.413 1.00 37.75 ? 282 GLY B O     1 
ATOM   5249 N  N     . ASN C 1 283 ? 42.519  -10.410 32.431 1.00 32.76 ? 283 ASN B N     1 
ATOM   5250 C  CA    . ASN C 1 283 ? 42.305  -11.724 31.794 1.00 34.81 ? 283 ASN B CA    1 
ATOM   5251 C  C     . ASN C 1 283 ? 43.615  -12.496 31.548 1.00 36.13 ? 283 ASN B C     1 
ATOM   5252 O  O     . ASN C 1 283 ? 43.761  -13.221 30.580 1.00 37.44 ? 283 ASN B O     1 
ATOM   5253 C  CB    . ASN C 1 283 ? 41.619  -11.532 30.443 1.00 30.95 ? 283 ASN B CB    1 
ATOM   5254 C  CG    . ASN C 1 283 ? 40.893  -12.763 29.947 1.00 28.64 ? 283 ASN B CG    1 
ATOM   5255 O  OD1   . ASN C 1 283 ? 40.909  -13.055 28.748 1.00 28.33 ? 283 ASN B OD1   1 
ATOM   5256 N  ND2   . ASN C 1 283 ? 40.161  -13.421 30.840 1.00 25.27 ? 283 ASN B ND2   1 
ATOM   5257 N  N     . LEU C 1 284 ? 44.647  -12.185 32.325 1.00 39.87 ? 284 LEU B N     1 
ATOM   5258 C  CA    . LEU C 1 284 ? 45.941  -12.875 32.236 1.00 38.93 ? 284 LEU B CA    1 
ATOM   5259 C  C     . LEU C 1 284 ? 46.055  -13.819 33.443 1.00 37.82 ? 284 LEU B C     1 
ATOM   5260 O  O     . LEU C 1 284 ? 45.102  -13.952 34.223 1.00 35.45 ? 284 LEU B O     1 
ATOM   5261 C  CB    . LEU C 1 284 ? 47.106  -11.863 32.143 1.00 35.07 ? 284 LEU B CB    1 
ATOM   5262 C  CG    . LEU C 1 284 ? 47.105  -10.821 31.000 1.00 35.99 ? 284 LEU B CG    1 
ATOM   5263 C  CD1   . LEU C 1 284 ? 48.335  -9.889  31.100 1.00 32.58 ? 284 LEU B CD1   1 
ATOM   5264 C  CD2   . LEU C 1 284 ? 46.958  -11.491 29.658 1.00 35.92 ? 284 LEU B CD2   1 
ATOM   5265 N  N     . LYS C 1 285 ? 47.242  -14.397 33.647 1.00 39.51 ? 285 LYS B N     1 
ATOM   5266 C  CA    . LYS C 1 285 ? 47.437  -15.363 34.699 1.00 40.10 ? 285 LYS B CA    1 
ATOM   5267 C  C     . LYS C 1 285 ? 47.261  -14.790 36.079 1.00 40.24 ? 285 LYS B C     1 
ATOM   5268 O  O     . LYS C 1 285 ? 46.639  -15.434 36.936 1.00 39.22 ? 285 LYS B O     1 
ATOM   5269 C  CB    . LYS C 1 285 ? 48.777  -16.092 34.522 1.00 47.17 ? 285 LYS B CB    1 
ATOM   5270 C  CG    . LYS C 1 285 ? 49.345  -16.111 33.102 0.00 49.42 ? 285 LYS B CG    1 
ATOM   5271 C  CD    . LYS C 1 285 ? 48.401  -16.729 32.081 0.00 53.02 ? 285 LYS B CD    1 
ATOM   5272 C  CE    . LYS C 1 285 ? 48.976  -16.581 30.680 0.00 54.48 ? 285 LYS B CE    1 
ATOM   5273 N  NZ    . LYS C 1 285 ? 48.040  -17.031 29.615 0.00 56.51 ? 285 LYS B NZ    1 
ATOM   5274 N  N     . ASP C 1 286 ? 47.820  -13.597 36.294 1.00 41.01 ? 286 ASP B N     1 
ATOM   5275 C  CA    . ASP C 1 286 ? 47.676  -12.907 37.587 1.00 39.86 ? 286 ASP B CA    1 
ATOM   5276 C  C     . ASP C 1 286 ? 46.295  -12.292 37.815 1.00 37.27 ? 286 ASP B C     1 
ATOM   5277 O  O     . ASP C 1 286 ? 45.895  -12.052 38.963 1.00 38.99 ? 286 ASP B O     1 
ATOM   5278 C  CB    . ASP C 1 286 ? 48.773  -11.898 37.825 1.00 40.87 ? 286 ASP B CB    1 
ATOM   5279 C  CG    . ASP C 1 286 ? 50.111  -12.505 37.633 1.00 52.07 ? 286 ASP B CG    1 
ATOM   5280 O  OD1   . ASP C 1 286 ? 50.349  -13.530 38.322 1.00 54.36 ? 286 ASP B OD1   1 
ATOM   5281 O  OD2   . ASP C 1 286 ? 50.834  -12.030 36.726 1.00 54.07 ? 286 ASP B OD2   1 
ATOM   5282 N  N     . GLY C 1 287 ? 45.520  -12.266 36.741 1.00 35.00 ? 287 GLY B N     1 
ATOM   5283 C  CA    . GLY C 1 287 ? 44.151  -11.791 36.833 1.00 38.98 ? 287 GLY B CA    1 
ATOM   5284 C  C     . GLY C 1 287 ? 44.080  -10.300 37.115 1.00 36.34 ? 287 GLY B C     1 
ATOM   5285 O  O     . GLY C 1 287 ? 44.851  -9.553  36.494 1.00 36.37 ? 287 GLY B O     1 
ATOM   5286 N  N     . VAL C 1 288 ? 43.327  -9.967  38.171 1.00 33.71 ? 288 VAL B N     1 
ATOM   5287 C  CA    . VAL C 1 288 ? 43.027  -8.607  38.603 1.00 32.87 ? 288 VAL B CA    1 
ATOM   5288 C  C     . VAL C 1 288 ? 44.314  -7.976  39.063 1.00 39.59 ? 288 VAL B C     1 
ATOM   5289 O  O     . VAL C 1 288 ? 44.470  -6.780  38.794 1.00 44.01 ? 288 VAL B O     1 
ATOM   5290 C  CB    . VAL C 1 288 ? 41.848  -8.431  39.657 1.00 34.86 ? 288 VAL B CB    1 
ATOM   5291 C  CG1   . VAL C 1 288 ? 42.176  -8.756  41.100 1.00 27.66 ? 288 VAL B CG1   1 
ATOM   5292 C  CG2   . VAL C 1 288 ? 41.345  -7.041  39.660 1.00 31.12 ? 288 VAL B CG2   1 
ATOM   5293 N  N     . ASN C 1 289 ? 45.253  -8.797  39.548 1.00 37.36 ? 289 ASN B N     1 
ATOM   5294 C  CA    . ASN C 1 289 ? 46.516  -8.319  40.050 1.00 33.62 ? 289 ASN B CA    1 
ATOM   5295 C  C     . ASN C 1 289 ? 47.424  -7.581  39.069 1.00 34.91 ? 289 ASN B C     1 
ATOM   5296 O  O     . ASN C 1 289 ? 48.130  -6.622  39.477 1.00 33.08 ? 289 ASN B O     1 
ATOM   5297 C  CB    . ASN C 1 289 ? 47.171  -9.370  40.900 1.00 35.30 ? 289 ASN B CB    1 
ATOM   5298 C  CG    . ASN C 1 289 ? 46.456  -9.515  42.193 1.00 43.11 ? 289 ASN B CG    1 
ATOM   5299 O  OD1   . ASN C 1 289 ? 45.865  -10.545 42.479 1.00 47.46 ? 289 ASN B OD1   1 
ATOM   5300 N  ND2   . ASN C 1 289 ? 46.437  -8.444  42.975 1.00 54.39 ? 289 ASN B ND2   1 
ATOM   5301 N  N     . ASP C 1 290 ? 47.256  -7.884  37.779 1.00 31.49 ? 290 ASP B N     1 
ATOM   5302 C  CA    . ASP C 1 290 ? 47.979  -7.094  36.772 1.00 35.87 ? 290 ASP B CA    1 
ATOM   5303 C  C     . ASP C 1 290 ? 47.525  -5.615  36.859 1.00 35.34 ? 290 ASP B C     1 
ATOM   5304 O  O     . ASP C 1 290 ? 48.344  -4.720  36.632 1.00 40.98 ? 290 ASP B O     1 
ATOM   5305 C  CB    . ASP C 1 290 ? 47.602  -7.466  35.334 1.00 38.54 ? 290 ASP B CB    1 
ATOM   5306 C  CG    . ASP C 1 290 ? 47.827  -8.928  34.987 1.00 49.73 ? 290 ASP B CG    1 
ATOM   5307 O  OD1   . ASP C 1 290 ? 48.979  -9.363  35.299 1.00 35.15 ? 290 ASP B OD1   1 
ATOM   5308 O  OD2   . ASP C 1 290 ? 46.826  -9.527  34.428 1.00 50.99 ? 290 ASP B OD2   1 
ATOM   5309 N  N     . ILE C 1 291 ? 46.229  -5.361  37.072 1.00 26.79 ? 291 ILE B N     1 
ATOM   5310 C  CA    . ILE C 1 291 ? 45.710  -3.996  37.112 1.00 23.79 ? 291 ILE B CA    1 
ATOM   5311 C  C     . ILE C 1 291 ? 46.068  -3.321  38.433 1.00 23.46 ? 291 ILE B C     1 
ATOM   5312 O  O     . ILE C 1 291 ? 46.610  -2.216  38.458 1.00 26.98 ? 291 ILE B O     1 
ATOM   5313 C  CB    . ILE C 1 291 ? 44.221  -3.991  36.978 1.00 28.59 ? 291 ILE B CB    1 
ATOM   5314 C  CG1   . ILE C 1 291 ? 43.777  -4.598  35.640 1.00 24.01 ? 291 ILE B CG1   1 
ATOM   5315 C  CG2   . ILE C 1 291 ? 43.745  -2.526  36.947 1.00 31.51 ? 291 ILE B CG2   1 
ATOM   5316 C  CD1   . ILE C 1 291 ? 42.326  -4.850  35.662 1.00 23.02 ? 291 ILE B CD1   1 
ATOM   5317 N  N     . LYS C 1 292 ? 45.831  -3.979  39.548 1.00 21.09 ? 292 LYS B N     1 
ATOM   5318 C  CA    . LYS C 1 292 ? 46.098  -3.387  40.824 1.00 22.16 ? 292 LYS B CA    1 
ATOM   5319 C  C     . LYS C 1 292 ? 47.484  -2.867  41.130 1.00 26.35 ? 292 LYS B C     1 
ATOM   5320 O  O     . LYS C 1 292 ? 47.646  -2.117  42.122 1.00 28.79 ? 292 LYS B O     1 
ATOM   5321 C  CB    . LYS C 1 292 ? 45.625  -4.287  41.965 1.00 20.29 ? 292 LYS B CB    1 
ATOM   5322 C  CG    . LYS C 1 292 ? 44.140  -4.684  41.899 1.00 27.39 ? 292 LYS B CG    1 
ATOM   5323 C  CD    . LYS C 1 292 ? 43.724  -4.747  43.389 1.00 26.96 ? 292 LYS B CD    1 
ATOM   5324 C  CE    . LYS C 1 292 ? 42.700  -5.775  43.733 1.00 24.57 ? 292 LYS B CE    1 
ATOM   5325 N  NZ    . LYS C 1 292 ? 42.770  -6.052  45.198 1.00 26.03 ? 292 LYS B NZ    1 
ATOM   5326 N  N     . ASN C 1 293 ? 48.423  -3.642  40.580 1.00 32.05 ? 293 ASN B N     1 
ATOM   5327 C  CA    . ASN C 1 293 ? 49.880  -3.500  40.715 1.00 32.50 ? 293 ASN B CA    1 
ATOM   5328 C  C     . ASN C 1 293 ? 50.437  -2.613  39.625 1.00 33.25 ? 293 ASN B C     1 
ATOM   5329 O  O     . ASN C 1 293 ? 51.672  -2.562  39.479 1.00 33.38 ? 293 ASN B O     1 
ATOM   5330 C  CB    . ASN C 1 293 ? 50.555  -4.885  40.563 1.00 35.73 ? 293 ASN B CB    1 
ATOM   5331 C  CG    . ASN C 1 293 ? 50.385  -5.773  41.768 1.00 39.91 ? 293 ASN B CG    1 
ATOM   5332 O  OD1   . ASN C 1 293 ? 50.245  -5.305  42.896 1.00 42.36 ? 293 ASN B OD1   1 
ATOM   5333 N  ND2   . ASN C 1 293 ? 50.496  -7.077  41.551 1.00 44.28 ? 293 ASN B ND2   1 
ATOM   5334 N  N     . HIS C 1 294 ? 49.583  -2.173  38.687 1.00 31.18 ? 294 HIS B N     1 
ATOM   5335 C  CA    . HIS C 1 294 ? 50.042  -1.223  37.688 1.00 29.99 ? 294 HIS B CA    1 
ATOM   5336 C  C     . HIS C 1 294 ? 50.497  0.116   38.341 1.00 33.16 ? 294 HIS B C     1 
ATOM   5337 O  O     . HIS C 1 294 ? 50.026  0.484   39.436 1.00 26.32 ? 294 HIS B O     1 
ATOM   5338 C  CB    . HIS C 1 294 ? 49.038  -1.064  36.587 1.00 25.16 ? 294 HIS B CB    1 
ATOM   5339 C  CG    . HIS C 1 294 ? 49.552  -0.316  35.405 1.00 26.53 ? 294 HIS B CG    1 
ATOM   5340 N  ND1   . HIS C 1 294 ? 49.930  1.017   35.478 1.00 29.95 ? 294 HIS B ND1   1 
ATOM   5341 C  CD2   . HIS C 1 294 ? 49.756  -0.692  34.125 1.00 25.63 ? 294 HIS B CD2   1 
ATOM   5342 C  CE1   . HIS C 1 294 ? 50.396  1.406   34.301 1.00 25.71 ? 294 HIS B CE1   1 
ATOM   5343 N  NE2   . HIS C 1 294 ? 50.283  0.395   33.462 1.00 22.93 ? 294 HIS B NE2   1 
ATOM   5344 N  N     . LYS C 1 295 ? 51.630  0.627   37.816 1.00 33.88 ? 295 LYS B N     1 
ATOM   5345 C  CA    . LYS C 1 295 ? 52.258  1.916   38.171 1.00 33.29 ? 295 LYS B CA    1 
ATOM   5346 C  C     . LYS C 1 295 ? 51.202  3.025   38.324 1.00 34.00 ? 295 LYS B C     1 
ATOM   5347 O  O     . LYS C 1 295 ? 51.297  3.772   39.310 1.00 33.19 ? 295 LYS B O     1 
ATOM   5348 C  CB    . LYS C 1 295 ? 53.199  2.411   37.063 1.00 32.38 ? 295 LYS B CB    1 
ATOM   5349 C  CG    . LYS C 1 295 ? 54.657  2.201   37.296 1.00 32.69 ? 295 LYS B CG    1 
ATOM   5350 C  CD    . LYS C 1 295 ? 55.154  2.876   38.557 1.00 37.52 ? 295 LYS B CD    1 
ATOM   5351 C  CE    . LYS C 1 295 ? 56.426  2.186   39.120 1.00 37.49 ? 295 LYS B CE    1 
ATOM   5352 N  NZ    . LYS C 1 295 ? 57.327  2.998   39.999 0.00 34.11 ? 295 LYS B NZ    1 
ATOM   5353 N  N     . TRP C 1 296 ? 50.141  3.023   37.494 1.00 28.46 ? 296 TRP B N     1 
ATOM   5354 C  CA    . TRP C 1 296 ? 49.077  4.019   37.675 1.00 30.35 ? 296 TRP B CA    1 
ATOM   5355 C  C     . TRP C 1 296 ? 48.404  3.962   39.030 1.00 30.73 ? 296 TRP B C     1 
ATOM   5356 O  O     . TRP C 1 296 ? 48.066  5.020   39.551 1.00 35.08 ? 296 TRP B O     1 
ATOM   5357 C  CB    . TRP C 1 296 ? 48.062  4.022   36.538 1.00 33.27 ? 296 TRP B CB    1 
ATOM   5358 C  CG    . TRP C 1 296 ? 47.310  5.312   36.367 1.00 39.42 ? 296 TRP B CG    1 
ATOM   5359 C  CD1   . TRP C 1 296 ? 47.810  6.460   35.846 1.00 41.80 ? 296 TRP B CD1   1 
ATOM   5360 C  CD2   . TRP C 1 296 ? 45.898  5.553   36.575 1.00 38.98 ? 296 TRP B CD2   1 
ATOM   5361 N  NE1   . TRP C 1 296 ? 46.817  7.391   35.662 1.00 40.95 ? 296 TRP B NE1   1 
ATOM   5362 C  CE2   . TRP C 1 296 ? 45.629  6.893   36.120 1.00 37.01 ? 296 TRP B CE2   1 
ATOM   5363 C  CE3   . TRP C 1 296 ? 44.835  4.776   37.073 1.00 30.22 ? 296 TRP B CE3   1 
ATOM   5364 C  CZ2   . TRP C 1 296 ? 44.324  7.495   36.153 1.00 34.16 ? 296 TRP B CZ2   1 
ATOM   5365 C  CZ3   . TRP C 1 296 ? 43.509  5.361   37.092 1.00 37.61 ? 296 TRP B CZ3   1 
ATOM   5366 C  CH2   . TRP C 1 296 ? 43.280  6.730   36.630 1.00 33.52 ? 296 TRP B CH2   1 
ATOM   5367 N  N     . PHE C 1 297 ? 48.428  2.806   39.700 1.00 27.83 ? 297 PHE B N     1 
ATOM   5368 C  CA    . PHE C 1 297 ? 47.783  2.633   41.005 1.00 22.42 ? 297 PHE B CA    1 
ATOM   5369 C  C     . PHE C 1 297 ? 48.739  2.541   42.136 1.00 22.53 ? 297 PHE B C     1 
ATOM   5370 O  O     . PHE C 1 297 ? 48.289  2.359   43.241 1.00 25.48 ? 297 PHE B O     1 
ATOM   5371 C  CB    . PHE C 1 297 ? 46.815  1.411   41.094 1.00 24.25 ? 297 PHE B CB    1 
ATOM   5372 C  CG    . PHE C 1 297 ? 45.560  1.546   40.274 1.00 15.36 ? 297 PHE B CG    1 
ATOM   5373 C  CD1   . PHE C 1 297 ? 44.452  2.259   40.781 1.00 21.17 ? 297 PHE B CD1   1 
ATOM   5374 C  CD2   . PHE C 1 297 ? 45.461  0.909   39.036 1.00 13.90 ? 297 PHE B CD2   1 
ATOM   5375 C  CE1   . PHE C 1 297 ? 43.201  2.337   40.065 1.00 16.80 ? 297 PHE B CE1   1 
ATOM   5376 C  CE2   . PHE C 1 297 ? 44.224  0.926   38.300 1.00 19.75 ? 297 PHE B CE2   1 
ATOM   5377 C  CZ    . PHE C 1 297 ? 43.100  1.644   38.830 1.00 15.89 ? 297 PHE B CZ    1 
ATOM   5378 N  N     . ALA C 1 298 ? 50.016  2.853   41.926 1.00 27.93 ? 298 ALA B N     1 
ATOM   5379 C  CA    . ALA C 1 298 ? 51.062  2.798   42.956 1.00 27.73 ? 298 ALA B CA    1 
ATOM   5380 C  C     . ALA C 1 298 ? 50.715  3.519   44.221 1.00 27.86 ? 298 ALA B C     1 
ATOM   5381 O  O     . ALA C 1 298 ? 50.879  2.937   45.261 1.00 32.65 ? 298 ALA B O     1 
ATOM   5382 C  CB    . ALA C 1 298 ? 52.400  3.316   42.415 1.00 31.75 ? 298 ALA B CB    1 
ATOM   5383 N  N     . THR C 1 299 ? 50.070  4.678   44.143 1.00 33.10 ? 299 THR B N     1 
ATOM   5384 C  CA    . THR C 1 299 ? 49.666  5.464   45.333 1.00 36.57 ? 299 THR B CA    1 
ATOM   5385 C  C     . THR C 1 299 ? 48.305  5.084   45.984 1.00 38.69 ? 299 THR B C     1 
ATOM   5386 O  O     . THR C 1 299 ? 47.886  5.734   46.954 1.00 42.93 ? 299 THR B O     1 
ATOM   5387 C  CB    . THR C 1 299 ? 49.595  6.980   44.973 1.00 39.57 ? 299 THR B CB    1 
ATOM   5388 O  OG1   . THR C 1 299 ? 48.782  7.189   43.801 1.00 39.05 ? 299 THR B OG1   1 
ATOM   5389 C  CG2   . THR C 1 299 ? 50.969  7.473   44.642 1.00 44.63 ? 299 THR B CG2   1 
ATOM   5390 N  N     . THR C 1 300 ? 47.570  4.120   45.423 1.00 35.00 ? 300 THR B N     1 
ATOM   5391 C  CA    . THR C 1 300 ? 46.250  3.684   45.936 1.00 34.47 ? 300 THR B CA    1 
ATOM   5392 C  C     . THR C 1 300 ? 46.299  2.640   47.063 1.00 33.96 ? 300 THR B C     1 
ATOM   5393 O  O     . THR C 1 300 ? 46.998  1.641   46.940 1.00 33.17 ? 300 THR B O     1 
ATOM   5394 C  CB    . THR C 1 300 ? 45.427  3.136   44.757 1.00 36.02 ? 300 THR B CB    1 
ATOM   5395 O  OG1   . THR C 1 300 ? 45.408  4.117   43.696 1.00 36.80 ? 300 THR B OG1   1 
ATOM   5396 C  CG2   . THR C 1 300 ? 44.023  2.708   45.162 1.00 32.80 ? 300 THR B CG2   1 
ATOM   5397 N  N     . ASP C 1 301 ? 45.685  2.956   48.206 1.00 31.82 ? 301 ASP B N     1 
ATOM   5398 C  CA    . ASP C 1 301 ? 45.581  2.054   49.352 1.00 35.22 ? 301 ASP B CA    1 
ATOM   5399 C  C     . ASP C 1 301 ? 44.262  1.320   49.100 1.00 36.39 ? 301 ASP B C     1 
ATOM   5400 O  O     . ASP C 1 301 ? 43.165  1.816   49.442 1.00 37.39 ? 301 ASP B O     1 
ATOM   5401 C  CB    . ASP C 1 301 ? 45.468  2.832   50.669 1.00 44.50 ? 301 ASP B CB    1 
ATOM   5402 C  CG    . ASP C 1 301 ? 45.670  1.971   51.911 1.00 53.70 ? 301 ASP B CG    1 
ATOM   5403 O  OD1   . ASP C 1 301 ? 45.060  0.877   52.028 1.00 57.36 ? 301 ASP B OD1   1 
ATOM   5404 O  OD2   . ASP C 1 301 ? 46.404  2.436   52.832 1.00 62.97 ? 301 ASP B OD2   1 
ATOM   5405 N  N     . TRP C 1 302 ? 44.407  0.093   48.605 1.00 31.06 ? 302 TRP B N     1 
ATOM   5406 C  CA    . TRP C 1 302 ? 43.285  -0.754  48.196 1.00 30.93 ? 302 TRP B CA    1 
ATOM   5407 C  C     . TRP C 1 302 ? 42.381  -1.080  49.345 1.00 31.77 ? 302 TRP B C     1 
ATOM   5408 O  O     . TRP C 1 302 ? 41.170  -0.828  49.247 1.00 33.54 ? 302 TRP B O     1 
ATOM   5409 C  CB    . TRP C 1 302 ? 43.720  -2.008  47.415 1.00 23.86 ? 302 TRP B CB    1 
ATOM   5410 C  CG    . TRP C 1 302 ? 44.326  -1.689  46.168 1.00 19.09 ? 302 TRP B CG    1 
ATOM   5411 C  CD1   . TRP C 1 302 ? 45.676  -1.616  45.900 1.00 22.74 ? 302 TRP B CD1   1 
ATOM   5412 C  CD2   . TRP C 1 302 ? 43.665  -1.362  44.967 1.00 21.06 ? 302 TRP B CD2   1 
ATOM   5413 N  NE1   . TRP C 1 302 ? 45.896  -1.301  44.564 1.00 27.47 ? 302 TRP B NE1   1 
ATOM   5414 C  CE2   . TRP C 1 302 ? 44.670  -1.144  43.971 1.00 21.95 ? 302 TRP B CE2   1 
ATOM   5415 C  CE3   . TRP C 1 302 ? 42.316  -1.240  44.612 1.00 24.55 ? 302 TRP B CE3   1 
ATOM   5416 C  CZ2   . TRP C 1 302 ? 44.368  -0.830  42.635 1.00 25.70 ? 302 TRP B CZ2   1 
ATOM   5417 C  CZ3   . TRP C 1 302 ? 42.002  -0.933  43.253 1.00 22.38 ? 302 TRP B CZ3   1 
ATOM   5418 C  CH2   . TRP C 1 302 ? 43.037  -0.739  42.274 1.00 28.35 ? 302 TRP B CH2   1 
ATOM   5419 N  N     . ILE C 1 303 ? 43.018  -1.272  50.499 1.00 33.81 ? 303 ILE B N     1 
ATOM   5420 C  CA    . ILE C 1 303 ? 42.286  -1.542  51.724 1.00 36.08 ? 303 ILE B CA    1 
ATOM   5421 C  C     . ILE C 1 303 ? 41.530  -0.316  52.227 1.00 36.53 ? 303 ILE B C     1 
ATOM   5422 O  O     . ILE C 1 303 ? 40.406  -0.507  52.676 1.00 38.84 ? 303 ILE B O     1 
ATOM   5423 C  CB    . ILE C 1 303 ? 43.152  -2.211  52.892 1.00 39.92 ? 303 ILE B CB    1 
ATOM   5424 C  CG1   . ILE C 1 303 ? 43.591  -3.647  52.541 1.00 39.08 ? 303 ILE B CG1   1 
ATOM   5425 C  CG2   . ILE C 1 303 ? 42.311  -2.423  54.206 1.00 34.68 ? 303 ILE B CG2   1 
ATOM   5426 C  CD1   . ILE C 1 303 ? 44.569  -3.652  51.445 1.00 39.62 ? 303 ILE B CD1   1 
ATOM   5427 N  N     . ALA C 1 304 ? 42.138  0.881   52.215 1.00 37.05 ? 304 ALA B N     1 
ATOM   5428 C  CA    . ALA C 1 304 ? 41.512  2.127   52.752 1.00 34.89 ? 304 ALA B CA    1 
ATOM   5429 C  C     . ALA C 1 304 ? 40.311  2.589   51.941 1.00 28.84 ? 304 ALA B C     1 
ATOM   5430 O  O     . ALA C 1 304 ? 39.347  3.060   52.496 1.00 34.17 ? 304 ALA B O     1 
ATOM   5431 C  CB    . ALA C 1 304 ? 42.517  3.249   52.889 1.00 37.57 ? 304 ALA B CB    1 
ATOM   5432 N  N     . ILE C 1 305 ? 40.395  2.441   50.639 1.00 23.41 ? 305 ILE B N     1 
ATOM   5433 C  CA    . ILE C 1 305 ? 39.307  2.666   49.697 1.00 31.06 ? 305 ILE B CA    1 
ATOM   5434 C  C     . ILE C 1 305 ? 38.118  1.728   49.977 1.00 30.69 ? 305 ILE B C     1 
ATOM   5435 O  O     . ILE C 1 305 ? 36.972  2.208   50.070 1.00 29.18 ? 305 ILE B O     1 
ATOM   5436 C  CB    . ILE C 1 305 ? 39.820  2.593   48.220 1.00 34.55 ? 305 ILE B CB    1 
ATOM   5437 C  CG1   . ILE C 1 305 ? 40.669  3.860   48.020 1.00 32.58 ? 305 ILE B CG1   1 
ATOM   5438 C  CG2   . ILE C 1 305 ? 38.614  2.428   47.178 1.00 34.99 ? 305 ILE B CG2   1 
ATOM   5439 C  CD1   . ILE C 1 305 ? 40.964  4.224   46.649 1.00 35.63 ? 305 ILE B CD1   1 
ATOM   5440 N  N     . TYR C 1 306 ? 38.404  0.425   50.094 1.00 29.42 ? 306 TYR B N     1 
ATOM   5441 C  CA    . TYR C 1 306 ? 37.397  -0.580  50.461 1.00 30.05 ? 306 TYR B CA    1 
ATOM   5442 C  C     . TYR C 1 306 ? 36.688  -0.161  51.802 1.00 28.61 ? 306 TYR B C     1 
ATOM   5443 O  O     . TYR C 1 306 ? 35.466  -0.311  51.971 1.00 25.78 ? 306 TYR B O     1 
ATOM   5444 C  CB    . TYR C 1 306 ? 38.071  -1.975  50.564 1.00 32.81 ? 306 TYR B CB    1 
ATOM   5445 C  CG    . TYR C 1 306 ? 37.163  -2.997  51.248 1.00 29.26 ? 306 TYR B CG    1 
ATOM   5446 C  CD1   . TYR C 1 306 ? 36.075  -3.598  50.539 1.00 21.54 ? 306 TYR B CD1   1 
ATOM   5447 C  CD2   . TYR C 1 306 ? 37.218  -3.144  52.657 1.00 23.06 ? 306 TYR B CD2   1 
ATOM   5448 C  CE1   . TYR C 1 306 ? 35.099  -4.286  51.239 1.00 30.24 ? 306 TYR B CE1   1 
ATOM   5449 C  CE2   . TYR C 1 306 ? 36.260  -3.805  53.340 1.00 26.16 ? 306 TYR B CE2   1 
ATOM   5450 C  CZ    . TYR C 1 306 ? 35.204  -4.388  52.636 1.00 32.50 ? 306 TYR B CZ    1 
ATOM   5451 O  OH    . TYR C 1 306 ? 34.305  -5.152  53.365 1.00 45.93 ? 306 TYR B OH    1 
ATOM   5452 N  N     . GLN C 1 307 ? 37.487  0.210   52.804 1.00 30.84 ? 307 GLN B N     1 
ATOM   5453 C  CA    . GLN C 1 307 ? 36.972  0.648   54.109 1.00 32.80 ? 307 GLN B CA    1 
ATOM   5454 C  C     . GLN C 1 307 ? 36.341  2.059   54.117 1.00 35.55 ? 307 GLN B C     1 
ATOM   5455 O  O     . GLN C 1 307 ? 35.655  2.432   55.087 1.00 37.92 ? 307 GLN B O     1 
ATOM   5456 C  CB    . GLN C 1 307 ? 38.057  0.525   55.158 1.00 32.00 ? 307 GLN B CB    1 
ATOM   5457 C  CG    . GLN C 1 307 ? 38.749  -0.810  55.205 1.00 37.99 ? 307 GLN B CG    1 
ATOM   5458 C  CD    . GLN C 1 307 ? 39.793  -0.843  56.285 1.00 46.48 ? 307 GLN B CD    1 
ATOM   5459 O  OE1   . GLN C 1 307 ? 40.925  -0.412  56.098 1.00 48.82 ? 307 GLN B OE1   1 
ATOM   5460 N  NE2   . GLN C 1 307 ? 39.370  -1.206  57.480 1.00 52.60 ? 307 GLN B NE2   1 
ATOM   5461 N  N     . ARG C 1 308 ? 36.424  2.717   52.950 1.00 37.36 ? 308 ARG B N     1 
ATOM   5462 C  CA    . ARG C 1 308 ? 35.957  4.075   52.680 1.00 40.44 ? 308 ARG B CA    1 
ATOM   5463 C  C     . ARG C 1 308 ? 36.553  5.168   53.615 1.00 41.28 ? 308 ARG B C     1 
ATOM   5464 O  O     . ARG C 1 308 ? 35.864  6.082   54.066 1.00 50.01 ? 308 ARG B O     1 
ATOM   5465 C  CB    . ARG C 1 308 ? 34.422  4.082   52.574 1.00 34.67 ? 308 ARG B CB    1 
ATOM   5466 C  CG    . ARG C 1 308 ? 33.848  3.280   51.403 1.00 26.62 ? 308 ARG B CG    1 
ATOM   5467 C  CD    . ARG C 1 308 ? 32.445  2.819   51.818 1.00 31.86 ? 308 ARG B CD    1 
ATOM   5468 N  NE    . ARG C 1 308 ? 31.537  3.939   52.077 1.00 28.03 ? 308 ARG B NE    1 
ATOM   5469 C  CZ    . ARG C 1 308 ? 30.693  4.459   51.193 1.00 28.28 ? 308 ARG B CZ    1 
ATOM   5470 N  NH1   . ARG C 1 308 ? 30.378  3.810   50.072 1.00 32.27 ? 308 ARG B NH1   1 
ATOM   5471 N  NH2   . ARG C 1 308 ? 30.039  5.571   51.511 1.00 26.19 ? 308 ARG B NH2   1 
ATOM   5472 N  N     . LYS C 1 309 ? 37.823  5.016   53.982 1.00 38.88 ? 309 LYS B N     1 
ATOM   5473 C  CA    . LYS C 1 309 ? 38.616  5.912   54.812 1.00 38.06 ? 309 LYS B CA    1 
ATOM   5474 C  C     . LYS C 1 309 ? 39.265  7.042   53.987 1.00 39.78 ? 309 LYS B C     1 
ATOM   5475 O  O     . LYS C 1 309 ? 39.905  7.953   54.496 1.00 44.08 ? 309 LYS B O     1 
ATOM   5476 C  CB    . LYS C 1 309 ? 39.733  5.099   55.448 1.00 39.09 ? 309 LYS B CB    1 
ATOM   5477 C  CG    . LYS C 1 309 ? 39.316  4.320   56.680 1.00 45.14 ? 309 LYS B CG    1 
ATOM   5478 C  CD    . LYS C 1 309 ? 40.435  3.313   56.981 1.00 48.86 ? 309 LYS B CD    1 
ATOM   5479 C  CE    . LYS C 1 309 ? 40.308  2.604   58.323 1.00 50.57 ? 309 LYS B CE    1 
ATOM   5480 N  NZ    . LYS C 1 309 ? 38.904  2.294   58.744 1.00 52.01 ? 309 LYS B NZ    1 
ATOM   5481 N  N     . VAL C 1 310 ? 39.224  6.918   52.675 1.00 40.24 ? 310 VAL B N     1 
ATOM   5482 C  CA    . VAL C 1 310 ? 39.779  7.908   51.776 1.00 39.88 ? 310 VAL B CA    1 
ATOM   5483 C  C     . VAL C 1 310 ? 38.844  9.118   51.669 1.00 41.17 ? 310 VAL B C     1 
