data_1CEZ
# 
_entry.id   1CEZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1CEZ         
NDB   PD0086       
RCSB  RCSB000627   
WWPDB D_1000000627 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1CEZ 
_pdbx_database_status.recvd_initial_deposition_date   1999-03-11 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cheetham, G.M.T.' 1 
'Jeruzalmi, D.'    2 
'Steitz, T.A.'     3 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for initiation of transcription from an RNA polymerase-promoter complex.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            399 
_citation.page_first                80 
_citation.page_last                 83 
_citation.year                      1999 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10331394 
_citation.pdbx_database_id_DOI      10.1038/19999 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Cheetham, G.M.' 1 
primary 'Jeruzalmi, D.'  2 
primary 'Steitz, T.A.'   3 
# 
_cell.entry_id           1CEZ 
_cell.length_a           220.100 
_cell.length_b           73.300 
_cell.length_c           80.900 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1CEZ 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     orthorhombic 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 
;DNA (5'-D(P*TP*AP*TP*AP*GP*TP*GP*AP*GP*TP*CP*GP*TP*AP*TP*TP*A)-3')
;
5256.431  1   ?       ? ? ? 
2 polymer syn 
;DNA (5'-D(P*TP*AP*AP*TP*AP*CP*GP*AP*CP*TP*CP*AP*CP*TP*A)-3')
;
4536.987  1   ?       ? ? ? 
3 polymer man 'PROTEIN (BACTERIOPHAGE T7 RNA POLYMERASE)'                          98984.227 1   2.7.7.6 ? ? ? 
4 water   nat water                                                                18.015    471 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'PROMOTER TEMPLATE STRAND'     
2 'PROMOTER NON-TEMPLATE STRAND' 
# 
_entity_name_sys.entity_id   3 
_entity_name_sys.name        'EC 2.7.7.6' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DA)(DT)(DA)(DG)(DT)(DG)(DA)(DG)(DT)(DC)(DG)(DT)(DA)(DT)(DT)(DA)' TATAGTGAGTCGTATTA T ? 
2 polydeoxyribonucleotide no no '(DT)(DA)(DA)(DT)(DA)(DC)(DG)(DA)(DC)(DT)(DC)(DA)(DC)(DT)(DA)' TAATACGACTCACTA N ? 
3 'polypeptide(L)'        no no 
;MNTINIAKNDFSDIELAAIPFNTLADHYGERLAREQLALEHESYEMGEARFRKMFERQLKAGEVADNAAAKPLITTLLPK
MIARINDWFEEVKAKRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIGRAIEDEARFGRIRDLEAK
HFKKNVEEQLNKRVGHVYKKAFMQVVEADMLSKGLLGGEAWSSWHKEDSIHVGVRCIEMLIESTGMVSLHRQNAGVVGQD
SETIELAPEYAEAIATRAGALAGISPMFQPCVVPPKPWTGITGGGYWANGRRPLALVRTHSKKALMRYEDVYMPEVYKAI
NIAQNTAWKINKKVLAVANVITKWKHCPVEDIPAIEREELPMKPEDIDMNPEALTAWKRAAAAVYRKDKARKSRRISLEF
MLEQANKFANHKAIWFPYNMDWRGRVYAVSMFNPQGNDMTKGLLTLAKGKPIGKEGYYWLKIHGANCAGVDKVPFPERIK
FIEENHENIMACAKSPLENTWWAEQDSPFCFLAFCFEYAGVQHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVN
LLPSETVQDIYGIVAKKVNEILQADAINGTDNEVVTVTDENTGEISEKVKLGTKALAGQWLAYGVTRSVTKRSVMTLAYG
SKEFGFRQQVLEDTIQPAIDSGKGLMFTQPNQAAGYMAKLIWESVSVTVVAAVEAMNWLKSAAKLLAAEVKDKKTGEILR
KRCAVHWVTPDGFPVWQEYKKPIQTRLNLMFLGQFRLQPTINTNKDSEIDAHKQESGIAPNFVHSQDGSHLRKTVVWAHE
KYGIESFALIHDSFGTIPADAANLFKAVRETMVDTYESCDVLADFYDQFADQLHESQLDKMPALPAKGNLNLRDILESDF
AFA
;
;MNTINIAKNDFSDIELAAIPFNTLADHYGERLAREQLALEHESYEMGEARFRKMFERQLKAGEVADNAAAKPLITTLLPK
MIARINDWFEEVKAKRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIGRAIEDEARFGRIRDLEAK
HFKKNVEEQLNKRVGHVYKKAFMQVVEADMLSKGLLGGEAWSSWHKEDSIHVGVRCIEMLIESTGMVSLHRQNAGVVGQD
SETIELAPEYAEAIATRAGALAGISPMFQPCVVPPKPWTGITGGGYWANGRRPLALVRTHSKKALMRYEDVYMPEVYKAI
NIAQNTAWKINKKVLAVANVITKWKHCPVEDIPAIEREELPMKPEDIDMNPEALTAWKRAAAAVYRKDKARKSRRISLEF
MLEQANKFANHKAIWFPYNMDWRGRVYAVSMFNPQGNDMTKGLLTLAKGKPIGKEGYYWLKIHGANCAGVDKVPFPERIK
FIEENHENIMACAKSPLENTWWAEQDSPFCFLAFCFEYAGVQHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVN
LLPSETVQDIYGIVAKKVNEILQADAINGTDNEVVTVTDENTGEISEKVKLGTKALAGQWLAYGVTRSVTKRSVMTLAYG
SKEFGFRQQVLEDTIQPAIDSGKGLMFTQPNQAAGYMAKLIWESVSVTVVAAVEAMNWLKSAAKLLAAEVKDKKTGEILR
KRCAVHWVTPDGFPVWQEYKKPIQTRLNLMFLGQFRLQPTINTNKDSEIDAHKQESGIAPNFVHSQDGSHLRKTVVWAHE
KYGIESFALIHDSFGTIPADAANLFKAVRETMVDTYESCDVLADFYDQFADQLHESQLDKMPALPAKGNLNLRDILESDF
AFA
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DT  n 
1 2   DA  n 
1 3   DT  n 
1 4   DA  n 
1 5   DG  n 
1 6   DT  n 
1 7   DG  n 
1 8   DA  n 
1 9   DG  n 
1 10  DT  n 
1 11  DC  n 
1 12  DG  n 
1 13  DT  n 
1 14  DA  n 
1 15  DT  n 
1 16  DT  n 
1 17  DA  n 
2 1   DT  n 
2 2   DA  n 
2 3   DA  n 
2 4   DT  n 
2 5   DA  n 
2 6   DC  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DT  n 
2 11  DC  n 
2 12  DA  n 
2 13  DC  n 
2 14  DT  n 
2 15  DA  n 
3 1   MET n 
3 2   ASN n 
3 3   THR n 
3 4   ILE n 
3 5   ASN n 
3 6   ILE n 
3 7   ALA n 
3 8   LYS n 
3 9   ASN n 
3 10  ASP n 
3 11  PHE n 
3 12  SER n 
3 13  ASP n 
3 14  ILE n 
3 15  GLU n 
3 16  LEU n 
3 17  ALA n 
3 18  ALA n 
3 19  ILE n 
3 20  PRO n 
3 21  PHE n 
3 22  ASN n 
3 23  THR n 
3 24  LEU n 
3 25  ALA n 
3 26  ASP n 
3 27  HIS n 
3 28  TYR n 
3 29  GLY n 
3 30  GLU n 
3 31  ARG n 
3 32  LEU n 
3 33  ALA n 
3 34  ARG n 
3 35  GLU n 
3 36  GLN n 
3 37  LEU n 
3 38  ALA n 
3 39  LEU n 
3 40  GLU n 
3 41  HIS n 
3 42  GLU n 
3 43  SER n 
3 44  TYR n 
3 45  GLU n 
3 46  MET n 
3 47  GLY n 
3 48  GLU n 
3 49  ALA n 
3 50  ARG n 
3 51  PHE n 
3 52  ARG n 
3 53  LYS n 
3 54  MET n 
3 55  PHE n 
3 56  GLU n 
3 57  ARG n 
3 58  GLN n 
3 59  LEU n 
3 60  LYS n 
3 61  ALA n 
3 62  GLY n 
3 63  GLU n 
3 64  VAL n 
3 65  ALA n 
3 66  ASP n 
3 67  ASN n 
3 68  ALA n 
3 69  ALA n 
3 70  ALA n 
3 71  LYS n 
3 72  PRO n 
3 73  LEU n 
3 74  ILE n 
3 75  THR n 
3 76  THR n 
3 77  LEU n 
3 78  LEU n 
3 79  PRO n 
3 80  LYS n 
3 81  MET n 
3 82  ILE n 
3 83  ALA n 
3 84  ARG n 
3 85  ILE n 
3 86  ASN n 
3 87  ASP n 
3 88  TRP n 
3 89  PHE n 
3 90  GLU n 
3 91  GLU n 
3 92  VAL n 
3 93  LYS n 
3 94  ALA n 
3 95  LYS n 
3 96  ARG n 
3 97  GLY n 
3 98  LYS n 
3 99  ARG n 
3 100 PRO n 
3 101 THR n 
3 102 ALA n 
3 103 PHE n 
3 104 GLN n 
3 105 PHE n 
3 106 LEU n 
3 107 GLN n 
3 108 GLU n 
3 109 ILE n 
3 110 LYS n 
3 111 PRO n 
3 112 GLU n 
3 113 ALA n 
3 114 VAL n 
3 115 ALA n 
3 116 TYR n 
3 117 ILE n 
3 118 THR n 
3 119 ILE n 
3 120 LYS n 
3 121 THR n 
3 122 THR n 
3 123 LEU n 
3 124 ALA n 
3 125 CYS n 
3 126 LEU n 
3 127 THR n 
3 128 SER n 
3 129 ALA n 
3 130 ASP n 
3 131 ASN n 
3 132 THR n 
3 133 THR n 
3 134 VAL n 
3 135 GLN n 
3 136 ALA n 
3 137 VAL n 
3 138 ALA n 
3 139 SER n 
3 140 ALA n 
3 141 ILE n 
3 142 GLY n 
3 143 ARG n 
3 144 ALA n 
3 145 ILE n 
3 146 GLU n 
3 147 ASP n 
3 148 GLU n 
3 149 ALA n 
3 150 ARG n 
3 151 PHE n 
3 152 GLY n 
3 153 ARG n 
3 154 ILE n 
3 155 ARG n 
3 156 ASP n 
3 157 LEU n 
3 158 GLU n 
3 159 ALA n 
3 160 LYS n 
3 161 HIS n 
3 162 PHE n 
3 163 LYS n 
3 164 LYS n 
3 165 ASN n 
3 166 VAL n 
3 167 GLU n 
3 168 GLU n 
3 169 GLN n 
3 170 LEU n 
3 171 ASN n 
3 172 LYS n 
3 173 ARG n 
3 174 VAL n 
3 175 GLY n 
3 176 HIS n 
3 177 VAL n 
3 178 TYR n 
3 179 LYS n 
3 180 LYS n 
3 181 ALA n 
3 182 PHE n 
3 183 MET n 
3 184 GLN n 
3 185 VAL n 
3 186 VAL n 
3 187 GLU n 
3 188 ALA n 
3 189 ASP n 
3 190 MET n 
3 191 LEU n 
3 192 SER n 
3 193 LYS n 
3 194 GLY n 
3 195 LEU n 
3 196 LEU n 
3 197 GLY n 
3 198 GLY n 
3 199 GLU n 
3 200 ALA n 
3 201 TRP n 
3 202 SER n 
3 203 SER n 
3 204 TRP n 
3 205 HIS n 
3 206 LYS n 
3 207 GLU n 
3 208 ASP n 
3 209 SER n 
3 210 ILE n 
3 211 HIS n 
3 212 VAL n 
3 213 GLY n 
3 214 VAL n 
3 215 ARG n 
3 216 CYS n 
3 217 ILE n 
3 218 GLU n 
3 219 MET n 
3 220 LEU n 
3 221 ILE n 
3 222 GLU n 
3 223 SER n 
3 224 THR n 
3 225 GLY n 
3 226 MET n 
3 227 VAL n 
3 228 SER n 
3 229 LEU n 
3 230 HIS n 
3 231 ARG n 
3 232 GLN n 
3 233 ASN n 
3 234 ALA n 
3 235 GLY n 
3 236 VAL n 
3 237 VAL n 
3 238 GLY n 
3 239 GLN n 
3 240 ASP n 
3 241 SER n 
3 242 GLU n 
3 243 THR n 
3 244 ILE n 
3 245 GLU n 
3 246 LEU n 
3 247 ALA n 
3 248 PRO n 
3 249 GLU n 
3 250 TYR n 
3 251 ALA n 
3 252 GLU n 
3 253 ALA n 
3 254 ILE n 
3 255 ALA n 
3 256 THR n 
3 257 ARG n 
3 258 ALA n 
3 259 GLY n 
3 260 ALA n 
3 261 LEU n 
3 262 ALA n 
3 263 GLY n 
3 264 ILE n 
3 265 SER n 
3 266 PRO n 
3 267 MET n 
3 268 PHE n 
3 269 GLN n 
3 270 PRO n 
3 271 CYS n 
3 272 VAL n 
3 273 VAL n 
3 274 PRO n 
3 275 PRO n 
3 276 LYS n 
3 277 PRO n 
3 278 TRP n 
3 279 THR n 
3 280 GLY n 
3 281 ILE n 
3 282 THR n 
3 283 GLY n 
3 284 GLY n 
3 285 GLY n 
3 286 TYR n 
3 287 TRP n 
3 288 ALA n 
3 289 ASN n 
3 290 GLY n 
3 291 ARG n 
3 292 ARG n 
3 293 PRO n 
3 294 LEU n 
3 295 ALA n 
3 296 LEU n 
3 297 VAL n 
3 298 ARG n 
3 299 THR n 
3 300 HIS n 
3 301 SER n 
3 302 LYS n 
3 303 LYS n 
3 304 ALA n 
3 305 LEU n 
3 306 MET n 
3 307 ARG n 
3 308 TYR n 
3 309 GLU n 
3 310 ASP n 
3 311 VAL n 
3 312 TYR n 
3 313 MET n 
3 314 PRO n 
3 315 GLU n 
3 316 VAL n 
3 317 TYR n 
3 318 LYS n 
3 319 ALA n 
3 320 ILE n 
3 321 ASN n 
3 322 ILE n 
3 323 ALA n 
3 324 GLN n 
3 325 ASN n 
3 326 THR n 
3 327 ALA n 
3 328 TRP n 
3 329 LYS n 
3 330 ILE n 
3 331 ASN n 
3 332 LYS n 
3 333 LYS n 
3 334 VAL n 
3 335 LEU n 
3 336 ALA n 
3 337 VAL n 
3 338 ALA n 
3 339 ASN n 
3 340 VAL n 
3 341 ILE n 
3 342 THR n 
3 343 LYS n 
3 344 TRP n 
3 345 LYS n 
3 346 HIS n 
3 347 CYS n 
3 348 PRO n 
3 349 VAL n 
3 350 GLU n 
3 351 ASP n 
3 352 ILE n 
3 353 PRO n 
3 354 ALA n 
3 355 ILE n 
3 356 GLU n 
3 357 ARG n 
3 358 GLU n 
3 359 GLU n 
3 360 LEU n 
3 361 PRO n 
3 362 MET n 
3 363 LYS n 
3 364 PRO n 
3 365 GLU n 
3 366 ASP n 
3 367 ILE n 
3 368 ASP n 
3 369 MET n 
3 370 ASN n 
3 371 PRO n 
3 372 GLU n 
3 373 ALA n 
3 374 LEU n 
3 375 THR n 
3 376 ALA n 
3 377 TRP n 
3 378 LYS n 
3 379 ARG n 
3 380 ALA n 
3 381 ALA n 
3 382 ALA n 
3 383 ALA n 
3 384 VAL n 
3 385 TYR n 
3 386 ARG n 
3 387 LYS n 
3 388 ASP n 
3 389 LYS n 
3 390 ALA n 
3 391 ARG n 
3 392 LYS n 
3 393 SER n 
3 394 ARG n 
3 395 ARG n 
3 396 ILE n 
3 397 SER n 
3 398 LEU n 
3 399 GLU n 
3 400 PHE n 
3 401 MET n 
3 402 LEU n 
3 403 GLU n 
3 404 GLN n 
3 405 ALA n 
3 406 ASN n 
3 407 LYS n 
3 408 PHE n 
3 409 ALA n 
3 410 ASN n 
3 411 HIS n 
3 412 LYS n 
3 413 ALA n 
3 414 ILE n 
3 415 TRP n 
3 416 PHE n 
3 417 PRO n 
3 418 TYR n 
3 419 ASN n 
3 420 MET n 
3 421 ASP n 
3 422 TRP n 
3 423 ARG n 
3 424 GLY n 
3 425 ARG n 
3 426 VAL n 
3 427 TYR n 
3 428 ALA n 
3 429 VAL n 
3 430 SER n 
3 431 MET n 
3 432 PHE n 
3 433 ASN n 
3 434 PRO n 
3 435 GLN n 
3 436 GLY n 
3 437 ASN n 
3 438 ASP n 
3 439 MET n 
3 440 THR n 
3 441 LYS n 
3 442 GLY n 
3 443 LEU n 
3 444 LEU n 
3 445 THR n 
3 446 LEU n 
3 447 ALA n 
3 448 LYS n 
3 449 GLY n 
3 450 LYS n 
3 451 PRO n 
3 452 ILE n 
3 453 GLY n 
3 454 LYS n 
3 455 GLU n 
3 456 GLY n 
3 457 TYR n 
3 458 TYR n 
3 459 TRP n 
3 460 LEU n 
3 461 LYS n 
3 462 ILE n 
3 463 HIS n 
3 464 GLY n 
3 465 ALA n 
3 466 ASN n 
3 467 CYS n 
3 468 ALA n 
3 469 GLY n 
3 470 VAL n 
3 471 ASP n 
3 472 LYS n 
3 473 VAL n 
3 474 PRO n 
3 475 PHE n 
3 476 PRO n 
3 477 GLU n 
3 478 ARG n 
3 479 ILE n 
3 480 LYS n 
3 481 PHE n 
3 482 ILE n 
3 483 GLU n 
3 484 GLU n 
3 485 ASN n 
3 486 HIS n 
3 487 GLU n 
3 488 ASN n 
3 489 ILE n 
3 490 MET n 
3 491 ALA n 
3 492 CYS n 
3 493 ALA n 
3 494 LYS n 
3 495 SER n 
3 496 PRO n 
3 497 LEU n 
3 498 GLU n 
3 499 ASN n 
3 500 THR n 
3 501 TRP n 
3 502 TRP n 
3 503 ALA n 
3 504 GLU n 
3 505 GLN n 
3 506 ASP n 
3 507 SER n 
3 508 PRO n 
3 509 PHE n 
3 510 CYS n 
3 511 PHE n 
3 512 LEU n 
3 513 ALA n 
3 514 PHE n 
3 515 CYS n 
3 516 PHE n 
3 517 GLU n 
3 518 TYR n 
3 519 ALA n 
3 520 GLY n 
3 521 VAL n 
3 522 GLN n 
3 523 HIS n 
3 524 HIS n 
3 525 GLY n 
3 526 LEU n 
3 527 SER n 
3 528 TYR n 
3 529 ASN n 
3 530 CYS n 
3 531 SER n 
3 532 LEU n 
3 533 PRO n 
3 534 LEU n 
3 535 ALA n 
3 536 PHE n 
3 537 ASP n 
3 538 GLY n 
3 539 SER n 
3 540 CYS n 
3 541 SER n 
3 542 GLY n 
3 543 ILE n 
3 544 GLN n 
3 545 HIS n 
3 546 PHE n 
3 547 SER n 
3 548 ALA n 
3 549 MET n 
3 550 LEU n 
3 551 ARG n 
3 552 ASP n 
3 553 GLU n 
3 554 VAL n 
3 555 GLY n 
3 556 GLY n 
3 557 ARG n 
3 558 ALA n 
3 559 VAL n 
3 560 ASN n 
3 561 LEU n 
3 562 LEU n 
3 563 PRO n 
3 564 SER n 
3 565 GLU n 
3 566 THR n 
3 567 VAL n 
3 568 GLN n 
3 569 ASP n 
3 570 ILE n 
3 571 TYR n 
3 572 GLY n 
3 573 ILE n 
3 574 VAL n 
3 575 ALA n 
3 576 LYS n 
3 577 LYS n 
3 578 VAL n 
3 579 ASN n 
3 580 GLU n 
3 581 ILE n 
3 582 LEU n 
3 583 GLN n 
3 584 ALA n 
3 585 ASP n 
3 586 ALA n 
3 587 ILE n 
3 588 ASN n 
3 589 GLY n 
3 590 THR n 
3 591 ASP n 
3 592 ASN n 
3 593 GLU n 
3 594 VAL n 
3 595 VAL n 
3 596 THR n 
3 597 VAL n 
3 598 THR n 
3 599 ASP n 
3 600 GLU n 
3 601 ASN n 
3 602 THR n 
3 603 GLY n 
3 604 GLU n 
3 605 ILE n 
3 606 SER n 
3 607 GLU n 
3 608 LYS n 
3 609 VAL n 
3 610 LYS n 
3 611 LEU n 
3 612 GLY n 
3 613 THR n 
3 614 LYS n 
3 615 ALA n 
3 616 LEU n 
3 617 ALA n 
3 618 GLY n 
3 619 GLN n 
3 620 TRP n 
3 621 LEU n 
3 622 ALA n 
3 623 TYR n 
3 624 GLY n 
3 625 VAL n 
3 626 THR n 
3 627 ARG n 
3 628 SER n 
3 629 VAL n 
3 630 THR n 
3 631 LYS n 
3 632 ARG n 
3 633 SER n 
3 634 VAL n 
3 635 MET n 
3 636 THR n 
3 637 LEU n 
3 638 ALA n 
3 639 TYR n 
3 640 GLY n 
3 641 SER n 
3 642 LYS n 
3 643 GLU n 
3 644 PHE n 
3 645 GLY n 
3 646 PHE n 
3 647 ARG n 
3 648 GLN n 
3 649 GLN n 
3 650 VAL n 
3 651 LEU n 
3 652 GLU n 
3 653 ASP n 
3 654 THR n 
3 655 ILE n 
3 656 GLN n 
3 657 PRO n 
3 658 ALA n 
3 659 ILE n 
3 660 ASP n 
3 661 SER n 
3 662 GLY n 
3 663 LYS n 
3 664 GLY n 
3 665 LEU n 
3 666 MET n 
3 667 PHE n 
3 668 THR n 
3 669 GLN n 
3 670 PRO n 
3 671 ASN n 
3 672 GLN n 
3 673 ALA n 
3 674 ALA n 
3 675 GLY n 
3 676 TYR n 
3 677 MET n 
3 678 ALA n 
3 679 LYS n 
3 680 LEU n 
3 681 ILE n 
3 682 TRP n 
3 683 GLU n 
3 684 SER n 
3 685 VAL n 
3 686 SER n 
3 687 VAL n 
3 688 THR n 
3 689 VAL n 
3 690 VAL n 
3 691 ALA n 
3 692 ALA n 
3 693 VAL n 
3 694 GLU n 
3 695 ALA n 
3 696 MET n 
3 697 ASN n 
3 698 TRP n 
3 699 LEU n 
3 700 LYS n 
3 701 SER n 
3 702 ALA n 
3 703 ALA n 
3 704 LYS n 
3 705 LEU n 
3 706 LEU n 
3 707 ALA n 
3 708 ALA n 
3 709 GLU n 
3 710 VAL n 
3 711 LYS n 
3 712 ASP n 
3 713 LYS n 
3 714 LYS n 
3 715 THR n 
3 716 GLY n 
3 717 GLU n 
3 718 ILE n 
3 719 LEU n 
3 720 ARG n 
3 721 LYS n 
3 722 ARG n 
3 723 CYS n 
3 724 ALA n 
3 725 VAL n 
3 726 HIS n 
3 727 TRP n 
3 728 VAL n 
3 729 THR n 
3 730 PRO n 
3 731 ASP n 
3 732 GLY n 
3 733 PHE n 
3 734 PRO n 
3 735 VAL n 
3 736 TRP n 
3 737 GLN n 
3 738 GLU n 
3 739 TYR n 
3 740 LYS n 
3 741 LYS n 
3 742 PRO n 
3 743 ILE n 
3 744 GLN n 
3 745 THR n 
3 746 ARG n 
3 747 LEU n 
3 748 ASN n 
3 749 LEU n 
3 750 MET n 
3 751 PHE n 
3 752 LEU n 
3 753 GLY n 
3 754 GLN n 
3 755 PHE n 
3 756 ARG n 
3 757 LEU n 
3 758 GLN n 
3 759 PRO n 
3 760 THR n 
3 761 ILE n 
3 762 ASN n 
3 763 THR n 
3 764 ASN n 
3 765 LYS n 
3 766 ASP n 
3 767 SER n 
3 768 GLU n 
3 769 ILE n 
3 770 ASP n 
3 771 ALA n 
3 772 HIS n 
3 773 LYS n 
3 774 GLN n 
3 775 GLU n 
3 776 SER n 
3 777 GLY n 
3 778 ILE n 
3 779 ALA n 
3 780 PRO n 
3 781 ASN n 
3 782 PHE n 
3 783 VAL n 
3 784 HIS n 
3 785 SER n 
3 786 GLN n 
3 787 ASP n 
3 788 GLY n 
3 789 SER n 
3 790 HIS n 
3 791 LEU n 
3 792 ARG n 
3 793 LYS n 
3 794 THR n 
3 795 VAL n 
3 796 VAL n 
3 797 TRP n 
3 798 ALA n 
3 799 HIS n 
3 800 GLU n 
3 801 LYS n 
3 802 TYR n 
3 803 GLY n 
3 804 ILE n 
3 805 GLU n 
3 806 SER n 
3 807 PHE n 
3 808 ALA n 
3 809 LEU n 
3 810 ILE n 
3 811 HIS n 
3 812 ASP n 
3 813 SER n 
3 814 PHE n 
3 815 GLY n 
3 816 THR n 
3 817 ILE n 
3 818 PRO n 
3 819 ALA n 
3 820 ASP n 
3 821 ALA n 
3 822 ALA n 
3 823 ASN n 
3 824 LEU n 
3 825 PHE n 
3 826 LYS n 
3 827 ALA n 
3 828 VAL n 
3 829 ARG n 
3 830 GLU n 
3 831 THR n 
3 832 MET n 
3 833 VAL n 
3 834 ASP n 
3 835 THR n 
3 836 TYR n 
3 837 GLU n 
3 838 SER n 
3 839 CYS n 
3 840 ASP n 
3 841 VAL n 
3 842 LEU n 
3 843 ALA n 
3 844 ASP n 
3 845 PHE n 
3 846 TYR n 
3 847 ASP n 
3 848 GLN n 
3 849 PHE n 
3 850 ALA n 
3 851 ASP n 
3 852 GLN n 
3 853 LEU n 
3 854 HIS n 
3 855 GLU n 
3 856 SER n 
3 857 GLN n 
3 858 LEU n 
3 859 ASP n 
3 860 LYS n 
3 861 MET n 
3 862 PRO n 
3 863 ALA n 
3 864 LEU n 
3 865 PRO n 
3 866 ALA n 
3 867 LYS n 
3 868 GLY n 
3 869 ASN n 
3 870 LEU n 
3 871 ASN n 
3 872 LEU n 
3 873 ARG n 
3 874 ASP n 
3 875 ILE n 
3 876 LEU n 
3 877 GLU n 
3 878 SER n 
3 879 ASP n 
3 880 PHE n 
3 881 ALA n 
3 882 PHE n 
3 883 ALA n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     'T7-like viruses' 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage T7' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10760 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP RPOL_BPT7 3 ? ? P00573 ? 
2 PDB 1CEZ      1 ? ? 1CEZ   ? 
3 PDB 1CEZ      2 ? ? 1CEZ   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1CEZ A 1 ? 883 ? P00573 1   ? 883 ? 1   883 
2 2 1CEZ T 1 ? 17  ? 1CEZ   1   ? 17  ? 1   17  
3 3 1CEZ N 1 ? 15  ? 1CEZ   101 ? 115 ? 101 115 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1CEZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.8 
_exptl_crystal.density_percent_sol   58 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.7 
_exptl_crystal_grow.pdbx_details    'pH 8.7' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ADSC 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.910 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             0.910 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1CEZ 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.0 
_reflns.d_resolution_high            2.4 
_reflns.number_obs                   50077 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0840000 
_reflns.pdbx_netI_over_sigmaI        11.9 
_reflns.B_iso_Wilson_estimate        48.6 
_reflns.pdbx_redundancy              2.9 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.46 
_reflns_shell.percent_possible_all   97.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.3900000 
_reflns_shell.meanI_over_sigI_obs    1.9 
_reflns_shell.pdbx_redundancy        2.7 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1CEZ 
_refine.ls_number_reflns_obs                     42312 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          3.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.00 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    81.3 
_refine.ls_R_factor_obs                          0.2240000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2240000 
_refine.ls_R_factor_R_free                       0.2700000 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  4243 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               53.4 
_refine.aniso_B[1][1]                            6.91 
_refine.aniso_B[2][2]                            1.20 
_refine.aniso_B[3][3]                            -8.11 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.310 
_refine.solvent_model_param_bsol                 60 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIRAS 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1CEZ 
_refine_analyze.Luzzati_coordinate_error_obs    0.32 
_refine_analyze.Luzzati_sigma_a_obs             0.32 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.40 
_refine_analyze.Luzzati_sigma_a_free            0.41 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6639 
_refine_hist.pdbx_number_atoms_nucleic_acid   656 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             471 
_refine_hist.number_atoms_total               7766 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        40.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.010 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.5   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      20.8  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.01  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.91  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            3.11  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             3.10  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            4.39  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   12 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.47 
_refine_ls_shell.number_reflns_R_work             1984 
_refine_ls_shell.R_factor_R_work                  0.3020000 
_refine_ls_shell.percent_reflns_obs               50.5 
_refine_ls_shell.R_factor_R_free                  0.3410000 
_refine_ls_shell.R_factor_R_free_error            0.025 
_refine_ls_shell.percent_reflns_R_free            8.6 
_refine_ls_shell.number_reflns_R_free             187 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PARAM DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1CEZ 
_struct.title                     'CRYSTAL STRUCTURE OF A T7 RNA POLYMERASE-T7 PROMOTER COMPLEX' 
_struct.pdbx_descriptor           'BACTERIOPHAGE T7 RNA POLYMERASE/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1CEZ 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'T7 RNA POLYMERASE, TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA C 7   ? ASP C 10  ? ALA A 7   ASP A 10  1 ? 4  
HELX_P HELX_P2  2  ASP C 13  ? ASP C 26  ? ASP A 13  ASP A 26  1 ? 14 
HELX_P HELX_P3  3  GLY C 29  ? SER C 43  ? GLY A 29  SER A 43  1 ? 15 
HELX_P HELX_P4  4  GLU C 48  ? MET C 54  ? GLU A 48  MET A 54  1 ? 7  
HELX_P HELX_P5  5  LEU C 73  ? LYS C 93  ? LEU A 73  LYS A 93  5 ? 21 
HELX_P HELX_P6  6  THR C 101 ? GLU C 108 ? THR A 101 GLU A 108 1 ? 8  
HELX_P HELX_P7  7  PRO C 111 ? THR C 127 ? PRO A 111 THR A 127 1 ? 17 
HELX_P HELX_P8  8  VAL C 134 ? ALA C 149 ? VAL A 134 ALA A 149 1 ? 16 
HELX_P HELX_P9  9  GLY C 152 ? LYS C 163 ? GLY A 152 LYS A 163 1 ? 12 
HELX_P HELX_P10 10 LEU C 170 ? ARG C 173 ? LEU A 170 ARG A 173 1 ? 4  
HELX_P HELX_P11 11 ALA C 188 ? MET C 190 ? ALA A 188 MET A 190 5 ? 3  
HELX_P HELX_P12 12 LYS C 193 ? LEU C 195 ? LYS A 193 LEU A 195 5 ? 3  
HELX_P HELX_P13 13 LYS C 206 ? SER C 223 ? LYS A 206 SER A 223 1 ? 18 
HELX_P HELX_P14 14 PRO C 248 ? THR C 256 ? PRO A 248 THR A 256 1 ? 9  
HELX_P HELX_P15 15 LYS C 302 ? TYR C 308 ? LYS A 302 TYR A 308 1 ? 7  
HELX_P HELX_P16 16 PRO C 314 ? GLN C 324 ? PRO A 314 GLN A 324 1 ? 11 
HELX_P HELX_P17 17 LYS C 332 ? LYS C 343 ? LYS A 332 LYS A 343 1 ? 12 
HELX_P HELX_P18 18 ALA C 373 ? LYS C 407 ? ALA A 373 LYS A 407 1 ? 35 
HELX_P HELX_P19 19 ASP C 438 ? LEU C 443 ? ASP A 438 LEU A 443 1 ? 6  
HELX_P HELX_P20 20 GLY C 453 ? CYS C 467 ? GLY A 453 CYS A 467 1 ? 15 
HELX_P HELX_P21 21 PHE C 475 ? LYS C 494 ? PHE A 475 LYS A 494 1 ? 20 
HELX_P HELX_P22 22 TRP C 502 ? GLU C 504 ? TRP A 502 GLU A 504 5 ? 3  
HELX_P HELX_P23 23 PRO C 508 ? SER C 527 ? PRO A 508 SER A 527 1 ? 20 
HELX_P HELX_P24 24 ILE C 543 ? LEU C 550 ? ILE A 543 LEU A 550 1 ? 8  
HELX_P HELX_P25 25 GLU C 553 ? ALA C 558 ? GLU A 553 ALA A 558 1 ? 6  
HELX_P HELX_P26 26 ILE C 570 ? ILE C 587 ? ILE A 570 ILE A 587 1 ? 18 
HELX_P HELX_P27 27 THR C 613 ? TYR C 623 ? THR A 613 TYR A 623 1 ? 11 
HELX_P HELX_P28 28 ARG C 627 ? MET C 635 ? ARG A 627 MET A 635 1 ? 9  
HELX_P HELX_P29 29 VAL C 650 ? ASP C 653 ? VAL A 650 ASP A 653 1 ? 4  
HELX_P HELX_P30 30 ILE C 655 ? SER C 661 ? ILE A 655 SER A 661 1 ? 7  
HELX_P HELX_P31 31 PRO C 670 ? THR C 688 ? PRO A 670 THR A 688 1 ? 19 
HELX_P HELX_P32 32 VAL C 690 ? LEU C 706 ? VAL A 690 LEU A 706 1 ? 17 
HELX_P HELX_P33 33 ALA C 771 ? GLU C 800 ? ALA A 771 GLU A 800 1 ? 30 
HELX_P HELX_P34 34 PRO C 818 ? SER C 838 ? PRO A 818 SER A 838 1 ? 21 
HELX_P HELX_P35 35 VAL C 841 ? GLN C 848 ? VAL A 841 GLN A 848 1 ? 8  
HELX_P HELX_P36 36 LEU C 872 ? ILE C 875 ? LEU A 872 ILE A 875 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DG 5  N1 ? ? ? 1_555 B DC 13 N3 ? ? T DG 5  N DC 113 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DG 5  N2 ? ? ? 1_555 B DC 13 O2 ? ? T DG 5  N DC 113 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DG 5  O6 ? ? ? 1_555 B DC 13 N4 ? ? T DG 5  N DC 113 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DT 6  N3 ? ? ? 1_555 B DA 12 N1 ? ? T DT 6  N DA 112 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DT 6  O4 ? ? ? 1_555 B DA 12 N6 ? ? T DT 6  N DA 112 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DG 7  N1 ? ? ? 1_555 B DC 11 N3 ? ? T DG 7  N DC 111 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DG 7  N2 ? ? ? 1_555 B DC 11 O2 ? ? T DG 7  N DC 111 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DG 7  O6 ? ? ? 1_555 B DC 11 N4 ? ? T DG 7  N DC 111 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DA 8  N1 ? ? ? 1_555 B DT 10 N3 ? ? T DA 8  N DT 110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DA 8  N6 ? ? ? 1_555 B DT 10 O4 ? ? T DA 8  N DT 110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DG 9  N1 ? ? ? 1_555 B DC 9  N3 ? ? T DG 9  N DC 109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DG 9  N2 ? ? ? 1_555 B DC 9  O2 ? ? T DG 9  N DC 109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DG 9  O6 ? ? ? 1_555 B DC 9  N4 ? ? T DG 9  N DC 109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DT 10 N3 ? ? ? 1_555 B DA 8  N1 ? ? T DT 10 N DA 108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DT 10 O4 ? ? ? 1_555 B DA 8  N6 ? ? T DT 10 N DA 108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DC 11 N3 ? ? ? 1_555 B DG 7  N1 ? ? T DC 11 N DG 107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DC 11 N4 ? ? ? 1_555 B DG 7  O6 ? ? T DC 11 N DG 107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DC 11 O2 ? ? ? 1_555 B DG 7  N2 ? ? T DC 11 N DG 107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DG 12 N1 ? ? ? 1_555 B DC 6  N3 ? ? T DG 12 N DC 106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DG 12 N2 ? ? ? 1_555 B DC 6  O2 ? ? T DG 12 N DC 106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DG 12 O6 ? ? ? 1_555 B DC 6  N4 ? ? T DG 12 N DC 106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DT 13 N3 ? ? ? 1_555 B DA 5  N1 ? ? T DT 13 N DA 105 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DT 13 O4 ? ? ? 1_555 B DA 5  N6 ? ? T DT 13 N DA 105 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DA 14 N1 ? ? ? 1_555 B DT 4  N3 ? ? T DA 14 N DT 104 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? A DA 14 N6 ? ? ? 1_555 B DT 4  O4 ? ? T DA 14 N DT 104 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? A DT 15 N3 ? ? ? 1_555 B DA 3  N1 ? ? T DT 15 N DA 103 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? A DT 15 O4 ? ? ? 1_555 B DA 3  N6 ? ? T DT 15 N DA 103 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? A DT 16 N3 ? ? ? 1_555 B DA 2  N1 ? ? T DT 16 N DA 102 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? A DT 16 O4 ? ? ? 1_555 B DA 2  N6 ? ? T DT 16 N DA 102 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? A DA 17 N1 ? ? ? 1_555 B DT 1  N3 ? ? T DA 17 N DT 101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? A DA 17 N6 ? ? ? 1_555 B DT 1  O4 ? ? T DA 17 N DT 101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL C 227 ? GLN C 232 ? VAL A 227 GLN A 232 
A 2 SER C 241 ? LEU C 246 ? SER A 241 LEU A 246 
B 1 TRP C 328 ? ILE C 330 ? TRP A 328 ILE A 330 
B 2 LEU C 444 ? LEU C 446 ? LEU A 444 LEU A 446 
C 1 TYR C 418 ? MET C 420 ? TYR A 418 MET A 420 
C 2 VAL C 426 ? ALA C 428 ? VAL A 426 ALA A 428 
D 1 LEU C 534 ? ASP C 537 ? LEU A 534 ASP A 537 
D 2 SER C 813 ? THR C 816 ? SER A 813 THR A 816 
E 1 VAL C 725 ? VAL C 728 ? VAL A 725 VAL A 728 
E 2 PRO C 734 ? GLN C 737 ? PRO A 734 GLN A 737 
F 1 GLN C 744 ? ARG C 746 ? GLN A 744 ARG A 746 
F 2 THR C 760 ? ASN C 762 ? THR A 760 ASN A 762 
G 1 LEU C 749 ? PHE C 751 ? LEU A 749 PHE A 751 
G 2 PHE C 755 ? LEU C 757 ? PHE A 755 LEU A 757 
H 1 LYS C 740 ? PRO C 742 ? LYS A 740 PRO A 742 
H 2 ASP C 766 ? ILE C 769 ? ASP A 766 ILE A 769 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O SER C 228 ? O SER A 228 N GLU C 245 ? N GLU A 245 
B 1 2 O LYS C 329 ? O LYS A 329 N THR C 445 ? N THR A 445 
C 1 2 O ASN C 419 ? O ASN A 419 N TYR C 427 ? N TYR A 427 
D 1 2 O LEU C 534 ? O LEU A 534 N THR C 816 ? N THR A 816 
E 1 2 O VAL C 725 ? O VAL A 725 N GLN C 737 ? N GLN A 737 
F 1 2 O THR C 745 ? O THR A 745 N ILE C 761 ? N ILE A 761 
G 1 2 O LEU C 749 ? O LEU A 749 N LEU C 757 ? N LEU A 757 
H 1 2 O LYS C 741 ? O LYS A 741 N GLU C 768 ? N GLU A 768 
# 
_database_PDB_matrix.entry_id          1CEZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1CEZ 
_atom_sites.fract_transf_matrix[1][1]   0.004543 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013642 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012361 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    P P     . DT  A 1 1   ? 87.339  39.862 14.996  1.00 110.51 ? 1    DT  T P     1 
ATOM   2    O OP1   . DT  A 1 1   ? 86.202  39.386 15.897  1.00 110.23 ? 1    DT  T OP1   1 
ATOM   3    O OP2   . DT  A 1 1   ? 86.873  40.434 13.664  1.00 110.51 ? 1    DT  T OP2   1 
ATOM   4    O "O5'" . DT  A 1 1   ? 88.245  38.555 14.630  1.00 110.51 ? 1    DT  T "O5'" 1 
ATOM   5    C "C5'" . DT  A 1 1   ? 89.414  38.226 15.408  1.00 109.62 ? 1    DT  T "C5'" 1 
ATOM   6    C "C4'" . DT  A 1 1   ? 89.140  37.024 16.284  1.00 108.71 ? 1    DT  T "C4'" 1 
ATOM   7    O "O4'" . DT  A 1 1   ? 90.118  37.031 17.354  1.00 106.55 ? 1    DT  T "O4'" 1 
ATOM   8    C "C3'" . DT  A 1 1   ? 87.778  37.075 16.980  1.00 108.18 ? 1    DT  T "C3'" 1 
ATOM   9    O "O3'" . DT  A 1 1   ? 87.268  35.754 17.240  1.00 109.86 ? 1    DT  T "O3'" 1 
ATOM   10   C "C2'" . DT  A 1 1   ? 88.086  37.835 18.255  1.00 106.45 ? 1    DT  T "C2'" 1 
ATOM   11   C "C1'" . DT  A 1 1   ? 89.502  37.380 18.588  1.00 104.13 ? 1    DT  T "C1'" 1 
ATOM   12   N N1    . DT  A 1 1   ? 90.318  38.430 19.228  1.00 101.40 ? 1    DT  T N1    1 
ATOM   13   C C2    . DT  A 1 1   ? 90.878  38.171 20.462  1.00 99.74  ? 1    DT  T C2    1 
ATOM   14   O O2    . DT  A 1 1   ? 90.759  37.108 21.042  1.00 101.30 ? 1    DT  T O2    1 
ATOM   15   N N3    . DT  A 1 1   ? 91.585  39.211 20.996  1.00 97.18  ? 1    DT  T N3    1 
ATOM   16   C C4    . DT  A 1 1   ? 91.786  40.452 20.437  1.00 95.89  ? 1    DT  T C4    1 
ATOM   17   O O4    . DT  A 1 1   ? 92.437  41.285 21.042  1.00 95.63  ? 1    DT  T O4    1 
ATOM   18   C C5    . DT  A 1 1   ? 91.183  40.654 19.140  1.00 96.32  ? 1    DT  T C5    1 
ATOM   19   C C7    . DT  A 1 1   ? 91.352  41.973 18.456  1.00 97.16  ? 1    DT  T C7    1 
ATOM   20   C C6    . DT  A 1 1   ? 90.492  39.645 18.605  1.00 98.59  ? 1    DT  T C6    1 
ATOM   21   P P     . DA  A 1 2   ? 85.820  35.567 17.934  1.00 110.51 ? 2    DA  T P     1 
ATOM   22   O OP1   . DA  A 1 2   ? 85.689  36.539 19.049  1.00 110.51 ? 2    DA  T OP1   1 
ATOM   23   O OP2   . DA  A 1 2   ? 85.638  34.111 18.203  1.00 110.51 ? 2    DA  T OP2   1 
ATOM   24   O "O5'" . DA  A 1 2   ? 84.776  35.988 16.810  1.00 110.51 ? 2    DA  T "O5'" 1 
ATOM   25   C "C5'" . DA  A 1 2   ? 84.172  35.003 15.980  1.00 109.67 ? 2    DA  T "C5'" 1 
ATOM   26   C "C4'" . DA  A 1 2   ? 84.484  35.292 14.532  1.00 109.01 ? 2    DA  T "C4'" 1 
ATOM   27   O "O4'" . DA  A 1 2   ? 85.923  35.407 14.398  1.00 108.57 ? 2    DA  T "O4'" 1 
ATOM   28   C "C3'" . DA  A 1 2   ? 84.079  34.171 13.581  1.00 107.79 ? 2    DA  T "C3'" 1 
ATOM   29   O "O3'" . DA  A 1 2   ? 83.714  34.713 12.303  1.00 105.06 ? 2    DA  T "O3'" 1 
ATOM   30   C "C2'" . DA  A 1 2   ? 85.308  33.280 13.567  1.00 107.73 ? 2    DA  T "C2'" 1 
ATOM   31   C "C1'" . DA  A 1 2   ? 86.456  34.271 13.724  1.00 107.90 ? 2    DA  T "C1'" 1 
ATOM   32   N N9    . DA  A 1 2   ? 87.569  33.755 14.526  1.00 108.09 ? 2    DA  T N9    1 
ATOM   33   C C8    . DA  A 1 2   ? 87.495  32.870 15.578  1.00 108.40 ? 2    DA  T C8    1 
ATOM   34   N N7    . DA  A 1 2   ? 88.661  32.564 16.096  1.00 107.74 ? 2    DA  T N7    1 
ATOM   35   C C5    . DA  A 1 2   ? 89.563  33.299 15.341  1.00 106.79 ? 2    DA  T C5    1 
ATOM   36   C C6    . DA  A 1 2   ? 90.959  33.409 15.390  1.00 105.77 ? 2    DA  T C6    1 
ATOM   37   N N6    . DA  A 1 2   ? 91.717  32.746 16.265  1.00 105.50 ? 2    DA  T N6    1 
ATOM   38   N N1    . DA  A 1 2   ? 91.559  34.230 14.499  1.00 104.93 ? 2    DA  T N1    1 
ATOM   39   C C2    . DA  A 1 2   ? 90.795  34.889 13.621  1.00 104.85 ? 2    DA  T C2    1 
ATOM   40   N N3    . DA  A 1 2   ? 89.472  34.868 13.473  1.00 106.72 ? 2    DA  T N3    1 
ATOM   41   C C4    . DA  A 1 2   ? 88.907  34.043 14.374  1.00 107.37 ? 2    DA  T C4    1 
ATOM   42   P P     . DT  A 1 3   ? 84.066  33.911 10.954  1.00 102.13 ? 3    DT  T P     1 
ATOM   43   O OP1   . DT  A 1 3   ? 83.210  34.486 9.887   1.00 101.38 ? 3    DT  T OP1   1 
ATOM   44   O OP2   . DT  A 1 3   ? 84.029  32.445 11.215  1.00 101.95 ? 3    DT  T OP2   1 
ATOM   45   O "O5'" . DT  A 1 3   ? 85.574  34.352 10.675  1.00 96.05  ? 3    DT  T "O5'" 1 
ATOM   46   C "C5'" . DT  A 1 3   ? 85.977  35.709 10.878  1.00 84.16  ? 3    DT  T "C5'" 1 
ATOM   47   C "C4'" . DT  A 1 3   ? 87.102  36.078 9.941   1.00 77.26  ? 3    DT  T "C4'" 1 
ATOM   48   O "O4'" . DT  A 1 3   ? 88.339  35.498 10.417  1.00 71.89  ? 3    DT  T "O4'" 1 
ATOM   49   C "C3'" . DT  A 1 3   ? 86.914  35.512 8.536   1.00 74.87  ? 3    DT  T "C3'" 1 
ATOM   50   O "O3'" . DT  A 1 3   ? 87.506  36.366 7.563   1.00 74.13  ? 3    DT  T "O3'" 1 
ATOM   51   C "C2'" . DT  A 1 3   ? 87.602  34.161 8.614   1.00 71.85  ? 3    DT  T "C2'" 1 
ATOM   52   C "C1'" . DT  A 1 3   ? 88.757  34.433 9.565   1.00 67.47  ? 3    DT  T "C1'" 1 
ATOM   53   N N1    . DT  A 1 3   ? 89.120  33.291 10.421  1.00 62.26  ? 3    DT  T N1    1 
ATOM   54   C C2    . DT  A 1 3   ? 90.453  32.985 10.571  1.00 59.88  ? 3    DT  T C2    1 
ATOM   55   O O2    . DT  A 1 3   ? 91.346  33.620 10.039  1.00 60.08  ? 3    DT  T O2    1 
ATOM   56   N N3    . DT  A 1 3   ? 90.704  31.903 11.374  1.00 57.16  ? 3    DT  T N3    1 
ATOM   57   C C4    . DT  A 1 3   ? 89.772  31.116 12.027  1.00 56.74  ? 3    DT  T C4    1 
ATOM   58   O O4    . DT  A 1 3   ? 90.140  30.172 12.709  1.00 54.21  ? 3    DT  T O4    1 
ATOM   59   C C5    . DT  A 1 3   ? 88.397  31.497 11.831  1.00 57.38  ? 3    DT  T C5    1 
ATOM   60   C C7    . DT  A 1 3   ? 87.324  30.701 12.502  1.00 56.64  ? 3    DT  T C7    1 
ATOM   61   C C6    . DT  A 1 3   ? 88.142  32.552 11.050  1.00 58.98  ? 3    DT  T C6    1 