ATOM   5484 O  O     . VAL C 1 310 ? 37.609  9.029   51.629 1.00 39.81 ? 310 VAL B O     1 
ATOM   5485 C  CB    . VAL C 1 310 ? 40.160  7.265   50.458 1.00 36.05 ? 310 VAL B CB    1 
ATOM   5486 C  CG1   . VAL C 1 310 ? 40.840  8.285   49.541 1.00 42.44 ? 310 VAL B CG1   1 
ATOM   5487 C  CG2   . VAL C 1 310 ? 41.151  6.149   50.790 1.00 41.04 ? 310 VAL B CG2   1 
ATOM   5488 N  N     . GLU C 1 311 ? 39.469  10.280  51.745 1.00 40.33 ? 311 GLU B N     1 
ATOM   5489 C  CA    . GLU C 1 311 ? 38.733  11.536  51.731 1.00 44.93 ? 311 GLU B CA    1 
ATOM   5490 C  C     . GLU C 1 311 ? 38.297  11.764  50.257 1.00 42.47 ? 311 GLU B C     1 
ATOM   5491 O  O     . GLU C 1 311 ? 39.185  11.922  49.411 1.00 43.26 ? 311 GLU B O     1 
ATOM   5492 C  CB    . GLU C 1 311 ? 39.704  12.575  52.312 1.00 49.88 ? 311 GLU B CB    1 
ATOM   5493 C  CG    . GLU C 1 311 ? 40.243  12.329  53.801 1.00 58.07 ? 311 GLU B CG    1 
ATOM   5494 C  CD    . GLU C 1 311 ? 40.995  10.990  54.174 1.00 58.29 ? 311 GLU B CD    1 
ATOM   5495 O  OE1   . GLU C 1 311 ? 41.702  10.335  53.360 1.00 58.08 ? 311 GLU B OE1   1 
ATOM   5496 O  OE2   . GLU C 1 311 ? 40.880  10.576  55.348 1.00 58.44 ? 311 GLU B OE2   1 
ATOM   5497 N  N     . ALA C 1 312 ? 37.000  11.646  49.923 1.00 35.32 ? 312 ALA B N     1 
ATOM   5498 C  CA    . ALA C 1 312 ? 36.575  11.841  48.529 1.00 33.95 ? 312 ALA B CA    1 
ATOM   5499 C  C     . ALA C 1 312 ? 36.881  13.218  47.902 1.00 35.03 ? 312 ALA B C     1 
ATOM   5500 O  O     . ALA C 1 312 ? 36.769  14.280  48.557 1.00 35.63 ? 312 ALA B O     1 
ATOM   5501 C  CB    . ALA C 1 312 ? 35.117  11.414  48.284 1.00 33.74 ? 312 ALA B CB    1 
ATOM   5502 N  N     . PRO C 1 313 ? 37.279  13.236  46.624 1.00 29.90 ? 313 PRO B N     1 
ATOM   5503 C  CA    . PRO C 1 313 ? 37.628  14.449  45.930 1.00 32.17 ? 313 PRO B CA    1 
ATOM   5504 C  C     . PRO C 1 313 ? 36.526  15.453  45.655 1.00 34.60 ? 313 PRO B C     1 
ATOM   5505 O  O     . PRO C 1 313 ? 36.801  16.547  45.172 1.00 43.61 ? 313 PRO B O     1 
ATOM   5506 C  CB    . PRO C 1 313 ? 38.182  13.870  44.623 1.00 31.75 ? 313 PRO B CB    1 
ATOM   5507 C  CG    . PRO C 1 313 ? 37.324  12.644  44.397 1.00 27.45 ? 313 PRO B CG    1 
ATOM   5508 C  CD    . PRO C 1 313 ? 37.589  12.121  45.725 1.00 29.42 ? 313 PRO B CD    1 
ATOM   5509 N  N     . PHE C 1 314 ? 35.298  15.005  45.739 1.00 32.35 ? 314 PHE B N     1 
ATOM   5510 C  CA    . PHE C 1 314 ? 34.135  15.819  45.440 1.00 33.68 ? 314 PHE B CA    1 
ATOM   5511 C  C     . PHE C 1 314 ? 32.943  15.230  46.226 1.00 37.09 ? 314 PHE B C     1 
ATOM   5512 O  O     . PHE C 1 314 ? 32.674  14.021  46.144 1.00 32.54 ? 314 PHE B O     1 
ATOM   5513 C  CB    . PHE C 1 314 ? 33.958  15.830  43.913 1.00 36.83 ? 314 PHE B CB    1 
ATOM   5514 C  CG    . PHE C 1 314 ? 32.573  16.087  43.456 1.00 41.78 ? 314 PHE B CG    1 
ATOM   5515 C  CD1   . PHE C 1 314 ? 32.038  17.375  43.546 1.00 48.15 ? 314 PHE B CD1   1 
ATOM   5516 C  CD2   . PHE C 1 314 ? 31.731  15.008  43.096 1.00 44.61 ? 314 PHE B CD2   1 
ATOM   5517 C  CE1   . PHE C 1 314 ? 30.640  17.578  43.300 1.00 51.99 ? 314 PHE B CE1   1 
ATOM   5518 C  CE2   . PHE C 1 314 ? 30.360  15.172  42.860 1.00 42.11 ? 314 PHE B CE2   1 
ATOM   5519 C  CZ    . PHE C 1 314 ? 29.799  16.456  42.962 1.00 50.33 ? 314 PHE B CZ    1 
ATOM   5520 N  N     . ILE C 1 315 ? 32.418  15.994  47.180 1.00 32.18 ? 315 ILE B N     1 
ATOM   5521 C  CA    . ILE C 1 315 ? 31.234  15.564  47.886 1.00 37.10 ? 315 ILE B CA    1 
ATOM   5522 C  C     . ILE C 1 315 ? 30.085  16.395  47.288 1.00 40.89 ? 315 ILE B C     1 
ATOM   5523 O  O     . ILE C 1 315 ? 30.137  17.611  47.284 1.00 40.64 ? 315 ILE B O     1 
ATOM   5524 C  CB    . ILE C 1 315 ? 31.427  15.572  49.383 1.00 37.76 ? 315 ILE B CB    1 
ATOM   5525 C  CG1   . ILE C 1 315 ? 32.487  14.521  49.724 1.00 40.55 ? 315 ILE B CG1   1 
ATOM   5526 C  CG2   . ILE C 1 315 ? 30.136  15.281  50.062 1.00 37.26 ? 315 ILE B CG2   1 
ATOM   5527 C  CD1   . ILE C 1 315 ? 33.057  14.522  51.135 1.00 45.16 ? 315 ILE B CD1   1 
ATOM   5528 N  N     . PRO C 1 316 ? 29.099  15.756  46.646 1.00 43.07 ? 316 PRO B N     1 
ATOM   5529 C  CA    . PRO C 1 316 ? 27.991  16.507  46.044 1.00 44.14 ? 316 PRO B CA    1 
ATOM   5530 C  C     . PRO C 1 316 ? 27.224  17.425  47.034 1.00 41.91 ? 316 PRO B C     1 
ATOM   5531 O  O     . PRO C 1 316 ? 27.334  17.215  48.253 1.00 39.96 ? 316 PRO B O     1 
ATOM   5532 C  CB    . PRO C 1 316 ? 27.129  15.367  45.499 1.00 46.13 ? 316 PRO B CB    1 
ATOM   5533 C  CG    . PRO C 1 316 ? 27.214  14.365  46.667 1.00 48.20 ? 316 PRO B CG    1 
ATOM   5534 C  CD    . PRO C 1 316 ? 28.723  14.335  46.809 1.00 46.02 ? 316 PRO B CD    1 
ATOM   5535 N  N     . LYS C 1 317 ? 26.592  18.493  46.551 1.00 43.60 ? 317 LYS B N     1 
ATOM   5536 C  CA    . LYS C 1 317 ? 25.835  19.330  47.496 1.00 50.83 ? 317 LYS B CA    1 
ATOM   5537 C  C     . LYS C 1 317 ? 24.363  18.950  47.543 1.00 50.90 ? 317 LYS B C     1 
ATOM   5538 O  O     . LYS C 1 317 ? 23.754  18.752  46.485 1.00 52.09 ? 317 LYS B O     1 
ATOM   5539 C  CB    . LYS C 1 317 ? 26.047  20.832  47.246 1.00 56.81 ? 317 LYS B CB    1 
ATOM   5540 C  CG    . LYS C 1 317 ? 26.034  21.245  45.781 0.00 61.45 ? 317 LYS B CG    1 
ATOM   5541 C  CD    . LYS C 1 317 ? 25.022  22.351  45.500 0.00 64.79 ? 317 LYS B CD    1 
ATOM   5542 C  CE    . LYS C 1 317 ? 23.595  21.818  45.448 0.00 66.22 ? 317 LYS B CE    1 
ATOM   5543 N  NZ    . LYS C 1 317 ? 23.392  20.856  44.325 0.00 66.92 ? 317 LYS B NZ    1 
ATOM   5544 N  N     . PHE C 1 318 ? 23.666  19.298  48.652 0.00 60.08 ? 318 PHE B N     1 
ATOM   5545 C  CA    . PHE C 1 318 ? 22.175  19.081  48.766 0.00 65.14 ? 318 PHE B CA    1 
ATOM   5546 C  C     . PHE C 1 318 ? 21.252  19.716  49.882 0.00 64.93 ? 318 PHE B C     1 
ATOM   5547 O  O     . PHE C 1 318 ? 21.647  19.776  51.046 0.00 65.39 ? 318 PHE B O     1 
ATOM   5548 C  CB    . PHE C 1 318 ? 21.804  17.591  48.616 0.00 73.55 ? 318 PHE B CB    1 
ATOM   5549 C  CG    . PHE C 1 318 ? 22.901  16.630  48.986 0.00 81.82 ? 318 PHE B CG    1 
ATOM   5550 C  CD1   . PHE C 1 318 ? 23.555  16.716  50.211 0.00 84.93 ? 318 PHE B CD1   1 
ATOM   5551 C  CD2   . PHE C 1 318 ? 23.272  15.626  48.096 0.00 84.93 ? 318 PHE B CD2   1 
ATOM   5552 C  CE1   . PHE C 1 318 ? 24.566  15.816  50.542 0.00 87.79 ? 318 PHE B CE1   1 
ATOM   5553 C  CE2   . PHE C 1 318 ? 24.279  14.725  48.416 0.00 87.79 ? 318 PHE B CE2   1 
ATOM   5554 C  CZ    . PHE C 1 318 ? 24.928  14.820  49.640 0.00 88.70 ? 318 PHE B CZ    1 
ATOM   5555 N  N     . LYS C 1 319 ? 20.029  20.177  49.510 0.00 65.17 ? 319 LYS B N     1 
ATOM   5556 C  CA    . LYS C 1 319 ? 18.980  20.765  50.427 0.00 65.88 ? 319 LYS B CA    1 
ATOM   5557 C  C     . LYS C 1 319 ? 18.091  19.643  51.014 0.00 63.80 ? 319 LYS B C     1 
ATOM   5558 O  O     . LYS C 1 319 ? 16.859  19.597  50.974 0.00 62.53 ? 319 LYS B O     1 
ATOM   5559 C  CB    . LYS C 1 319 ? 18.161  21.859  49.740 0.00 70.26 ? 319 LYS B CB    1 
ATOM   5560 C  CG    . LYS C 1 319 ? 18.541  23.251  50.234 0.00 77.28 ? 319 LYS B CG    1 
ATOM   5561 C  CD    . LYS C 1 319 ? 18.481  23.309  51.762 0.00 83.93 ? 319 LYS B CD    1 
ATOM   5562 C  CE    . LYS C 1 319 ? 19.189  24.532  52.330 0.00 88.66 ? 319 LYS B CE    1 
ATOM   5563 N  NZ    . LYS C 1 319 ? 20.660  24.540  52.078 0.00 92.94 ? 319 LYS B NZ    1 
ATOM   5564 N  N     . GLY C 1 320 ? 18.890  18.913  51.739 1.00 57.96 ? 320 GLY B N     1 
ATOM   5565 C  CA    . GLY C 1 320 ? 18.855  17.660  52.488 1.00 54.49 ? 320 GLY B CA    1 
ATOM   5566 C  C     . GLY C 1 320 ? 17.834  16.626  52.042 1.00 51.78 ? 320 GLY B C     1 
ATOM   5567 O  O     . GLY C 1 320 ? 17.599  16.568  50.844 1.00 48.17 ? 320 GLY B O     1 
ATOM   5568 N  N     . PRO C 1 321 ? 17.227  15.800  52.932 1.00 52.45 ? 321 PRO B N     1 
ATOM   5569 C  CA    . PRO C 1 321 ? 16.205  14.775  52.615 1.00 53.02 ? 321 PRO B CA    1 
ATOM   5570 C  C     . PRO C 1 321 ? 15.148  15.097  51.527 1.00 50.37 ? 321 PRO B C     1 
ATOM   5571 O  O     . PRO C 1 321 ? 14.547  16.199  51.483 1.00 49.54 ? 321 PRO B O     1 
ATOM   5572 C  CB    . PRO C 1 321 ? 15.516  14.500  53.958 1.00 52.96 ? 321 PRO B CB    1 
ATOM   5573 C  CG    . PRO C 1 321 ? 16.438  15.116  55.000 1.00 54.71 ? 321 PRO B CG    1 
ATOM   5574 C  CD    . PRO C 1 321 ? 17.691  15.617  54.319 1.00 54.53 ? 321 PRO B CD    1 
ATOM   5575 N  N     . GLY C 1 322 ? 15.206  14.225  50.514 1.00 46.79 ? 322 GLY B N     1 
ATOM   5576 C  CA    . GLY C 1 322 ? 14.337  14.275  49.349 1.00 37.71 ? 322 GLY B CA    1 
ATOM   5577 C  C     . GLY C 1 322 ? 14.746  15.226  48.257 1.00 34.15 ? 322 GLY B C     1 
ATOM   5578 O  O     . GLY C 1 322 ? 14.029  15.283  47.280 1.00 36.69 ? 322 GLY B O     1 
ATOM   5579 N  N     . ASP C 1 323 ? 15.776  16.049  48.428 1.00 28.02 ? 323 ASP B N     1 
ATOM   5580 C  CA    . ASP C 1 323 ? 16.202  16.952  47.367 1.00 31.64 ? 323 ASP B CA    1 
ATOM   5581 C  C     . ASP C 1 323 ? 16.725  16.060  46.241 1.00 34.95 ? 323 ASP B C     1 
ATOM   5582 O  O     . ASP C 1 323 ? 17.526  15.145  46.510 1.00 38.96 ? 323 ASP B O     1 
ATOM   5583 C  CB    . ASP C 1 323 ? 17.399  17.737  47.908 1.00 35.12 ? 323 ASP B CB    1 
ATOM   5584 C  CG    . ASP C 1 323 ? 18.204  18.511  46.849 1.00 36.43 ? 323 ASP B CG    1 
ATOM   5585 O  OD1   . ASP C 1 323 ? 17.694  18.836  45.782 1.00 40.66 ? 323 ASP B OD1   1 
ATOM   5586 O  OD2   . ASP C 1 323 ? 19.285  19.007  47.200 1.00 38.62 ? 323 ASP B OD2   1 
ATOM   5587 N  N     . THR C 1 324 ? 16.346  16.441  45.023 1.00 32.78 ? 324 THR B N     1 
ATOM   5588 C  CA    . THR C 1 324 ? 16.702  15.819  43.750 1.00 29.24 ? 324 THR B CA    1 
ATOM   5589 C  C     . THR C 1 324 ? 17.465  16.733  42.757 1.00 30.67 ? 324 THR B C     1 
ATOM   5590 O  O     . THR C 1 324 ? 17.447  16.547  41.515 1.00 24.90 ? 324 THR B O     1 
ATOM   5591 C  CB    . THR C 1 324 ? 15.485  15.135  43.126 1.00 34.56 ? 324 THR B CB    1 
ATOM   5592 O  OG1   . THR C 1 324 ? 14.710  16.086  42.406 1.00 40.37 ? 324 THR B OG1   1 
ATOM   5593 C  CG2   . THR C 1 324 ? 14.706  14.300  44.127 1.00 30.12 ? 324 THR B CG2   1 
ATOM   5594 N  N     . SER C 1 325 ? 18.240  17.670  43.336 1.00 26.68 ? 325 SER B N     1 
ATOM   5595 C  CA    . SER C 1 325 ? 18.876  18.717  42.540 1.00 26.69 ? 325 SER B CA    1 
ATOM   5596 C  C     . SER C 1 325 ? 20.065  18.266  41.709 1.00 25.97 ? 325 SER B C     1 
ATOM   5597 O  O     . SER C 1 325 ? 20.343  18.868  40.625 1.00 23.91 ? 325 SER B O     1 
ATOM   5598 C  CB    . SER C 1 325 ? 19.226  19.928  43.396 1.00 27.16 ? 325 SER B CB    1 
ATOM   5599 O  OG    . SER C 1 325 ? 20.049  19.522  44.475 1.00 39.61 ? 325 SER B OG    1 
ATOM   5600 N  N     . ASN C 1 326 ? 20.556  17.074  42.084 1.00 22.53 ? 326 ASN B N     1 
ATOM   5601 C  CA    . ASN C 1 326 ? 21.667  16.442  41.412 1.00 16.86 ? 326 ASN B CA    1 
ATOM   5602 C  C     . ASN C 1 326 ? 21.192  15.570  40.258 1.00 17.84 ? 326 ASN B C     1 
ATOM   5603 O  O     . ASN C 1 326 ? 22.041  15.030  39.545 1.00 24.40 ? 326 ASN B O     1 
ATOM   5604 C  CB    . ASN C 1 326 ? 22.547  15.704  42.409 1.00 20.31 ? 326 ASN B CB    1 
ATOM   5605 C  CG    . ASN C 1 326 ? 23.421  16.607  43.265 1.00 21.98 ? 326 ASN B CG    1 
ATOM   5606 O  OD1   . ASN C 1 326 ? 23.551  16.463  44.495 1.00 27.13 ? 326 ASN B OD1   1 
ATOM   5607 N  ND2   . ASN C 1 326 ? 24.304  17.257  42.568 1.00 28.60 ? 326 ASN B ND2   1 
ATOM   5608 N  N     . PHE C 1 327 ? 19.931  15.617  39.868 1.00 16.42 ? 327 PHE B N     1 
ATOM   5609 C  CA    . PHE C 1 327 ? 19.450  14.826  38.711 1.00 18.38 ? 327 PHE B CA    1 
ATOM   5610 C  C     . PHE C 1 327 ? 18.698  15.743  37.857 1.00 22.52 ? 327 PHE B C     1 
ATOM   5611 O  O     . PHE C 1 327 ? 17.969  16.517  38.438 1.00 24.04 ? 327 PHE B O     1 
ATOM   5612 C  CB    . PHE C 1 327 ? 18.308  13.811  39.055 1.00 17.05 ? 327 PHE B CB    1 
ATOM   5613 C  CG    . PHE C 1 327 ? 18.782  12.667  39.881 1.00 22.38 ? 327 PHE B CG    1 
ATOM   5614 C  CD1   . PHE C 1 327 ? 18.977  12.853  41.262 1.00 21.36 ? 327 PHE B CD1   1 
ATOM   5615 C  CD2   . PHE C 1 327 ? 19.250  11.472  39.232 1.00 20.58 ? 327 PHE B CD2   1 
ATOM   5616 C  CE1   . PHE C 1 327 ? 19.670  11.855  42.022 1.00 27.47 ? 327 PHE B CE1   1 
ATOM   5617 C  CE2   . PHE C 1 327 ? 19.944  10.485  39.944 1.00 17.07 ? 327 PHE B CE2   1 
ATOM   5618 C  CZ    . PHE C 1 327 ? 20.165  10.656  41.345 1.00 22.62 ? 327 PHE B CZ    1 
ATOM   5619 N  N     . ASP C 1 328 ? 18.733  15.554  36.545 1.00 19.78 ? 328 ASP B N     1 
ATOM   5620 C  CA    . ASP C 1 328 ? 17.927  16.313  35.623 1.00 22.72 ? 328 ASP B CA    1 
ATOM   5621 C  C     . ASP C 1 328 ? 16.463  16.029  35.843 1.00 25.73 ? 328 ASP B C     1 
ATOM   5622 O  O     . ASP C 1 328 ? 16.150  15.001  36.459 1.00 22.24 ? 328 ASP B O     1 
ATOM   5623 C  CB    . ASP C 1 328 ? 18.253  15.836  34.234 1.00 21.66 ? 328 ASP B CB    1 
ATOM   5624 C  CG    . ASP C 1 328 ? 19.640  16.220  33.786 1.00 28.03 ? 328 ASP B CG    1 
ATOM   5625 O  OD1   . ASP C 1 328 ? 20.346  17.045  34.448 1.00 23.40 ? 328 ASP B OD1   1 
ATOM   5626 O  OD2   . ASP C 1 328 ? 19.951  15.604  32.729 1.00 22.00 ? 328 ASP B OD2   1 
ATOM   5627 N  N     . ASP C 1 329 ? 15.602  16.783  35.148 1.00 26.83 ? 329 ASP B N     1 
ATOM   5628 C  CA    . ASP C 1 329 ? 14.145  16.656  35.290 1.00 29.04 ? 329 ASP B CA    1 
ATOM   5629 C  C     . ASP C 1 329 ? 13.684  15.900  34.107 1.00 26.85 ? 329 ASP B C     1 
ATOM   5630 O  O     . ASP C 1 329 ? 14.286  16.025  33.063 1.00 28.53 ? 329 ASP B O     1 
ATOM   5631 C  CB    . ASP C 1 329 ? 13.393  18.002  35.322 1.00 37.13 ? 329 ASP B CB    1 
ATOM   5632 C  CG    . ASP C 1 329 ? 13.959  18.996  36.346 1.00 43.45 ? 329 ASP B CG    1 
ATOM   5633 O  OD1   . ASP C 1 329 ? 14.052  18.731  37.567 1.00 42.84 ? 329 ASP B OD1   1 
ATOM   5634 O  OD2   . ASP C 1 329 ? 14.375  20.081  35.873 1.00 52.33 ? 329 ASP B OD2   1 
ATOM   5635 N  N     . TYR C 1 330 ? 12.613  15.131  34.245 1.00 26.91 ? 330 TYR B N     1 
ATOM   5636 C  CA    . TYR C 1 330 ? 12.118  14.307  33.146 1.00 26.78 ? 330 TYR B CA    1 
ATOM   5637 C  C     . TYR C 1 330 ? 10.614  14.454  33.168 1.00 29.80 ? 330 TYR B C     1 
ATOM   5638 O  O     . TYR C 1 330 ? 9.965   14.366  34.207 1.00 35.97 ? 330 TYR B O     1 
ATOM   5639 C  CB    . TYR C 1 330 ? 12.378  12.791  33.400 1.00 26.75 ? 330 TYR B CB    1 
ATOM   5640 C  CG    . TYR C 1 330 ? 13.807  12.253  33.444 1.00 21.53 ? 330 TYR B CG    1 
ATOM   5641 C  CD1   . TYR C 1 330 ? 14.636  12.488  34.577 1.00 24.54 ? 330 TYR B CD1   1 
ATOM   5642 C  CD2   . TYR C 1 330 ? 14.383  11.724  32.283 1.00 19.77 ? 330 TYR B CD2   1 
ATOM   5643 C  CE1   . TYR C 1 330 ? 16.011  12.243  34.520 1.00 18.92 ? 330 TYR B CE1   1 
ATOM   5644 C  CE2   . TYR C 1 330 ? 15.727  11.449  32.207 1.00 13.57 ? 330 TYR B CE2   1 
ATOM   5645 C  CZ    . TYR C 1 330 ? 16.496  11.712  33.306 1.00 20.48 ? 330 TYR B CZ    1 
ATOM   5646 O  OH    . TYR C 1 330 ? 17.815  11.409  33.163 1.00 27.82 ? 330 TYR B OH    1 
ATOM   5647 N  N     . GLU C 1 331 ? 10.115  14.125  31.999 1.00 31.91 ? 331 GLU B N     1 
ATOM   5648 C  CA    . GLU C 1 331 ? 8.690   14.097  31.766 1.00 34.99 ? 331 GLU B CA    1 
ATOM   5649 C  C     . GLU C 1 331 ? 8.072   12.990  32.584 1.00 34.88 ? 331 GLU B C     1 
ATOM   5650 O  O     . GLU C 1 331 ? 8.542   11.875  32.450 1.00 35.78 ? 331 GLU B O     1 
ATOM   5651 C  CB    . GLU C 1 331 ? 8.419   13.837  30.282 0.00 38.81 ? 331 GLU B CB    1 
ATOM   5652 C  CG    . GLU C 1 331 ? 6.969   13.522  29.950 0.00 43.66 ? 331 GLU B CG    1 
ATOM   5653 C  CD    . GLU C 1 331 ? 6.823   12.727  28.667 0.00 44.88 ? 331 GLU B CD    1 
ATOM   5654 O  OE1   . GLU C 1 331 ? 7.473   11.664  28.545 0.00 44.21 ? 331 GLU B OE1   1 
ATOM   5655 O  OE2   . GLU C 1 331 ? 6.051   13.156  27.784 0.00 44.21 ? 331 GLU B OE2   1 
ATOM   5656 N  N     . GLU C 1 332 ? 7.296   13.368  33.603 1.00 32.24 ? 332 GLU B N     1 
ATOM   5657 C  CA    . GLU C 1 332 ? 6.478   12.404  34.346 1.00 33.78 ? 332 GLU B CA    1 
ATOM   5658 C  C     . GLU C 1 332 ? 5.356   11.710  33.574 1.00 36.73 ? 332 GLU B C     1 
ATOM   5659 O  O     . GLU C 1 332 ? 4.666   12.323  32.770 1.00 45.45 ? 332 GLU B O     1 
ATOM   5660 C  CB    . GLU C 1 332 ? 5.848   13.053  35.529 1.00 23.28 ? 332 GLU B CB    1 
ATOM   5661 C  CG    . GLU C 1 332 ? 6.821   13.764  36.394 1.00 30.66 ? 332 GLU B CG    1 
ATOM   5662 C  CD    . GLU C 1 332 ? 7.867   12.871  37.073 1.00 34.63 ? 332 GLU B CD    1 
ATOM   5663 O  OE1   . GLU C 1 332 ? 7.654   11.648  37.205 1.00 38.44 ? 332 GLU B OE1   1 
ATOM   5664 O  OE2   . GLU C 1 332 ? 8.844   13.406  37.645 1.00 35.08 ? 332 GLU B OE2   1 
ATOM   5665 N  N     . GLU C 1 333 ? 5.365   10.386  33.598 1.00 42.95 ? 333 GLU B N     1 
ATOM   5666 C  CA    . GLU C 1 333 ? 4.364   9.539   32.963 1.00 46.97 ? 333 GLU B CA    1 
ATOM   5667 C  C     . GLU C 1 333 ? 3.514   8.821   34.036 1.00 50.36 ? 333 GLU B C     1 
ATOM   5668 O  O     . GLU C 1 333 ? 3.943   8.686   35.172 1.00 47.94 ? 333 GLU B O     1 
ATOM   5669 C  CB    . GLU C 1 333 ? 5.054   8.543   32.040 1.00 51.70 ? 333 GLU B CB    1 
ATOM   5670 C  CG    . GLU C 1 333 ? 4.109   7.707   31.190 0.00 53.55 ? 333 GLU B CG    1 
ATOM   5671 C  CD    . GLU C 1 333 ? 4.847   6.748   30.277 0.00 55.20 ? 333 GLU B CD    1 
ATOM   5672 O  OE1   . GLU C 1 333 ? 5.422   7.210   29.268 0.00 54.72 ? 333 GLU B OE1   1 
ATOM   5673 O  OE2   . GLU C 1 333 ? 4.858   5.536   30.572 0.00 54.72 ? 333 GLU B OE2   1 
ATOM   5674 N  N     . GLU C 1 334 ? 2.262   8.482   33.736 1.00 54.68 ? 334 GLU B N     1 
ATOM   5675 C  CA    . GLU C 1 334 ? 1.415   7.783   34.701 1.00 61.97 ? 334 GLU B CA    1 
ATOM   5676 C  C     . GLU C 1 334 ? 1.727   6.283   34.694 1.00 63.22 ? 334 GLU B C     1 
ATOM   5677 O  O     . GLU C 1 334 ? 1.839   5.692   33.617 1.00 66.52 ? 334 GLU B O     1 
ATOM   5678 C  CB    . GLU C 1 334 ? -0.060  7.984   34.333 0.00 66.29 ? 334 GLU B CB    1 
ATOM   5679 C  CG    . GLU C 1 334 ? -0.866  8.842   35.298 0.00 69.63 ? 334 GLU B CG    1 
ATOM   5680 C  CD    . GLU C 1 334 ? -1.227  8.110   36.577 0.00 69.65 ? 334 GLU B CD    1 
ATOM   5681 O  OE1   . GLU C 1 334 ? -2.124  7.241   36.535 0.00 67.98 ? 334 GLU B OE1   1 
ATOM   5682 O  OE2   . GLU C 1 334 ? -0.614  8.402   37.624 0.00 67.98 ? 334 GLU B OE2   1 
ATOM   5683 N  N     . ILE C 1 335 ? 2.029   5.719   35.866 1.00 63.56 ? 335 ILE B N     1 
ATOM   5684 C  CA    . ILE C 1 335 ? 2.228   4.273   36.024 1.00 62.39 ? 335 ILE B CA    1 
ATOM   5685 C  C     . ILE C 1 335 ? 0.824   3.647   36.082 1.00 61.60 ? 335 ILE B C     1 
ATOM   5686 O  O     . ILE C 1 335 ? 0.105   3.766   37.083 1.00 63.92 ? 335 ILE B O     1 
ATOM   5687 C  CB    . ILE C 1 335 ? 2.985   3.890   37.337 1.00 62.39 ? 335 ILE B CB    1 
ATOM   5688 C  CG1   . ILE C 1 335 ? 4.348   4.551   37.459 0.00 60.05 ? 335 ILE B CG1   1 
ATOM   5689 C  CG2   . ILE C 1 335 ? 3.114   2.368   37.439 0.00 62.13 ? 335 ILE B CG2   1 
ATOM   5690 C  CD1   . ILE C 1 335 ? 5.004   4.223   38.785 0.00 57.08 ? 335 ILE B CD1   1 
ATOM   5691 N  N     . ARG C 1 336 ? 0.395   3.118   34.945 1.00 58.15 ? 336 ARG B N     1 
ATOM   5692 C  CA    . ARG C 1 336 ? -0.881  2.426   34.791 1.00 58.30 ? 336 ARG B CA    1 
ATOM   5693 C  C     . ARG C 1 336 ? -0.777  0.937   35.204 1.00 55.91 ? 336 ARG B C     1 
ATOM   5694 O  O     . ARG C 1 336 ? 0.256   0.295   34.979 1.00 57.51 ? 336 ARG B O     1 
ATOM   5695 C  CB    . ARG C 1 336 ? -1.270  2.569   33.315 1.00 60.84 ? 336 ARG B CB    1 
ATOM   5696 C  CG    . ARG C 1 336 ? -2.497  1.838   32.802 1.00 69.01 ? 336 ARG B CG    1 
ATOM   5697 C  CD    . ARG C 1 336 ? -2.303  1.291   31.391 1.00 71.62 ? 336 ARG B CD    1 
ATOM   5698 N  NE    . ARG C 1 336 ? -3.546  0.562   31.071 0.00 73.87 ? 336 ARG B NE    1 
ATOM   5699 C  CZ    . ARG C 1 336 ? -4.131  0.617   29.878 0.00 74.73 ? 336 ARG B CZ    1 
ATOM   5700 N  NH1   . ARG C 1 336 ? -3.612  1.378   28.929 0.00 74.65 ? 336 ARG B NH1   1 
ATOM   5701 N  NH2   . ARG C 1 336 ? -5.253  -0.049  29.636 0.00 74.65 ? 336 ARG B NH2   1 
ATOM   5702 N  N     . VAL C 1 337 ? -1.807  0.412   35.877 1.00 51.35 ? 337 VAL B N     1 
ATOM   5703 C  CA    . VAL C 1 337 ? -1.906  -1.005  36.277 1.00 44.90 ? 337 VAL B CA    1 
ATOM   5704 C  C     . VAL C 1 337 ? -3.213  -1.700  35.846 1.00 41.09 ? 337 VAL B C     1 
ATOM   5705 O  O     . VAL C 1 337 ? -4.209  -1.437  36.493 1.00 43.68 ? 337 VAL B O     1 
ATOM   5706 C  CB    . VAL C 1 337 ? -1.763  -1.135  37.818 1.00 43.48 ? 337 VAL B CB    1 
ATOM   5707 C  CG1   . VAL C 1 337 ? -1.838  -2.614  38.252 1.00 44.94 ? 337 VAL B CG1   1 
ATOM   5708 C  CG2   . VAL C 1 337 ? -0.515  -0.410  38.386 1.00 38.79 ? 337 VAL B CG2   1 
ATOM   5709 N  N     . SER C 1 338 ? -3.262  -2.576  34.835 1.00 43.20 ? 338 SER B N     1 
ATOM   5710 C  CA    . SER C 1 338 ? -4.497  -3.310  34.433 1.00 45.02 ? 338 SER B CA    1 
ATOM   5711 C  C     . SER C 1 338 ? -5.192  -4.186  35.509 1.00 49.51 ? 338 SER B C     1 
ATOM   5712 O  O     . SER C 1 338 ? -4.723  -4.400  36.639 1.00 44.37 ? 338 SER B O     1 
ATOM   5713 C  CB    . SER C 1 338 ? -4.366  -4.158  33.147 1.00 40.79 ? 338 SER B CB    1 
ATOM   5714 O  OG    . SER C 1 338 ? -5.375  -4.040  32.122 1.00 40.88 ? 338 SER B OG    1 
ATOM   5715 N  N     . ILE C 1 339 ? -6.465  -4.453  35.204 1.00 58.52 ? 339 ILE B N     1 
ATOM   5716 C  CA    . ILE C 1 339 ? -7.390  -5.295  35.991 1.00 62.74 ? 339 ILE B CA    1 
ATOM   5717 C  C     . ILE C 1 339 ? -7.143  -6.796  35.738 1.00 61.85 ? 339 ILE B C     1 
ATOM   5718 O  O     . ILE C 1 339 ? -7.700  -7.645  36.433 1.00 60.95 ? 339 ILE B O     1 
ATOM   5719 C  CB    . ILE C 1 339 ? -8.896  -4.908  35.723 1.00 65.73 ? 339 ILE B CB    1 
ATOM   5720 C  CG1   . ILE C 1 339 ? -9.791  -5.494  36.824 1.00 67.32 ? 339 ILE B CG1   1 
ATOM   5721 C  CG2   . ILE C 1 339 ? -9.367  -5.277  34.276 1.00 61.33 ? 339 ILE B CG2   1 
ATOM   5722 C  CD1   . ILE C 1 339 ? -9.446  -5.052  38.242 1.00 68.22 ? 339 ILE B CD1   1 
ATOM   5723 N  N     . ASN C 1 340 ? -6.361  -7.064  34.687 1.00 61.39 ? 340 ASN B N     1 
ATOM   5724 C  CA    . ASN C 1 340 ? -5.909  -8.375  34.242 1.00 56.79 ? 340 ASN B CA    1 
ATOM   5725 C  C     . ASN C 1 340 ? -4.393  -8.480  34.230 1.00 53.18 ? 340 ASN B C     1 
ATOM   5726 O  O     . ASN C 1 340 ? -3.737  -7.606  33.668 1.00 50.65 ? 340 ASN B O     1 
ATOM   5727 C  CB    . ASN C 1 340 ? -6.409  -8.618  32.826 1.00 56.13 ? 340 ASN B CB    1 
ATOM   5728 C  CG    . ASN C 1 340 ? -7.904  -8.527  32.741 1.00 57.78 ? 340 ASN B CG    1 
ATOM   5729 O  OD1   . ASN C 1 340 ? -8.627  -9.120  33.557 1.00 54.90 ? 340 ASN B OD1   1 
ATOM   5730 N  ND2   . ASN C 1 340 ? -8.364  -7.629  31.889 1.00 55.21 ? 340 ASN B ND2   1 
ATOM   5731 N  N     . GLU C 1 341 ? -3.878  -9.482  34.952 1.00 51.74 ? 341 GLU B N     1 
ATOM   5732 C  CA    . GLU C 1 341 ? -2.462  -9.909  35.026 1.00 47.15 ? 341 GLU B CA    1 
ATOM   5733 C  C     . GLU C 1 341 ? -1.878  -10.150 33.649 1.00 43.01 ? 341 GLU B C     1 
ATOM   5734 O  O     . GLU C 1 341 ? -2.503  -10.746 32.755 1.00 46.18 ? 341 GLU B O     1 
ATOM   5735 C  CB    . GLU C 1 341 ? -2.324  -11.216 35.791 1.00 48.42 ? 341 GLU B CB    1 
ATOM   5736 C  CG    . GLU C 1 341 ? -0.949  -11.806 35.860 1.00 51.24 ? 341 GLU B CG    1 
ATOM   5737 C  CD    . GLU C 1 341 ? -0.646  -12.301 37.238 1.00 55.95 ? 341 GLU B CD    1 
ATOM   5738 O  OE1   . GLU C 1 341 ? -0.274  -11.454 38.092 1.00 63.59 ? 341 GLU B OE1   1 
ATOM   5739 O  OE2   . GLU C 1 341 ? -0.772  -13.529 37.451 1.00 57.38 ? 341 GLU B OE2   1 
ATOM   5740 N  N     . LYS C 1 342 ? -0.808  -9.416  33.439 1.00 36.53 ? 342 LYS B N     1 
ATOM   5741 C  CA    . LYS C 1 342 ? -0.057  -9.504  32.207 1.00 38.34 ? 342 LYS B CA    1 
ATOM   5742 C  C     . LYS C 1 342 ? 1.199   -10.275 32.557 1.00 37.47 ? 342 LYS B C     1 
ATOM   5743 O  O     . LYS C 1 342 ? 1.702   -10.176 33.686 1.00 32.43 ? 342 LYS B O     1 
ATOM   5744 C  CB    . LYS C 1 342 ? 0.303   -8.125  31.682 1.00 41.44 ? 342 LYS B CB    1 
ATOM   5745 C  CG    . LYS C 1 342 ? -0.875  -7.153  31.593 1.00 46.26 ? 342 LYS B CG    1 
ATOM   5746 C  CD    . LYS C 1 342 ? -1.515  -7.237  30.241 1.00 50.66 ? 342 LYS B CD    1 
ATOM   5747 C  CE    . LYS C 1 342 ? -2.856  -6.633  30.370 1.00 52.58 ? 342 LYS B CE    1 
ATOM   5748 N  NZ    . LYS C 1 342 ? -3.737  -7.680  30.934 1.00 59.89 ? 342 LYS B NZ    1 
ATOM   5749 N  N     . CYS C 1 343 ? 1.494   -11.224 31.668 1.00 40.04 ? 343 CYS B N     1 
ATOM   5750 C  CA    . CYS C 1 343 ? 2.680   -12.104 31.677 1.00 39.82 ? 343 CYS B CA    1 
ATOM   5751 C  C     . CYS C 1 343 ? 3.020   -12.829 32.988 1.00 40.91 ? 343 CYS B C     1 
ATOM   5752 O  O     . CYS C 1 343 ? 4.197   -13.090 33.283 1.00 48.73 ? 343 CYS B O     1 
ATOM   5753 C  CB    . CYS C 1 343 ? 3.856   -11.306 31.125 1.00 35.71 ? 343 CYS B CB    1 
ATOM   5754 S  SG    . CYS C 1 343 ? 3.420   -10.504 29.572 1.00 45.14 ? 343 CYS B SG    1 
ATOM   5755 N  N     . GLY C 1 344 ? 1.978   -13.244 33.723 1.00 38.89 ? 344 GLY B N     1 
ATOM   5756 C  CA    . GLY C 1 344 ? 2.070   -13.888 35.023 1.00 35.65 ? 344 GLY B CA    1 
ATOM   5757 C  C     . GLY C 1 344 ? 2.983   -15.095 34.971 1.00 37.27 ? 344 GLY B C     1 
ATOM   5758 O  O     . GLY C 1 344 ? 3.924   -15.143 35.750 1.00 40.45 ? 344 GLY B O     1 
ATOM   5759 N  N     . LYS C 1 345 ? 2.859   -15.909 33.921 1.00 34.36 ? 345 LYS B N     1 
ATOM   5760 C  CA    . LYS C 1 345 ? 3.719   -17.092 33.760 1.00 38.89 ? 345 LYS B CA    1 
ATOM   5761 C  C     . LYS C 1 345 ? 5.233   -16.750 33.515 1.00 34.79 ? 345 LYS B C     1 
ATOM   5762 O  O     . LYS C 1 345 ? 6.049   -17.178 34.330 1.00 31.37 ? 345 LYS B O     1 
ATOM   5763 C  CB    . LYS C 1 345 ? 3.135   -18.005 32.701 1.00 35.89 ? 345 LYS B CB    1 
ATOM   5764 C  CG    . LYS C 1 345 ? 3.639   -19.405 32.883 1.00 48.93 ? 345 LYS B CG    1 
ATOM   5765 C  CD    . LYS C 1 345 ? 4.702   -19.777 31.793 1.00 53.22 ? 345 LYS B CD    1 
ATOM   5766 C  CE    . LYS C 1 345 ? 5.218   -21.159 31.961 0.00 52.23 ? 345 LYS B CE    1 
ATOM   5767 N  NZ    . LYS C 1 345 ? 4.087   -22.061 31.722 0.00 49.57 ? 345 LYS B NZ    1 
ATOM   5768 N  N     . GLU C 1 346 ? 5.554   -15.858 32.571 1.00 31.39 ? 346 GLU B N     1 
ATOM   5769 C  CA    . GLU C 1 346 ? 6.950   -15.434 32.342 1.00 30.19 ? 346 GLU B CA    1 
ATOM   5770 C  C     . GLU C 1 346 ? 7.619   -14.808 33.585 1.00 33.10 ? 346 GLU B C     1 
ATOM   5771 O  O     . GLU C 1 346 ? 8.836   -15.094 33.856 1.00 28.69 ? 346 GLU B O     1 
ATOM   5772 C  CB    . GLU C 1 346 ? 7.117   -14.596 31.089 1.00 32.29 ? 346 GLU B CB    1 
ATOM   5773 C  CG    . GLU C 1 346 ? 6.454   -15.191 29.846 1.00 39.04 ? 346 GLU B CG    1 
ATOM   5774 C  CD    . GLU C 1 346 ? 4.984   -14.763 29.556 1.00 43.99 ? 346 GLU B CD    1 
ATOM   5775 O  OE1   . GLU C 1 346 ? 4.106   -14.616 30.466 1.00 37.96 ? 346 GLU B OE1   1 
ATOM   5776 O  OE2   . GLU C 1 346 ? 4.738   -14.498 28.353 1.00 48.12 ? 346 GLU B OE2   1 
ATOM   5777 N  N     . PHE C 1 347 ? 6.792   -14.197 34.460 1.00 27.09 ? 347 PHE B N     1 
ATOM   5778 C  CA    . PHE C 1 347 ? 7.339   -13.656 35.712 1.00 28.70 ? 347 PHE B CA    1 
ATOM   5779 C  C     . PHE C 1 347 ? 7.118   -14.276 37.063 1.00 32.12 ? 347 PHE B C     1 
ATOM   5780 O  O     . PHE C 1 347 ? 7.471   -13.640 38.104 1.00 33.76 ? 347 PHE B O     1 
ATOM   5781 C  CB    . PHE C 1 347 ? 7.349   -12.115 35.867 1.00 26.35 ? 347 PHE B CB    1 
ATOM   5782 C  CG    . PHE C 1 347 ? 7.805   -11.411 34.660 1.00 25.22 ? 347 PHE B CG    1 
ATOM   5783 C  CD1   . PHE C 1 347 ? 9.184   -11.193 34.445 1.00 22.57 ? 347 PHE B CD1   1 
ATOM   5784 C  CD2   . PHE C 1 347 ? 6.863   -11.100 33.687 1.00 16.04 ? 347 PHE B CD2   1 
ATOM   5785 C  CE1   . PHE C 1 347 ? 9.592   -10.655 33.207 1.00 24.56 ? 347 PHE B CE1   1 
ATOM   5786 C  CE2   . PHE C 1 347 ? 7.250   -10.563 32.475 1.00 23.06 ? 347 PHE B CE2   1 
ATOM   5787 C  CZ    . PHE C 1 347 ? 8.622   -10.327 32.212 1.00 24.58 ? 347 PHE B CZ    1 
ATOM   5788 N  N     . SER C 1 348 ? 6.873   -15.583 37.039 1.00 27.71 ? 348 SER B N     1 
ATOM   5789 C  CA    . SER C 1 348 ? 6.589   -16.311 38.293 1.00 28.93 ? 348 SER B CA    1 
ATOM   5790 C  C     . SER C 1 348 ? 7.587   -16.198 39.431 1.00 27.82 ? 348 SER B C     1 
ATOM   5791 O  O     . SER C 1 348 ? 7.148   -15.990 40.576 1.00 23.97 ? 348 SER B O     1 
ATOM   5792 C  CB    . SER C 1 348 ? 6.300   -17.809 38.062 1.00 28.64 ? 348 SER B CB    1 
ATOM   5793 O  OG    . SER C 1 348 ? 5.878   -18.037 36.724 1.00 38.08 ? 348 SER B OG    1 
ATOM   5794 N  N     . GLU C 1 349 ? 8.885   -16.374 39.131 1.00 19.12 ? 349 GLU B N     1 
ATOM   5795 C  CA    . GLU C 1 349 ? 9.829   -16.312 40.215 1.00 24.30 ? 349 GLU B CA    1 
ATOM   5796 C  C     . GLU C 1 349 ? 10.224  -14.908 40.664 1.00 22.78 ? 349 GLU B C     1 
ATOM   5797 O  O     . GLU C 1 349 ? 10.864  -14.800 41.697 1.00 22.31 ? 349 GLU B O     1 
ATOM   5798 C  CB    . GLU C 1 349 ? 11.104  -17.094 39.886 1.00 28.47 ? 349 GLU B CB    1 
ATOM   5799 C  CG    . GLU C 1 349 ? 11.831  -16.473 38.712 1.00 37.62 ? 349 GLU B CG    1 
ATOM   5800 C  CD    . GLU C 1 349 ? 13.172  -17.066 38.478 1.00 35.68 ? 349 GLU B CD    1 
ATOM   5801 O  OE1   . GLU C 1 349 ? 13.162  -18.220 37.987 1.00 29.00 ? 349 GLU B OE1   1 
ATOM   5802 O  OE2   . GLU C 1 349 ? 14.148  -16.331 38.732 1.00 22.58 ? 349 GLU B OE2   1 
ATOM   5803 N  N     . PHE C 1 350 ? 9.801   -13.867 39.938 1.00 26.01 ? 350 PHE B N     1 
ATOM   5804 C  CA    . PHE C 1 350 ? 10.127  -12.473 40.317 1.00 21.58 ? 350 PHE B CA    1 
ATOM   5805 C  C     . PHE C 1 350 ? 9.565   -12.162 41.686 1.00 17.41 ? 350 PHE B C     1 
ATOM   5806 O  O     . PHE C 1 350 ? 10.226  -11.911 42.696 1.00 16.32 ? 350 PHE B O     1 
ATOM   5807 C  CB    . PHE C 1 350 ? 9.663   -11.465 39.243 1.00 24.83 ? 350 PHE B CB    1 
ATOM   5808 C  CG    . PHE C 1 350 ? 10.179  -10.046 39.500 1.00 29.34 ? 350 PHE B CG    1 
ATOM   5809 C  CD1   . PHE C 1 350 ? 9.570   -9.210  40.472 1.00 23.05 ? 350 PHE B CD1   1 
ATOM   5810 C  CD2   . PHE C 1 350 ? 11.364  -9.588  38.819 1.00 34.38 ? 350 PHE B CD2   1 
ATOM   5811 C  CE1   . PHE C 1 350 ? 10.112  -7.937  40.788 1.00 28.95 ? 350 PHE B CE1   1 
ATOM   5812 C  CE2   . PHE C 1 350 ? 11.940  -8.308  39.102 1.00 31.36 ? 350 PHE B CE2   1 
ATOM   5813 C  CZ    . PHE C 1 350 ? 11.286  -7.471  40.116 1.00 30.86 ? 350 PHE B CZ    1 
ATOM   5814 O  OXT   . PHE C 1 350 ? 8.403   -12.445 41.837 1.00 21.48 ? 350 PHE B OXT   1 
ATOM   5815 N  N     . THR D 2 1   ? 39.637  20.723  17.554 1.00 21.30 ? 1   THR J N     1 
ATOM   5816 C  CA    . THR D 2 1   ? 40.156  19.849  18.657 1.00 20.82 ? 1   THR J CA    1 
ATOM   5817 C  C     . THR D 2 1   ? 39.175  18.688  18.851 1.00 23.91 ? 1   THR J C     1 
ATOM   5818 O  O     . THR D 2 1   ? 38.110  18.677  18.216 1.00 22.40 ? 1   THR J O     1 
ATOM   5819 C  CB    . THR D 2 1   ? 40.367  20.551  19.941 1.00 24.42 ? 1   THR J CB    1 
ATOM   5820 O  OG1   . THR D 2 1   ? 39.082  20.747  20.543 1.00 30.01 ? 1   THR J OG1   1 
ATOM   5821 C  CG2   . THR D 2 1   ? 41.235  21.874  19.777 1.00 17.84 ? 1   THR J CG2   1 
ATOM   5822 N  N     . THR D 2 2   ? 39.638  17.648  19.547 1.00 24.87 ? 2   THR J N     1 
ATOM   5823 C  CA    . THR D 2 2   ? 38.812  16.443  19.781 1.00 28.00 ? 2   THR J CA    1 
ATOM   5824 C  C     . THR D 2 2   ? 37.600  16.774  20.656 1.00 20.95 ? 2   THR J C     1 
ATOM   5825 O  O     . THR D 2 2   ? 36.512  16.450  20.199 1.00 28.55 ? 2   THR J O     1 
ATOM   5826 C  CB    . THR D 2 2   ? 39.586  15.222  20.366 1.00 27.12 ? 2   THR J CB    1 
ATOM   5827 O  OG1   . THR D 2 2   ? 40.881  15.135  19.746 1.00 30.26 ? 2   THR J OG1   1 
ATOM   5828 C  CG2   . THR D 2 2   ? 38.790  13.945  20.070 1.00 27.78 ? 2   THR J CG2   1 
ATOM   5829 N  N     . TYR D 2 3   ? 37.793  17.380  21.829 1.00 20.76 ? 3   TYR J N     1 
ATOM   5830 C  CA    . TYR D 2 3   ? 36.708  17.869  22.704 1.00 22.22 ? 3   TYR J CA    1 
ATOM   5831 C  C     . TYR D 2 3   ? 35.647  18.695  21.932 1.00 22.20 ? 3   TYR J C     1 
ATOM   5832 O  O     . TYR D 2 3   ? 34.458  18.360  21.955 1.00 22.84 ? 3   TYR J O     1 
ATOM   5833 C  CB    . TYR D 2 3   ? 37.271  18.679  23.874 1.00 29.07 ? 3   TYR J CB    1 
ATOM   5834 C  CG    . TYR D 2 3   ? 36.226  19.154  24.884 1.00 35.04 ? 3   TYR J CG    1 
ATOM   5835 C  CD1   . TYR D 2 3   ? 35.706  18.255  25.831 1.00 44.20 ? 3   TYR J CD1   1 
ATOM   5836 C  CD2   . TYR D 2 3   ? 35.651  20.436  24.811 1.00 44.21 ? 3   TYR J CD2   1 
ATOM   5837 C  CE1   . TYR D 2 3   ? 34.630  18.614  26.703 1.00 49.70 ? 3   TYR J CE1   1 
ATOM   5838 C  CE2   . TYR D 2 3   ? 34.530  20.824  25.661 1.00 46.49 ? 3   TYR J CE2   1 
ATOM   5839 C  CZ    . TYR D 2 3   ? 34.041  19.898  26.625 1.00 52.05 ? 3   TYR J CZ    1 
ATOM   5840 O  OH    . TYR D 2 3   ? 33.060  20.245  27.565 1.00 51.88 ? 3   TYR J OH    1 
ATOM   5841 N  N     . ALA D 2 4   ? 36.100  19.531  20.989 1.00 22.46 ? 4   ALA J N     1 
ATOM   5842 C  CA    . ALA D 2 4   ? 35.269  20.376  20.169 1.00 21.57 ? 4   ALA J CA    1 
ATOM   5843 C  C     . ALA D 2 4   ? 34.466  19.473  19.259 1.00 23.76 ? 4   ALA J C     1 
ATOM   5844 O  O     . ALA D 2 4   ? 33.294  19.799  19.029 1.00 27.42 ? 4   ALA J O     1 
ATOM   5845 C  CB    . ALA D 2 4   ? 36.127  21.354  19.326 1.00 19.41 ? 4   ALA J CB    1 
ATOM   5846 N  N     . ASP D 2 5   ? 35.069  18.418  18.691 1.00 17.91 ? 5   ASP J N     1 
ATOM   5847 C  CA    . ASP D 2 5   ? 34.319  17.464  17.801 1.00 21.31 ? 5   ASP J CA    1 
ATOM   5848 C  C     . ASP D 2 5   ? 33.324  16.524  18.497 1.00 11.95 ? 5   ASP J C     1 
ATOM   5849 O  O     . ASP D 2 5   ? 32.153  16.471  18.119 1.00 14.95 ? 5   ASP J O     1 
ATOM   5850 C  CB    . ASP D 2 5   ? 35.229  16.657  16.891 1.00 20.32 ? 5   ASP J CB    1 
ATOM   5851 C  CG    . ASP D 2 5   ? 36.126  17.567  16.062 1.00 27.88 ? 5   ASP J CG    1 
ATOM   5852 O  OD1   . ASP D 2 5   ? 35.689  18.606  15.512 1.00 30.40 ? 5   ASP J OD1   1 
ATOM   5853 O  OD2   . ASP D 2 5   ? 37.285  17.215  15.903 1.00 31.59 ? 5   ASP J OD2   1 
ATOM   5854 N  N     . PHE D 2 6   ? 33.722  16.230  19.721 1.00 11.75 ? 6   PHE J N     1 
ATOM   5855 C  CA    . PHE D 2 6   ? 32.868  15.428  20.560 1.00 16.93 ? 6   PHE J CA    1 
ATOM   5856 C  C     . PHE D 2 6   ? 31.610  16.271  20.922 1.00 20.14 ? 6   PHE J C     1 
ATOM   5857 O  O     . PHE D 2 6   ? 30.484  15.883  20.551 1.00 17.90 ? 6   PHE J O     1 
ATOM   5858 C  CB    . PHE D 2 6   ? 33.582  14.994  21.797 1.00 11.36 ? 6   PHE J CB    1 
ATOM   5859 C  CG    . PHE D 2 6   ? 32.653  14.306  22.781 1.00 16.75 ? 6   PHE J CG    1 
ATOM   5860 C  CD1   . PHE D 2 6   ? 31.948  13.141  22.394 1.00 21.03 ? 6   PHE J CD1   1 
ATOM   5861 C  CD2   . PHE D 2 6   ? 32.484  14.819  24.085 1.00 17.84 ? 6   PHE J CD2   1 
ATOM   5862 C  CE1   . PHE D 2 6   ? 31.081  12.440  23.351 1.00 15.87 ? 6   PHE J CE1   1 
ATOM   5863 C  CE2   . PHE D 2 6   ? 31.623  14.152  25.051 1.00 20.67 ? 6   PHE J CE2   1 
ATOM   5864 C  CZ    . PHE D 2 6   ? 30.932  12.922  24.636 1.00 14.98 ? 6   PHE J CZ    1 
ATOM   5865 N  N     . ILE D 2 7   ? 31.851  17.444  21.517 1.00 19.63 ? 7   ILE J N     1 
ATOM   5866 C  CA    . ILE D 2 7   ? 30.836  18.442  21.900 1.00 23.52 ? 7   ILE J CA    1 
ATOM   5867 C  C     . ILE D 2 7   ? 29.898  18.841  20.750 1.00 15.39 ? 7   ILE J C     1 
ATOM   5868 O  O     . ILE D 2 7   ? 28.727  19.003  21.015 1.00 16.73 ? 7   ILE J O     1 
ATOM   5869 C  CB    . ILE D 2 7   ? 31.478  19.603  22.734 1.00 23.84 ? 7   ILE J CB    1 
ATOM   5870 C  CG1   . ILE D 2 7   ? 31.923  19.022  24.046 1.00 29.14 ? 7   ILE J CG1   1 
ATOM   5871 C  CG2   . ILE D 2 7   ? 30.478  20.727  23.012 1.00 32.12 ? 7   ILE J CG2   1 
ATOM   5872 C  CD1   . ILE D 2 7   ? 30.837  18.279  24.946 1.00 29.25 ? 7   ILE J CD1   1 
ATOM   5873 N  N     . ALA D 2 8   ? 30.351  18.787  19.499 1.00 10.95 ? 8   ALA J N     1 
ATOM   5874 C  CA    . ALA D 2 8   ? 29.465  19.089  18.403 1.00 18.16 ? 8   ALA J CA    1 
ATOM   5875 C  C     . ALA D 2 8   ? 28.635  17.885  17.855 1.00 25.20 ? 8   ALA J C     1 
ATOM   5876 O  O     . ALA D 2 8   ? 27.825  18.033  16.925 1.00 23.35 ? 8   ALA J O     1 
ATOM   5877 C  CB    . ALA D 2 8   ? 30.290  19.753  17.279 1.00 20.44 ? 8   ALA J CB    1 
ATOM   5878 N  N     . SER D 2 9   ? 29.008  16.659  18.255 1.00 28.12 ? 9   SER J N     1 
ATOM   5879 C  CA    . SER D 2 9   ? 28.302  15.405  17.929 1.00 25.26 ? 9   SER J CA    1 
ATOM   5880 C  C     . SER D 2 9   ? 26.909  15.308  18.524 1.00 21.20 ? 9   SER J C     1 
ATOM   5881 O  O     . SER D 2 9   ? 26.692  15.775  19.642 1.00 20.78 ? 9   SER J O     1 
ATOM   5882 C  CB    . SER D 2 9   ? 29.075  14.293  18.646 1.00 24.08 ? 9   SER J CB    1 
ATOM   5883 O  OG    . SER D 2 9   ? 30.257  14.219  17.913 1.00 36.74 ? 9   SER J OG    1 
ATOM   5884 N  N     . GLY D 2 10  ? 26.306  14.209  18.052 1.00 30.27 ? 10  GLY J N     1 
ATOM   5885 C  CA    . GLY D 2 10  ? 25.012  13.702  18.494 1.00 24.22 ? 10  GLY J CA    1 
ATOM   5886 C  C     . GLY D 2 10  ? 25.022  12.783  19.706 1.00 21.74 ? 10  GLY J C     1 
ATOM   5887 O  O     . GLY D 2 10  ? 23.973  12.438  20.157 1.00 25.47 ? 10  GLY J O     1 
ATOM   5888 N  N     . ARG D 2 11  ? 26.140  12.422  20.311 1.00 21.76 ? 11  ARG J N     1 
ATOM   5889 C  CA    . ARG D 2 11  ? 26.138  11.539  21.459 1.00 20.57 ? 11  ARG J CA    1 
ATOM   5890 C  C     . ARG D 2 11  ? 26.799  12.042  22.719 1.00 16.44 ? 11  ARG J C     1 
ATOM   5891 O  O     . ARG D 2 11  ? 27.538  11.338  23.450 1.00 21.03 ? 11  ARG J O     1 
ATOM   5892 C  CB    . ARG D 2 11  ? 26.580  10.162  21.011 1.00 29.35 ? 11  ARG J CB    1 
ATOM   5893 C  CG    . ARG D 2 11  ? 25.612  9.506   19.971 1.00 27.69 ? 11  ARG J CG    1 
ATOM   5894 C  CD    . ARG D 2 11  ? 26.029  8.105   19.418 1.00 31.62 ? 11  ARG J CD    1 
ATOM   5895 N  NE    . ARG D 2 11  ? 26.082  7.239   20.576 1.00 24.09 ? 11  ARG J NE    1 
ATOM   5896 C  CZ    . ARG D 2 11  ? 25.120  6.467   21.002 1.00 19.82 ? 11  ARG J CZ    1 
ATOM   5897 N  NH1   . ARG D 2 11  ? 23.996  6.412   20.338 1.00 25.87 ? 11  ARG J NH1   1 
ATOM   5898 N  NH2   . ARG D 2 11  ? 25.301  5.856   22.144 1.00 13.44 ? 11  ARG J NH2   1 
ATOM   5899 N  N     . THR D 2 12  ? 26.359  13.258  23.075 1.00 17.51 ? 12  THR J N     1 
ATOM   5900 C  CA    . THR D 2 12  ? 26.897  13.958  24.274 1.00 16.75 ? 12  THR J CA    1 
ATOM   5901 C  C     . THR D 2 12  ? 25.966  13.836  25.458 1.00 16.26 ? 12  THR J C     1 
ATOM   5902 O  O     . THR D 2 12  ? 26.458  13.991  26.577 1.00 17.70 ? 12  THR J O     1 
ATOM   5903 C  CB    . THR D 2 12  ? 27.101  15.478  24.072 1.00 19.67 ? 12  THR J CB    1 
ATOM   5904 O  OG1   . THR D 2 12  ? 25.857  15.937  23.534 1.00 18.41 ? 12  THR J OG1   1 
ATOM   5905 C  CG2   . THR D 2 12  ? 28.264  15.747  23.018 1.00 16.75 ? 12  THR J CG2   1 
ATOM   5906 N  N     . GLY D 2 13  ? 24.713  13.444  25.203 1.00 18.70 ? 13  GLY J N     1 
ATOM   5907 C  CA    . GLY D 2 13  ? 23.741  13.205  26.282 1.00 21.70 ? 13  GLY J CA    1 
ATOM   5908 C  C     . GLY D 2 13  ? 23.813  11.750  26.778 1.00 27.28 ? 13  GLY J C     1 
ATOM   5909 O  O     . GLY D 2 13  ? 24.682  10.986  26.270 1.00 26.78 ? 13  GLY J O     1 
ATOM   5910 N  N     . ARG D 2 14  ? 22.905  11.357  27.697 1.00 24.23 ? 14  ARG J N     1 
ATOM   5911 C  CA    . ARG D 2 14  ? 22.836  10.029  28.346 1.00 17.31 ? 14  ARG J CA    1 
ATOM   5912 C  C     . ARG D 2 14  ? 22.571  8.973   27.302 1.00 18.35 ? 14  ARG J C     1 
ATOM   5913 O  O     . ARG D 2 14  ? 21.852  9.181   26.333 1.00 21.73 ? 14  ARG J O     1 
ATOM   5914 C  CB    . ARG D 2 14  ? 21.787  9.890   29.427 1.00 15.06 ? 14  ARG J CB    1 
ATOM   5915 C  CG    . ARG D 2 14  ? 21.943  10.878  30.555 1.00 17.56 ? 14  ARG J CG    1 
ATOM   5916 C  CD    . ARG D 2 14  ? 20.802  10.879  31.516 1.00 19.61 ? 14  ARG J CD    1 
ATOM   5917 N  NE    . ARG D 2 14  ? 20.509  9.660   32.326 1.00 22.55 ? 14  ARG J NE    1 
ATOM   5918 C  CZ    . ARG D 2 14  ? 19.579  8.751   32.032 1.00 12.56 ? 14  ARG J CZ    1 
ATOM   5919 N  NH1   . ARG D 2 14  ? 18.840  8.799   30.933 1.00 10.78 ? 14  ARG J NH1   1 
ATOM   5920 N  NH2   . ARG D 2 14  ? 19.424  7.761   32.850 1.00 16.51 ? 14  ARG J NH2   1 
ATOM   5921 N  N     . ARG D 2 15  ? 23.441  7.979   27.336 1.00 19.79 ? 15  ARG J N     1 
ATOM   5922 C  CA    . ARG D 2 15  ? 23.422  6.868   26.385 1.00 19.39 ? 15  ARG J CA    1 
ATOM   5923 C  C     . ARG D 2 15  ? 22.665  5.679   27.008 1.00 16.81 ? 15  ARG J C     1 
ATOM   5924 O  O     . ARG D 2 15  ? 22.834  5.288   28.165 1.00 14.23 ? 15  ARG J O     1 
ATOM   5925 C  CB    . ARG D 2 15  ? 24.868  6.475   26.097 1.00 22.32 ? 15  ARG J CB    1 
ATOM   5926 C  CG    . ARG D 2 15  ? 25.680  7.676   25.538 1.00 22.98 ? 15  ARG J CG    1 
ATOM   5927 C  CD    . ARG D 2 15  ? 27.198  7.460   25.652 1.00 11.30 ? 15  ARG J CD    1 
ATOM   5928 N  NE    . ARG D 2 15  ? 27.539  7.575   27.053 1.00 11.88 ? 15  ARG J NE    1 
ATOM   5929 C  CZ    . ARG D 2 15  ? 28.767  7.904   27.390 1.00 8.55  ? 15  ARG J CZ    1 
ATOM   5930 N  NH1   . ARG D 2 15  ? 29.695  8.154   26.486 1.00 10.33 ? 15  ARG J NH1   1 
ATOM   5931 N  NH2   . ARG D 2 15  ? 29.070  7.991   28.613 1.00 4.27  ? 15  ARG J NH2   1 
ATOM   5932 N  N     . ASN D 2 16  ? 21.592  5.358   26.325 1.00 21.66 ? 16  ASN J N     1 
ATOM   5933 C  CA    . ASN D 2 16  ? 20.802  4.167   26.735 1.00 23.90 ? 16  ASN J CA    1 
ATOM   5934 C  C     . ASN D 2 16  ? 21.408  2.852   26.163 1.00 20.82 ? 16  ASN J C     1 
ATOM   5935 O  O     . ASN D 2 16  ? 22.207  2.855   25.203 1.00 14.85 ? 16  ASN J O     1 
ATOM   5936 C  CB    . ASN D 2 16  ? 19.377  4.310   26.240 1.00 15.94 ? 16  ASN J CB    1 
ATOM   5937 C  CG    . ASN D 2 16  ? 18.602  5.374   26.983 1.00 18.20 ? 16  ASN J CG    1 
ATOM   5938 O  OD1   . ASN D 2 16  ? 17.611  5.769   26.399 1.00 31.15 ? 16  ASN J OD1   1 
ATOM   5939 N  ND2   . ASN D 2 16  ? 18.913  5.740   28.238 1.00 16.00 ? 16  ASN J ND2   1 
ATOM   5940 N  N     . ALA D 2 17  ? 21.053  1.747   26.808 1.00 20.14 ? 17  ALA J N     1 
ATOM   5941 C  CA    . ALA D 2 17  ? 21.634  0.462   26.429 1.00 19.88 ? 17  ALA J CA    1 
ATOM   5942 C  C     . ALA D 2 17  ? 21.021  0.011   25.156 1.00 22.38 ? 17  ALA J C     1 
ATOM   5943 O  O     . ALA D 2 17  ? 19.963  0.529   24.751 1.00 25.66 ? 17  ALA J O     1 
ATOM   5944 C  CB    . ALA D 2 17  ? 21.456  -0.545  27.539 1.00 19.29 ? 17  ALA J CB    1 
ATOM   5945 N  N     . ILE D 2 18  ? 21.796  -0.753  24.407 1.00 18.88 ? 18  ILE J N     1 
ATOM   5946 C  CA    . ILE D 2 18  ? 21.264  -1.347  23.184 1.00 32.31 ? 18  ILE J CA    1 
ATOM   5947 C  C     . ILE D 2 18  ? 20.123  -2.366  23.440 1.00 34.96 ? 18  ILE J C     1 
ATOM   5948 O  O     . ILE D 2 18  ? 20.140  -3.068  24.477 1.00 35.75 ? 18  ILE J O     1 
ATOM   5949 C  CB    . ILE D 2 18  ? 22.360  -1.828  22.185 1.00 31.35 ? 18  ILE J CB    1 
ATOM   5950 C  CG1   . ILE D 2 18  ? 23.391  -2.791  22.788 1.00 44.10 ? 18  ILE J CG1   1 
ATOM   5951 C  CG2   . ILE D 2 18  ? 23.118  -0.683  21.744 1.00 35.56 ? 18  ILE J CG2   1 
ATOM   5952 C  CD1   . ILE D 2 18  ? 24.461  -3.454  21.848 1.00 41.56 ? 18  ILE J CD1   1 