ATOM   62   P P     . DA  A 1 4   ? 87.033  36.278 6.027   1.00 73.77  ? 4    DA  T P     1 
ATOM   63   O OP1   . DA  A 1 4   ? 86.313  37.532 5.679   1.00 74.00  ? 4    DA  T OP1   1 
ATOM   64   O OP2   . DA  A 1 4   ? 86.404  34.961 5.727   1.00 71.81  ? 4    DA  T OP2   1 
ATOM   65   O "O5'" . DA  A 1 4   ? 88.421  36.317 5.266   1.00 69.86  ? 4    DA  T "O5'" 1 
ATOM   66   C "C5'" . DA  A 1 4   ? 88.631  35.498 4.143   1.00 66.51  ? 4    DA  T "C5'" 1 
ATOM   67   C "C4'" . DA  A 1 4   ? 90.105  35.233 3.979   1.00 61.96  ? 4    DA  T "C4'" 1 
ATOM   68   O "O4'" . DA  A 1 4   ? 90.584  34.421 5.073   1.00 58.19  ? 4    DA  T "O4'" 1 
ATOM   69   C "C3'" . DA  A 1 4   ? 90.428  34.443 2.730   1.00 59.15  ? 4    DA  T "C3'" 1 
ATOM   70   O "O3'" . DA  A 1 4   ? 91.684  34.899 2.263   1.00 58.51  ? 4    DA  T "O3'" 1 
ATOM   71   C "C2'" . DA  A 1 4   ? 90.336  33.002 3.191   1.00 56.76  ? 4    DA  T "C2'" 1 
ATOM   72   C "C1'" . DA  A 1 4   ? 90.804  33.079 4.636   1.00 55.51  ? 4    DA  T "C1'" 1 
ATOM   73   N N9    . DA  A 1 4   ? 90.025  32.226 5.525   1.00 53.44  ? 4    DA  T N9    1 
ATOM   74   C C8    . DA  A 1 4   ? 88.651  32.147 5.615   1.00 54.44  ? 4    DA  T C8    1 
ATOM   75   N N7    . DA  A 1 4   ? 88.232  31.358 6.575   1.00 52.73  ? 4    DA  T N7    1 
ATOM   76   C C5    . DA  A 1 4   ? 89.405  30.868 7.137   1.00 51.68  ? 4    DA  T C5    1 
ATOM   77   C C6    . DA  A 1 4   ? 89.650  29.990 8.200   1.00 49.28  ? 4    DA  T C6    1 
ATOM   78   N N6    . DA  A 1 4   ? 88.692  29.414 8.920   1.00 48.40  ? 4    DA  T N6    1 
ATOM   79   N N1    . DA  A 1 4   ? 90.936  29.718 8.503   1.00 48.18  ? 4    DA  T N1    1 
ATOM   80   C C2    . DA  A 1 4   ? 91.898  30.287 7.779   1.00 46.50  ? 4    DA  T C2    1 
ATOM   81   N N3    . DA  A 1 4   ? 91.798  31.120 6.758   1.00 49.04  ? 4    DA  T N3    1 
ATOM   82   C C4    . DA  A 1 4   ? 90.513  31.379 6.485   1.00 51.59  ? 4    DA  T C4    1 
ATOM   83   P P     . DG  A 1 5   ? 91.727  36.238 1.388   1.00 57.87  ? 5    DG  T P     1 
ATOM   84   O OP1   . DG  A 1 5   ? 93.094  36.397 0.814   1.00 58.64  ? 5    DG  T OP1   1 
ATOM   85   O OP2   . DG  A 1 5   ? 91.148  37.312 2.233   1.00 55.80  ? 5    DG  T OP2   1 
ATOM   86   O "O5'" . DG  A 1 5   ? 90.691  35.917 0.226   1.00 52.52  ? 5    DG  T "O5'" 1 
ATOM   87   C "C5'" . DG  A 1 5   ? 90.996  36.167 -1.138  1.00 54.13  ? 5    DG  T "C5'" 1 
ATOM   88   C "C4'" . DG  A 1 5   ? 90.246  35.196 -2.018  1.00 52.78  ? 5    DG  T "C4'" 1 
ATOM   89   O "O4'" . DG  A 1 5   ? 90.213  35.760 -3.351  1.00 53.35  ? 5    DG  T "O4'" 1 
ATOM   90   C "C3'" . DG  A 1 5   ? 90.981  33.866 -2.147  1.00 51.68  ? 5    DG  T "C3'" 1 
ATOM   91   O "O3'" . DG  A 1 5   ? 90.139  32.744 -2.413  1.00 48.16  ? 5    DG  T "O3'" 1 
ATOM   92   C "C2'" . DG  A 1 5   ? 91.884  34.104 -3.332  1.00 55.35  ? 5    DG  T "C2'" 1 
ATOM   93   C "C1'" . DG  A 1 5   ? 91.053  35.021 -4.216  1.00 53.32  ? 5    DG  T "C1'" 1 
ATOM   94   N N9    . DG  A 1 5   ? 91.910  35.953 -4.945  1.00 52.08  ? 5    DG  T N9    1 
ATOM   95   C C8    . DG  A 1 5   ? 92.864  36.796 -4.433  1.00 47.86  ? 5    DG  T C8    1 
ATOM   96   N N7    . DG  A 1 5   ? 93.588  37.362 -5.358  1.00 49.63  ? 5    DG  T N7    1 
ATOM   97   C C5    . DG  A 1 5   ? 93.046  36.892 -6.547  1.00 49.31  ? 5    DG  T C5    1 
ATOM   98   C C6    . DG  A 1 5   ? 93.422  37.130 -7.894  1.00 49.26  ? 5    DG  T C6    1 
ATOM   99   O O6    . DG  A 1 5   ? 94.345  37.831 -8.330  1.00 52.78  ? 5    DG  T O6    1 
ATOM   100  N N1    . DG  A 1 5   ? 92.595  36.448 -8.781  1.00 49.12  ? 5    DG  T N1    1 
ATOM   101  C C2    . DG  A 1 5   ? 91.545  35.649 -8.423  1.00 47.29  ? 5    DG  T C2    1 
ATOM   102  N N2    . DG  A 1 5   ? 90.843  35.082 -9.417  1.00 47.31  ? 5    DG  T N2    1 
ATOM   103  N N3    . DG  A 1 5   ? 91.198  35.416 -7.179  1.00 50.29  ? 5    DG  T N3    1 
ATOM   104  C C4    . DG  A 1 5   ? 91.986  36.060 -6.302  1.00 49.37  ? 5    DG  T C4    1 
ATOM   105  P P     . DT  A 1 6   ? 90.812  31.352 -2.894  1.00 47.37  ? 6    DT  T P     1 
ATOM   106  O OP1   . DT  A 1 6   ? 89.964  30.236 -2.378  1.00 45.59  ? 6    DT  T OP1   1 
ATOM   107  O OP2   . DT  A 1 6   ? 92.266  31.387 -2.574  1.00 41.91  ? 6    DT  T OP2   1 
ATOM   108  O "O5'" . DT  A 1 6   ? 90.679  31.373 -4.488  1.00 47.05  ? 6    DT  T "O5'" 1 
ATOM   109  C "C5'" . DT  A 1 6   ? 89.396  31.530 -5.106  1.00 46.21  ? 6    DT  T "C5'" 1 
ATOM   110  C "C4'" . DT  A 1 6   ? 89.323  30.776 -6.416  1.00 45.71  ? 6    DT  T "C4'" 1 
ATOM   111  O "O4'" . DT  A 1 6   ? 89.979  31.559 -7.454  1.00 45.46  ? 6    DT  T "O4'" 1 
ATOM   112  C "C3'" . DT  A 1 6   ? 90.103  29.467 -6.351  1.00 44.71  ? 6    DT  T "C3'" 1 
ATOM   113  O "O3'" . DT  A 1 6   ? 89.567  28.421 -7.139  1.00 45.34  ? 6    DT  T "O3'" 1 
ATOM   114  C "C2'" . DT  A 1 6   ? 91.480  29.857 -6.837  1.00 46.86  ? 6    DT  T "C2'" 1 
ATOM   115  C "C1'" . DT  A 1 6   ? 91.180  30.937 -7.875  1.00 42.90  ? 6    DT  T "C1'" 1 
ATOM   116  N N1    . DT  A 1 6   ? 92.261  31.945 -7.910  1.00 40.75  ? 6    DT  T N1    1 
ATOM   117  C C2    . DT  A 1 6   ? 92.858  32.255 -9.120  1.00 41.10  ? 6    DT  T C2    1 
ATOM   118  O O2    . DT  A 1 6   ? 92.449  31.842 -10.183 1.00 44.07  ? 6    DT  T O2    1 
ATOM   119  N N3    . DT  A 1 6   ? 93.973  33.064 -9.023  1.00 36.77  ? 6    DT  T N3    1 
ATOM   120  C C4    . DT  A 1 6   ? 94.524  33.580 -7.859  1.00 39.05  ? 6    DT  T C4    1 
ATOM   121  O O4    . DT  A 1 6   ? 95.537  34.266 -7.902  1.00 38.29  ? 6    DT  T O4    1 
ATOM   122  C C5    . DT  A 1 6   ? 93.826  33.253 -6.643  1.00 40.89  ? 6    DT  T C5    1 
ATOM   123  C C7    . DT  A 1 6   ? 94.370  33.763 -5.346  1.00 42.16  ? 6    DT  T C7    1 
ATOM   124  C C6    . DT  A 1 6   ? 92.724  32.487 -6.728  1.00 41.39  ? 6    DT  T C6    1 
ATOM   125  P P     . DG  A 1 7   ? 90.303  26.992 -7.137  1.00 43.89  ? 7    DG  T P     1 
ATOM   126  O OP1   . DG  A 1 7   ? 89.260  25.956 -7.004  1.00 41.31  ? 7    DG  T OP1   1 
ATOM   127  O OP2   . DG  A 1 7   ? 91.394  27.068 -6.144  1.00 37.77  ? 7    DG  T OP2   1 
ATOM   128  O "O5'" . DG  A 1 7   ? 90.914  26.887 -8.610  1.00 43.76  ? 7    DG  T "O5'" 1 
ATOM   129  C "C5'" . DG  A 1 7   ? 90.041  26.857 -9.734  1.00 42.26  ? 7    DG  T "C5'" 1 
ATOM   130  C "C4'" . DG  A 1 7   ? 90.795  26.603 -11.020 1.00 44.30  ? 7    DG  T "C4'" 1 
ATOM   131  O "O4'" . DG  A 1 7   ? 91.751  27.673 -11.239 1.00 45.05  ? 7    DG  T "O4'" 1 
ATOM   132  C "C3'" . DG  A 1 7   ? 91.634  25.325 -11.016 1.00 44.97  ? 7    DG  T "C3'" 1 
ATOM   133  O "O3'" . DG  A 1 7   ? 91.693  24.776 -12.337 1.00 47.32  ? 7    DG  T "O3'" 1 
ATOM   134  C "C2'" . DG  A 1 7   ? 92.985  25.797 -10.500 1.00 43.59  ? 7    DG  T "C2'" 1 
ATOM   135  C "C1'" . DG  A 1 7   ? 93.088  27.192 -11.101 1.00 40.70  ? 7    DG  T "C1'" 1 
ATOM   136  N N9    . DG  A 1 7   ? 93.846  28.152 -10.306 1.00 37.96  ? 7    DG  T N9    1 
ATOM   137  C C8    . DG  A 1 7   ? 93.817  28.290 -8.943  1.00 41.83  ? 7    DG  T C8    1 
ATOM   138  N N7    . DG  A 1 7   ? 94.647  29.193 -8.495  1.00 40.40  ? 7    DG  T N7    1 
ATOM   139  C C5    . DG  A 1 7   ? 95.258  29.697 -9.639  1.00 41.75  ? 7    DG  T C5    1 
ATOM   140  C C6    . DG  A 1 7   ? 96.263  30.701 -9.785  1.00 40.55  ? 7    DG  T C6    1 
ATOM   141  O O6    . DG  A 1 7   ? 96.843  31.366 -8.899  1.00 40.44  ? 7    DG  T O6    1 
ATOM   142  N N1    . DG  A 1 7   ? 96.584  30.905 -11.114 1.00 38.94  ? 7    DG  T N1    1 
ATOM   143  C C2    . DG  A 1 7   ? 96.030  30.237 -12.175 1.00 42.62  ? 7    DG  T C2    1 
ATOM   144  N N2    . DG  A 1 7   ? 96.503  30.589 -13.391 1.00 43.36  ? 7    DG  T N2    1 
ATOM   145  N N3    . DG  A 1 7   ? 95.093  29.295 -12.060 1.00 43.41  ? 7    DG  T N3    1 
ATOM   146  C C4    . DG  A 1 7   ? 94.761  29.077 -10.770 1.00 41.84  ? 7    DG  T C4    1 
ATOM   147  P P     . DA  A 1 8   ? 92.821  23.681 -12.713 1.00 51.85  ? 8    DA  T P     1 
ATOM   148  O OP1   . DA  A 1 8   ? 92.185  22.731 -13.654 1.00 48.88  ? 8    DA  T OP1   1 
ATOM   149  O OP2   . DA  A 1 8   ? 93.470  23.173 -11.482 1.00 49.28  ? 8    DA  T OP2   1 
ATOM   150  O "O5'" . DA  A 1 8   ? 93.898  24.520 -13.532 1.00 49.93  ? 8    DA  T "O5'" 1 
ATOM   151  C "C5'" . DA  A 1 8   ? 93.492  25.303 -14.655 1.00 49.51  ? 8    DA  T "C5'" 1 
ATOM   152  C "C4'" . DA  A 1 8   ? 94.679  25.643 -15.526 1.00 49.33  ? 8    DA  T "C4'" 1 
ATOM   153  O "O4'" . DA  A 1 8   ? 95.563  26.532 -14.806 1.00 46.04  ? 8    DA  T "O4'" 1 
ATOM   154  C "C3'" . DA  A 1 8   ? 95.542  24.432 -15.881 1.00 50.80  ? 8    DA  T "C3'" 1 
ATOM   155  O "O3'" . DA  A 1 8   ? 96.152  24.666 -17.162 1.00 55.18  ? 8    DA  T "O3'" 1 
ATOM   156  C "C2'" . DA  A 1 8   ? 96.537  24.380 -14.732 1.00 47.64  ? 8    DA  T "C2'" 1 
ATOM   157  C "C1'" . DA  A 1 8   ? 96.759  25.859 -14.445 1.00 45.99  ? 8    DA  T "C1'" 1 
ATOM   158  N N9    . DA  A 1 8   ? 97.055  26.219 -13.065 1.00 45.20  ? 8    DA  T N9    1 
ATOM   159  C C8    . DA  A 1 8   ? 96.477  25.751 -11.913 1.00 44.98  ? 8    DA  T C8    1 
ATOM   160  N N7    . DA  A 1 8   ? 96.931  26.322 -10.826 1.00 44.67  ? 8    DA  T N7    1 
ATOM   161  C C5    . DA  A 1 8   ? 97.879  27.224 -11.294 1.00 46.02  ? 8    DA  T C5    1 
ATOM   162  C C6    . DA  A 1 8   ? 98.722  28.148 -10.639 1.00 45.33  ? 8    DA  T C6    1 
ATOM   163  N N6    . DA  A 1 8   ? 98.738  28.338 -9.315  1.00 42.09  ? 8    DA  T N6    1 
ATOM   164  N N1    . DA  A 1 8   ? 99.562  28.884 -11.403 1.00 46.36  ? 8    DA  T N1    1 
ATOM   165  C C2    . DA  A 1 8   ? 99.544  28.703 -12.726 1.00 48.13  ? 8    DA  T C2    1 
ATOM   166  N N3    . DA  A 1 8   ? 98.794  27.873 -13.458 1.00 49.09  ? 8    DA  T N3    1 
ATOM   167  C C4    . DA  A 1 8   ? 97.974  27.156 -12.670 1.00 47.69  ? 8    DA  T C4    1 
ATOM   168  P P     . DG  A 1 9   ? 97.283  23.663 -17.724 1.00 54.49  ? 9    DG  T P     1 
ATOM   169  O OP1   . DG  A 1 9   ? 97.101  23.677 -19.190 1.00 54.68  ? 9    DG  T OP1   1 
ATOM   170  O OP2   . DG  A 1 9   ? 97.262  22.367 -16.997 1.00 55.95  ? 9    DG  T OP2   1 
ATOM   171  O "O5'" . DG  A 1 9   ? 98.636  24.420 -17.371 1.00 52.87  ? 9    DG  T "O5'" 1 
ATOM   172  C "C5'" . DG  A 1 9   ? 98.964  25.641 -18.024 1.00 52.56  ? 9    DG  T "C5'" 1 
ATOM   173  C "C4'" . DG  A 1 9   ? 100.454 25.880 -17.983 1.00 52.22  ? 9    DG  T "C4'" 1 
ATOM   174  O "O4'" . DG  A 1 9   ? 100.848 26.333 -16.660 1.00 51.11  ? 9    DG  T "O4'" 1 
ATOM   175  C "C3'" . DG  A 1 9   ? 101.257 24.600 -18.224 1.00 53.66  ? 9    DG  T "C3'" 1 
ATOM   176  O "O3'" . DG  A 1 9   ? 102.523 24.958 -18.805 1.00 60.10  ? 9    DG  T "O3'" 1 
ATOM   177  C "C2'" . DG  A 1 9   ? 101.419 24.043 -16.817 1.00 48.05  ? 9    DG  T "C2'" 1 
ATOM   178  C "C1'" . DG  A 1 9   ? 101.609 25.319 -15.997 1.00 48.36  ? 9    DG  T "C1'" 1 
ATOM   179  N N9    . DG  A 1 9   ? 101.209 25.285 -14.586 1.00 50.42  ? 9    DG  T N9    1 
ATOM   180  C C8    . DG  A 1 9   ? 100.138 24.606 -14.040 1.00 50.00  ? 9    DG  T C8    1 
ATOM   181  N N7    . DG  A 1 9   ? 100.027 24.777 -12.748 1.00 48.60  ? 9    DG  T N7    1 
ATOM   182  C C5    . DG  A 1 9   ? 101.084 25.614 -12.414 1.00 47.25  ? 9    DG  T C5    1 
ATOM   183  C C6    . DG  A 1 9   ? 101.479 26.146 -11.148 1.00 45.19  ? 9    DG  T C6    1 
ATOM   184  O O6    . DG  A 1 9   ? 100.964 25.971 -10.038 1.00 45.41  ? 9    DG  T O6    1 
ATOM   185  N N1    . DG  A 1 9   ? 102.604 26.949 -11.261 1.00 45.86  ? 9    DG  T N1    1 
ATOM   186  C C2    . DG  A 1 9   ? 103.278 27.206 -12.434 1.00 47.09  ? 9    DG  T C2    1 
ATOM   187  N N2    . DG  A 1 9   ? 104.346 28.006 -12.329 1.00 45.16  ? 9    DG  T N2    1 
ATOM   188  N N3    . DG  A 1 9   ? 102.929 26.715 -13.616 1.00 47.10  ? 9    DG  T N3    1 
ATOM   189  C C4    . DG  A 1 9   ? 101.828 25.936 -13.534 1.00 47.67  ? 9    DG  T C4    1 
ATOM   190  P P     . DT  A 1 10  ? 103.427 23.845 -19.545 1.00 63.22  ? 10   DT  T P     1 
ATOM   191  O OP1   . DT  A 1 10  ? 104.085 24.593 -20.641 1.00 67.09  ? 10   DT  T OP1   1 
ATOM   192  O OP2   . DT  A 1 10  ? 102.649 22.622 -19.853 1.00 60.90  ? 10   DT  T OP2   1 
ATOM   193  O "O5'" . DT  A 1 10  ? 104.544 23.474 -18.473 1.00 63.19  ? 10   DT  T "O5'" 1 
ATOM   194  C "C5'" . DT  A 1 10  ? 104.392 23.864 -17.118 1.00 65.29  ? 10   DT  T "C5'" 1 
ATOM   195  C "C4'" . DT  A 1 10  ? 105.717 24.292 -16.542 1.00 64.39  ? 10   DT  T "C4'" 1 
ATOM   196  O "O4'" . DT  A 1 10  ? 105.473 24.766 -15.193 1.00 64.80  ? 10   DT  T "O4'" 1 
ATOM   197  C "C3'" . DT  A 1 10  ? 106.667 23.108 -16.392 1.00 65.29  ? 10   DT  T "C3'" 1 
ATOM   198  O "O3'" . DT  A 1 10  ? 108.026 23.523 -16.532 1.00 65.22  ? 10   DT  T "O3'" 1 
ATOM   199  C "C2'" . DT  A 1 10  ? 106.338 22.574 -15.010 1.00 63.03  ? 10   DT  T "C2'" 1 
ATOM   200  C "C1'" . DT  A 1 10  ? 105.981 23.836 -14.239 1.00 61.41  ? 10   DT  T "C1'" 1 
ATOM   201  N N1    . DT  A 1 10  ? 104.954 23.640 -13.180 1.00 59.29  ? 10   DT  T N1    1 
ATOM   202  C C2    . DT  A 1 10  ? 105.132 24.295 -11.973 1.00 57.73  ? 10   DT  T C2    1 
ATOM   203  O O2    . DT  A 1 10  ? 106.057 25.066 -11.758 1.00 59.33  ? 10   DT  T O2    1 
ATOM   204  N N3    . DT  A 1 10  ? 104.179 24.013 -11.019 1.00 54.74  ? 10   DT  T N3    1 
ATOM   205  C C4    . DT  A 1 10  ? 103.087 23.175 -11.150 1.00 52.16  ? 10   DT  T C4    1 
ATOM   206  O O4    . DT  A 1 10  ? 102.322 23.022 -10.203 1.00 53.69  ? 10   DT  T O4    1 
ATOM   207  C C5    . DT  A 1 10  ? 102.947 22.536 -12.446 1.00 53.13  ? 10   DT  T C5    1 
ATOM   208  C C7    . DT  A 1 10  ? 101.793 21.609 -12.679 1.00 46.20  ? 10   DT  T C7    1 
ATOM   209  C C6    . DT  A 1 10  ? 103.871 22.805 -13.387 1.00 55.18  ? 10   DT  T C6    1 
ATOM   210  P P     . DC  A 1 11  ? 109.199 22.421 -16.590 1.00 66.83  ? 11   DC  T P     1 
ATOM   211  O OP1   . DC  A 1 11  ? 110.175 22.970 -17.565 1.00 67.96  ? 11   DC  T OP1   1 
ATOM   212  O OP2   . DC  A 1 11  ? 108.632 21.064 -16.801 1.00 60.58  ? 11   DC  T OP2   1 
ATOM   213  O "O5'" . DC  A 1 11  ? 109.835 22.518 -15.132 1.00 63.79  ? 11   DC  T "O5'" 1 
ATOM   214  C "C5'" . DC  A 1 11  ? 109.900 23.791 -14.487 1.00 64.55  ? 11   DC  T "C5'" 1 
ATOM   215  C "C4'" . DC  A 1 11  ? 110.649 23.703 -13.181 1.00 64.98  ? 11   DC  T "C4'" 1 
ATOM   216  O "O4'" . DC  A 1 11  ? 109.708 23.593 -12.070 1.00 65.79  ? 11   DC  T "O4'" 1 
ATOM   217  C "C3'" . DC  A 1 11  ? 111.503 22.438 -13.116 1.00 66.17  ? 11   DC  T "C3'" 1 
ATOM   218  O "O3'" . DC  A 1 11  ? 112.694 22.677 -12.373 1.00 65.80  ? 11   DC  T "O3'" 1 
ATOM   219  C "C2'" . DC  A 1 11  ? 110.575 21.423 -12.467 1.00 66.00  ? 11   DC  T "C2'" 1 
ATOM   220  C "C1'" . DC  A 1 11  ? 109.794 22.293 -11.480 1.00 64.79  ? 11   DC  T "C1'" 1 
ATOM   221  N N1    . DC  A 1 11  ? 108.433 21.829 -11.121 1.00 60.77  ? 11   DC  T N1    1 
ATOM   222  C C2    . DC  A 1 11  ? 107.981 21.983 -9.788  1.00 59.80  ? 11   DC  T C2    1 
ATOM   223  O O2    . DC  A 1 11  ? 108.714 22.536 -8.954  1.00 60.19  ? 11   DC  T O2    1 
ATOM   224  N N3    . DC  A 1 11  ? 106.751 21.527 -9.446  1.00 57.36  ? 11   DC  T N3    1 
ATOM   225  C C4    . DC  A 1 11  ? 105.974 20.950 -10.365 1.00 55.87  ? 11   DC  T C4    1 
ATOM   226  N N4    . DC  A 1 11  ? 104.771 20.520 -9.976  1.00 56.32  ? 11   DC  T N4    1 
ATOM   227  C C5    . DC  A 1 11  ? 106.397 20.790 -11.722 1.00 56.34  ? 11   DC  T C5    1 
ATOM   228  C C6    . DC  A 1 11  ? 107.622 21.241 -12.053 1.00 59.49  ? 11   DC  T C6    1 
ATOM   229  P P     . DG  A 1 12  ? 113.636 21.446 -11.958 1.00 67.42  ? 12   DG  T P     1 
ATOM   230  O OP1   . DG  A 1 12  ? 115.035 21.928 -12.077 1.00 68.13  ? 12   DG  T OP1   1 
ATOM   231  O OP2   . DG  A 1 12  ? 113.216 20.206 -12.663 1.00 64.27  ? 12   DG  T OP2   1 
ATOM   232  O "O5'" . DG  A 1 12  ? 113.312 21.295 -10.410 1.00 69.94  ? 12   DG  T "O5'" 1 
ATOM   233  C "C5'" . DG  A 1 12  ? 113.237 22.457 -9.595  1.00 70.51  ? 12   DG  T "C5'" 1 
ATOM   234  C "C4'" . DG  A 1 12  ? 113.197 22.082 -8.133  1.00 68.67  ? 12   DG  T "C4'" 1 
ATOM   235  O "O4'" . DG  A 1 12  ? 111.879 21.572 -7.796  1.00 66.38  ? 12   DG  T "O4'" 1 
ATOM   236  C "C3'" . DG  A 1 12  ? 114.165 20.954 -7.794  1.00 66.55  ? 12   DG  T "C3'" 1 
ATOM   237  O "O3'" . DG  A 1 12  ? 114.624 21.125 -6.454  1.00 67.48  ? 12   DG  T "O3'" 1 
ATOM   238  C "C2'" . DG  A 1 12  ? 113.318 19.703 -7.998  1.00 64.42  ? 12   DG  T "C2'" 1 
ATOM   239  C "C1'" . DG  A 1 12  ? 111.940 20.170 -7.540  1.00 62.77  ? 12   DG  T "C1'" 1 
ATOM   240  N N9    . DG  A 1 12  ? 110.776 19.545 -8.168  1.00 58.28  ? 12   DG  T N9    1 
ATOM   241  C C8    . DG  A 1 12  ? 110.659 19.095 -9.458  1.00 56.12  ? 12   DG  T C8    1 
ATOM   242  N N7    . DG  A 1 12  ? 109.477 18.604 -9.726  1.00 52.29  ? 12   DG  T N7    1 
ATOM   243  C C5    . DG  A 1 12  ? 108.774 18.730 -8.539  1.00 52.14  ? 12   DG  T C5    1 
ATOM   244  C C6    . DG  A 1 12  ? 107.446 18.368 -8.223  1.00 51.88  ? 12   DG  T C6    1 
ATOM   245  O O6    . DG  A 1 12  ? 106.595 17.850 -8.958  1.00 51.99  ? 12   DG  T O6    1 
ATOM   246  N N1    . DG  A 1 12  ? 107.136 18.667 -6.899  1.00 49.90  ? 12   DG  T N1    1 
ATOM   247  C C2    . DG  A 1 12  ? 107.996 19.249 -5.992  1.00 51.95  ? 12   DG  T C2    1 
ATOM   248  N N2    . DG  A 1 12  ? 107.512 19.467 -4.750  1.00 50.47  ? 12   DG  T N2    1 
ATOM   249  N N3    . DG  A 1 12  ? 109.238 19.595 -6.280  1.00 52.81  ? 12   DG  T N3    1 
ATOM   250  C C4    . DG  A 1 12  ? 109.559 19.306 -7.563  1.00 55.03  ? 12   DG  T C4    1 
ATOM   251  P P     . DT  A 1 13  ? 115.769 20.169 -5.868  1.00 68.18  ? 13   DT  T P     1 
ATOM   252  O OP1   . DT  A 1 13  ? 116.831 21.076 -5.387  1.00 70.37  ? 13   DT  T OP1   1 
ATOM   253  O OP2   . DT  A 1 13  ? 116.095 19.087 -6.829  1.00 69.28  ? 13   DT  T OP2   1 
ATOM   254  O "O5'" . DT  A 1 13  ? 115.063 19.481 -4.624  1.00 67.97  ? 13   DT  T "O5'" 1 
ATOM   255  C "C5'" . DT  A 1 13  ? 113.682 19.141 -4.692  1.00 67.41  ? 13   DT  T "C5'" 1 
ATOM   256  C "C4'" . DT  A 1 13  ? 113.215 18.569 -3.377  1.00 66.01  ? 13   DT  T "C4'" 1 
ATOM   257  O "O4'" . DT  A 1 13  ? 111.842 18.161 -3.566  1.00 64.30  ? 13   DT  T "O4'" 1 
ATOM   258  C "C3'" . DT  A 1 13  ? 113.968 17.299 -2.999  1.00 66.65  ? 13   DT  T "C3'" 1 
ATOM   259  O "O3'" . DT  A 1 13  ? 114.016 17.130 -1.578  1.00 68.32  ? 13   DT  T "O3'" 1 
ATOM   260  C "C2'" . DT  A 1 13  ? 113.166 16.216 -3.693  1.00 66.43  ? 13   DT  T "C2'" 1 
ATOM   261  C "C1'" . DT  A 1 13  ? 111.742 16.749 -3.630  1.00 62.46  ? 13   DT  T "C1'" 1 
ATOM   262  N N1    . DT  A 1 13  ? 110.932 16.409 -4.817  1.00 59.36  ? 13   DT  T N1    1 
ATOM   263  C C2    . DT  A 1 13  ? 109.575 16.210 -4.652  1.00 58.85  ? 13   DT  T C2    1 
ATOM   264  O O2    . DT  A 1 13  ? 109.002 16.337 -3.584  1.00 58.13  ? 13   DT  T O2    1 
ATOM   265  N N3    . DT  A 1 13  ? 108.907 15.858 -5.795  1.00 53.13  ? 13   DT  T N3    1 
ATOM   266  C C4    . DT  A 1 13  ? 109.436 15.697 -7.053  1.00 53.43  ? 13   DT  T C4    1 
ATOM   267  O O4    . DT  A 1 13  ? 108.706 15.371 -7.987  1.00 55.06  ? 13   DT  T O4    1 
ATOM   268  C C5    . DT  A 1 13  ? 110.855 15.933 -7.162  1.00 54.73  ? 13   DT  T C5    1 
ATOM   269  C C7    . DT  A 1 13  ? 111.507 15.772 -8.498  1.00 51.09  ? 13   DT  T C7    1 
ATOM   270  C C6    . DT  A 1 13  ? 111.527 16.278 -6.054  1.00 55.65  ? 13   DT  T C6    1 
ATOM   271  P P     . DA  A 1 14  ? 115.127 16.160 -0.923  1.00 67.60  ? 14   DA  T P     1 
ATOM   272  O OP1   . DA  A 1 14  ? 116.062 17.026 -0.169  1.00 68.69  ? 14   DA  T OP1   1 
ATOM   273  O OP2   . DA  A 1 14  ? 115.659 15.251 -1.971  1.00 69.17  ? 14   DA  T OP2   1 
ATOM   274  O "O5'" . DA  A 1 14  ? 114.276 15.305 0.119   1.00 67.13  ? 14   DA  T "O5'" 1 
ATOM   275  C "C5'" . DA  A 1 14  ? 113.495 15.978 1.096   1.00 63.78  ? 14   DA  T "C5'" 1 
ATOM   276  C "C4'" . DA  A 1 14  ? 112.287 15.169 1.509   1.00 61.73  ? 14   DA  T "C4'" 1 
ATOM   277  O "O4'" . DA  A 1 14  ? 111.452 14.868 0.360   1.00 61.96  ? 14   DA  T "O4'" 1 
ATOM   278  C "C3'" . DA  A 1 14  ? 112.626 13.805 2.106   1.00 59.93  ? 14   DA  T "C3'" 1 
ATOM   279  O "O3'" . DA  A 1 14  ? 111.612 13.479 3.064   1.00 61.92  ? 14   DA  T "O3'" 1 
ATOM   280  C "C2'" . DA  A 1 14  ? 112.615 12.883 0.896   1.00 58.04  ? 14   DA  T "C2'" 1 
ATOM   281  C "C1'" . DA  A 1 14  ? 111.472 13.465 0.083   1.00 58.56  ? 14   DA  T "C1'" 1 
ATOM   282  N N9    . DA  A 1 14  ? 111.487 13.268 -1.371  1.00 58.19  ? 14   DA  T N9    1 
ATOM   283  C C8    . DA  A 1 14  ? 112.562 13.296 -2.220  1.00 57.96  ? 14   DA  T C8    1 
ATOM   284  N N7    . DA  A 1 14  ? 112.247 13.097 -3.484  1.00 58.30  ? 14   DA  T N7    1 
ATOM   285  C C5    . DA  A 1 14  ? 110.869 12.924 -3.464  1.00 58.14  ? 14   DA  T C5    1 
ATOM   286  C C6    . DA  A 1 14  ? 109.916 12.678 -4.491  1.00 55.10  ? 14   DA  T C6    1 
ATOM   287  N N6    . DA  A 1 14  ? 110.218 12.577 -5.787  1.00 49.82  ? 14   DA  T N6    1 
ATOM   288  N N1    . DA  A 1 14  ? 108.625 12.543 -4.129  1.00 54.16  ? 14   DA  T N1    1 
ATOM   289  C C2    . DA  A 1 14  ? 108.312 12.659 -2.836  1.00 57.72  ? 14   DA  T C2    1 
ATOM   290  N N3    . DA  A 1 14  ? 109.107 12.900 -1.783  1.00 59.20  ? 14   DA  T N3    1 
ATOM   291  C C4    . DA  A 1 14  ? 110.388 13.020 -2.168  1.00 58.21  ? 14   DA  T C4    1 
ATOM   292  P P     . DT  A 1 15  ? 111.631 12.059 3.804   1.00 63.09  ? 15   DT  T P     1 
ATOM   293  O OP1   . DT  A 1 15  ? 111.553 12.299 5.268   1.00 59.26  ? 15   DT  T OP1   1 
ATOM   294  O OP2   . DT  A 1 15  ? 112.756 11.270 3.241   1.00 64.38  ? 15   DT  T OP2   1 
ATOM   295  O "O5'" . DT  A 1 15  ? 110.274 11.380 3.326   1.00 59.32  ? 15   DT  T "O5'" 1 
ATOM   296  C "C5'" . DT  A 1 15  ? 109.994 11.273 1.947   1.00 57.72  ? 15   DT  T "C5'" 1 
ATOM   297  C "C4'" . DT  A 1 15  ? 108.697 10.541 1.723   1.00 55.98  ? 15   DT  T "C4'" 1 
ATOM   298  O "O4'" . DT  A 1 15  ? 108.519 10.491 0.291   1.00 57.53  ? 15   DT  T "O4'" 1 
ATOM   299  C "C3'" . DT  A 1 15  ? 108.720 9.083  2.178   1.00 56.27  ? 15   DT  T "C3'" 1 
ATOM   300  O "O3'" . DT  A 1 15  ? 107.395 8.642  2.503   1.00 55.33  ? 15   DT  T "O3'" 1 
ATOM   301  C "C2'" . DT  A 1 15  ? 109.279 8.364  0.964   1.00 57.32  ? 15   DT  T "C2'" 1 
ATOM   302  C "C1'" . DT  A 1 15  ? 108.731 9.176  -0.197  1.00 58.21  ? 15   DT  T "C1'" 1 
ATOM   303  N N1    . DT  A 1 15  ? 109.622 9.284  -1.363  1.00 59.67  ? 15   DT  T N1    1 
ATOM   304  C C2    . DT  A 1 15  ? 109.041 9.220  -2.602  1.00 59.99  ? 15   DT  T C2    1 
ATOM   305  O O2    . DT  A 1 15  ? 107.849 9.057  -2.760  1.00 62.76  ? 15   DT  T O2    1 
ATOM   306  N N3    . DT  A 1 15  ? 109.910 9.353  -3.656  1.00 60.30  ? 15   DT  T N3    1 
ATOM   307  C C4    . DT  A 1 15  ? 111.279 9.531  -3.592  1.00 59.31  ? 15   DT  T C4    1 
ATOM   308  O O4    . DT  A 1 15  ? 111.930 9.635  -4.631  1.00 58.77  ? 15   DT  T O4    1 
ATOM   309  C C5    . DT  A 1 15  ? 111.830 9.579  -2.254  1.00 57.53  ? 15   DT  T C5    1 
ATOM   310  C C7    . DT  A 1 15  ? 113.305 9.764  -2.084  1.00 57.26  ? 15   DT  T C7    1 
ATOM   311  C C6    . DT  A 1 15  ? 110.984 9.454  -1.218  1.00 58.29  ? 15   DT  T C6    1 
ATOM   312  P P     . DT  A 1 16  ? 107.172 7.253  3.293   1.00 53.51  ? 16   DT  T P     1 
ATOM   313  O OP1   . DT  A 1 16  ? 105.891 7.414  4.020   1.00 56.45  ? 16   DT  T OP1   1 
ATOM   314  O OP2   . DT  A 1 16  ? 108.401 6.926  4.051   1.00 60.15  ? 16   DT  T OP2   1 
ATOM   315  O "O5'" . DT  A 1 16  ? 106.961 6.166  2.140   1.00 48.55  ? 16   DT  T "O5'" 1 
ATOM   316  C "C5'" . DT  A 1 16  ? 105.738 6.149  1.422   1.00 47.17  ? 16   DT  T "C5'" 1 
ATOM   317  C "C4'" . DT  A 1 16  ? 105.697 5.056  0.378   1.00 47.57  ? 16   DT  T "C4'" 1 
ATOM   318  O "O4'" . DT  A 1 16  ? 106.600 5.344  -0.727  1.00 46.57  ? 16   DT  T "O4'" 1 
ATOM   319  C "C3'" . DT  A 1 16  ? 106.158 3.701  0.918   1.00 47.90  ? 16   DT  T "C3'" 1 
ATOM   320  O "O3'" . DT  A 1 16  ? 105.500 2.682  0.188   1.00 47.42  ? 16   DT  T "O3'" 1 
ATOM   321  C "C2'" . DT  A 1 16  ? 107.646 3.690  0.617   1.00 45.54  ? 16   DT  T "C2'" 1 
ATOM   322  C "C1'" . DT  A 1 16  ? 107.645 4.374  -0.742  1.00 46.67  ? 16   DT  T "C1'" 1 
ATOM   323  N N1    . DT  A 1 16  ? 108.887 4.999  -1.235  1.00 42.86  ? 16   DT  T N1    1 
ATOM   324  C C2    . DT  A 1 16  ? 109.008 5.157  -2.598  1.00 38.35  ? 16   DT  T C2    1 
ATOM   325  O O2    . DT  A 1 16  ? 108.134 4.860  -3.379  1.00 40.21  ? 16   DT  T O2    1 
ATOM   326  N N3    . DT  A 1 16  ? 110.201 5.677  -3.011  1.00 38.00  ? 16   DT  T N3    1 
ATOM   327  C C4    . DT  A 1 16  ? 111.255 6.052  -2.219  1.00 39.66  ? 16   DT  T C4    1 
ATOM   328  O O4    . DT  A 1 16  ? 112.265 6.489  -2.739  1.00 42.91  ? 16   DT  T O4    1 
ATOM   329  C C5    . DT  A 1 16  ? 111.056 5.885  -0.798  1.00 39.08  ? 16   DT  T C5    1 
ATOM   330  C C7    . DT  A 1 16  ? 112.158 6.268  0.140   1.00 42.95  ? 16   DT  T C7    1 
ATOM   331  C C6    . DT  A 1 16  ? 109.893 5.381  -0.381  1.00 42.88  ? 16   DT  T C6    1 
ATOM   332  P P     . DA  A 1 17  ? 104.885 1.426  0.964   1.00 54.59  ? 17   DA  T P     1 
ATOM   333  O OP1   . DA  A 1 17  ? 103.685 1.872  1.714   1.00 59.20  ? 17   DA  T OP1   1 
ATOM   334  O OP2   . DA  A 1 17  ? 105.995 0.786  1.700   1.00 57.19  ? 17   DA  T OP2   1 
ATOM   335  O "O5'" . DA  A 1 17  ? 104.398 0.479  -0.225  1.00 53.57  ? 17   DA  T "O5'" 1 
ATOM   336  C "C5'" . DA  A 1 17  ? 103.326 0.875  -1.088  1.00 47.80  ? 17   DA  T "C5'" 1 
ATOM   337  C "C4'" . DA  A 1 17  ? 103.402 0.156  -2.417  1.00 46.69  ? 17   DA  T "C4'" 1 
ATOM   338  O "O4'" . DA  A 1 17  ? 104.581 0.586  -3.128  1.00 44.39  ? 17   DA  T "O4'" 1 
ATOM   339  C "C3'" . DA  A 1 17  ? 103.534 -1.365 -2.330  1.00 47.66  ? 17   DA  T "C3'" 1 
ATOM   340  O "O3'" . DA  A 1 17  ? 103.190 -1.871 -3.616  1.00 48.26  ? 17   DA  T "O3'" 1 
ATOM   341  C "C2'" . DA  A 1 17  ? 105.038 -1.568 -2.237  1.00 46.82  ? 17   DA  T "C2'" 1 
ATOM   342  C "C1'" . DA  A 1 17  ? 105.554 -0.465 -3.154  1.00 45.65  ? 17   DA  T "C1'" 1 
ATOM   343  N N9    . DA  A 1 17  ? 106.854 0.117  -2.801  1.00 40.06  ? 17   DA  T N9    1 
ATOM   344  C C8    . DA  A 1 17  ? 107.421 0.271  -1.568  1.00 35.54  ? 17   DA  T C8    1 
ATOM   345  N N7    . DA  A 1 17  ? 108.582 0.893  -1.598  1.00 41.10  ? 17   DA  T N7    1 
ATOM   346  C C5    . DA  A 1 17  ? 108.793 1.154  -2.949  1.00 35.73  ? 17   DA  T C5    1 
ATOM   347  C C6    . DA  A 1 17  ? 109.841 1.808  -3.653  1.00 39.58  ? 17   DA  T C6    1 
ATOM   348  N N6    . DA  A 1 17  ? 110.919 2.351  -3.070  1.00 33.48  ? 17   DA  T N6    1 
ATOM   349  N N1    . DA  A 1 17  ? 109.739 1.890  -5.005  1.00 41.84  ? 17   DA  T N1    1 
ATOM   350  C C2    . DA  A 1 17  ? 108.661 1.348  -5.596  1.00 41.71  ? 17   DA  T C2    1 
ATOM   351  N N3    . DA  A 1 17  ? 107.616 0.719  -5.040  1.00 40.16  ? 17   DA  T N3    1 
ATOM   352  C C4    . DA  A 1 17  ? 107.745 0.664  -3.700  1.00 36.57  ? 17   DA  T C4    1 
ATOM   353  P P     . DT  B 2 1   ? 118.001 2.429  -8.959  1.00 90.06  ? 101  DT  N P     1 
ATOM   354  O OP1   . DT  B 2 1   ? 119.084 1.767  -9.808  1.00 91.73  ? 101  DT  N OP1   1 
ATOM   355  O OP2   . DT  B 2 1   ? 118.264 3.912  -8.703  1.00 90.30  ? 101  DT  N OP2   1 
ATOM   356  O "O5'" . DT  B 2 1   ? 116.602 2.329  -9.801  1.00 83.86  ? 101  DT  N "O5'" 1 
ATOM   357  C "C5'" . DT  B 2 1   ? 116.510 1.510  -10.983 1.00 73.80  ? 101  DT  N "C5'" 1 
ATOM   358  C "C4'" . DT  B 2 1   ? 115.069 1.304  -11.398 1.00 66.30  ? 101  DT  N "C4'" 1 
ATOM   359  O "O4'" . DT  B 2 1   ? 114.213 1.187  -10.230 1.00 64.27  ? 101  DT  N "O4'" 1 
ATOM   360  C "C3'" . DT  B 2 1   ? 114.509 2.497  -12.167 1.00 63.15  ? 101  DT  N "C3'" 1 
ATOM   361  O "O3'" . DT  B 2 1   ? 113.496 2.033  -13.057 1.00 59.53  ? 101  DT  N "O3'" 1 
ATOM   362  C "C2'" . DT  B 2 1   ? 113.932 3.377  -11.071 1.00 60.39  ? 101  DT  N "C2'" 1 
ATOM   363  C "C1'" . DT  B 2 1   ? 113.368 2.335  -10.120 1.00 58.57  ? 101  DT  N "C1'" 1 
ATOM   364  N N1    . DT  B 2 1   ? 113.271 2.711  -8.696  1.00 54.76  ? 101  DT  N N1    1 
ATOM   365  C C2    . DT  B 2 1   ? 112.138 2.334  -7.995  1.00 53.21  ? 101  DT  N C2    1 
ATOM   366  O O2    . DT  B 2 1   ? 111.189 1.756  -8.506  1.00 48.37  ? 101  DT  N O2    1 
ATOM   367  N N3    . DT  B 2 1   ? 112.158 2.659  -6.663  1.00 54.05  ? 101  DT  N N3    1 
ATOM   368  C C4    . DT  B 2 1   ? 113.166 3.317  -5.980  1.00 54.63  ? 101  DT  N C4    1 
ATOM   369  O O4    . DT  B 2 1   ? 113.047 3.528  -4.772  1.00 58.07  ? 101  DT  N O4    1 
ATOM   370  C C5    . DT  B 2 1   ? 114.308 3.705  -6.785  1.00 52.78  ? 101  DT  N C5    1 
ATOM   371  C C7    . DT  B 2 1   ? 115.446 4.427  -6.138  1.00 51.76  ? 101  DT  N C7    1 
ATOM   372  C C6    . DT  B 2 1   ? 114.297 3.392  -8.082  1.00 52.31  ? 101  DT  N C6    1 
ATOM   373  P P     . DA  B 2 2   ? 112.778 3.060  -14.052 1.00 61.49  ? 102  DA  N P     1 
ATOM   374  O OP1   . DA  B 2 2   ? 112.147 2.221  -15.104 1.00 59.15  ? 102  DA  N OP1   1 
ATOM   375  O OP2   . DA  B 2 2   ? 113.755 4.111  -14.436 1.00 59.12  ? 102  DA  N OP2   1 
ATOM   376  O "O5'" . DA  B 2 2   ? 111.629 3.733  -13.162 1.00 58.16  ? 102  DA  N "O5'" 1 
ATOM   377  C "C5'" . DA  B 2 2   ? 110.436 3.013  -12.840 1.00 53.27  ? 102  DA  N "C5'" 1 
ATOM   378  C "C4'" . DA  B 2 2   ? 109.371 3.934  -12.282 1.00 54.00  ? 102  DA  N "C4'" 1 
ATOM   379  O "O4'" . DA  B 2 2   ? 109.686 4.306  -10.913 1.00 53.12  ? 102  DA  N "O4'" 1 
ATOM   380  C "C3'" . DA  B 2 2   ? 109.312 5.265  -13.052 1.00 53.00  ? 102  DA  N "C3'" 1 
ATOM   381  O "O3'" . DA  B 2 2   ? 108.013 5.850  -12.923 1.00 53.05  ? 102  DA  N "O3'" 1 
ATOM   382  C "C2'" . DA  B 2 2   ? 110.289 6.140  -12.289 1.00 53.51  ? 102  DA  N "C2'" 1 
ATOM   383  C "C1'" . DA  B 2 2   ? 109.974 5.696  -10.871 1.00 52.48  ? 102  DA  N "C1'" 1 
ATOM   384  N N9    . DA  B 2 2   ? 110.932 5.974  -9.806  1.00 48.89  ? 102  DA  N N9    1 
ATOM   385  C C8    . DA  B 2 2   ? 112.208 6.460  -9.892  1.00 49.34  ? 102  DA  N C8    1 
ATOM   386  N N7    . DA  B 2 2   ? 112.774 6.665  -8.725  1.00 49.44  ? 102  DA  N N7    1 
ATOM   387  C C5    . DA  B 2 2   ? 111.805 6.272  -7.814  1.00 49.02  ? 102  DA  N C5    1 
ATOM   388  C C6    . DA  B 2 2   ? 111.781 6.247  -6.418  1.00 48.33  ? 102  DA  N C6    1 
ATOM   389  N N6    . DA  B 2 2   ? 112.803 6.634  -5.651  1.00 51.76  ? 102  DA  N N6    1 
ATOM   390  N N1    . DA  B 2 2   ? 110.655 5.803  -5.819  1.00 50.06  ? 102  DA  N N1    1 
ATOM   391  C C2    . DA  B 2 2   ? 109.632 5.411  -6.584  1.00 46.93  ? 102  DA  N C2    1 
ATOM   392  N N3    . DA  B 2 2   ? 109.537 5.389  -7.901  1.00 48.67  ? 102  DA  N N3    1 
ATOM   393  C C4    . DA  B 2 2   ? 110.671 5.838  -8.465  1.00 48.54  ? 102  DA  N C4    1 
ATOM   394  P P     . DA  B 2 3   ? 106.836 5.418  -13.926 1.00 53.22  ? 103  DA  N P     1 
ATOM   395  O OP1   . DA  B 2 3   ? 107.227 4.234  -14.727 1.00 55.14  ? 103  DA  N OP1   1 
ATOM   396  O OP2   . DA  B 2 3   ? 106.380 6.655  -14.601 1.00 52.78  ? 103  DA  N OP2   1 
ATOM   397  O "O5'" . DA  B 2 3   ? 105.700 4.910  -12.952 1.00 51.66  ? 103  DA  N "O5'" 1 
ATOM   398  C "C5'" . DA  B 2 3   ? 104.796 5.831  -12.410 1.00 53.21  ? 103  DA  N "C5'" 1 
ATOM   399  C "C4'" . DA  B 2 3   ? 104.466 5.470  -10.985 1.00 51.43  ? 103  DA  N "C4'" 1 
ATOM   400  O "O4'" . DA  B 2 3   ? 105.622 5.680  -10.126 1.00 47.37  ? 103  DA  N "O4'" 1 
ATOM   401  C "C3'" . DA  B 2 3   ? 103.423 6.454  -10.489 1.00 51.38  ? 103  DA  N "C3'" 1 
ATOM   402  O "O3'" . DA  B 2 3   ? 102.607 5.815  -9.521  1.00 51.65  ? 103  DA  N "O3'" 1 
ATOM   403  C "C2'" . DA  B 2 3   ? 104.257 7.586  -9.918  1.00 50.05  ? 103  DA  N "C2'" 1 
ATOM   404  C "C1'" . DA  B 2 3   ? 105.408 6.821  -9.301  1.00 46.12  ? 103  DA  N "C1'" 1 
ATOM   405  N N9    . DA  B 2 3   ? 106.663 7.560  -9.189  1.00 42.72  ? 103  DA  N N9    1 
ATOM   406  C C8    . DA  B 2 3   ? 107.496 8.023  -10.179 1.00 43.80  ? 103  DA  N C8    1 
ATOM   407  N N7    . DA  B 2 3   ? 108.588 8.600  -9.726  1.00 40.19  ? 103  DA  N N7    1 
ATOM   408  C C5    . DA  B 2 3   ? 108.455 8.520  -8.347  1.00 40.28  ? 103  DA  N C5    1 
ATOM   409  C C6    . DA  B 2 3   ? 109.282 8.937  -7.289  1.00 39.65  ? 103  DA  N C6    1 
ATOM   410  N N6    . DA  B 2 3   ? 110.471 9.535  -7.457  1.00 42.37  ? 103  DA  N N6    1 
ATOM   411  N N1    . DA  B 2 3   ? 108.843 8.717  -6.029  1.00 39.85  ? 103  DA  N N1    1 
ATOM   412  C C2    . DA  B 2 3   ? 107.660 8.112  -5.854  1.00 41.39  ? 103  DA  N C2    1 
ATOM   413  N N3    . DA  B 2 3   ? 106.805 7.665  -6.765  1.00 42.26  ? 103  DA  N N3    1 
ATOM   414  C C4    . DA  B 2 3   ? 107.265 7.903  -8.004  1.00 40.53  ? 103  DA  N C4    1 
ATOM   415  P P     . DT  B 2 4   ? 101.060 6.201  -9.443  1.00 54.66  ? 104  DT  N P     1 
ATOM   416  O OP1   . DT  B 2 4   ? 100.338 5.057  -8.824  1.00 52.47  ? 104  DT  N OP1   1 
ATOM   417  O OP2   . DT  B 2 4   ? 100.662 6.708  -10.783 1.00 51.68  ? 104  DT  N OP2   1 
ATOM   418  O "O5'" . DT  B 2 4   ? 101.060 7.425  -8.442  1.00 52.12  ? 104  DT  N "O5'" 1 
ATOM   419  C "C5'" . DT  B 2 4   ? 102.218 7.724  -7.697  1.00 49.32  ? 104  DT  N "C5'" 1 
ATOM   420  C "C4'" . DT  B 2 4   ? 101.826 8.286  -6.359  1.00 47.18  ? 104  DT  N "C4'" 1 
ATOM   421  O "O4'" . DT  B 2 4   ? 103.056 8.746  -5.749  1.00 48.59  ? 104  DT  N "O4'" 1 
ATOM   422  C "C3'" . DT  B 2 4   ? 100.953 9.526  -6.528  1.00 45.01  ? 104  DT  N "C3'" 1 
ATOM   423  O "O3'" . DT  B 2 4   ? 99.972  9.664  -5.491  1.00 48.55  ? 104  DT  N "O3'" 1 
ATOM   424  C "C2'" . DT  B 2 4   ? 101.963 10.649 -6.619  1.00 45.90  ? 104  DT  N "C2'" 1 