ATOM   5953 N  N     . HIS D 2 19  ? 19.077  -2.336  22.610 1.00 41.15 ? 19  HIS J N     1 
ATOM   5954 C  CA    . HIS D 2 19  ? 17.927  -3.251  22.819 1.00 54.74 ? 19  HIS J CA    1 
ATOM   5955 C  C     . HIS D 2 19  ? 17.372  -3.839  21.546 1.00 60.83 ? 19  HIS J C     1 
ATOM   5956 O  O     . HIS D 2 19  ? 16.312  -4.487  21.606 1.00 64.38 ? 19  HIS J O     1 
ATOM   5957 C  CB    . HIS D 2 19  ? 16.751  -2.599  23.570 1.00 54.64 ? 19  HIS J CB    1 
ATOM   5958 C  CG    . HIS D 2 19  ? 16.077  -1.466  22.842 1.00 58.15 ? 19  HIS J CG    1 
ATOM   5959 N  ND1   . HIS D 2 19  ? 16.259  -0.148  23.206 1.00 56.07 ? 19  HIS J ND1   1 
ATOM   5960 C  CD2   . HIS D 2 19  ? 15.177  -1.452  21.825 1.00 57.79 ? 19  HIS J CD2   1 
ATOM   5961 C  CE1   . HIS D 2 19  ? 15.506  0.623   22.444 1.00 58.93 ? 19  HIS J CE1   1 
ATOM   5962 N  NE2   . HIS D 2 19  ? 14.841  -0.142  21.598 1.00 60.45 ? 19  HIS J NE2   1 
ATOM   5963 N  N     . ASP D 2 20  ? 17.878  -3.317  20.423 1.00 63.35 ? 20  ASP J N     1 
ATOM   5964 C  CA    . ASP D 2 20  ? 17.493  -3.764  19.088 0.00 69.00 ? 20  ASP J CA    1 
ATOM   5965 C  C     . ASP D 2 20  ? 18.718  -3.714  18.179 0.00 68.17 ? 20  ASP J C     1 
ATOM   5966 O  O     . ASP D 2 20  ? 18.724  -4.426  17.153 0.00 68.15 ? 20  ASP J O     1 
ATOM   5967 C  CB    . ASP D 2 20  ? 16.382  -2.884  18.507 0.00 71.77 ? 20  ASP J CB    1 
ATOM   5968 C  CG    . ASP D 2 20  ? 14.991  -3.330  18.928 0.00 75.34 ? 20  ASP J CG    1 
ATOM   5969 O  OD1   . ASP D 2 20  ? 14.774  -4.551  19.103 0.00 76.70 ? 20  ASP J OD1   1 
ATOM   5970 O  OD2   . ASP D 2 20  ? 14.108  -2.462  19.070 0.00 76.70 ? 20  ASP J OD2   1 
ATOM   5971 O  OXT   . ASP D 2 20  ? 19.661  -2.964  18.514 0.00 68.15 ? 20  ASP J OXT   1 
HETATM 5972 MN MN    . MN  E 3 .   ? 75.227  29.415  33.161 1.00 18.27 ? 401 MN  A MN    1 
HETATM 5973 MN MN    . MN  F 3 .   ? 73.826  25.923  32.346 1.00 16.84 ? 402 MN  A MN    1 
HETATM 5974 P  PG    . ANP G 4 .   ? 73.708  28.509  30.819 1.00 21.59 ? 400 ANP A PG    1 
HETATM 5975 O  O1G   . ANP G 4 .   ? 73.464  26.989  30.818 1.00 17.34 ? 400 ANP A O1G   1 
HETATM 5976 O  O2G   . ANP G 4 .   ? 75.079  28.934  31.200 1.00 18.60 ? 400 ANP A O2G   1 
HETATM 5977 O  O3G   . ANP G 4 .   ? 73.233  29.138  29.596 1.00 8.08  ? 400 ANP A O3G   1 
HETATM 5978 P  PB    . ANP G 4 .   ? 71.699  28.269  32.907 1.00 20.38 ? 400 ANP A PB    1 
HETATM 5979 O  O1B   . ANP G 4 .   ? 70.452  28.406  32.183 1.00 13.97 ? 400 ANP A O1B   1 
HETATM 5980 O  O2B   . ANP G 4 .   ? 72.212  26.929  33.256 1.00 25.39 ? 400 ANP A O2B   1 
HETATM 5981 N  N3B   . ANP G 4 .   ? 72.848  29.111  32.068 1.00 16.93 ? 400 ANP A N3B   1 
HETATM 5982 P  PA    . ANP G 4 .   ? 72.683  29.286  35.386 1.00 19.00 ? 400 ANP A PA    1 
HETATM 5983 O  O1A   . ANP G 4 .   ? 72.680  28.199  36.380 1.00 18.64 ? 400 ANP A O1A   1 
HETATM 5984 O  O2A   . ANP G 4 .   ? 73.977  29.669  34.721 1.00 16.89 ? 400 ANP A O2A   1 
HETATM 5985 O  O3A   . ANP G 4 .   ? 71.528  29.079  34.285 1.00 9.41  ? 400 ANP A O3A   1 
HETATM 5986 O  "O5'" . ANP G 4 .   ? 72.092  30.565  36.156 1.00 23.47 ? 400 ANP A "O5'" 1 
HETATM 5987 C  "C5'" . ANP G 4 .   ? 71.831  31.782  35.442 1.00 21.75 ? 400 ANP A "C5'" 1 
HETATM 5988 C  "C4'" . ANP G 4 .   ? 72.435  32.951  36.190 1.00 16.37 ? 400 ANP A "C4'" 1 
HETATM 5989 O  "O4'" . ANP G 4 .   ? 71.827  33.098  37.487 1.00 17.72 ? 400 ANP A "O4'" 1 
HETATM 5990 C  "C3'" . ANP G 4 .   ? 73.922  32.754  36.457 1.00 13.06 ? 400 ANP A "C3'" 1 
HETATM 5991 O  "O3'" . ANP G 4 .   ? 74.727  33.149  35.351 1.00 16.67 ? 400 ANP A "O3'" 1 
HETATM 5992 C  "C2'" . ANP G 4 .   ? 74.154  33.605  37.672 1.00 19.95 ? 400 ANP A "C2'" 1 
HETATM 5993 O  "O2'" . ANP G 4 .   ? 74.301  34.973  37.266 1.00 16.39 ? 400 ANP A "O2'" 1 
HETATM 5994 C  "C1'" . ANP G 4 .   ? 72.838  33.486  38.436 1.00 15.44 ? 400 ANP A "C1'" 1 
HETATM 5995 N  N9    . ANP G 4 .   ? 72.939  32.529  39.532 1.00 16.72 ? 400 ANP A N9    1 
HETATM 5996 C  C8    . ANP G 4 .   ? 72.997  31.155  39.477 1.00 18.42 ? 400 ANP A C8    1 
HETATM 5997 N  N7    . ANP G 4 .   ? 73.257  30.596  40.619 1.00 19.01 ? 400 ANP A N7    1 
HETATM 5998 C  C5    . ANP G 4 .   ? 73.330  31.669  41.506 1.00 23.19 ? 400 ANP A C5    1 
HETATM 5999 C  C6    . ANP G 4 .   ? 73.495  31.729  42.893 1.00 23.95 ? 400 ANP A C6    1 
HETATM 6000 N  N6    . ANP G 4 .   ? 73.588  30.634  43.655 1.00 28.10 ? 400 ANP A N6    1 
HETATM 6001 N  N1    . ANP G 4 .   ? 73.508  32.961  43.463 1.00 30.51 ? 400 ANP A N1    1 
HETATM 6002 C  C2    . ANP G 4 .   ? 73.333  34.036  42.699 1.00 20.92 ? 400 ANP A C2    1 
HETATM 6003 N  N3    . ANP G 4 .   ? 73.132  34.097  41.390 1.00 22.72 ? 400 ANP A N3    1 
HETATM 6004 C  C4    . ANP G 4 .   ? 73.149  32.850  40.850 1.00 24.70 ? 400 ANP A C4    1 
HETATM 6005 C  C9    . MYR H 5 .   ? 93.954  20.032  52.480 1.00 31.53 ? 403 MYR A C9    1 
HETATM 6006 C  C10   . MYR H 5 .   ? 92.813  19.794  51.493 1.00 40.00 ? 403 MYR A C10   1 
HETATM 6007 C  C11   . MYR H 5 .   ? 93.059  20.275  50.074 1.00 37.17 ? 403 MYR A C11   1 
HETATM 6008 C  C12   . MYR H 5 .   ? 91.948  19.840  49.085 1.00 36.98 ? 403 MYR A C12   1 
HETATM 6009 C  C13   . MYR H 5 .   ? 92.440  19.947  47.613 1.00 41.28 ? 403 MYR A C13   1 
HETATM 6010 C  C14   . MYR H 5 .   ? 91.594  19.291  46.522 1.00 32.37 ? 403 MYR A C14   1 
HETATM 6011 MN MN    . MN  I 3 .   ? 21.156  2.223   32.891 1.00 16.11 ? 401 MN  B MN    1 
HETATM 6012 MN MN    . MN  J 3 .   ? 19.859  -1.344  32.099 1.00 19.28 ? 402 MN  B MN    1 
HETATM 6013 P  PG    . ANP K 4 .   ? 19.856  1.322   30.600 1.00 19.78 ? 400 ANP B PG    1 
HETATM 6014 O  O1G   . ANP K 4 .   ? 19.624  -0.185  30.604 1.00 20.65 ? 400 ANP B O1G   1 
HETATM 6015 O  O2G   . ANP K 4 .   ? 21.237  1.803   30.942 1.00 11.17 ? 400 ANP B O2G   1 
HETATM 6016 O  O3G   . ANP K 4 .   ? 19.335  1.937   29.376 1.00 10.73 ? 400 ANP B O3G   1 
HETATM 6017 P  PB    . ANP K 4 .   ? 17.748  1.033   32.587 1.00 20.25 ? 400 ANP B PB    1 
HETATM 6018 O  O1B   . ANP K 4 .   ? 16.520  1.253   31.821 1.00 12.75 ? 400 ANP B O1B   1 
HETATM 6019 O  O2B   . ANP K 4 .   ? 18.183  -0.335  32.911 1.00 19.35 ? 400 ANP B O2B   1 
HETATM 6020 N  N3B   . ANP K 4 .   ? 18.994  1.872   31.872 1.00 13.10 ? 400 ANP B N3B   1 
HETATM 6021 P  PA    . ANP K 4 .   ? 18.662  2.063   35.108 1.00 17.62 ? 400 ANP B PA    1 
HETATM 6022 O  O1A   . ANP K 4 .   ? 18.607  0.981   36.114 1.00 17.66 ? 400 ANP B O1A   1 
HETATM 6023 O  O2A   . ANP K 4 .   ? 19.979  2.473   34.514 1.00 16.09 ? 400 ANP B O2A   1 
HETATM 6024 O  O3A   . ANP K 4 .   ? 17.542  1.802   33.963 1.00 11.90 ? 400 ANP B O3A   1 
HETATM 6025 O  "O5'" . ANP K 4 .   ? 18.007  3.349   35.810 1.00 22.06 ? 400 ANP B "O5'" 1 
HETATM 6026 C  "C5'" . ANP K 4 .   ? 17.758  4.536   35.042 1.00 16.30 ? 400 ANP B "C5'" 1 
HETATM 6027 C  "C4'" . ANP K 4 .   ? 18.280  5.752   35.777 1.00 12.80 ? 400 ANP B "C4'" 1 
HETATM 6028 O  "O4'" . ANP K 4 .   ? 17.664  5.878   37.083 1.00 13.79 ? 400 ANP B "O4'" 1 
HETATM 6029 C  "C3'" . ANP K 4 .   ? 19.774  5.675   36.026 1.00 11.45 ? 400 ANP B "C3'" 1 
HETATM 6030 O  "O3'" . ANP K 4 .   ? 20.547  6.109   34.897 1.00 21.67 ? 400 ANP B "O3'" 1 
HETATM 6031 C  "C2'" . ANP K 4 .   ? 19.959  6.561   37.230 1.00 17.06 ? 400 ANP B "C2'" 1 
HETATM 6032 O  "O2'" . ANP K 4 .   ? 20.066  7.931   36.805 1.00 21.92 ? 400 ANP B "O2'" 1 
HETATM 6033 C  "C1'" . ANP K 4 .   ? 18.654  6.387   38.006 1.00 13.83 ? 400 ANP B "C1'" 1 
HETATM 6034 N  N9    . ANP K 4 .   ? 18.844  5.464   39.101 1.00 11.80 ? 400 ANP B N9    1 
HETATM 6035 C  C8    . ANP K 4 .   ? 18.891  4.090   39.068 1.00 12.95 ? 400 ANP B C8    1 
HETATM 6036 N  N7    . ANP K 4 .   ? 19.060  3.550   40.242 1.00 15.67 ? 400 ANP B N7    1 
HETATM 6037 C  C5    . ANP K 4 .   ? 19.108  4.636   41.110 1.00 16.11 ? 400 ANP B C5    1 
HETATM 6038 C  C6    . ANP K 4 .   ? 19.198  4.724   42.505 1.00 19.09 ? 400 ANP B C6    1 
HETATM 6039 N  N6    . ANP K 4 .   ? 19.258  3.640   43.295 1.00 17.46 ? 400 ANP B N6    1 
HETATM 6040 N  N1    . ANP K 4 .   ? 19.225  5.971   43.054 1.00 19.82 ? 400 ANP B N1    1 
HETATM 6041 C  C2    . ANP K 4 .   ? 19.148  7.038   42.259 1.00 7.44  ? 400 ANP B C2    1 
HETATM 6042 N  N3    . ANP K 4 .   ? 18.998  7.081   40.944 1.00 12.68 ? 400 ANP B N3    1 
HETATM 6043 C  C4    . ANP K 4 .   ? 19.001  5.813   40.424 1.00 19.83 ? 400 ANP B C4    1 
HETATM 6044 C  C9    . MYR L 5 .   ? 39.317  -6.757  52.275 1.00 28.45 ? 403 MYR B C9    1 
HETATM 6045 C  C10   . MYR L 5 .   ? 39.483  -6.281  50.800 1.00 33.07 ? 403 MYR B C10   1 
HETATM 6046 C  C11   . MYR L 5 .   ? 38.292  -6.699  49.941 1.00 34.88 ? 403 MYR B C11   1 
HETATM 6047 C  C12   . MYR L 5 .   ? 38.592  -7.036  48.459 1.00 37.42 ? 403 MYR B C12   1 
HETATM 6048 C  C13   . MYR L 5 .   ? 37.263  -7.199  47.718 1.00 33.16 ? 403 MYR B C13   1 
HETATM 6049 C  C14   . MYR L 5 .   ? 37.275  -7.738  46.320 1.00 27.76 ? 403 MYR B C14   1 
HETATM 6050 O  O     . HOH M 6 .   ? 70.330  23.786  33.637 1.00 16.32 ? 404 HOH A O     1 
HETATM 6051 O  O     . HOH M 6 .   ? 68.729  22.106  31.933 1.00 18.97 ? 405 HOH A O     1 
HETATM 6052 O  O     . HOH M 6 .   ? 71.301  21.827  30.778 1.00 18.91 ? 406 HOH A O     1 
HETATM 6053 O  O     . HOH M 6 .   ? 73.638  19.101  25.246 1.00 50.26 ? 407 HOH A O     1 
HETATM 6054 O  O     . HOH M 6 .   ? 71.349  16.520  24.776 1.00 62.90 ? 408 HOH A O     1 
HETATM 6055 O  O     . HOH M 6 .   ? 70.335  15.682  28.314 1.00 25.17 ? 409 HOH A O     1 
HETATM 6056 O  O     . HOH M 6 .   ? 76.218  11.716  36.027 1.00 21.09 ? 410 HOH A O     1 
HETATM 6057 O  O     . HOH M 6 .   ? 76.681  9.071   35.084 1.00 29.04 ? 411 HOH A O     1 
HETATM 6058 O  O     . HOH M 6 .   ? 74.747  10.248  32.771 1.00 48.11 ? 412 HOH A O     1 
HETATM 6059 O  O     . HOH M 6 .   ? 64.110  10.297  32.759 1.00 28.78 ? 413 HOH A O     1 
HETATM 6060 O  O     . HOH M 6 .   ? 56.932  16.225  37.460 1.00 39.21 ? 414 HOH A O     1 
HETATM 6061 O  O     . HOH M 6 .   ? 58.086  13.828  38.111 1.00 28.29 ? 415 HOH A O     1 
HETATM 6062 O  O     . HOH M 6 .   ? 56.234  22.972  32.123 1.00 42.57 ? 416 HOH A O     1 
HETATM 6063 O  O     . HOH M 6 .   ? 51.967  21.586  40.887 1.00 36.80 ? 417 HOH A O     1 
HETATM 6064 O  O     . HOH M 6 .   ? 56.420  29.593  34.558 1.00 40.30 ? 418 HOH A O     1 
HETATM 6065 O  O     . HOH M 6 .   ? 63.095  27.125  31.924 1.00 32.35 ? 419 HOH A O     1 
HETATM 6066 O  O     . HOH M 6 .   ? 73.395  24.394  38.989 1.00 19.93 ? 420 HOH A O     1 
HETATM 6067 O  O     . HOH M 6 .   ? 71.480  32.147  50.920 1.00 21.48 ? 421 HOH A O     1 
HETATM 6068 O  O     . HOH M 6 .   ? 73.070  37.969  35.970 1.00 21.83 ? 422 HOH A O     1 
HETATM 6069 O  O     . HOH M 6 .   ? 74.678  40.323  36.433 1.00 23.78 ? 423 HOH A O     1 
HETATM 6070 O  O     . HOH M 6 .   ? 76.805  40.213  38.174 1.00 23.22 ? 424 HOH A O     1 
HETATM 6071 O  O     . HOH M 6 .   ? 76.709  40.204  34.419 1.00 23.19 ? 425 HOH A O     1 
HETATM 6072 O  O     . HOH M 6 .   ? 86.832  42.242  29.525 1.00 28.63 ? 426 HOH A O     1 
HETATM 6073 O  O     . HOH M 6 .   ? 85.874  48.721  30.894 1.00 27.97 ? 427 HOH A O     1 
HETATM 6074 O  O     . HOH M 6 .   ? 93.191  43.326  38.843 1.00 29.74 ? 428 HOH A O     1 
HETATM 6075 O  O     . HOH M 6 .   ? 97.678  33.079  44.775 1.00 39.82 ? 429 HOH A O     1 
HETATM 6076 O  O     . HOH M 6 .   ? 80.292  31.867  50.277 1.00 51.52 ? 430 HOH A O     1 
HETATM 6077 O  O     . HOH M 6 .   ? 86.684  11.365  31.788 1.00 37.12 ? 431 HOH A O     1 
HETATM 6078 O  O     . HOH M 6 .   ? 84.664  23.344  31.652 1.00 21.78 ? 432 HOH A O     1 
HETATM 6079 O  O     . HOH M 6 .   ? 85.966  22.666  26.655 1.00 25.99 ? 433 HOH A O     1 
HETATM 6080 O  O     . HOH M 6 .   ? 83.286  36.030  20.642 1.00 52.68 ? 434 HOH A O     1 
HETATM 6081 O  O     . HOH M 6 .   ? 81.911  21.864  27.231 1.00 25.09 ? 435 HOH A O     1 
HETATM 6082 O  O     . HOH M 6 .   ? 75.495  24.836  31.438 1.00 17.08 ? 436 HOH A O     1 
HETATM 6083 O  O     . HOH M 6 .   ? 82.521  25.082  27.011 1.00 21.73 ? 437 HOH A O     1 
HETATM 6084 O  O     . HOH M 6 .   ? 81.833  27.160  29.136 1.00 30.39 ? 438 HOH A O     1 
HETATM 6085 O  O     . HOH M 6 .   ? 77.939  22.556  33.907 1.00 12.18 ? 439 HOH A O     1 
HETATM 6086 O  O     . HOH M 6 .   ? 82.148  5.794   31.586 1.00 37.10 ? 440 HOH A O     1 
HETATM 6087 O  O     . HOH M 6 .   ? 89.346  15.217  25.974 1.00 17.62 ? 441 HOH A O     1 
HETATM 6088 O  O     . HOH M 6 .   ? 92.345  16.304  37.049 1.00 24.18 ? 442 HOH A O     1 
HETATM 6089 O  O     . HOH M 6 .   ? 87.964  27.406  23.259 1.00 19.58 ? 443 HOH A O     1 
HETATM 6090 O  O     . HOH M 6 .   ? 96.022  39.273  21.471 1.00 44.71 ? 444 HOH A O     1 
HETATM 6091 O  O     . HOH M 6 .   ? 90.103  35.430  18.347 1.00 30.88 ? 445 HOH A O     1 
HETATM 6092 O  O     . HOH M 6 .   ? 94.574  37.760  19.027 1.00 43.77 ? 446 HOH A O     1 
HETATM 6093 O  O     . HOH M 6 .   ? 87.911  31.912  23.206 1.00 27.39 ? 447 HOH A O     1 
HETATM 6094 O  O     . HOH M 6 .   ? 106.203 38.949  28.012 1.00 50.33 ? 448 HOH A O     1 
HETATM 6095 O  O     . HOH M 6 .   ? 98.235  23.974  20.221 1.00 40.84 ? 449 HOH A O     1 
HETATM 6096 O  O     . HOH M 6 .   ? 65.916  41.630  37.304 1.00 31.07 ? 450 HOH A O     1 
HETATM 6097 O  O     . HOH M 6 .   ? 74.897  31.546  32.777 1.00 14.48 ? 451 HOH A O     1 
HETATM 6098 O  O     . HOH M 6 .   ? 66.733  10.871  43.505 1.00 45.05 ? 452 HOH A O     1 
HETATM 6099 O  O     . HOH M 6 .   ? 70.818  9.992   37.796 1.00 19.33 ? 453 HOH A O     1 
HETATM 6100 O  O     . HOH M 6 .   ? 71.056  11.554  35.592 1.00 33.60 ? 454 HOH A O     1 
HETATM 6101 O  O     . HOH M 6 .   ? 68.342  13.572  39.652 1.00 17.40 ? 455 HOH A O     1 
HETATM 6102 O  O     . HOH M 6 .   ? 77.588  32.520  49.397 1.00 45.73 ? 456 HOH A O     1 
HETATM 6103 O  O     . HOH M 6 .   ? 79.026  8.495   27.509 1.00 50.16 ? 457 HOH A O     1 
HETATM 6104 O  O     . HOH M 6 .   ? 80.064  4.492   27.688 1.00 36.89 ? 458 HOH A O     1 
HETATM 6105 O  O     . HOH M 6 .   ? 89.816  11.892  24.541 1.00 43.35 ? 459 HOH A O     1 
HETATM 6106 O  O     . HOH M 6 .   ? 80.075  16.776  19.520 1.00 57.27 ? 460 HOH A O     1 
HETATM 6107 O  O     . HOH M 6 .   ? 72.432  14.415  26.929 1.00 41.99 ? 461 HOH A O     1 
HETATM 6108 O  O     . HOH M 6 .   ? 74.559  13.130  30.332 1.00 26.69 ? 462 HOH A O     1 
HETATM 6109 O  O     . HOH M 6 .   ? 84.451  22.834  28.944 1.00 59.13 ? 463 HOH A O     1 
HETATM 6110 O  O     . HOH M 6 .   ? 85.451  44.834  28.438 1.00 32.07 ? 464 HOH A O     1 
HETATM 6111 O  O     . HOH M 6 .   ? 91.527  44.847  28.125 1.00 39.12 ? 465 HOH A O     1 
HETATM 6112 O  O     . HOH M 6 .   ? 95.187  42.883  27.101 1.00 31.80 ? 466 HOH A O     1 
HETATM 6113 O  O     . HOH M 6 .   ? 96.176  43.282  24.197 1.00 56.59 ? 467 HOH A O     1 
HETATM 6114 O  O     . HOH M 6 .   ? 99.224  16.746  33.388 1.00 28.89 ? 468 HOH A O     1 
HETATM 6115 O  O     . HOH M 6 .   ? 76.394  41.713  32.201 1.00 24.15 ? 469 HOH A O     1 
HETATM 6116 O  O     . HOH M 6 .   ? 72.099  32.713  23.029 1.00 64.70 ? 470 HOH A O     1 
HETATM 6117 O  O     . HOH M 6 .   ? 55.442  11.540  31.132 1.00 47.73 ? 471 HOH A O     1 
HETATM 6118 O  O     . HOH M 6 .   ? 69.735  41.894  31.484 1.00 31.01 ? 472 HOH A O     1 
HETATM 6119 O  O     . HOH M 6 .   ? 99.521  21.481  48.469 1.00 60.82 ? 473 HOH A O     1 
HETATM 6120 O  O     . HOH M 6 .   ? 87.613  6.445   56.018 1.00 48.66 ? 474 HOH A O     1 
HETATM 6121 O  O     . HOH M 6 .   ? 93.870  7.572   51.935 1.00 43.56 ? 475 HOH A O     1 
HETATM 6122 O  O     . HOH M 6 .   ? 82.892  15.214  49.115 1.00 37.45 ? 476 HOH A O     1 
HETATM 6123 O  O     . HOH M 6 .   ? 71.537  15.149  50.017 1.00 46.60 ? 477 HOH A O     1 
HETATM 6124 O  O     . HOH M 6 .   ? 68.764  13.138  42.225 1.00 36.76 ? 478 HOH A O     1 
HETATM 6125 O  O     . HOH M 6 .   ? 57.210  20.237  45.745 1.00 65.84 ? 479 HOH A O     1 
HETATM 6126 O  O     . HOH M 6 .   ? 57.822  27.517  33.202 1.00 57.66 ? 480 HOH A O     1 
HETATM 6127 O  O     . HOH M 6 .   ? 63.553  10.299  36.534 1.00 31.88 ? 481 HOH A O     1 
HETATM 6128 O  O     . HOH M 6 .   ? 67.936  18.567  47.141 1.00 43.58 ? 482 HOH A O     1 
HETATM 6129 O  O     . HOH M 6 .   ? 76.063  44.138  36.977 1.00 57.89 ? 483 HOH A O     1 
HETATM 6130 O  O     . HOH M 6 .   ? 85.874  51.726  32.024 1.00 62.90 ? 484 HOH A O     1 
HETATM 6131 O  O     . HOH M 6 .   ? 95.017  38.693  46.336 1.00 68.72 ? 485 HOH A O     1 
HETATM 6132 O  O     . HOH M 6 .   ? 98.802  44.516  24.979 1.00 44.56 ? 486 HOH A O     1 
HETATM 6133 O  O     . HOH M 6 .   ? 96.680  21.551  47.629 1.00 37.83 ? 487 HOH A O     1 
HETATM 6134 O  O     . HOH M 6 .   ? 88.398  11.523  45.515 1.00 43.65 ? 488 HOH A O     1 
HETATM 6135 O  O     . HOH M 6 .   ? 90.021  9.317   45.401 1.00 39.80 ? 489 HOH A O     1 
HETATM 6136 O  O     . HOH M 6 .   ? 84.043  5.111   42.676 1.00 52.64 ? 490 HOH A O     1 
HETATM 6137 O  O     . HOH M 6 .   ? 77.944  11.010  25.239 1.00 27.69 ? 491 HOH A O     1 
HETATM 6138 O  O     . HOH M 6 .   ? 75.686  16.556  20.743 1.00 50.41 ? 492 HOH A O     1 
HETATM 6139 O  O     . HOH M 6 .   ? 68.315  9.264   41.775 1.00 56.10 ? 493 HOH A O     1 
HETATM 6140 O  O     . HOH M 6 .   ? 91.226  12.806  36.509 1.00 57.65 ? 494 HOH A O     1 
HETATM 6141 O  O     . HOH M 6 .   ? 99.543  43.267  22.211 1.00 50.48 ? 495 HOH A O     1 
HETATM 6142 O  O     . HOH M 6 .   ? 91.705  17.840  20.169 1.00 38.62 ? 496 HOH A O     1 
HETATM 6143 O  O     . HOH M 6 .   ? 104.750 21.846  35.257 1.00 32.31 ? 497 HOH A O     1 
HETATM 6144 O  O     . HOH M 6 .   ? 87.967  26.032  53.871 1.00 31.83 ? 498 HOH A O     1 
HETATM 6145 O  O     . HOH M 6 .   ? 63.508  17.300  44.727 1.00 21.98 ? 499 HOH A O     1 
HETATM 6146 O  O     . HOH M 6 .   ? 83.347  36.506  23.598 1.00 19.46 ? 500 HOH A O     1 
HETATM 6147 O  O     . HOH M 6 .   ? 98.612  11.651  54.685 1.00 26.86 ? 501 HOH A O     1 
HETATM 6148 O  O     . HOH M 6 .   ? 97.706  15.611  57.254 1.00 51.53 ? 502 HOH A O     1 
HETATM 6149 O  O     . HOH M 6 .   ? 87.736  14.101  53.385 1.00 37.42 ? 503 HOH A O     1 
HETATM 6150 O  O     . HOH M 6 .   ? 79.987  15.470  49.611 1.00 24.22 ? 504 HOH A O     1 
HETATM 6151 O  O     . HOH M 6 .   ? 85.429  18.643  50.771 1.00 36.59 ? 505 HOH A O     1 
HETATM 6152 O  O     . HOH M 6 .   ? 83.719  15.546  52.313 1.00 46.56 ? 506 HOH A O     1 
HETATM 6153 O  O     . HOH M 6 .   ? 75.843  5.112   40.304 1.00 61.08 ? 507 HOH A O     1 
HETATM 6154 O  O     . HOH M 6 .   ? 74.816  4.321   42.825 1.00 62.16 ? 508 HOH A O     1 
HETATM 6155 O  O     . HOH M 6 .   ? 57.464  11.800  41.209 1.00 67.33 ? 509 HOH A O     1 
HETATM 6156 O  O     . HOH M 6 .   ? 63.921  44.181  37.023 1.00 36.84 ? 510 HOH A O     1 
HETATM 6157 O  O     . HOH M 6 .   ? 69.069  41.461  39.164 1.00 25.67 ? 511 HOH A O     1 
HETATM 6158 O  O     . HOH M 6 .   ? 78.751  35.338  50.401 1.00 40.59 ? 512 HOH A O     1 
HETATM 6159 O  O     . HOH M 6 .   ? 70.807  20.549  32.995 1.00 29.54 ? 513 HOH A O     1 
HETATM 6160 O  O     . HOH M 6 .   ? 72.493  24.157  31.830 1.00 23.01 ? 514 HOH A O     1 
HETATM 6161 O  O     . HOH M 6 .   ? 87.910  38.983  44.636 1.00 23.09 ? 515 HOH A O     1 
HETATM 6162 O  O     . HOH M 6 .   ? 74.823  17.030  32.785 1.00 29.13 ? 516 HOH A O     1 
HETATM 6163 O  O     . HOH M 6 .   ? 74.209  42.411  45.117 1.00 25.71 ? 517 HOH A O     1 
HETATM 6164 O  O     . HOH M 6 .   ? 78.539  43.678  31.490 1.00 40.45 ? 518 HOH A O     1 
HETATM 6165 O  O     . HOH M 6 .   ? 72.667  41.052  31.545 1.00 31.49 ? 519 HOH A O     1 
HETATM 6166 O  O     . HOH M 6 .   ? 96.685  41.067  32.736 1.00 26.74 ? 520 HOH A O     1 
HETATM 6167 O  O     . HOH M 6 .   ? 99.465  42.297  35.918 1.00 45.92 ? 521 HOH A O     1 
HETATM 6168 O  O     . HOH M 6 .   ? 99.514  40.545  32.300 1.00 35.61 ? 522 HOH A O     1 
HETATM 6169 O  O     . HOH M 6 .   ? 85.516  11.722  34.751 1.00 46.32 ? 523 HOH A O     1 
HETATM 6170 O  O     . HOH M 6 .   ? 87.252  13.529  35.763 1.00 45.68 ? 524 HOH A O     1 
HETATM 6171 O  O     . HOH M 6 .   ? 82.151  15.194  20.755 1.00 46.60 ? 525 HOH A O     1 
HETATM 6172 O  O     . HOH M 6 .   ? 81.199  38.193  26.396 1.00 25.32 ? 526 HOH A O     1 
HETATM 6173 O  O     . HOH M 6 .   ? 100.388 25.080  50.144 1.00 55.06 ? 527 HOH A O     1 
HETATM 6174 O  O     . HOH M 6 .   ? 65.004  38.360  31.836 1.00 50.68 ? 528 HOH A O     1 
HETATM 6175 O  O     . HOH M 6 .   ? 60.675  36.939  36.800 1.00 35.85 ? 529 HOH A O     1 
HETATM 6176 O  O     . HOH M 6 .   ? 49.395  12.983  36.405 1.00 46.49 ? 530 HOH A O     1 
HETATM 6177 O  O     . HOH M 6 .   ? 65.843  9.760   46.148 1.00 56.33 ? 531 HOH A O     1 
HETATM 6178 O  O     . HOH M 6 .   ? 69.947  31.100  24.103 1.00 63.71 ? 532 HOH A O     1 
HETATM 6179 O  O     . HOH N 6 .   ? 75.117  33.121  30.557 1.00 22.10 ? 49  HOH I O     1 
HETATM 6180 O  O     . HOH N 6 .   ? 79.672  43.383  28.429 1.00 47.54 ? 54  HOH I O     1 
HETATM 6181 O  O     . HOH N 6 .   ? 76.427  31.723  23.213 1.00 22.14 ? 63  HOH I O     1 
HETATM 6182 O  O     . HOH N 6 .   ? 75.720  41.610  29.470 1.00 54.88 ? 70  HOH I O     1 
HETATM 6183 O  O     . HOH N 6 .   ? 94.538  45.088  22.695 1.00 20.99 ? 73  HOH I O     1 
HETATM 6184 O  O     . HOH N 6 .   ? 95.766  48.044  23.471 1.00 76.14 ? 74  HOH I O     1 
HETATM 6185 O  O     . HOH N 6 .   ? 76.972  40.258  23.238 1.00 29.15 ? 75  HOH I O     1 
HETATM 6186 O  O     . HOH N 6 .   ? 74.402  34.004  24.676 1.00 40.01 ? 76  HOH I O     1 
HETATM 6187 O  O     . HOH N 6 .   ? 78.556  42.539  21.862 1.00 31.04 ? 77  HOH I O     1 