ATOM   425  C "C1'" . DT  B 2 4   ? 103.112 10.163 -5.748  1.00 45.47  ? 104  DT  N "C1'" 1 
ATOM   426  N N1    . DT  B 2 4   ? 104.426 10.567 -6.278  1.00 42.72  ? 104  DT  N N1    1 
ATOM   427  C C2    . DT  B 2 4   ? 105.419 10.927 -5.392  1.00 43.98  ? 104  DT  N C2    1 
ATOM   428  O O2    . DT  B 2 4   ? 105.296 10.846 -4.174  1.00 47.94  ? 104  DT  N O2    1 
ATOM   429  N N3    . DT  B 2 4   ? 106.574 11.388 -5.980  1.00 42.64  ? 104  DT  N N3    1 
ATOM   430  C C4    . DT  B 2 4   ? 106.832 11.507 -7.329  1.00 41.89  ? 104  DT  N C4    1 
ATOM   431  O O4    . DT  B 2 4   ? 107.921 11.952 -7.701  1.00 45.92  ? 104  DT  N O4    1 
ATOM   432  C C5    . DT  B 2 4   ? 105.743 11.082 -8.206  1.00 39.99  ? 104  DT  N C5    1 
ATOM   433  C C7    . DT  B 2 4   ? 105.901 11.188 -9.691  1.00 32.51  ? 104  DT  N C7    1 
ATOM   434  C C6    . DT  B 2 4   ? 104.623 10.625 -7.637  1.00 40.28  ? 104  DT  N C6    1 
ATOM   435  P P     . DA  B 2 5   ? 98.807  10.788 -5.624  1.00 46.99  ? 105  DA  N P     1 
ATOM   436  O OP1   . DA  B 2 5   ? 97.558  10.186 -5.085  1.00 46.57  ? 105  DA  N OP1   1 
ATOM   437  O OP2   . DA  B 2 5   ? 98.807  11.375 -6.987  1.00 43.46  ? 105  DA  N OP2   1 
ATOM   438  O "O5'" . DA  B 2 5   ? 99.322  11.884 -4.607  1.00 38.25  ? 105  DA  N "O5'" 1 
ATOM   439  C "C5'" . DA  B 2 5   ? 99.732  11.476 -3.326  1.00 31.91  ? 105  DA  N "C5'" 1 
ATOM   440  C "C4'" . DA  B 2 5   ? 100.263 12.646 -2.532  1.00 39.45  ? 105  DA  N "C4'" 1 
ATOM   441  O "O4'" . DA  B 2 5   ? 101.547 13.080 -3.079  1.00 39.19  ? 105  DA  N "O4'" 1 
ATOM   442  C "C3'" . DA  B 2 5   ? 99.357  13.883 -2.590  1.00 38.83  ? 105  DA  N "C3'" 1 
ATOM   443  O "O3'" . DA  B 2 5   ? 99.417  14.562 -1.323  1.00 40.17  ? 105  DA  N "O3'" 1 
ATOM   444  C "C2'" . DA  B 2 5   ? 99.914  14.669 -3.775  1.00 40.33  ? 105  DA  N "C2'" 1 
ATOM   445  C "C1'" . DA  B 2 5   ? 101.424 14.380 -3.666  1.00 43.01  ? 105  DA  N "C1'" 1 
ATOM   446  N N9    . DA  B 2 5   ? 102.249 14.409 -4.886  1.00 46.56  ? 105  DA  N N9    1 
ATOM   447  C C8    . DA  B 2 5   ? 101.906 14.040 -6.167  1.00 47.52  ? 105  DA  N C8    1 
ATOM   448  N N7    . DA  B 2 5   ? 102.891 14.139 -7.029  1.00 45.44  ? 105  DA  N N7    1 
ATOM   449  C C5    . DA  B 2 5   ? 103.952 14.609 -6.269  1.00 46.49  ? 105  DA  N C5    1 
ATOM   450  C C6    . DA  B 2 5   ? 105.294 14.908 -6.595  1.00 45.93  ? 105  DA  N C6    1 
ATOM   451  N N6    . DA  B 2 5   ? 105.804 14.759 -7.816  1.00 45.18  ? 105  DA  N N6    1 
ATOM   452  N N1    . DA  B 2 5   ? 106.099 15.364 -5.608  1.00 42.73  ? 105  DA  N N1    1 
ATOM   453  C C2    . DA  B 2 5   ? 105.589 15.497 -4.389  1.00 42.78  ? 105  DA  N C2    1 
ATOM   454  N N3    . DA  B 2 5   ? 104.346 15.241 -3.954  1.00 46.16  ? 105  DA  N N3    1 
ATOM   455  C C4    . DA  B 2 5   ? 103.570 14.795 -4.955  1.00 44.32  ? 105  DA  N C4    1 
ATOM   456  P P     . DC  B 2 6   ? 98.569  15.911 -1.076  1.00 38.29  ? 106  DC  N P     1 
ATOM   457  O OP1   . DC  B 2 6   ? 98.285  15.969 0.373   1.00 33.22  ? 106  DC  N OP1   1 
ATOM   458  O OP2   . DC  B 2 6   ? 97.469  15.952 -2.046  1.00 37.38  ? 106  DC  N OP2   1 
ATOM   459  O "O5'" . DC  B 2 6   ? 99.629  17.064 -1.380  1.00 39.05  ? 106  DC  N "O5'" 1 
ATOM   460  C "C5'" . DC  B 2 6   ? 100.835 17.096 -0.632  1.00 38.84  ? 106  DC  N "C5'" 1 
ATOM   461  C "C4'" . DC  B 2 6   ? 101.675 18.311 -0.955  1.00 42.40  ? 106  DC  N "C4'" 1 
ATOM   462  O "O4'" . DC  B 2 6   ? 102.533 18.065 -2.108  1.00 41.42  ? 106  DC  N "O4'" 1 
ATOM   463  C "C3'" . DC  B 2 6   ? 100.803 19.508 -1.352  1.00 42.29  ? 106  DC  N "C3'" 1 
ATOM   464  O "O3'" . DC  B 2 6   ? 101.505 20.705 -1.035  1.00 40.97  ? 106  DC  N "O3'" 1 
ATOM   465  C "C2'" . DC  B 2 6   ? 100.725 19.372 -2.864  1.00 43.26  ? 106  DC  N "C2'" 1 
ATOM   466  C "C1'" . DC  B 2 6   ? 102.151 18.937 -3.141  1.00 42.74  ? 106  DC  N "C1'" 1 
ATOM   467  N N1    . DC  B 2 6   ? 102.567 18.410 -4.452  1.00 44.48  ? 106  DC  N N1    1 
ATOM   468  C C2    . DC  B 2 6   ? 103.942 18.506 -4.822  1.00 43.38  ? 106  DC  N C2    1 
ATOM   469  O O2    . DC  B 2 6   ? 104.777 18.904 -3.984  1.00 42.96  ? 106  DC  N O2    1 
ATOM   470  N N3    . DC  B 2 6   ? 104.309 18.170 -6.080  1.00 40.88  ? 106  DC  N N3    1 
ATOM   471  C C4    . DC  B 2 6   ? 103.390 17.740 -6.952  1.00 45.07  ? 106  DC  N C4    1 
ATOM   472  N N4    . DC  B 2 6   ? 103.790 17.458 -8.200  1.00 42.72  ? 106  DC  N N4    1 
ATOM   473  C C5    . DC  B 2 6   ? 102.009 17.583 -6.590  1.00 44.92  ? 106  DC  N C5    1 
ATOM   474  C C6    . DC  B 2 6   ? 101.651 17.913 -5.338  1.00 45.99  ? 106  DC  N C6    1 
ATOM   475  P P     . DG  B 2 7   ? 100.935 21.712 0.071   1.00 46.55  ? 107  DG  N P     1 
ATOM   476  O OP1   . DG  B 2 7   ? 100.560 20.965 1.298   1.00 41.76  ? 107  DG  N OP1   1 
ATOM   477  O OP2   . DG  B 2 7   ? 99.925  22.589 -0.592  1.00 46.40  ? 107  DG  N OP2   1 
ATOM   478  O "O5'" . DG  B 2 7   ? 102.219 22.589 0.396   1.00 44.91  ? 107  DG  N "O5'" 1 
ATOM   479  C "C5'" . DG  B 2 7   ? 103.362 21.974 0.976   1.00 45.89  ? 107  DG  N "C5'" 1 
ATOM   480  C "C4'" . DG  B 2 7   ? 104.639 22.633 0.505   1.00 45.60  ? 107  DG  N "C4'" 1 
ATOM   481  O "O4'" . DG  B 2 7   ? 104.973 22.212 -0.844  1.00 45.83  ? 107  DG  N "O4'" 1 
ATOM   482  C "C3'" . DG  B 2 7   ? 104.518 24.152 0.424   1.00 46.44  ? 107  DG  N "C3'" 1 
ATOM   483  O "O3'" . DG  B 2 7   ? 105.789 24.713 0.683   1.00 46.75  ? 107  DG  N "O3'" 1 
ATOM   484  C "C2'" . DG  B 2 7   ? 104.065 24.389 -1.008  1.00 45.38  ? 107  DG  N "C2'" 1 
ATOM   485  C "C1'" . DG  B 2 7   ? 104.830 23.305 -1.752  1.00 45.54  ? 107  DG  N "C1'" 1 
ATOM   486  N N9    . DG  B 2 7   ? 104.245 22.805 -2.996  1.00 46.62  ? 107  DG  N N9    1 
ATOM   487  C C8    . DG  B 2 7   ? 102.951 22.382 -3.192  1.00 49.25  ? 107  DG  N C8    1 
ATOM   488  N N7    . DG  B 2 7   ? 102.736 21.929 -4.399  1.00 49.13  ? 107  DG  N N7    1 
ATOM   489  C C5    . DG  B 2 7   ? 103.956 22.076 -5.049  1.00 47.43  ? 107  DG  N C5    1 
ATOM   490  C C6    . DG  B 2 7   ? 104.335 21.748 -6.373  1.00 44.35  ? 107  DG  N C6    1 
ATOM   491  O O6    . DG  B 2 7   ? 103.657 21.216 -7.266  1.00 43.53  ? 107  DG  N O6    1 
ATOM   492  N N1    . DG  B 2 7   ? 105.655 22.081 -6.626  1.00 46.56  ? 107  DG  N N1    1 
ATOM   493  C C2    . DG  B 2 7   ? 106.519 22.632 -5.725  1.00 49.16  ? 107  DG  N C2    1 
ATOM   494  N N2    . DG  B 2 7   ? 107.761 22.857 -6.181  1.00 50.81  ? 107  DG  N N2    1 
ATOM   495  N N3    . DG  B 2 7   ? 106.193 22.931 -4.473  1.00 50.03  ? 107  DG  N N3    1 
ATOM   496  C C4    . DG  B 2 7   ? 104.898 22.629 -4.206  1.00 48.55  ? 107  DG  N C4    1 
ATOM   497  P P     . DA  B 2 8   ? 105.954 26.292 0.834   1.00 52.26  ? 108  DA  N P     1 
ATOM   498  O OP1   . DA  B 2 8   ? 107.049 26.384 1.829   1.00 52.20  ? 108  DA  N OP1   1 
ATOM   499  O OP2   . DA  B 2 8   ? 104.654 26.983 1.086   1.00 49.77  ? 108  DA  N OP2   1 
ATOM   500  O "O5'" . DA  B 2 8   ? 106.501 26.753 -0.589  1.00 54.53  ? 108  DA  N "O5'" 1 
ATOM   501  C "C5'" . DA  B 2 8   ? 107.731 26.233 -1.081  1.00 53.86  ? 108  DA  N "C5'" 1 
ATOM   502  C "C4'" . DA  B 2 8   ? 108.202 27.002 -2.293  1.00 54.62  ? 108  DA  N "C4'" 1 
ATOM   503  O "O4'" . DA  B 2 8   ? 107.593 26.452 -3.491  1.00 55.49  ? 108  DA  N "O4'" 1 
ATOM   504  C "C3'" . DA  B 2 8   ? 107.758 28.457 -2.254  1.00 54.61  ? 108  DA  N "C3'" 1 
ATOM   505  O "O3'" . DA  B 2 8   ? 108.725 29.286 -2.902  1.00 61.22  ? 108  DA  N "O3'" 1 
ATOM   506  C "C2'" . DA  B 2 8   ? 106.423 28.417 -2.982  1.00 54.57  ? 108  DA  N "C2'" 1 
ATOM   507  C "C1'" . DA  B 2 8   ? 106.688 27.375 -4.056  1.00 51.12  ? 108  DA  N "C1'" 1 
ATOM   508  N N9    . DA  B 2 8   ? 105.543 26.643 -4.610  1.00 49.79  ? 108  DA  N N9    1 
ATOM   509  C C8    . DA  B 2 8   ? 104.339 26.367 -4.002  1.00 49.96  ? 108  DA  N C8    1 
ATOM   510  N N7    . DA  B 2 8   ? 103.481 25.746 -4.781  1.00 49.48  ? 108  DA  N N7    1 
ATOM   511  C C5    . DA  B 2 8   ? 104.163 25.588 -5.979  1.00 47.74  ? 108  DA  N C5    1 
ATOM   512  C C6    . DA  B 2 8   ? 103.799 25.005 -7.213  1.00 45.75  ? 108  DA  N C6    1 
ATOM   513  N N6    . DA  B 2 8   ? 102.608 24.451 -7.457  1.00 44.63  ? 108  DA  N N6    1 
ATOM   514  N N1    . DA  B 2 8   ? 104.713 25.009 -8.203  1.00 46.44  ? 108  DA  N N1    1 
ATOM   515  C C2    . DA  B 2 8   ? 105.905 25.561 -7.962  1.00 46.61  ? 108  DA  N C2    1 
ATOM   516  N N3    . DA  B 2 8   ? 106.367 26.139 -6.852  1.00 46.58  ? 108  DA  N N3    1 
ATOM   517  C C4    . DA  B 2 8   ? 105.441 26.122 -5.885  1.00 48.38  ? 108  DA  N C4    1 
ATOM   518  P P     . DC  B 2 9   ? 108.709 30.883 -2.665  1.00 63.86  ? 109  DC  N P     1 
ATOM   519  O OP1   . DC  B 2 9   ? 110.107 31.314 -2.418  1.00 65.57  ? 109  DC  N OP1   1 
ATOM   520  O OP2   . DC  B 2 9   ? 107.645 31.231 -1.684  1.00 63.94  ? 109  DC  N OP2   1 
ATOM   521  O "O5'" . DC  B 2 9   ? 108.269 31.430 -4.086  1.00 65.71  ? 109  DC  N "O5'" 1 
ATOM   522  C "C5'" . DC  B 2 9   ? 107.601 30.562 -4.981  1.00 69.75  ? 109  DC  N "C5'" 1 
ATOM   523  C "C4'" . DC  B 2 9   ? 107.984 30.883 -6.400  1.00 70.96  ? 109  DC  N "C4'" 1 
ATOM   524  O "O4'" . DC  B 2 9   ? 107.328 29.914 -7.247  1.00 71.18  ? 109  DC  N "O4'" 1 
ATOM   525  C "C3'" . DC  B 2 9   ? 107.439 32.237 -6.826  1.00 72.93  ? 109  DC  N "C3'" 1 
ATOM   526  O "O3'" . DC  B 2 9   ? 108.242 32.814 -7.849  1.00 76.66  ? 109  DC  N "O3'" 1 
ATOM   527  C "C2'" . DC  B 2 9   ? 106.057 31.897 -7.335  1.00 72.59  ? 109  DC  N "C2'" 1 
ATOM   528  C "C1'" . DC  B 2 9   ? 106.258 30.520 -7.950  1.00 70.20  ? 109  DC  N "C1'" 1 
ATOM   529  N N1    . DC  B 2 9   ? 105.078 29.655 -7.810  1.00 67.53  ? 109  DC  N N1    1 
ATOM   530  C C2    . DC  B 2 9   ? 104.705 28.861 -8.888  1.00 65.51  ? 109  DC  N C2    1 
ATOM   531  O O2    . DC  B 2 9   ? 105.415 28.863 -9.901  1.00 65.25  ? 109  DC  N O2    1 
ATOM   532  N N3    . DC  B 2 9   ? 103.581 28.114 -8.800  1.00 64.96  ? 109  DC  N N3    1 
ATOM   533  C C4    . DC  B 2 9   ? 102.847 28.137 -7.684  1.00 61.87  ? 109  DC  N C4    1 
ATOM   534  N N4    . DC  B 2 9   ? 101.733 27.403 -7.654  1.00 60.45  ? 109  DC  N N4    1 
ATOM   535  C C5    . DC  B 2 9   ? 103.223 28.918 -6.553  1.00 63.19  ? 109  DC  N C5    1 
ATOM   536  C C6    . DC  B 2 9   ? 104.339 29.651 -6.656  1.00 65.44  ? 109  DC  N C6    1 
ATOM   537  P P     . DT  B 2 10  ? 107.761 34.179 -8.549  1.00 81.55  ? 110  DT  N P     1 
ATOM   538  O OP1   . DT  B 2 10  ? 108.980 34.747 -9.178  1.00 80.49  ? 110  DT  N OP1   1 
ATOM   539  O OP2   . DT  B 2 10  ? 106.973 34.998 -7.575  1.00 79.07  ? 110  DT  N OP2   1 
ATOM   540  O "O5'" . DT  B 2 10  ? 106.779 33.693 -9.709  1.00 78.25  ? 110  DT  N "O5'" 1 
ATOM   541  C "C5'" . DT  B 2 10  ? 107.283 32.943 -10.807 1.00 76.98  ? 110  DT  N "C5'" 1 
ATOM   542  C "C4'" . DT  B 2 10  ? 106.420 33.142 -12.032 1.00 75.24  ? 110  DT  N "C4'" 1 
ATOM   543  O "O4'" . DT  B 2 10  ? 105.269 32.256 -11.972 1.00 72.81  ? 110  DT  N "O4'" 1 
ATOM   544  C "C3'" . DT  B 2 10  ? 105.840 34.554 -12.100 1.00 74.29  ? 110  DT  N "C3'" 1 
ATOM   545  O "O3'" . DT  B 2 10  ? 105.690 34.974 -13.466 1.00 76.27  ? 110  DT  N "O3'" 1 
ATOM   546  C "C2'" . DT  B 2 10  ? 104.520 34.410 -11.358 1.00 72.83  ? 110  DT  N "C2'" 1 
ATOM   547  C "C1'" . DT  B 2 10  ? 104.081 33.010 -11.765 1.00 70.55  ? 110  DT  N "C1'" 1 
ATOM   548  N N1    . DT  B 2 10  ? 103.196 32.278 -10.817 1.00 67.02  ? 110  DT  N N1    1 
ATOM   549  C C2    . DT  B 2 10  ? 102.314 31.340 -11.333 1.00 64.32  ? 110  DT  N C2    1 
ATOM   550  O O2    . DT  B 2 10  ? 102.261 31.051 -12.513 1.00 65.00  ? 110  DT  N O2    1 
ATOM   551  N N3    . DT  B 2 10  ? 101.493 30.747 -10.406 1.00 60.55  ? 110  DT  N N3    1 
ATOM   552  C C4    . DT  B 2 10  ? 101.466 30.979 -9.049  1.00 59.02  ? 110  DT  N C4    1 
ATOM   553  O O4    . DT  B 2 10  ? 100.670 30.371 -8.347  1.00 59.55  ? 110  DT  N O4    1 
ATOM   554  C C5    . DT  B 2 10  ? 102.421 31.958 -8.569  1.00 60.46  ? 110  DT  N C5    1 
ATOM   555  C C7    . DT  B 2 10  ? 102.460 32.279 -7.106  1.00 57.22  ? 110  DT  N C7    1 
ATOM   556  C C6    . DT  B 2 10  ? 103.232 32.545 -9.465  1.00 63.26  ? 110  DT  N C6    1 
ATOM   557  P P     . DC  B 2 11  ? 104.931 36.357 -13.814 1.00 77.87  ? 111  DC  N P     1 
ATOM   558  O OP1   . DC  B 2 11  ? 105.722 37.036 -14.867 1.00 78.23  ? 111  DC  N OP1   1 
ATOM   559  O OP2   . DC  B 2 11  ? 104.606 37.086 -12.556 1.00 77.55  ? 111  DC  N OP2   1 
ATOM   560  O "O5'" . DC  B 2 11  ? 103.576 35.848 -14.476 1.00 74.74  ? 111  DC  N "O5'" 1 
ATOM   561  C "C5'" . DC  B 2 11  ? 103.602 34.714 -15.329 1.00 71.98  ? 111  DC  N "C5'" 1 
ATOM   562  C "C4'" . DC  B 2 11  ? 102.266 34.513 -16.000 1.00 71.19  ? 111  DC  N "C4'" 1 
ATOM   563  O "O4'" . DC  B 2 11  ? 101.396 33.737 -15.137 1.00 70.04  ? 111  DC  N "O4'" 1 
ATOM   564  C "C3'" . DC  B 2 11  ? 101.529 35.826 -16.239 1.00 70.51  ? 111  DC  N "C3'" 1 
ATOM   565  O "O3'" . DC  B 2 11  ? 100.732 35.713 -17.418 1.00 72.27  ? 111  DC  N "O3'" 1 
ATOM   566  C "C2'" . DC  B 2 11  ? 100.705 35.986 -14.969 1.00 68.79  ? 111  DC  N "C2'" 1 
ATOM   567  C "C1'" . DC  B 2 11  ? 100.333 34.541 -14.649 1.00 65.39  ? 111  DC  N "C1'" 1 
ATOM   568  N N1    . DC  B 2 11  ? 100.088 34.189 -13.232 1.00 62.18  ? 111  DC  N N1    1 
ATOM   569  C C2    . DC  B 2 11  ? 99.107  33.218 -12.935 1.00 60.26  ? 111  DC  N C2    1 
ATOM   570  O O2    . DC  B 2 11  ? 98.500  32.669 -13.867 1.00 59.19  ? 111  DC  N O2    1 
ATOM   571  N N3    . DC  B 2 11  ? 98.853  32.910 -11.643 1.00 58.43  ? 111  DC  N N3    1 
ATOM   572  C C4    . DC  B 2 11  ? 99.529  33.523 -10.662 1.00 57.36  ? 111  DC  N C4    1 
ATOM   573  N N4    . DC  B 2 11  ? 99.231  33.202 -9.395  1.00 55.76  ? 111  DC  N N4    1 
ATOM   574  C C5    . DC  B 2 11  ? 100.536 34.497 -10.934 1.00 55.73  ? 111  DC  N C5    1 
ATOM   575  C C6    . DC  B 2 11  ? 100.781 34.795 -12.219 1.00 60.00  ? 111  DC  N C6    1 
ATOM   576  P P     . DA  B 2 12  ? 99.964  36.987 -18.019 1.00 76.76  ? 112  DA  N P     1 
ATOM   577  O OP1   . DA  B 2 12  ? 100.289 37.027 -19.490 1.00 74.54  ? 112  DA  N OP1   1 
ATOM   578  O OP2   . DA  B 2 12  ? 100.133 38.199 -17.137 1.00 72.42  ? 112  DA  N OP2   1 
ATOM   579  O "O5'" . DA  B 2 12  ? 98.458  36.532 -18.027 1.00 74.75  ? 112  DA  N "O5'" 1 
ATOM   580  C "C5'" . DA  B 2 12  ? 98.129  35.266 -18.566 1.00 75.75  ? 112  DA  N "C5'" 1 
ATOM   581  C "C4'" . DA  B 2 12  ? 96.701  34.919 -18.224 1.00 75.79  ? 112  DA  N "C4'" 1 
ATOM   582  O "O4'" . DA  B 2 12  ? 96.614  34.711 -16.784 1.00 75.24  ? 112  DA  N "O4'" 1 
ATOM   583  C "C3'" . DA  B 2 12  ? 95.797  36.132 -18.505 1.00 75.27  ? 112  DA  N "C3'" 1 
ATOM   584  O "O3'" . DA  B 2 12  ? 94.504  35.708 -18.928 1.00 75.05  ? 112  DA  N "O3'" 1 
ATOM   585  C "C2'" . DA  B 2 12  ? 95.800  36.899 -17.186 1.00 72.56  ? 112  DA  N "C2'" 1 
ATOM   586  C "C1'" . DA  B 2 12  ? 95.828  35.748 -16.201 1.00 72.17  ? 112  DA  N "C1'" 1 
ATOM   587  N N9    . DA  B 2 12  ? 96.277  35.952 -14.829 1.00 69.87  ? 112  DA  N N9    1 
ATOM   588  C C8    . DA  B 2 12  ? 97.138  36.862 -14.278 1.00 68.67  ? 112  DA  N C8    1 
ATOM   589  N N7    . DA  B 2 12  ? 97.275  36.741 -12.982 1.00 66.64  ? 112  DA  N N7    1 
ATOM   590  C C5    . DA  B 2 12  ? 96.455  35.665 -12.661 1.00 65.84  ? 112  DA  N C5    1 
ATOM   591  C C6    . DA  B 2 12  ? 96.159  35.023 -11.448 1.00 63.37  ? 112  DA  N C6    1 
ATOM   592  N N6    . DA  B 2 12  ? 96.676  35.376 -10.280 1.00 60.10  ? 112  DA  N N6    1 
ATOM   593  N N1    . DA  B 2 12  ? 95.296  33.990 -11.477 1.00 64.51  ? 112  DA  N N1    1 
ATOM   594  C C2    . DA  B 2 12  ? 94.772  33.623 -12.648 1.00 66.27  ? 112  DA  N C2    1 
ATOM   595  N N3    . DA  B 2 12  ? 94.973  34.139 -13.858 1.00 67.85  ? 112  DA  N N3    1 
ATOM   596  C C4    . DA  B 2 12  ? 95.838  35.172 -13.790 1.00 68.31  ? 112  DA  N C4    1 
ATOM   597  P P     . DC  B 2 13  ? 93.492  36.775 -19.579 1.00 79.40  ? 113  DC  N P     1 
ATOM   598  O OP1   . DC  B 2 13  ? 93.013  36.342 -20.934 1.00 79.88  ? 113  DC  N OP1   1 
ATOM   599  O OP2   . DC  B 2 13  ? 94.000  38.171 -19.365 1.00 76.24  ? 113  DC  N OP2   1 
ATOM   600  O "O5'" . DC  B 2 13  ? 92.230  36.575 -18.668 1.00 79.06  ? 113  DC  N "O5'" 1 
ATOM   601  C "C5'" . DC  B 2 13  ? 92.485  36.424 -17.335 1.00 81.31  ? 113  DC  N "C5'" 1 
ATOM   602  C "C4'" . DC  B 2 13  ? 91.564  35.418 -16.715 1.00 81.41  ? 113  DC  N "C4'" 1 
ATOM   603  O "O4'" . DC  B 2 13  ? 92.032  35.272 -15.379 1.00 78.31  ? 113  DC  N "O4'" 1 
ATOM   604  C "C3'" . DC  B 2 13  ? 90.165  35.932 -16.600 1.00 85.66  ? 113  DC  N "C3'" 1 
ATOM   605  O "O3'" . DC  B 2 13  ? 89.345  34.776 -16.300 1.00 98.17  ? 113  DC  N "O3'" 1 
ATOM   606  C "C2'" . DC  B 2 13  ? 90.269  36.800 -15.355 1.00 79.48  ? 113  DC  N "C2'" 1 
ATOM   607  C "C1'" . DC  B 2 13  ? 91.223  35.987 -14.509 1.00 74.36  ? 113  DC  N "C1'" 1 
ATOM   608  N N1    . DC  B 2 13  ? 92.137  36.683 -13.622 1.00 67.59  ? 113  DC  N N1    1 
ATOM   609  C C2    . DC  B 2 13  ? 92.276  36.179 -12.355 1.00 64.90  ? 113  DC  N C2    1 
ATOM   610  O O2    . DC  B 2 13  ? 91.629  35.170 -12.058 1.00 62.24  ? 113  DC  N O2    1 
ATOM   611  N N3    . DC  B 2 13  ? 93.115  36.772 -11.491 1.00 63.22  ? 113  DC  N N3    1 
ATOM   612  C C4    . DC  B 2 13  ? 93.833  37.809 -11.879 1.00 62.27  ? 113  DC  N C4    1 
ATOM   613  N N4    . DC  B 2 13  ? 94.639  38.346 -10.980 1.00 60.90  ? 113  DC  N N4    1 
ATOM   614  C C5    . DC  B 2 13  ? 93.736  38.339 -13.196 1.00 63.15  ? 113  DC  N C5    1 
ATOM   615  C C6    . DC  B 2 13  ? 92.863  37.759 -14.024 1.00 65.15  ? 113  DC  N C6    1 
ATOM   616  P P     . DT  B 2 14  ? 89.458  33.375 -17.206 1.00 106.79 ? 114  DT  N P     1 
ATOM   617  O OP1   . DT  B 2 14  ? 88.249  32.488 -16.779 1.00 106.23 ? 114  DT  N OP1   1 
ATOM   618  O OP2   . DT  B 2 14  ? 90.848  32.780 -17.131 1.00 105.68 ? 114  DT  N OP2   1 
ATOM   619  O "O5'" . DT  B 2 14  ? 89.190  33.882 -18.724 1.00 107.90 ? 114  DT  N "O5'" 1 
ATOM   620  C "C5'" . DT  B 2 14  ? 87.951  33.496 -19.401 1.00 109.58 ? 114  DT  N "C5'" 1 
ATOM   621  C "C4'" . DT  B 2 14  ? 86.901  34.562 -19.203 1.00 109.90 ? 114  DT  N "C4'" 1 
ATOM   622  O "O4'" . DT  B 2 14  ? 85.594  33.926 -19.006 1.00 110.51 ? 114  DT  N "O4'" 1 
ATOM   623  C "C3'" . DT  B 2 14  ? 87.166  35.287 -17.893 1.00 109.38 ? 114  DT  N "C3'" 1 
ATOM   624  O "O3'" . DT  B 2 14  ? 86.849  36.647 -17.973 1.00 109.90 ? 114  DT  N "O3'" 1 
ATOM   625  C "C2'" . DT  B 2 14  ? 86.390  34.532 -16.843 1.00 109.35 ? 114  DT  N "C2'" 1 
ATOM   626  C "C1'" . DT  B 2 14  ? 85.164  34.104 -17.632 1.00 110.42 ? 114  DT  N "C1'" 1 
ATOM   627  N N1    . DT  B 2 14  ? 84.548  32.823 -17.143 1.00 110.51 ? 114  DT  N N1    1 
ATOM   628  C C2    . DT  B 2 14  ? 83.132  32.711 -17.160 1.00 110.51 ? 114  DT  N C2    1 
ATOM   629  O O2    . DT  B 2 14  ? 82.386  33.582 -17.664 1.00 110.51 ? 114  DT  N O2    1 
ATOM   630  N N3    . DT  B 2 14  ? 82.630  31.543 -16.585 1.00 110.35 ? 114  DT  N N3    1 
ATOM   631  C C4    . DT  B 2 14  ? 83.383  30.496 -16.022 1.00 110.51 ? 114  DT  N C4    1 
ATOM   632  O O4    . DT  B 2 14  ? 82.793  29.506 -15.520 1.00 110.51 ? 114  DT  N O4    1 
ATOM   633  C C5    . DT  B 2 14  ? 84.874  30.673 -16.085 1.00 110.51 ? 114  DT  N C5    1 
ATOM   634  C C7    . DT  B 2 14  ? 85.779  29.615 -15.523 1.00 110.08 ? 114  DT  N C7    1 
ATOM   635  C C6    . DT  B 2 14  ? 85.355  31.804 -16.645 1.00 110.51 ? 114  DT  N C6    1 
ATOM   636  P P     . DA  B 2 15  ? 87.825  37.661 -17.211 1.00 110.51 ? 115  DA  N P     1 
ATOM   637  O OP1   . DA  B 2 15  ? 89.190  37.646 -17.892 1.00 110.51 ? 115  DA  N OP1   1 
ATOM   638  O OP2   . DA  B 2 15  ? 87.674  37.184 -15.795 1.00 110.51 ? 115  DA  N OP2   1 
ATOM   639  O "O5'" . DA  B 2 15  ? 87.192  39.135 -17.351 1.00 110.51 ? 115  DA  N "O5'" 1 
ATOM   640  C "C5'" . DA  B 2 15  ? 88.036  40.322 -17.204 1.00 110.51 ? 115  DA  N "C5'" 1 
ATOM   641  C "C4'" . DA  B 2 15  ? 87.621  41.112 -15.975 1.00 110.51 ? 115  DA  N "C4'" 1 
ATOM   642  O "O4'" . DA  B 2 15  ? 86.178  41.384 -16.084 1.00 110.51 ? 115  DA  N "O4'" 1 
ATOM   643  C "C3'" . DA  B 2 15  ? 87.806  40.334 -14.657 1.00 110.51 ? 115  DA  N "C3'" 1 
ATOM   644  O "O3'" . DA  B 2 15  ? 87.987  41.079 -13.396 1.00 110.26 ? 115  DA  N "O3'" 1 
ATOM   645  C "C2'" . DA  B 2 15  ? 86.485  39.581 -14.538 1.00 110.51 ? 115  DA  N "C2'" 1 
ATOM   646  C "C1'" . DA  B 2 15  ? 85.460  40.549 -15.148 1.00 110.51 ? 115  DA  N "C1'" 1 
ATOM   647  N N9    . DA  B 2 15  ? 84.384  39.849 -15.867 1.00 110.51 ? 115  DA  N N9    1 
ATOM   648  C C8    . DA  B 2 15  ? 84.058  38.498 -15.694 1.00 110.51 ? 115  DA  N C8    1 
ATOM   649  N N7    . DA  B 2 15  ? 83.003  38.099 -16.391 1.00 110.51 ? 115  DA  N N7    1 
ATOM   650  C C5    . DA  B 2 15  ? 82.623  39.252 -17.098 1.00 110.51 ? 115  DA  N C5    1 
ATOM   651  C C6    . DA  B 2 15  ? 81.551  39.496 -18.017 1.00 110.51 ? 115  DA  N C6    1 
ATOM   652  N N6    . DA  B 2 15  ? 80.670  38.525 -18.404 1.00 110.51 ? 115  DA  N N6    1 
ATOM   653  N N1    . DA  B 2 15  ? 81.418  40.770 -18.522 1.00 110.51 ? 115  DA  N N1    1 
ATOM   654  C C2    . DA  B 2 15  ? 82.307  41.726 -18.128 1.00 110.51 ? 115  DA  N C2    1 
ATOM   655  N N3    . DA  B 2 15  ? 83.367  41.620 -17.268 1.00 110.51 ? 115  DA  N N3    1 
ATOM   656  C C4    . DA  B 2 15  ? 83.471  40.343 -16.786 1.00 110.51 ? 115  DA  N C4    1 
ATOM   657  N N     . ILE C 3 6   ? 97.434  18.213 38.611  1.00 98.95  ? 6    ILE A N     1 
ATOM   658  C CA    . ILE C 3 6   ? 96.736  18.743 37.403  1.00 99.06  ? 6    ILE A CA    1 
ATOM   659  C C     . ILE C 3 6   ? 96.213  17.604 36.530  1.00 99.24  ? 6    ILE A C     1 
ATOM   660  O O     . ILE C 3 6   ? 96.965  16.689 36.183  1.00 99.26  ? 6    ILE A O     1 
ATOM   661  C CB    . ILE C 3 6   ? 97.691  19.626 36.595  1.00 97.77  ? 6    ILE A CB    1 
ATOM   662  N N     . ALA C 3 7   ? 94.927  17.666 36.180  1.00 98.45  ? 7    ALA A N     1 
ATOM   663  C CA    . ALA C 3 7   ? 94.304  16.647 35.340  1.00 98.25  ? 7    ALA A CA    1 
ATOM   664  C C     . ALA C 3 7   ? 95.338  16.114 34.359  1.00 98.59  ? 7    ALA A C     1 
ATOM   665  O O     . ALA C 3 7   ? 95.521  14.901 34.226  1.00 98.73  ? 7    ALA A O     1 
ATOM   666  C CB    . ALA C 3 7   ? 93.117  17.239 34.585  1.00 96.95  ? 7    ALA A CB    1 
ATOM   667  N N     . LYS C 3 8   ? 96.023  17.036 33.685  1.00 98.66  ? 8    LYS A N     1 
ATOM   668  C CA    . LYS C 3 8   ? 97.056  16.680 32.721  1.00 97.54  ? 8    LYS A CA    1 
ATOM   669  C C     . LYS C 3 8   ? 98.220  16.028 33.461  1.00 96.20  ? 8    LYS A C     1 
ATOM   670  O O     . LYS C 3 8   ? 98.980  16.702 34.165  1.00 95.71  ? 8    LYS A O     1 
ATOM   671  C CB    . LYS C 3 8   ? 97.534  17.926 31.973  1.00 97.99  ? 8    LYS A CB    1 
ATOM   672  N N     . ASN C 3 9   ? 98.331  14.710 33.302  1.00 94.59  ? 9    ASN A N     1 
ATOM   673  C CA    . ASN C 3 9   ? 99.380  13.905 33.926  1.00 92.34  ? 9    ASN A CA    1 
ATOM   674  C C     . ASN C 3 9   ? 99.000  13.409 35.320  1.00 90.06  ? 9    ASN A C     1 
ATOM   675  O O     . ASN C 3 9   ? 98.957  12.203 35.561  1.00 90.45  ? 9    ASN A O     1 
ATOM   676  C CB    . ASN C 3 9   ? 100.702 14.691 33.988  1.00 93.21  ? 9    ASN A CB    1 
ATOM   677  N N     . ASP C 3 10  ? 98.718  14.335 36.232  1.00 87.15  ? 10   ASP A N     1 
ATOM   678  C CA    . ASP C 3 10  ? 98.371  13.974 37.604  1.00 84.17  ? 10   ASP A CA    1 
ATOM   679  C C     . ASP C 3 10  ? 97.485  12.737 37.724  1.00 81.35  ? 10   ASP A C     1 
ATOM   680  O O     . ASP C 3 10  ? 97.519  12.055 38.749  1.00 81.66  ? 10   ASP A O     1 
ATOM   681  C CB    . ASP C 3 10  ? 97.709  15.154 38.308  1.00 84.89  ? 10   ASP A CB    1 
ATOM   682  N N     . PHE C 3 11  ? 96.690  12.450 36.692  1.00 77.37  ? 11   PHE A N     1 
ATOM   683  C CA    . PHE C 3 11  ? 95.811  11.280 36.722  1.00 71.82  ? 11   PHE A CA    1 
ATOM   684  C C     . PHE C 3 11  ? 96.020  10.345 35.541  1.00 69.04  ? 11   PHE A C     1 
ATOM   685  O O     . PHE C 3 11  ? 96.605  10.718 34.526  1.00 67.39  ? 11   PHE A O     1 
ATOM   686  C CB    . PHE C 3 11  ? 94.338  11.697 36.757  1.00 68.83  ? 11   PHE A CB    1 
ATOM   687  C CG    . PHE C 3 11  ? 93.940  12.427 38.001  1.00 65.90  ? 11   PHE A CG    1 
ATOM   688  C CD1   . PHE C 3 11  ? 94.332  13.746 38.205  1.00 64.22  ? 11   PHE A CD1   1 
ATOM   689  C CD2   . PHE C 3 11  ? 93.169  11.793 38.975  1.00 65.27  ? 11   PHE A CD2   1 
ATOM   690  C CE1   . PHE C 3 11  ? 93.961  14.429 39.367  1.00 64.14  ? 11   PHE A CE1   1 
ATOM   691  C CE2   . PHE C 3 11  ? 92.792  12.465 40.140  1.00 64.45  ? 11   PHE A CE2   1 
ATOM   692  C CZ    . PHE C 3 11  ? 93.189  13.787 40.336  1.00 64.01  ? 11   PHE A CZ    1 
ATOM   693  N N     . SER C 3 12  ? 95.525  9.123  35.690  1.00 66.83  ? 12   SER A N     1 
ATOM   694  C CA    . SER C 3 12  ? 95.632  8.108  34.652  1.00 65.70  ? 12   SER A CA    1 
ATOM   695  C C     . SER C 3 12  ? 94.449  8.170  33.666  1.00 64.92  ? 12   SER A C     1 
ATOM   696  O O     . SER C 3 12  ? 93.353  8.624  34.012  1.00 64.74  ? 12   SER A O     1 
ATOM   697  C CB    . SER C 3 12  ? 95.684  6.726  35.300  1.00 63.58  ? 12   SER A CB    1 
ATOM   698  O OG    . SER C 3 12  ? 95.681  5.716  34.314  1.00 65.95  ? 12   SER A OG    1 
ATOM   699  N N     . ASP C 3 13  ? 94.665  7.709  32.439  1.00 62.62  ? 13   ASP A N     1 
ATOM   700  C CA    . ASP C 3 13  ? 93.592  7.725  31.463  1.00 64.17  ? 13   ASP A CA    1 
ATOM   701  C C     . ASP C 3 13  ? 92.409  6.901  31.977  1.00 63.57  ? 13   ASP A C     1 
ATOM   702  O O     . ASP C 3 13  ? 91.262  7.124  31.582  1.00 63.74  ? 13   ASP A O     1 
ATOM   703  C CB    . ASP C 3 13  ? 94.078  7.191  30.105  1.00 67.78  ? 13   ASP A CB    1 
ATOM   704  C CG    . ASP C 3 13  ? 95.035  8.165  29.386  1.00 72.69  ? 13   ASP A CG    1 
ATOM   705  O OD1   . ASP C 3 13  ? 96.125  8.465  29.935  1.00 76.14  ? 13   ASP A OD1   1 
ATOM   706  O OD2   . ASP C 3 13  ? 94.705  8.629  28.268  1.00 71.96  ? 13   ASP A OD2   1 
ATOM   707  N N     . ILE C 3 14  ? 92.677  5.959  32.875  1.00 62.48  ? 14   ILE A N     1 
ATOM   708  C CA    . ILE C 3 14  ? 91.600  5.134  33.414  1.00 60.94  ? 14   ILE A CA    1 
ATOM   709  C C     . ILE C 3 14  ? 90.816  5.919  34.458  1.00 59.62  ? 14   ILE A C     1 
ATOM   710  O O     . ILE C 3 14  ? 89.605  5.760  34.585  1.00 58.35  ? 14   ILE A O     1 
ATOM   711  C CB    . ILE C 3 14  ? 92.138  3.829  34.066  1.00 60.73  ? 14   ILE A CB    1 
ATOM   712  C CG1   . ILE C 3 14  ? 92.805  2.942  33.017  1.00 61.76  ? 14   ILE A CG1   1 
ATOM   713  C CG2   . ILE C 3 14  ? 90.994  3.052  34.685  1.00 62.62  ? 14   ILE A CG2   1 
ATOM   714  C CD1   . ILE C 3 14  ? 93.358  1.652  33.570  1.00 63.18  ? 14   ILE A CD1   1 
ATOM   715  N N     . GLU C 3 15  ? 91.516  6.769  35.203  1.00 59.75  ? 15   GLU A N     1 
ATOM   716  C CA    . GLU C 3 15  ? 90.886  7.577  36.244  1.00 57.57  ? 15   GLU A CA    1 
ATOM   717  C C     . GLU C 3 15  ? 90.100  8.736  35.639  1.00 55.72  ? 15   GLU A C     1 
ATOM   718  O O     . GLU C 3 15  ? 89.002  9.067  36.093  1.00 55.78  ? 15   GLU A O     1 
ATOM   719  C CB    . GLU C 3 15  ? 91.948  8.136  37.203  1.00 58.69  ? 15   GLU A CB    1 
ATOM   720  C CG    . GLU C 3 15  ? 92.795  7.081  37.918  1.00 59.52  ? 15   GLU A CG    1 
ATOM   721  C CD    . GLU C 3 15  ? 93.851  7.696  38.842  1.00 59.31  ? 15   GLU A CD    1 
ATOM   722  O OE1   . GLU C 3 15  ? 93.488  8.270  39.887  1.00 58.54  ? 15   GLU A OE1   1 
ATOM   723  O OE2   . GLU C 3 15  ? 95.048  7.611  38.516  1.00 60.43  ? 15   GLU A OE2   1 
ATOM   724  N N     . LEU C 3 16  ? 90.669  9.365  34.619  1.00 51.47  ? 16   LEU A N     1 
ATOM   725  C CA    . LEU C 3 16  ? 89.985  10.478 34.003  1.00 46.64  ? 16   LEU A CA    1 
ATOM   726  C C     . LEU C 3 16  ? 88.696  9.999  33.357  1.00 46.88  ? 16   LEU A C     1 
ATOM   727  O O     . LEU C 3 16  ? 87.677  10.683 33.417  1.00 49.24  ? 16   LEU A O     1 
ATOM   728  C CB    . LEU C 3 16  ? 90.882  11.141 32.973  1.00 40.36  ? 16   LEU A CB    1 
ATOM   729  C CG    . LEU C 3 16  ? 92.151  11.762 33.548  1.00 36.97  ? 16   LEU A CG    1 
ATOM   730  C CD1   . LEU C 3 16  ? 93.070  12.160 32.400  1.00 37.57  ? 16   LEU A CD1   1 
ATOM   731  C CD2   . LEU C 3 16  ? 91.818  12.964 34.388  1.00 35.63  ? 16   LEU A CD2   1 
ATOM   732  N N     . ALA C 3 17  ? 88.749  8.815  32.757  1.00 44.67  ? 17   ALA A N     1 
ATOM   733  C CA    . ALA C 3 17  ? 87.606  8.221  32.086  1.00 42.68  ? 17   ALA A CA    1 
ATOM   734  C C     . ALA C 3 17  ? 86.415  8.022  32.995  1.00 44.82  ? 17   ALA A C     1 
ATOM   735  O O     . ALA C 3 17  ? 85.261  8.102  32.551  1.00 44.73  ? 17   ALA A O     1 
ATOM   736  C CB    . ALA C 3 17  ? 87.989  6.874  31.491  1.00 39.08  ? 17   ALA A CB    1 
ATOM   737  N N     . ALA C 3 18  ? 86.690  7.756  34.266  1.00 46.01  ? 18   ALA A N     1 
ATOM   738  C CA    . ALA C 3 18  ? 85.630  7.480  35.209  1.00 49.38  ? 18   ALA A CA    1 
ATOM   739  C C     . ALA C 3 18  ? 85.364  8.596  36.203  1.00 51.44  ? 18   ALA A C     1 
ATOM   740  O O     . ALA C 3 18  ? 84.293  8.655  36.803  1.00 54.07  ? 18   ALA A O     1 
ATOM   741  C CB    . ALA C 3 18  ? 85.955  6.193  35.954  1.00 48.61  ? 18   ALA A CB    1 
ATOM   742  N N     . ILE C 3 19  ? 86.330  9.484  36.373  1.00 51.97  ? 19   ILE A N     1 
ATOM   743  C CA    . ILE C 3 19  ? 86.168  10.543 37.332  1.00 54.23  ? 19   ILE A CA    1 
ATOM   744  C C     . ILE C 3 19  ? 84.884  11.385 37.177  1.00 56.39  ? 19   ILE A C     1 
ATOM   745  O O     . ILE C 3 19  ? 84.304  11.795 38.186  1.00 59.26  ? 19   ILE A O     1 
ATOM   746  C CB    . ILE C 3 19  ? 87.425  11.434 37.372  1.00 56.28  ? 19   ILE A CB    1 
ATOM   747  C CG1   . ILE C 3 19  ? 87.555  12.077 38.746  1.00 56.04  ? 19   ILE A CG1   1 
ATOM   748  C CG2   . ILE C 3 19  ? 87.365  12.504 36.306  1.00 62.07  ? 19   ILE A CG2   1 
ATOM   749  C CD1   . ILE C 3 19  ? 88.146  11.147 39.788  1.00 58.07  ? 19   ILE A CD1   1 
ATOM   750  N N     . PRO C 3 20  ? 84.401  11.631 35.938  1.00 54.32  ? 20   PRO A N     1 
ATOM   751  C CA    . PRO C 3 20  ? 83.176  12.437 35.827  1.00 52.66  ? 20   PRO A CA    1 
ATOM   752  C C     . PRO C 3 20  ? 81.885  11.657 36.085  1.00 52.08  ? 20   PRO A C     1 
ATOM   753  O O     . PRO C 3 20  ? 80.955  12.152 36.729  1.00 51.33  ? 20   PRO A O     1 
ATOM   754  C CB    . PRO C 3 20  ? 83.238  12.976 34.393  1.00 51.79  ? 20   PRO A CB    1 
ATOM   755  C CG    . PRO C 3 20  ? 84.698  12.945 34.075  1.00 52.35  ? 20   PRO A CG    1 
ATOM   756  C CD    . PRO C 3 20  ? 85.080  11.594 34.636  1.00 54.41  ? 20   PRO A CD    1 
ATOM   757  N N     . PHE C 3 21  ? 81.827  10.441 35.563  1.00 51.15  ? 21   PHE A N     1 
ATOM   758  C CA    . PHE C 3 21  ? 80.656  9.593  35.738  1.00 49.32  ? 21   PHE A CA    1 
ATOM   759  C C     . PHE C 3 21  ? 80.303  9.399  37.202  1.00 46.95  ? 21   PHE A C     1 
ATOM   760  O O     . PHE C 3 21  ? 79.151  9.545  37.613  1.00 45.38  ? 21   PHE A O     1 
ATOM   761  C CB    . PHE C 3 21  ? 80.902  8.214  35.134  1.00 50.14  ? 21   PHE A CB    1 
ATOM   762  C CG    . PHE C 3 21  ? 79.716  7.297  35.240  1.00 47.93  ? 21   PHE A CG    1 
ATOM   763  C CD1   . PHE C 3 21  ? 78.558  7.561  34.521  1.00 46.25  ? 21   PHE A CD1   1 
ATOM   764  C CD2   . PHE C 3 21  ? 79.755  6.179  36.065  1.00 47.89  ? 21   PHE A CD2   1 
ATOM   765  C CE1   . PHE C 3 21  ? 77.449  6.731  34.611  1.00 49.47  ? 21   PHE A CE1   1 
ATOM   766  C CE2   . PHE C 3 21  ? 78.650  5.329  36.169  1.00 50.05  ? 21   PHE A CE2   1 
ATOM   767  C CZ    . PHE C 3 21  ? 77.488  5.599  35.441  1.00 50.87  ? 21   PHE A CZ    1 
ATOM   768  N N     . ASN C 3 22  ? 81.320  9.045  37.974  1.00 47.22  ? 22   ASN A N     1 
ATOM   769  C CA    . ASN C 3 22  ? 81.176  8.785  39.391  1.00 47.72  ? 22   ASN A CA    1 
ATOM   770  C C     . ASN C 3 22  ? 80.626  9.993  40.140  1.00 45.98  ? 22   ASN A C     1 
ATOM   771  O O     . ASN C 3 22  ? 79.660  9.880  40.920  1.00 44.92  ? 22   ASN A O     1 
ATOM   772  C CB    . ASN C 3 22  ? 82.533  8.342  39.956  1.00 47.10  ? 22   ASN A CB    1 
ATOM   773  C CG    . ASN C 3 22  ? 83.031  7.055  39.314  1.00 48.78  ? 22   ASN A CG    1 
ATOM   774  O OD1   . ASN C 3 22  ? 84.201  6.702  39.417  1.00 52.47  ? 22   ASN A OD1   1 
ATOM   775  N ND2   . ASN C 3 22  ? 82.137  6.348  38.655  1.00 48.66  ? 22   ASN A ND2   1 
ATOM   776  N N     . THR C 3 23  ? 81.232  11.154 39.907  1.00 46.68  ? 23   THR A N     1 
ATOM   777  C CA    . THR C 3 23  ? 80.739  12.343 40.580  1.00 43.33  ? 23   THR A CA    1 
ATOM   778  C C     . THR C 3 23  ? 79.371  12.735 40.031  1.00 41.67  ? 23   THR A C     1 
ATOM   779  O O     . THR C 3 23  ? 78.480  13.081 40.789  1.00 43.92  ? 23   THR A O     1 
ATOM   780  C CB    . THR C 3 23  ? 81.721  13.529 40.485  1.00 42.02  ? 23   THR A CB    1 
ATOM   781  O OG1   . THR C 3 23  ? 80.975  14.739 40.332  1.00 44.40  ? 23   THR A OG1   1 
ATOM   782  C CG2   . THR C 3 23  ? 82.669  13.370 39.354  1.00 40.28  ? 23   THR A CG2   1 
ATOM   783  N N     . LEU C 3 24  ? 79.176  12.648 38.724  1.00 40.17  ? 24   LEU A N     1 
ATOM   784  C CA    . LEU C 3 24  ? 77.874  13.005 38.177  1.00 40.20  ? 24   LEU A CA    1 
ATOM   785  C C     . LEU C 3 24  ? 76.849  12.044 38.735  1.00 43.58  ? 24   LEU A C     1 
ATOM   786  O O     . LEU C 3 24  ? 75.678  12.389 38.886  1.00 43.87  ? 24   LEU A O     1 
ATOM   787  C CB    . LEU C 3 24  ? 77.883  12.921 36.653  1.00 38.61  ? 24   LEU A CB    1 