HETATM 6188 O  O     . HOH N 6 .   ? 72.690  36.704  26.988 1.00 51.95 ? 78  HOH I O     1 
HETATM 6189 O  O     . HOH N 6 .   ? 72.340  38.392  29.620 1.00 31.23 ? 79  HOH I O     1 
HETATM 6190 O  O     . HOH N 6 .   ? 75.341  32.170  20.342 1.00 62.13 ? 88  HOH I O     1 
HETATM 6191 O  O     . HOH N 6 .   ? 96.744  45.334  20.560 1.00 36.32 ? 109 HOH I O     1 
HETATM 6192 O  O     . HOH N 6 .   ? 92.412  41.557  15.980 1.00 50.16 ? 110 HOH I O     1 
HETATM 6193 O  O     . HOH N 6 .   ? 92.883  46.229  15.721 1.00 23.57 ? 111 HOH I O     1 
HETATM 6194 O  O     . HOH N 6 .   ? 75.499  29.264  21.166 1.00 62.11 ? 113 HOH I O     1 
HETATM 6195 O  O     . HOH N 6 .   ? 73.094  29.308  22.727 1.00 46.13 ? 129 HOH I O     1 
HETATM 6196 O  O     . HOH N 6 .   ? 85.231  43.354  15.948 1.00 31.41 ? 146 HOH I O     1 
HETATM 6197 O  O     . HOH N 6 .   ? 77.488  37.052  23.989 1.00 44.49 ? 147 HOH I O     1 
HETATM 6198 O  O     . HOH N 6 .   ? 74.021  38.805  25.502 1.00 53.10 ? 148 HOH I O     1 
HETATM 6199 O  O     . HOH O 6 .   ? 16.299  -3.322  33.408 1.00 15.14 ? 404 HOH B O     1 
HETATM 6200 O  O     . HOH O 6 .   ? 14.758  -5.217  31.607 1.00 28.09 ? 405 HOH B O     1 
HETATM 6201 O  O     . HOH O 6 .   ? 17.487  -5.493  30.569 1.00 16.11 ? 406 HOH B O     1 
HETATM 6202 O  O     . HOH O 6 .   ? 5.839   5.304   33.839 1.00 60.75 ? 407 HOH B O     1 
HETATM 6203 O  O     . HOH O 6 .   ? 19.897  -8.192  25.284 1.00 29.22 ? 408 HOH B O     1 
HETATM 6204 O  O     . HOH O 6 .   ? 18.113  -10.689 25.094 1.00 41.09 ? 409 HOH B O     1 
HETATM 6205 O  O     . HOH O 6 .   ? 16.510  -11.773 28.164 1.00 25.51 ? 410 HOH B O     1 
HETATM 6206 O  O     . HOH O 6 .   ? 22.363  -15.321 35.911 1.00 21.06 ? 411 HOH B O     1 
HETATM 6207 O  O     . HOH O 6 .   ? 22.901  -17.928 35.075 1.00 22.27 ? 412 HOH B O     1 
HETATM 6208 O  O     . HOH O 6 .   ? 20.280  -16.938 32.816 1.00 31.86 ? 413 HOH B O     1 
HETATM 6209 O  O     . HOH O 6 .   ? 10.390  -16.961 32.560 1.00 34.16 ? 414 HOH B O     1 
HETATM 6210 O  O     . HOH O 6 .   ? 3.378   -11.351 37.300 1.00 53.17 ? 415 HOH B O     1 
HETATM 6211 O  O     . HOH O 6 .   ? 4.073   -13.958 38.034 1.00 48.69 ? 416 HOH B O     1 
HETATM 6212 O  O     . HOH O 6 .   ? 2.260   -4.774  31.526 1.00 28.69 ? 417 HOH B O     1 
HETATM 6213 O  O     . HOH O 6 .   ? -2.191  -5.698  40.596 1.00 41.00 ? 418 HOH B O     1 
HETATM 6214 O  O     . HOH O 6 .   ? 9.355   -0.287  31.556 1.00 49.36 ? 419 HOH B O     1 
HETATM 6215 O  O     . HOH O 6 .   ? 19.333  -2.833  38.757 1.00 21.66 ? 420 HOH B O     1 
HETATM 6216 O  O     . HOH O 6 .   ? 17.409  5.179   50.758 1.00 26.68 ? 421 HOH B O     1 
HETATM 6217 O  O     . HOH O 6 .   ? 19.006  10.654  35.465 1.00 13.56 ? 422 HOH B O     1 
HETATM 6218 O  O     . HOH O 6 .   ? 20.444  13.189  35.734 1.00 25.69 ? 423 HOH B O     1 
HETATM 6219 O  O     . HOH O 6 .   ? 22.449  12.957  37.599 1.00 20.25 ? 424 HOH B O     1 
HETATM 6220 O  O     . HOH O 6 .   ? 22.690  12.940  33.861 1.00 24.34 ? 425 HOH B O     1 
HETATM 6221 O  O     . HOH O 6 .   ? 32.627  15.100  29.555 1.00 29.11 ? 426 HOH B O     1 
HETATM 6222 O  O     . HOH O 6 .   ? 32.115  21.785  30.919 1.00 31.71 ? 427 HOH B O     1 
HETATM 6223 O  O     . HOH O 6 .   ? 38.936  16.484  38.765 1.00 35.97 ? 428 HOH B O     1 
HETATM 6224 O  O     . HOH O 6 .   ? 42.983  6.368   45.476 1.00 47.96 ? 429 HOH B O     1 
HETATM 6225 O  O     . HOH O 6 .   ? 34.436  11.659  51.648 1.00 46.78 ? 430 HOH B O     1 
HETATM 6226 O  O     . HOH O 6 .   ? 32.684  -15.587 32.208 1.00 52.23 ? 431 HOH B O     1 
HETATM 6227 O  O     . HOH O 6 .   ? 30.750  -3.612  31.607 1.00 21.16 ? 432 HOH B O     1 
HETATM 6228 O  O     . HOH O 6 .   ? 32.188  -4.434  26.659 1.00 28.34 ? 433 HOH B O     1 
HETATM 6229 O  O     . HOH O 6 .   ? 28.187  -5.433  27.473 1.00 22.95 ? 434 HOH B O     1 
HETATM 6230 O  O     . HOH O 6 .   ? 21.734  -2.457  31.456 1.00 9.10  ? 435 HOH B O     1 
HETATM 6231 O  O     . HOH O 6 .   ? 28.603  -2.184  27.201 1.00 27.23 ? 436 HOH B O     1 
HETATM 6232 O  O     . HOH O 6 .   ? 28.136  -0.035  28.970 1.00 16.89 ? 437 HOH B O     1 
HETATM 6233 O  O     . HOH O 6 .   ? 24.051  -4.771  33.995 1.00 17.62 ? 438 HOH B O     1 
HETATM 6234 O  O     . HOH O 6 .   ? 28.580  -21.271 31.371 1.00 50.61 ? 439 HOH B O     1 
HETATM 6235 O  O     . HOH O 6 .   ? 35.643  -11.893 26.387 1.00 21.88 ? 440 HOH B O     1 
HETATM 6236 O  O     . HOH O 6 .   ? 38.512  -10.962 36.674 1.00 29.39 ? 441 HOH B O     1 
HETATM 6237 O  O     . HOH O 6 .   ? 34.206  0.192   23.478 1.00 15.87 ? 442 HOH B O     1 
HETATM 6238 O  O     . HOH O 6 .   ? 40.824  6.745   19.611 1.00 36.91 ? 443 HOH B O     1 
HETATM 6239 O  O     . HOH O 6 .   ? 36.887  8.110   18.518 1.00 54.70 ? 444 HOH B O     1 
HETATM 6240 O  O     . HOH O 6 .   ? 40.712  10.151  19.902 1.00 45.27 ? 445 HOH B O     1 
HETATM 6241 O  O     . HOH O 6 .   ? 33.985  4.657   23.299 1.00 21.71 ? 446 HOH B O     1 
HETATM 6242 O  O     . HOH O 6 .   ? 44.611  -3.838  20.271 1.00 41.28 ? 447 HOH B O     1 
HETATM 6243 O  O     . HOH O 6 .   ? 11.703  14.353  36.891 1.00 40.24 ? 448 HOH B O     1 
HETATM 6244 O  O     . HOH O 6 .   ? 20.767  4.473   32.625 1.00 19.89 ? 449 HOH B O     1 
HETATM 6245 O  O     . HOH O 6 .   ? 12.410  -16.044 43.469 1.00 51.69 ? 450 HOH B O     1 
HETATM 6246 O  O     . HOH O 6 .   ? 17.016  -17.026 37.745 1.00 24.68 ? 451 HOH B O     1 
HETATM 6247 O  O     . HOH O 6 .   ? 17.224  -15.721 35.311 1.00 40.26 ? 452 HOH B O     1 
HETATM 6248 O  O     . HOH O 6 .   ? 14.323  -13.680 39.566 1.00 25.78 ? 453 HOH B O     1 
HETATM 6249 O  O     . HOH O 6 .   ? 28.233  18.332  27.258 1.00 40.67 ? 454 HOH B O     1 
HETATM 6250 O  O     . HOH O 6 .   ? 22.584  6.332   49.576 1.00 27.75 ? 455 HOH B O     1 
HETATM 6251 O  O     . HOH O 6 .   ? 24.204  -18.619 28.041 1.00 34.56 ? 456 HOH B O     1 
HETATM 6252 O  O     . HOH O 6 .   ? 26.779  -19.439 28.881 1.00 49.04 ? 457 HOH B O     1 
HETATM 6253 O  O     . HOH O 6 .   ? 36.032  -16.091 25.393 1.00 51.13 ? 458 HOH B O     1 
HETATM 6254 O  O     . HOH O 6 .   ? 27.463  -10.865 20.184 1.00 45.52 ? 459 HOH B O     1 
HETATM 6255 O  O     . HOH O 6 .   ? 18.760  -12.930 26.592 1.00 41.71 ? 460 HOH B O     1 
HETATM 6256 O  O     . HOH O 6 .   ? 20.766  -14.288 30.125 1.00 55.94 ? 461 HOH B O     1 
HETATM 6257 O  O     . HOH O 6 .   ? 30.476  -4.522  28.811 1.00 29.62 ? 462 HOH B O     1 
HETATM 6258 O  O     . HOH O 6 .   ? 37.196  19.170  29.051 1.00 54.69 ? 463 HOH B O     1 
HETATM 6259 O  O     . HOH O 6 .   ? 41.160  16.062  27.299 1.00 27.91 ? 464 HOH B O     1 
HETATM 6260 O  O     . HOH O 6 .   ? 41.741  16.090  24.569 1.00 45.66 ? 465 HOH B O     1 
HETATM 6261 O  O     . HOH O 6 .   ? 49.617  -12.140 34.129 1.00 52.85 ? 466 HOH B O     1 
HETATM 6262 O  O     . HOH O 6 .   ? 21.949  14.447  31.561 1.00 32.01 ? 467 HOH B O     1 
HETATM 6263 O  O     . HOH O 6 .   ? 1.405   -14.818 29.330 1.00 58.57 ? 468 HOH B O     1 
HETATM 6264 O  O     . HOH O 6 .   ? 15.541  14.944  31.029 1.00 36.64 ? 469 HOH B O     1 
HETATM 6265 O  O     . HOH O 6 .   ? 42.780  -5.320  47.991 1.00 34.22 ? 470 HOH B O     1 
HETATM 6266 O  O     . HOH O 6 .   ? 40.031  -19.737 51.278 1.00 50.09 ? 471 HOH B O     1 
HETATM 6267 O  O     . HOH O 6 .   ? 28.296  -11.783 49.139 1.00 28.44 ? 472 HOH B O     1 
HETATM 6268 O  O     . HOH O 6 .   ? 21.848  -8.735  49.475 1.00 58.72 ? 473 HOH B O     1 
HETATM 6269 O  O     . HOH O 6 .   ? 14.412  -14.000 42.162 1.00 26.09 ? 474 HOH B O     1 
HETATM 6270 O  O     . HOH O 6 .   ? 13.402  1.523   24.793 1.00 40.05 ? 475 HOH B O     1 
HETATM 6271 O  O     . HOH O 6 .   ? 5.937   1.216   33.083 1.00 44.91 ? 476 HOH B O     1 
HETATM 6272 O  O     . HOH O 6 .   ? 9.524   -16.791 36.057 1.00 37.61 ? 477 HOH B O     1 
HETATM 6273 O  O     . HOH O 6 .   ? 14.548  -8.131  47.927 1.00 43.40 ? 478 HOH B O     1 
HETATM 6274 O  O     . HOH O 6 .   ? 21.924  17.006  36.549 1.00 54.10 ? 479 HOH B O     1 
HETATM 6275 O  O     . HOH O 6 .   ? 33.233  24.985  31.772 1.00 57.33 ? 480 HOH B O     1 
HETATM 6276 O  O     . HOH O 6 .   ? 35.443  22.866  33.664 1.00 61.37 ? 481 HOH B O     1 
HETATM 6277 O  O     . HOH O 6 .   ? 44.047  5.596   48.720 1.00 59.70 ? 482 HOH B O     1 
HETATM 6278 O  O     . HOH O 6 .   ? 37.896  -11.762 40.508 1.00 36.46 ? 483 HOH B O     1 
HETATM 6279 O  O     . HOH O 6 .   ? 32.445  -14.193 34.918 1.00 62.44 ? 484 HOH B O     1 
HETATM 6280 O  O     . HOH O 6 .   ? 30.325  13.100  53.354 1.00 58.15 ? 485 HOH B O     1 
HETATM 6281 O  O     . HOH O 6 .   ? 24.559  -16.605 25.469 1.00 32.96 ? 486 HOH B O     1 
HETATM 6282 O  O     . HOH O 6 .   ? 22.008  -11.801 21.503 1.00 38.45 ? 487 HOH B O     1 
HETATM 6283 O  O     . HOH O 6 .   ? 14.179  -17.867 41.447 1.00 67.70 ? 488 HOH B O     1 
HETATM 6284 O  O     . HOH O 6 .   ? 37.424  -14.184 38.340 1.00 44.39 ? 489 HOH B O     1 
HETATM 6285 O  O     . HOH O 6 .   ? 45.589  16.333  22.840 1.00 53.68 ? 490 HOH B O     1 
HETATM 6286 O  O     . HOH O 6 .   ? 38.444  -9.584  20.980 1.00 33.53 ? 491 HOH B O     1 
HETATM 6287 O  O     . HOH O 6 .   ? 51.375  -4.953  37.346 1.00 58.54 ? 492 HOH B O     1 
HETATM 6288 O  O     . HOH O 6 .   ? 33.461  -0.753  53.799 1.00 34.37 ? 493 HOH B O     1 
HETATM 6289 O  O     . HOH O 6 .   ? 9.277   -9.864  44.213 1.00 22.54 ? 494 HOH B O     1 
HETATM 6290 O  O     . HOH O 6 .   ? 25.476  -11.224 49.961 1.00 41.66 ? 495 HOH B O     1 
HETATM 6291 O  O     . HOH O 6 .   ? 30.087  -9.797  50.957 1.00 49.70 ? 496 HOH B O     1 
HETATM 6292 O  O     . HOH O 6 .   ? 31.922  -11.422 53.555 1.00 55.16 ? 497 HOH B O     1 
HETATM 6293 O  O     . HOH O 6 .   ? 16.121  -20.059 42.138 1.00 40.32 ? 498 HOH B O     1 
HETATM 6294 O  O     . HOH O 6 .   ? 16.819  -6.532  32.795 1.00 35.55 ? 499 HOH B O     1 
HETATM 6295 O  O     . HOH O 6 .   ? 21.781  -22.137 40.668 1.00 35.61 ? 500 HOH B O     1 
HETATM 6296 O  O     . HOH O 6 .   ? 12.009  -8.970  47.446 1.00 37.89 ? 501 HOH B O     1 
HETATM 6297 O  O     . HOH O 6 .   ? 3.278   -7.056  46.554 1.00 35.05 ? 502 HOH B O     1 
HETATM 6298 O  O     . HOH O 6 .   ? 1.777   7.977   45.133 1.00 47.19 ? 503 HOH B O     1 
HETATM 6299 O  O     . HOH O 6 .   ? 19.991  15.636  44.608 1.00 42.53 ? 504 HOH B O     1 
HETATM 6300 O  O     . HOH O 6 .   ? 15.088  14.270  38.982 1.00 35.05 ? 505 HOH B O     1 
HETATM 6301 O  O     . HOH O 6 .   ? 18.560  -3.205  31.757 1.00 11.25 ? 506 HOH B O     1 
HETATM 6302 O  O     . HOH O 6 .   ? 12.116  3.403   29.813 1.00 45.80 ? 507 HOH B O     1 
HETATM 6303 O  O     . HOH O 6 .   ? 8.795   2.142   33.200 1.00 39.05 ? 508 HOH B O     1 
HETATM 6304 O  O     . HOH O 6 .   ? 5.048   -7.660  24.137 1.00 44.60 ? 509 HOH B O     1 
HETATM 6305 O  O     . HOH O 6 .   ? 9.569   -9.795  21.537 1.00 58.33 ? 510 HOH B O     1 
HETATM 6306 O  O     . HOH O 6 .   ? 12.656  -16.787 30.640 1.00 35.41 ? 511 HOH B O     1 
HETATM 6307 O  O     . HOH O 6 .   ? 20.979  -10.216 32.660 1.00 22.98 ? 512 HOH B O     1 
HETATM 6308 O  O     . HOH O 6 .   ? 23.527  -4.869  46.715 1.00 43.97 ? 513 HOH B O     1 
HETATM 6309 O  O     . HOH O 6 .   ? 20.965  -5.789  46.960 1.00 42.77 ? 514 HOH B O     1 
HETATM 6310 O  O     . HOH O 6 .   ? 25.917  -0.110  49.200 1.00 35.19 ? 515 HOH B O     1 
HETATM 6311 O  O     . HOH O 6 .   ? 24.782  8.406   50.484 1.00 31.08 ? 516 HOH B O     1 
HETATM 6312 O  O     . HOH O 6 .   ? 4.348   -9.212  44.061 1.00 47.72 ? 517 HOH B O     1 
HETATM 6313 O  O     . HOH O 6 .   ? 4.304   -15.264 41.790 1.00 35.69 ? 518 HOH B O     1 
HETATM 6314 O  O     . HOH O 6 .   ? 19.244  7.667   50.874 1.00 38.68 ? 519 HOH B O     1 
HETATM 6315 O  O     . HOH O 6 .   ? 24.694  17.245  38.831 1.00 46.26 ? 520 HOH B O     1 
HETATM 6316 O  O     . HOH O 6 .   ? 33.083  12.069  44.362 1.00 19.83 ? 521 HOH B O     1 
HETATM 6317 O  O     . HOH O 6 .   ? 26.258  18.512  36.857 1.00 40.20 ? 522 HOH B O     1 
HETATM 6318 O  O     . HOH O 6 .   ? 38.173  20.533  32.953 1.00 54.96 ? 523 HOH B O     1 
HETATM 6319 O  O     . HOH O 6 .   ? 42.362  14.226  33.177 1.00 32.95 ? 524 HOH B O     1 
HETATM 6320 O  O     . HOH O 6 .   ? 45.140  13.812  32.303 1.00 34.67 ? 525 HOH B O     1 
HETATM 6321 O  O     . HOH O 6 .   ? 45.728  15.335  36.069 1.00 42.32 ? 526 HOH B O     1 
HETATM 6322 O  O     . HOH O 6 .   ? 27.409  10.972  26.319 1.00 14.92 ? 527 HOH B O     1 
HETATM 6323 O  O     . HOH O 6 .   ? 36.399  -13.862 23.267 1.00 42.33 ? 528 HOH B O     1 
HETATM 6324 O  O     . HOH O 6 .   ? 38.828  5.994   17.804 1.00 41.55 ? 529 HOH B O     1 
HETATM 6325 O  O     . HOH O 6 .   ? 42.292  11.891  21.521 1.00 29.69 ? 530 HOH B O     1 
HETATM 6326 O  O     . HOH O 6 .   ? 37.935  9.943   20.698 1.00 51.72 ? 531 HOH B O     1 
HETATM 6327 O  O     . HOH O 6 .   ? 52.968  5.140   28.277 1.00 41.64 ? 532 HOH B O     1 
HETATM 6328 O  O     . HOH O 6 .   ? 51.057  7.728   37.503 1.00 45.13 ? 533 HOH B O     1 
HETATM 6329 O  O     . HOH O 6 .   ? 52.884  -2.668  33.066 1.00 31.42 ? 534 HOH B O     1 
HETATM 6330 O  O     . HOH O 6 .   ? 53.302  2.295   33.070 1.00 53.92 ? 535 HOH B O     1 
HETATM 6331 O  O     . HOH O 6 .   ? 44.118  -8.878  44.865 1.00 37.53 ? 536 HOH B O     1 
HETATM 6332 O  O     . HOH O 6 .   ? 50.034  -0.441  41.837 1.00 45.45 ? 537 HOH B O     1 
HETATM 6333 O  O     . HOH O 6 .   ? 48.878  -0.185  44.830 1.00 35.72 ? 538 HOH B O     1 
HETATM 6334 O  O     . HOH O 6 .   ? 51.996  -3.056  35.556 1.00 58.45 ? 539 HOH B O     1 
HETATM 6335 O  O     . HOH O 6 .   ? 53.348  -0.491  35.732 1.00 40.78 ? 540 HOH B O     1 
HETATM 6336 O  O     . HOH O 6 .   ? 49.809  6.186   41.353 1.00 44.72 ? 541 HOH B O     1 
HETATM 6337 O  O     . HOH O 6 .   ? 18.423  13.923  31.166 1.00 30.63 ? 542 HOH B O     1 
HETATM 6338 O  O     . HOH O 6 .   ? 16.840  18.806  33.142 1.00 43.35 ? 543 HOH B O     1 
HETATM 6339 O  O     . HOH P 6 .   ? 21.310  5.788   30.377 1.00 16.48 ? 196 HOH J O     1 
HETATM 6340 O  O     . HOH P 6 .   ? 22.890  4.333   22.875 1.00 29.27 ? 210 HOH J O     1 
HETATM 6341 O  O     . HOH P 6 .   ? 31.694  18.046  28.614 1.00 29.68 ? 211 HOH J O     1 
HETATM 6342 O  O     . HOH P 6 .   ? 21.310  13.817  28.715 1.00 37.15 ? 217 HOH J O     1 
HETATM 6343 O  O     . HOH P 6 .   ? 19.462  1.045   22.006 1.00 57.03 ? 218 HOH J O     1 
HETATM 6344 O  O     . HOH P 6 .   ? 40.732  17.989  22.841 1.00 34.05 ? 220 HOH J O     1 
HETATM 6345 O  O     . HOH P 6 .   ? 23.127  12.906  22.699 1.00 31.08 ? 221 HOH J O     1 
HETATM 6346 O  O     . HOH P 6 .   ? 20.787  6.492   23.852 1.00 23.98 ? 222 HOH J O     1 
HETATM 6347 O  O     . HOH P 6 .   ? 24.711  15.345  21.400 1.00 24.24 ? 223 HOH J O     1 
HETATM 6348 O  O     . HOH P 6 .   ? 19.238  9.075   26.577 1.00 46.18 ? 224 HOH J O     1 
HETATM 6349 O  O     . HOH P 6 .   ? 18.092  10.728  28.798 1.00 27.47 ? 225 HOH J O     1 
HETATM 6350 O  O     . HOH P 6 .   ? 21.121  4.876   19.712 1.00 49.44 ? 232 HOH J O     1 
HETATM 6351 O  O     . HOH P 6 .   ? 17.666  5.341   22.389 1.00 49.58 ? 233 HOH J O     1 
HETATM 6352 O  O     . HOH P 6 .   ? 42.677  17.497  20.140 1.00 32.10 ? 254 HOH J O     1 
HETATM 6353 O  O     . HOH P 6 .   ? 41.785  17.438  16.713 1.00 63.28 ? 255 HOH J O     1 
HETATM 6354 O  O     . HOH P 6 .   ? 38.530  14.742  16.551 1.00 44.57 ? 256 HOH J O     1 
HETATM 6355 O  O     . HOH P 6 .   ? 39.144  19.137  15.493 1.00 22.94 ? 257 HOH J O     1 
HETATM 6356 O  O     . HOH P 6 .   ? 29.519  9.153   23.796 1.00 25.08 ? 258 HOH J O     1 
HETATM 6357 O  O     . HOH P 6 .   ? 21.942  2.473   20.755 1.00 55.10 ? 259 HOH J O     1 
HETATM 6358 O  O     . HOH P 6 .   ? 25.281  16.367  27.531 1.00 35.81 ? 288 HOH J O     1 
HETATM 6359 O  O     . HOH P 6 .   ? 22.646  9.473   23.025 1.00 54.50 ? 295 HOH J O     1 
HETATM 6360 O  O     . HOH P 6 .   ? 23.222  7.453   17.731 1.00 57.36 ? 296 HOH J O     1 
HETATM 6361 O  O     . HOH P 6 .   ? 31.441  16.768  15.730 1.00 47.28 ? 312 HOH J O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   ?   ?   ?   A . n 
A 1 2   ASN 2   2   ?   ?   ?   A . n 
A 1 3   ALA 3   3   ?   ?   ?   A . n 
A 1 4   ALA 4   4   ?   ?   ?   A . n 
A 1 5   ALA 5   5   ?   ?   ?   A . n 
A 1 6   ALA 6   6   ?   ?   ?   A . n 
A 1 7   LYS 7   7   ?   ?   ?   A . n 
A 1 8   LYS 8   8   8   LYS LYS A . n 
A 1 9   GLY 9   9   9   GLY GLY A . n 
A 1 10  SER 10  10  10  SER SER A . n 
A 1 11  GLU 11  11  11  GLU GLU A . n 
A 1 12  GLN 12  12  12  GLN GLN A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  SER 14  14  14  SER SER A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  PHE 18  18  18  PHE PHE A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  ALA 20  20  20  ALA ALA A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  ALA 22  22  22  ALA ALA A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  ASP 25  25  25  ASP ASP A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  TRP 30  30  30  TRP TRP A . n 
A 1 31  GLU 31  31  31  GLU GLU A . n 
A 1 32  ASN 32  32  32  ASN ASN A . n 
A 1 33  PRO 33  33  33  PRO PRO A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  GLN 35  35  35  GLN GLN A . n 
A 1 36  ASN 36  36  36  ASN ASN A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  HIS 39  39  39  HIS HIS A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  ASP 41  41  41  ASP ASP A . n 
A 1 42  GLN 42  42  42  GLN GLN A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ILE 46  46  46  ILE ILE A . n 
A 1 47  LYS 47  47  47  LYS LYS A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  LEU 49  49  49  LEU LEU A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  GLY 52  52  52  GLY GLY A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  PHE 54  54  54  PHE PHE A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  MET 58  58  58  MET MET A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  HIS 62  62  62  HIS HIS A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  THR 65  65  65  THR THR A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  HIS 68  68  68  HIS HIS A . n 
A 1 69  PHE 69  69  69  PHE PHE A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  MET 71  71  71  MET MET A . n 
A 1 72  LYS 72  72  72  LYS LYS A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  LYS 76  76  76  LYS LYS A . n 
A 1 77  GLN 77  77  77  GLN GLN A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  LYS 83  83  83  LYS LYS A . n 
A 1 84  GLN 84  84  84  GLN GLN A . n 
A 1 85  ILE 85  85  85  ILE ILE A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  HIS 87  87  87  HIS HIS A . n 
A 1 88  THR 88  88  88  THR THR A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  ASN 90  90  90  ASN ASN A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  ARG 93  93  93  ARG ARG A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  GLN 96  96  96  GLN GLN A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  ASN 99  99  99  ASN ASN A . n 
A 1 100 PHE 100 100 100 PHE PHE A . n 
A 1 101 PRO 101 101 101 PRO PRO A . n 
A 1 102 PHE 102 102 102 PHE PHE A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 VAL 104 104 104 VAL VAL A . n 
A 1 105 LYS 105 105 105 LYS LYS A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 GLU 107 107 107 GLU GLU A . n 
A 1 108 TYR 108 108 108 TYR TYR A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 PHE 110 110 110 PHE PHE A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 ASN 113 113 113 ASN ASN A . n 
A 1 114 SER 114 114 114 SER SER A . n 
A 1 115 ASN 115 115 115 ASN ASN A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 TYR 117 117 117 TYR TYR A . n 
A 1 118 MET 118 118 118 MET MET A . n 
A 1 119 VAL 119 119 119 VAL VAL A . n 
A 1 120 MET 120 120 120 MET MET A . n 
A 1 121 GLU 121 121 121 GLU GLU A . n 
A 1 122 TYR 122 122 122 TYR TYR A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 PRO 124 124 124 PRO PRO A . n 
A 1 125 GLY 125 125 125 GLY GLY A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 GLU 127 127 127 GLU GLU A . n 
A 1 128 MET 128 128 128 MET MET A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 SER 130 130 130 SER SER A . n 
A 1 131 HIS 131 131 131 HIS HIS A . n 
A 1 132 LEU 132 132 132 LEU LEU A . n 
A 1 133 ARG 133 133 133 ARG ARG A . n 
A 1 134 ARG 134 134 134 ARG ARG A . n 
A 1 135 ILE 135 135 135 ILE ILE A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 PHE 138 138 138 PHE PHE A . n 
A 1 139 SER 139 139 139 SER SER A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 PRO 141 141 141 PRO PRO A . n 
A 1 142 HIS 142 142 142 HIS HIS A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 ARG 144 144 144 ARG ARG A . n 
A 1 145 PHE 145 145 145 PHE PHE A . n 
A 1 146 TYR 146 146 146 TYR TYR A . n 
A 1 147 ALA 147 147 147 ALA ALA A . n 
A 1 148 ALA 148 148 148 ALA ALA A . n 
A 1 149 GLN 149 149 149 GLN GLN A . n 
A 1 150 ILE 150 150 150 ILE ILE A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 THR 153 153 153 THR THR A . n 
A 1 154 PHE 154 154 154 PHE PHE A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 TYR 156 156 156 TYR TYR A . n 
A 1 157 LEU 157 157 157 LEU LEU A . n 
A 1 158 HIS 158 158 158 HIS HIS A . n 
A 1 159 SER 159 159 159 SER SER A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 ASP 161 161 161 ASP ASP A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 ILE 163 163 163 ILE ILE A . n 
A 1 164 TYR 164 164 164 TYR TYR A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 LYS 168 168 168 LYS LYS A . n 
A 1 169 PRO 169 169 169 PRO PRO A . n 
A 1 170 GLU 170 170 170 GLU GLU A . n 
A 1 171 ASN 171 171 171 ASN ASN A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 GLN 177 177 177 GLN GLN A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 TYR 179 179 179 TYR TYR A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 THR 183 183 183 THR THR A . n 
A 1 184 ASP 184 184 184 ASP ASP A . n 
A 1 185 PHE 185 185 185 PHE PHE A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 LYS 189 189 189 LYS LYS A . n 
A 1 190 ARG 190 190 190 ARG ARG A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 GLY 193 193 193 GLY GLY A . n 
A 1 194 ARG 194 194 194 ARG ARG A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 TRP 196 196 196 TRP TRP A . n 
A 1 197 TPO 197 197 197 TPO TPO A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 CYS 199 199 199 CYS CYS A . n 
A 1 200 GLY 200 200 200 GLY GLY A . n 
A 1 201 THR 201 201 201 THR THR A . n 
A 1 202 PRO 202 202 202 PRO PRO A . n 
A 1 203 GLU 203 203 203 GLU GLU A . n 
A 1 204 TYR 204 204 204 TYR TYR A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 PRO 207 207 207 PRO PRO A . n 
A 1 208 GLU 208 208 208 GLU GLU A . n 
A 1 209 ILE 209 209 209 ILE ILE A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 LYS 213 213 213 LYS LYS A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 TYR 215 215 215 TYR TYR A . n 
A 1 216 ASN 216 216 216 ASN ASN A . n 
A 1 217 LYS 217 217 217 LYS LYS A . n 
A 1 218 ALA 218 218 218 ALA ALA A . n 
A 1 219 VAL 219 219 219 VAL VAL A . n 
A 1 220 ASP 220 220 220 ASP ASP A . n 
A 1 221 TRP 221 221 221 TRP TRP A . n 
A 1 222 TRP 222 222 222 TRP TRP A . n 
A 1 223 ALA 223 223 223 ALA ALA A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 ILE 228 228 228 ILE ILE A . n 
A 1 229 TYR 229 229 229 TYR TYR A . n 
A 1 230 GLU 230 230 230 GLU GLU A . n 
A 1 231 MET 231 231 231 MET MET A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 ALA 233 233 233 ALA ALA A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 TYR 235 235 235 TYR TYR A . n 
A 1 236 PRO 236 236 236 PRO PRO A . n 
A 1 237 PRO 237 237 237 PRO PRO A . n 
A 1 238 PHE 238 238 238 PHE PHE A . n 
A 1 239 PHE 239 239 239 PHE PHE A . n 
A 1 240 ALA 240 240 240 ALA ALA A . n 
A 1 241 ASP 241 241 241 ASP ASP A . n 
A 1 242 GLN 242 242 242 GLN GLN A . n 
A 1 243 PRO 243 243 243 PRO PRO A . n 
A 1 244 ILE 244 244 244 ILE ILE A . n 
A 1 245 GLN 245 245 245 GLN GLN A . n 
A 1 246 ILE 246 246 246 ILE ILE A . n 
A 1 247 TYR 247 247 247 TYR TYR A . n 
A 1 248 GLU 248 248 248 GLU GLU A . n 
A 1 249 LYS 249 249 249 LYS LYS A . n 
A 1 250 ILE 250 250 250 ILE ILE A . n 
A 1 251 VAL 251 251 251 VAL VAL A . n 
A 1 252 SER 252 252 252 SER SER A . n 
A 1 253 GLY 253 253 253 GLY GLY A . n 
A 1 254 LYS 254 254 254 LYS LYS A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 ARG 256 256 256 ARG ARG A . n 
A 1 257 PHE 257 257 257 PHE PHE A . n 
A 1 258 PRO 258 258 258 PRO PRO A . n 
A 1 259 SER 259 259 259 SER SER A . n 
A 1 260 HIS 260 260 260 HIS HIS A . n 
A 1 261 PHE 261 261 261 PHE PHE A . n 
A 1 262 SER 262 262 262 SER SER A . n 
A 1 263 SER 263 263 263 SER SER A . n 
A 1 264 ASP 264 264 264 ASP ASP A . n 
A 1 265 LEU 265 265 265 LEU LEU A . n 
A 1 266 LYS 266 266 266 LYS LYS A . n 
A 1 267 ASP 267 267 267 ASP ASP A . n 
A 1 268 LEU 268 268 268 LEU LEU A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 ARG 270 270 270 ARG ARG A . n 
A 1 271 ASN 271 271 271 ASN ASN A . n 
A 1 272 LEU 272 272 272 LEU LEU A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 GLN 274 274 274 GLN GLN A . n 
A 1 275 VAL 275 275 275 VAL VAL A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 LEU 277 277 277 LEU LEU A . n 
A 1 278 THR 278 278 278 THR THR A . n 
A 1 279 LYS 279 279 279 LYS LYS A . n 
A 1 280 ARG 280 280 280 ARG ARG A . n 
A 1 281 PHE 281 281 281 PHE PHE A . n 
A 1 282 GLY 282 282 282 GLY GLY A . n 
A 1 283 ASN 283 283 283 ASN ASN A . n 
A 1 284 LEU 284 284 284 LEU LEU A . n 
A 1 285 LYS 285 285 285 LYS LYS A . n 
A 1 286 ASP 286 286 286 ASP ASP A . n 
A 1 287 GLY 287 287 287 GLY GLY A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 ASN 289 289 289 ASN ASN A . n 
A 1 290 ASP 290 290 290 ASP ASP A . n 
A 1 291 ILE 291 291 291 ILE ILE A . n 
A 1 292 LYS 292 292 292 LYS LYS A . n 
A 1 293 ASN 293 293 293 ASN ASN A . n 
A 1 294 HIS 294 294 294 HIS HIS A . n 
A 1 295 LYS 295 295 295 LYS LYS A . n 
A 1 296 TRP 296 296 296 TRP TRP A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 ALA 298 298 298 ALA ALA A . n 
A 1 299 THR 299 299 299 THR THR A . n 
A 1 300 THR 300 300 300 THR THR A . n 
A 1 301 ASP 301 301 301 ASP ASP A . n 
A 1 302 TRP 302 302 302 TRP TRP A . n 
A 1 303 ILE 303 303 303 ILE ILE A . n 
A 1 304 ALA 304 304 304 ALA ALA A . n 
A 1 305 ILE 305 305 305 ILE ILE A . n 
A 1 306 TYR 306 306 306 TYR TYR A . n 
A 1 307 GLN 307 307 307 GLN GLN A . n 
A 1 308 ARG 308 308 308 ARG ARG A . n 
A 1 309 LYS 309 309 309 LYS LYS A . n 
A 1 310 VAL 310 310 310 VAL VAL A . n 
A 1 311 GLU 311 311 311 GLU GLU A . n 
A 1 312 ALA 312 312 312 ALA ALA A . n 
A 1 313 PRO 313 313 313 PRO PRO A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 ILE 315 315 315 ILE ILE A . n 
A 1 316 PRO 316 316 316 PRO PRO A . n 
A 1 317 LYS 317 317 317 LYS LYS A . n 
A 1 318 PHE 318 318 318 PHE PHE A . n 
A 1 319 LYS 319 319 319 LYS LYS A . n 
A 1 320 GLY 320 320 320 GLY GLY A . n 
A 1 321 PRO 321 321 321 PRO PRO A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 THR 324 324 324 THR THR A . n 
A 1 325 SER 325 325 325 SER SER A . n 
A 1 326 ASN 326 326 326 ASN ASN A . n 
A 1 327 PHE 327 327 327 PHE PHE A . n 
A 1 328 ASP 328 328 328 ASP ASP A . n 
A 1 329 ASP 329 329 329 ASP ASP A . n 
A 1 330 TYR 330 330 330 TYR TYR A . n 
A 1 331 GLU 331 331 331 GLU GLU A . n 
A 1 332 GLU 332 332 332 GLU GLU A . n 
A 1 333 GLU 333 333 333 GLU GLU A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 ILE 335 335 335 ILE ILE A . n 
A 1 336 ARG 336 336 336 ARG ARG A . n 
A 1 337 VAL 337 337 337 VAL VAL A . n 
A 1 338 SER 338 338 338 SER SER A . n 
A 1 339 ILE 339 339 339 ILE ILE A . n 
A 1 340 ASN 340 340 340 ASN ASN A . n 
A 1 341 GLU 341 341 341 GLU GLU A . n 
A 1 342 LYS 342 342 342 LYS LYS A . n 
A 1 343 CYS 343 343 343 CYS CYS A . n 
A 1 344 GLY 344 344 344 GLY GLY A . n 
A 1 345 LYS 345 345 345 LYS LYS A . n 
A 1 346 GLU 346 346 346 GLU GLU A . n 
A 1 347 PHE 347 347 347 PHE PHE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 GLU 349 349 349 GLU GLU A . n 
A 1 350 PHE 350 350 350 PHE PHE A . n 
B 2 1   THR 1   1   1   THR THR I . n 
B 2 2   THR 2   2   2   THR THR I . n 
B 2 3   TYR 3   3   3   TYR TYR I . n 
B 2 4   ALA 4   4   4   ALA ALA I . n 
B 2 5   ASP 5   5   5   ASP ASP I . n 
B 2 6   PHE 6   6   6   PHE PHE I . n 
B 2 7   ILE 7   7   7   ILE ILE I . n 
B 2 8   ALA 8   8   8   ALA ALA I . n 
B 2 9   SER 9   9   9   SER SER I . n 
B 2 10  GLY 10  10  10  GLY GLY I . n 
B 2 11  ARG 11  11  11  ARG ARG I . n 
B 2 12  THR 12  12  12  THR THR I . n 
B 2 13  GLY 13  13  13  GLY GLY I . n 
B 2 14  ARG 14  14  14  ARG ARG I . n 
B 2 15  ARG 15  15  15  ARG ARG I . n 
B 2 16  ASN 16  16  16  ASN ASN I . n 
B 2 17  ALA 17  17  17  ALA ALA I . n 
B 2 18  ILE 18  18  18  ILE ILE I . n 
B 2 19  HIS 19  19  19  HIS HIS I . n 
B 2 20  ASP 20  20  20  ASP ASP I . n 
C 1 1   GLY 1   1   ?   ?   ?   B . n 
C 1 2   ASN 2   2   ?   ?   ?   B . n 
C 1 3   ALA 3   3   ?   ?   ?   B . n 
C 1 4   ALA 4   4   ?   ?   ?   B . n 
C 1 5   ALA 5   5   ?   ?   ?   B . n 
C 1 6   ALA 6   6   ?   ?   ?   B . n 
C 1 7   LYS 7   7   ?   ?   ?   B . n 
C 1 8   LYS 8   8   8   LYS LYS B . n 
C 1 9   GLY 9   9   9   GLY GLY B . n 
C 1 10  SER 10  10  10  SER SER B . n 
C 1 11  GLU 11  11  11  GLU GLU B . n 
C 1 12  GLN 12  12  12  GLN GLN B . n 
C 1 13  GLU 13  13  13  GLU GLU B . n 
C 1 14  SER 14  14  14  SER SER B . n 
C 1 15  VAL 15  15  15  VAL VAL B . n 
C 1 16  LYS 16  16  16  LYS LYS B . n 
C 1 17  GLU 17  17  17  GLU GLU B . n 
C 1 18  PHE 18  18  18  PHE PHE B . n 
C 1 19  LEU 19  19  19  LEU LEU B . n 
C 1 20  ALA 20  20  20  ALA ALA B . n 
C 1 21  LYS 21  21  21  LYS LYS B . n 
C 1 22  ALA 22  22  22  ALA ALA B . n 
C 1 23  LYS 23  23  23  LYS LYS B . n 
C 1 24  GLU 24  24  24  GLU GLU B . n 
C 1 25  ASP 25  25  25  ASP ASP B . n 
C 1 26  PHE 26  26  26  PHE PHE B . n 
C 1 27  LEU 27  27  27  LEU LEU B . n 
C 1 28  LYS 28  28  28  LYS LYS B . n 
C 1 29  LYS 29  29  29  LYS LYS B . n 
C 1 30  TRP 30  30  30  TRP TRP B . n 
C 1 31  GLU 31  31  31  GLU GLU B . n 
C 1 32  ASN 32  32  32  ASN ASN B . n 
C 1 33  PRO 33  33  33  PRO PRO B . n 
C 1 34  ALA 34  34  34  ALA ALA B . n 
C 1 35  GLN 35  35  35  GLN GLN B . n 
C 1 36  ASN 36  36  36  ASN ASN B . n 
C 1 37  THR 37  37  37  THR THR B . n 
C 1 38  ALA 38  38  38  ALA ALA B . n 
C 1 39  HIS 39  39  39  HIS HIS B . n 
C 1 40  LEU 40  40  40  LEU LEU B . n 
C 1 41  ASP 41  41  41  ASP ASP B . n 
C 1 42  GLN 42  42  42  GLN GLN B . n 
C 1 43  PHE 43  43  43  PHE PHE B . n 
C 1 44  GLU 44  44  44  GLU GLU B . n 
C 1 45  ARG 45  45  45  ARG ARG B . n 
C 1 46  ILE 46  46  46  ILE ILE B . n 
C 1 47  LYS 47  47  47  LYS LYS B . n 
C 1 48  THR 48  48  48  THR THR B . n 
C 1 49  LEU 49  49  49  LEU LEU B . n 
C 1 50  GLY 50  50  50  GLY GLY B . n 
C 1 51  THR 51  51  51  THR THR B . n 
C 1 52  GLY 52  52  52  GLY GLY B . n 
C 1 53  SER 53  53  53  SER SER B . n 
C 1 54  PHE 54  54  54  PHE PHE B . n 
C 1 55  GLY 55  55  55  GLY GLY B . n 
C 1 56  ARG 56  56  56  ARG ARG B . n 
C 1 57  VAL 57  57  57  VAL VAL B . n 
C 1 58  MET 58  58  58  MET MET B . n 
C 1 59  LEU 59  59  59  LEU LEU B . n 
C 1 60  VAL 60  60  60  VAL VAL B . n 
C 1 61  LYS 61  61  61  LYS LYS B . n 
C 1 62  HIS 62  62  62  HIS HIS B . n 
C 1 63  LYS 63  63  63  LYS LYS B . n 
C 1 64  GLU 64  64  64  GLU GLU B . n 
C 1 65  THR 65  65  65  THR THR B . n 
C 1 66  GLY 66  66  66  GLY GLY B . n 
C 1 67  ASN 67  67  67  ASN ASN B . n 
C 1 68  HIS 68  68  68  HIS HIS B . n 
C 1 69  PHE 69  69  69  PHE PHE B . n 
C 1 70  ALA 70  70  70  ALA ALA B . n 
C 1 71  MET 71  71  71  MET MET B . n 
C 1 72  LYS 72  72  72  LYS LYS B . n 
C 1 73  ILE 73  73  73  ILE ILE B . n 
C 1 74  LEU 74  74  74  LEU LEU B . n 
C 1 75  ASP 75  75  75  ASP ASP B . n 
C 1 76  LYS 76  76  76  LYS LYS B . n 
C 1 77  GLN 77  77  77  GLN GLN B . n 
C 1 78  LYS 78  78  78  LYS LYS B . n 
C 1 79  VAL 79  79  79  VAL VAL B . n 
C 1 80  VAL 80  80  80  VAL VAL B . n 
C 1 81  LYS 81  81  81  LYS LYS B . n 
C 1 82  LEU 82  82  82  LEU LEU B . n 
C 1 83  LYS 83  83  83  LYS LYS B . n 
C 1 84  GLN 84  84  84  GLN GLN B . n 
C 1 85  ILE 85  85  85  ILE ILE B . n 
C 1 86  GLU 86  86  86  GLU GLU B . n 
C 1 87  HIS 87  87  87  HIS HIS B . n 
C 1 88  THR 88  88  88  THR THR B . n 
C 1 89  LEU 89  89  89  LEU LEU B . n 
C 1 90  ASN 90  90  90  ASN ASN B . n 
C 1 91  GLU 91  91  91  GLU GLU B . n 
C 1 92  LYS 92  92  92  LYS LYS B . n 
C 1 93  ARG 93  93  93  ARG ARG B . n 
C 1 94  ILE 94  94  94  ILE ILE B . n 
C 1 95  LEU 95  95  95  LEU LEU B . n 
C 1 96  GLN 96  96  96  GLN GLN B . n 
C 1 97  ALA 97  97  97  ALA ALA B . n 
C 1 98  VAL 98  98  98  VAL VAL B . n 
C 1 99  ASN 99  99  99  ASN ASN B . n 
C 1 100 PHE 100 100 100 PHE PHE B . n 
C 1 101 PRO 101 101 101 PRO PRO B . n 
C 1 102 PHE 102 102 102 PHE PHE B . n 
C 1 103 LEU 103 103 103 LEU LEU B . n 
C 1 104 VAL 104 104 104 VAL VAL B . n 
C 1 105 LYS 105 105 105 LYS LYS B . n 
C 1 106 LEU 106 106 106 LEU LEU B . n 
C 1 107 GLU 107 107 107 GLU GLU B . n 
C 1 108 TYR 108 108 108 TYR TYR B . n 
C 1 109 SER 109 109 109 SER SER B . n 
C 1 110 PHE 110 110 110 PHE PHE B . n 
C 1 111 LYS 111 111 111 LYS LYS B . n 
C 1 112 ASP 112 112 112 ASP ASP B . n 
C 1 113 ASN 113 113 113 ASN ASN B . n 
C 1 114 SER 114 114 114 SER SER B . n 
C 1 115 ASN 115 115 115 ASN ASN B . n 
C 1 116 LEU 116 116 116 LEU LEU B . n 
C 1 117 TYR 117 117 117 TYR TYR B . n 
C 1 118 MET 118 118 118 MET MET B . n 
C 1 119 VAL 119 119 119 VAL VAL B . n 
C 1 120 MET 120 120 120 MET MET B . n 
C 1 121 GLU 121 121 121 GLU GLU B . n 
C 1 122 TYR 122 122 122 TYR TYR B . n 
C 1 123 VAL 123 123 123 VAL VAL B . n 
C 1 124 PRO 124 124 124 PRO PRO B . n 
C 1 125 GLY 125 125 125 GLY GLY B . n 
C 1 126 GLY 126 126 126 GLY GLY B . n 
C 1 127 GLU 127 127 127 GLU GLU B . n 
C 1 128 MET 128 128 128 MET MET B . n 
C 1 129 PHE 129 129 129 PHE PHE B . n 
C 1 130 SER 130 130 130 SER SER B . n 
C 1 131 HIS 131 131 131 HIS HIS B . n 
C 1 132 LEU 132 132 132 LEU LEU B . n 
C 1 133 ARG 133 133 133 ARG ARG B . n 
C 1 134 ARG 134 134 134 ARG ARG B . n 
C 1 135 ILE 135 135 135 ILE ILE B . n 
C 1 136 GLY 136 136 136 GLY GLY B . n 
C 1 137 ARG 137 137 137 ARG ARG B . n 
C 1 138 PHE 138 138 138 PHE PHE B . n 
C 1 139 SER 139 139 139 SER SER B . n 
C 1 140 GLU 140 140 140 GLU GLU B . n 
C 1 141 PRO 141 141 141 PRO PRO B . n 
C 1 142 HIS 142 142 142 HIS HIS B . n 
C 1 143 ALA 143 143 143 ALA ALA B . n 
C 1 144 ARG 144 144 144 ARG ARG B . n 
C 1 145 PHE 145 145 145 PHE PHE B . n 
C 1 146 TYR 146 146 146 TYR TYR B . n 
C 1 147 ALA 147 147 147 ALA ALA B . n 
C 1 148 ALA 148 148 148 ALA ALA B . n 
C 1 149 GLN 149 149 149 GLN GLN B . n 
C 1 150 ILE 150 150 150 ILE ILE B . n 
C 1 151 VAL 151 151 151 VAL VAL B . n 
C 1 152 LEU 152 152 152 LEU LEU B . n 
C 1 153 THR 153 153 153 THR THR B . n 
C 1 154 PHE 154 154 154 PHE PHE B . n 
C 1 155 GLU 155 155 155 GLU GLU B . n 
C 1 156 TYR 156 156 156 TYR TYR B . n 
C 1 157 LEU 157 157 157 LEU LEU B . n 
C 1 158 HIS 158 158 158 HIS HIS B . n 
C 1 159 SER 159 159 159 SER SER B . n 
C 1 160 LEU 160 160 160 LEU LEU B . n 
C 1 161 ASP 161 161 161 ASP ASP B . n 
C 1 162 LEU 162 162 162 LEU LEU B . n 
C 1 163 ILE 163 163 163 ILE ILE B . n 
C 1 164 TYR 164 164 164 TYR TYR B . n 
C 1 165 ARG 165 165 165 ARG ARG B . n 
C 1 166 ASP 166 166 166 ASP ASP B . n 
C 1 167 LEU 167 167 167 LEU LEU B . n 
C 1 168 LYS 168 168 168 LYS LYS B . n 
C 1 169 PRO 169 169 169 PRO PRO B . n 
C 1 170 GLU 170 170 170 GLU GLU B . n 
C 1 171 ASN 171 171 171 ASN ASN B . n 
C 1 172 LEU 172 172 172 LEU LEU B . n 
C 1 173 LEU 173 173 173 LEU LEU B . n 
C 1 174 ILE 174 174 174 ILE ILE B . n 
C 1 175 ASP 175 175 175 ASP ASP B . n 
C 1 176 GLN 176 176 176 GLN GLN B . n 
C 1 177 GLN 177 177 177 GLN GLN B . n 
C 1 178 GLY 178 178 178 GLY GLY B . n 
C 1 179 TYR 179 179 179 TYR TYR B . n 
C 1 180 ILE 180 180 180 ILE ILE B . n 
C 1 181 GLN 181 181 181 GLN GLN B . n 
C 1 182 VAL 182 182 182 VAL VAL B . n 
C 1 183 THR 183 183 183 THR THR B . n 
C 1 184 ASP 184 184 184 ASP ASP B . n 
C 1 185 PHE 185 185 185 PHE PHE B . n 
C 1 186 GLY 186 186 186 GLY GLY B . n 
C 1 187 PHE 187 187 187 PHE PHE B . n 
C 1 188 ALA 188 188 188 ALA ALA B . n 
C 1 189 LYS 189 189 189 LYS LYS B . n 
C 1 190 ARG 190 190 190 ARG ARG B . n 
C 1 191 VAL 191 191 191 VAL VAL B . n 
C 1 192 LYS 192 192 192 LYS LYS B . n 
C 1 193 GLY 193 193 193 GLY GLY B . n 
C 1 194 ARG 194 194 194 ARG ARG B . n 
C 1 195 THR 195 195 195 THR THR B . n 
C 1 196 TRP 196 196 196 TRP TRP B . n 
C 1 197 TPO 197 197 197 TPO TPO B . n 
C 1 198 LEU 198 198 198 LEU LEU B . n 
C 1 199 CYS 199 199 199 CYS CYS B . n 
C 1 200 GLY 200 200 200 GLY GLY B . n 
C 1 201 THR 201 201 201 THR THR B . n 
C 1 202 PRO 202 202 202 PRO PRO B . n 
C 1 203 GLU 203 203 203 GLU GLU B . n 
C 1 204 TYR 204 204 204 TYR TYR B . n 
C 1 205 LEU 205 205 205 LEU LEU B . n 
C 1 206 ALA 206 206 206 ALA ALA B . n 
C 1 207 PRO 207 207 207 PRO PRO B . n 
C 1 208 GLU 208 208 208 GLU GLU B . n 
C 1 209 ILE 209 209 209 ILE ILE B . n 
C 1 210 ILE 210 210 210 ILE ILE B . n 
C 1 211 LEU 211 211 211 LEU LEU B . n 
C 1 212 SER 212 212 212 SER SER B . n 
C 1 213 LYS 213 213 213 LYS LYS B . n 
C 1 214 GLY 214 214 214 GLY GLY B . n 
C 1 215 TYR 215 215 215 TYR TYR B . n 
C 1 216 ASN 216 216 216 ASN ASN B . n 
C 1 217 LYS 217 217 217 LYS LYS B . n 
C 1 218 ALA 218 218 218 ALA ALA B . n 
C 1 219 VAL 219 219 219 VAL VAL B . n 
C 1 220 ASP 220 220 220 ASP ASP B . n 
C 1 221 TRP 221 221 221 TRP TRP B . n 
C 1 222 TRP 222 222 222 TRP TRP B . n 
C 1 223 ALA 223 223 223 ALA ALA B . n 
C 1 224 LEU 224 224 224 LEU LEU B . n 
C 1 225 GLY 225 225 225 GLY GLY B . n 
C 1 226 VAL 226 226 226 VAL VAL B . n 
C 1 227 LEU 227 227 227 LEU LEU B . n 
C 1 228 ILE 228 228 228 ILE ILE B . n 
C 1 229 TYR 229 229 229 TYR TYR B . n 
C 1 230 GLU 230 230 230 GLU GLU B . n 
C 1 231 MET 231 231 231 MET MET B . n 
C 1 232 ALA 232 232 232 ALA ALA B . n 
C 1 233 ALA 233 233 233 ALA ALA B . n 
C 1 234 GLY 234 234 234 GLY GLY B . n 
C 1 235 TYR 235 235 235 TYR TYR B . n 
C 1 236 PRO 236 236 236 PRO PRO B . n 
C 1 237 PRO 237 237 237 PRO PRO B . n 
C 1 238 PHE 238 238 238 PHE PHE B . n 
C 1 239 PHE 239 239 239 PHE PHE B . n 
C 1 240 ALA 240 240 240 ALA ALA B . n 
C 1 241 ASP 241 241 241 ASP ASP B . n 
C 1 242 GLN 242 242 242 GLN GLN B . n 
C 1 243 PRO 243 243 243 PRO PRO B . n 
C 1 244 ILE 244 244 244 ILE ILE B . n 
C 1 245 GLN 245 245 245 GLN GLN B . n 
C 1 246 ILE 246 246 246 ILE ILE B . n 
C 1 247 TYR 247 247 247 TYR TYR B . n 
C 1 248 GLU 248 248 248 GLU GLU B . n 
C 1 249 LYS 249 249 249 LYS LYS B . n 
C 1 250 ILE 250 250 250 ILE ILE B . n 
C 1 251 VAL 251 251 251 VAL VAL B . n 
C 1 252 SER 252 252 252 SER SER B . n 
C 1 253 GLY 253 253 253 GLY GLY B . n 
C 1 254 LYS 254 254 254 LYS LYS B . n 
C 1 255 VAL 255 255 255 VAL VAL B . n 
C 1 256 ARG 256 256 256 ARG ARG B . n 
C 1 257 PHE 257 257 257 PHE PHE B . n 
C 1 258 PRO 258 258 258 PRO PRO B . n 
C 1 259 SER 259 259 259 SER SER B . n 
C 1 260 HIS 260 260 260 HIS HIS B . n 
C 1 261 PHE 261 261 261 PHE PHE B . n 
C 1 262 SER 262 262 262 SER SER B . n 
C 1 263 SER 263 263 263 SER SER B . n 
C 1 264 ASP 264 264 264 ASP ASP B . n 
C 1 265 LEU 265 265 265 LEU LEU B . n 
C 1 266 LYS 266 266 266 LYS LYS B . n 
C 1 267 ASP 267 267 267 ASP ASP B . n 
C 1 268 LEU 268 268 268 LEU LEU B . n 
C 1 269 LEU 269 269 269 LEU LEU B . n 
C 1 270 ARG 270 270 270 ARG ARG B . n 
C 1 271 ASN 271 271 271 ASN ASN B . n 
C 1 272 LEU 272 272 272 LEU LEU B . n 
C 1 273 LEU 273 273 273 LEU LEU B . n 
C 1 274 GLN 274 274 274 GLN GLN B . n 
C 1 275 VAL 275 275 275 VAL VAL B . n 
C 1 276 ASP 276 276 276 ASP ASP B . n 
C 1 277 LEU 277 277 277 LEU LEU B . n 
C 1 278 THR 278 278 278 THR THR B . n 
C 1 279 LYS 279 279 279 LYS LYS B . n 
C 1 280 ARG 280 280 280 ARG ARG B . n 
C 1 281 PHE 281 281 281 PHE PHE B . n 
C 1 282 GLY 282 282 282 GLY GLY B . n 
C 1 283 ASN 283 283 283 ASN ASN B . n 
C 1 284 LEU 284 284 284 LEU LEU B . n 
C 1 285 LYS 285 285 285 LYS LYS B . n 
C 1 286 ASP 286 286 286 ASP ASP B . n 
C 1 287 GLY 287 287 287 GLY GLY B . n 
C 1 288 VAL 288 288 288 VAL VAL B . n 
C 1 289 ASN 289 289 289 ASN ASN B . n 
C 1 290 ASP 290 290 290 ASP ASP B . n 
C 1 291 ILE 291 291 291 ILE ILE B . n 
C 1 292 LYS 292 292 292 LYS LYS B . n 
C 1 293 ASN 293 293 293 ASN ASN B . n 
C 1 294 HIS 294 294 294 HIS HIS B . n 
C 1 295 LYS 295 295 295 LYS LYS B . n 
C 1 296 TRP 296 296 296 TRP TRP B . n 
C 1 297 PHE 297 297 297 PHE PHE B . n 
C 1 298 ALA 298 298 298 ALA ALA B . n 
C 1 299 THR 299 299 299 THR THR B . n 
C 1 300 THR 300 300 300 THR THR B . n 
C 1 301 ASP 301 301 301 ASP ASP B . n 
C 1 302 TRP 302 302 302 TRP TRP B . n 
C 1 303 ILE 303 303 303 ILE ILE B . n 
C 1 304 ALA 304 304 304 ALA ALA B . n 
C 1 305 ILE 305 305 305 ILE ILE B . n 
C 1 306 TYR 306 306 306 TYR TYR B . n 
C 1 307 GLN 307 307 307 GLN GLN B . n 
C 1 308 ARG 308 308 308 ARG ARG B . n 
C 1 309 LYS 309 309 309 LYS LYS B . n 
C 1 310 VAL 310 310 310 VAL VAL B . n 
C 1 311 GLU 311 311 311 GLU GLU B . n 
C 1 312 ALA 312 312 312 ALA ALA B . n 
C 1 313 PRO 313 313 313 PRO PRO B . n 
C 1 314 PHE 314 314 314 PHE PHE B . n 
C 1 315 ILE 315 315 315 ILE ILE B . n 
C 1 316 PRO 316 316 316 PRO PRO B . n 
C 1 317 LYS 317 317 317 LYS LYS B . n 
C 1 318 PHE 318 318 318 PHE PHE B . n 
C 1 319 LYS 319 319 319 LYS LYS B . n 
C 1 320 GLY 320 320 320 GLY GLY B . n 
C 1 321 PRO 321 321 321 PRO PRO B . n 
C 1 322 GLY 322 322 322 GLY GLY B . n 
C 1 323 ASP 323 323 323 ASP ASP B . n 
C 1 324 THR 324 324 324 THR THR B . n 
C 1 325 SER 325 325 325 SER SER B . n 
C 1 326 ASN 326 326 326 ASN ASN B . n 
C 1 327 PHE 327 327 327 PHE PHE B . n 
C 1 328 ASP 328 328 328 ASP ASP B . n 
C 1 329 ASP 329 329 329 ASP ASP B . n 
C 1 330 TYR 330 330 330 TYR TYR B . n 
C 1 331 GLU 331 331 331 GLU GLU B . n 
C 1 332 GLU 332 332 332 GLU GLU B . n 
C 1 333 GLU 333 333 333 GLU GLU B . n 
C 1 334 GLU 334 334 334 GLU GLU B . n 
C 1 335 ILE 335 335 335 ILE ILE B . n 
C 1 336 ARG 336 336 336 ARG ARG B . n 
C 1 337 VAL 337 337 337 VAL VAL B . n 
C 1 338 SER 338 338 338 SER SER B . n 
C 1 339 ILE 339 339 339 ILE ILE B . n 
C 1 340 ASN 340 340 340 ASN ASN B . n 
C 1 341 GLU 341 341 341 GLU GLU B . n 
C 1 342 LYS 342 342 342 LYS LYS B . n 
C 1 343 CYS 343 343 343 CYS CYS B . n 
C 1 344 GLY 344 344 344 GLY GLY B . n 
C 1 345 LYS 345 345 345 LYS LYS B . n 
C 1 346 GLU 346 346 346 GLU GLU B . n 
C 1 347 PHE 347 347 347 PHE PHE B . n 
C 1 348 SER 348 348 348 SER SER B . n 
C 1 349 GLU 349 349 349 GLU GLU B . n 
C 1 350 PHE 350 350 350 PHE PHE B . n 
D 2 1   THR 1   1   1   THR THR J . n 
D 2 2   THR 2   2   2   THR THR J . n 
D 2 3   TYR 3   3   3   TYR TYR J . n 
D 2 4   ALA 4   4   4   ALA ALA J . n 
D 2 5   ASP 5   5   5   ASP ASP J . n 
D 2 6   PHE 6   6   6   PHE PHE J . n 
D 2 7   ILE 7   7   7   ILE ILE J . n 
D 2 8   ALA 8   8   8   ALA ALA J . n 
D 2 9   SER 9   9   9   SER SER J . n 
D 2 10  GLY 10  10  10  GLY GLY J . n 
D 2 11  ARG 11  11  11  ARG ARG J . n 
D 2 12  THR 12  12  12  THR THR J . n 
D 2 13  GLY 13  13  13  GLY GLY J . n 
D 2 14  ARG 14  14  14  ARG ARG J . n 
D 2 15  ARG 15  15  15  ARG ARG J . n 
D 2 16  ASN 16  16  16  ASN ASN J . n 
D 2 17  ALA 17  17  17  ALA ALA J . n 
D 2 18  ILE 18  18  18  ILE ILE J . n 
D 2 19  HIS 19  19  19  HIS HIS J . n 
D 2 20  ASP 20  20  20  ASP ASP J . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 MN  1   401 401 MN  MN  A . 