ATOM   788  C CG    . LEU C 3 24  ? 77.456  14.165 35.853  1.00 39.16  ? 24   LEU A CG    1 
ATOM   789  C CD1   . LEU C 3 24  ? 77.981  15.430 36.500  1.00 37.36  ? 24   LEU A CD1   1 
ATOM   790  C CD2   . LEU C 3 24  ? 77.962  14.035 34.427  1.00 34.93  ? 24   LEU A CD2   1 
ATOM   791  N N     . ALA C 3 25  ? 77.281  10.826 39.047  1.00 44.72  ? 25   ALA A N     1 
ATOM   792  C CA    . ALA C 3 25  ? 76.358  9.842  39.591  1.00 46.22  ? 25   ALA A CA    1 
ATOM   793  C C     . ALA C 3 25  ? 76.130  10.147 41.071  1.00 46.14  ? 25   ALA A C     1 
ATOM   794  O O     . ALA C 3 25  ? 75.002  10.085 41.550  1.00 43.23  ? 25   ALA A O     1 
ATOM   795  C CB    . ALA C 3 25  ? 76.918  8.423  39.409  1.00 47.92  ? 25   ALA A CB    1 
ATOM   796  N N     . ASP C 3 26  ? 77.207  10.481 41.781  1.00 46.99  ? 26   ASP A N     1 
ATOM   797  C CA    . ASP C 3 26  ? 77.122  10.809 43.197  1.00 49.32  ? 26   ASP A CA    1 
ATOM   798  C C     . ASP C 3 26  ? 75.930  11.747 43.429  1.00 48.29  ? 26   ASP A C     1 
ATOM   799  O O     . ASP C 3 26  ? 75.150  11.566 44.357  1.00 49.97  ? 26   ASP A O     1 
ATOM   800  C CB    . ASP C 3 26  ? 78.441  11.452 43.653  1.00 54.50  ? 26   ASP A CB    1 
ATOM   801  C CG    . ASP C 3 26  ? 78.510  11.659 45.161  1.00 59.44  ? 26   ASP A CG    1 
ATOM   802  O OD1   . ASP C 3 26  ? 78.113  10.739 45.919  1.00 59.01  ? 26   ASP A OD1   1 
ATOM   803  O OD2   . ASP C 3 26  ? 78.975  12.744 45.589  1.00 63.98  ? 26   ASP A OD2   1 
ATOM   804  N N     . HIS C 3 27  ? 75.797  12.767 42.592  1.00 47.41  ? 27   HIS A N     1 
ATOM   805  C CA    . HIS C 3 27  ? 74.654  13.666 42.681  1.00 44.42  ? 27   HIS A CA    1 
ATOM   806  C C     . HIS C 3 27  ? 73.864  13.295 41.421  1.00 45.61  ? 27   HIS A C     1 
ATOM   807  O O     . HIS C 3 27  ? 74.427  12.743 40.472  1.00 48.13  ? 27   HIS A O     1 
ATOM   808  C CB    . HIS C 3 27  ? 75.079  15.129 42.559  1.00 43.93  ? 27   HIS A CB    1 
ATOM   809  C CG    . HIS C 3 27  ? 76.479  15.414 43.011  1.00 44.28  ? 27   HIS A CG    1 
ATOM   810  N ND1   . HIS C 3 27  ? 76.763  16.271 44.055  1.00 44.28  ? 27   HIS A ND1   1 
ATOM   811  C CD2   . HIS C 3 27  ? 77.675  14.993 42.537  1.00 41.61  ? 27   HIS A CD2   1 
ATOM   812  C CE1   . HIS C 3 27  ? 78.072  16.365 44.203  1.00 45.06  ? 27   HIS A CE1   1 
ATOM   813  N NE2   . HIS C 3 27  ? 78.650  15.600 43.295  1.00 43.77  ? 27   HIS A NE2   1 
ATOM   814  N N     . TYR C 3 28  ? 72.574  13.568 41.386  1.00 44.40  ? 28   TYR A N     1 
ATOM   815  C CA    . TYR C 3 28  ? 71.810  13.288 40.164  1.00 45.19  ? 28   TYR A CA    1 
ATOM   816  C C     . TYR C 3 28  ? 71.514  11.821 39.862  1.00 46.85  ? 28   TYR A C     1 
ATOM   817  O O     . TYR C 3 28  ? 70.499  11.506 39.215  1.00 46.97  ? 28   TYR A O     1 
ATOM   818  C CB    . TYR C 3 28  ? 72.529  13.882 38.948  1.00 40.67  ? 28   TYR A CB    1 
ATOM   819  C CG    . TYR C 3 28  ? 73.113  15.253 39.175  1.00 40.89  ? 28   TYR A CG    1 
ATOM   820  C CD1   . TYR C 3 28  ? 72.350  16.274 39.759  1.00 41.63  ? 28   TYR A CD1   1 
ATOM   821  C CD2   . TYR C 3 28  ? 74.429  15.542 38.795  1.00 38.06  ? 28   TYR A CD2   1 
ATOM   822  C CE1   . TYR C 3 28  ? 72.898  17.563 39.963  1.00 41.36  ? 28   TYR A CE1   1 
ATOM   823  C CE2   . TYR C 3 28  ? 74.973  16.807 38.981  1.00 37.67  ? 28   TYR A CE2   1 
ATOM   824  C CZ    . TYR C 3 28  ? 74.206  17.811 39.566  1.00 39.63  ? 28   TYR A CZ    1 
ATOM   825  O OH    . TYR C 3 28  ? 74.741  19.058 39.758  1.00 42.56  ? 28   TYR A OH    1 
ATOM   826  N N     . GLY C 3 29  ? 72.395  10.925 40.295  1.00 47.64  ? 29   GLY A N     1 
ATOM   827  C CA    . GLY C 3 29  ? 72.164  9.510  40.040  1.00 53.10  ? 29   GLY A CA    1 
ATOM   828  C C     . GLY C 3 29  ? 72.661  8.975  38.703  1.00 55.60  ? 29   GLY A C     1 
ATOM   829  O O     . GLY C 3 29  ? 72.822  9.712  37.725  1.00 55.82  ? 29   GLY A O     1 
ATOM   830  N N     . GLU C 3 30  ? 72.861  7.666  38.653  1.00 57.39  ? 30   GLU A N     1 
ATOM   831  C CA    . GLU C 3 30  ? 73.388  7.019  37.466  1.00 57.51  ? 30   GLU A CA    1 
ATOM   832  C C     . GLU C 3 30  ? 72.539  7.020  36.181  1.00 56.07  ? 30   GLU A C     1 
ATOM   833  O O     . GLU C 3 30  ? 72.985  6.576  35.135  1.00 57.17  ? 30   GLU A O     1 
ATOM   834  C CB    . GLU C 3 30  ? 73.792  5.587  37.820  1.00 58.99  ? 30   GLU A CB    1 
ATOM   835  C CG    . GLU C 3 30  ? 72.647  4.605  37.833  1.00 62.64  ? 30   GLU A CG    1 
ATOM   836  C CD    . GLU C 3 30  ? 73.090  3.221  37.411  1.00 63.36  ? 30   GLU A CD    1 
ATOM   837  O OE1   . GLU C 3 30  ? 73.710  2.509  38.231  1.00 63.60  ? 30   GLU A OE1   1 
ATOM   838  O OE2   . GLU C 3 30  ? 72.830  2.860  36.246  1.00 61.52  ? 30   GLU A OE2   1 
ATOM   839  N N     . ARG C 3 31  ? 71.314  7.494  36.218  1.00 54.78  ? 31   ARG A N     1 
ATOM   840  C CA    . ARG C 3 31  ? 70.574  7.487  34.974  1.00 54.23  ? 31   ARG A CA    1 
ATOM   841  C C     . ARG C 3 31  ? 70.884  8.777  34.194  1.00 54.01  ? 31   ARG A C     1 
ATOM   842  O O     . ARG C 3 31  ? 71.213  8.731  33.000  1.00 51.77  ? 31   ARG A O     1 
ATOM   843  C CB    . ARG C 3 31  ? 69.097  7.356  35.268  1.00 57.82  ? 31   ARG A CB    1 
ATOM   844  C CG    . ARG C 3 31  ? 68.200  7.386  34.065  1.00 61.77  ? 31   ARG A CG    1 
ATOM   845  C CD    . ARG C 3 31  ? 66.806  7.055  34.522  1.00 68.81  ? 31   ARG A CD    1 
ATOM   846  N NE    . ARG C 3 31  ? 65.791  7.309  33.512  1.00 75.01  ? 31   ARG A NE    1 
ATOM   847  C CZ    . ARG C 3 31  ? 64.521  6.925  33.630  1.00 78.73  ? 31   ARG A CZ    1 
ATOM   848  N NH1   . ARG C 3 31  ? 64.123  6.265  34.715  1.00 79.33  ? 31   ARG A NH1   1 
ATOM   849  N NH2   . ARG C 3 31  ? 63.643  7.211  32.672  1.00 79.56  ? 31   ARG A NH2   1 
ATOM   850  N N     . LEU C 3 32  ? 70.805  9.923  34.874  1.00 51.93  ? 32   LEU A N     1 
ATOM   851  C CA    . LEU C 3 32  ? 71.095  11.196 34.228  1.00 49.74  ? 32   LEU A CA    1 
ATOM   852  C C     . LEU C 3 32  ? 72.589  11.326 33.999  1.00 46.94  ? 32   LEU A C     1 
ATOM   853  O O     . LEU C 3 32  ? 73.036  11.893 33.001  1.00 46.81  ? 32   LEU A O     1 
ATOM   854  C CB    . LEU C 3 32  ? 70.604  12.370 35.074  1.00 51.98  ? 32   LEU A CB    1 
ATOM   855  C CG    . LEU C 3 32  ? 69.097  12.601 35.081  1.00 53.44  ? 32   LEU A CG    1 
ATOM   856  C CD1   . LEU C 3 32  ? 68.787  13.770 35.992  1.00 55.06  ? 32   LEU A CD1   1 
ATOM   857  C CD2   . LEU C 3 32  ? 68.598  12.861 33.672  1.00 51.49  ? 32   LEU A CD2   1 
ATOM   858  N N     . ALA C 3 33  ? 73.364  10.799 34.929  1.00 42.25  ? 33   ALA A N     1 
ATOM   859  C CA    . ALA C 3 33  ? 74.806  10.857 34.792  1.00 40.78  ? 33   ALA A CA    1 
ATOM   860  C C     . ALA C 3 33  ? 75.232  10.158 33.502  1.00 42.09  ? 33   ALA A C     1 
ATOM   861  O O     . ALA C 3 33  ? 76.047  10.680 32.759  1.00 42.72  ? 33   ALA A O     1 
ATOM   862  C CB    . ALA C 3 33  ? 75.474  10.208 35.996  1.00 41.40  ? 33   ALA A CB    1 
ATOM   863  N N     . ARG C 3 34  ? 74.664  8.985  33.232  1.00 43.75  ? 34   ARG A N     1 
ATOM   864  C CA    . ARG C 3 34  ? 74.993  8.224  32.029  1.00 45.05  ? 34   ARG A CA    1 
ATOM   865  C C     . ARG C 3 34  ? 74.521  8.953  30.786  1.00 43.74  ? 34   ARG A C     1 
ATOM   866  O O     . ARG C 3 34  ? 75.246  9.047  29.798  1.00 44.30  ? 34   ARG A O     1 
ATOM   867  C CB    . ARG C 3 34  ? 74.331  6.851  32.072  1.00 46.95  ? 34   ARG A CB    1 
ATOM   868  C CG    . ARG C 3 34  ? 74.418  6.076  30.781  1.00 48.69  ? 34   ARG A CG    1 
ATOM   869  C CD    . ARG C 3 34  ? 73.854  4.693  31.006  1.00 50.89  ? 34   ARG A CD    1 
ATOM   870  N NE    . ARG C 3 34  ? 74.563  4.054  32.106  1.00 51.81  ? 34   ARG A NE    1 
ATOM   871  C CZ    . ARG C 3 34  ? 74.035  3.140  32.910  1.00 51.22  ? 34   ARG A CZ    1 
ATOM   872  N NH1   . ARG C 3 34  ? 72.775  2.751  32.743  1.00 47.27  ? 34   ARG A NH1   1 
ATOM   873  N NH2   . ARG C 3 34  ? 74.779  2.616  33.879  1.00 50.78  ? 34   ARG A NH2   1 
ATOM   874  N N     . GLU C 3 35  ? 73.298  9.464  30.853  1.00 43.27  ? 35   GLU A N     1 
ATOM   875  C CA    . GLU C 3 35  ? 72.705  10.209 29.751  1.00 44.09  ? 35   GLU A CA    1 
ATOM   876  C C     . GLU C 3 35  ? 73.490  11.480 29.405  1.00 40.95  ? 35   GLU A C     1 
ATOM   877  O O     . GLU C 3 35  ? 73.701  11.766 28.243  1.00 39.48  ? 35   GLU A O     1 
ATOM   878  C CB    . GLU C 3 35  ? 71.258  10.574 30.078  1.00 47.11  ? 35   GLU A CB    1 
ATOM   879  C CG    . GLU C 3 35  ? 70.551  11.280 28.954  1.00 54.98  ? 35   GLU A CG    1 
ATOM   880  C CD    . GLU C 3 35  ? 69.164  11.748 29.340  1.00 59.59  ? 35   GLU A CD    1 
ATOM   881  O OE1   . GLU C 3 35  ? 68.401  10.960 29.947  1.00 59.70  ? 35   GLU A OE1   1 
ATOM   882  O OE2   . GLU C 3 35  ? 68.832  12.905 29.022  1.00 63.85  ? 35   GLU A OE2   1 
ATOM   883  N N     . GLN C 3 36  ? 73.939  12.229 30.407  1.00 38.83  ? 36   GLN A N     1 
ATOM   884  C CA    . GLN C 3 36  ? 74.693  13.435 30.116  1.00 38.28  ? 36   GLN A CA    1 
ATOM   885  C C     . GLN C 3 36  ? 76.024  13.160 29.384  1.00 38.88  ? 36   GLN A C     1 
ATOM   886  O O     . GLN C 3 36  ? 76.405  13.904 28.460  1.00 40.51  ? 36   GLN A O     1 
ATOM   887  C CB    . GLN C 3 36  ? 74.931  14.228 31.404  1.00 36.81  ? 36   GLN A CB    1 
ATOM   888  C CG    . GLN C 3 36  ? 75.918  15.392 31.290  1.00 33.59  ? 36   GLN A CG    1 
ATOM   889  C CD    . GLN C 3 36  ? 75.421  16.540 30.425  1.00 32.94  ? 36   GLN A CD    1 
ATOM   890  O OE1   . GLN C 3 36  ? 76.216  17.207 29.755  1.00 32.20  ? 36   GLN A OE1   1 
ATOM   891  N NE2   . GLN C 3 36  ? 74.117  16.782 30.442  1.00 31.57  ? 36   GLN A NE2   1 
ATOM   892  N N     . LEU C 3 37  ? 76.732  12.104 29.759  1.00 34.69  ? 37   LEU A N     1 
ATOM   893  C CA    . LEU C 3 37  ? 77.997  11.833 29.088  1.00 34.44  ? 37   LEU A CA    1 
ATOM   894  C C     . LEU C 3 37  ? 77.750  11.210 27.709  1.00 35.98  ? 37   LEU A C     1 
ATOM   895  O O     . LEU C 3 37  ? 78.487  11.459 26.754  1.00 34.26  ? 37   LEU A O     1 
ATOM   896  C CB    . LEU C 3 37  ? 78.872  10.925 29.960  1.00 35.76  ? 37   LEU A CB    1 
ATOM   897  C CG    . LEU C 3 37  ? 79.261  11.535 31.309  1.00 36.21  ? 37   LEU A CG    1 
ATOM   898  C CD1   . LEU C 3 37  ? 79.717  10.450 32.271  1.00 40.79  ? 37   LEU A CD1   1 
ATOM   899  C CD2   . LEU C 3 37  ? 80.329  12.562 31.116  1.00 40.08  ? 37   LEU A CD2   1 
ATOM   900  N N     . ALA C 3 38  ? 76.705  10.399 27.601  1.00 37.19  ? 38   ALA A N     1 
ATOM   901  C CA    . ALA C 3 38  ? 76.392  9.795  26.321  1.00 39.72  ? 38   ALA A CA    1 
ATOM   902  C C     . ALA C 3 38  ? 76.029  10.935 25.355  1.00 40.06  ? 38   ALA A C     1 
ATOM   903  O O     . ALA C 3 38  ? 76.372  10.906 24.174  1.00 44.76  ? 38   ALA A O     1 
ATOM   904  C CB    . ALA C 3 38  ? 75.229  8.833  26.468  1.00 39.42  ? 38   ALA A CB    1 
ATOM   905  N N     . LEU C 3 39  ? 75.342  11.939 25.882  1.00 38.83  ? 39   LEU A N     1 
ATOM   906  C CA    . LEU C 3 39  ? 74.936  13.108 25.113  1.00 37.01  ? 39   LEU A CA    1 
ATOM   907  C C     . LEU C 3 39  ? 76.184  13.850 24.602  1.00 36.03  ? 39   LEU A C     1 
ATOM   908  O O     . LEU C 3 39  ? 76.284  14.192 23.422  1.00 34.74  ? 39   LEU A O     1 
ATOM   909  C CB    . LEU C 3 39  ? 74.120  14.041 25.998  1.00 38.14  ? 39   LEU A CB    1 
ATOM   910  C CG    . LEU C 3 39  ? 73.377  15.171 25.292  1.00 42.03  ? 39   LEU A CG    1 
ATOM   911  C CD1   . LEU C 3 39  ? 72.408  14.594 24.249  1.00 42.42  ? 39   LEU A CD1   1 
ATOM   912  C CD2   . LEU C 3 39  ? 72.616  15.978 26.323  1.00 41.89  ? 39   LEU A CD2   1 
ATOM   913  N N     . GLU C 3 40  ? 77.138  14.092 25.491  1.00 32.25  ? 40   GLU A N     1 
ATOM   914  C CA    . GLU C 3 40  ? 78.341  14.782 25.085  1.00 33.39  ? 40   GLU A CA    1 
ATOM   915  C C     . GLU C 3 40  ? 79.149  13.987 24.054  1.00 34.01  ? 40   GLU A C     1 
ATOM   916  O O     . GLU C 3 40  ? 79.743  14.576 23.149  1.00 31.89  ? 40   GLU A O     1 
ATOM   917  C CB    . GLU C 3 40  ? 79.181  15.135 26.319  1.00 35.35  ? 40   GLU A CB    1 
ATOM   918  C CG    . GLU C 3 40  ? 78.501  16.203 27.233  1.00 37.64  ? 40   GLU A CG    1 
ATOM   919  C CD    . GLU C 3 40  ? 79.351  16.612 28.446  1.00 39.27  ? 40   GLU A CD    1 
ATOM   920  O OE1   . GLU C 3 40  ? 80.577  16.783 28.279  1.00 38.67  ? 40   GLU A OE1   1 
ATOM   921  O OE2   . GLU C 3 40  ? 78.793  16.782 29.560  1.00 33.94  ? 40   GLU A OE2   1 
ATOM   922  N N     . HIS C 3 41  ? 79.129  12.655 24.136  1.00 34.82  ? 41   HIS A N     1 
ATOM   923  C CA    . HIS C 3 41  ? 79.889  11.849 23.181  1.00 36.81  ? 41   HIS A CA    1 
ATOM   924  C C     . HIS C 3 41  ? 79.335  11.868 21.754  1.00 38.70  ? 41   HIS A C     1 
ATOM   925  O O     . HIS C 3 41  ? 80.047  11.550 20.794  1.00 38.98  ? 41   HIS A O     1 
ATOM   926  C CB    . HIS C 3 41  ? 80.032  10.408 23.690  1.00 41.08  ? 41   HIS A CB    1 
ATOM   927  C CG    . HIS C 3 41  ? 80.934  10.284 24.881  1.00 42.10  ? 41   HIS A CG    1 
ATOM   928  N ND1   . HIS C 3 41  ? 81.406  9.072  25.337  1.00 42.59  ? 41   HIS A ND1   1 
ATOM   929  C CD2   . HIS C 3 41  ? 81.425  11.223 25.725  1.00 42.06  ? 41   HIS A CD2   1 
ATOM   930  C CE1   . HIS C 3 41  ? 82.145  9.269  26.415  1.00 46.21  ? 41   HIS A CE1   1 
ATOM   931  N NE2   . HIS C 3 41  ? 82.173  10.567 26.671  1.00 46.24  ? 41   HIS A NE2   1 
ATOM   932  N N     . GLU C 3 42  ? 78.072  12.254 21.608  1.00 39.68  ? 42   GLU A N     1 
ATOM   933  C CA    . GLU C 3 42  ? 77.452  12.362 20.288  1.00 40.68  ? 42   GLU A CA    1 
ATOM   934  C C     . GLU C 3 42  ? 78.159  13.422 19.446  1.00 40.22  ? 42   GLU A C     1 
ATOM   935  O O     . GLU C 3 42  ? 77.892  13.547 18.263  1.00 40.40  ? 42   GLU A O     1 
ATOM   936  C CB    . GLU C 3 42  ? 75.988  12.770 20.404  1.00 44.17  ? 42   GLU A CB    1 
ATOM   937  C CG    . GLU C 3 42  ? 75.065  11.725 20.957  1.00 47.93  ? 42   GLU A CG    1 
ATOM   938  C CD    . GLU C 3 42  ? 73.709  12.304 21.254  1.00 51.78  ? 42   GLU A CD    1 
ATOM   939  O OE1   . GLU C 3 42  ? 73.178  13.055 20.406  1.00 52.20  ? 42   GLU A OE1   1 
ATOM   940  O OE2   . GLU C 3 42  ? 73.165  12.010 22.335  1.00 58.04  ? 42   GLU A OE2   1 
ATOM   941  N N     . SER C 3 43  ? 79.030  14.212 20.060  1.00 39.49  ? 43   SER A N     1 
ATOM   942  C CA    . SER C 3 43  ? 79.749  15.233 19.305  1.00 41.90  ? 43   SER A CA    1 
ATOM   943  C C     . SER C 3 43  ? 80.915  14.618 18.537  1.00 41.26  ? 43   SER A C     1 
ATOM   944  O O     . SER C 3 43  ? 81.573  15.306 17.754  1.00 40.80  ? 43   SER A O     1 
ATOM   945  C CB    . SER C 3 43  ? 80.297  16.325 20.229  1.00 41.45  ? 43   SER A CB    1 
ATOM   946  O OG    . SER C 3 43  ? 79.261  16.939 20.970  1.00 46.50  ? 43   SER A OG    1 
ATOM   947  N N     . TYR C 3 44  ? 81.180  13.336 18.763  1.00 42.24  ? 44   TYR A N     1 
ATOM   948  C CA    . TYR C 3 44  ? 82.287  12.702 18.076  1.00 44.32  ? 44   TYR A CA    1 
ATOM   949  C C     . TYR C 3 44  ? 81.921  11.415 17.399  1.00 46.04  ? 44   TYR A C     1 
ATOM   950  O O     . TYR C 3 44  ? 82.546  11.048 16.406  1.00 46.62  ? 44   TYR A O     1 
ATOM   951  C CB    . TYR C 3 44  ? 83.442  12.401 19.033  1.00 45.67  ? 44   TYR A CB    1 
ATOM   952  C CG    . TYR C 3 44  ? 83.928  13.595 19.799  1.00 45.94  ? 44   TYR A CG    1 
ATOM   953  C CD1   . TYR C 3 44  ? 83.318  13.974 20.983  1.00 46.16  ? 44   TYR A CD1   1 
ATOM   954  C CD2   . TYR C 3 44  ? 84.936  14.400 19.289  1.00 46.99  ? 44   TYR A CD2   1 
ATOM   955  C CE1   . TYR C 3 44  ? 83.687  15.135 21.636  1.00 49.93  ? 44   TYR A CE1   1 
ATOM   956  C CE2   . TYR C 3 44  ? 85.316  15.570 19.935  1.00 50.78  ? 44   TYR A CE2   1 
ATOM   957  C CZ    . TYR C 3 44  ? 84.683  15.934 21.102  1.00 48.37  ? 44   TYR A CZ    1 
ATOM   958  O OH    . TYR C 3 44  ? 85.010  17.119 21.706  1.00 49.84  ? 44   TYR A OH    1 
ATOM   959  N N     . GLU C 3 45  ? 80.915  10.728 17.923  1.00 48.85  ? 45   GLU A N     1 
ATOM   960  C CA    . GLU C 3 45  ? 80.538  9.437  17.372  1.00 49.50  ? 45   GLU A CA    1 
ATOM   961  C C     . GLU C 3 45  ? 79.090  9.079  17.690  1.00 53.06  ? 45   GLU A C     1 
ATOM   962  O O     . GLU C 3 45  ? 78.619  9.282  18.811  1.00 53.12  ? 45   GLU A O     1 
ATOM   963  C CB    . GLU C 3 45  ? 81.463  8.364  17.948  1.00 48.52  ? 45   GLU A CB    1 
ATOM   964  C CG    . GLU C 3 45  ? 81.476  7.075  17.170  1.00 51.65  ? 45   GLU A CG    1 
ATOM   965  C CD    . GLU C 3 45  ? 82.358  6.007  17.793  1.00 52.95  ? 45   GLU A CD    1 
ATOM   966  O OE1   . GLU C 3 45  ? 83.455  6.337  18.297  1.00 52.33  ? 45   GLU A OE1   1 
ATOM   967  O OE2   . GLU C 3 45  ? 81.956  4.822  17.762  1.00 57.42  ? 45   GLU A OE2   1 
ATOM   968  N N     . MET C 3 46  ? 78.385  8.538  16.704  1.00 57.01  ? 46   MET A N     1 
ATOM   969  C CA    . MET C 3 46  ? 76.999  8.152  16.905  1.00 61.91  ? 46   MET A CA    1 
ATOM   970  C C     . MET C 3 46  ? 76.903  6.775  17.521  1.00 64.16  ? 46   MET A C     1 
ATOM   971  O O     . MET C 3 46  ? 77.372  5.795  16.947  1.00 63.22  ? 46   MET A O     1 
ATOM   972  C CB    . MET C 3 46  ? 76.229  8.170  15.582  1.00 63.11  ? 46   MET A CB    1 
ATOM   973  C CG    . MET C 3 46  ? 74.816  7.596  15.700  1.00 64.61  ? 46   MET A CG    1 
ATOM   974  S SD    . MET C 3 46  ? 73.689  8.213  14.434  1.00 64.43  ? 46   MET A SD    1 
ATOM   975  C CE    . MET C 3 46  ? 72.433  8.894  15.438  1.00 65.07  ? 46   MET A CE    1 
ATOM   976  N N     . GLY C 3 47  ? 76.290  6.705  18.696  1.00 69.49  ? 47   GLY A N     1 
ATOM   977  C CA    . GLY C 3 47  ? 76.142  5.426  19.370  1.00 75.05  ? 47   GLY A CA    1 
ATOM   978  C C     . GLY C 3 47  ? 75.493  4.346  18.520  1.00 77.00  ? 47   GLY A C     1 
ATOM   979  O O     . GLY C 3 47  ? 74.570  4.615  17.755  1.00 77.87  ? 47   GLY A O     1 
ATOM   980  N N     . GLU C 3 48  ? 75.988  3.120  18.651  1.00 80.27  ? 48   GLU A N     1 
ATOM   981  C CA    . GLU C 3 48  ? 75.451  1.984  17.909  1.00 83.05  ? 48   GLU A CA    1 
ATOM   982  C C     . GLU C 3 48  ? 73.997  1.765  18.314  1.00 83.18  ? 48   GLU A C     1 
ATOM   983  O O     . GLU C 3 48  ? 73.188  1.266  17.531  1.00 84.07  ? 48   GLU A O     1 
ATOM   984  C CB    . GLU C 3 48  ? 76.281  0.727  18.211  1.00 86.01  ? 48   GLU A CB    1 
ATOM   985  C CG    . GLU C 3 48  ? 75.557  -0.613 18.008  1.00 90.27  ? 48   GLU A CG    1 
ATOM   986  C CD    . GLU C 3 48  ? 75.010  -0.804 16.598  1.00 91.76  ? 48   GLU A CD    1 
ATOM   987  O OE1   . GLU C 3 48  ? 75.794  -0.686 15.634  1.00 91.56  ? 48   GLU A OE1   1 
ATOM   988  O OE2   . GLU C 3 48  ? 73.797  -1.081 16.457  1.00 93.13  ? 48   GLU A OE2   1 
ATOM   989  N N     . ALA C 3 49  ? 73.677  2.158  19.543  1.00 83.32  ? 49   ALA A N     1 
ATOM   990  C CA    . ALA C 3 49  ? 72.333  2.010  20.087  1.00 81.91  ? 49   ALA A CA    1 
ATOM   991  C C     . ALA C 3 49  ? 71.335  2.921  19.405  1.00 80.76  ? 49   ALA A C     1 
ATOM   992  O O     . ALA C 3 49  ? 70.231  2.494  19.080  1.00 81.72  ? 49   ALA A O     1 
ATOM   993  C CB    . ALA C 3 49  ? 72.342  2.295  21.591  1.00 82.72  ? 49   ALA A CB    1 
ATOM   994  N N     . ARG C 3 50  ? 71.717  4.179  19.201  1.00 79.96  ? 50   ARG A N     1 
ATOM   995  C CA    . ARG C 3 50  ? 70.828  5.150  18.571  1.00 78.79  ? 50   ARG A CA    1 
ATOM   996  C C     . ARG C 3 50  ? 70.621  4.901  17.089  1.00 76.62  ? 50   ARG A C     1 
ATOM   997  O O     . ARG C 3 50  ? 69.498  4.967  16.592  1.00 75.43  ? 50   ARG A O     1 
ATOM   998  C CB    . ARG C 3 50  ? 71.362  6.577  18.758  1.00 81.52  ? 50   ARG A CB    1 
ATOM   999  C CG    . ARG C 3 50  ? 71.036  7.227  20.096  1.00 84.22  ? 50   ARG A CG    1 
ATOM   1000 C CD    . ARG C 3 50  ? 71.793  6.595  21.251  1.00 86.95  ? 50   ARG A CD    1 
ATOM   1001 N NE    . ARG C 3 50  ? 71.464  7.241  22.522  1.00 89.74  ? 50   ARG A NE    1 
ATOM   1002 C CZ    . ARG C 3 50  ? 72.060  6.970  23.681  1.00 90.78  ? 50   ARG A CZ    1 
ATOM   1003 N NH1   . ARG C 3 50  ? 73.024  6.058  23.738  1.00 92.39  ? 50   ARG A NH1   1 
ATOM   1004 N NH2   . ARG C 3 50  ? 71.693  7.614  24.785  1.00 90.31  ? 50   ARG A NH2   1 
ATOM   1005 N N     . PHE C 3 51  ? 71.717  4.610  16.397  1.00 74.65  ? 51   PHE A N     1 
ATOM   1006 C CA    . PHE C 3 51  ? 71.705  4.383  14.954  1.00 74.49  ? 51   PHE A CA    1 
ATOM   1007 C C     . PHE C 3 51  ? 70.868  3.203  14.474  1.00 75.11  ? 51   PHE A C     1 
ATOM   1008 O O     . PHE C 3 51  ? 69.962  3.361  13.653  1.00 73.31  ? 51   PHE A O     1 
ATOM   1009 C CB    . PHE C 3 51  ? 73.132  4.196  14.446  1.00 72.45  ? 51   PHE A CB    1 
ATOM   1010 C CG    . PHE C 3 51  ? 73.231  4.137  12.955  1.00 72.74  ? 51   PHE A CG    1 
ATOM   1011 C CD1   . PHE C 3 51  ? 73.076  5.286  12.192  1.00 72.25  ? 51   PHE A CD1   1 
ATOM   1012 C CD2   . PHE C 3 51  ? 73.462  2.931  12.311  1.00 72.94  ? 51   PHE A CD2   1 
ATOM   1013 C CE1   . PHE C 3 51  ? 73.149  5.236  10.810  1.00 73.15  ? 51   PHE A CE1   1 
ATOM   1014 C CE2   . PHE C 3 51  ? 73.537  2.868  10.925  1.00 73.43  ? 51   PHE A CE2   1 
ATOM   1015 C CZ    . PHE C 3 51  ? 73.381  4.024  10.173  1.00 74.29  ? 51   PHE A CZ    1 
ATOM   1016 N N     . ARG C 3 52  ? 71.200  2.020  14.976  1.00 76.23  ? 52   ARG A N     1 
ATOM   1017 C CA    . ARG C 3 52  ? 70.517  0.790  14.602  1.00 76.83  ? 52   ARG A CA    1 
ATOM   1018 C C     . ARG C 3 52  ? 69.022  0.831  14.965  1.00 76.58  ? 52   ARG A C     1 
ATOM   1019 O O     . ARG C 3 52  ? 68.185  0.199  14.311  1.00 75.57  ? 52   ARG A O     1 
ATOM   1020 C CB    . ARG C 3 52  ? 71.229  -0.389 15.283  1.00 78.66  ? 52   ARG A CB    1 
ATOM   1021 C CG    . ARG C 3 52  ? 70.650  -1.749 14.991  1.00 80.98  ? 52   ARG A CG    1 
ATOM   1022 C CD    . ARG C 3 52  ? 70.651  -2.052 13.511  1.00 80.81  ? 52   ARG A CD    1 
ATOM   1023 N NE    . ARG C 3 52  ? 69.824  -3.224 13.244  1.00 84.59  ? 52   ARG A NE    1 
ATOM   1024 C CZ    . ARG C 3 52  ? 69.539  -3.681 12.031  1.00 84.71  ? 52   ARG A CZ    1 
ATOM   1025 N NH1   . ARG C 3 52  ? 70.019  -3.061 10.959  1.00 86.51  ? 52   ARG A NH1   1 
ATOM   1026 N NH2   . ARG C 3 52  ? 68.770  -4.753 11.892  1.00 84.00  ? 52   ARG A NH2   1 
ATOM   1027 N N     . LYS C 3 53  ? 68.696  1.601  15.998  1.00 76.48  ? 53   LYS A N     1 
ATOM   1028 C CA    . LYS C 3 53  ? 67.319  1.744  16.465  1.00 77.24  ? 53   LYS A CA    1 
ATOM   1029 C C     . LYS C 3 53  ? 66.420  2.437  15.433  1.00 76.04  ? 53   LYS A C     1 
ATOM   1030 O O     . LYS C 3 53  ? 65.199  2.247  15.422  1.00 75.87  ? 53   LYS A O     1 
ATOM   1031 C CB    . LYS C 3 53  ? 67.314  2.541  17.782  1.00 78.78  ? 53   LYS A CB    1 
ATOM   1032 C CG    . LYS C 3 53  ? 65.942  2.823  18.374  1.00 80.44  ? 53   LYS A CG    1 
ATOM   1033 C CD    . LYS C 3 53  ? 66.054  3.671  19.639  1.00 81.96  ? 53   LYS A CD    1 
ATOM   1034 C CE    . LYS C 3 53  ? 64.676  4.018  20.194  1.00 83.77  ? 53   LYS A CE    1 
ATOM   1035 N NZ    . LYS C 3 53  ? 64.753  4.849  21.434  1.00 82.44  ? 53   LYS A NZ    1 
ATOM   1036 N N     . MET C 3 54  ? 67.037  3.220  14.555  1.00 74.61  ? 54   MET A N     1 
ATOM   1037 C CA    . MET C 3 54  ? 66.308  3.984  13.549  1.00 73.18  ? 54   MET A CA    1 
ATOM   1038 C C     . MET C 3 54  ? 65.822  3.231  12.302  1.00 71.96  ? 54   MET A C     1 
ATOM   1039 O O     . MET C 3 54  ? 65.227  3.840  11.407  1.00 71.21  ? 54   MET A O     1 
ATOM   1040 C CB    . MET C 3 54  ? 67.161  5.181  13.116  1.00 73.56  ? 54   MET A CB    1 
ATOM   1041 C CG    . MET C 3 54  ? 67.656  6.038  14.271  1.00 72.21  ? 54   MET A CG    1 
ATOM   1042 S SD    . MET C 3 54  ? 68.563  7.491  13.708  1.00 71.37  ? 54   MET A SD    1 
ATOM   1043 C CE    . MET C 3 54  ? 67.420  8.791  14.168  1.00 71.36  ? 54   MET A CE    1 
ATOM   1044 N N     . PHE C 3 55  ? 66.063  1.922  12.239  1.00 69.78  ? 55   PHE A N     1 
ATOM   1045 C CA    . PHE C 3 55  ? 65.644  1.132  11.082  1.00 67.95  ? 55   PHE A CA    1 
ATOM   1046 C C     . PHE C 3 55  ? 64.309  0.402  11.243  1.00 67.71  ? 55   PHE A C     1 
ATOM   1047 O O     . PHE C 3 55  ? 63.931  0.112  12.398  1.00 70.00  ? 55   PHE A O     1 
ATOM   1048 C CB    . PHE C 3 55  ? 66.739  0.124  10.710  1.00 65.47  ? 55   PHE A CB    1 
ATOM   1049 C CG    . PHE C 3 55  ? 67.963  0.756  10.116  1.00 61.98  ? 55   PHE A CG    1 
ATOM   1050 C CD1   . PHE C 3 55  ? 68.913  1.355  10.925  1.00 60.31  ? 55   PHE A CD1   1 
ATOM   1051 C CD2   . PHE C 3 55  ? 68.146  0.783  8.740   1.00 60.67  ? 55   PHE A CD2   1 
ATOM   1052 C CE1   . PHE C 3 55  ? 70.032  1.975  10.372  1.00 59.17  ? 55   PHE A CE1   1 
ATOM   1053 C CE2   . PHE C 3 55  ? 69.261  1.404  8.181   1.00 60.02  ? 55   PHE A CE2   1 
ATOM   1054 C CZ    . PHE C 3 55  ? 70.204  1.999  9.001   1.00 58.70  ? 55   PHE A CZ    1 
ATOM   1055 N N     . PRO C 3 72  ? 65.109  8.865  8.014   1.00 36.75  ? 72   PRO A N     1 
ATOM   1056 C CA    . PRO C 3 72  ? 66.136  9.805  8.566   1.00 38.29  ? 72   PRO A CA    1 
ATOM   1057 C C     . PRO C 3 72  ? 67.418  9.672  7.752   1.00 37.53  ? 72   PRO A C     1 
ATOM   1058 O O     . PRO C 3 72  ? 67.983  8.584  7.649   1.00 37.10  ? 72   PRO A O     1 
ATOM   1059 C CB    . PRO C 3 72  ? 66.393  9.418  10.028  1.00 36.92  ? 72   PRO A CB    1 
ATOM   1060 C CG    . PRO C 3 72  ? 65.135  8.633  10.360  1.00 36.68  ? 72   PRO A CG    1 
ATOM   1061 C CD    . PRO C 3 72  ? 64.766  7.878  9.051   1.00 37.33  ? 72   PRO A CD    1 
ATOM   1062 N N     . LEU C 3 73  ? 67.845  10.788 7.171   1.00 35.96  ? 73   LEU A N     1 
ATOM   1063 C CA    . LEU C 3 73  ? 69.034  10.879 6.339   1.00 33.74  ? 73   LEU A CA    1 
ATOM   1064 C C     . LEU C 3 73  ? 70.326  10.238 6.856   1.00 32.50  ? 73   LEU A C     1 
ATOM   1065 O O     . LEU C 3 73  ? 71.128  9.745  6.072   1.00 33.86  ? 73   LEU A O     1 
ATOM   1066 C CB    . LEU C 3 73  ? 69.317  12.361 6.042   1.00 32.22  ? 73   LEU A CB    1 
ATOM   1067 C CG    . LEU C 3 73  ? 68.182  13.088 5.301   1.00 30.00  ? 73   LEU A CG    1 
ATOM   1068 C CD1   . LEU C 3 73  ? 68.389  14.612 5.297   1.00 28.41  ? 73   LEU A CD1   1 
ATOM   1069 C CD2   . LEU C 3 73  ? 68.131  12.550 3.876   1.00 28.39  ? 73   LEU A CD2   1 
ATOM   1070 N N     . ILE C 3 74  ? 70.544  10.250 8.161   1.00 32.01  ? 74   ILE A N     1 
ATOM   1071 C CA    . ILE C 3 74  ? 71.799  9.723  8.693   1.00 31.39  ? 74   ILE A CA    1 
ATOM   1072 C C     . ILE C 3 74  ? 71.878  8.195  8.570   1.00 35.22  ? 74   ILE A C     1 
ATOM   1073 O O     . ILE C 3 74  ? 72.950  7.610  8.814   1.00 33.28  ? 74   ILE A O     1 
ATOM   1074 C CB    . ILE C 3 74  ? 71.996  10.155 10.179  1.00 30.43  ? 74   ILE A CB    1 
ATOM   1075 C CG1   . ILE C 3 74  ? 73.423  9.842  10.648  1.00 28.09  ? 74   ILE A CG1   1 
ATOM   1076 C CG2   . ILE C 3 74  ? 70.979  9.437  11.094  1.00 30.22  ? 74   ILE A CG2   1 
ATOM   1077 C CD1   . ILE C 3 74  ? 74.504  10.747 10.062  1.00 29.23  ? 74   ILE A CD1   1 
ATOM   1078 N N     . THR C 3 75  ? 70.750  7.562  8.212   1.00 33.14  ? 75   THR A N     1 
ATOM   1079 C CA    . THR C 3 75  ? 70.734  6.121  8.067   1.00 35.31  ? 75   THR A CA    1 
ATOM   1080 C C     . THR C 3 75  ? 71.353  5.704  6.746   1.00 36.25  ? 75   THR A C     1 
ATOM   1081 O O     . THR C 3 75  ? 71.745  4.554  6.591   1.00 35.68  ? 75   THR A O     1 
ATOM   1082 C CB    . THR C 3 75  ? 69.308  5.504  8.240   1.00 34.98  ? 75   THR A CB    1 
ATOM   1083 O OG1   . THR C 3 75  ? 68.339  6.244  7.484   1.00 39.02  ? 75   THR A OG1   1 
ATOM   1084 C CG2   . THR C 3 75  ? 68.921  5.515  9.698   1.00 36.03  ? 75   THR A CG2   1 
ATOM   1085 N N     . THR C 3 76  ? 71.458  6.636  5.803   1.00 36.90  ? 76   THR A N     1 
ATOM   1086 C CA    . THR C 3 76  ? 72.112  6.338  4.534   1.00 40.63  ? 76   THR A CA    1 
ATOM   1087 C C     . THR C 3 76  ? 73.479  7.033  4.533   1.00 39.83  ? 76   THR A C     1 
ATOM   1088 O O     . THR C 3 76  ? 74.511  6.394  4.335   1.00 43.87  ? 76   THR A O     1 
ATOM   1089 C CB    . THR C 3 76  ? 71.294  6.827  3.338   1.00 43.49  ? 76   THR A CB    1 
ATOM   1090 O OG1   . THR C 3 76  ? 71.035  8.222  3.483   1.00 49.66  ? 76   THR A OG1   1 
ATOM   1091 C CG2   . THR C 3 76  ? 69.965  6.080  3.258   1.00 47.34  ? 76   THR A CG2   1 
ATOM   1092 N N     . LEU C 3 77  ? 73.479  8.335  4.786   1.00 38.25  ? 77   LEU A N     1 
ATOM   1093 C CA    . LEU C 3 77  ? 74.702  9.136  4.830   1.00 35.57  ? 77   LEU A CA    1 
ATOM   1094 C C     . LEU C 3 77  ? 75.867  8.459  5.573   1.00 35.98  ? 77   LEU A C     1 
ATOM   1095 O O     . LEU C 3 77  ? 76.937  8.251  5.010   1.00 33.85  ? 77   LEU A O     1 
ATOM   1096 C CB    . LEU C 3 77  ? 74.404  10.494 5.488   1.00 32.71  ? 77   LEU A CB    1 
ATOM   1097 C CG    . LEU C 3 77  ? 74.131  11.776 4.675   1.00 35.09  ? 77   LEU A CG    1 
ATOM   1098 C CD1   . LEU C 3 77  ? 73.542  11.491 3.308   1.00 36.87  ? 77   LEU A CD1   1 
ATOM   1099 C CD2   . LEU C 3 77  ? 73.201  12.653 5.482   1.00 32.00  ? 77   LEU A CD2   1 
ATOM   1100 N N     . LEU C 3 78  ? 75.654  8.107  6.835   1.00 35.35  ? 78   LEU A N     1 
ATOM   1101 C CA    . LEU C 3 78  ? 76.709  7.506  7.631   1.00 35.25  ? 78   LEU A CA    1 
ATOM   1102 C C     . LEU C 3 78  ? 77.356  6.268  6.976   1.00 37.16  ? 78   LEU A C     1 
ATOM   1103 O O     . LEU C 3 78  ? 78.539  6.290  6.654   1.00 40.05  ? 78   LEU A O     1 
ATOM   1104 C CB    . LEU C 3 78  ? 76.176  7.198  9.028   1.00 30.14  ? 78   LEU A CB    1 
ATOM   1105 C CG    . LEU C 3 78  ? 77.220  6.787  10.068  1.00 33.82  ? 78   LEU A CG    1 
ATOM   1106 C CD1   . LEU C 3 78  ? 78.387  7.761  10.077  1.00 34.86  ? 78   LEU A CD1   1 
ATOM   1107 C CD2   . LEU C 3 78  ? 76.558  6.739  11.444  1.00 34.75  ? 78   LEU A CD2   1 
ATOM   1108 N N     . PRO C 3 79  ? 76.597  5.183  6.756   1.00 39.21  ? 79   PRO A N     1 
ATOM   1109 C CA    . PRO C 3 79  ? 77.243  4.019  6.124   1.00 40.11  ? 79   PRO A CA    1 
ATOM   1110 C C     . PRO C 3 79  ? 77.990  4.317  4.806   1.00 41.06  ? 79   PRO A C     1 
ATOM   1111 O O     . PRO C 3 79  ? 79.116  3.870  4.613   1.00 41.84  ? 79   PRO A O     1 
ATOM   1112 C CB    . PRO C 3 79  ? 76.079  3.025  5.939   1.00 39.59  ? 79   PRO A CB    1 
ATOM   1113 C CG    . PRO C 3 79  ? 74.845  3.911  5.927   1.00 39.78  ? 79   PRO A CG    1 
ATOM   1114 C CD    . PRO C 3 79  ? 75.164  4.925  7.004   1.00 38.38  ? 79   PRO A CD    1 
ATOM   1115 N N     . LYS C 3 80  ? 77.371  5.074  3.903   1.00 43.29  ? 80   LYS A N     1 
ATOM   1116 C CA    . LYS C 3 80  ? 78.019  5.400  2.634   1.00 42.34  ? 80   LYS A CA    1 
ATOM   1117 C C     . LYS C 3 80  ? 79.327  6.125  2.875   1.00 43.62  ? 80   LYS A C     1 
ATOM   1118 O O     . LYS C 3 80  ? 80.263  6.001  2.075   1.00 47.62  ? 80   LYS A O     1 
ATOM   1119 C CB    . LYS C 3 80  ? 77.155  6.323  1.765   1.00 43.08  ? 80   LYS A CB    1 
ATOM   1120 C CG    . LYS C 3 80  ? 76.129  5.677  0.852   1.00 46.69  ? 80   LYS A CG    1 
ATOM   1121 C CD    . LYS C 3 80  ? 74.850  5.321  1.574   1.00 52.70  ? 80   LYS A CD    1 
ATOM   1122 C CE    . LYS C 3 80  ? 73.757  4.934  0.579   1.00 56.02  ? 80   LYS A CE    1 
ATOM   1123 N NZ    . LYS C 3 80  ? 72.508  4.451  1.266   1.00 61.99  ? 80   LYS A NZ    1 
ATOM   1124 N N     . MET C 3 81  ? 79.385  6.895  3.965   1.00 40.87  ? 81   MET A N     1 
ATOM   1125 C CA    . MET C 3 81  ? 80.560  7.699  4.282   1.00 39.22  ? 81   MET A CA    1 
ATOM   1126 C C     . MET C 3 81  ? 81.640  6.895  4.986   1.00 38.53  ? 81   MET A C     1 
ATOM   1127 O O     . MET C 3 81  ? 82.824  7.052  4.696   1.00 32.29  ? 81   MET A O     1 
ATOM   1128 C CB    . MET C 3 81  ? 80.156  8.911  5.135   1.00 40.06  ? 81   MET A CB    1 
ATOM   1129 C CG    . MET C 3 81  ? 81.326  9.756  5.639   1.00 38.23  ? 81   MET A CG    1 
ATOM   1130 S SD    . MET C 3 81  ? 82.210  10.681 4.335   1.00 40.96  ? 81   MET A SD    1 
ATOM   1131 C CE    . MET C 3 81  ? 83.038  11.853 5.286   1.00 31.90  ? 81   MET A CE    1 
ATOM   1132 N N     . ILE C 3 82  ? 81.232  6.048  5.922   1.00 40.08  ? 82   ILE A N     1 
ATOM   1133 C CA    . ILE C 3 82  ? 82.184  5.206  6.636   1.00 42.21  ? 82   ILE A CA    1 
ATOM   1134 C C     . ILE C 3 82  ? 82.897  4.328  5.605   1.00 43.37  ? 82   ILE A C     1 
ATOM   1135 O O     . ILE C 3 82  ? 84.125  4.262  5.565   1.00 42.52  ? 82   ILE A O     1 
ATOM   1136 C CB    . ILE C 3 82  ? 81.456  4.314  7.691   1.00 43.91  ? 82   ILE A CB    1 
ATOM   1137 C CG1   . ILE C 3 82  ? 81.013  5.171  8.884   1.00 43.31  ? 82   ILE A CG1   1 
ATOM   1138 C CG2   . ILE C 3 82  ? 82.373  3.195  8.185   1.00 47.33  ? 82   ILE A CG2   1 
ATOM   1139 C CD1   . ILE C 3 82  ? 79.939  4.533  9.741   1.00 41.18  ? 82   ILE A CD1   1 
ATOM   1140 N N     . ALA C 3 83  ? 82.109  3.689  4.746   1.00 44.59  ? 83   ALA A N     1 
ATOM   1141 C CA    . ALA C 3 83  ? 82.638  2.811  3.719   1.00 44.03  ? 83   ALA A CA    1 
ATOM   1142 C C     . ALA C 3 83  ? 83.642  3.507  2.803   1.00 46.05  ? 83   ALA A C     1 
ATOM   1143 O O     . ALA C 3 83  ? 84.617  2.893  2.375   1.00 47.48  ? 83   ALA A O     1 
ATOM   1144 C CB    . ALA C 3 83  ? 81.499  2.230  2.900   1.00 37.93  ? 83   ALA A CB    1 
ATOM   1145 N N     . ARG C 3 84  ? 83.409  4.781  2.501   1.00 46.12  ? 84   ARG A N     1 
ATOM   1146 C CA    . ARG C 3 84  ? 84.308  5.528  1.622   1.00 43.83  ? 84   ARG A CA    1 
ATOM   1147 C C     . ARG C 3 84  ? 85.635  5.847  2.300   1.00 44.41  ? 84   ARG A C     1 
ATOM   1148 O O     . ARG C 3 84  ? 86.680  5.863  1.655   1.00 46.31  ? 84   ARG A O     1 
ATOM   1149 C CB    . ARG C 3 84  ? 83.620  6.815  1.136   1.00 45.17  ? 84   ARG A CB    1 
ATOM   1150 C CG    . ARG C 3 84  ? 84.453  7.722  0.244   1.00 41.64  ? 84   ARG A CG    1 
ATOM   1151 C CD    . ARG C 3 84  ? 85.149  6.937  -0.842  1.00 41.64  ? 84   ARG A CD    1 
ATOM   1152 N NE    . ARG C 3 84  ? 86.161  7.731  -1.528  1.00 44.87  ? 84   ARG A NE    1 
ATOM   1153 C CZ    . ARG C 3 84  ? 87.152  7.214  -2.244  1.00 46.99  ? 84   ARG A CZ    1 
ATOM   1154 N NH1   . ARG C 3 84  ? 87.261  5.899  -2.360  1.00 46.97  ? 84   ARG A NH1   1 
ATOM   1155 N NH2   . ARG C 3 84  ? 88.027  8.012  -2.853  1.00 48.90  ? 84   ARG A NH2   1 
ATOM   1156 N N     . ILE C 3 85  ? 85.609  6.086  3.603   1.00 44.99  ? 85   ILE A N     1 
ATOM   1157 C CA    . ILE C 3 85  ? 86.843  6.381  4.335   1.00 44.94  ? 85   ILE A CA    1 
ATOM   1158 C C     . ILE C 3 85  ? 87.710  5.131  4.400   1.00 45.08  ? 85   ILE A C     1 
ATOM   1159 O O     . ILE C 3 85  ? 88.927  5.202  4.260   1.00 45.15  ? 85   ILE A O     1 
ATOM   1160 C CB    . ILE C 3 85  ? 86.551  6.832  5.766   1.00 43.19  ? 85   ILE A CB    1 
ATOM   1161 C CG1   . ILE C 3 85  ? 85.788  8.155  5.746   1.00 46.51  ? 85   ILE A CG1   1 
ATOM   1162 C CG2   . ILE C 3 85  ? 87.837  6.953  6.535   1.00 37.64  ? 85   ILE A CG2   1 
ATOM   1163 C CD1   . ILE C 3 85  ? 85.159  8.516  7.096   1.00 50.39  ? 85   ILE A CD1   1 
ATOM   1164 N N     . ASN C 3 86  ? 87.073  3.985  4.616   1.00 46.56  ? 86   ASN A N     1 
ATOM   1165 C CA    . ASN C 3 86  ? 87.784  2.704  4.686   1.00 47.23  ? 86   ASN A CA    1 
ATOM   1166 C C     . ASN C 3 86  ? 88.421  2.326  3.343   1.00 48.68  ? 86   ASN A C     1 
ATOM   1167 O O     . ASN C 3 86  ? 89.515  1.752  3.310   1.00 50.71  ? 86   ASN A O     1 
ATOM   1168 C CB    . ASN C 3 86  ? 86.824  1.611  5.164   1.00 42.80  ? 86   ASN A CB    1 
ATOM   1169 C CG    . ASN C 3 86  ? 86.537  1.725  6.643   1.00 39.89  ? 86   ASN A CG    1 
ATOM   1170 O OD1   . ASN C 3 86  ? 85.471  1.354  7.119   1.00 45.65  ? 86   ASN A OD1   1 
ATOM   1171 N ND2   . ASN C 3 86  ? 87.506  2.242  7.383   1.00 35.94  ? 86   ASN A ND2   1 
ATOM   1172 N N     . ASP C 3 87  ? 87.751  2.667  2.242   1.00 47.22  ? 87   ASP A N     1 
ATOM   1173 C CA    . ASP C 3 87  ? 88.281  2.374  0.920   1.00 45.40  ? 87   ASP A CA    1 
ATOM   1174 C C     . ASP C 3 87  ? 89.394  3.352  0.537   1.00 44.07  ? 87   ASP A C     1 
ATOM   1175 O O     . ASP C 3 87  ? 90.324  2.987  -0.179  1.00 43.13  ? 87   ASP A O     1 
ATOM   1176 C CB    . ASP C 3 87  ? 87.181  2.450  -0.135  1.00 48.18  ? 87   ASP A CB    1 
ATOM   1177 C CG    . ASP C 3 87  ? 86.056  1.466  0.118   1.00 55.14  ? 87   ASP A CG    1 
ATOM   1178 O OD1   . ASP C 3 87  ? 86.332  0.318  0.543   1.00 59.34  ? 87   ASP A OD1   1 
ATOM   1179 O OD2   . ASP C 3 87  ? 84.888  1.837  -0.129  1.00 57.66  ? 87   ASP A OD2   1 
ATOM   1180 N N     . TRP C 3 88  ? 89.280  4.598  0.993   1.00 43.37  ? 88   TRP A N     1 
ATOM   1181 C CA    . TRP C 3 88  ? 90.276  5.611  0.680   1.00 43.44  ? 88   TRP A CA    1 
ATOM   1182 C C     . TRP C 3 88  ? 91.589  5.166  1.272   1.00 45.37  ? 88   TRP A C     1 
ATOM   1183 O O     . TRP C 3 88  ? 92.635  5.286  0.631   1.00 41.50  ? 88   TRP A O     1 
ATOM   1184 C CB    . TRP C 3 88  ? 89.890  6.987  1.250   1.00 41.10  ? 88   TRP A CB    1 
ATOM   1185 C CG    . TRP C 3 88  ? 90.934  8.065  1.005   1.00 37.31  ? 88   TRP A CG    1 
ATOM   1186 C CD1   . TRP C 3 88  ? 91.492  8.414  -0.192  1.00 37.98  ? 88   TRP A CD1   1 
ATOM   1187 C CD2   . TRP C 3 88  ? 91.525  8.931  1.980   1.00 35.86  ? 88   TRP A CD2   1 
ATOM   1188 N NE1   . TRP C 3 88  ? 92.391  9.439  -0.026  1.00 36.92  ? 88   TRP A NE1   1 
ATOM   1189 C CE2   . TRP C 3 88  ? 92.431  9.776  1.297   1.00 36.10  ? 88   TRP A CE2   1 
ATOM   1190 C CE3   . TRP C 3 88  ? 91.375  9.081  3.359   1.00 37.08  ? 88   TRP A CE3   1 
ATOM   1191 C CZ2   . TRP C 3 88  ? 93.178  10.752 1.947   1.00 34.79  ? 88   TRP A CZ2   1 
ATOM   1192 C CZ3   . TRP C 3 88  ? 92.121  10.056 4.007   1.00 37.57  ? 88   TRP A CZ3   1 
ATOM   1193 C CH2   . TRP C 3 88  ? 93.010  10.878 3.297   1.00 34.70  ? 88   TRP A CH2   1 
ATOM   1194 N N     . PHE C 3 89  ? 91.518  4.647  2.497   1.00 46.65  ? 89   PHE A N     1 
ATOM   1195 C CA    . PHE C 3 89  ? 92.706  4.159  3.182   1.00 49.73  ? 89   PHE A CA    1 
ATOM   1196 C C     . PHE C 3 89  ? 93.400  3.057  2.370   1.00 52.16  ? 89   PHE A C     1 
ATOM   1197 O O     . PHE C 3 89  ? 94.629  3.056  2.229   1.00 51.29  ? 89   PHE A O     1 
ATOM   1198 C CB    . PHE C 3 89  ? 92.333  3.657  4.578   1.00 46.01  ? 89   PHE A CB    1 
ATOM   1199 C CG    . PHE C 3 89  ? 92.006  4.764  5.557   1.00 49.12  ? 89   PHE A CG    1 
ATOM   1200 C CD1   . PHE C 3 89  ? 92.021  6.106  5.157   1.00 48.04  ? 89   PHE A CD1   1 
ATOM   1201 C CD2   . PHE C 3 89  ? 91.720  4.472  6.890   1.00 48.16  ? 89   PHE A CD2   1 
ATOM   1202 C CE1   . PHE C 3 89  ? 91.765  7.123  6.063   1.00 46.89  ? 89   PHE A CE1   1 
ATOM   1203 C CE2   . PHE C 3 89  ? 91.461  5.486  7.805   1.00 45.08  ? 89   PHE A CE2   1 
ATOM   1204 C CZ    . PHE C 3 89  ? 91.485  6.812  7.393   1.00 47.48  ? 89   PHE A CZ    1 
ATOM   1205 N N     . GLU C 3 90  ? 92.621  2.133  1.815   1.00 53.69  ? 90   GLU A N     1 
ATOM   1206 C CA    . GLU C 3 90  ? 93.218  1.066  1.023   1.00 56.97  ? 90   GLU A CA    1 
ATOM   1207 C C     . GLU C 3 90  ? 93.899  1.608  -0.224  1.00 56.28  ? 90   GLU A C     1 
ATOM   1208 O O     . GLU C 3 90  ? 95.002  1.191  -0.551  1.00 58.26  ? 90   GLU A O     1 
ATOM   1209 C CB    . GLU C 3 90  ? 92.178  0.009  0.640   1.00 61.16  ? 90   GLU A CB    1 
ATOM   1210 C CG    . GLU C 3 90  ? 91.873  -0.980 1.761   1.00 66.71  ? 90   GLU A CG    1 
ATOM   1211 C CD    . GLU C 3 90  ? 90.967  -2.126 1.315   1.00 72.01  ? 90   GLU A CD    1 
ATOM   1212 O OE1   . GLU C 3 90  ? 89.760  -1.885 1.041   1.00 74.61  ? 90   GLU A OE1   1 
ATOM   1213 O OE2   . GLU C 3 90  ? 91.468  -3.275 1.234   1.00 73.74  ? 90   GLU A OE2   1 
ATOM   1214 N N     . GLU C 3 91  ? 93.257  2.546  -0.909  1.00 55.67  ? 91   GLU A N     1 
ATOM   1215 C CA    . GLU C 3 91  ? 93.846  3.141  -2.106  1.00 56.49  ? 91   GLU A CA    1 
ATOM   1216 C C     . GLU C 3 91  ? 95.161  3.847  -1.791  1.00 57.21  ? 91   GLU A C     1 
ATOM   1217 O O     . GLU C 3 91  ? 96.081  3.840  -2.600  1.00 58.31  ? 91   GLU A O     1 
ATOM   1218 C CB    . GLU C 3 91  ? 92.889  4.156  -2.723  1.00 57.33  ? 91   GLU A CB    1 
ATOM   1219 C CG    . GLU C 3 91  ? 91.718  3.560  -3.499  1.00 58.94  ? 91   GLU A CG    1 
ATOM   1220 C CD    . GLU C 3 91  ? 90.561  4.546  -3.670  1.00 59.95  ? 91   GLU A CD    1 
ATOM   1221 O OE1   . GLU C 3 91  ? 90.795  5.718  -4.059  1.00 60.23  ? 91   GLU A OE1   1 
ATOM   1222 O OE2   . GLU C 3 91  ? 89.411  4.138  -3.416  1.00 60.93  ? 91   GLU A OE2   1 
ATOM   1223 N N     . VAL C 3 92  ? 95.240  4.455  -0.611  1.00 57.42  ? 92   VAL A N     1 
ATOM   1224 C CA    . VAL C 3 92  ? 96.427  5.183  -0.185  1.00 56.23  ? 92   VAL A CA    1 
ATOM   1225 C C     . VAL C 3 92  ? 97.608  4.285  0.153   1.00 56.73  ? 92   VAL A C     1 
ATOM   1226 O O     . VAL C 3 92  ? 98.753  4.612  -0.142  1.00 56.86  ? 92   VAL A O     1 
ATOM   1227 C CB    . VAL C 3 92  ? 96.120  6.063  1.047   1.00 54.45  ? 92   VAL A CB    1 
ATOM   1228 C CG1   . VAL C 3 92  ? 97.414  6.493  1.728   1.00 54.79  ? 92   VAL A CG1   1 
ATOM   1229 C CG2   . VAL C 3 92  ? 95.324  7.293  0.613   1.00 54.24  ? 92   VAL A CG2   1 
ATOM   1230 N N     . LYS C 3 93  ? 97.324  3.160  0.786   1.00 56.00  ? 93   LYS A N     1 
ATOM   1231 C CA    . LYS C 3 93  ? 98.365  2.237  1.179   1.00 53.86  ? 93   LYS A CA    1 
ATOM   1232 C C     . LYS C 3 93  ? 98.864  1.424  -0.001  1.00 53.40  ? 93   LYS A C     1 
ATOM   1233 O O     . LYS C 3 93  ? 100.025 1.059  -0.055  1.00 50.69  ? 93   LYS A O     1 
ATOM   1234 C CB    . LYS C 3 93  ? 97.829  1.312  2.270   1.00 53.45  ? 93   LYS A CB    1 
ATOM   1235 C CG    . LYS C 3 93  ? 97.453  2.055  3.535   1.00 54.09  ? 93   LYS A CG    1 
ATOM   1236 C CD    . LYS C 3 93  ? 96.759  1.152  4.522   1.00 56.63  ? 93   LYS A CD    1 
ATOM   1237 C CE    . LYS C 3 93  ? 96.442  1.890  5.813   1.00 58.88  ? 93   LYS A CE    1 
ATOM   1238 N NZ    . LYS C 3 93  ? 95.497  1.133  6.705   1.00 62.59  ? 93   LYS A NZ    1 
ATOM   1239 N N     . ALA C 3 94  ? 97.974  1.183  -0.955  1.00 54.36  ? 94   ALA A N     1 
ATOM   1240 C CA    . ALA C 3 94  ? 98.259  0.384  -2.142  1.00 53.78  ? 94   ALA A CA    1 
ATOM   1241 C C     . ALA C 3 94  ? 99.173  1.013  -3.183  1.00 56.59  ? 94   ALA A C     1 
ATOM   1242 O O     . ALA C 3 94  ? 99.523  0.377  -4.185  1.00 61.27  ? 94   ALA A O     1 
ATOM   1243 C CB    . ALA C 3 94  ? 96.946  -0.014 -2.807  1.00 51.69  ? 94   ALA A CB    1 
ATOM   1244 N N     . LYS C 3 95  ? 99.573  2.254  -2.986  1.00 56.20  ? 95   LYS A N     1 
ATOM   1245 C CA    . LYS C 3 95  ? 100.424 2.847  -3.987  1.00 53.20  ? 95   LYS A CA    1 
ATOM   1246 C C     . LYS C 3 95  ? 101.687 3.400  -3.387  1.00 51.42  ? 95   LYS A C     1 
ATOM   1247 O O     . LYS C 3 95  ? 101.746 3.675  -2.199  1.00 50.77  ? 95   LYS A O     1 
ATOM   1248 C CB    . LYS C 3 95  ? 99.611  3.879  -4.747  1.00 56.76  ? 95   LYS A CB    1 
ATOM   1249 C CG    . LYS C 3 95  ? 98.455  3.180  -5.483  1.00 60.84  ? 95   LYS A CG    1 
ATOM   1250 C CD    . LYS C 3 95  ? 97.550  4.142  -6.227  1.00 65.20  ? 95   LYS A CD    1 
ATOM   1251 C CE    . LYS C 3 95  ? 96.488  3.434  -7.074  1.00 65.12  ? 95   LYS A CE    1 
ATOM   1252 N NZ    . LYS C 3 95  ? 95.411  4.407  -7.465  1.00 68.79  ? 95   LYS A NZ    1 
ATOM   1253 N N     . ARG C 3 96  ? 102.726 3.508  -4.199  1.00 50.38  ? 96   ARG A N     1 
ATOM   1254 C CA    . ARG C 3 96  ? 104.012 4.002  -3.719  1.00 47.03  ? 96   ARG A CA    1 
ATOM   1255 C C     . ARG C 3 96  ? 103.945 5.518  -3.655  1.00 43.79  ? 96   ARG A C     1 
ATOM   1256 O O     . ARG C 3 96  ? 102.935 6.103  -4.055  1.00 43.52  ? 96   ARG A O     1 
ATOM   1257 C CB    . ARG C 3 96  ? 105.132 3.560  -4.677  1.00 46.61  ? 96   ARG A CB    1 
ATOM   1258 C CG    . ARG C 3 96  ? 105.352 4.511  -5.851  1.00 50.92  ? 96   ARG A CG    1 
ATOM   1259 C CD    . ARG C 3 96  ? 106.393 4.020  -6.852  1.00 51.74  ? 96   ARG A CD    1 
ATOM   1260 N NE    . ARG C 3 96  ? 105.890 2.925  -7.680  1.00 54.07  ? 96   ARG A NE    1 
ATOM   1261 C CZ    . ARG C 3 96  ? 106.517 2.450  -8.758  1.00 56.90  ? 96   ARG A CZ    1 
ATOM   1262 N NH1   . ARG C 3 96  ? 107.680 2.981  -9.153  1.00 52.46  ? 96   ARG A NH1   1 
ATOM   1263 N NH2   . ARG C 3 96  ? 105.990 1.430  -9.432  1.00 56.65  ? 96   ARG A NH2   1 
ATOM   1264 N N     . GLY C 3 97  ? 105.009 6.138  -3.141  1.00 40.27  ? 97   GLY A N     1 
ATOM   1265 C CA    . GLY C 3 97  ? 105.081 7.590  -3.062  1.00 36.51  ? 97   GLY A CA    1 
ATOM   1266 C C     . GLY C 3 97  ? 104.586 8.301  -1.805  1.00 35.25  ? 97   GLY A C     1 
ATOM   1267 O O     . GLY C 3 97  ? 104.126 7.688  -0.837  1.00 32.34  ? 97   GLY A O     1 
ATOM   1268 N N     . LYS C 3 98  ? 104.675 9.627  -1.819  1.00 35.51  ? 98   LYS A N     1 
ATOM   1269 C CA    . LYS C 3 98  ? 104.229 10.405 -0.669  1.00 38.89  ? 98   LYS A CA    1 
ATOM   1270 C C     . LYS C 3 98  ? 102.753 10.127 -0.358  1.00 39.84  ? 98   LYS A C     1 
ATOM   1271 O O     . LYS C 3 98  ? 101.923 10.017 -1.268  1.00 38.89  ? 98   LYS A O     1 
ATOM   1272 C CB    . LYS C 3 98  ? 104.438 11.901 -0.919  1.00 38.85  ? 98   LYS A CB    1 
ATOM   1273 C CG    . LYS C 3 98  ? 104.047 12.766 0.263   1.00 41.23  ? 98   LYS A CG    1 
ATOM   1274 C CD    . LYS C 3 98  ? 104.684 14.157 0.234   1.00 41.07  ? 98   LYS A CD    1 
ATOM   1275 C CE    . LYS C 3 98  ? 104.266 14.981 -0.984  1.00 40.85  ? 98   LYS A CE    1 
ATOM   1276 N NZ    . LYS C 3 98  ? 104.882 16.357 -0.969  1.00 38.35  ? 98   LYS A NZ    1 
ATOM   1277 N N     . ARG C 3 99  ? 102.439 9.967  0.922   1.00 39.74  ? 99   ARG A N     1 
ATOM   1278 C CA    . ARG C 3 99  ? 101.057 9.747  1.323   1.00 42.27  ? 99   ARG A CA    1 
ATOM   1279 C C     . ARG C 3 99  ? 100.445 11.139 1.513   1.00 42.22  ? 99   ARG A C     1 
ATOM   1280 O O     . ARG C 3 99  ? 101.114 12.050 2.004   1.00 42.76  ? 99   ARG A O     1 
ATOM   1281 C CB    . ARG C 3 99  ? 100.984 8.942  2.630   1.00 39.87  ? 99   ARG A CB    1 
ATOM   1282 C CG    . ARG C 3 99  ? 101.052 7.423  2.438   1.00 37.68  ? 99   ARG A CG    1 
ATOM   1283 C CD    . ARG C 3 99  ? 102.293 6.981  1.660   1.00 40.00  ? 99   ARG A CD    1 
ATOM   1284 N NE    . ARG C 3 99  ? 102.008 5.849  0.783   1.00 41.84  ? 99   ARG A NE    1 
ATOM   1285 C CZ    . ARG C 3 99  ? 101.676 4.643  1.232   1.00 47.55  ? 99   ARG A CZ    1 
ATOM   1286 N NH1   . ARG C 3 99  ? 101.596 4.425  2.547   1.00 49.79  ? 99   ARG A NH1   1 
ATOM   1287 N NH2   . ARG C 3 99  ? 101.423 3.652  0.382   1.00 47.39  ? 99   ARG A NH2   1 
ATOM   1288 N N     . PRO C 3 100 ? 99.181  11.333 1.092   1.00 43.54  ? 100  PRO A N     1 
ATOM   1289 C CA    . PRO C 3 100 ? 98.569  12.662 1.266   1.00 42.42  ? 100  PRO A CA    1 
ATOM   1290 C C     . PRO C 3 100 ? 98.601  13.140 2.710   1.00 41.62  ? 100  PRO A C     1 
ATOM   1291 O O     . PRO C 3 100 ? 98.396  12.373 3.637   1.00 40.95  ? 100  PRO A O     1 
ATOM   1292 C CB    . PRO C 3 100 ? 97.151  12.487 0.704   1.00 40.63  ? 100  PRO A CB    1 
ATOM   1293 C CG    . PRO C 3 100 ? 96.941  11.001 0.688   1.00 45.32  ? 100  PRO A CG    1 
ATOM   1294 C CD    . PRO C 3 100 ? 98.292  10.432 0.345   1.00 42.32  ? 100  PRO A CD    1 
ATOM   1295 N N     . THR C 3 101 ? 98.888  14.418 2.892   1.00 43.03  ? 101  THR A N     1 
ATOM   1296 C CA    . THR C 3 101 ? 98.984  14.985 4.220   1.00 43.65  ? 101  THR A CA    1 
ATOM   1297 C C     . THR C 3 101 ? 97.762  14.658 5.066   1.00 44.10  ? 101  THR A C     1 
ATOM   1298 O O     . THR C 3 101 ? 97.880  14.350 6.250   1.00 43.93  ? 101  THR A O     1 
ATOM   1299 C CB    . THR C 3 101 ? 99.161  16.512 4.141   1.00 45.15  ? 101  THR A CB    1 
ATOM   1300 O OG1   . THR C 3 101 ? 100.271 16.813 3.289   1.00 47.28  ? 101  THR A OG1   1 
ATOM   1301 C CG2   . THR C 3 101 ? 99.433  17.097 5.524   1.00 41.62  ? 101  THR A CG2   1 
ATOM   1302 N N     . ALA C 3 102 ? 96.587  14.717 4.460   1.00 44.87  ? 102  ALA A N     1 
ATOM   1303 C CA    . ALA C 3 102 ? 95.361  14.429 5.193   1.00 45.71  ? 102  ALA A CA    1 
ATOM   1304 C C     . ALA C 3 102 ? 95.429  13.042 5.828   1.00 43.88  ? 102  ALA A C     1 
ATOM   1305 O O     . ALA C 3 102 ? 95.123  12.877 7.014   1.00 42.14  ? 102  ALA A O     1 
ATOM   1306 C CB    . ALA C 3 102 ? 94.135  14.548 4.256   1.00 41.82  ? 102  ALA A CB    1 
ATOM   1307 N N     . PHE C 3 103 ? 95.857  12.058 5.040   1.00 45.82  ? 103  PHE A N     1 
ATOM   1308 C CA    . PHE C 3 103 ? 95.980  10.673 5.509   1.00 45.59  ? 103  PHE A CA    1 
ATOM   1309 C C     . PHE C 3 103 ? 96.813  10.545 6.783   1.00 45.27  ? 103  PHE A C     1 
ATOM   1310 O O     . PHE C 3 103 ? 96.439  9.818  7.704   1.00 45.40  ? 103  PHE A O     1 
ATOM   1311 C CB    . PHE C 3 103 ? 96.608  9.799  4.420   1.00 48.94  ? 103  PHE A CB    1 
ATOM   1312 C CG    . PHE C 3 103 ? 96.749  8.349  4.805   1.00 50.44  ? 103  PHE A CG    1 
ATOM   1313 C CD1   . PHE C 3 103 ? 95.633  7.512  4.850   1.00 52.34  ? 103  PHE A CD1   1 
ATOM   1314 C CD2   . PHE C 3 103 ? 98.005  7.813  5.101   1.00 48.46  ? 103  PHE A CD2   1 
ATOM   1315 C CE1   . PHE C 3 103 ? 95.762  6.142  5.185   1.00 52.57  ? 103  PHE A CE1   1 
ATOM   1316 C CE2   . PHE C 3 103 ? 98.150  6.444  5.437   1.00 50.92  ? 103  PHE A CE2   1 
ATOM   1317 C CZ    . PHE C 3 103 ? 97.026  5.610  5.479   1.00 51.44  ? 103  PHE A CZ    1 
ATOM   1318 N N     . GLN C 3 104 ? 97.937  11.254 6.824   1.00 43.90  ? 104  GLN A N     1 
ATOM   1319 C CA    . GLN C 3 104 ? 98.831  11.220 7.967   1.00 45.81  ? 104  GLN A CA    1 
ATOM   1320 C C     . GLN C 3 104 ? 98.076  11.364 9.277   1.00 44.99  ? 104  GLN A C     1 
ATOM   1321 O O     . GLN C 3 104 ? 98.257  10.550 10.195  1.00 44.27  ? 104  GLN A O     1 
ATOM   1322 C CB    . GLN C 3 104 ? 99.878  12.333 7.856   1.00 47.43  ? 104  GLN A CB    1 
ATOM   1323 C CG    . GLN C 3 104 ? 100.741 12.259 6.592   1.00 54.70  ? 104  GLN A CG    1 
ATOM   1324 C CD    . GLN C 3 104 ? 101.702 11.070 6.584   1.00 58.46  ? 104  GLN A CD    1 
ATOM   1325 O OE1   . GLN C 3 104 ? 101.303 9.921  6.782   1.00 62.31  ? 104  GLN A OE1   1 
ATOM   1326 N NE2   . GLN C 3 104 ? 102.974 11.348 6.343   1.00 59.51  ? 104  GLN A NE2   1 
ATOM   1327 N N     . PHE C 3 105 ? 97.235  12.400 9.367   1.00 44.23  ? 105  PHE A N     1 
ATOM   1328 C CA    . PHE C 3 105 ? 96.459  12.640 10.573  1.00 40.96  ? 105  PHE A CA    1 
ATOM   1329 C C     . PHE C 3 105 ? 95.228  11.726 10.699  1.00 40.92  ? 105  PHE A C     1 
ATOM   1330 O O     . PHE C 3 105 ? 94.999  11.132 11.746  1.00 40.71  ? 105  PHE A O     1 
ATOM   1331 C CB    . PHE C 3 105 ? 96.000  14.096 10.638  1.00 39.86  ? 105  PHE A CB    1 
ATOM   1332 C CG    . PHE C 3 105 ? 97.122  15.102 10.555  1.00 40.55  ? 105  PHE A CG    1 
ATOM   1333 C CD1   . PHE C 3 105 ? 97.663  15.451 9.336   1.00 38.40  ? 105  PHE A CD1   1 
ATOM   1334 C CD2   . PHE C 3 105 ? 97.655  15.667 11.707  1.00 43.60  ? 105  PHE A CD2   1 
ATOM   1335 C CE1   . PHE C 3 105 ? 98.724  16.346 9.258   1.00 43.46  ? 105  PHE A CE1   1 
ATOM   1336 C CE2   . PHE C 3 105 ? 98.724  16.569 11.646  1.00 42.36  ? 105  PHE A CE2   1 
ATOM   1337 C CZ    . PHE C 3 105 ? 99.261  16.908 10.414  1.00 43.27  ? 105  PHE A CZ    1 
ATOM   1338 N N     . LEU C 3 106 ? 94.455  11.600 9.624   1.00 41.70  ? 106  LEU A N     1 
ATOM   1339 C CA    . LEU C 3 106 ? 93.222  10.815 9.632   1.00 42.32  ? 106  LEU A CA    1 
ATOM   1340 C C     . LEU C 3 106 ? 93.370  9.314  9.865   1.00 46.36  ? 106  LEU A C     1 
ATOM   1341 O O     . LEU C 3 106 ? 92.482  8.658  10.440  1.00 44.09  ? 106  LEU A O     1 
ATOM   1342 C CB    . LEU C 3 106 ? 92.462  11.065 8.325   1.00 38.52  ? 106  LEU A CB    1 
ATOM   1343 C CG    . LEU C 3 106 ? 91.785  12.441 8.202   1.00 38.73  ? 106  LEU A CG    1 
ATOM   1344 C CD1   . LEU C 3 106 ? 91.295  12.647 6.781   1.00 36.10  ? 106  LEU A CD1   1 
ATOM   1345 C CD2   . LEU C 3 106 ? 90.622  12.555 9.192   1.00 35.89  ? 106  LEU A CD2   1 
ATOM   1346 N N     . GLN C 3 107 ? 94.495  8.782  9.406   1.00 49.36  ? 107  GLN A N     1 
ATOM   1347 C CA    . GLN C 3 107 ? 94.815  7.363  9.507   1.00 51.11  ? 107  GLN A CA    1 
ATOM   1348 C C     . GLN C 3 107 ? 94.563  6.762  10.887  1.00 50.91  ? 107  GLN A C     1 
ATOM   1349 O O     . GLN C 3 107 ? 94.152  5.620  10.999  1.00 51.01  ? 107  GLN A O     1 
ATOM   1350 C CB    . GLN C 3 107 ? 96.279  7.183  9.123   1.00 55.63  ? 107  GLN A CB    1 
ATOM   1351 C CG    . GLN C 3 107 ? 96.827  5.796  9.244   1.00 57.51  ? 107  GLN A CG    1 
ATOM   1352 C CD    . GLN C 3 107 ? 98.306  5.752  8.921   1.00 60.32  ? 107  GLN A CD    1 
ATOM   1353 O OE1   . GLN C 3 107 ? 98.888  4.672  8.790   1.00 64.01  ? 107  GLN A OE1   1 
ATOM   1354 N NE2   . GLN C 3 107 ? 98.927  6.928  8.791   1.00 58.02  ? 107  GLN A NE2   1 
ATOM   1355 N N     . GLU C 3 108 ? 94.802  7.556  11.927  1.00 52.44  ? 108  GLU A N     1 
ATOM   1356 C CA    . GLU C 3 108 ? 94.654  7.122  13.315  1.00 50.42  ? 108  GLU A CA    1 
ATOM   1357 C C     . GLU C 3 108 ? 93.259  7.193  13.934  1.00 47.47  ? 108  GLU A C     1 
ATOM   1358 O O     . GLU C 3 108 ? 92.968  6.471  14.878  1.00 46.78  ? 108  GLU A O     1 
ATOM   1359 C CB    . GLU C 3 108 ? 95.623  7.931  14.183  1.00 57.33  ? 108  GLU A CB    1 
ATOM   1360 C CG    . GLU C 3 108 ? 97.105  7.736  13.826  1.00 65.97  ? 108  GLU A CG    1 
ATOM   1361 C CD    . GLU C 3 108 ? 97.590  6.292  14.048  1.00 71.13  ? 108  GLU A CD    1 
ATOM   1362 O OE1   . GLU C 3 108 ? 97.109  5.375  13.334  1.00 72.93  ? 108  GLU A OE1   1 
ATOM   1363 O OE2   . GLU C 3 108 ? 98.451  6.075  14.942  1.00 73.95  ? 108  GLU A OE2   1 
ATOM   1364 N N     . ILE C 3 109 ? 92.405  8.065  13.416  1.00 44.99  ? 109  ILE A N     1 
ATOM   1365 C CA    . ILE C 3 109 ? 91.057  8.234  13.951  1.00 41.54  ? 109  ILE A CA    1 
ATOM   1366 C C     . ILE C 3 109 ? 90.057  7.173  13.504  1.00 41.53  ? 109  ILE A C     1 
ATOM   1367 O O     . ILE C 3 109 ? 90.052  6.738  12.361  1.00 41.16  ? 109  ILE A O     1 
ATOM   1368 C CB    . ILE C 3 109 ? 90.473  9.598  13.566  1.00 40.22  ? 109  ILE A CB    1 
ATOM   1369 C CG1   . ILE C 3 109 ? 91.460  10.702 13.933  1.00 36.06  ? 109  ILE A CG1   1 
ATOM   1370 C CG2   . ILE C 3 109 ? 89.131  9.807  14.272  1.00 40.30  ? 109  ILE A CG2   1 
ATOM   1371 C CD1   . ILE C 3 109 ? 92.163  11.249 12.765  1.00 37.12  ? 109  ILE A CD1   1 
ATOM   1372 N N     . LYS C 3 110 ? 89.211  6.759  14.428  1.00 39.42  ? 110  LYS A N     1 
ATOM   1373 C CA    . LYS C 3 110 ? 88.197  5.766  14.126  1.00 42.05  ? 110  LYS A CA    1 
ATOM   1374 C C     . LYS C 3 110 ? 87.316  6.326  12.993  1.00 43.26  ? 110  LYS A C     1 
ATOM   1375 O O     . LYS C 3 110 ? 86.786  7.430  13.089  1.00 43.07  ? 110  LYS A O     1 
ATOM   1376 C CB    . LYS C 3 110 ? 87.379  5.492  15.401  1.00 41.93  ? 110  LYS A CB    1 
ATOM   1377 C CG    . LYS C 3 110 ? 86.373  4.390  15.298  1.00 43.00  ? 110  LYS A CG    1 
ATOM   1378 C CD    . LYS C 3 110 ? 85.895  3.971  16.694  1.00 47.18  ? 110  LYS A CD    1 
ATOM   1379 C CE    . LYS C 3 110 ? 84.774  2.926  16.612  1.00 47.21  ? 110  LYS A CE    1 
ATOM   1380 N NZ    . LYS C 3 110 ? 84.279  2.470  17.945  1.00 46.45  ? 110  LYS A NZ    1 
ATOM   1381 N N     . PRO C 3 111 ? 87.190  5.582  11.887  1.00 43.82  ? 111  PRO A N     1 
ATOM   1382 C CA    . PRO C 3 111 ? 86.382  6.014  10.747  1.00 46.79  ? 111  PRO A CA    1 
ATOM   1383 C C     . PRO C 3 111 ? 84.931  6.381  11.041  1.00 46.80  ? 111  PRO A C     1 
ATOM   1384 O O     . PRO C 3 111 ? 84.376  7.261  10.393  1.00 46.02  ? 111  PRO A O     1 
ATOM   1385 C CB    . PRO C 3 111 ? 86.523  4.852  9.760   1.00 43.73  ? 111  PRO A CB    1 
ATOM   1386 C CG    . PRO C 3 111 ? 86.997  3.723  10.596  1.00 44.33  ? 111  PRO A CG    1 
ATOM   1387 C CD    . PRO C 3 111 ? 87.918  4.355  11.555  1.00 43.45  ? 111  PRO A CD    1 
ATOM   1388 N N     . GLU C 3 112 ? 84.323  5.713  12.016  1.00 47.14  ? 112  GLU A N     1 
ATOM   1389 C CA    . GLU C 3 112 ? 82.940  5.996  12.386  1.00 46.45  ? 112  GLU A CA    1 
ATOM   1390 C C     . GLU C 3 112 ? 82.861  7.410  12.925  1.00 43.57  ? 112  GLU A C     1 
ATOM   1391 O O     . GLU C 3 112 ? 81.846  8.093  12.770  1.00 44.64  ? 112  GLU A O     1 
ATOM   1392 C CB    . GLU C 3 112 ? 82.440  5.016  13.457  1.00 47.14  ? 112  GLU A CB    1 
ATOM   1393 C CG    . GLU C 3 112 ? 82.250  3.581  12.976  1.00 53.69  ? 112  GLU A CG    1 
ATOM   1394 C CD    . GLU C 3 112 ? 83.558  2.870  12.596  1.00 55.63  ? 112  GLU A CD    1 
ATOM   1395 O OE1   . GLU C 3 112 ? 84.519  2.905  13.392  1.00 59.23  ? 112  GLU A OE1   1 
ATOM   1396 O OE2   . GLU C 3 112 ? 83.619  2.263  11.506  1.00 52.15  ? 112  GLU A OE2   1 
ATOM   1397 N N     . ALA C 3 113 ? 83.937  7.842  13.571  1.00 38.95  ? 113  ALA A N     1 
ATOM   1398 C CA    . ALA C 3 113 ? 84.001  9.177  14.133  1.00 36.55  ? 113  ALA A CA    1 
ATOM   1399 C C     . ALA C 3 113 ? 84.253  10.197 13.041  1.00 37.54  ? 113  ALA A C     1 
ATOM   1400 O O     . ALA C 3 113 ? 83.615  11.260 13.011  1.00 39.24  ? 113  ALA A O     1 
ATOM   1401 C CB    . ALA C 3 113 ? 85.079  9.257  15.186  1.00 36.21  ? 113  ALA A CB    1 
ATOM   1402 N N     . VAL C 3 114 ? 85.170  9.887  12.133  1.00 36.11  ? 114  VAL A N     1 
ATOM   1403 C CA    . VAL C 3 114 ? 85.452  10.804 11.040  1.00 33.39  ? 114  VAL A CA    1 
ATOM   1404 C C     . VAL C 3 114 ? 84.193  11.073 10.212  1.00 33.55  ? 114  VAL A C     1 
ATOM   1405 O O     . VAL C 3 114 ? 83.889  12.211 9.883   1.00 31.04  ? 114  VAL A O     1 
ATOM   1406 C CB    . VAL C 3 114 ? 86.533  10.250 10.106  1.00 32.81  ? 114  VAL A CB    1 
ATOM   1407 C CG1   . VAL C 3 114 ? 86.783  11.244 8.982   1.00 32.38  ? 114  VAL A CG1   1 
ATOM   1408 C CG2   . VAL C 3 114 ? 87.830  10.028 10.886  1.00 36.25  ? 114  VAL A CG2   1 
ATOM   1409 N N     . ALA C 3 115 ? 83.467  10.015 9.872   1.00 32.32  ? 115  ALA A N     1 
ATOM   1410 C CA    . ALA C 3 115 ? 82.260  10.164 9.082   1.00 34.62  ? 115  ALA A CA    1 
ATOM   1411 C C     . ALA C 3 115 ? 81.188  11.013 9.797   1.00 37.11  ? 115  ALA A C     1 
ATOM   1412 O O     . ALA C 3 115 ? 80.580  11.917 9.204   1.00 33.82  ? 115  ALA A O     1 
ATOM   1413 C CB    . ALA C 3 115 ? 81.684  8.791  8.743   1.00 33.64  ? 115  ALA A CB    1 
ATOM   1414 N N     . TYR C 3 116 ? 80.963  10.717 11.072  1.00 39.00  ? 116  TYR A N     1 
ATOM   1415 C CA    . TYR C 3 116 ? 79.943  11.422 11.823  1.00 39.73  ? 116  TYR A CA    1 
ATOM   1416 C C     . TYR C 3 116 ? 80.251  12.901 12.041  1.00 40.09  ? 116  TYR A C     1 
ATOM   1417 O O     . TYR C 3 116 ? 79.352  13.741 11.968  1.00 42.59  ? 116  TYR A O     1 
ATOM   1418 C CB    . TYR C 3 116 ? 79.718  10.730 13.160  1.00 36.13  ? 116  TYR A CB    1 
ATOM   1419 C CG    . TYR C 3 116 ? 78.429  11.123 13.830  1.00 38.61  ? 116  TYR A CG    1 
ATOM   1420 C CD1   . TYR C 3 116 ? 77.227  11.146 13.115  1.00 38.01  ? 116  TYR A CD1   1 
ATOM   1421 C CD2   . TYR C 3 116 ? 78.393  11.424 15.192  1.00 37.64  ? 116  TYR A CD2   1 
ATOM   1422 C CE1   . TYR C 3 116 ? 76.030  11.456 13.738  1.00 38.05  ? 116  TYR A CE1   1 
ATOM   1423 C CE2   . TYR C 3 116 ? 77.202  11.728 15.828  1.00 34.14  ? 116  TYR A CE2   1 
ATOM   1424 C CZ    . TYR C 3 116 ? 76.032  11.745 15.097  1.00 38.90  ? 116  TYR A CZ    1 
ATOM   1425 O OH    . TYR C 3 116 ? 74.869  12.073 15.719  1.00 38.64  ? 116  TYR A OH    1 
ATOM   1426 N N     . ILE C 3 117 ? 81.517  13.208 12.308  1.00 39.44  ? 117  ILE A N     1 
ATOM   1427 C CA    . ILE C 3 117 ? 81.939  14.579 12.541  1.00 38.41  ? 117  ILE A CA    1 
ATOM   1428 C C     . ILE C 3 117 ? 81.820  15.411 11.269  1.00 38.93  ? 117  ILE A C     1 
ATOM   1429 O O     . ILE C 3 117 ? 81.431  16.579 11.323  1.00 40.58  ? 117  ILE A O     1 
ATOM   1430 C CB    . ILE C 3 117 ? 83.392  14.626 13.049  1.00 38.25  ? 117  ILE A CB    1 
ATOM   1431 C CG1   . ILE C 3 117 ? 83.457  14.018 14.453  1.00 36.81  ? 117  ILE A CG1   1 
ATOM   1432 C CG2   . ILE C 3 117 ? 83.929  16.080 13.008  1.00 35.12  ? 117  ILE A CG2   1 
ATOM   1433 C CD1   . ILE C 3 117 ? 84.881  13.799 14.959  1.00 36.86  ? 117  ILE A CD1   1 
ATOM   1434 N N     . THR C 3 118 ? 82.157  14.792 10.140  1.00 37.33  ? 118  THR A N     1 
ATOM   1435 C CA    . THR C 3 118 ? 82.092  15.410 8.820   1.00 32.91  ? 118  THR A CA    1 
ATOM   1436 C C     . THR C 3 118 ? 80.641  15.757 8.456   1.00 31.17  ? 118  THR A C     1 
ATOM   1437 O O     . THR C 3 118 ? 80.339  16.881 8.034   1.00 30.53  ? 118  THR A O     1 
ATOM   1438 C CB    . THR C 3 118 ? 82.659  14.449 7.746   1.00 30.89  ? 118  THR A CB    1 
ATOM   1439 O OG1   . THR C 3 118 ? 84.050  14.217 8.005   1.00 29.97  ? 118  THR A OG1   1 
ATOM   1440 C CG2   . THR C 3 118 ? 82.512  15.041 6.350   1.00 28.92  ? 118  THR A CG2   1 
ATOM   1441 N N     . ILE C 3 119 ? 79.753  14.788 8.620   1.00 30.41  ? 119  ILE A N     1 
ATOM   1442 C CA    . ILE C 3 119 ? 78.324  14.990 8.334   1.00 31.95  ? 119  ILE A CA    1 
ATOM   1443 C C     . ILE C 3 119 ? 77.789  16.177 9.136   1.00 31.22  ? 119  ILE A C     1 
ATOM   1444 O O     . ILE C 3 119 ? 77.290  17.145 8.571   1.00 28.75  ? 119  ILE A O     1 
ATOM   1445 C CB    . ILE C 3 119 ? 77.442  13.771 8.759   1.00 30.37  ? 119  ILE A CB    1 
ATOM   1446 C CG1   . ILE C 3 119 ? 77.909  12.485 8.077   1.00 33.51  ? 119  ILE A CG1   1 
ATOM   1447 C CG2   . ILE C 3 119 ? 76.011  14.041 8.399   1.00 29.17  ? 119  ILE A CG2   1 
ATOM   1448 C CD1   . ILE C 3 119 ? 77.852  12.547 6.582   1.00 36.65  ? 119  ILE A CD1   1 
ATOM   1449 N N     . LYS C 3 120 ? 77.922  16.073 10.457  1.00 32.29  ? 120  LYS A N     1 
ATOM   1450 C CA    . LYS C 3 120 ? 77.423  17.076 11.385  1.00 36.19  ? 120  LYS A CA    1 
ATOM   1451 C C     . LYS C 3 120 ? 78.013  18.456 11.258  1.00 35.81  ? 120  LYS A C     1 
ATOM   1452 O O     . LYS C 3 120 ? 77.288  19.453 11.339  1.00 37.76  ? 120  LYS A O     1 
ATOM   1453 C CB    . LYS C 3 120 ? 77.571  16.576 12.839  1.00 36.99  ? 120  LYS A CB    1 
ATOM   1454 C CG    . LYS C 3 120 ? 76.516  15.531 13.208  1.00 41.08  ? 120  LYS A CG    1 
ATOM   1455 C CD    . LYS C 3 120 ? 76.803  14.759 14.496  1.00 45.07  ? 120  LYS A CD    1 
ATOM   1456 C CE    . LYS C 3 120 ? 76.688  15.600 15.751  1.00 46.21  ? 120  LYS A CE    1 
ATOM   1457 N NZ    . LYS C 3 120 ? 77.843  16.542 15.856  1.00 48.00  ? 120  LYS A NZ    1 
ATOM   1458 N N     . THR C 3 121 ? 79.323  18.522 11.053  1.00 34.38  ? 121  THR A N     1 
ATOM   1459 C CA    . THR C 3 121 ? 79.979  19.806 10.950  1.00 30.80  ? 121  THR A CA    1 
ATOM   1460 C C     . THR C 3 121 ? 79.572  20.495 9.671   1.00 31.54  ? 121  THR A C     1 
ATOM   1461 O O     . THR C 3 121 ? 79.306  21.709 9.657   1.00 34.08  ? 121  THR A O     1 
ATOM   1462 C CB    . THR C 3 121 ? 81.497  19.648 11.002  1.00 28.06  ? 121  THR A CB    1 
ATOM   1463 O OG1   . THR C 3 121 ? 81.829  18.929 12.182  1.00 28.23  ? 121  THR A OG1   1 
ATOM   1464 C CG2   . THR C 3 121 ? 82.180  21.002 11.051  1.00 28.02  ? 121  THR A CG2   1 
ATOM   1465 N N     . THR C 3 122 ? 79.507  19.730 8.595   1.00 26.37  ? 122  THR A N     1 
ATOM   1466 C CA    . THR C 3 122 ? 79.127  20.316 7.330   1.00 26.78  ? 122  THR A CA    1 
ATOM   1467 C C     . THR C 3 122 ? 77.702  20.876 7.337   1.00 27.00  ? 122  THR A C     1 
ATOM   1468 O O     . THR C 3 122 ? 77.461  21.967 6.844   1.00 27.58  ? 122  THR A O     1 
ATOM   1469 C CB    . THR C 3 122 ? 79.269  19.303 6.201   1.00 27.85  ? 122  THR A CB    1 
ATOM   1470 O OG1   . THR C 3 122 ? 80.643  18.930 6.080   1.00 31.19  ? 122  THR A OG1   1 
ATOM   1471 C CG2   . THR C 3 122 ? 78.809  19.891 4.911   1.00 24.97  ? 122  THR A CG2   1 
ATOM   1472 N N     . LEU C 3 123 ? 76.746  20.133 7.871   1.00 29.18  ? 123  LEU A N     1 
ATOM   1473 C CA    . LEU C 3 123 ? 75.367  20.631 7.912   1.00 30.14  ? 123  LEU A CA    1 
ATOM   1474 C C     . LEU C 3 123 ? 75.262  21.867 8.815   1.00 30.02  ? 123  LEU A C     1 
ATOM   1475 O O     . LEU C 3 123 ? 74.499  22.776 8.543   1.00 30.98  ? 123  LEU A O     1 
ATOM   1476 C CB    . LEU C 3 123 ? 74.429  19.543 8.403   1.00 30.89  ? 123  LEU A CB    1 
ATOM   1477 C CG    . LEU C 3 123 ? 74.004  18.522 7.361   1.00 33.37  ? 123  LEU A CG    1 
ATOM   1478 C CD1   . LEU C 3 123 ? 73.511  17.273 8.037   1.00 32.75  ? 123  LEU A CD1   1 
ATOM   1479 C CD2   . LEU C 3 123 ? 72.908  19.152 6.476   1.00 33.77  ? 123  LEU A CD2   1 
ATOM   1480 N N     . ALA C 3 124 ? 76.059  21.894 9.873   1.00 29.18  ? 124  ALA A N     1 
ATOM   1481 C CA    . ALA C 3 124 ? 76.066  23.019 10.785  1.00 31.67  ? 124  ALA A CA    1 
ATOM   1482 C C     . ALA C 3 124 ? 76.594  24.302 10.124  1.00 33.99  ? 124  ALA A C     1 
ATOM   1483 O O     . ALA C 3 124 ? 76.021  25.378 10.328  1.00 35.54  ? 124  ALA A O     1 
ATOM   1484 C CB    . ALA C 3 124 ? 76.899  22.686 12.013  1.00 29.79  ? 124  ALA A CB    1 
ATOM   1485 N N     . CYS C 3 125 ? 77.688  24.188 9.355   1.00 32.43  ? 125  CYS A N     1 
ATOM   1486 C CA    . CYS C 3 125 ? 78.275  25.337 8.675   1.00 32.19  ? 125  CYS A CA    1 
ATOM   1487 C C     . CYS C 3 125 ? 77.277  25.892 7.654   1.00 33.98  ? 125  CYS A C     1 
ATOM   1488 O O     . CYS C 3 125 ? 77.237  27.108 7.405   1.00 32.25  ? 125  CYS A O     1 
ATOM   1489 C CB    . CYS C 3 125 ? 79.599  24.952 7.972   1.00 32.59  ? 125  CYS A CB    1 
ATOM   1490 S SG    . CYS C 3 125 ? 81.003  24.580 9.100   1.00 37.83  ? 125  CYS A SG    1 
ATOM   1491 N N     . LEU C 3 126 ? 76.482  25.003 7.059   1.00 33.18  ? 126  LEU A N     1 
ATOM   1492 C CA    . LEU C 3 126 ? 75.474  25.417 6.088   1.00 36.58  ? 126  LEU A CA    1 
ATOM   1493 C C     . LEU C 3 126 ? 74.319  26.246 6.704   1.00 39.46  ? 126  LEU A C     1 
ATOM   1494 O O     . LEU C 3 126 ? 73.513  26.815 5.982   1.00 39.53  ? 126  LEU A O     1 
ATOM   1495 C CB    . LEU C 3 126 ? 74.905  24.197 5.364   1.00 34.79  ? 126  LEU A CB    1 
ATOM   1496 C CG    . LEU C 3 126 ? 75.889  23.510 4.405   1.00 38.81  ? 126  LEU A CG    1 
ATOM   1497 C CD1   . LEU C 3 126 ? 75.354  22.179 3.906   1.00 35.29  ? 126  LEU A CD1   1 
ATOM   1498 C CD2   . LEU C 3 126 ? 76.130  24.436 3.238   1.00 37.79  ? 126  LEU A CD2   1 
ATOM   1499 N N     . THR C 3 127 ? 74.235  26.319 8.031   1.00 41.98  ? 127  THR A N     1 
ATOM   1500 C CA    . THR C 3 127 ? 73.175  27.115 8.639   1.00 42.92  ? 127  THR A CA    1 
ATOM   1501 C C     . THR C 3 127 ? 73.602  28.566 8.599   1.00 47.74  ? 127  THR A C     1 
ATOM   1502 O O     . THR C 3 127 ? 72.910  29.435 9.123   1.00 49.50  ? 127  THR A O     1 
ATOM   1503 C CB    . THR C 3 127 ? 72.880  26.739 10.106  1.00 37.66  ? 127  THR A CB    1 
ATOM   1504 O OG1   . THR C 3 127 ? 73.930  27.214 10.942  1.00 33.24  ? 127  THR A OG1   1 
ATOM   1505 C CG2   . THR C 3 127 ? 72.749  25.241 10.260  1.00 36.53  ? 127  THR A CG2   1 
ATOM   1506 N N     . SER C 3 128 ? 74.753  28.820 7.983   1.00 51.84  ? 128  SER A N     1 
ATOM   1507 C CA    . SER C 3 128 ? 75.266  30.184 7.845   1.00 56.36  ? 128  SER A CA    1 
ATOM   1508 C C     . SER C 3 128 ? 74.758  30.696 6.505   1.00 59.53  ? 128  SER A C     1 
ATOM   1509 O O     . SER C 3 128 ? 74.885  30.016 5.491   1.00 62.74  ? 128  SER A O     1 
ATOM   1510 C CB    . SER C 3 128 ? 76.790  30.192 7.845   1.00 56.11  ? 128  SER A CB    1 
ATOM   1511 O OG    . SER C 3 128 ? 77.285  31.434 7.373   1.00 56.76  ? 128  SER A OG    1 
ATOM   1512 N N     . ALA C 3 129 ? 74.187  31.892 6.486   1.00 62.77  ? 129  ALA A N     1 