F 3 MN  1   402 402 MN  MN  A . 
G 4 ANP 1   400 400 ANP ANP A . 
H 5 MYR 1   403 403 MYR MYR A . 
I 3 MN  1   401 401 MN  MN  B . 
J 3 MN  1   402 402 MN  MN  B . 
K 4 ANP 1   400 400 ANP ANP B . 
L 5 MYR 1   403 403 MYR MYR B . 
M 6 HOH 1   404 404 HOH HOH A . 
M 6 HOH 2   405 405 HOH HOH A . 
M 6 HOH 3   406 406 HOH HOH A . 
M 6 HOH 4   407 407 HOH HOH A . 
M 6 HOH 5   408 408 HOH HOH A . 
M 6 HOH 6   409 409 HOH HOH A . 
M 6 HOH 7   410 410 HOH HOH A . 
M 6 HOH 8   411 411 HOH HOH A . 
M 6 HOH 9   412 412 HOH HOH A . 
M 6 HOH 10  413 413 HOH HOH A . 
M 6 HOH 11  414 414 HOH HOH A . 
M 6 HOH 12  415 415 HOH HOH A . 
M 6 HOH 13  416 416 HOH HOH A . 
M 6 HOH 14  417 417 HOH HOH A . 
M 6 HOH 15  418 418 HOH HOH A . 
M 6 HOH 16  419 419 HOH HOH A . 
M 6 HOH 17  420 420 HOH HOH A . 
M 6 HOH 18  421 421 HOH HOH A . 
M 6 HOH 19  422 422 HOH HOH A . 
M 6 HOH 20  423 423 HOH HOH A . 
M 6 HOH 21  424 424 HOH HOH A . 
M 6 HOH 22  425 425 HOH HOH A . 
M 6 HOH 23  426 426 HOH HOH A . 
M 6 HOH 24  427 427 HOH HOH A . 
M 6 HOH 25  428 428 HOH HOH A . 
M 6 HOH 26  429 429 HOH HOH A . 
M 6 HOH 27  430 430 HOH HOH A . 
M 6 HOH 28  431 431 HOH HOH A . 
M 6 HOH 29  432 432 HOH HOH A . 
M 6 HOH 30  433 433 HOH HOH A . 
M 6 HOH 31  434 434 HOH HOH A . 
M 6 HOH 32  435 435 HOH HOH A . 
M 6 HOH 33  436 436 HOH HOH A . 
M 6 HOH 34  437 437 HOH HOH A . 
M 6 HOH 35  438 438 HOH HOH A . 
M 6 HOH 36  439 439 HOH HOH A . 
M 6 HOH 37  440 440 HOH HOH A . 
M 6 HOH 38  441 441 HOH HOH A . 
M 6 HOH 39  442 442 HOH HOH A . 
M 6 HOH 40  443 443 HOH HOH A . 
M 6 HOH 41  444 444 HOH HOH A . 
M 6 HOH 42  445 445 HOH HOH A . 
M 6 HOH 43  446 446 HOH HOH A . 
M 6 HOH 44  447 447 HOH HOH A . 
M 6 HOH 45  448 448 HOH HOH A . 
M 6 HOH 46  449 449 HOH HOH A . 
M 6 HOH 47  450 450 HOH HOH A . 
M 6 HOH 48  451 451 HOH HOH A . 
M 6 HOH 49  452 452 HOH HOH A . 
M 6 HOH 50  453 453 HOH HOH A . 
M 6 HOH 51  454 454 HOH HOH A . 
M 6 HOH 52  455 455 HOH HOH A . 
M 6 HOH 53  456 456 HOH HOH A . 
M 6 HOH 54  457 457 HOH HOH A . 
M 6 HOH 55  458 458 HOH HOH A . 
M 6 HOH 56  459 459 HOH HOH A . 
M 6 HOH 57  460 460 HOH HOH A . 
M 6 HOH 58  461 461 HOH HOH A . 
M 6 HOH 59  462 462 HOH HOH A . 
M 6 HOH 60  463 463 HOH HOH A . 
M 6 HOH 61  464 464 HOH HOH A . 
M 6 HOH 62  465 465 HOH HOH A . 
M 6 HOH 63  466 466 HOH HOH A . 
M 6 HOH 64  467 467 HOH HOH A . 
M 6 HOH 65  468 468 HOH HOH A . 
M 6 HOH 66  469 469 HOH HOH A . 
M 6 HOH 67  470 470 HOH HOH A . 
M 6 HOH 68  471 471 HOH HOH A . 
M 6 HOH 69  472 472 HOH HOH A . 
M 6 HOH 70  473 473 HOH HOH A . 
M 6 HOH 71  474 474 HOH HOH A . 
M 6 HOH 72  475 475 HOH HOH A . 
M 6 HOH 73  476 476 HOH HOH A . 
M 6 HOH 74  477 477 HOH HOH A . 
M 6 HOH 75  478 478 HOH HOH A . 
M 6 HOH 76  479 479 HOH HOH A . 
M 6 HOH 77  480 480 HOH HOH A . 
M 6 HOH 78  481 481 HOH HOH A . 
M 6 HOH 79  482 482 HOH HOH A . 
M 6 HOH 80  483 483 HOH HOH A . 
M 6 HOH 81  484 484 HOH HOH A . 
M 6 HOH 82  485 485 HOH HOH A . 
M 6 HOH 83  486 486 HOH HOH A . 
M 6 HOH 84  487 487 HOH HOH A . 
M 6 HOH 85  488 488 HOH HOH A . 
M 6 HOH 86  489 489 HOH HOH A . 
M 6 HOH 87  490 490 HOH HOH A . 
M 6 HOH 88  491 491 HOH HOH A . 
M 6 HOH 89  492 492 HOH HOH A . 
M 6 HOH 90  493 493 HOH HOH A . 
M 6 HOH 91  494 494 HOH HOH A . 
M 6 HOH 92  495 495 HOH HOH A . 
M 6 HOH 93  496 496 HOH HOH A . 
M 6 HOH 94  497 497 HOH HOH A . 
M 6 HOH 95  498 498 HOH HOH A . 
M 6 HOH 96  499 499 HOH HOH A . 
M 6 HOH 97  500 500 HOH HOH A . 
M 6 HOH 98  501 501 HOH HOH A . 
M 6 HOH 99  502 502 HOH HOH A . 
M 6 HOH 100 503 503 HOH HOH A . 
M 6 HOH 101 504 504 HOH HOH A . 
M 6 HOH 102 505 505 HOH HOH A . 
M 6 HOH 103 506 506 HOH HOH A . 
M 6 HOH 104 507 507 HOH HOH A . 
M 6 HOH 105 508 508 HOH HOH A . 
M 6 HOH 106 509 509 HOH HOH A . 
M 6 HOH 107 510 510 HOH HOH A . 
M 6 HOH 108 511 511 HOH HOH A . 
M 6 HOH 109 512 512 HOH HOH A . 
M 6 HOH 110 513 513 HOH HOH A . 
M 6 HOH 111 514 514 HOH HOH A . 
M 6 HOH 112 515 515 HOH HOH A . 
M 6 HOH 113 516 516 HOH HOH A . 
M 6 HOH 114 517 517 HOH HOH A . 
M 6 HOH 115 518 518 HOH HOH A . 
M 6 HOH 116 519 519 HOH HOH A . 
M 6 HOH 117 520 520 HOH HOH A . 
M 6 HOH 118 521 521 HOH HOH A . 
M 6 HOH 119 522 522 HOH HOH A . 
M 6 HOH 120 523 523 HOH HOH A . 
M 6 HOH 121 524 524 HOH HOH A . 
M 6 HOH 122 525 525 HOH HOH A . 
M 6 HOH 123 526 526 HOH HOH A . 
M 6 HOH 124 527 527 HOH HOH A . 
M 6 HOH 125 528 528 HOH HOH A . 
M 6 HOH 126 529 529 HOH HOH A . 
M 6 HOH 127 530 530 HOH HOH A . 
M 6 HOH 128 531 531 HOH HOH A . 
M 6 HOH 129 532 532 HOH HOH A . 
N 6 HOH 1   49  49  HOH HOH I . 
N 6 HOH 2   54  54  HOH HOH I . 
N 6 HOH 3   63  63  HOH HOH I . 
N 6 HOH 4   70  70  HOH HOH I . 
N 6 HOH 5   73  73  HOH HOH I . 
N 6 HOH 6   74  74  HOH HOH I . 
N 6 HOH 7   75  75  HOH HOH I . 
N 6 HOH 8   76  76  HOH HOH I . 
N 6 HOH 9   77  77  HOH HOH I . 
N 6 HOH 10  78  78  HOH HOH I . 
N 6 HOH 11  79  79  HOH HOH I . 
N 6 HOH 12  88  88  HOH HOH I . 
N 6 HOH 13  109 109 HOH HOH I . 
N 6 HOH 14  110 110 HOH HOH I . 
N 6 HOH 15  111 111 HOH HOH I . 
N 6 HOH 16  113 113 HOH HOH I . 
N 6 HOH 17  129 129 HOH HOH I . 
N 6 HOH 18  146 146 HOH HOH I . 
N 6 HOH 19  147 147 HOH HOH I . 
N 6 HOH 20  148 148 HOH HOH I . 
O 6 HOH 1   404 404 HOH HOH B . 
O 6 HOH 2   405 405 HOH HOH B . 
O 6 HOH 3   406 406 HOH HOH B . 
O 6 HOH 4   407 407 HOH HOH B . 
O 6 HOH 5   408 408 HOH HOH B . 
O 6 HOH 6   409 409 HOH HOH B . 
O 6 HOH 7   410 410 HOH HOH B . 
O 6 HOH 8   411 411 HOH HOH B . 
O 6 HOH 9   412 412 HOH HOH B . 
O 6 HOH 10  413 413 HOH HOH B . 
O 6 HOH 11  414 414 HOH HOH B . 
O 6 HOH 12  415 415 HOH HOH B . 
O 6 HOH 13  416 416 HOH HOH B . 
O 6 HOH 14  417 417 HOH HOH B . 
O 6 HOH 15  418 418 HOH HOH B . 
O 6 HOH 16  419 419 HOH HOH B . 
O 6 HOH 17  420 420 HOH HOH B . 
O 6 HOH 18  421 421 HOH HOH B . 
O 6 HOH 19  422 422 HOH HOH B . 
O 6 HOH 20  423 423 HOH HOH B . 
O 6 HOH 21  424 424 HOH HOH B . 
O 6 HOH 22  425 425 HOH HOH B . 
O 6 HOH 23  426 426 HOH HOH B . 
O 6 HOH 24  427 427 HOH HOH B . 
O 6 HOH 25  428 428 HOH HOH B . 
O 6 HOH 26  429 429 HOH HOH B . 
O 6 HOH 27  430 430 HOH HOH B . 
O 6 HOH 28  431 431 HOH HOH B . 
O 6 HOH 29  432 432 HOH HOH B . 
O 6 HOH 30  433 433 HOH HOH B . 
O 6 HOH 31  434 434 HOH HOH B . 
O 6 HOH 32  435 435 HOH HOH B . 
O 6 HOH 33  436 436 HOH HOH B . 
O 6 HOH 34  437 437 HOH HOH B . 
O 6 HOH 35  438 438 HOH HOH B . 
O 6 HOH 36  439 439 HOH HOH B . 
O 6 HOH 37  440 440 HOH HOH B . 
O 6 HOH 38  441 441 HOH HOH B . 
O 6 HOH 39  442 442 HOH HOH B . 
O 6 HOH 40  443 443 HOH HOH B . 
O 6 HOH 41  444 444 HOH HOH B . 
O 6 HOH 42  445 445 HOH HOH B . 
O 6 HOH 43  446 446 HOH HOH B . 
O 6 HOH 44  447 447 HOH HOH B . 
O 6 HOH 45  448 448 HOH HOH B . 
O 6 HOH 46  449 449 HOH HOH B . 
O 6 HOH 47  450 450 HOH HOH B . 
O 6 HOH 48  451 451 HOH HOH B . 
O 6 HOH 49  452 452 HOH HOH B . 
O 6 HOH 50  453 453 HOH HOH B . 
O 6 HOH 51  454 454 HOH HOH B . 
O 6 HOH 52  455 455 HOH HOH B . 
O 6 HOH 53  456 456 HOH HOH B . 
O 6 HOH 54  457 457 HOH HOH B . 
O 6 HOH 55  458 458 HOH HOH B . 
O 6 HOH 56  459 459 HOH HOH B . 
O 6 HOH 57  460 460 HOH HOH B . 
O 6 HOH 58  461 461 HOH HOH B . 
O 6 HOH 59  462 462 HOH HOH B . 
O 6 HOH 60  463 463 HOH HOH B . 
O 6 HOH 61  464 464 HOH HOH B . 
O 6 HOH 62  465 465 HOH HOH B . 
O 6 HOH 63  466 466 HOH HOH B . 
O 6 HOH 64  467 467 HOH HOH B . 
O 6 HOH 65  468 468 HOH HOH B . 
O 6 HOH 66  469 469 HOH HOH B . 
O 6 HOH 67  470 470 HOH HOH B . 
O 6 HOH 68  471 471 HOH HOH B . 
O 6 HOH 69  472 472 HOH HOH B . 
O 6 HOH 70  473 473 HOH HOH B . 
O 6 HOH 71  474 474 HOH HOH B . 
O 6 HOH 72  475 475 HOH HOH B . 
O 6 HOH 73  476 476 HOH HOH B . 
O 6 HOH 74  477 477 HOH HOH B . 
O 6 HOH 75  478 478 HOH HOH B . 
O 6 HOH 76  479 479 HOH HOH B . 
O 6 HOH 77  480 480 HOH HOH B . 
O 6 HOH 78  481 481 HOH HOH B . 
O 6 HOH 79  482 482 HOH HOH B . 
O 6 HOH 80  483 483 HOH HOH B . 
O 6 HOH 81  484 484 HOH HOH B . 
O 6 HOH 82  485 485 HOH HOH B . 
O 6 HOH 83  486 486 HOH HOH B . 
O 6 HOH 84  487 487 HOH HOH B . 
O 6 HOH 85  488 488 HOH HOH B . 
O 6 HOH 86  489 489 HOH HOH B . 
O 6 HOH 87  490 490 HOH HOH B . 
O 6 HOH 88  491 491 HOH HOH B . 
O 6 HOH 89  492 492 HOH HOH B . 
O 6 HOH 90  493 493 HOH HOH B . 
O 6 HOH 91  494 494 HOH HOH B . 
O 6 HOH 92  495 495 HOH HOH B . 
O 6 HOH 93  496 496 HOH HOH B . 
O 6 HOH 94  497 497 HOH HOH B . 
O 6 HOH 95  498 498 HOH HOH B . 
O 6 HOH 96  499 499 HOH HOH B . 
O 6 HOH 97  500 500 HOH HOH B . 
O 6 HOH 98  501 501 HOH HOH B . 
O 6 HOH 99  502 502 HOH HOH B . 
O 6 HOH 100 503 503 HOH HOH B . 
O 6 HOH 101 504 504 HOH HOH B . 
O 6 HOH 102 505 505 HOH HOH B . 
O 6 HOH 103 506 506 HOH HOH B . 
O 6 HOH 104 507 507 HOH HOH B . 
O 6 HOH 105 508 508 HOH HOH B . 
O 6 HOH 106 509 509 HOH HOH B . 
O 6 HOH 107 510 510 HOH HOH B . 
O 6 HOH 108 511 511 HOH HOH B . 
O 6 HOH 109 512 512 HOH HOH B . 
O 6 HOH 110 513 513 HOH HOH B . 
O 6 HOH 111 514 514 HOH HOH B . 
O 6 HOH 112 515 515 HOH HOH B . 
O 6 HOH 113 516 516 HOH HOH B . 
O 6 HOH 114 517 517 HOH HOH B . 
O 6 HOH 115 518 518 HOH HOH B . 
O 6 HOH 116 519 519 HOH HOH B . 
O 6 HOH 117 520 520 HOH HOH B . 
O 6 HOH 118 521 521 HOH HOH B . 
O 6 HOH 119 522 522 HOH HOH B . 
O 6 HOH 120 523 523 HOH HOH B . 
O 6 HOH 121 524 524 HOH HOH B . 
O 6 HOH 122 525 525 HOH HOH B . 
O 6 HOH 123 526 526 HOH HOH B . 
O 6 HOH 124 527 527 HOH HOH B . 
O 6 HOH 125 528 528 HOH HOH B . 
O 6 HOH 126 529 529 HOH HOH B . 
O 6 HOH 127 530 530 HOH HOH B . 
O 6 HOH 128 531 531 HOH HOH B . 
O 6 HOH 129 532 532 HOH HOH B . 
O 6 HOH 130 533 533 HOH HOH B . 
O 6 HOH 131 534 534 HOH HOH B . 
O 6 HOH 132 535 535 HOH HOH B . 
O 6 HOH 133 536 536 HOH HOH B . 
O 6 HOH 134 537 537 HOH HOH B . 
O 6 HOH 135 538 538 HOH HOH B . 
O 6 HOH 136 539 539 HOH HOH B . 
O 6 HOH 137 540 540 HOH HOH B . 
O 6 HOH 138 541 541 HOH HOH B . 
O 6 HOH 139 542 542 HOH HOH B . 
O 6 HOH 140 543 543 HOH HOH B . 
P 6 HOH 1   196 196 HOH HOH J . 
P 6 HOH 2   210 210 HOH HOH J . 
P 6 HOH 3   211 211 HOH HOH J . 
P 6 HOH 4   217 217 HOH HOH J . 
P 6 HOH 5   218 218 HOH HOH J . 
P 6 HOH 6   220 220 HOH HOH J . 
P 6 HOH 7   221 221 HOH HOH J . 
P 6 HOH 8   222 222 HOH HOH J . 
P 6 HOH 9   223 223 HOH HOH J . 
P 6 HOH 10  224 224 HOH HOH J . 
P 6 HOH 11  225 225 HOH HOH J . 
P 6 HOH 12  232 232 HOH HOH J . 
P 6 HOH 13  233 233 HOH HOH J . 
P 6 HOH 14  254 254 HOH HOH J . 
P 6 HOH 15  255 255 HOH HOH J . 
P 6 HOH 16  256 256 HOH HOH J . 
P 6 HOH 17  257 257 HOH HOH J . 
P 6 HOH 18  258 258 HOH HOH J . 
P 6 HOH 19  259 259 HOH HOH J . 
P 6 HOH 20  288 288 HOH HOH J . 
P 6 HOH 21  295 295 HOH HOH J . 
P 6 HOH 22  296 296 HOH HOH J . 
P 6 HOH 23  312 312 HOH HOH J . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A TPO 197 A TPO 197 ? THR PHOSPHOTHREONINE 
2 C TPO 197 B TPO 197 ? THR PHOSPHOTHREONINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,G,H,M,N 
2 1 C,D,I,J,K,L,O,P 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3880  ? 
1 MORE         -18   ? 
1 'SSA (A^2)'  15940 ? 
2 'ABSA (A^2)' 3890  ? 
2 MORE         -17   ? 
2 'SSA (A^2)'  15900 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASN 171 ? A ASN 171 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 O2G ? G ANP .   ? A ANP 400 ? 1_555 123.9 ? 
2  OD1 ? A ASN 171 ? A ASN 171 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 O   ? M HOH .   ? A HOH 451 ? 1_555 97.9  ? 
3  O2G ? G ANP .   ? A ANP 400 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 O   ? M HOH .   ? A HOH 451 ? 1_555 92.9  ? 
4  OD1 ? A ASN 171 ? A ASN 171 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 O2A ? G ANP .   ? A ANP 400 ? 1_555 98.5  ? 
5  O2G ? G ANP .   ? A ANP 400 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 O2A ? G ANP .   ? A ANP 400 ? 1_555 137.3 ? 
6  O   ? M HOH .   ? A HOH 451 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 O2A ? G ANP .   ? A ANP 400 ? 1_555 85.4  ? 
7  OD1 ? A ASN 171 ? A ASN 171 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 OD2 ? A ASP 184 ? A ASP 184 ? 1_555 91.9  ? 
8  O2G ? G ANP .   ? A ANP 400 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 OD2 ? A ASP 184 ? A ASP 184 ? 1_555 79.8  ? 
9  O   ? M HOH .   ? A HOH 451 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 OD2 ? A ASP 184 ? A ASP 184 ? 1_555 170.0 ? 
10 O2A ? G ANP .   ? A ANP 400 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 OD2 ? A ASP 184 ? A ASP 184 ? 1_555 95.3  ? 
11 OD1 ? A ASN 171 ? A ASN 171 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 N3B ? G ANP .   ? A ANP 400 ? 1_555 174.8 ? 
12 O2G ? G ANP .   ? A ANP 400 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 N3B ? G ANP .   ? A ANP 400 ? 1_555 60.3  ? 
13 O   ? M HOH .   ? A HOH 451 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 N3B ? G ANP .   ? A ANP 400 ? 1_555 84.5  ? 
14 O2A ? G ANP .   ? A ANP 400 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 N3B ? G ANP .   ? A ANP 400 ? 1_555 77.0  ? 
15 OD2 ? A ASP 184 ? A ASP 184 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 N3B ? G ANP .   ? A ANP 400 ? 1_555 85.9  ? 