ATOM   1513 C CA    . ALA C 3 129 ? 73.635  32.419 5.239   1.00 65.73  ? 129  ALA A CA    1 
ATOM   1514 C C     . ALA C 3 129 ? 74.715  32.912 4.296   1.00 66.92  ? 129  ALA A C     1 
ATOM   1515 O O     . ALA C 3 129 ? 74.575  32.835 3.069   1.00 65.86  ? 129  ALA A O     1 
ATOM   1516 C CB    . ALA C 3 129 ? 72.638  33.553 5.544   1.00 67.80  ? 129  ALA A CB    1 
ATOM   1517 N N     . ASP C 3 130 ? 75.801  33.400 4.889   1.00 68.48  ? 130  ASP A N     1 
ATOM   1518 C CA    . ASP C 3 130 ? 76.909  33.944 4.132   1.00 69.20  ? 130  ASP A CA    1 
ATOM   1519 C C     . ASP C 3 130 ? 78.116  33.041 3.959   1.00 67.98  ? 130  ASP A C     1 
ATOM   1520 O O     . ASP C 3 130 ? 78.267  32.392 2.919   1.00 71.54  ? 130  ASP A O     1 
ATOM   1521 C CB    . ASP C 3 130 ? 77.362  35.264 4.754   1.00 73.01  ? 130  ASP A CB    1 
ATOM   1522 C CG    . ASP C 3 130 ? 76.371  36.384 4.521   1.00 77.62  ? 130  ASP A CG    1 
ATOM   1523 O OD1   . ASP C 3 130 ? 75.996  36.614 3.349   1.00 79.43  ? 130  ASP A OD1   1 
ATOM   1524 O OD2   . ASP C 3 130 ? 75.969  37.038 5.507   1.00 80.34  ? 130  ASP A OD2   1 
ATOM   1525 N N     . ASN C 3 131 ? 78.971  32.999 4.977   1.00 62.99  ? 131  ASN A N     1 
ATOM   1526 C CA    . ASN C 3 131 ? 80.201  32.223 4.913   1.00 57.15  ? 131  ASN A CA    1 
ATOM   1527 C C     . ASN C 3 131 ? 80.191  30.689 4.925   1.00 53.26  ? 131  ASN A C     1 
ATOM   1528 O O     . ASN C 3 131 ? 80.195  30.057 5.990   1.00 50.47  ? 131  ASN A O     1 
ATOM   1529 C CB    . ASN C 3 131 ? 81.165  32.698 6.000   1.00 58.69  ? 131  ASN A CB    1 
ATOM   1530 C CG    . ASN C 3 131 ? 82.618  32.557 5.580   1.00 60.39  ? 131  ASN A CG    1 
ATOM   1531 O OD1   . ASN C 3 131 ? 83.113  31.454 5.360   1.00 61.53  ? 131  ASN A OD1   1 
ATOM   1532 N ND2   . ASN C 3 131 ? 83.305  33.686 5.449   1.00 63.52  ? 131  ASN A ND2   1 
ATOM   1533 N N     . THR C 3 132 ? 80.203  30.106 3.727   1.00 46.87  ? 132  THR A N     1 
ATOM   1534 C CA    . THR C 3 132 ? 80.297  28.662 3.568   1.00 43.57  ? 132  THR A CA    1 
ATOM   1535 C C     . THR C 3 132 ? 81.434  28.416 2.568   1.00 40.07  ? 132  THR A C     1 
ATOM   1536 O O     . THR C 3 132 ? 81.359  27.518 1.729   1.00 36.52  ? 132  THR A O     1 
ATOM   1537 C CB    . THR C 3 132 ? 79.003  28.022 3.004   1.00 45.95  ? 132  THR A CB    1 
ATOM   1538 O OG1   . THR C 3 132 ? 78.661  28.650 1.760   1.00 46.67  ? 132  THR A OG1   1 
ATOM   1539 C CG2   . THR C 3 132 ? 77.851  28.137 4.008   1.00 46.12  ? 132  THR A CG2   1 
ATOM   1540 N N     . THR C 3 133 ? 82.476  29.245 2.614   1.00 36.88  ? 133  THR A N     1 
ATOM   1541 C CA    . THR C 3 133 ? 83.598  29.017 1.696   1.00 35.37  ? 133  THR A CA    1 
ATOM   1542 C C     . THR C 3 133 ? 84.253  27.685 2.079   1.00 36.89  ? 133  THR A C     1 
ATOM   1543 O O     . THR C 3 133 ? 84.132  27.218 3.216   1.00 34.27  ? 133  THR A O     1 
ATOM   1544 C CB    . THR C 3 133 ? 84.665  30.094 1.820   1.00 35.46  ? 133  THR A CB    1 
ATOM   1545 O OG1   . THR C 3 133 ? 85.043  30.224 3.197   1.00 40.31  ? 133  THR A OG1   1 
ATOM   1546 C CG2   . THR C 3 133 ? 84.164  31.433 1.274   1.00 35.87  ? 133  THR A CG2   1 
ATOM   1547 N N     . VAL C 3 134 ? 84.955  27.070 1.137   1.00 37.79  ? 134  VAL A N     1 
ATOM   1548 C CA    . VAL C 3 134 ? 85.618  25.804 1.426   1.00 38.80  ? 134  VAL A CA    1 
ATOM   1549 C C     . VAL C 3 134 ? 86.554  25.928 2.637   1.00 36.99  ? 134  VAL A C     1 
ATOM   1550 O O     . VAL C 3 134 ? 86.823  24.941 3.319   1.00 39.76  ? 134  VAL A O     1 
ATOM   1551 C CB    . VAL C 3 134 ? 86.406  25.282 0.181   1.00 40.44  ? 134  VAL A CB    1 
ATOM   1552 C CG1   . VAL C 3 134 ? 87.626  26.168 -0.096  1.00 41.60  ? 134  VAL A CG1   1 
ATOM   1553 C CG2   . VAL C 3 134 ? 86.806  23.846 0.389   1.00 38.50  ? 134  VAL A CG2   1 
ATOM   1554 N N     . GLN C 3 135 ? 87.026  27.135 2.925   1.00 35.26  ? 135  GLN A N     1 
ATOM   1555 C CA    . GLN C 3 135 ? 87.917  27.354 4.067   1.00 34.76  ? 135  GLN A CA    1 
ATOM   1556 C C     . GLN C 3 135 ? 87.192  27.209 5.382   1.00 36.61  ? 135  GLN A C     1 
ATOM   1557 O O     . GLN C 3 135 ? 87.641  26.497 6.293   1.00 40.92  ? 135  GLN A O     1 
ATOM   1558 C CB    . GLN C 3 135 ? 88.544  28.750 4.038   1.00 35.95  ? 135  GLN A CB    1 
ATOM   1559 C CG    . GLN C 3 135 ? 89.691  28.898 3.091   1.00 35.52  ? 135  GLN A CG    1 
ATOM   1560 C CD    . GLN C 3 135 ? 89.258  29.364 1.725   1.00 38.07  ? 135  GLN A CD    1 
ATOM   1561 O OE1   . GLN C 3 135 ? 88.157  29.052 1.269   1.00 37.02  ? 135  GLN A OE1   1 
ATOM   1562 N NE2   . GLN C 3 135 ? 90.135  30.109 1.050   1.00 35.02  ? 135  GLN A NE2   1 
ATOM   1563 N N     . ALA C 3 136 ? 86.064  27.891 5.484   1.00 34.24  ? 136  ALA A N     1 
ATOM   1564 C CA    . ALA C 3 136 ? 85.296  27.849 6.703   1.00 34.05  ? 136  ALA A CA    1 
ATOM   1565 C C     . ALA C 3 136 ? 84.880  26.436 7.040   1.00 33.79  ? 136  ALA A C     1 
ATOM   1566 O O     . ALA C 3 136 ? 84.974  26.000 8.183   1.00 36.09  ? 136  ALA A O     1 
ATOM   1567 C CB    . ALA C 3 136 ? 84.044  28.747 6.575   1.00 35.74  ? 136  ALA A CB    1 
ATOM   1568 N N     . VAL C 3 137 ? 84.416  25.705 6.044   1.00 32.77  ? 137  VAL A N     1 
ATOM   1569 C CA    . VAL C 3 137 ? 83.935  24.380 6.326   1.00 31.08  ? 137  VAL A CA    1 
ATOM   1570 C C     . VAL C 3 137 ? 85.045  23.392 6.655   1.00 33.66  ? 137  VAL A C     1 
ATOM   1571 O O     . VAL C 3 137 ? 84.937  22.646 7.633   1.00 34.42  ? 137  VAL A O     1 
ATOM   1572 C CB    . VAL C 3 137 ? 83.102  23.875 5.165   1.00 29.81  ? 137  VAL A CB    1 
ATOM   1573 C CG1   . VAL C 3 137 ? 82.578  22.501 5.449   1.00 24.65  ? 137  VAL A CG1   1 
ATOM   1574 C CG2   . VAL C 3 137 ? 81.991  24.840 4.902   1.00 30.77  ? 137  VAL A CG2   1 
ATOM   1575 N N     . ALA C 3 138 ? 86.115  23.402 5.859   1.00 33.47  ? 138  ALA A N     1 
ATOM   1576 C CA    . ALA C 3 138 ? 87.215  22.476 6.082   1.00 30.23  ? 138  ALA A CA    1 
ATOM   1577 C C     . ALA C 3 138 ? 87.897  22.831 7.384   1.00 32.11  ? 138  ALA A C     1 
ATOM   1578 O O     . ALA C 3 138 ? 88.417  21.960 8.082   1.00 32.76  ? 138  ALA A O     1 
ATOM   1579 C CB    . ALA C 3 138 ? 88.204  22.529 4.921   1.00 32.81  ? 138  ALA A CB    1 
ATOM   1580 N N     . SER C 3 139 ? 87.891  24.116 7.717   1.00 32.40  ? 139  SER A N     1 
ATOM   1581 C CA    . SER C 3 139 ? 88.495  24.574 8.957   1.00 32.19  ? 139  SER A CA    1 
ATOM   1582 C C     . SER C 3 139 ? 87.718  24.018 10.148  1.00 33.95  ? 139  SER A C     1 
ATOM   1583 O O     . SER C 3 139 ? 88.304  23.515 11.105  1.00 35.04  ? 139  SER A O     1 
ATOM   1584 C CB    . SER C 3 139 ? 88.471  26.093 8.994   1.00 33.55  ? 139  SER A CB    1 
ATOM   1585 O OG    . SER C 3 139 ? 88.950  26.597 10.221  1.00 39.80  ? 139  SER A OG    1 
ATOM   1586 N N     . ALA C 3 140 ? 86.391  24.113 10.086  1.00 30.65  ? 140  ALA A N     1 
ATOM   1587 C CA    . ALA C 3 140 ? 85.536  23.622 11.160  1.00 32.26  ? 140  ALA A CA    1 
ATOM   1588 C C     . ALA C 3 140 ? 85.625  22.093 11.318  1.00 32.91  ? 140  ALA A C     1 
ATOM   1589 O O     . ALA C 3 140 ? 85.514  21.563 12.420  1.00 31.29  ? 140  ALA A O     1 
ATOM   1590 C CB    . ALA C 3 140 ? 84.093  24.039 10.901  1.00 29.81  ? 140  ALA A CB    1 
ATOM   1591 N N     . ILE C 3 141 ? 85.820  21.396 10.208  1.00 33.15  ? 141  ILE A N     1 
ATOM   1592 C CA    . ILE C 3 141 ? 85.929  19.952 10.245  1.00 35.39  ? 141  ILE A CA    1 
ATOM   1593 C C     . ILE C 3 141 ? 87.279  19.520 10.819  1.00 36.73  ? 141  ILE A C     1 
ATOM   1594 O O     . ILE C 3 141 ? 87.341  18.571 11.613  1.00 35.94  ? 141  ILE A O     1 
ATOM   1595 C CB    . ILE C 3 141 ? 85.784  19.352 8.848   1.00 35.75  ? 141  ILE A CB    1 
ATOM   1596 C CG1   . ILE C 3 141 ? 84.343  19.521 8.361   1.00 34.26  ? 141  ILE A CG1   1 
ATOM   1597 C CG2   . ILE C 3 141 ? 86.198  17.884 8.884   1.00 34.87  ? 141  ILE A CG2   1 
ATOM   1598 C CD1   . ILE C 3 141 ? 84.139  19.171 6.932   1.00 31.69  ? 141  ILE A CD1   1 
ATOM   1599 N N     . GLY C 3 142 ? 88.345  20.220 10.423  1.00 35.90  ? 142  GLY A N     1 
ATOM   1600 C CA    . GLY C 3 142 ? 89.668  19.878 10.900  1.00 38.79  ? 142  GLY A CA    1 
ATOM   1601 C C     . GLY C 3 142 ? 89.766  20.033 12.403  1.00 40.01  ? 142  GLY A C     1 
ATOM   1602 O O     . GLY C 3 142 ? 90.311  19.185 13.101  1.00 40.47  ? 142  GLY A O     1 
ATOM   1603 N N     . ARG C 3 143 ? 89.213  21.132 12.892  1.00 41.87  ? 143  ARG A N     1 
ATOM   1604 C CA    . ARG C 3 143 ? 89.195  21.441 14.307  1.00 42.15  ? 143  ARG A CA    1 
ATOM   1605 C C     . ARG C 3 143 ? 88.484  20.343 15.108  1.00 41.02  ? 143  ARG A C     1 
ATOM   1606 O O     . ARG C 3 143 ? 88.951  19.938 16.171  1.00 40.86  ? 143  ARG A O     1 
ATOM   1607 C CB    . ARG C 3 143 ? 88.495  22.792 14.519  1.00 43.27  ? 143  ARG A CB    1 
ATOM   1608 C CG    . ARG C 3 143 ? 88.362  23.217 15.971  1.00 48.05  ? 143  ARG A CG    1 
ATOM   1609 C CD    . ARG C 3 143 ? 87.617  24.518 16.102  1.00 53.37  ? 143  ARG A CD    1 
ATOM   1610 N NE    . ARG C 3 143 ? 87.517  24.917 17.500  1.00 62.20  ? 143  ARG A NE    1 
ATOM   1611 C CZ    . ARG C 3 143 ? 86.963  26.052 17.928  1.00 66.76  ? 143  ARG A CZ    1 
ATOM   1612 N NH1   . ARG C 3 143 ? 86.449  26.914 17.053  1.00 69.17  ? 143  ARG A NH1   1 
ATOM   1613 N NH2   . ARG C 3 143 ? 86.931  26.331 19.230  1.00 66.24  ? 143  ARG A NH2   1 
ATOM   1614 N N     . ALA C 3 144 ? 87.347  19.872 14.601  1.00 39.08  ? 144  ALA A N     1 
ATOM   1615 C CA    . ALA C 3 144 ? 86.596  18.835 15.286  1.00 36.63  ? 144  ALA A CA    1 
ATOM   1616 C C     . ALA C 3 144 ? 87.320  17.490 15.159  1.00 34.46  ? 144  ALA A C     1 
ATOM   1617 O O     . ALA C 3 144 ? 87.372  16.724 16.099  1.00 31.85  ? 144  ALA A O     1 
ATOM   1618 C CB    . ALA C 3 144 ? 85.160  18.745 14.707  1.00 34.25  ? 144  ALA A CB    1 
ATOM   1619 N N     . ILE C 3 145 ? 87.860  17.192 13.989  1.00 36.87  ? 145  ILE A N     1 
ATOM   1620 C CA    . ILE C 3 145 ? 88.589  15.939 13.819  1.00 37.80  ? 145  ILE A CA    1 
ATOM   1621 C C     . ILE C 3 145 ? 89.743  15.898 14.812  1.00 39.96  ? 145  ILE A C     1 
ATOM   1622 O O     . ILE C 3 145 ? 90.046  14.845 15.371  1.00 43.49  ? 145  ILE A O     1 
ATOM   1623 C CB    . ILE C 3 145 ? 89.166  15.798 12.404  1.00 37.32  ? 145  ILE A CB    1 
ATOM   1624 C CG1   . ILE C 3 145 ? 88.031  15.597 11.405  1.00 36.05  ? 145  ILE A CG1   1 
ATOM   1625 C CG2   . ILE C 3 145 ? 90.138  14.626 12.349  1.00 35.83  ? 145  ILE A CG2   1 
ATOM   1626 C CD1   . ILE C 3 145 ? 87.250  14.329 11.637  1.00 42.11  ? 145  ILE A CD1   1 
ATOM   1627 N N     . GLU C 3 146 ? 90.379  17.043 15.039  1.00 37.40  ? 146  GLU A N     1 
ATOM   1628 C CA    . GLU C 3 146 ? 91.495  17.082 15.964  1.00 37.26  ? 146  GLU A CA    1 
ATOM   1629 C C     . GLU C 3 146 ? 91.047  16.857 17.419  1.00 39.28  ? 146  GLU A C     1 
ATOM   1630 O O     . GLU C 3 146 ? 91.807  16.312 18.236  1.00 39.49  ? 146  GLU A O     1 
ATOM   1631 C CB    . GLU C 3 146 ? 92.267  18.410 15.855  1.00 38.11  ? 146  GLU A CB    1 
ATOM   1632 C CG    . GLU C 3 146 ? 93.578  18.378 16.649  1.00 38.47  ? 146  GLU A CG    1 
ATOM   1633 C CD    . GLU C 3 146 ? 94.192  19.738 16.878  1.00 40.95  ? 146  GLU A CD    1 
ATOM   1634 O OE1   . GLU C 3 146 ? 94.110  20.587 15.975  1.00 46.08  ? 146  GLU A OE1   1 
ATOM   1635 O OE2   . GLU C 3 146 ? 94.776  19.956 17.959  1.00 43.72  ? 146  GLU A OE2   1 
ATOM   1636 N N     . ASP C 3 147 ? 89.842  17.302 17.759  1.00 37.72  ? 147  ASP A N     1 
ATOM   1637 C CA    . ASP C 3 147 ? 89.344  17.093 19.112  1.00 37.17  ? 147  ASP A CA    1 
ATOM   1638 C C     . ASP C 3 147 ? 89.320  15.572 19.318  1.00 36.69  ? 147  ASP A C     1 
ATOM   1639 O O     . ASP C 3 147 ? 89.837  15.092 20.290  1.00 37.18  ? 147  ASP A O     1 
ATOM   1640 C CB    . ASP C 3 147 ? 87.917  17.658 19.295  1.00 42.24  ? 147  ASP A CB    1 
ATOM   1641 C CG    . ASP C 3 147 ? 87.863  19.192 19.252  1.00 46.91  ? 147  ASP A CG    1 
ATOM   1642 O OD1   . ASP C 3 147 ? 88.936  19.842 19.222  1.00 44.83  ? 147  ASP A OD1   1 
ATOM   1643 O OD2   . ASP C 3 147 ? 86.735  19.751 19.262  1.00 48.57  ? 147  ASP A OD2   1 
ATOM   1644 N N     . GLU C 3 148 ? 88.733  14.824 18.387  1.00 36.64  ? 148  GLU A N     1 
ATOM   1645 C CA    . GLU C 3 148 ? 88.661  13.362 18.486  1.00 37.33  ? 148  GLU A CA    1 
ATOM   1646 C C     . GLU C 3 148 ? 90.001  12.620 18.542  1.00 36.81  ? 148  GLU A C     1 
ATOM   1647 O O     . GLU C 3 148 ? 90.139  11.678 19.331  1.00 38.54  ? 148  GLU A O     1 
ATOM   1648 C CB    . GLU C 3 148 ? 87.840  12.787 17.319  1.00 36.93  ? 148  GLU A CB    1 
ATOM   1649 C CG    . GLU C 3 148 ? 87.762  11.254 17.280  1.00 38.40  ? 148  GLU A CG    1 
ATOM   1650 C CD    . GLU C 3 148 ? 87.202  10.632 18.576  1.00 41.64  ? 148  GLU A CD    1 
ATOM   1651 O OE1   . GLU C 3 148 ? 86.375  11.271 19.260  1.00 39.27  ? 148  GLU A OE1   1 
ATOM   1652 O OE2   . GLU C 3 148 ? 87.574  9.482  18.909  1.00 46.04  ? 148  GLU A OE2   1 
ATOM   1653 N N     . ALA C 3 149 ? 90.958  13.007 17.700  1.00 35.12  ? 149  ALA A N     1 
ATOM   1654 C CA    . ALA C 3 149 ? 92.268  12.360 17.671  1.00 36.56  ? 149  ALA A CA    1 
ATOM   1655 C C     . ALA C 3 149 ? 92.788  12.409 19.092  1.00 40.24  ? 149  ALA A C     1 
ATOM   1656 O O     . ALA C 3 149 ? 93.184  11.400 19.670  1.00 44.93  ? 149  ALA A O     1 
ATOM   1657 C CB    . ALA C 3 149 ? 93.220  13.101 16.723  1.00 34.72  ? 149  ALA A CB    1 
ATOM   1658 N N     . ARG C 3 150 ? 92.780  13.606 19.653  1.00 41.57  ? 150  ARG A N     1 
ATOM   1659 C CA    . ARG C 3 150 ? 93.183  13.830 21.035  1.00 43.32  ? 150  ARG A CA    1 
ATOM   1660 C C     . ARG C 3 150 ? 91.884  13.503 21.779  1.00 42.95  ? 150  ARG A C     1 
ATOM   1661 O O     . ARG C 3 150 ? 90.833  13.545 21.187  1.00 47.88  ? 150  ARG A O     1 
ATOM   1662 C CB    . ARG C 3 150 ? 93.541  15.302 21.185  1.00 45.35  ? 150  ARG A CB    1 
ATOM   1663 C CG    . ARG C 3 150 ? 94.307  15.631 22.415  1.00 55.10  ? 150  ARG A CG    1 
ATOM   1664 C CD    . ARG C 3 150 ? 94.966  16.975 22.252  1.00 61.15  ? 150  ARG A CD    1 
ATOM   1665 N NE    . ARG C 3 150 ? 95.857  17.274 23.364  1.00 66.28  ? 150  ARG A NE    1 
ATOM   1666 C CZ    . ARG C 3 150 ? 96.438  18.451 23.543  1.00 68.80  ? 150  ARG A CZ    1 
ATOM   1667 N NH1   . ARG C 3 150 ? 96.216  19.433 22.675  1.00 71.03  ? 150  ARG A NH1   1 
ATOM   1668 N NH2   . ARG C 3 150 ? 97.223  18.651 24.592  1.00 69.15  ? 150  ARG A NH2   1 
ATOM   1669 N N     . PHE C 3 151 ? 91.897  13.159 23.047  1.00 41.60  ? 151  PHE A N     1 
ATOM   1670 C CA    . PHE C 3 151 ? 90.598  12.859 23.713  1.00 39.17  ? 151  PHE A CA    1 
ATOM   1671 C C     . PHE C 3 151 ? 89.843  11.574 23.298  1.00 35.81  ? 151  PHE A C     1 
ATOM   1672 O O     . PHE C 3 151 ? 89.084  11.017 24.092  1.00 36.08  ? 151  PHE A O     1 
ATOM   1673 C CB    . PHE C 3 151 ? 89.652  14.065 23.604  1.00 39.03  ? 151  PHE A CB    1 
ATOM   1674 C CG    . PHE C 3 151 ? 90.218  15.322 24.213  1.00 37.83  ? 151  PHE A CG    1 
ATOM   1675 C CD1   . PHE C 3 151 ? 90.601  15.351 25.556  1.00 35.09  ? 151  PHE A CD1   1 
ATOM   1676 C CD2   . PHE C 3 151 ? 90.480  16.428 23.419  1.00 36.47  ? 151  PHE A CD2   1 
ATOM   1677 C CE1   . PHE C 3 151 ? 91.249  16.455 26.087  1.00 36.53  ? 151  PHE A CE1   1 
ATOM   1678 C CE2   . PHE C 3 151 ? 91.132  17.551 23.944  1.00 39.57  ? 151  PHE A CE2   1 
ATOM   1679 C CZ    . PHE C 3 151 ? 91.521  17.564 25.278  1.00 37.59  ? 151  PHE A CZ    1 
ATOM   1680 N N     . GLY C 3 152 ? 90.054  11.086 22.086  1.00 33.09  ? 152  GLY A N     1 
ATOM   1681 C CA    . GLY C 3 152 ? 89.389  9.858  21.687  1.00 36.89  ? 152  GLY A CA    1 
ATOM   1682 C C     . GLY C 3 152 ? 89.677  8.645  22.586  1.00 40.29  ? 152  GLY A C     1 
ATOM   1683 O O     . GLY C 3 152 ? 88.769  7.878  22.928  1.00 40.42  ? 152  GLY A O     1 
ATOM   1684 N N     . ARG C 3 153 ? 90.933  8.439  22.965  1.00 42.55  ? 153  ARG A N     1 
ATOM   1685 C CA    . ARG C 3 153 ? 91.258  7.301  23.820  1.00 44.53  ? 153  ARG A CA    1 
ATOM   1686 C C     . ARG C 3 153 ? 90.494  7.364  25.150  1.00 41.25  ? 153  ARG A C     1 
ATOM   1687 O O     . ARG C 3 153 ? 89.916  6.372  25.599  1.00 37.82  ? 153  ARG A O     1 
ATOM   1688 C CB    . ARG C 3 153 ? 92.767  7.240  24.073  1.00 48.70  ? 153  ARG A CB    1 
ATOM   1689 C CG    . ARG C 3 153 ? 93.194  6.019  24.869  1.00 57.93  ? 153  ARG A CG    1 
ATOM   1690 C CD    . ARG C 3 153 ? 94.650  5.662  24.595  1.00 64.60  ? 153  ARG A CD    1 
ATOM   1691 N NE    . ARG C 3 153 ? 95.562  6.707  25.044  1.00 72.71  ? 153  ARG A NE    1 
ATOM   1692 C CZ    . ARG C 3 153 ? 95.884  6.924  26.317  1.00 77.02  ? 153  ARG A CZ    1 
ATOM   1693 N NH1   . ARG C 3 153 ? 95.370  6.163  27.279  1.00 76.17  ? 153  ARG A NH1   1 
ATOM   1694 N NH2   . ARG C 3 153 ? 96.719  7.910  26.626  1.00 77.95  ? 153  ARG A NH2   1 
ATOM   1695 N N     . ILE C 3 154 ? 90.477  8.540  25.766  1.00 40.05  ? 154  ILE A N     1 
ATOM   1696 C CA    . ILE C 3 154 ? 89.771  8.726  27.022  1.00 39.87  ? 154  ILE A CA    1 
ATOM   1697 C C     . ILE C 3 154 ? 88.252  8.676  26.854  1.00 40.82  ? 154  ILE A C     1 
ATOM   1698 O O     . ILE C 3 154 ? 87.521  8.482  27.823  1.00 40.99  ? 154  ILE A O     1 
ATOM   1699 C CB    . ILE C 3 154 ? 90.143  10.049 27.660  1.00 39.23  ? 154  ILE A CB    1 
ATOM   1700 C CG1   . ILE C 3 154 ? 91.581  9.972  28.170  1.00 39.13  ? 154  ILE A CG1   1 
ATOM   1701 C CG2   . ILE C 3 154 ? 89.129  10.400 28.760  1.00 37.05  ? 154  ILE A CG2   1 
ATOM   1702 C CD1   . ILE C 3 154 ? 92.119  11.309 28.646  1.00 40.52  ? 154  ILE A CD1   1 
ATOM   1703 N N     . ARG C 3 155 ? 87.781  8.863  25.627  1.00 42.01  ? 155  ARG A N     1 
ATOM   1704 C CA    . ARG C 3 155 ? 86.352  8.821  25.350  1.00 42.94  ? 155  ARG A CA    1 
ATOM   1705 C C     . ARG C 3 155 ? 85.927  7.361  25.270  1.00 44.04  ? 155  ARG A C     1 
ATOM   1706 O O     . ARG C 3 155 ? 84.845  6.981  25.728  1.00 42.63  ? 155  ARG A O     1 
ATOM   1707 C CB    . ARG C 3 155 ? 86.061  9.508  24.018  1.00 44.76  ? 155  ARG A CB    1 
ATOM   1708 C CG    . ARG C 3 155 ? 84.652  10.002 23.851  1.00 46.78  ? 155  ARG A CG    1 
ATOM   1709 C CD    . ARG C 3 155 ? 83.708  8.998  23.228  1.00 51.50  ? 155  ARG A CD    1 
ATOM   1710 N NE    . ARG C 3 155 ? 84.012  8.622  21.840  1.00 50.34  ? 155  ARG A NE    1 
ATOM   1711 C CZ    . ARG C 3 155 ? 84.489  9.449  20.919  1.00 50.11  ? 155  ARG A CZ    1 
ATOM   1712 N NH1   . ARG C 3 155 ? 84.730  10.711 21.243  1.00 47.09  ? 155  ARG A NH1   1 
ATOM   1713 N NH2   . ARG C 3 155 ? 84.696  9.022  19.674  1.00 43.56  ? 155  ARG A NH2   1 
ATOM   1714 N N     . ASP C 3 156 ? 86.790  6.544  24.683  1.00 44.06  ? 156  ASP A N     1 
ATOM   1715 C CA    . ASP C 3 156 ? 86.502  5.133  24.514  1.00 46.68  ? 156  ASP A CA    1 
ATOM   1716 C C     . ASP C 3 156 ? 86.390  4.466  25.889  1.00 45.54  ? 156  ASP A C     1 
ATOM   1717 O O     . ASP C 3 156 ? 85.481  3.671  26.145  1.00 45.61  ? 156  ASP A O     1 
ATOM   1718 C CB    . ASP C 3 156 ? 87.607  4.504  23.651  1.00 52.96  ? 156  ASP A CB    1 
ATOM   1719 C CG    . ASP C 3 156 ? 87.350  3.042  23.331  1.00 60.84  ? 156  ASP A CG    1 
ATOM   1720 O OD1   . ASP C 3 156 ? 87.502  2.181  24.236  1.00 63.65  ? 156  ASP A OD1   1 
ATOM   1721 O OD2   . ASP C 3 156 ? 86.992  2.751  22.164  1.00 66.81  ? 156  ASP A OD2   1 
ATOM   1722 N N     . LEU C 3 157 ? 87.300  4.836  26.781  1.00 41.18  ? 157  LEU A N     1 
ATOM   1723 C CA    . LEU C 3 157 ? 87.329  4.298  28.120  1.00 38.41  ? 157  LEU A CA    1 
ATOM   1724 C C     . LEU C 3 157 ? 86.168  4.823  28.942  1.00 39.95  ? 157  LEU A C     1 
ATOM   1725 O O     . LEU C 3 157 ? 85.525  4.066  29.688  1.00 42.30  ? 157  LEU A O     1 
ATOM   1726 C CB    . LEU C 3 157 ? 88.654  4.661  28.785  1.00 38.98  ? 157  LEU A CB    1 
ATOM   1727 C CG    . LEU C 3 157 ? 89.895  4.166  28.037  1.00 41.02  ? 157  LEU A CG    1 
ATOM   1728 C CD1   . LEU C 3 157 ? 91.144  4.728  28.709  1.00 41.82  ? 157  LEU A CD1   1 
ATOM   1729 C CD2   . LEU C 3 157 ? 89.925  2.617  28.012  1.00 40.65  ? 157  LEU A CD2   1 
ATOM   1730 N N     . GLU C 3 158 ? 85.897  6.117  28.798  1.00 37.52  ? 158  GLU A N     1 
ATOM   1731 C CA    . GLU C 3 158 ? 84.826  6.766  29.525  1.00 37.24  ? 158  GLU A CA    1 
ATOM   1732 C C     . GLU C 3 158 ? 83.502  6.102  29.176  1.00 38.98  ? 158  GLU A C     1 
ATOM   1733 O O     . GLU C 3 158 ? 82.680  5.843  30.052  1.00 39.59  ? 158  GLU A O     1 
ATOM   1734 C CB    . GLU C 3 158 ? 84.815  8.275  29.190  1.00 39.20  ? 158  GLU A CB    1 
ATOM   1735 C CG    . GLU C 3 158 ? 83.784  9.127  29.937  1.00 36.11  ? 158  GLU A CG    1 
ATOM   1736 C CD    . GLU C 3 158 ? 83.999  10.656 29.735  1.00 40.34  ? 158  GLU A CD    1 
ATOM   1737 O OE1   . GLU C 3 158 ? 84.052  11.127 28.571  1.00 39.77  ? 158  GLU A OE1   1 
ATOM   1738 O OE2   . GLU C 3 158 ? 84.108  11.386 30.748  1.00 35.49  ? 158  GLU A OE2   1 
ATOM   1739 N N     . ALA C 3 159 ? 83.300  5.808  27.899  1.00 40.38  ? 159  ALA A N     1 
ATOM   1740 C CA    . ALA C 3 159 ? 82.061  5.165  27.468  1.00 43.63  ? 159  ALA A CA    1 
ATOM   1741 C C     . ALA C 3 159 ? 81.948  3.769  28.034  1.00 46.29  ? 159  ALA A C     1 
ATOM   1742 O O     . ALA C 3 159 ? 80.857  3.356  28.445  1.00 47.92  ? 159  ALA A O     1 
ATOM   1743 C CB    . ALA C 3 159 ? 81.977  5.096  25.946  1.00 39.84  ? 159  ALA A CB    1 
ATOM   1744 N N     . LYS C 3 160 ? 83.059  3.028  28.042  1.00 47.17  ? 160  LYS A N     1 
ATOM   1745 C CA    . LYS C 3 160 ? 83.018  1.664  28.573  1.00 46.50  ? 160  LYS A CA    1 
ATOM   1746 C C     . LYS C 3 160 ? 82.652  1.718  30.049  1.00 44.39  ? 160  LYS A C     1 
ATOM   1747 O O     . LYS C 3 160 ? 81.943  0.849  30.558  1.00 41.75  ? 160  LYS A O     1 
ATOM   1748 C CB    . LYS C 3 160 ? 84.370  0.957  28.407  1.00 48.02  ? 160  LYS A CB    1 
ATOM   1749 C CG    . LYS C 3 160 ? 84.771  0.709  26.953  1.00 52.86  ? 160  LYS A CG    1 
ATOM   1750 C CD    . LYS C 3 160 ? 86.094  -0.069 26.843  1.00 57.06  ? 160  LYS A CD    1 
ATOM   1751 C CE    . LYS C 3 160 ? 86.553  -0.202 25.394  1.00 58.53  ? 160  LYS A CE    1 
ATOM   1752 N NZ    . LYS C 3 160 ? 85.474  -0.738 24.504  1.00 62.35  ? 160  LYS A NZ    1 
ATOM   1753 N N     . HIS C 3 161 ? 83.116  2.769  30.715  1.00 42.72  ? 161  HIS A N     1 
ATOM   1754 C CA    . HIS C 3 161 ? 82.880  2.947  32.138  1.00 44.90  ? 161  HIS A CA    1 
ATOM   1755 C C     . HIS C 3 161 ? 81.443  3.273  32.534  1.00 46.20  ? 161  HIS A C     1 
ATOM   1756 O O     . HIS C 3 161 ? 80.930  2.709  33.495  1.00 47.08  ? 161  HIS A O     1 
ATOM   1757 C CB    . HIS C 3 161 ? 83.811  4.027  32.697  1.00 43.65  ? 161  HIS A CB    1 
ATOM   1758 C CG    . HIS C 3 161 ? 83.577  4.329  34.142  1.00 43.67  ? 161  HIS A CG    1 
ATOM   1759 N ND1   . HIS C 3 161 ? 84.048  3.527  35.155  1.00 44.72  ? 161  HIS A ND1   1 
ATOM   1760 C CD2   . HIS C 3 161 ? 82.856  5.302  34.741  1.00 46.05  ? 161  HIS A CD2   1 
ATOM   1761 C CE1   . HIS C 3 161 ? 83.624  3.988  36.317  1.00 44.61  ? 161  HIS A CE1   1 
ATOM   1762 N NE2   . HIS C 3 161 ? 82.897  5.065  36.093  1.00 44.36  ? 161  HIS A NE2   1 
ATOM   1763 N N     . PHE C 3 162 ? 80.786  4.174  31.810  1.00 46.79  ? 162  PHE A N     1 
ATOM   1764 C CA    . PHE C 3 162 ? 79.434  4.528  32.190  1.00 46.15  ? 162  PHE A CA    1 
ATOM   1765 C C     . PHE C 3 162 ? 78.418  3.557  31.678  1.00 45.80  ? 162  PHE A C     1 
ATOM   1766 O O     . PHE C 3 162 ? 77.231  3.688  31.963  1.00 46.53  ? 162  PHE A O     1 
ATOM   1767 C CB    . PHE C 3 162 ? 79.087  5.970  31.784  1.00 43.36  ? 162  PHE A CB    1 
ATOM   1768 C CG    . PHE C 3 162 ? 79.056  6.220  30.310  1.00 40.99  ? 162  PHE A CG    1 
ATOM   1769 C CD1   . PHE C 3 162 ? 78.103  5.615  29.504  1.00 38.89  ? 162  PHE A CD1   1 
ATOM   1770 C CD2   . PHE C 3 162 ? 79.930  7.123  29.745  1.00 41.03  ? 162  PHE A CD2   1 
ATOM   1771 C CE1   . PHE C 3 162 ? 78.017  5.902  28.175  1.00 37.70  ? 162  PHE A CE1   1 
ATOM   1772 C CE2   . PHE C 3 162 ? 79.852  7.423  28.398  1.00 42.64  ? 162  PHE A CE2   1 
ATOM   1773 C CZ    . PHE C 3 162 ? 78.889  6.807  27.611  1.00 41.17  ? 162  PHE A CZ    1 
ATOM   1774 N N     . LYS C 3 163 ? 78.889  2.575  30.919  1.00 47.68  ? 163  LYS A N     1 
ATOM   1775 C CA    . LYS C 3 163 ? 78.006  1.528  30.406  1.00 49.79  ? 163  LYS A CA    1 
ATOM   1776 C C     . LYS C 3 163 ? 77.711  0.567  31.564  1.00 50.20  ? 163  LYS A C     1 
ATOM   1777 O O     . LYS C 3 163 ? 76.630  -0.006 31.630  1.00 50.80  ? 163  LYS A O     1 
ATOM   1778 C CB    . LYS C 3 163 ? 78.680  0.768  29.264  1.00 49.64  ? 163  LYS A CB    1 
ATOM   1779 N N     . LYS C 3 164 ? 78.682  0.413  32.468  1.00 51.68  ? 164  LYS A N     1 
ATOM   1780 C CA    . LYS C 3 164 ? 78.571  -0.459 33.641  1.00 54.39  ? 164  LYS A CA    1 
ATOM   1781 C C     . LYS C 3 164 ? 77.845  0.260  34.779  1.00 57.07  ? 164  LYS A C     1 
ATOM   1782 O O     . LYS C 3 164 ? 78.195  1.386  35.119  1.00 59.05  ? 164  LYS A O     1 
ATOM   1783 C CB    . LYS C 3 164 ? 79.974  -0.897 34.101  1.00 52.03  ? 164  LYS A CB    1 
ATOM   1784 N N     . ASN C 3 165 ? 76.838  -0.382 35.371  1.00 61.32  ? 165  ASN A N     1 
ATOM   1785 C CA    . ASN C 3 165 ? 76.092  0.241  36.463  1.00 63.34  ? 165  ASN A CA    1 
ATOM   1786 C C     . ASN C 3 165 ? 77.008  0.502  37.652  1.00 65.62  ? 165  ASN A C     1 
ATOM   1787 O O     . ASN C 3 165 ? 77.890  -0.303 37.962  1.00 63.42  ? 165  ASN A O     1 
ATOM   1788 C CB    . ASN C 3 165 ? 74.919  -0.644 36.909  1.00 64.20  ? 165  ASN A CB    1 
ATOM   1789 C CG    . ASN C 3 165 ? 73.755  -0.635 35.922  1.00 66.38  ? 165  ASN A CG    1 
ATOM   1790 O OD1   . ASN C 3 165 ? 72.859  -1.475 35.995  1.00 65.89  ? 165  ASN A OD1   1 
ATOM   1791 N ND2   . ASN C 3 165 ? 73.760  0.318  35.005  1.00 69.32  ? 165  ASN A ND2   1 
ATOM   1792 N N     . VAL C 3 166 ? 76.785  1.634  38.313  1.00 69.37  ? 166  VAL A N     1 
ATOM   1793 C CA    . VAL C 3 166 ? 77.578  2.022  39.470  1.00 71.71  ? 166  VAL A CA    1 
ATOM   1794 C C     . VAL C 3 166 ? 77.315  1.079  40.653  1.00 73.54  ? 166  VAL A C     1 
ATOM   1795 O O     . VAL C 3 166 ? 76.267  0.430  40.734  1.00 72.41  ? 166  VAL A O     1 
ATOM   1796 C CB    . VAL C 3 166 ? 77.294  3.517  39.850  1.00 71.56  ? 166  VAL A CB    1 
ATOM   1797 C CG1   . VAL C 3 166 ? 75.803  3.763  39.938  1.00 70.32  ? 166  VAL A CG1   1 
ATOM   1798 C CG2   . VAL C 3 166 ? 77.977  3.872  41.162  1.00 71.39  ? 166  VAL A CG2   1 
ATOM   1799 N N     . GLU C 3 167 ? 78.285  1.010  41.559  1.00 75.67  ? 167  GLU A N     1 
ATOM   1800 C CA    . GLU C 3 167 ? 78.227  0.141  42.725  1.00 78.07  ? 167  GLU A CA    1 
ATOM   1801 C C     . GLU C 3 167 ? 77.185  0.392  43.813  1.00 79.77  ? 167  GLU A C     1 
ATOM   1802 O O     . GLU C 3 167 ? 77.105  1.466  44.418  1.00 80.72  ? 167  GLU A O     1 
ATOM   1803 C CB    . GLU C 3 167 ? 79.603  0.078  43.396  1.00 79.61  ? 167  GLU A CB    1 
ATOM   1804 C CG    . GLU C 3 167 ? 80.594  1.133  42.922  1.00 83.51  ? 167  GLU A CG    1 
ATOM   1805 C CD    . GLU C 3 167 ? 81.174  0.804  41.558  1.00 85.52  ? 167  GLU A CD    1 
ATOM   1806 O OE1   . GLU C 3 167 ? 81.851  -0.243 41.442  1.00 87.44  ? 167  GLU A OE1   1 
ATOM   1807 O OE2   . GLU C 3 167 ? 80.952  1.587  40.609  1.00 83.98  ? 167  GLU A OE2   1 
ATOM   1808 N N     . GLU C 3 168 ? 76.397  -0.651 44.044  1.00 80.47  ? 168  GLU A N     1 
ATOM   1809 C CA    . GLU C 3 168 ? 75.368  -0.729 45.074  1.00 80.94  ? 168  GLU A CA    1 
ATOM   1810 C C     . GLU C 3 168 ? 74.528  0.485  45.525  1.00 79.78  ? 168  GLU A C     1 
ATOM   1811 O O     . GLU C 3 168 ? 74.400  1.477  44.809  1.00 80.65  ? 168  GLU A O     1 
ATOM   1812 C CB    . GLU C 3 168 ? 76.010  -1.420 46.279  1.00 82.67  ? 168  GLU A CB    1 
ATOM   1813 C CG    . GLU C 3 168 ? 76.676  -2.733 45.864  1.00 86.06  ? 168  GLU A CG    1 
ATOM   1814 C CD    . GLU C 3 168 ? 77.792  -3.168 46.793  1.00 89.34  ? 168  GLU A CD    1 
ATOM   1815 O OE1   . GLU C 3 168 ? 77.506  -3.466 47.973  1.00 91.10  ? 168  GLU A OE1   1 
ATOM   1816 O OE2   . GLU C 3 168 ? 78.961  -3.213 46.338  1.00 91.00  ? 168  GLU A OE2   1 
ATOM   1817 N N     . GLN C 3 169 ? 73.958  0.357  46.727  1.00 77.29  ? 169  GLN A N     1 
ATOM   1818 C CA    . GLN C 3 169 ? 73.054  1.331  47.357  1.00 72.92  ? 169  GLN A CA    1 
ATOM   1819 C C     . GLN C 3 169 ? 72.147  2.045  46.367  1.00 69.14  ? 169  GLN A C     1 
ATOM   1820 O O     . GLN C 3 169 ? 72.475  3.102  45.820  1.00 66.07  ? 169  GLN A O     1 
ATOM   1821 C CB    . GLN C 3 169 ? 73.801  2.354  48.216  1.00 74.77  ? 169  GLN A CB    1 
ATOM   1822 C CG    . GLN C 3 169 ? 72.851  3.326  48.966  1.00 75.34  ? 169  GLN A CG    1 
ATOM   1823 C CD    . GLN C 3 169 ? 72.648  3.010  50.458  1.00 75.63  ? 169  GLN A CD    1 
ATOM   1824 O OE1   . GLN C 3 169 ? 73.532  2.450  51.122  1.00 76.01  ? 169  GLN A OE1   1 
ATOM   1825 N NE2   . GLN C 3 169 ? 71.492  3.407  50.993  1.00 71.08  ? 169  GLN A NE2   1 
ATOM   1826 N N     . LEU C 3 170 ? 70.982  1.439  46.179  1.00 64.56  ? 170  LEU A N     1 
ATOM   1827 C CA    . LEU C 3 170 ? 69.969  1.908  45.267  1.00 62.08  ? 170  LEU A CA    1 
ATOM   1828 C C     . LEU C 3 170 ? 69.517  3.360  45.454  1.00 61.08  ? 170  LEU A C     1 
ATOM   1829 O O     . LEU C 3 170 ? 69.294  4.059  44.475  1.00 58.75  ? 170  LEU A O     1 
ATOM   1830 C CB    . LEU C 3 170 ? 68.768  0.968  45.350  1.00 59.50  ? 170  LEU A CB    1 
ATOM   1831 C CG    . LEU C 3 170 ? 67.674  1.110  44.292  1.00 59.95  ? 170  LEU A CG    1 
ATOM   1832 C CD1   . LEU C 3 170 ? 68.268  0.837  42.916  1.00 59.42  ? 170  LEU A CD1   1 
ATOM   1833 C CD2   . LEU C 3 170 ? 66.545  0.147  44.594  1.00 58.28  ? 170  LEU A CD2   1 
ATOM   1834 N N     . ASN C 3 171 ? 69.372  3.812  46.698  1.00 61.80  ? 171  ASN A N     1 
ATOM   1835 C CA    . ASN C 3 171 ? 68.926  5.185  46.954  1.00 62.27  ? 171  ASN A CA    1 
ATOM   1836 C C     . ASN C 3 171 ? 69.821  6.216  46.268  1.00 63.12  ? 171  ASN A C     1 
ATOM   1837 O O     . ASN C 3 171 ? 69.339  7.239  45.791  1.00 63.27  ? 171  ASN A O     1 
ATOM   1838 C CB    . ASN C 3 171 ? 68.887  5.474  48.460  1.00 60.92  ? 171  ASN A CB    1 
ATOM   1839 C CG    . ASN C 3 171 ? 67.623  4.949  49.144  1.00 59.59  ? 171  ASN A CG    1 
ATOM   1840 O OD1   . ASN C 3 171 ? 67.505  5.020  50.366  1.00 58.86  ? 171  ASN A OD1   1 
ATOM   1841 N ND2   . ASN C 3 171 ? 66.684  4.431  48.367  1.00 56.49  ? 171  ASN A ND2   1 
ATOM   1842 N N     . LYS C 3 172 ? 71.125  5.941  46.234  1.00 64.72  ? 172  LYS A N     1 
ATOM   1843 C CA    . LYS C 3 172 ? 72.093  6.831  45.598  1.00 65.83  ? 172  LYS A CA    1 
ATOM   1844 C C     . LYS C 3 172 ? 71.913  6.804  44.080  1.00 66.75  ? 172  LYS A C     1 
ATOM   1845 O O     . LYS C 3 172 ? 71.951  7.846  43.426  1.00 65.26  ? 172  LYS A O     1 
ATOM   1846 C CB    . LYS C 3 172 ? 73.518  6.394  45.938  1.00 66.57  ? 172  LYS A CB    1 
ATOM   1847 C CG    . LYS C 3 172 ? 73.825  6.356  47.427  1.00 69.26  ? 172  LYS A CG    1 
ATOM   1848 C CD    . LYS C 3 172 ? 75.012  5.441  47.734  1.00 69.24  ? 172  LYS A CD    1 
ATOM   1849 C CE    . LYS C 3 172 ? 75.238  5.302  49.240  1.00 69.19  ? 172  LYS A CE    1 
ATOM   1850 N NZ    . LYS C 3 172 ? 76.144  4.167  49.583  1.00 70.22  ? 172  LYS A NZ    1 
ATOM   1851 N N     . ARG C 3 173 ? 71.712  5.606  43.534  1.00 68.18  ? 173  ARG A N     1 
ATOM   1852 C CA    . ARG C 3 173 ? 71.532  5.420  42.094  1.00 69.65  ? 173  ARG A CA    1 
ATOM   1853 C C     . ARG C 3 173 ? 70.145  5.844  41.599  1.00 69.95  ? 173  ARG A C     1 
ATOM   1854 O O     . ARG C 3 173 ? 69.964  6.095  40.413  1.00 67.36  ? 173  ARG A O     1 
ATOM   1855 C CB    . ARG C 3 173 ? 71.802  3.952  41.712  1.00 68.19  ? 173  ARG A CB    1 
ATOM   1856 C CG    . ARG C 3 173 ? 73.074  3.387  42.335  1.00 68.73  ? 173  ARG A CG    1 
ATOM   1857 C CD    . ARG C 3 173 ? 73.589  2.117  41.649  1.00 68.84  ? 173  ARG A CD    1 
ATOM   1858 N NE    . ARG C 3 173 ? 72.684  0.981  41.752  1.00 69.27  ? 173  ARG A NE    1 
ATOM   1859 C CZ    . ARG C 3 173 ? 71.930  0.530  40.754  1.00 72.00  ? 173  ARG A CZ    1 
ATOM   1860 N NH1   . ARG C 3 173 ? 71.973  1.123  39.567  1.00 72.74  ? 173  ARG A NH1   1 
ATOM   1861 N NH2   . ARG C 3 173 ? 71.132  -0.516 40.942  1.00 71.96  ? 173  ARG A NH2   1 
ATOM   1862 N N     . VAL C 3 174 ? 69.172  5.921  42.502  1.00 75.58  ? 174  VAL A N     1 
ATOM   1863 C CA    . VAL C 3 174 ? 67.817  6.330  42.119  1.00 82.57  ? 174  VAL A CA    1 
ATOM   1864 C C     . VAL C 3 174 ? 67.956  7.668  41.409  1.00 86.46  ? 174  VAL A C     1 
ATOM   1865 O O     . VAL C 3 174 ? 67.146  8.034  40.559  1.00 85.60  ? 174  VAL A O     1 
ATOM   1866 C CB    . VAL C 3 174 ? 66.891  6.528  43.347  1.00 82.74  ? 174  VAL A CB    1 
ATOM   1867 C CG1   . VAL C 3 174 ? 65.504  6.949  42.885  1.00 82.56  ? 174  VAL A CG1   1 
ATOM   1868 C CG2   . VAL C 3 174 ? 66.809  5.251  44.157  1.00 84.05  ? 174  VAL A CG2   1 
ATOM   1869 N N     . GLY C 3 175 ? 69.000  8.394  41.791  1.00 91.39  ? 175  GLY A N     1 
ATOM   1870 C CA    . GLY C 3 175 ? 69.292  9.680  41.192  1.00 97.27  ? 175  GLY A CA    1 
ATOM   1871 C C     . GLY C 3 175 ? 68.198  10.726 41.207  1.00 101.12 ? 175  GLY A C     1 
ATOM   1872 O O     . GLY C 3 175 ? 68.058  11.473 42.180  1.00 101.71 ? 175  GLY A O     1 
ATOM   1873 N N     . HIS C 3 176 ? 67.429  10.788 40.121  1.00 104.45 ? 176  HIS A N     1 
ATOM   1874 C CA    . HIS C 3 176 ? 66.358  11.769 40.006  1.00 106.74 ? 176  HIS A CA    1 
ATOM   1875 C C     . HIS C 3 176 ? 65.498  11.897 41.255  1.00 107.52 ? 176  HIS A C     1 
ATOM   1876 O O     . HIS C 3 176 ? 65.597  12.898 41.971  1.00 107.67 ? 176  HIS A O     1 
ATOM   1877 C CB    . HIS C 3 176 ? 65.468  11.484 38.780  1.00 107.08 ? 176  HIS A CB    1 
ATOM   1878 C CG    . HIS C 3 176 ? 65.361  10.034 38.414  1.00 106.66 ? 176  HIS A CG    1 
ATOM   1879 N ND1   . HIS C 3 176 ? 66.412  9.321  37.879  1.00 105.85 ? 176  HIS A ND1   1 
ATOM   1880 C CD2   . HIS C 3 176 ? 64.318  9.173  38.484  1.00 106.06 ? 176  HIS A CD2   1 
ATOM   1881 C CE1   . HIS C 3 176 ? 66.021  8.083  37.635  1.00 105.82 ? 176  HIS A CE1   1 
ATOM   1882 N NE2   . HIS C 3 176 ? 64.755  7.968  37.992  1.00 106.53 ? 176  HIS A NE2   1 
ATOM   1883 N N     . VAL C 3 177 ? 64.684  10.881 41.536  1.00 108.44 ? 177  VAL A N     1 
ATOM   1884 C CA    . VAL C 3 177 ? 63.791  10.933 42.691  1.00 109.39 ? 177  VAL A CA    1 
ATOM   1885 C C     . VAL C 3 177 ? 63.016  12.221 42.450  1.00 110.23 ? 177  VAL A C     1 
ATOM   1886 O O     . VAL C 3 177 ? 63.496  13.301 42.792  1.00 110.51 ? 177  VAL A O     1 
ATOM   1887 C CB    . VAL C 3 177 ? 64.570  11.059 44.029  1.00 108.92 ? 177  VAL A CB    1 
ATOM   1888 C CG1   . VAL C 3 177 ? 63.598  11.007 45.207  1.00 107.66 ? 177  VAL A CG1   1 
ATOM   1889 C CG2   . VAL C 3 177 ? 65.612  9.960  44.136  1.00 108.53 ? 177  VAL A CG2   1 
ATOM   1890 N N     . TYR C 3 178 ? 61.833  12.111 41.849  1.00 110.32 ? 178  TYR A N     1 
ATOM   1891 C CA    . TYR C 3 178 ? 61.039  13.294 41.528  1.00 110.06 ? 178  TYR A CA    1 
ATOM   1892 C C     . TYR C 3 178 ? 60.873  14.282 42.679  1.00 109.22 ? 178  TYR A C     1 
ATOM   1893 O O     . TYR C 3 178 ? 59.771  14.469 43.202  1.00 109.37 ? 178  TYR A O     1 
ATOM   1894 C CB    . TYR C 3 178 ? 59.663  12.891 40.987  1.00 110.27 ? 178  TYR A CB    1 
ATOM   1895 C CG    . TYR C 3 178 ? 59.108  13.912 40.019  1.00 110.41 ? 178  TYR A CG    1 
ATOM   1896 C CD1   . TYR C 3 178 ? 59.809  14.245 38.859  1.00 110.28 ? 178  TYR A CD1   1 
ATOM   1897 C CD2   . TYR C 3 178 ? 57.907  14.572 40.274  1.00 110.51 ? 178  TYR A CD2   1 
ATOM   1898 C CE1   . TYR C 3 178 ? 59.333  15.210 37.977  1.00 110.45 ? 178  TYR A CE1   1 
ATOM   1899 C CE2   . TYR C 3 178 ? 57.419  15.543 39.393  1.00 110.51 ? 178  TYR A CE2   1 
ATOM   1900 C CZ    . TYR C 3 178 ? 58.140  15.855 38.248  1.00 110.51 ? 178  TYR A CZ    1 
ATOM   1901 O OH    . TYR C 3 178 ? 57.673  16.811 37.376  1.00 110.51 ? 178  TYR A OH    1 
ATOM   1902 N N     . LYS C 3 179 ? 61.981  14.917 43.053  1.00 107.73 ? 179  LYS A N     1 
ATOM   1903 C CA    . LYS C 3 179 ? 62.011  15.905 44.124  1.00 105.54 ? 179  LYS A CA    1 
ATOM   1904 C C     . LYS C 3 179 ? 61.622  17.237 43.487  1.00 104.54 ? 179  LYS A C     1 
ATOM   1905 O O     . LYS C 3 179 ? 62.487  17.938 42.967  1.00 104.69 ? 179  LYS A O     1 
ATOM   1906 C CB    . LYS C 3 179 ? 63.431  16.021 44.701  1.00 105.34 ? 179  LYS A CB    1 
ATOM   1907 C CG    . LYS C 3 179 ? 64.063  14.716 45.171  1.00 104.68 ? 179  LYS A CG    1 
ATOM   1908 C CD    . LYS C 3 179 ? 65.542  14.906 45.494  1.00 102.95 ? 179  LYS A CD    1 
ATOM   1909 C CE    . LYS C 3 179 ? 66.193  13.594 45.898  1.00 103.28 ? 179  LYS A CE    1 
ATOM   1910 N NZ    . LYS C 3 179 ? 67.640  13.750 46.213  1.00 102.88 ? 179  LYS A NZ    1 
ATOM   1911 N N     . LYS C 3 180 ? 60.333  17.577 43.508  1.00 102.58 ? 180  LYS A N     1 
ATOM   1912 C CA    . LYS C 3 180 ? 59.871  18.836 42.919  1.00 100.05 ? 180  LYS A CA    1 
ATOM   1913 C C     . LYS C 3 180 ? 60.633  20.039 43.487  1.00 97.29  ? 180  LYS A C     1 
ATOM   1914 O O     . LYS C 3 180 ? 60.165  20.772 44.363  1.00 97.10  ? 180  LYS A O     1 
ATOM   1915 C CB    . LYS C 3 180 ? 58.356  18.991 43.103  1.00 101.04 ? 180  LYS A CB    1 
ATOM   1916 C CG    . LYS C 3 180 ? 57.560  17.990 42.263  1.00 101.96 ? 180  LYS A CG    1 
ATOM   1917 C CD    . LYS C 3 180 ? 56.055  18.194 42.373  1.00 103.00 ? 180  LYS A CD    1 
ATOM   1918 C CE    . LYS C 3 180 ? 55.297  17.160 41.537  1.00 102.99 ? 180  LYS A CE    1 
ATOM   1919 N NZ    . LYS C 3 180 ? 53.815  17.306 41.633  1.00 101.33 ? 180  LYS A NZ    1 
ATOM   1920 N N     . ALA C 3 181 ? 61.830  20.196 42.939  1.00 93.24  ? 181  ALA A N     1 
ATOM   1921 C CA    . ALA C 3 181 ? 62.815  21.218 43.255  1.00 87.88  ? 181  ALA A CA    1 
ATOM   1922 C C     . ALA C 3 181 ? 63.874  20.736 42.267  1.00 83.48  ? 181  ALA A C     1 
ATOM   1923 O O     . ALA C 3 181 ? 64.047  19.529 42.091  1.00 83.90  ? 181  ALA A O     1 
ATOM   1924 C CB    . ALA C 3 181 ? 63.305  21.068 44.689  1.00 88.86  ? 181  ALA A CB    1 
ATOM   1925 N N     . PHE C 3 182 ? 64.580  21.640 41.613  1.00 76.12  ? 182  PHE A N     1 
ATOM   1926 C CA    . PHE C 3 182 ? 65.530  21.180 40.623  1.00 68.25  ? 182  PHE A CA    1 
ATOM   1927 C C     . PHE C 3 182 ? 66.909  20.821 41.107  1.00 64.81  ? 182  PHE A C     1 
ATOM   1928 O O     . PHE C 3 182 ? 67.335  21.228 42.181  1.00 63.92  ? 182  PHE A O     1 
ATOM   1929 C CB    . PHE C 3 182 ? 65.588  22.196 39.494  1.00 64.42  ? 182  PHE A CB    1 
ATOM   1930 C CG    . PHE C 3 182 ? 64.260  22.425 38.873  1.00 59.79  ? 182  PHE A CG    1 
ATOM   1931 C CD1   . PHE C 3 182 ? 63.326  23.248 39.494  1.00 58.75  ? 182  PHE A CD1   1 
ATOM   1932 C CD2   . PHE C 3 182 ? 63.889  21.725 37.738  1.00 58.95  ? 182  PHE A CD2   1 
ATOM   1933 C CE1   . PHE C 3 182 ? 62.036  23.368 38.998  1.00 57.24  ? 182  PHE A CE1   1 
ATOM   1934 C CE2   . PHE C 3 182 ? 62.602  21.832 37.231  1.00 59.67  ? 182  PHE A CE2   1 
ATOM   1935 C CZ    . PHE C 3 182 ? 61.669  22.655 37.863  1.00 58.57  ? 182  PHE A CZ    1 
ATOM   1936 N N     . MET C 3 183 ? 67.594  20.020 40.309  1.00 61.45  ? 183  MET A N     1 
ATOM   1937 C CA    . MET C 3 183 ? 68.937  19.613 40.655  1.00 60.64  ? 183  MET A CA    1 
ATOM   1938 C C     . MET C 3 183 ? 69.743  20.875 40.923  1.00 60.27  ? 183  MET A C     1 
ATOM   1939 O O     . MET C 3 183 ? 69.541  21.904 40.274  1.00 58.45  ? 183  MET A O     1 
ATOM   1940 C CB    . MET C 3 183 ? 69.568  18.832 39.507  1.00 59.58  ? 183  MET A CB    1 
ATOM   1941 C CG    . MET C 3 183 ? 68.648  17.830 38.883  1.00 60.15  ? 183  MET A CG    1 
ATOM   1942 S SD    . MET C 3 183 ? 69.584  16.628 37.968  1.00 55.89  ? 183  MET A SD    1 
ATOM   1943 C CE    . MET C 3 183 ? 69.304  15.177 39.023  1.00 63.05  ? 183  MET A CE    1 
ATOM   1944 N N     . GLN C 3 184 ? 70.656  20.798 41.879  1.00 60.82  ? 184  GLN A N     1 
ATOM   1945 C CA    . GLN C 3 184 ? 71.462  21.954 42.206  1.00 62.07  ? 184  GLN A CA    1 
ATOM   1946 C C     . GLN C 3 184 ? 72.869  21.733 41.719  1.00 60.71  ? 184  GLN A C     1 
ATOM   1947 O O     . GLN C 3 184 ? 73.359  20.610 41.705  1.00 58.62  ? 184  GLN A O     1 
ATOM   1948 C CB    . GLN C 3 184 ? 71.443  22.199 43.715  1.00 65.31  ? 184  GLN A CB    1 
ATOM   1949 C CG    . GLN C 3 184 ? 71.975  23.566 44.124  1.00 70.66  ? 184  GLN A CG    1 
ATOM   1950 C CD    . GLN C 3 184 ? 71.385  24.705 43.300  1.00 72.14  ? 184  GLN A CD    1 
ATOM   1951 O OE1   . GLN C 3 184 ? 70.164  24.899 43.247  1.00 74.26  ? 184  GLN A OE1   1 
ATOM   1952 N NE2   . GLN C 3 184 ? 72.257  25.465 42.651  1.00 71.39  ? 184  GLN A NE2   1 
ATOM   1953 N N     . VAL C 3 185 ? 73.510  22.812 41.290  1.00 60.75  ? 185  VAL A N     1 
ATOM   1954 C CA    . VAL C 3 185 ? 74.878  22.746 40.804  1.00 59.76  ? 185  VAL A CA    1 
ATOM   1955 C C     . VAL C 3 185 ? 75.747  22.117 41.889  1.00 59.57  ? 185  VAL A C     1 
ATOM   1956 O O     . VAL C 3 185 ? 75.356  22.041 43.055  1.00 60.36  ? 185  VAL A O     1 
ATOM   1957 C CB    . VAL C 3 185 ? 75.414  24.155 40.503  1.00 59.57  ? 185  VAL A CB    1 
ATOM   1958 C CG1   . VAL C 3 185 ? 75.465  24.969 41.794  1.00 60.05  ? 185  VAL A CG1   1 
ATOM   1959 C CG2   . VAL C 3 185 ? 76.791  24.075 39.863  1.00 58.08  ? 185  VAL A CG2   1 
ATOM   1960 N N     . VAL C 3 186 ? 76.928  21.668 41.501  1.00 59.49  ? 186  VAL A N     1 
ATOM   1961 C CA    . VAL C 3 186 ? 77.850  21.064 42.440  1.00 58.55  ? 186  VAL A CA    1 
ATOM   1962 C C     . VAL C 3 186 ? 78.687  22.180 43.064  1.00 60.09  ? 186  VAL A C     1 
ATOM   1963 O O     . VAL C 3 186 ? 78.819  23.268 42.496  1.00 58.15  ? 186  VAL A O     1 
ATOM   1964 C CB    . VAL C 3 186 ? 78.766  20.049 41.721  1.00 57.20  ? 186  VAL A CB    1 
ATOM   1965 C CG1   . VAL C 3 186 ? 79.846  19.566 42.658  1.00 58.85  ? 186  VAL A CG1   1 
ATOM   1966 C CG2   . VAL C 3 186 ? 77.936  18.861 41.204  1.00 56.04  ? 186  VAL A CG2   1 
ATOM   1967 N N     . GLU C 3 187 ? 79.224  21.912 44.250  1.00 62.83  ? 187  GLU A N     1 
ATOM   1968 C CA    . GLU C 3 187 ? 80.058  22.874 44.949  1.00 65.67  ? 187  GLU A CA    1 
ATOM   1969 C C     . GLU C 3 187 ? 81.452  22.827 44.346  1.00 65.38  ? 187  GLU A C     1 
ATOM   1970 O O     . GLU C 3 187 ? 81.964  21.746 44.064  1.00 65.60  ? 187  GLU A O     1 
ATOM   1971 C CB    . GLU C 3 187 ? 80.140  22.521 46.433  1.00 70.37  ? 187  GLU A CB    1 
ATOM   1972 C CG    . GLU C 3 187 ? 78.797  22.469 47.142  1.00 77.49  ? 187  GLU A CG    1 
ATOM   1973 C CD    . GLU C 3 187 ? 78.019  23.763 47.004  1.00 82.43  ? 187  GLU A CD    1 
ATOM   1974 O OE1   . GLU C 3 187 ? 78.609  24.847 47.247  1.00 84.43  ? 187  GLU A OE1   1 
ATOM   1975 O OE2   . GLU C 3 187 ? 76.816  23.691 46.656  1.00 84.40  ? 187  GLU A OE2   1 
ATOM   1976 N N     . ALA C 3 188 ? 82.061  23.991 44.148  1.00 64.84  ? 188  ALA A N     1 
ATOM   1977 C CA    . ALA C 3 188 ? 83.406  24.068 43.575  1.00 66.02  ? 188  ALA A CA    1 
ATOM   1978 C C     . ALA C 3 188 ? 84.389  23.091 44.225  1.00 66.79  ? 188  ALA A C     1 
ATOM   1979 O O     . ALA C 3 188 ? 85.020  22.284 43.540  1.00 65.84  ? 188  ALA A O     1 
ATOM   1980 C CB    . ALA C 3 188 ? 83.944  25.497 43.691  1.00 64.92  ? 188  ALA A CB    1 
ATOM   1981 N N     . ASP C 3 189 ? 84.509  23.161 45.548  1.00 68.96  ? 189  ASP A N     1 
ATOM   1982 C CA    . ASP C 3 189 ? 85.425  22.290 46.282  1.00 70.39  ? 189  ASP A CA    1 
ATOM   1983 C C     . ASP C 3 189 ? 85.045  20.813 46.225  1.00 68.81  ? 189  ASP A C     1 
ATOM   1984 O O     . ASP C 3 189 ? 85.822  19.956 46.632  1.00 70.62  ? 189  ASP A O     1 
ATOM   1985 C CB    . ASP C 3 189 ? 85.505  22.731 47.742  1.00 73.19  ? 189  ASP A CB    1 
ATOM   1986 C CG    . ASP C 3 189 ? 84.160  22.670 48.436  1.00 76.86  ? 189  ASP A CG    1 
ATOM   1987 O OD1   . ASP C 3 189 ? 83.569  21.568 48.495  1.00 80.10  ? 189  ASP A OD1   1 
ATOM   1988 O OD2   . ASP C 3 189 ? 83.690  23.723 48.918  1.00 78.30  ? 189  ASP A OD2   1 
ATOM   1989 N N     . MET C 3 190 ? 83.848  20.512 45.737  1.00 66.41  ? 190  MET A N     1 
ATOM   1990 C CA    . MET C 3 190 ? 83.404  19.124 45.639  1.00 63.67  ? 190  MET A CA    1 
ATOM   1991 C C     . MET C 3 190 ? 83.859  18.534 44.310  1.00 61.34  ? 190  MET A C     1 
ATOM   1992 O O     . MET C 3 190 ? 83.426  17.452 43.917  1.00 58.87  ? 190  MET A O     1 
ATOM   1993 C CB    . MET C 3 190 ? 81.872  19.035 45.746  1.00 66.35  ? 190  MET A CB    1 
ATOM   1994 C CG    . MET C 3 190 ? 81.300  19.298 47.139  1.00 69.40  ? 190  MET A CG    1 
ATOM   1995 S SD    . MET C 3 190 ? 81.516  17.923 48.326  1.00 74.28  ? 190  MET A SD    1 
ATOM   1996 C CE    . MET C 3 190 ? 83.072  18.422 49.195  1.00 73.23  ? 190  MET A CE    1 
ATOM   1997 N N     . LEU C 3 191 ? 84.745  19.251 43.625  1.00 59.79  ? 191  LEU A N     1 
ATOM   1998 C CA    . LEU C 3 191 ? 85.241  18.810 42.329  1.00 57.00  ? 191  LEU A CA    1 
ATOM   1999 C C     . LEU C 3 191 ? 86.655  18.272 42.393  1.00 57.79  ? 191  LEU A C     1 
ATOM   2000 O O     . LEU C 3 191 ? 87.583  19.008 42.726  1.00 59.24  ? 191  LEU A O     1 
ATOM   2001 C CB    . LEU C 3 191 ? 85.216  19.964 41.325  1.00 54.87  ? 191  LEU A CB    1 
ATOM   2002 C CG    . LEU C 3 191 ? 83.906  20.662 40.927  1.00 49.47  ? 191  LEU A CG    1 
ATOM   2003 C CD1   . LEU C 3 191 ? 84.255  21.946 40.199  1.00 48.03  ? 191  LEU A CD1   1 
ATOM   2004 C CD2   . LEU C 3 191 ? 83.058  19.764 40.038  1.00 49.90  ? 191  LEU A CD2   1 
ATOM   2005 N N     . SER C 3 192 ? 86.811  16.989 42.064  1.00 58.67  ? 192  SER A N     1 
ATOM   2006 C CA    . SER C 3 192 ? 88.116  16.333 42.038  1.00 55.99  ? 192  SER A CA    1 
ATOM   2007 C C     . SER C 3 192 ? 89.000  17.078 41.053  1.00 56.55  ? 192  SER A C     1 
ATOM   2008 O O     . SER C 3 192 ? 88.508  17.608 40.060  1.00 57.39  ? 192  SER A O     1 
ATOM   2009 C CB    . SER C 3 192 ? 87.966  14.878 41.578  1.00 55.96  ? 192  SER A CB    1 
ATOM   2010 O OG    . SER C 3 192 ? 89.146  14.408 40.933  1.00 57.84  ? 192  SER A OG    1 
ATOM   2011 N N     . LYS C 3 193 ? 90.300  17.115 41.319  1.00 56.24  ? 193  LYS A N     1 
ATOM   2012 C CA    . LYS C 3 193 ? 91.237  17.801 40.441  1.00 55.47  ? 193  LYS A CA    1 
ATOM   2013 C C     . LYS C 3 193 ? 91.216  17.210 39.031  1.00 54.40  ? 193  LYS A C     1 
ATOM   2014 O O     . LYS C 3 193 ? 91.566  17.880 38.065  1.00 52.48  ? 193  LYS A O     1 
ATOM   2015 C CB    . LYS C 3 193 ? 92.651  17.730 41.027  1.00 58.49  ? 193  LYS A CB    1 
ATOM   2016 C CG    . LYS C 3 193 ? 92.813  18.492 42.346  1.00 62.59  ? 193  LYS A CG    1 
ATOM   2017 C CD    . LYS C 3 193 ? 94.210  18.305 42.951  1.00 67.80  ? 193  LYS A CD    1 
ATOM   2018 C CE    . LYS C 3 193 ? 94.353  19.019 44.312  1.00 68.99  ? 193  LYS A CE    1 
ATOM   2019 N NZ    . LYS C 3 193 ? 95.586  18.610 45.070  1.00 67.18  ? 193  LYS A NZ    1 
ATOM   2020 N N     . GLY C 3 194 ? 90.796  15.958 38.915  1.00 52.55  ? 194  GLY A N     1 
ATOM   2021 C CA    . GLY C 3 194 ? 90.742  15.328 37.611  1.00 53.61  ? 194  GLY A CA    1 
ATOM   2022 C C     . GLY C 3 194 ? 89.594  15.859 36.769  1.00 53.49  ? 194  GLY A C     1 
ATOM   2023 O O     . GLY C 3 194 ? 89.350  15.380 35.664  1.00 50.52  ? 194  GLY A O     1 
ATOM   2024 N N     . LEU C 3 195 ? 88.882  16.843 37.309  1.00 53.50  ? 195  LEU A N     1 
ATOM   2025 C CA    . LEU C 3 195 ? 87.760  17.465 36.613  1.00 54.18  ? 195  LEU A CA    1 
ATOM   2026 C C     . LEU C 3 195 ? 88.118  18.890 36.201  1.00 54.01  ? 195  LEU A C     1 
ATOM   2027 O O     . LEU C 3 195 ? 87.381  19.505 35.433  1.00 54.93  ? 195  LEU A O     1 
ATOM   2028 C CB    . LEU C 3 195 ? 86.497  17.494 37.499  1.00 51.73  ? 195  LEU A CB    1 
ATOM   2029 C CG    . LEU C 3 195 ? 85.804  16.158 37.781  1.00 53.32  ? 195  LEU A CG    1 
ATOM   2030 C CD1   . LEU C 3 195 ? 84.501  16.388 38.531  1.00 53.60  ? 195  LEU A CD1   1 
ATOM   2031 C CD2   . LEU C 3 195 ? 85.527  15.440 36.463  1.00 54.81  ? 195  LEU A CD2   1 
ATOM   2032 N N     . LEU C 3 196 ? 89.223  19.420 36.732  1.00 54.24  ? 196  LEU A N     1 
ATOM   2033 C CA    . LEU C 3 196 ? 89.655  20.775 36.378  1.00 55.84  ? 196  LEU A CA    1 
ATOM   2034 C C     . LEU C 3 196 ? 90.236  20.728 34.963  1.00 55.03  ? 196  LEU A C     1 
ATOM   2035 O O     . LEU C 3 196 ? 91.441  20.591 34.788  1.00 52.11  ? 196  LEU A O     1 
ATOM   2036 C CB    . LEU C 3 196 ? 90.714  21.311 37.366  1.00 57.66  ? 196  LEU A CB    1 
ATOM   2037 C CG    . LEU C 3 196 ? 91.297  22.713 37.055  1.00 62.27  ? 196  LEU A CG    1 
ATOM   2038 C CD1   . LEU C 3 196 ? 90.219  23.793 37.303  1.00 63.59  ? 196  LEU A CD1   1 
ATOM   2039 C CD2   . LEU C 3 196 ? 92.540  23.007 37.900  1.00 62.72  ? 196  LEU A CD2   1 
ATOM   2040 N N     . GLY C 3 197 ? 89.345  20.830 33.968  1.00 56.92  ? 197  GLY A N     1 
ATOM   2041 C CA    . GLY C 3 197 ? 89.709  20.782 32.556  1.00 53.37  ? 197  GLY A CA    1 
ATOM   2042 C C     . GLY C 3 197 ? 90.983  21.506 32.160  1.00 53.11  ? 197  GLY A C     1 
ATOM   2043 O O     . GLY C 3 197 ? 91.464  22.379 32.881  1.00 52.96  ? 197  GLY A O     1 
ATOM   2044 N N     . GLY C 3 198 ? 91.532  21.123 31.008  1.00 52.31  ? 198  GLY A N     1 
ATOM   2045 C CA    . GLY C 3 198 ? 92.740  21.742 30.513  1.00 51.40  ? 198  GLY A CA    1 
ATOM   2046 C C     . GLY C 3 198 ? 92.963  21.576 29.022  1.00 51.65  ? 198  GLY A C     1 
ATOM   2047 O O     . GLY C 3 198 ? 92.815  20.495 28.470  1.00 52.79  ? 198  GLY A O     1 
ATOM   2048 N N     . GLU C 3 199 ? 93.327  22.675 28.374  1.00 54.24  ? 199  GLU A N     1 
ATOM   2049 C CA    . GLU C 3 199 ? 93.627  22.717 26.936  1.00 56.17  ? 199  GLU A CA    1 
ATOM   2050 C C     . GLU C 3 199 ? 92.439  22.764 25.993  1.00 54.67  ? 199  GLU A C     1 
ATOM   2051 O O     . GLU C 3 199 ? 91.989  21.733 25.482  1.00 52.81  ? 199  GLU A O     1 
ATOM   2052 C CB    . GLU C 3 199 ? 94.528  21.556 26.524  1.00 59.89  ? 199  GLU A CB    1 
ATOM   2053 C CG    . GLU C 3 199 ? 95.291  21.866 25.241  1.00 64.12  ? 199  GLU A CG    1 
ATOM   2054 C CD    . GLU C 3 199 ? 95.975  23.233 25.293  1.00 67.66  ? 199  GLU A CD    1 
ATOM   2055 O OE1   . GLU C 3 199 ? 95.270  24.267 25.265  1.00 66.96  ? 199  GLU A OE1   1 
ATOM   2056 O OE2   . GLU C 3 199 ? 97.223  23.278 25.373  1.00 70.49  ? 199  GLU A OE2   1 
ATOM   2057 N N     . ALA C 3 200 ? 91.974  23.986 25.747  1.00 52.89  ? 200  ALA A N     1 
ATOM   2058 C CA    . ALA C 3 200 ? 90.837  24.257 24.890  1.00 52.67  ? 200  ALA A CA    1 
ATOM   2059 C C     . ALA C 3 200 ? 91.279  24.671 23.498  1.00 53.56  ? 200  ALA A C     1 
ATOM   2060 O O     . ALA C 3 200 ? 90.466  24.691 22.571  1.00 54.03  ? 200  ALA A O     1 
ATOM   2061 C CB    . ALA C 3 200 ? 89.985  25.357 25.506  1.00 54.75  ? 200  ALA A CB    1 
ATOM   2062 N N     . TRP C 3 201 ? 92.561  24.998 23.359  1.00 53.30  ? 201  TRP A N     1 
ATOM   2063 C CA    . TRP C 3 201 ? 93.113  25.428 22.081  1.00 55.18  ? 201  TRP A CA    1 
ATOM   2064 C C     . TRP C 3 201 ? 93.772  24.355 21.255  1.00 56.20  ? 201  TRP A C     1 
ATOM   2065 O O     . TRP C 3 201 ? 94.536  23.545 21.766  1.00 58.41  ? 201  TRP A O     1 
ATOM   2066 C CB    . TRP C 3 201 ? 94.104  26.569 22.281  1.00 55.36  ? 201  TRP A CB    1 
ATOM   2067 C CG    . TRP C 3 201 ? 93.426  27.871 22.148  1.00 56.78  ? 201  TRP A CG    1 
ATOM   2068 C CD1   . TRP C 3 201 ? 92.664  28.503 23.089  1.00 56.80  ? 201  TRP A CD1   1 
ATOM   2069 C CD2   . TRP C 3 201 ? 93.327  28.654 20.960  1.00 56.60  ? 201  TRP A CD2   1 
ATOM   2070 N NE1   . TRP C 3 201 ? 92.087  29.633 22.557  1.00 56.35  ? 201  TRP A NE1   1 
ATOM   2071 C CE2   . TRP C 3 201 ? 92.478  29.750 21.249  1.00 57.41  ? 201  TRP A CE2   1 
ATOM   2072 C CE3   . TRP C 3 201 ? 93.870  28.536 19.675  1.00 55.53  ? 201  TRP A CE3   1 
ATOM   2073 C CZ2   . TRP C 3 201 ? 92.160  30.725 20.297  1.00 56.50  ? 201  TRP A CZ2   1 
ATOM   2074 C CZ3   . TRP C 3 201 ? 93.556  29.503 18.729  1.00 57.83  ? 201  TRP A CZ3   1 
ATOM   2075 C CH2   . TRP C 3 201 ? 92.705  30.587 19.047  1.00 57.45  ? 201  TRP A CH2   1 
ATOM   2076 N N     . SER C 3 202 ? 93.468  24.371 19.962  1.00 57.92  ? 202  SER A N     1 
ATOM   2077 C CA    . SER C 3 202 ? 94.009  23.408 19.014  1.00 57.88  ? 202  SER A CA    1 
ATOM   2078 C C     . SER C 3 202 ? 95.505  23.569 18.870  1.00 56.27  ? 202  SER A C     1 
ATOM   2079 O O     . SER C 3 202 ? 96.027  24.660 19.060  1.00 55.44  ? 202  SER A O     1 
ATOM   2080 C CB    . SER C 3 202 ? 93.365  23.606 17.648  1.00 60.05  ? 202  SER A CB    1 
ATOM   2081 O OG    . SER C 3 202 ? 94.088  22.879 16.669  1.00 65.03  ? 202  SER A OG    1 
ATOM   2082 N N     . SER C 3 203 ? 96.189  22.488 18.518  1.00 55.00  ? 203  SER A N     1 
ATOM   2083 C CA    . SER C 3 203 ? 97.632  22.544 18.340  1.00 55.65  ? 203  SER A CA    1 
ATOM   2084 C C     . SER C 3 203 ? 98.093  22.213 16.910  1.00 54.30  ? 203  SER A C     1 
ATOM   2085 O O     . SER C 3 203 ? 99.284  22.313 16.598  1.00 57.57  ? 203  SER A O     1 
ATOM   2086 C CB    . SER C 3 203 ? 98.329  21.620 19.341  1.00 55.83  ? 203  SER A CB    1 
ATOM   2087 O OG    . SER C 3 203 ? 97.940  20.271 19.154  1.00 59.19  ? 203  SER A OG    1 
ATOM   2088 N N     . TRP C 3 204 ? 97.165  21.824 16.042  1.00 49.24  ? 204  TRP A N     1 
ATOM   2089 C CA    . TRP C 3 204 ? 97.510  21.520 14.651  1.00 45.33  ? 204  TRP A CA    1 
ATOM   2090 C C     . TRP C 3 204 ? 97.681  22.817 13.847  1.00 44.09  ? 204  TRP A C     1 
ATOM   2091 O O     . TRP C 3 204 ? 96.991  23.804 14.102  1.00 45.70  ? 204  TRP A O     1 
ATOM   2092 C CB    . TRP C 3 204 ? 96.391  20.721 13.973  1.00 39.40  ? 204  TRP A CB    1 
ATOM   2093 C CG    . TRP C 3 204 ? 96.311  19.274 14.265  1.00 37.22  ? 204  TRP A CG    1 
ATOM   2094 C CD1   . TRP C 3 204 ? 97.060  18.558 15.151  1.00 38.89  ? 204  TRP A CD1   1 
ATOM   2095 C CD2   . TRP C 3 204 ? 95.410  18.348 13.662  1.00 38.31  ? 204  TRP A CD2   1 
ATOM   2096 N NE1   . TRP C 3 204 ? 96.681  17.235 15.136  1.00 36.57  ? 204  TRP A NE1   1 
ATOM   2097 C CE2   . TRP C 3 204 ? 95.669  17.078 14.231  1.00 37.11  ? 204  TRP A CE2   1 
ATOM   2098 C CE3   . TRP C 3 204 ? 94.405  18.467 12.691  1.00 32.92  ? 204  TRP A CE3   1 
ATOM   2099 C CZ2   . TRP C 3 204 ? 94.964  15.935 13.864  1.00 38.06  ? 204  TRP A CZ2   1 
ATOM   2100 C CZ3   . TRP C 3 204 ? 93.704  17.334 12.321  1.00 35.37  ? 204  TRP A CZ3   1 
ATOM   2101 C CH2   . TRP C 3 204 ? 93.987  16.078 12.908  1.00 38.44  ? 204  TRP A CH2   1 
ATOM   2102 N N     . HIS C 3 205 ? 98.581  22.811 12.871  1.00 42.31  ? 205  HIS A N     1 
ATOM   2103 C CA    . HIS C 3 205 ? 98.761  23.974 12.007  1.00 42.13  ? 205  HIS A CA    1 
ATOM   2104 C C     . HIS C 3 205 ? 97.507  24.077 11.101  1.00 40.08  ? 205  HIS A C     1 
ATOM   2105 O O     . HIS C 3 205 ? 96.910  23.058 10.763  1.00 37.48  ? 205  HIS A O     1 
ATOM   2106 C CB    . HIS C 3 205 ? 99.982  23.794 11.096  1.00 44.59  ? 205  HIS A CB    1 
ATOM   2107 C CG    . HIS C 3 205 ? 101.293 23.853 11.805  1.00 49.71  ? 205  HIS A CG    1 
ATOM   2108 N ND1   . HIS C 3 205 ? 101.711 24.966 12.504  1.00 52.81  ? 205  HIS A ND1   1 
ATOM   2109 C CD2   . HIS C 3 205 ? 102.283 22.938 11.926  1.00 50.73  ? 205  HIS A CD2   1 
ATOM   2110 C CE1   . HIS C 3 205 ? 102.900 24.731 13.029  1.00 53.90  ? 205  HIS A CE1   1 
ATOM   2111 N NE2   . HIS C 3 205 ? 103.269 23.507 12.693  1.00 55.71  ? 205  HIS A NE2   1 
ATOM   2112 N N     . LYS C 3 206 ? 97.137  25.295 10.705  1.00 39.07  ? 206  LYS A N     1 
ATOM   2113 C CA    . LYS C 3 206 ? 95.996  25.526 9.826   1.00 38.31  ? 206  LYS A CA    1 
ATOM   2114 C C     . LYS C 3 206 ? 96.116  24.720 8.545   1.00 39.82  ? 206  LYS A C     1 
ATOM   2115 O O     . LYS C 3 206 ? 95.122  24.159 8.071   1.00 40.71  ? 206  LYS A O     1 
ATOM   2116 C CB    . LYS C 3 206 ? 95.885  27.011 9.456   1.00 41.25  ? 206  LYS A CB    1 
ATOM   2117 C CG    . LYS C 3 206 ? 94.648  27.714 10.016  1.00 42.95  ? 206  LYS A CG    1 
ATOM   2118 C CD    . LYS C 3 206 ? 93.365  26.997 9.641   1.00 44.50  ? 206  LYS A CD    1 
ATOM   2119 C CE    . LYS C 3 206 ? 92.135  27.656 10.298  1.00 44.14  ? 206  LYS A CE    1 
ATOM   2120 N NZ    . LYS C 3 206 ? 92.275  27.838 11.777  1.00 47.97  ? 206  LYS A NZ    1 
ATOM   2121 N N     . GLU C 3 207 ? 97.325  24.688 7.971   1.00 39.74  ? 207  GLU A N     1 
ATOM   2122 C CA    . GLU C 3 207 ? 97.589  23.930 6.737   1.00 38.89  ? 207  GLU A CA    1 
ATOM   2123 C C     . GLU C 3 207 ? 97.091  22.494 6.866   1.00 38.26  ? 207  GLU A C     1 
ATOM   2124 O O     . GLU C 3 207 ? 96.444  21.970 5.963   1.00 38.83  ? 207  GLU A O     1 
ATOM   2125 C CB    . GLU C 3 207 ? 99.102  23.881 6.405   1.00 40.29  ? 207  GLU A CB    1 
ATOM   2126 C CG    . GLU C 3 207 ? 99.750  25.215 6.022   1.00 39.59  ? 207  GLU A CG    1 
ATOM   2127 C CD    . GLU C 3 207 ? 100.174 26.044 7.225   1.00 45.41  ? 207  GLU A CD    1 
ATOM   2128 O OE1   . GLU C 3 207 ? 99.528  25.958 8.306   1.00 46.70  ? 207  GLU A OE1   1 
ATOM   2129 O OE2   . GLU C 3 207 ? 101.158 26.805 7.086   1.00 47.98  ? 207  GLU A OE2   1 
ATOM   2130 N N     . ASP C 3 208 ? 97.400  21.857 7.994   1.00 37.49  ? 208  ASP A N     1 
ATOM   2131 C CA    . ASP C 3 208 ? 96.996  20.480 8.212   1.00 38.14  ? 208  ASP A CA    1 
ATOM   2132 C C     . ASP C 3 208 ? 95.498  20.328 8.483   1.00 36.96  ? 208  ASP A C     1 
ATOM   2133 O O     . ASP C 3 208 ? 94.856  19.373 8.027   1.00 29.58  ? 208  ASP A O     1 
ATOM   2134 C CB    . ASP C 3 208 ? 97.803  19.876 9.366   1.00 42.98  ? 208  ASP A CB    1 
ATOM   2135 C CG    . ASP C 3 208 ? 99.294  19.771 9.045   1.00 46.97  ? 208  ASP A CG    1 
ATOM   2136 O OD1   . ASP C 3 208 ? 99.604  19.416 7.895   1.00 46.97  ? 208  ASP A OD1   1 
ATOM   2137 O OD2   . ASP C 3 208 ? 100.143 20.033 9.935   1.00 46.99  ? 208  ASP A OD2   1 
ATOM   2138 N N     . SER C 3 209 ? 94.959  21.270 9.247   1.00 37.92  ? 209  SER A N     1 
ATOM   2139 C CA    . SER C 3 209 ? 93.551  21.257 9.601   1.00 39.92  ? 209  SER A CA    1 
ATOM   2140 C C     . SER C 3 209 ? 92.719  21.343 8.331   1.00 38.48  ? 209  SER A C     1 
ATOM   2141 O O     . SER C 3 209 ? 91.740  20.603 8.158   1.00 37.31  ? 209  SER A O     1 
ATOM   2142 C CB    . SER C 3 209 ? 93.236  22.438 10.510  1.00 42.26  ? 209  SER A CB    1 
ATOM   2143 O OG    . SER C 3 209 ? 91.850  22.470 10.779  1.00 51.28  ? 209  SER A OG    1 
ATOM   2144 N N     . ILE C 3 210 ? 93.137  22.229 7.429   1.00 35.00  ? 210  ILE A N     1 
ATOM   2145 C CA    . ILE C 3 210 ? 92.428  22.400 6.169   1.00 35.68  ? 210  ILE A CA    1 
ATOM   2146 C C     . ILE C 3 210 ? 92.650  21.189 5.281   1.00 32.24  ? 210  ILE A C     1 
ATOM   2147 O O     . ILE C 3 210 ? 91.757  20.800 4.540   1.00 32.66  ? 210  ILE A O     1 
ATOM   2148 C CB    . ILE C 3 210 ? 92.891  23.650 5.402   1.00 33.06  ? 210  ILE A CB    1 
ATOM   2149 C CG1   . ILE C 3 210 ? 92.771  24.890 6.277   1.00 35.31  ? 210  ILE A CG1   1 
ATOM   2150 C CG2   . ILE C 3 210 ? 92.082  23.792 4.152   1.00 31.52  ? 210  ILE A CG2   1 
ATOM   2151 C CD1   . ILE C 3 210 ? 91.383  25.133 6.783   1.00 37.54  ? 210  ILE A CD1   1 
ATOM   2152 N N     . HIS C 3 211 ? 93.852  20.622 5.328   1.00 33.31  ? 211  HIS A N     1 
ATOM   2153 C CA    . HIS C 3 211 ? 94.169  19.417 4.542   1.00 31.99  ? 211  HIS A CA    1 
ATOM   2154 C C     . HIS C 3 211 ? 93.136  18.361 4.942   1.00 30.12  ? 211  HIS A C     1 
ATOM   2155 O O     . HIS C 3 211 ? 92.437  17.799 4.115   1.00 30.88  ? 211  HIS A O     1 
ATOM   2156 C CB    . HIS C 3 211 ? 95.579  18.909 4.875   1.00 32.11  ? 211  HIS A CB    1 
ATOM   2157 C CG    . HIS C 3 211 ? 96.613  19.271 3.856   1.00 35.27  ? 211  HIS A CG    1 
ATOM   2158 N ND1   . HIS C 3 211 ? 96.777  18.570 2.679   1.00 32.85  ? 211  HIS A ND1   1 
ATOM   2159 C CD2   . HIS C 3 211 ? 97.518  20.279 3.823   1.00 30.58  ? 211  HIS A CD2   1 
ATOM   2160 C CE1   . HIS C 3 211 ? 97.734  19.132 1.964   1.00 28.06  ? 211  HIS A CE1   1 
ATOM   2161 N NE2   . HIS C 3 211 ? 98.198  20.172 2.633   1.00 28.26  ? 211  HIS A NE2   1 
ATOM   2162 N N     . VAL C 3 212 ? 93.031  18.117 6.232   1.00 30.28  ? 212  VAL A N     1 
ATOM   2163 C CA    . VAL C 3 212 ? 92.067  17.145 6.732   1.00 30.83  ? 212  VAL A CA    1 
ATOM   2164 C C     . VAL C 3 212 ? 90.625  17.505 6.372   1.00 30.84  ? 212  VAL A C     1 
ATOM   2165 O O     . VAL C 3 212 ? 89.872  16.648 5.878   1.00 33.98  ? 212  VAL A O     1 
ATOM   2166 C CB    . VAL C 3 212 ? 92.195  17.003 8.255   1.00 29.94  ? 212  VAL A CB    1 
ATOM   2167 C CG1   . VAL C 3 212 ? 91.092  16.116 8.791   1.00 28.46  ? 212  VAL A CG1   1 
ATOM   2168 C CG2   . VAL C 3 212 ? 93.593  16.428 8.586   1.00 25.09  ? 212  VAL A CG2   1 
ATOM   2169 N N     . GLY C 3 213 ? 90.245  18.764 6.600   1.00 29.44  ? 213  GLY A N     1 
ATOM   2170 C CA    . GLY C 3 213 ? 88.885  19.187 6.298   1.00 27.80  ? 213  GLY A CA    1 
ATOM   2171 C C     . GLY C 3 213 ? 88.477  19.028 4.848   1.00 27.82  ? 213  GLY A C     1 
ATOM   2172 O O     . GLY C 3 213 ? 87.363  18.597 4.536   1.00 27.43  ? 213  GLY A O     1 
ATOM   2173 N N     . VAL C 3 214 ? 89.380  19.395 3.950   1.00 30.37  ? 214  VAL A N     1 
ATOM   2174 C CA    . VAL C 3 214 ? 89.123  19.253 2.527   1.00 31.53  ? 214  VAL A CA    1 
ATOM   2175 C C     . VAL C 3 214 ? 88.945  17.776 2.144   1.00 32.49  ? 214  VAL A C     1 
ATOM   2176 O O     . VAL C 3 214 ? 87.962  17.395 1.481   1.00 31.11  ? 214  VAL A O     1 
ATOM   2177 C CB    . VAL C 3 214 ? 90.268  19.876 1.712   1.00 27.93  ? 214  VAL A CB    1 
ATOM   2178 C CG1   . VAL C 3 214 ? 90.125  19.538 0.255   1.00 30.13  ? 214  VAL A CG1   1 
ATOM   2179 C CG2   . VAL C 3 214 ? 90.233  21.369 1.873   1.00 25.15  ? 214  VAL A CG2   1 
ATOM   2180 N N     . ARG C 3 215 ? 89.876  16.927 2.564   1.00 33.61  ? 215  ARG A N     1 
ATOM   2181 C CA    . ARG C 3 215 ? 89.742  15.516 2.210   1.00 34.64  ? 215  ARG A CA    1 
ATOM   2182 C C     . ARG C 3 215 ? 88.420  14.927 2.704   1.00 33.78  ? 215  ARG A C     1 
ATOM   2183 O O     . ARG C 3 215 ? 87.814  14.132 2.016   1.00 31.42  ? 215  ARG A O     1 
ATOM   2184 C CB    . ARG C 3 215 ? 90.904  14.698 2.763   1.00 34.55  ? 215  ARG A CB    1 
ATOM   2185 C CG    . ARG C 3 215 ? 91.974  14.377 1.743   1.00 37.80  ? 215  ARG A CG    1 
ATOM   2186 C CD    . ARG C 3 215 ? 92.732  15.606 1.291   1.00 36.18  ? 215  ARG A CD    1 
ATOM   2187 N NE    . ARG C 3 215 ? 92.466  15.877 -0.111  1.00 42.02  ? 215  ARG A NE    1 
ATOM   2188 C CZ    . ARG C 3 215 ? 93.405  16.149 -1.005  1.00 42.14  ? 215  ARG A CZ    1 
ATOM   2189 N NH1   . ARG C 3 215 ? 94.674  16.179 -0.642  1.00 45.02  ? 215  ARG A NH1   1 
ATOM   2190 N NH2   . ARG C 3 215 ? 93.073  16.404 -2.257  1.00 44.05  ? 215  ARG A NH2   1 
ATOM   2191 N N     . CYS C 3 216 ? 87.985  15.306 3.898   1.00 33.93  ? 216  CYS A N     1 
ATOM   2192 C CA    . CYS C 3 216 ? 86.727  14.805 4.424   1.00 35.31  ? 216  CYS A CA    1 
ATOM   2193 C C     . CYS C 3 216 ? 85.551  15.307 3.586   1.00 36.20  ? 216  CYS A C     1 
ATOM   2194 O O     . CYS C 3 216 ? 84.658  14.531 3.226   1.00 36.17  ? 216  CYS A O     1 
ATOM   2195 C CB    . CYS C 3 216 ? 86.565  15.236 5.867   1.00 35.77  ? 216  CYS A CB    1 
ATOM   2196 S SG    . CYS C 3 216 ? 87.710  14.398 6.974   1.00 42.52  ? 216  CYS A SG    1 
ATOM   2197 N N     . ILE C 3 217 ? 85.553  16.599 3.260   1.00 34.42  ? 217  ILE A N     1 
ATOM   2198 C CA    . ILE C 3 217 ? 84.491  17.158 2.432   1.00 34.07  ? 217  ILE A CA    1 
ATOM   2199 C C     . ILE C 3 217 ? 84.468  16.382 1.121   1.00 36.60  ? 217  ILE A C     1 
ATOM   2200 O O     . ILE C 3 217 ? 83.404  15.989 0.632   1.00 36.21  ? 217  ILE A O     1 
ATOM   2201 C CB    . ILE C 3 217 ? 84.742  18.661 2.141   1.00 33.04  ? 217  ILE A CB    1 
ATOM   2202 C CG1   . ILE C 3 217 ? 84.510  19.470 3.417   1.00 31.20  ? 217  ILE A CG1   1 
ATOM   2203 C CG2   . ILE C 3 217 ? 83.852  19.139 0.991   1.00 30.05  ? 217  ILE A CG2   1 
ATOM   2204 C CD1   . ILE C 3 217 ? 84.969  20.932 3.324   1.00 37.26  ? 217  ILE A CD1   1 
ATOM   2205 N N     . GLU C 3 218 ? 85.662  16.151 0.578   1.00 38.68  ? 218  GLU A N     1 
ATOM   2206 C CA    . GLU C 3 218 ? 85.852  15.429 -0.686  1.00 40.41  ? 218  GLU A CA    1 
ATOM   2207 C C     . GLU C 3 218 ? 85.210  14.037 -0.670  1.00 40.68  ? 218  GLU A C     1 
ATOM   2208 O O     . GLU C 3 218 ? 84.512  13.646 -1.611  1.00 43.04  ? 218  GLU A O     1 
ATOM   2209 C CB    . GLU C 3 218 ? 87.352  15.336 -0.977  1.00 45.85  ? 218  GLU A CB    1 
ATOM   2210 C CG    . GLU C 3 218 ? 87.751  14.621 -2.251  1.00 52.05  ? 218  GLU A CG    1 
ATOM   2211 C CD    . GLU C 3 218 ? 89.272  14.597 -2.445  1.00 57.16  ? 218  GLU A CD    1 
ATOM   2212 O OE1   . GLU C 3 218 ? 89.870  15.688 -2.533  1.00 59.59  ? 218  GLU A OE1   1 
ATOM   2213 O OE2   . GLU C 3 218 ? 89.870  13.496 -2.498  1.00 59.43  ? 218  GLU A OE2   1 
ATOM   2214 N N     . MET C 3 219 ? 85.433  13.294 0.404   1.00 38.49  ? 219  MET A N     1 
ATOM   2215 C CA    . MET C 3 219 ? 84.851  11.974 0.525   1.00 38.58  ? 219  MET A CA    1 
ATOM   2216 C C     . MET C 3 219 ? 83.326  12.017 0.707   1.00 37.30  ? 219  MET A C     1 
ATOM   2217 O O     . MET C 3 219 ? 82.629  11.128 0.255   1.00 37.32  ? 219  MET A O     1 
ATOM   2218 C CB    . MET C 3 219 ? 85.510  11.224 1.682   1.00 39.78  ? 219  MET A CB    1 
ATOM   2219 C CG    . MET C 3 219 ? 86.977  10.850 1.412   1.00 39.29  ? 219  MET A CG    1 
ATOM   2220 S SD    . MET C 3 219 ? 87.703  9.770  2.700   1.00 47.51  ? 219  MET A SD    1 
ATOM   2221 C CE    . MET C 3 219 ? 88.093  10.993 4.005   1.00 40.45  ? 219  MET A CE    1 
ATOM   2222 N N     . LEU C 3 220 ? 82.815  13.051 1.367   1.00 39.14  ? 220  LEU A N     1 
ATOM   2223 C CA    . LEU C 3 220 ? 81.376  13.198 1.578   1.00 37.99  ? 220  LEU A CA    1 
ATOM   2224 C C     . LEU C 3 220 ? 80.687  13.450 0.219   1.00 39.91  ? 220  LEU A C     1 
ATOM   2225 O O     . LEU C 3 220 ? 79.611  12.904 -0.055  1.00 38.04  ? 220  LEU A O     1 
ATOM   2226 C CB    . LEU C 3 220 ? 81.108  14.357 2.543   1.00 39.06  ? 220  LEU A CB    1 
ATOM   2227 C CG    . LEU C 3 220 ? 79.686  14.888 2.679   1.00 42.10  ? 220  LEU A CG    1 
ATOM   2228 C CD1   . LEU C 3 220 ? 78.835  13.833 3.345   1.00 43.63  ? 220  LEU A CD1   1 
ATOM   2229 C CD2   . LEU C 3 220 ? 79.658  16.189 3.494   1.00 44.38  ? 220  LEU A CD2   1 
ATOM   2230 N N     . ILE C 3 221 ? 81.319  14.271 -0.622  1.00 39.58  ? 221  ILE A N     1 
ATOM   2231 C CA    . ILE C 3 221 ? 80.788  14.553 -1.942  1.00 40.78  ? 221  ILE A CA    1 
ATOM   2232 C C     . ILE C 3 221 ? 80.802  13.257 -2.746  1.00 42.88  ? 221  ILE A C     1 
ATOM   2233 O O     . ILE C 3 221 ? 79.909  12.987 -3.532  1.00 46.02  ? 221  ILE A O     1 
ATOM   2234 C CB    . ILE C 3 221 ? 81.644  15.603 -2.710  1.00 41.03  ? 221  ILE A CB    1 
ATOM   2235 C CG1   . ILE C 3 221 ? 81.679  16.931 -1.947  1.00 41.35  ? 221  ILE A CG1   1 
ATOM   2236 C CG2   . ILE C 3 221 ? 81.030  15.874 -4.098  1.00 40.61  ? 221  ILE A CG2   1 
ATOM   2237 C CD1   . ILE C 3 221 ? 82.440  18.034 -2.674  1.00 31.75  ? 221  ILE A CD1   1 
ATOM   2238 N N     . GLU C 3 222 ? 81.828  12.455 -2.531  1.00 45.00  ? 222  GLU A N     1 