16 OD1 ? A ASP 184 ? A ASP 184 ? 1_555 MN ? F MN . ? A MN 402 ? 1_555 OD2 ? A ASP 184 ? A ASP 184 ? 1_555 60.2  ? 
17 OD1 ? A ASP 184 ? A ASP 184 ? 1_555 MN ? F MN . ? A MN 402 ? 1_555 O   ? M HOH .   ? A HOH 514 ? 1_555 99.6  ? 
18 OD2 ? A ASP 184 ? A ASP 184 ? 1_555 MN ? F MN . ? A MN 402 ? 1_555 O   ? M HOH .   ? A HOH 514 ? 1_555 155.5 ? 
19 OD1 ? A ASP 184 ? A ASP 184 ? 1_555 MN ? F MN . ? A MN 402 ? 1_555 O   ? M HOH .   ? A HOH 436 ? 1_555 101.8 ? 
20 OD2 ? A ASP 184 ? A ASP 184 ? 1_555 MN ? F MN . ? A MN 402 ? 1_555 O   ? M HOH .   ? A HOH 436 ? 1_555 83.2  ? 
21 O   ? M HOH .   ? A HOH 514 ? 1_555 MN ? F MN . ? A MN 402 ? 1_555 O   ? M HOH .   ? A HOH 436 ? 1_555 88.1  ? 
22 OD1 ? A ASP 184 ? A ASP 184 ? 1_555 MN ? F MN . ? A MN 402 ? 1_555 O1G ? G ANP .   ? A ANP 400 ? 1_555 155.7 ? 
23 OD2 ? A ASP 184 ? A ASP 184 ? 1_555 MN ? F MN . ? A MN 402 ? 1_555 O1G ? G ANP .   ? A ANP 400 ? 1_555 105.4 ? 
24 O   ? M HOH .   ? A HOH 514 ? 1_555 MN ? F MN . ? A MN 402 ? 1_555 O1G ? G ANP .   ? A ANP 400 ? 1_555 98.2  ? 
25 O   ? M HOH .   ? A HOH 436 ? 1_555 MN ? F MN . ? A MN 402 ? 1_555 O1G ? G ANP .   ? A ANP 400 ? 1_555 95.2  ? 
26 OD1 ? A ASP 184 ? A ASP 184 ? 1_555 MN ? F MN . ? A MN 402 ? 1_555 O2B ? G ANP .   ? A ANP 400 ? 1_555 77.1  ? 
27 OD2 ? A ASP 184 ? A ASP 184 ? 1_555 MN ? F MN . ? A MN 402 ? 1_555 O2B ? G ANP .   ? A ANP 400 ? 1_555 97.0  ? 
28 O   ? M HOH .   ? A HOH 514 ? 1_555 MN ? F MN . ? A MN 402 ? 1_555 O2B ? G ANP .   ? A ANP 400 ? 1_555 91.1  ? 
29 O   ? M HOH .   ? A HOH 436 ? 1_555 MN ? F MN . ? A MN 402 ? 1_555 O2B ? G ANP .   ? A ANP 400 ? 1_555 178.5 ? 
30 O1G ? G ANP .   ? A ANP 400 ? 1_555 MN ? F MN . ? A MN 402 ? 1_555 O2B ? G ANP .   ? A ANP 400 ? 1_555 86.2  ? 
31 OD1 ? C ASN 171 ? B ASN 171 ? 1_555 MN ? I MN . ? B MN 401 ? 1_555 O2G ? K ANP .   ? B ANP 400 ? 1_555 118.8 ? 
32 OD1 ? C ASN 171 ? B ASN 171 ? 1_555 MN ? I MN . ? B MN 401 ? 1_555 O   ? O HOH .   ? B HOH 449 ? 1_555 95.4  ? 
33 O2G ? K ANP .   ? B ANP 400 ? 1_555 MN ? I MN . ? B MN 401 ? 1_555 O   ? O HOH .   ? B HOH 449 ? 1_555 95.7  ? 
34 OD1 ? C ASN 171 ? B ASN 171 ? 1_555 MN ? I MN . ? B MN 401 ? 1_555 O2A ? K ANP .   ? B ANP 400 ? 1_555 94.6  ? 
35 O2G ? K ANP .   ? B ANP 400 ? 1_555 MN ? I MN . ? B MN 401 ? 1_555 O2A ? K ANP .   ? B ANP 400 ? 1_555 146.5 ? 
36 O   ? O HOH .   ? B HOH 449 ? 1_555 MN ? I MN . ? B MN 401 ? 1_555 O2A ? K ANP .   ? B ANP 400 ? 1_555 82.7  ? 
37 OD1 ? C ASN 171 ? B ASN 171 ? 1_555 MN ? I MN . ? B MN 401 ? 1_555 N3B ? K ANP .   ? B ANP 400 ? 1_555 174.4 ? 
38 O2G ? K ANP .   ? B ANP 400 ? 1_555 MN ? I MN . ? B MN 401 ? 1_555 N3B ? K ANP .   ? B ANP 400 ? 1_555 66.0  ? 
39 O   ? O HOH .   ? B HOH 449 ? 1_555 MN ? I MN . ? B MN 401 ? 1_555 N3B ? K ANP .   ? B ANP 400 ? 1_555 86.7  ? 
40 O2A ? K ANP .   ? B ANP 400 ? 1_555 MN ? I MN . ? B MN 401 ? 1_555 N3B ? K ANP .   ? B ANP 400 ? 1_555 80.5  ? 
41 OD1 ? C ASN 171 ? B ASN 171 ? 1_555 MN ? I MN . ? B MN 401 ? 1_555 OD2 ? C ASP 184 ? B ASP 184 ? 1_555 93.8  ? 
42 O2G ? K ANP .   ? B ANP 400 ? 1_555 MN ? I MN . ? B MN 401 ? 1_555 OD2 ? C ASP 184 ? B ASP 184 ? 1_555 84.9  ? 
43 O   ? O HOH .   ? B HOH 449 ? 1_555 MN ? I MN . ? B MN 401 ? 1_555 OD2 ? C ASP 184 ? B ASP 184 ? 1_555 169.2 ? 
44 O2A ? K ANP .   ? B ANP 400 ? 1_555 MN ? I MN . ? B MN 401 ? 1_555 OD2 ? C ASP 184 ? B ASP 184 ? 1_555 90.8  ? 
45 N3B ? K ANP .   ? B ANP 400 ? 1_555 MN ? I MN . ? B MN 401 ? 1_555 OD2 ? C ASP 184 ? B ASP 184 ? 1_555 83.7  ? 
46 OD1 ? C ASP 184 ? B ASP 184 ? 1_555 MN ? J MN . ? B MN 402 ? 1_555 OD2 ? C ASP 184 ? B ASP 184 ? 1_555 60.0  ? 
47 OD1 ? C ASP 184 ? B ASP 184 ? 1_555 MN ? J MN . ? B MN 402 ? 1_555 O   ? O HOH .   ? B HOH 506 ? 1_555 92.0  ? 
48 OD2 ? C ASP 184 ? B ASP 184 ? 1_555 MN ? J MN . ? B MN 402 ? 1_555 O   ? O HOH .   ? B HOH 506 ? 1_555 151.1 ? 
49 OD1 ? C ASP 184 ? B ASP 184 ? 1_555 MN ? J MN . ? B MN 402 ? 1_555 O2B ? K ANP .   ? B ANP 400 ? 1_555 79.5  ? 
50 OD2 ? C ASP 184 ? B ASP 184 ? 1_555 MN ? J MN . ? B MN 402 ? 1_555 O2B ? K ANP .   ? B ANP 400 ? 1_555 91.9  ? 
51 O   ? O HOH .   ? B HOH 506 ? 1_555 MN ? J MN . ? B MN 402 ? 1_555 O2B ? K ANP .   ? B ANP 400 ? 1_555 89.7  ? 
52 OD1 ? C ASP 184 ? B ASP 184 ? 1_555 MN ? J MN . ? B MN 402 ? 1_555 O1G ? K ANP .   ? B ANP 400 ? 1_555 154.8 ? 
53 OD2 ? C ASP 184 ? B ASP 184 ? 1_555 MN ? J MN . ? B MN 402 ? 1_555 O1G ? K ANP .   ? B ANP 400 ? 1_555 101.1 ? 
54 O   ? O HOH .   ? B HOH 506 ? 1_555 MN ? J MN . ? B MN 402 ? 1_555 O1G ? K ANP .   ? B ANP 400 ? 1_555 107.8 ? 
55 O2B ? K ANP .   ? B ANP 400 ? 1_555 MN ? J MN . ? B MN 402 ? 1_555 O1G ? K ANP .   ? B ANP 400 ? 1_555 85.0  ? 
56 OD1 ? C ASP 184 ? B ASP 184 ? 1_555 MN ? J MN . ? B MN 402 ? 1_555 O   ? O HOH .   ? B HOH 435 ? 1_555 94.5  ? 
57 OD2 ? C ASP 184 ? B ASP 184 ? 1_555 MN ? J MN . ? B MN 402 ? 1_555 O   ? O HOH .   ? B HOH 435 ? 1_555 84.1  ? 
58 O   ? O HOH .   ? B HOH 506 ? 1_555 MN ? J MN . ? B MN 402 ? 1_555 O   ? O HOH .   ? B HOH 435 ? 1_555 91.6  ? 
59 O2B ? K ANP .   ? B ANP 400 ? 1_555 MN ? J MN . ? B MN 402 ? 1_555 O   ? O HOH .   ? B HOH 435 ? 1_555 173.9 ? 
60 O1G ? K ANP .   ? B ANP 400 ? 1_555 MN ? J MN . ? B MN 402 ? 1_555 O   ? O HOH .   ? B HOH 435 ? 1_555 100.2 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1995-10-15 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2012-07-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Source and taxonomy'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
X-PLOR phasing          . ? 3 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CE2 A TYR 179 ? ? CD2 A TYR 179 ? ? 1.482 1.389 0.093  0.015 N 
2 1 N   A ASP 323 ? ? CA  A ASP 323 ? ? 1.261 1.459 -0.198 0.020 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CD  A LYS 29  ? ? CE A LYS 29  ? ? NZ  A LYS 29  ? ? 96.03  111.70 -15.67 2.30 N 
2  1 CD  A LYS 92  ? ? CE A LYS 92  ? ? NZ  A LYS 92  ? ? 97.78  111.70 -13.92 2.30 N 
3  1 NE  A ARG 93  ? ? CZ A ARG 93  ? ? NH1 A ARG 93  ? ? 124.32 120.30 4.02   0.50 N 
4  1 NE  A ARG 93  ? ? CZ A ARG 93  ? ? NH2 A ARG 93  ? ? 115.48 120.30 -4.82  0.50 N 
5  1 CB  A ASP 112 ? ? CG A ASP 112 ? ? OD1 A ASP 112 ? ? 126.09 118.30 7.79   0.90 N 
6  1 CG  A MET 118 ? ? SD A MET 118 ? ? CE  A MET 118 ? ? 88.27  100.20 -11.93 1.60 N 
7  1 CG  A MET 128 ? ? SD A MET 128 ? ? CE  A MET 128 ? ? 81.45  100.20 -18.75 1.60 N 
8  1 CA  A SER 130 ? ? CB A SER 130 ? ? OG  A SER 130 ? ? 94.13  111.20 -17.07 2.70 N 
9  1 NE  A ARG 133 ? ? CZ A ARG 133 ? ? NH2 A ARG 133 ? ? 116.18 120.30 -4.12  0.50 N 
10 1 NE  A ARG 144 ? ? CZ A ARG 144 ? ? NH2 A ARG 144 ? ? 117.07 120.30 -3.23  0.50 N 
11 1 CB  A LEU 157 ? ? CG A LEU 157 ? ? CD1 A LEU 157 ? ? 99.03  111.00 -11.97 1.70 N 
12 1 NE  A ARG 165 ? ? CZ A ARG 165 ? ? NH2 A ARG 165 ? ? 116.16 120.30 -4.14  0.50 N 
13 1 CB  A ASP 175 ? ? CG A ASP 175 ? ? OD1 A ASP 175 ? ? 127.27 118.30 8.97   0.90 N 
14 1 CB  A ASP 184 ? ? CG A ASP 184 ? ? OD1 A ASP 184 ? ? 125.25 118.30 6.95   0.90 N 
15 1 NE  A ARG 194 ? ? CZ A ARG 194 ? ? NH1 A ARG 194 ? ? 124.78 120.30 4.48   0.50 N 
16 1 NE  A ARG 194 ? ? CZ A ARG 194 ? ? NH2 A ARG 194 ? ? 115.28 120.30 -5.02  0.50 N 
17 1 CB  A TYR 215 ? ? CG A TYR 215 ? ? CD1 A TYR 215 ? ? 117.28 121.00 -3.72  0.60 N 
18 1 CB  A ASP 220 ? ? CG A ASP 220 ? ? OD1 A ASP 220 ? ? 123.72 118.30 5.42   0.90 N 
19 1 CG1 A VAL 226 ? ? CB A VAL 226 ? ? CG2 A VAL 226 ? ? 100.22 110.90 -10.68 1.60 N 
20 1 OE1 A GLU 230 ? ? CD A GLU 230 ? ? OE2 A GLU 230 ? ? 115.77 123.30 -7.53  1.20 N 
21 1 CD  A LYS 266 ? ? CE A LYS 266 ? ? NZ  A LYS 266 ? ? 129.22 111.70 17.52  2.30 N 
22 1 NE  A ARG 270 ? ? CZ A ARG 270 ? ? NH2 A ARG 270 ? ? 116.74 120.30 -3.56  0.50 N 
23 1 CG1 A VAL 288 ? ? CB A VAL 288 ? ? CG2 A VAL 288 ? ? 99.32  110.90 -11.58 1.60 N 
24 1 CG1 A ILE 303 ? ? CB A ILE 303 ? ? CG2 A ILE 303 ? ? 93.76  111.40 -17.64 2.20 N 
25 1 NE  A ARG 308 ? ? CZ A ARG 308 ? ? NH2 A ARG 308 ? ? 116.26 120.30 -4.04  0.50 N 
26 1 CA  A GLY 322 ? ? C  A GLY 322 ? ? N   A ASP 323 ? ? 90.01  117.20 -27.19 2.20 Y 
27 1 O   A GLY 322 ? ? C  A GLY 322 ? ? N   A ASP 323 ? ? 141.19 122.70 18.49  1.60 Y 
28 1 N   A ASP 323 ? ? CA A ASP 323 ? ? CB  A ASP 323 ? ? 133.56 110.60 22.96  1.80 N 
29 1 CB  A ASP 329 ? ? CG A ASP 329 ? ? OD1 A ASP 329 ? ? 126.84 118.30 8.54   0.90 N 
30 1 CB  A ASP 329 ? ? CG A ASP 329 ? ? OD2 A ASP 329 ? ? 111.40 118.30 -6.90  0.90 N 
31 1 CG  A ARG 336 ? ? CD A ARG 336 ? ? NE  A ARG 336 ? ? 126.07 111.80 14.27  2.10 N 
32 1 NE  A ARG 336 ? ? CZ A ARG 336 ? ? NH2 A ARG 336 ? ? 116.16 120.30 -4.14  0.50 N 
33 1 NE  I ARG 14  ? ? CZ I ARG 14  ? ? NH2 I ARG 14  ? ? 116.34 120.30 -3.96  0.50 N 
34 1 N   B GLY 9   ? ? CA B GLY 9   ? ? C   B GLY 9   ? ? 130.86 113.10 17.76  2.50 N 
35 1 CB  B ASP 41  ? ? CG B ASP 41  ? ? OD1 B ASP 41  ? ? 124.58 118.30 6.28   0.90 N 
36 1 CD  B LYS 61  ? ? CE B LYS 61  ? ? NZ  B LYS 61  ? ? 125.96 111.70 14.26  2.30 N 
37 1 CG  B MET 71  ? ? SD B MET 71  ? ? CE  B MET 71  ? ? 87.25  100.20 -12.95 1.60 N 
38 1 NE  B ARG 93  ? ? CZ B ARG 93  ? ? NH2 B ARG 93  ? ? 116.82 120.30 -3.48  0.50 N 
39 1 CD  B LYS 105 ? ? CE B LYS 105 ? ? NZ  B LYS 105 ? ? 125.76 111.70 14.06  2.30 N 
40 1 CB  B TYR 108 ? ? CA B TYR 108 ? ? C   B TYR 108 ? ? 98.28  110.40 -12.12 2.00 N 
41 1 CB  B ASP 112 ? ? CG B ASP 112 ? ? OD1 B ASP 112 ? ? 128.11 118.30 9.81   0.90 N 
42 1 CB  B ASP 112 ? ? CG B ASP 112 ? ? OD2 B ASP 112 ? ? 110.12 118.30 -8.18  0.90 N 
43 1 CG  B MET 128 ? ? SD B MET 128 ? ? CE  B MET 128 ? ? 84.29  100.20 -15.91 1.60 N 
44 1 NE  B ARG 133 ? ? CZ B ARG 133 ? ? NH1 B ARG 133 ? ? 124.57 120.30 4.27   0.50 N 
45 1 NE  B ARG 133 ? ? CZ B ARG 133 ? ? NH2 B ARG 133 ? ? 116.92 120.30 -3.38  0.50 N 
46 1 NE  B ARG 144 ? ? CZ B ARG 144 ? ? NH2 B ARG 144 ? ? 117.22 120.30 -3.08  0.50 N 
47 1 CB  B ASP 161 ? ? CG B ASP 161 ? ? OD2 B ASP 161 ? ? 125.46 118.30 7.16   0.90 N 
48 1 CB  B ASP 175 ? ? CG B ASP 175 ? ? OD1 B ASP 175 ? ? 128.73 118.30 10.43  0.90 N 
49 1 CB  B ASP 184 ? ? CG B ASP 184 ? ? OD1 B ASP 184 ? ? 131.51 118.30 13.21  0.90 N 
50 1 CB  B ASP 241 ? ? CG B ASP 241 ? ? OD1 B ASP 241 ? ? 123.96 118.30 5.66   0.90 N 
51 1 NE  B ARG 270 ? ? CZ B ARG 270 ? ? NH1 B ARG 270 ? ? 123.53 120.30 3.23   0.50 N 
52 1 NE  B ARG 270 ? ? CZ B ARG 270 ? ? NH2 B ARG 270 ? ? 114.23 120.30 -6.07  0.50 N 
53 1 NE  B ARG 280 ? ? CZ B ARG 280 ? ? NH1 B ARG 280 ? ? 116.13 120.30 -4.17  0.50 N 
54 1 C   B LYS 319 ? ? N  B GLY 320 ? ? CA  B GLY 320 ? ? 138.73 122.30 16.43  2.10 Y 
55 1 CB  B ASP 328 ? ? CG B ASP 328 ? ? OD2 B ASP 328 ? ? 110.56 118.30 -7.74  0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 36  ? ? 17.08   72.55   
2  1 ILE A 46  ? ? -63.05  -89.37  
3  1 ASP A 112 ? ? -151.47 -155.49 
4  1 ARG A 165 ? ? 78.16   -3.52   
5  1 LYS A 168 ? ? -170.12 147.48  
6  1 THR A 183 ? ? -113.76 -166.20 
7  1 ASP A 184 ? ? 47.38   80.03   
8  1 LEU A 198 ? ? -68.20  99.41   
9  1 ALA A 240 ? ? -172.83 -175.16 
10 1 LEU A 273 ? ? -86.95  39.24   
11 1 ARG I 11  ? ? -113.94 55.80   
12 1 HIS I 19  ? ? -140.57 -9.46   
13 1 ILE B 46  ? ? -74.89  -70.89  
14 1 ASP B 166 ? ? -140.65 34.93   
15 1 ASP B 184 ? ? 50.82   76.29   
16 1 ALA B 240 ? ? -170.37 -169.71 
17 1 LEU B 273 ? ? -101.79 43.58   
18 1 LEU B 277 ? ? -65.09  1.49    
19 1 PRO B 321 ? ? -37.67  119.95  
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1  1 LYS A 23  ? ? -11.16 
2  1 THR A 51  ? ? -10.58 
3  1 ASP A 166 ? ? 11.73  
4  1 TYR A 179 ? ? 10.12  
5  1 ASP A 184 ? ? -12.23 
6  1 VAL A 191 ? ? 11.16  
7  1 PRO A 202 ? ? -13.05 
8  1 GLU A 203 ? ? 12.11  
9  1 ALA A 218 ? ? 10.43  
10 1 ASP A 220 ? ? 12.21  
11 1 PRO A 243 ? ? -11.88 
12 1 LEU A 273 ? ? -11.12 
13 1 GLY A 287 ? ? -13.20 
14 1 TRP A 302 ? ? -11.55 
15 1 ILE A 315 ? ? 12.61  
16 1 GLY A 322 ? ? -11.24 
17 1 GLU A 332 ? ? 13.26  
18 1 GLU A 341 ? ? 11.56  
19 1 LYS A 345 ? ? -11.91 
20 1 SER I 9   ? ? -11.93 
21 1 ARG I 14  ? ? 10.90  
22 1 ARG I 15  ? ? 12.18  
23 1 LYS B 28  ? ? -10.86 
24 1 LEU B 40  ? ? -11.64 
25 1 VAL B 98  ? ? 12.33  
26 1 ALA B 143 ? ? -11.86 
27 1 ASP B 166 ? ? 12.70  
28 1 LEU B 167 ? ? 11.11  
29 1 ASP B 175 ? ? -10.09 
30 1 VAL B 191 ? ? 12.05  
31 1 THR B 195 ? ? 11.04  
32 1 SER B 212 ? ? 11.93  
33 1 ALA B 218 ? ? 12.89  
34 1 LEU B 224 ? ? -12.43 
35 1 VAL B 226 ? ? -12.40 
36 1 ASP B 264 ? ? -11.23 
37 1 LEU B 268 ? ? -10.54 
38 1 LYS B 292 ? ? 11.65  
39 1 LYS B 317 ? ? -12.46 
40 1 TYR B 330 ? ? -13.23 
41 1 ASP J 5   ? ? -11.82 
42 1 SER J 9   ? ? -15.34 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1  1 TYR A 108 ? ? 0.083 'SIDE CHAIN' 
2  1 TYR A 164 ? ? 0.073 'SIDE CHAIN' 
3  1 PHE A 239 ? ? 0.091 'SIDE CHAIN' 
4  1 TYR A 247 ? ? 0.081 'SIDE CHAIN' 
5  1 TYR A 306 ? ? 0.101 'SIDE CHAIN' 
6  1 ARG A 336 ? ? 0.183 'SIDE CHAIN' 
7  1 TYR I 3   ? ? 0.069 'SIDE CHAIN' 
8  1 ARG I 14  ? ? 0.112 'SIDE CHAIN' 
9  1 PHE B 18  ? ? 0.075 'SIDE CHAIN' 
10 1 PHE B 43  ? ? 0.094 'SIDE CHAIN' 
11 1 PHE B 69  ? ? 0.088 'SIDE CHAIN' 
12 1 TYR B 122 ? ? 0.082 'SIDE CHAIN' 
13 1 TYR B 146 ? ? 0.063 'SIDE CHAIN' 
14 1 HIS B 158 ? ? 0.132 'SIDE CHAIN' 
15 1 TYR B 229 ? ? 0.089 'SIDE CHAIN' 
16 1 PHE B 238 ? ? 0.075 'SIDE CHAIN' 
17 1 TYR B 306 ? ? 0.071 'SIDE CHAIN' 
18 1 TYR B 330 ? ? 0.069 'SIDE CHAIN' 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CA 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    LYS 
_pdbx_validate_chiral.auth_seq_id     192 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LYS 8   ? CB  ? A LYS 8   CB  
2   1 Y 0 A LYS 28  ? CE  ? A LYS 28  CE  
3   1 Y 0 A LYS 28  ? NZ  ? A LYS 28  NZ  
4   1 Y 0 A ASN 36  ? CG  ? A ASN 36  CG  
5   1 Y 0 A ASN 36  ? OD1 ? A ASN 36  OD1 
6   1 Y 0 A ASN 36  ? ND2 ? A ASN 36  ND2 
7   1 Y 0 A ARG 45  ? CG  ? A ARG 45  CG  
8   1 Y 0 A ARG 45  ? CD  ? A ARG 45  CD  
9   1 Y 0 A ARG 45  ? NE  ? A ARG 45  NE  
10  1 Y 0 A ARG 45  ? CZ  ? A ARG 45  CZ  
11  1 Y 0 A ARG 45  ? NH1 ? A ARG 45  NH1 
12  1 Y 0 A ARG 45  ? NH2 ? A ARG 45  NH2 
13  1 Y 0 A THR 65  ? OG1 ? A THR 65  OG1 
14  1 Y 0 A THR 65  ? CG2 ? A THR 65  CG2 
15  1 Y 0 A GLN 77  ? CD  ? A GLN 77  CD  
16  1 Y 0 A GLN 77  ? OE1 ? A GLN 77  OE1 
17  1 Y 0 A GLN 77  ? NE2 ? A GLN 77  NE2 
18  1 Y 0 A LYS 81  ? CG  ? A LYS 81  CG  
19  1 Y 0 A LYS 81  ? CD  ? A LYS 81  CD  
20  1 Y 0 A LYS 81  ? CE  ? A LYS 81  CE  
21  1 Y 0 A LYS 81  ? NZ  ? A LYS 81  NZ  
22  1 Y 0 A LYS 83  ? CE  ? A LYS 83  CE  
23  1 Y 0 A LYS 83  ? NZ  ? A LYS 83  NZ  
24  1 Y 0 A GLN 242 ? CD  ? A GLN 242 CD  
25  1 Y 0 A GLN 242 ? OE1 ? A GLN 242 OE1 
26  1 Y 0 A GLN 242 ? NE2 ? A GLN 242 NE2 
27  1 Y 0 A LYS 254 ? CD  ? A LYS 254 CD  
28  1 Y 0 A LYS 254 ? CE  ? A LYS 254 CE  
29  1 Y 0 A LYS 254 ? NZ  ? A LYS 254 NZ  
30  1 Y 0 A ARG 256 ? CD  ? A ARG 256 CD  
31  1 Y 0 A ARG 256 ? NE  ? A ARG 256 NE  
32  1 Y 0 A ARG 256 ? CZ  ? A ARG 256 CZ  
33  1 Y 0 A ARG 256 ? NH1 ? A ARG 256 NH1 
34  1 Y 0 A ARG 256 ? NH2 ? A ARG 256 NH2 
35  1 Y 0 A LYS 279 ? CG  ? A LYS 279 CG  
36  1 Y 0 A LYS 279 ? CD  ? A LYS 279 CD  
37  1 Y 0 A LYS 279 ? CE  ? A LYS 279 CE  
38  1 Y 0 A LYS 279 ? NZ  ? A LYS 279 NZ  
39  1 Y 0 A LYS 285 ? CG  ? A LYS 285 CG  
40  1 Y 0 A LYS 285 ? CD  ? A LYS 285 CD  
41  1 Y 0 A LYS 285 ? CE  ? A LYS 285 CE  
42  1 Y 0 A LYS 285 ? NZ  ? A LYS 285 NZ  
43  1 Y 0 A GLU 311 ? CG  ? A GLU 311 CG  
44  1 Y 0 A GLU 311 ? CD  ? A GLU 311 CD  
45  1 Y 0 A GLU 311 ? OE1 ? A GLU 311 OE1 
46  1 Y 0 A GLU 311 ? OE2 ? A GLU 311 OE2 
47  1 Y 0 A LYS 317 ? CG  ? A LYS 317 CG  
48  1 Y 0 A LYS 317 ? CD  ? A LYS 317 CD  
49  1 Y 0 A LYS 317 ? CE  ? A LYS 317 CE  
50  1 Y 0 A LYS 317 ? NZ  ? A LYS 317 NZ  
51  1 Y 0 A GLY 322 ? N   ? A GLY 322 N   
52  1 Y 0 A ASP 323 ? N   ? A ASP 323 N   
53  1 Y 0 A GLU 331 ? CD  ? A GLU 331 CD  
54  1 Y 0 A GLU 331 ? OE1 ? A GLU 331 OE1 
55  1 Y 0 A GLU 331 ? OE2 ? A GLU 331 OE2 
56  1 Y 0 A GLU 333 ? CD  ? A GLU 333 CD  
57  1 Y 0 A GLU 333 ? OE1 ? A GLU 333 OE1 
58  1 Y 0 A GLU 333 ? OE2 ? A GLU 333 OE2 
59  1 Y 0 A GLU 334 ? CB  ? A GLU 334 CB  
60  1 Y 0 A GLU 334 ? CG  ? A GLU 334 CG  
61  1 Y 0 A GLU 334 ? CD  ? A GLU 334 CD  
62  1 Y 0 A GLU 334 ? OE1 ? A GLU 334 OE1 
63  1 Y 0 A GLU 334 ? OE2 ? A GLU 334 OE2 
64  1 Y 0 A ILE 335 ? CG1 ? A ILE 335 CG1 
65  1 Y 0 A ILE 335 ? CG2 ? A ILE 335 CG2 
66  1 Y 0 A ILE 335 ? CD1 ? A ILE 335 CD1 
67  1 Y 0 A LYS 345 ? CD  ? A LYS 345 CD  
68  1 Y 0 A LYS 345 ? CE  ? A LYS 345 CE  
69  1 Y 0 A LYS 345 ? NZ  ? A LYS 345 NZ  
70  1 Y 0 I ASP 20  ? C   ? B ASP 20  C   
71  1 Y 0 I ASP 20  ? O   ? B ASP 20  O   
72  1 Y 0 I ASP 20  ? CB  ? B ASP 20  CB  
73  1 Y 0 I ASP 20  ? CG  ? B ASP 20  CG  
74  1 Y 0 I ASP 20  ? OD1 ? B ASP 20  OD1 
75  1 Y 0 I ASP 20  ? OD2 ? B ASP 20  OD2 
76  1 Y 0 I ASP 20  ? OXT ? B ASP 20  OXT 
77  1 Y 0 B GLY 9   ? N   ? C GLY 9   N   
78  1 Y 0 B SER 10  ? CB  ? C SER 10  CB  
79  1 Y 0 B SER 10  ? OG  ? C SER 10  OG  
80  1 Y 0 B GLU 11  ? CG  ? C GLU 11  CG  
81  1 Y 0 B GLU 11  ? CD  ? C GLU 11  CD  
82  1 Y 0 B GLU 11  ? OE1 ? C GLU 11  OE1 
83  1 Y 0 B GLU 11  ? OE2 ? C GLU 11  OE2 
84  1 Y 0 B GLN 12  ? CD  ? C GLN 12  CD  
85  1 Y 0 B GLN 12  ? OE1 ? C GLN 12  OE1 
86  1 Y 0 B GLN 12  ? NE2 ? C GLN 12  NE2 
87  1 Y 0 B GLU 13  ? CB  ? C GLU 13  CB  
88  1 Y 0 B GLU 13  ? CG  ? C GLU 13  CG  
89  1 Y 0 B GLU 13  ? CD  ? C GLU 13  CD  
90  1 Y 0 B GLU 13  ? OE1 ? C GLU 13  OE1 
91  1 Y 0 B GLU 13  ? OE2 ? C GLU 13  OE2 
92  1 Y 0 B LYS 16  ? CG  ? C LYS 16  CG  
93  1 Y 0 B LYS 16  ? CD  ? C LYS 16  CD  
94  1 Y 0 B LYS 16  ? CE  ? C LYS 16  CE  
95  1 Y 0 B LYS 16  ? NZ  ? C LYS 16  NZ  
96  1 Y 0 B GLU 17  ? CG  ? C GLU 17  CG  
97  1 Y 0 B GLU 17  ? CD  ? C GLU 17  CD  
98  1 Y 0 B GLU 17  ? OE1 ? C GLU 17  OE1 
99  1 Y 0 B GLU 17  ? OE2 ? C GLU 17  OE2 
100 1 Y 0 B LYS 28  ? NZ  ? C LYS 28  NZ  
101 1 Y 0 B GLN 176 ? CD  ? C GLN 176 CD  
102 1 Y 0 B GLN 176 ? OE1 ? C GLN 176 OE1 
103 1 Y 0 B GLN 176 ? NE2 ? C GLN 176 NE2 
104 1 Y 0 B LYS 254 ? CD  ? C LYS 254 CD  
105 1 Y 0 B LYS 254 ? CE  ? C LYS 254 CE  
106 1 Y 0 B LYS 254 ? NZ  ? C LYS 254 NZ  
107 1 Y 0 B ARG 256 ? CG  ? C ARG 256 CG  
108 1 Y 0 B ARG 256 ? CD  ? C ARG 256 CD  
109 1 Y 0 B ARG 256 ? NE  ? C ARG 256 NE  
110 1 Y 0 B ARG 256 ? CZ  ? C ARG 256 CZ  
111 1 Y 0 B ARG 256 ? NH1 ? C ARG 256 NH1 
112 1 Y 0 B ARG 256 ? NH2 ? C ARG 256 NH2 
113 1 Y 0 B LYS 279 ? CD  ? C LYS 279 CD  
114 1 Y 0 B LYS 279 ? CE  ? C LYS 279 CE  
115 1 Y 0 B LYS 279 ? NZ  ? C LYS 279 NZ  
116 1 Y 0 B LYS 285 ? CG  ? C LYS 285 CG  
117 1 Y 0 B LYS 285 ? CD  ? C LYS 285 CD  
118 1 Y 0 B LYS 285 ? CE  ? C LYS 285 CE  
119 1 Y 0 B LYS 285 ? NZ  ? C LYS 285 NZ  
120 1 Y 0 B LYS 295 ? NZ  ? C LYS 295 NZ  
121 1 Y 0 B LYS 317 ? CG  ? C LYS 317 CG  
122 1 Y 0 B LYS 317 ? CD  ? C LYS 317 CD  
123 1 Y 0 B LYS 317 ? CE  ? C LYS 317 CE  
124 1 Y 0 B LYS 317 ? NZ  ? C LYS 317 NZ  
125 1 Y 0 B GLU 331 ? CB  ? C GLU 331 CB  
126 1 Y 0 B GLU 331 ? CG  ? C GLU 331 CG  
127 1 Y 0 B GLU 331 ? CD  ? C GLU 331 CD  
128 1 Y 0 B GLU 331 ? OE1 ? C GLU 331 OE1 
129 1 Y 0 B GLU 331 ? OE2 ? C GLU 331 OE2 
130 1 Y 0 B GLU 333 ? CG  ? C GLU 333 CG  
131 1 Y 0 B GLU 333 ? CD  ? C GLU 333 CD  
132 1 Y 0 B GLU 333 ? OE1 ? C GLU 333 OE1 
133 1 Y 0 B GLU 333 ? OE2 ? C GLU 333 OE2 
134 1 Y 0 B GLU 334 ? CB  ? C GLU 334 CB  
135 1 Y 0 B GLU 334 ? CG  ? C GLU 334 CG  
136 1 Y 0 B GLU 334 ? CD  ? C GLU 334 CD  
137 1 Y 0 B GLU 334 ? OE1 ? C GLU 334 OE1 
138 1 Y 0 B GLU 334 ? OE2 ? C GLU 334 OE2 
139 1 Y 0 B ILE 335 ? CG1 ? C ILE 335 CG1 
140 1 Y 0 B ILE 335 ? CG2 ? C ILE 335 CG2 
141 1 Y 0 B ILE 335 ? CD1 ? C ILE 335 CD1 
142 1 Y 0 B ARG 336 ? NE  ? C ARG 336 NE  
143 1 Y 0 B ARG 336 ? CZ  ? C ARG 336 CZ  
144 1 Y 0 B ARG 336 ? NH1 ? C ARG 336 NH1 
145 1 Y 0 B ARG 336 ? NH2 ? C ARG 336 NH2 
146 1 Y 0 B LYS 345 ? CE  ? C LYS 345 CE  
147 1 Y 0 B LYS 345 ? NZ  ? C LYS 345 NZ  
148 1 Y 0 J ASP 20  ? CA  ? D ASP 20  CA  
149 1 Y 0 J ASP 20  ? C   ? D ASP 20  C   
150 1 Y 0 J ASP 20  ? O   ? D ASP 20  O   
151 1 Y 0 J ASP 20  ? CB  ? D ASP 20  CB  
152 1 Y 0 J ASP 20  ? CG  ? D ASP 20  CG  
153 1 Y 0 J ASP 20  ? OD1 ? D ASP 20  OD1 
154 1 Y 0 J ASP 20  ? OD2 ? D ASP 20  OD2 
155 1 Y 0 J ASP 20  ? OXT ? D ASP 20  OXT 
156 1 N 1 A MYR 403 ? C1  ? H MYR 1   C1  
157 1 N 1 A MYR 403 ? O1  ? H MYR 1   O1  
158 1 N 1 A MYR 403 ? O2  ? H MYR 1   O2  
159 1 N 1 A MYR 403 ? C2  ? H MYR 1   C2  
160 1 N 1 A MYR 403 ? C3  ? H MYR 1   C3  
161 1 N 1 A MYR 403 ? C4  ? H MYR 1   C4  
162 1 N 1 A MYR 403 ? C5  ? H MYR 1   C5  
163 1 N 1 A MYR 403 ? C6  ? H MYR 1   C6  
164 1 N 1 A MYR 403 ? C7  ? H MYR 1   C7  
165 1 N 1 A MYR 403 ? C8  ? H MYR 1   C8  
166 1 N 1 B MYR 403 ? C1  ? L MYR 1   C1  
167 1 N 1 B MYR 403 ? O1  ? L MYR 1   O1  
168 1 N 1 B MYR 403 ? O2  ? L MYR 1   O2  
169 1 N 1 B MYR 403 ? C2  ? L MYR 1   C2  
170 1 N 1 B MYR 403 ? C3  ? L MYR 1   C3  
171 1 N 1 B MYR 403 ? C4  ? L MYR 1   C4  
172 1 N 1 B MYR 403 ? C5  ? L MYR 1   C5  
173 1 N 1 B MYR 403 ? C6  ? L MYR 1   C6  
174 1 N 1 B MYR 403 ? C7  ? L MYR 1   C7  
175 1 N 1 B MYR 403 ? C8  ? L MYR 1   C8  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 1   ? A GLY 1   
2  1 Y 1 A ASN 2   ? A ASN 2   
3  1 Y 1 A ALA 3   ? A ALA 3   
4  1 Y 1 A ALA 4   ? A ALA 4   
5  1 Y 1 A ALA 5   ? A ALA 5   
6  1 Y 1 A ALA 6   ? A ALA 6   
7  1 Y 1 A LYS 7   ? A LYS 7   
8  1 Y 0 A LYS 8   ? A LYS 8   
9  1 Y 0 A PHE 318 ? A PHE 318 
10 1 Y 0 A LYS 319 ? A LYS 319 
11 1 Y 0 A GLY 320 ? A GLY 320 
12 1 Y 0 A PRO 321 ? A PRO 321 
13 1 Y 1 B GLY 1   ? C GLY 1   
14 1 Y 1 B ASN 2   ? C ASN 2   
15 1 Y 1 B ALA 3   ? C ALA 3   
16 1 Y 1 B ALA 4   ? C ALA 4   
17 1 Y 1 B ALA 5   ? C ALA 5   
18 1 Y 1 B ALA 6   ? C ALA 6   
19 1 Y 1 B LYS 7   ? C LYS 7   
20 1 Y 0 B LYS 8   ? C LYS 8   
21 1 Y 0 B PHE 318 ? C PHE 318 
22 1 Y 0 B LYS 319 ? C LYS 319 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'MANGANESE (II) ION'                          MN  
4 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ANP 
5 'MYRISTIC ACID'                               MYR 
6 water                                         HOH 
#