ATOM   2239 C CA    . GLU C 3 222 ? 81.986  11.197 -3.241  1.00 49.42  ? 222  GLU A CA    1 
ATOM   2240 C C     . GLU C 3 222 ? 80.989  10.112 -2.817  1.00 49.67  ? 222  GLU A C     1 
ATOM   2241 O O     . GLU C 3 222 ? 80.191  9.652  -3.629  1.00 49.41  ? 222  GLU A O     1 
ATOM   2242 C CB    . GLU C 3 222 ? 83.416  10.696 -3.026  1.00 52.19  ? 222  GLU A CB    1 
ATOM   2243 C CG    . GLU C 3 222 ? 84.054  9.985  -4.189  1.00 56.26  ? 222  GLU A CG    1 
ATOM   2244 C CD    . GLU C 3 222 ? 85.549  10.271 -4.248  1.00 61.82  ? 222  GLU A CD    1 
ATOM   2245 O OE1   . GLU C 3 222 ? 86.251  9.994  -3.243  1.00 56.21  ? 222  GLU A OE1   1 
ATOM   2246 O OE2   . GLU C 3 222 ? 86.015  10.784 -5.297  1.00 65.33  ? 222  GLU A OE2   1 
ATOM   2247 N N     . SER C 3 223 ? 81.039  9.712  -1.549  1.00 48.53  ? 223  SER A N     1 
ATOM   2248 C CA    . SER C 3 223 ? 80.179  8.657  -1.036  1.00 50.30  ? 223  SER A CA    1 
ATOM   2249 C C     . SER C 3 223 ? 78.694  8.985  -1.114  1.00 51.61  ? 223  SER A C     1 
ATOM   2250 O O     . SER C 3 223 ? 77.881  8.131  -1.444  1.00 52.85  ? 223  SER A O     1 
ATOM   2251 C CB    . SER C 3 223 ? 80.560  8.330  0.406   1.00 53.17  ? 223  SER A CB    1 
ATOM   2252 O OG    . SER C 3 223 ? 80.420  9.465  1.250   1.00 55.60  ? 223  SER A OG    1 
ATOM   2253 N N     . THR C 3 224 ? 78.336  10.218 -0.792  1.00 51.40  ? 224  THR A N     1 
ATOM   2254 C CA    . THR C 3 224 ? 76.942  10.650 -0.853  1.00 50.07  ? 224  THR A CA    1 
ATOM   2255 C C     . THR C 3 224 ? 76.997  11.906 -1.702  1.00 50.51  ? 224  THR A C     1 
ATOM   2256 O O     . THR C 3 224 ? 78.087  12.406 -1.978  1.00 54.88  ? 224  THR A O     1 
ATOM   2257 C CB    . THR C 3 224 ? 76.423  11.048 0.526   1.00 48.18  ? 224  THR A CB    1 
ATOM   2258 O OG1   . THR C 3 224 ? 76.878  12.372 0.839   1.00 45.34  ? 224  THR A OG1   1 
ATOM   2259 C CG2   . THR C 3 224 ? 76.937  10.076 1.589   1.00 47.13  ? 224  THR A CG2   1 
ATOM   2260 N N     . GLY C 3 225 ? 75.868  12.430 -2.137  1.00 45.73  ? 225  GLY A N     1 
ATOM   2261 C CA    . GLY C 3 225 ? 75.978  13.655 -2.907  1.00 46.52  ? 225  GLY A CA    1 
ATOM   2262 C C     . GLY C 3 225 ? 75.385  14.762 -2.064  1.00 45.61  ? 225  GLY A C     1 
ATOM   2263 O O     . GLY C 3 225 ? 74.727  15.661 -2.582  1.00 47.00  ? 225  GLY A O     1 
ATOM   2264 N N     . MET C 3 226 ? 75.612  14.692 -0.758  1.00 42.00  ? 226  MET A N     1 
ATOM   2265 C CA    . MET C 3 226 ? 75.025  15.661 0.143   1.00 41.55  ? 226  MET A CA    1 
ATOM   2266 C C     . MET C 3 226 ? 75.360  17.114 -0.208  1.00 39.62  ? 226  MET A C     1 
ATOM   2267 O O     . MET C 3 226 ? 74.469  17.960 -0.189  1.00 39.58  ? 226  MET A O     1 
ATOM   2268 C CB    . MET C 3 226 ? 75.396  15.330 1.594   1.00 45.06  ? 226  MET A CB    1 
ATOM   2269 C CG    . MET C 3 226 ? 74.456  15.974 2.617   1.00 45.40  ? 226  MET A CG    1 
ATOM   2270 S SD    . MET C 3 226 ? 74.990  15.730 4.330   1.00 48.05  ? 226  MET A SD    1 
ATOM   2271 C CE    . MET C 3 226 ? 76.103  17.161 4.523   1.00 45.57  ? 226  MET A CE    1 
ATOM   2272 N N     . VAL C 3 227 ? 76.622  17.408 -0.522  1.00 36.41  ? 227  VAL A N     1 
ATOM   2273 C CA    . VAL C 3 227 ? 77.007  18.768 -0.920  1.00 38.04  ? 227  VAL A CA    1 
ATOM   2274 C C     . VAL C 3 227 ? 77.799  18.760 -2.235  1.00 38.52  ? 227  VAL A C     1 
ATOM   2275 O O     . VAL C 3 227 ? 78.160  17.708 -2.780  1.00 40.01  ? 227  VAL A O     1 
ATOM   2276 C CB    . VAL C 3 227 ? 77.894  19.503 0.137   1.00 36.66  ? 227  VAL A CB    1 
ATOM   2277 C CG1   . VAL C 3 227 ? 77.150  19.698 1.441   1.00 31.65  ? 227  VAL A CG1   1 
ATOM   2278 C CG2   . VAL C 3 227 ? 79.174  18.726 0.364   1.00 39.38  ? 227  VAL A CG2   1 
ATOM   2279 N N     . SER C 3 228 ? 78.083  19.951 -2.732  1.00 37.14  ? 228  SER A N     1 
ATOM   2280 C CA    . SER C 3 228 ? 78.814  20.104 -3.971  1.00 38.11  ? 228  SER A CA    1 
ATOM   2281 C C     . SER C 3 228 ? 79.655  21.376 -3.864  1.00 39.43  ? 228  SER A C     1 
ATOM   2282 O O     . SER C 3 228 ? 79.387  22.250 -3.019  1.00 36.60  ? 228  SER A O     1 
ATOM   2283 C CB    . SER C 3 228 ? 77.833  20.219 -5.143  1.00 39.99  ? 228  SER A CB    1 
ATOM   2284 O OG    . SER C 3 228 ? 77.151  21.471 -5.130  1.00 45.60  ? 228  SER A OG    1 
ATOM   2285 N N     . LEU C 3 229 ? 80.660  21.488 -4.725  1.00 39.04  ? 229  LEU A N     1 
ATOM   2286 C CA    . LEU C 3 229 ? 81.534  22.645 -4.696  1.00 40.13  ? 229  LEU A CA    1 
ATOM   2287 C C     . LEU C 3 229 ? 81.181  23.634 -5.807  1.00 40.35  ? 229  LEU A C     1 
ATOM   2288 O O     . LEU C 3 229 ? 81.057  23.266 -6.973  1.00 40.79  ? 229  LEU A O     1 
ATOM   2289 C CB    . LEU C 3 229 ? 82.994  22.178 -4.806  1.00 40.77  ? 229  LEU A CB    1 
ATOM   2290 C CG    . LEU C 3 229 ? 84.091  23.068 -4.195  1.00 41.36  ? 229  LEU A CG    1 
ATOM   2291 C CD1   . LEU C 3 229 ? 83.898  23.208 -2.703  1.00 41.51  ? 229  LEU A CD1   1 
ATOM   2292 C CD2   . LEU C 3 229 ? 85.436  22.439 -4.452  1.00 44.80  ? 229  LEU A CD2   1 
ATOM   2293 N N     . HIS C 3 230 ? 81.013  24.897 -5.449  1.00 42.63  ? 230  HIS A N     1 
ATOM   2294 C CA    . HIS C 3 230 ? 80.658  25.897 -6.442  1.00 44.62  ? 230  HIS A CA    1 
ATOM   2295 C C     . HIS C 3 230 ? 81.594  27.092 -6.482  1.00 42.69  ? 230  HIS A C     1 
ATOM   2296 O O     . HIS C 3 230 ? 81.820  27.741 -5.469  1.00 42.66  ? 230  HIS A O     1 
ATOM   2297 C CB    . HIS C 3 230 ? 79.220  26.377 -6.204  1.00 50.81  ? 230  HIS A CB    1 
ATOM   2298 C CG    . HIS C 3 230 ? 78.179  25.395 -6.650  1.00 58.30  ? 230  HIS A CG    1 
ATOM   2299 N ND1   . HIS C 3 230 ? 78.188  24.820 -7.904  1.00 61.23  ? 230  HIS A ND1   1 
ATOM   2300 C CD2   . HIS C 3 230 ? 77.077  24.912 -6.025  1.00 62.16  ? 230  HIS A CD2   1 
ATOM   2301 C CE1   . HIS C 3 230 ? 77.137  24.027 -8.032  1.00 61.93  ? 230  HIS A CE1   1 
ATOM   2302 N NE2   . HIS C 3 230 ? 76.447  24.065 -6.906  1.00 61.76  ? 230  HIS A NE2   1 
ATOM   2303 N N     . ARG C 3 231 ? 82.135  27.373 -7.660  1.00 42.55  ? 231  ARG A N     1 
ATOM   2304 C CA    . ARG C 3 231 ? 83.036  28.503 -7.844  1.00 44.55  ? 231  ARG A CA    1 
ATOM   2305 C C     . ARG C 3 231 ? 82.193  29.762 -8.006  1.00 46.62  ? 231  ARG A C     1 
ATOM   2306 O O     . ARG C 3 231 ? 81.308  29.806 -8.857  1.00 47.94  ? 231  ARG A O     1 
ATOM   2307 C CB    . ARG C 3 231 ? 83.878  28.273 -9.095  1.00 44.28  ? 231  ARG A CB    1 
ATOM   2308 C CG    . ARG C 3 231 ? 84.809  29.399 -9.488  1.00 46.00  ? 231  ARG A CG    1 
ATOM   2309 C CD    . ARG C 3 231 ? 86.083  29.421 -8.660  1.00 46.73  ? 231  ARG A CD    1 
ATOM   2310 N NE    . ARG C 3 231 ? 87.058  30.350 -9.224  1.00 45.22  ? 231  ARG A NE    1 
ATOM   2311 C CZ    . ARG C 3 231 ? 87.767  30.123 -10.328 1.00 43.74  ? 231  ARG A CZ    1 
ATOM   2312 N NH1   . ARG C 3 231 ? 87.627  28.988 -10.998 1.00 42.38  ? 231  ARG A NH1   1 
ATOM   2313 N NH2   . ARG C 3 231 ? 88.611  31.046 -10.768 1.00 44.12  ? 231  ARG A NH2   1 
ATOM   2314 N N     . GLN C 3 232 ? 82.469  30.778 -7.193  1.00 48.89  ? 232  GLN A N     1 
ATOM   2315 C CA    . GLN C 3 232 ? 81.740  32.044 -7.238  1.00 51.10  ? 232  GLN A CA    1 
ATOM   2316 C C     . GLN C 3 232 ? 82.583  33.207 -7.772  1.00 53.38  ? 232  GLN A C     1 
ATOM   2317 O O     . GLN C 3 232 ? 83.717  33.404 -7.344  1.00 55.64  ? 232  GLN A O     1 
ATOM   2318 C CB    . GLN C 3 232 ? 81.229  32.405 -5.844  1.00 51.70  ? 232  GLN A CB    1 
ATOM   2319 C CG    . GLN C 3 232 ? 80.319  31.352 -5.235  1.00 54.31  ? 232  GLN A CG    1 
ATOM   2320 C CD    . GLN C 3 232 ? 79.046  31.160 -6.036  1.00 55.50  ? 232  GLN A CD    1 
ATOM   2321 O OE1   . GLN C 3 232 ? 78.348  32.130 -6.340  1.00 55.06  ? 232  GLN A OE1   1 
ATOM   2322 N NE2   . GLN C 3 232 ? 78.731  29.911 -6.375  1.00 53.80  ? 232  GLN A NE2   1 
ATOM   2323 N N     . ASN C 3 233 ? 82.007  33.979 -8.698  1.00 55.58  ? 233  ASN A N     1 
ATOM   2324 C CA    . ASN C 3 233 ? 82.675  35.128 -9.314  1.00 55.63  ? 233  ASN A CA    1 
ATOM   2325 C C     . ASN C 3 233 ? 84.059  34.777 -9.855  1.00 54.66  ? 233  ASN A C     1 
ATOM   2326 O O     . ASN C 3 233 ? 85.070  35.309 -9.397  1.00 54.01  ? 233  ASN A O     1 
ATOM   2327 C CB    . ASN C 3 233 ? 82.785  36.277 -8.304  1.00 58.96  ? 233  ASN A CB    1 
ATOM   2328 C CG    . ASN C 3 233 ? 81.420  36.823 -7.885  1.00 62.35  ? 233  ASN A CG    1 
ATOM   2329 O OD1   . ASN C 3 233 ? 81.078  36.717 -6.684  1.00 63.11  ? 233  ASN A OD1   1 
ATOM   2330 N ND2   . ASN C 3 233 ? 80.688  37.356 -8.758  1.00 63.21  ? 233  ASN A ND2   1 
ATOM   2331 N N     . ALA C 3 234 ? 84.097  33.894 -10.847 1.00 53.75  ? 234  ALA A N     1 
ATOM   2332 C CA    . ALA C 3 234 ? 85.362  33.458 -11.427 1.00 55.35  ? 234  ALA A CA    1 
ATOM   2333 C C     . ALA C 3 234 ? 86.096  34.558 -12.183 1.00 56.93  ? 234  ALA A C     1 
ATOM   2334 O O     . ALA C 3 234 ? 85.719  34.902 -13.300 1.00 57.77  ? 234  ALA A O     1 
ATOM   2335 C CB    . ALA C 3 234 ? 85.131  32.268 -12.349 1.00 50.13  ? 234  ALA A CB    1 
ATOM   2336 N N     . GLY C 3 235 ? 87.146  35.107 -11.577 1.00 58.51  ? 235  GLY A N     1 
ATOM   2337 C CA    . GLY C 3 235 ? 87.912  36.145 -12.241 1.00 58.89  ? 235  GLY A CA    1 
ATOM   2338 C C     . GLY C 3 235 ? 88.038  37.441 -11.470 1.00 61.40  ? 235  GLY A C     1 
ATOM   2339 O O     . GLY C 3 235 ? 88.817  38.314 -11.852 1.00 64.01  ? 235  GLY A O     1 
ATOM   2340 N N     . VAL C 3 236 ? 87.284  37.580 -10.388 1.00 61.36  ? 236  VAL A N     1 
ATOM   2341 C CA    . VAL C 3 236 ? 87.344  38.805 -9.600  1.00 62.05  ? 236  VAL A CA    1 
ATOM   2342 C C     . VAL C 3 236 ? 88.248  38.668 -8.379  1.00 62.77  ? 236  VAL A C     1 
ATOM   2343 O O     . VAL C 3 236 ? 87.903  38.007 -7.401  1.00 64.17  ? 236  VAL A O     1 
ATOM   2344 C CB    . VAL C 3 236 ? 85.940  39.233 -9.142  1.00 63.32  ? 236  VAL A CB    1 
ATOM   2345 C CG1   . VAL C 3 236 ? 86.023  40.552 -8.402  1.00 63.16  ? 236  VAL A CG1   1 
ATOM   2346 C CG2   . VAL C 3 236 ? 85.018  39.347 -10.350 1.00 61.25  ? 236  VAL A CG2   1 
ATOM   2347 N N     . VAL C 3 237 ? 89.409  39.305 -8.444  1.00 63.50  ? 237  VAL A N     1 
ATOM   2348 C CA    . VAL C 3 237 ? 90.382  39.257 -7.364  1.00 63.55  ? 237  VAL A CA    1 
ATOM   2349 C C     . VAL C 3 237 ? 89.775  39.486 -5.988  1.00 64.66  ? 237  VAL A C     1 
ATOM   2350 O O     . VAL C 3 237 ? 90.269  38.958 -4.993  1.00 65.37  ? 237  VAL A O     1 
ATOM   2351 C CB    . VAL C 3 237 ? 91.503  40.302 -7.588  1.00 62.81  ? 237  VAL A CB    1 
ATOM   2352 C CG1   . VAL C 3 237 ? 92.561  40.195 -6.489  1.00 61.10  ? 237  VAL A CG1   1 
ATOM   2353 C CG2   . VAL C 3 237 ? 92.125  40.097 -8.952  1.00 60.62  ? 237  VAL A CG2   1 
ATOM   2354 N N     . GLY C 3 238 ? 88.700  40.265 -5.927  1.00 64.89  ? 238  GLY A N     1 
ATOM   2355 C CA    . GLY C 3 238 ? 88.086  40.545 -4.639  1.00 63.53  ? 238  GLY A CA    1 
ATOM   2356 C C     . GLY C 3 238 ? 86.933  39.647 -4.234  1.00 62.32  ? 238  GLY A C     1 
ATOM   2357 O O     . GLY C 3 238 ? 86.588  39.568 -3.055  1.00 62.26  ? 238  GLY A O     1 
ATOM   2358 N N     . GLN C 3 239 ? 86.342  38.947 -5.193  1.00 60.09  ? 239  GLN A N     1 
ATOM   2359 C CA    . GLN C 3 239 ? 85.207  38.110 -4.866  1.00 58.12  ? 239  GLN A CA    1 
ATOM   2360 C C     . GLN C 3 239 ? 85.299  36.633 -5.264  1.00 55.59  ? 239  GLN A C     1 
ATOM   2361 O O     . GLN C 3 239 ? 84.385  35.860 -4.981  1.00 55.77  ? 239  GLN A O     1 
ATOM   2362 C CB    . GLN C 3 239 ? 83.958  38.729 -5.485  1.00 59.43  ? 239  GLN A CB    1 
ATOM   2363 C CG    . GLN C 3 239 ? 83.829  40.230 -5.249  1.00 60.56  ? 239  GLN A CG    1 
ATOM   2364 C CD    . GLN C 3 239 ? 82.542  40.802 -5.826  1.00 62.99  ? 239  GLN A CD    1 
ATOM   2365 O OE1   . GLN C 3 239 ? 82.456  41.999 -6.108  1.00 64.17  ? 239  GLN A OE1   1 
ATOM   2366 N NE2   . GLN C 3 239 ? 81.532  39.948 -5.998  1.00 62.38  ? 239  GLN A NE2   1 
ATOM   2367 N N     . ASP C 3 240 ? 86.386  36.227 -5.910  1.00 51.72  ? 240  ASP A N     1 
ATOM   2368 C CA    . ASP C 3 240 ? 86.494  34.835 -6.324  1.00 45.73  ? 240  ASP A CA    1 
ATOM   2369 C C     . ASP C 3 240 ? 86.430  33.923 -5.085  1.00 42.99  ? 240  ASP A C     1 
ATOM   2370 O O     . ASP C 3 240 ? 87.081  34.182 -4.070  1.00 40.24  ? 240  ASP A O     1 
ATOM   2371 C CB    . ASP C 3 240 ? 87.792  34.615 -7.108  1.00 44.43  ? 240  ASP A CB    1 
ATOM   2372 C CG    . ASP C 3 240 ? 87.667  33.507 -8.126  1.00 46.92  ? 240  ASP A CG    1 
ATOM   2373 O OD1   . ASP C 3 240 ? 86.989  32.496 -7.834  1.00 43.33  ? 240  ASP A OD1   1 
ATOM   2374 O OD2   . ASP C 3 240 ? 88.255  33.633 -9.221  1.00 50.85  ? 240  ASP A OD2   1 
ATOM   2375 N N     . SER C 3 241 ? 85.622  32.872 -5.158  1.00 40.69  ? 241  SER A N     1 
ATOM   2376 C CA    . SER C 3 241 ? 85.479  31.963 -4.022  1.00 39.84  ? 241  SER A CA    1 
ATOM   2377 C C     . SER C 3 241 ? 85.065  30.556 -4.419  1.00 38.75  ? 241  SER A C     1 
ATOM   2378 O O     . SER C 3 241 ? 84.529  30.331 -5.495  1.00 39.50  ? 241  SER A O     1 
ATOM   2379 C CB    . SER C 3 241 ? 84.449  32.522 -3.021  1.00 34.60  ? 241  SER A CB    1 
ATOM   2380 O OG    . SER C 3 241 ? 83.124  32.573 -3.527  1.00 39.02  ? 241  SER A OG    1 
ATOM   2381 N N     . GLU C 3 242 ? 85.316  29.620 -3.514  1.00 38.40  ? 242  GLU A N     1 
ATOM   2382 C CA    . GLU C 3 242 ? 84.942  28.231 -3.691  1.00 39.84  ? 242  GLU A CA    1 
ATOM   2383 C C     . GLU C 3 242 ? 83.966  27.958 -2.512  1.00 38.58  ? 242  GLU A C     1 
ATOM   2384 O O     . GLU C 3 242 ? 84.353  28.077 -1.349  1.00 37.02  ? 242  GLU A O     1 
ATOM   2385 C CB    . GLU C 3 242 ? 86.195  27.371 -3.576  1.00 43.65  ? 242  GLU A CB    1 
ATOM   2386 C CG    . GLU C 3 242 ? 86.139  26.057 -4.324  1.00 51.62  ? 242  GLU A CG    1 
ATOM   2387 C CD    . GLU C 3 242 ? 86.209  26.236 -5.827  1.00 53.12  ? 242  GLU A CD    1 
ATOM   2388 O OE1   . GLU C 3 242 ? 87.165  26.901 -6.294  1.00 51.99  ? 242  GLU A OE1   1 
ATOM   2389 O OE2   . GLU C 3 242 ? 85.317  25.704 -6.534  1.00 56.50  ? 242  GLU A OE2   1 
ATOM   2390 N N     . THR C 3 243 ? 82.712  27.602 -2.793  1.00 36.25  ? 243  THR A N     1 
ATOM   2391 C CA    . THR C 3 243 ? 81.761  27.383 -1.704  1.00 35.02  ? 243  THR A CA    1 
ATOM   2392 C C     . THR C 3 243 ? 81.059  26.041 -1.689  1.00 37.41  ? 243  THR A C     1 
ATOM   2393 O O     . THR C 3 243 ? 80.896  25.395 -2.724  1.00 40.92  ? 243  THR A O     1 
ATOM   2394 C CB    . THR C 3 243 ? 80.624  28.436 -1.692  1.00 35.50  ? 243  THR A CB    1 
ATOM   2395 O OG1   . THR C 3 243 ? 79.742  28.171 -2.777  1.00 36.18  ? 243  THR A OG1   1 
ATOM   2396 C CG2   . THR C 3 243 ? 81.154  29.862 -1.825  1.00 33.93  ? 243  THR A CG2   1 
ATOM   2397 N N     . ILE C 3 244 ? 80.629  25.635 -0.500  1.00 37.40  ? 244  ILE A N     1 
ATOM   2398 C CA    . ILE C 3 244 ? 79.899  24.395 -0.338  1.00 38.77  ? 244  ILE A CA    1 
ATOM   2399 C C     . ILE C 3 244 ? 78.405  24.709 -0.442  1.00 41.17  ? 244  ILE A C     1 
ATOM   2400 O O     . ILE C 3 244 ? 77.900  25.633 0.200   1.00 40.77  ? 244  ILE A O     1 
ATOM   2401 C CB    . ILE C 3 244 ? 80.150  23.775 1.030   1.00 39.79  ? 244  ILE A CB    1 
ATOM   2402 C CG1   . ILE C 3 244 ? 81.654  23.583 1.256   1.00 41.30  ? 244  ILE A CG1   1 
ATOM   2403 C CG2   . ILE C 3 244 ? 79.411  22.423 1.119   1.00 35.60  ? 244  ILE A CG2   1 
ATOM   2404 C CD1   . ILE C 3 244 ? 82.294  22.567 0.317   1.00 36.70  ? 244  ILE A CD1   1 
ATOM   2405 N N     . GLU C 3 245 ? 77.696  23.928 -1.241  1.00 43.63  ? 245  GLU A N     1 
ATOM   2406 C CA    . GLU C 3 245 ? 76.267  24.144 -1.434  1.00 43.92  ? 245  GLU A CA    1 
ATOM   2407 C C     . GLU C 3 245 ? 75.550  22.831 -1.194  1.00 42.60  ? 245  GLU A C     1 
ATOM   2408 O O     . GLU C 3 245 ? 75.927  21.806 -1.745  1.00 41.91  ? 245  GLU A O     1 
ATOM   2409 C CB    . GLU C 3 245 ? 75.989  24.615 -2.869  1.00 45.52  ? 245  GLU A CB    1 
ATOM   2410 C CG    . GLU C 3 245 ? 75.237  25.925 -3.001  1.00 56.32  ? 245  GLU A CG    1 
ATOM   2411 C CD    . GLU C 3 245 ? 76.010  27.109 -2.433  1.00 59.93  ? 245  GLU A CD    1 
ATOM   2412 O OE1   . GLU C 3 245 ? 77.155  27.346 -2.872  1.00 60.08  ? 245  GLU A OE1   1 
ATOM   2413 O OE2   . GLU C 3 245 ? 75.466  27.805 -1.548  1.00 63.83  ? 245  GLU A OE2   1 
ATOM   2414 N N     . LEU C 3 246 ? 74.512  22.860 -0.370  1.00 42.28  ? 246  LEU A N     1 
ATOM   2415 C CA    . LEU C 3 246 ? 73.757  21.650 -0.119  1.00 40.95  ? 246  LEU A CA    1 
ATOM   2416 C C     . LEU C 3 246 ? 73.046  21.261 -1.421  1.00 40.25  ? 246  LEU A C     1 
ATOM   2417 O O     . LEU C 3 246 ? 72.495  22.113 -2.113  1.00 38.60  ? 246  LEU A O     1 
ATOM   2418 C CB    . LEU C 3 246 ? 72.732  21.884 0.977   1.00 39.55  ? 246  LEU A CB    1 
ATOM   2419 C CG    . LEU C 3 246 ? 71.952  20.590 1.223   1.00 41.66  ? 246  LEU A CG    1 
ATOM   2420 C CD1   . LEU C 3 246 ? 72.854  19.586 1.948   1.00 39.40  ? 246  LEU A CD1   1 
ATOM   2421 C CD2   . LEU C 3 246 ? 70.709  20.891 2.036   1.00 42.23  ? 246  LEU A CD2   1 
ATOM   2422 N N     . ALA C 3 247 ? 73.069  19.981 -1.758  1.00 39.35  ? 247  ALA A N     1 
ATOM   2423 C CA    . ALA C 3 247 ? 72.417  19.510 -2.980  1.00 42.71  ? 247  ALA A CA    1 
ATOM   2424 C C     . ALA C 3 247 ? 70.885  19.614 -2.920  1.00 44.52  ? 247  ALA A C     1 
ATOM   2425 O O     . ALA C 3 247 ? 70.267  19.330 -1.888  1.00 44.16  ? 247  ALA A O     1 
ATOM   2426 C CB    . ALA C 3 247 ? 72.834  18.052 -3.271  1.00 40.43  ? 247  ALA A CB    1 
ATOM   2427 N N     . PRO C 3 248 ? 70.251  20.000 -4.041  1.00 47.85  ? 248  PRO A N     1 
ATOM   2428 C CA    . PRO C 3 248 ? 68.790  20.141 -4.125  1.00 48.74  ? 248  PRO A CA    1 
ATOM   2429 C C     . PRO C 3 248 ? 68.028  18.922 -3.588  1.00 49.19  ? 248  PRO A C     1 
ATOM   2430 O O     . PRO C 3 248 ? 67.000  19.069 -2.931  1.00 49.27  ? 248  PRO A O     1 
ATOM   2431 C CB    . PRO C 3 248 ? 68.555  20.361 -5.613  1.00 50.04  ? 248  PRO A CB    1 
ATOM   2432 C CG    . PRO C 3 248 ? 69.812  21.043 -6.050  1.00 50.29  ? 248  PRO A CG    1 
ATOM   2433 C CD    . PRO C 3 248 ? 70.874  20.244 -5.352  1.00 48.01  ? 248  PRO A CD    1 
ATOM   2434 N N     . GLU C 3 249 ? 68.533  17.725 -3.864  1.00 49.60  ? 249  GLU A N     1 
ATOM   2435 C CA    . GLU C 3 249 ? 67.891  16.509 -3.383  1.00 53.19  ? 249  GLU A CA    1 
ATOM   2436 C C     . GLU C 3 249 ? 67.707  16.584 -1.879  1.00 52.93  ? 249  GLU A C     1 
ATOM   2437 O O     . GLU C 3 249 ? 66.601  16.360 -1.376  1.00 53.35  ? 249  GLU A O     1 
ATOM   2438 C CB    . GLU C 3 249 ? 68.731  15.259 -3.691  1.00 57.27  ? 249  GLU A CB    1 
ATOM   2439 C CG    . GLU C 3 249 ? 69.245  15.166 -5.115  1.00 66.06  ? 249  GLU A CG    1 
ATOM   2440 C CD    . GLU C 3 249 ? 70.715  15.557 -5.227  1.00 70.37  ? 249  GLU A CD    1 
ATOM   2441 O OE1   . GLU C 3 249 ? 71.570  14.838 -4.636  1.00 71.94  ? 249  GLU A OE1   1 
ATOM   2442 O OE2   . GLU C 3 249 ? 71.008  16.579 -5.904  1.00 73.35  ? 249  GLU A OE2   1 
ATOM   2443 N N     . TYR C 3 250 ? 68.788  16.885 -1.159  1.00 49.07  ? 250  TYR A N     1 
ATOM   2444 C CA    . TYR C 3 250 ? 68.700  16.970 0.299   1.00 47.39  ? 250  TYR A CA    1 
ATOM   2445 C C     . TYR C 3 250 ? 67.948  18.182 0.820   1.00 43.72  ? 250  TYR A C     1 
ATOM   2446 O O     . TYR C 3 250 ? 67.230  18.087 1.793   1.00 43.32  ? 250  TYR A O     1 
ATOM   2447 C CB    . TYR C 3 250 ? 70.092  16.925 0.924   1.00 47.47  ? 250  TYR A CB    1 
ATOM   2448 C CG    . TYR C 3 250 ? 70.755  15.592 0.723   1.00 48.47  ? 250  TYR A CG    1 
ATOM   2449 C CD1   . TYR C 3 250 ? 71.438  15.304 -0.459  1.00 50.82  ? 250  TYR A CD1   1 
ATOM   2450 C CD2   . TYR C 3 250 ? 70.668  14.606 1.691   1.00 44.83  ? 250  TYR A CD2   1 
ATOM   2451 C CE1   . TYR C 3 250 ? 72.018  14.068 -0.665  1.00 46.33  ? 250  TYR A CE1   1 
ATOM   2452 C CE2   . TYR C 3 250 ? 71.239  13.369 1.495   1.00 46.44  ? 250  TYR A CE2   1 
ATOM   2453 C CZ    . TYR C 3 250 ? 71.914  13.103 0.320   1.00 45.72  ? 250  TYR A CZ    1 
ATOM   2454 O OH    . TYR C 3 250 ? 72.507  11.881 0.150   1.00 43.62  ? 250  TYR A OH    1 
ATOM   2455 N N     . ALA C 3 251 ? 68.125  19.320 0.170   1.00 42.44  ? 251  ALA A N     1 
ATOM   2456 C CA    . ALA C 3 251 ? 67.454  20.542 0.573   1.00 44.03  ? 251  ALA A CA    1 
ATOM   2457 C C     . ALA C 3 251 ? 65.950  20.288 0.628   1.00 46.02  ? 251  ALA A C     1 
ATOM   2458 O O     . ALA C 3 251 ? 65.262  20.740 1.540   1.00 47.08  ? 251  ALA A O     1 
ATOM   2459 C CB    . ALA C 3 251 ? 67.763  21.664 -0.432  1.00 40.87  ? 251  ALA A CB    1 
ATOM   2460 N N     . GLU C 3 252 ? 65.454  19.549 -0.358  1.00 48.32  ? 252  GLU A N     1 
ATOM   2461 C CA    . GLU C 3 252 ? 64.041  19.251 -0.449  1.00 49.06  ? 252  GLU A CA    1 
ATOM   2462 C C     . GLU C 3 252 ? 63.595  18.208 0.567   1.00 48.35  ? 252  GLU A C     1 
ATOM   2463 O O     . GLU C 3 252 ? 62.471  18.280 1.069   1.00 48.93  ? 252  GLU A O     1 
ATOM   2464 C CB    . GLU C 3 252 ? 63.709  18.829 -1.884  1.00 54.06  ? 252  GLU A CB    1 
ATOM   2465 C CG    . GLU C 3 252 ? 64.037  19.949 -2.878  1.00 63.70  ? 252  GLU A CG    1 
ATOM   2466 C CD    . GLU C 3 252 ? 63.893  19.572 -4.351  1.00 68.69  ? 252  GLU A CD    1 
ATOM   2467 O OE1   . GLU C 3 252 ? 64.643  18.680 -4.822  1.00 70.91  ? 252  GLU A OE1   1 
ATOM   2468 O OE2   . GLU C 3 252 ? 63.036  20.185 -5.039  1.00 71.64  ? 252  GLU A OE2   1 
ATOM   2469 N N     . ALA C 3 253 ? 64.470  17.259 0.894   1.00 43.51  ? 253  ALA A N     1 
ATOM   2470 C CA    . ALA C 3 253 ? 64.114  16.224 1.867   1.00 42.20  ? 253  ALA A CA    1 
ATOM   2471 C C     . ALA C 3 253 ? 64.028  16.808 3.273   1.00 41.36  ? 253  ALA A C     1 
ATOM   2472 O O     . ALA C 3 253 ? 63.099  16.516 4.009   1.00 40.69  ? 253  ALA A O     1 
ATOM   2473 C CB    . ALA C 3 253 ? 65.127  15.078 1.840   1.00 39.50  ? 253  ALA A CB    1 
ATOM   2474 N N     . ILE C 3 254 ? 65.012  17.626 3.634   1.00 41.21  ? 254  ILE A N     1 
ATOM   2475 C CA    . ILE C 3 254 ? 65.064  18.285 4.936   1.00 41.84  ? 254  ILE A CA    1 
ATOM   2476 C C     . ILE C 3 254 ? 63.862  19.219 5.090   1.00 42.04  ? 254  ILE A C     1 
ATOM   2477 O O     . ILE C 3 254 ? 63.277  19.334 6.172   1.00 41.54  ? 254  ILE A O     1 
ATOM   2478 C CB    . ILE C 3 254 ? 66.360  19.108 5.073   1.00 42.30  ? 254  ILE A CB    1 
ATOM   2479 C CG1   . ILE C 3 254 ? 67.577  18.162 5.061   1.00 43.04  ? 254  ILE A CG1   1 
ATOM   2480 C CG2   . ILE C 3 254 ? 66.332  19.916 6.334   1.00 38.47  ? 254  ILE A CG2   1 
ATOM   2481 C CD1   . ILE C 3 254 ? 68.908  18.863 4.833   1.00 36.24  ? 254  ILE A CD1   1 
ATOM   2482 N N     . ALA C 3 255 ? 63.495  19.873 3.992   1.00 41.54  ? 255  ALA A N     1 
ATOM   2483 C CA    . ALA C 3 255 ? 62.366  20.789 3.984   1.00 40.25  ? 255  ALA A CA    1 
ATOM   2484 C C     . ALA C 3 255 ? 61.017  20.093 4.089   1.00 41.67  ? 255  ALA A C     1 
ATOM   2485 O O     . ALA C 3 255 ? 60.172  20.491 4.873   1.00 42.09  ? 255  ALA A O     1 
ATOM   2486 C CB    . ALA C 3 255 ? 62.391  21.638 2.709   1.00 37.66  ? 255  ALA A CB    1 
ATOM   2487 N N     . THR C 3 256 ? 60.830  19.032 3.314   1.00 44.26  ? 256  THR A N     1 
ATOM   2488 C CA    . THR C 3 256 ? 59.546  18.350 3.269   1.00 44.95  ? 256  THR A CA    1 
ATOM   2489 C C     . THR C 3 256 ? 59.323  17.142 4.163   1.00 44.83  ? 256  THR A C     1 
ATOM   2490 O O     . THR C 3 256 ? 58.179  16.745 4.376   1.00 45.36  ? 256  THR A O     1 
ATOM   2491 C CB    . THR C 3 256 ? 59.211  17.939 1.810   1.00 46.74  ? 256  THR A CB    1 
ATOM   2492 O OG1   . THR C 3 256 ? 57.806  17.711 1.694   1.00 53.57  ? 256  THR A OG1   1 
ATOM   2493 C CG2   . THR C 3 256 ? 59.936  16.655 1.423   1.00 47.47  ? 256  THR A CG2   1 
ATOM   2494 N N     . ARG C 3 257 ? 60.386  16.551 4.698   1.00 44.53  ? 257  ARG A N     1 
ATOM   2495 C CA    . ARG C 3 257 ? 60.211  15.378 5.549   1.00 44.55  ? 257  ARG A CA    1 
ATOM   2496 C C     . ARG C 3 257 ? 60.246  15.703 7.026   1.00 47.33  ? 257  ARG A C     1 
ATOM   2497 O O     . ARG C 3 257 ? 60.889  16.675 7.443   1.00 51.45  ? 257  ARG A O     1 
ATOM   2498 C CB    . ARG C 3 257 ? 61.281  14.349 5.257   1.00 44.33  ? 257  ARG A CB    1 
ATOM   2499 C CG    . ARG C 3 257 ? 61.332  13.902 3.823   1.00 46.50  ? 257  ARG A CG    1 
ATOM   2500 C CD    . ARG C 3 257 ? 62.405  12.866 3.654   1.00 48.05  ? 257  ARG A CD    1 
ATOM   2501 N NE    . ARG C 3 257 ? 62.541  12.474 2.269   1.00 50.97  ? 257  ARG A NE    1 
ATOM   2502 C CZ    . ARG C 3 257 ? 63.493  11.667 1.819   1.00 53.62  ? 257  ARG A CZ    1 
ATOM   2503 N NH1   . ARG C 3 257 ? 64.391  11.166 2.666   1.00 50.29  ? 257  ARG A NH1   1 
ATOM   2504 N NH2   . ARG C 3 257 ? 63.551  11.384 0.518   1.00 52.75  ? 257  ARG A NH2   1 
ATOM   2505 N N     . ALA C 3 258 ? 59.564  14.883 7.826   1.00 47.36  ? 258  ALA A N     1 
ATOM   2506 C CA    . ALA C 3 258 ? 59.529  15.095 9.271   1.00 46.05  ? 258  ALA A CA    1 
ATOM   2507 C C     . ALA C 3 258 ? 60.654  14.335 9.981   1.00 44.03  ? 258  ALA A C     1 
ATOM   2508 O O     . ALA C 3 258 ? 60.641  13.114 10.056  1.00 43.79  ? 258  ALA A O     1 
ATOM   2509 C CB    . ALA C 3 258 ? 58.152  14.673 9.834   1.00 46.07  ? 258  ALA A CB    1 
ATOM   2510 N N     . GLY C 3 259 ? 61.629  15.068 10.510  1.00 45.92  ? 259  GLY A N     1 
ATOM   2511 C CA    . GLY C 3 259 ? 62.734  14.435 11.205  1.00 43.13  ? 259  GLY A CA    1 
ATOM   2512 C C     . GLY C 3 259 ? 63.869  13.959 10.314  1.00 43.18  ? 259  GLY A C     1 
ATOM   2513 O O     . GLY C 3 259 ? 64.582  13.011 10.668  1.00 44.53  ? 259  GLY A O     1 
ATOM   2514 N N     . ALA C 3 260 ? 64.040  14.594 9.158   1.00 37.04  ? 260  ALA A N     1 
ATOM   2515 C CA    . ALA C 3 260 ? 65.129  14.230 8.258   1.00 35.73  ? 260  ALA A CA    1 
ATOM   2516 C C     . ALA C 3 260 ? 66.488  14.270 8.974   1.00 36.43  ? 260  ALA A C     1 
ATOM   2517 O O     . ALA C 3 260 ? 67.381  13.474 8.675   1.00 38.84  ? 260  ALA A O     1 
ATOM   2518 C CB    . ALA C 3 260 ? 65.155  15.181 7.053   1.00 29.73  ? 260  ALA A CB    1 
ATOM   2519 N N     . LEU C 3 261 ? 66.636  15.204 9.908   1.00 36.07  ? 261  LEU A N     1 
ATOM   2520 C CA    . LEU C 3 261 ? 67.876  15.401 10.661  1.00 36.89  ? 261  LEU A CA    1 
ATOM   2521 C C     . LEU C 3 261 ? 67.885  14.662 11.986  1.00 39.72  ? 261  LEU A C     1 
ATOM   2522 O O     . LEU C 3 261 ? 68.786  14.853 12.790  1.00 39.29  ? 261  LEU A O     1 
ATOM   2523 C CB    . LEU C 3 261 ? 68.056  16.883 10.954  1.00 38.14  ? 261  LEU A CB    1 
ATOM   2524 C CG    . LEU C 3 261 ? 68.954  17.716 10.069  1.00 38.75  ? 261  LEU A CG    1 
ATOM   2525 C CD1   . LEU C 3 261 ? 68.667  17.456 8.628   1.00 38.30  ? 261  LEU A CD1   1 
ATOM   2526 C CD2   . LEU C 3 261 ? 68.748  19.178 10.434  1.00 38.88  ? 261  LEU A CD2   1 
ATOM   2527 N N     . ALA C 3 262 ? 66.875  13.825 12.185  1.00 43.76  ? 262  ALA A N     1 
ATOM   2528 C CA    . ALA C 3 262 ? 66.665  13.033 13.386  1.00 44.58  ? 262  ALA A CA    1 
ATOM   2529 C C     . ALA C 3 262 ? 67.863  12.754 14.264  1.00 46.76  ? 262  ALA A C     1 
ATOM   2530 O O     . ALA C 3 262 ? 67.932  13.258 15.390  1.00 54.29  ? 262  ALA A O     1 
ATOM   2531 C CB    . ALA C 3 262 ? 65.997  11.744 13.031  1.00 45.61  ? 262  ALA A CB    1 
ATOM   2532 N N     . GLY C 3 263 ? 68.803  11.951 13.798  1.00 42.81  ? 263  GLY A N     1 
ATOM   2533 C CA    . GLY C 3 263 ? 69.946  11.672 14.653  1.00 39.39  ? 263  GLY A CA    1 
ATOM   2534 C C     . GLY C 3 263 ? 71.183  12.499 14.360  1.00 39.25  ? 263  GLY A C     1 
ATOM   2535 O O     . GLY C 3 263 ? 72.304  12.061 14.585  1.00 35.71  ? 263  GLY A O     1 
ATOM   2536 N N     . ILE C 3 264 ? 70.985  13.710 13.864  1.00 40.47  ? 264  ILE A N     1 
ATOM   2537 C CA    . ILE C 3 264 ? 72.106  14.569 13.531  1.00 41.92  ? 264  ILE A CA    1 
ATOM   2538 C C     . ILE C 3 264 ? 71.953  15.847 14.320  1.00 43.76  ? 264  ILE A C     1 
ATOM   2539 O O     . ILE C 3 264 ? 71.438  16.844 13.810  1.00 46.42  ? 264  ILE A O     1 
ATOM   2540 C CB    . ILE C 3 264 ? 72.111  14.885 12.029  1.00 38.44  ? 264  ILE A CB    1 
ATOM   2541 C CG1   . ILE C 3 264 ? 72.132  13.584 11.240  1.00 40.56  ? 264  ILE A CG1   1 
ATOM   2542 C CG2   . ILE C 3 264 ? 73.311  15.706 11.675  1.00 41.27  ? 264  ILE A CG2   1 
ATOM   2543 C CD1   . ILE C 3 264 ? 72.198  13.781 9.718   1.00 43.72  ? 264  ILE A CD1   1 
ATOM   2544 N N     . SER C 3 265 ? 72.399  15.809 15.570  1.00 42.84  ? 265  SER A N     1 
ATOM   2545 C CA    . SER C 3 265 ? 72.295  16.955 16.455  1.00 41.42  ? 265  SER A CA    1 
ATOM   2546 C C     . SER C 3 265 ? 73.470  17.923 16.317  1.00 41.27  ? 265  SER A C     1 
ATOM   2547 O O     . SER C 3 265 ? 74.516  17.585 15.782  1.00 40.79  ? 265  SER A O     1 
ATOM   2548 C CB    . SER C 3 265 ? 72.193  16.462 17.901  1.00 44.89  ? 265  SER A CB    1 
ATOM   2549 O OG    . SER C 3 265 ? 71.146  15.505 18.057  1.00 44.18  ? 265  SER A OG    1 
ATOM   2550 N N     . PRO C 3 266 ? 73.302  19.161 16.794  1.00 41.89  ? 266  PRO A N     1 
ATOM   2551 C CA    . PRO C 3 266 ? 74.389  20.139 16.698  1.00 40.17  ? 266  PRO A CA    1 
ATOM   2552 C C     . PRO C 3 266 ? 75.581  19.626 17.493  1.00 38.51  ? 266  PRO A C     1 
ATOM   2553 O O     . PRO C 3 266 ? 75.422  18.768 18.349  1.00 40.70  ? 266  PRO A O     1 
ATOM   2554 C CB    . PRO C 3 266 ? 73.778  21.387 17.321  1.00 41.35  ? 266  PRO A CB    1 
ATOM   2555 C CG    . PRO C 3 266 ? 72.304  21.238 16.979  1.00 39.78  ? 266  PRO A CG    1 
ATOM   2556 C CD    . PRO C 3 266 ? 72.065  19.791 17.290  1.00 38.32  ? 266  PRO A CD    1 
ATOM   2557 N N     . MET C 3 267 ? 76.765  20.153 17.224  1.00 38.75  ? 267  MET A N     1 
ATOM   2558 C CA    . MET C 3 267 ? 77.948  19.712 17.942  1.00 39.59  ? 267  MET A CA    1 
ATOM   2559 C C     . MET C 3 267 ? 77.861  20.058 19.432  1.00 36.70  ? 267  MET A C     1 
ATOM   2560 O O     . MET C 3 267 ? 78.336  19.311 20.278  1.00 37.81  ? 267  MET A O     1 
ATOM   2561 C CB    . MET C 3 267 ? 79.202  20.346 17.338  1.00 44.48  ? 267  MET A CB    1 
ATOM   2562 C CG    . MET C 3 267 ? 80.465  19.469 17.466  1.00 53.59  ? 267  MET A CG    1 
ATOM   2563 S SD    . MET C 3 267 ? 80.363  17.937 16.428  1.00 60.05  ? 267  MET A SD    1 
ATOM   2564 C CE    . MET C 3 267 ? 79.779  18.636 14.850  1.00 58.96  ? 267  MET A CE    1 
ATOM   2565 N N     . PHE C 3 268 ? 77.269  21.198 19.754  1.00 34.79  ? 268  PHE A N     1 
ATOM   2566 C CA    . PHE C 3 268 ? 77.136  21.600 21.142  1.00 35.35  ? 268  PHE A CA    1 
ATOM   2567 C C     . PHE C 3 268 ? 75.664  21.545 21.536  1.00 33.17  ? 268  PHE A C     1 
ATOM   2568 O O     . PHE C 3 268 ? 74.844  22.236 20.949  1.00 31.94  ? 268  PHE A O     1 
ATOM   2569 C CB    . PHE C 3 268 ? 77.706  23.016 21.318  1.00 37.54  ? 268  PHE A CB    1 
ATOM   2570 C CG    . PHE C 3 268 ? 79.202  23.087 21.169  1.00 36.43  ? 268  PHE A CG    1 
ATOM   2571 C CD1   . PHE C 3 268 ? 80.039  22.655 22.201  1.00 38.67  ? 268  PHE A CD1   1 
ATOM   2572 C CD2   . PHE C 3 268 ? 79.780  23.584 20.009  1.00 38.55  ? 268  PHE A CD2   1 
ATOM   2573 C CE1   . PHE C 3 268 ? 81.444  22.722 22.080  1.00 38.25  ? 268  PHE A CE1   1 
ATOM   2574 C CE2   . PHE C 3 268 ? 81.191  23.656 19.877  1.00 40.23  ? 268  PHE A CE2   1 
ATOM   2575 C CZ    . PHE C 3 268 ? 82.018  23.224 20.917  1.00 35.21  ? 268  PHE A CZ    1 
ATOM   2576 N N     . GLN C 3 269 ? 75.332  20.729 22.532  1.00 34.01  ? 269  GLN A N     1 
ATOM   2577 C CA    . GLN C 3 269 ? 73.940  20.552 22.973  1.00 31.10  ? 269  GLN A CA    1 
ATOM   2578 C C     . GLN C 3 269 ? 73.744  20.953 24.422  1.00 31.60  ? 269  GLN A C     1 
ATOM   2579 O O     . GLN C 3 269 ? 74.699  21.229 25.136  1.00 32.37  ? 269  GLN A O     1 
ATOM   2580 C CB    . GLN C 3 269 ? 73.498  19.083 22.815  1.00 29.26  ? 269  GLN A CB    1 
ATOM   2581 C CG    . GLN C 3 269 ? 73.547  18.547 21.382  1.00 30.54  ? 269  GLN A CG    1 
ATOM   2582 C CD    . GLN C 3 269 ? 72.996  17.119 21.242  1.00 35.06  ? 269  GLN A CD    1 
ATOM   2583 O OE1   . GLN C 3 269 ? 73.734  16.135 21.363  1.00 38.55  ? 269  GLN A OE1   1 
ATOM   2584 N NE2   . GLN C 3 269 ? 71.696  17.008 20.995  1.00 34.33  ? 269  GLN A NE2   1 
ATOM   2585 N N     . PRO C 3 270 ? 72.483  21.014 24.866  1.00 32.00  ? 270  PRO A N     1 
ATOM   2586 C CA    . PRO C 3 270 ? 72.146  21.375 26.234  1.00 30.72  ? 270  PRO A CA    1 
ATOM   2587 C C     . PRO C 3 270 ? 72.520  20.238 27.169  1.00 33.26  ? 270  PRO A C     1 
ATOM   2588 O O     . PRO C 3 270 ? 72.713  19.097 26.742  1.00 35.84  ? 270  PRO A O     1 
ATOM   2589 C CB    . PRO C 3 270 ? 70.640  21.553 26.171  1.00 30.70  ? 270  PRO A CB    1 
ATOM   2590 C CG    . PRO C 3 270 ? 70.395  21.952 24.784  1.00 27.18  ? 270  PRO A CG    1 
ATOM   2591 C CD    . PRO C 3 270 ? 71.270  21.026 24.036  1.00 31.33  ? 270  PRO A CD    1 
ATOM   2592 N N     . CYS C 3 271 ? 72.634  20.554 28.447  1.00 33.37  ? 271  CYS A N     1 
ATOM   2593 C CA    . CYS C 3 271 ? 72.938  19.548 29.438  1.00 33.28  ? 271  CYS A CA    1 
ATOM   2594 C C     . CYS C 3 271 ? 71.609  19.124 30.044  1.00 33.62  ? 271  CYS A C     1 
ATOM   2595 O O     . CYS C 3 271 ? 70.642  19.901 30.045  1.00 32.74  ? 271  CYS A O     1 
ATOM   2596 C CB    . CYS C 3 271 ? 73.848  20.124 30.508  1.00 36.47  ? 271  CYS A CB    1 
ATOM   2597 S SG    . CYS C 3 271 ? 75.456  20.629 29.860  1.00 41.37  ? 271  CYS A SG    1 
ATOM   2598 N N     . VAL C 3 272 ? 71.559  17.880 30.515  1.00 34.35  ? 272  VAL A N     1 
ATOM   2599 C CA    . VAL C 3 272 ? 70.359  17.309 31.140  1.00 33.51  ? 272  VAL A CA    1 
ATOM   2600 C C     . VAL C 3 272 ? 70.543  17.368 32.670  1.00 33.41  ? 272  VAL A C     1 
ATOM   2601 O O     . VAL C 3 272 ? 69.679  16.941 33.443  1.00 32.76  ? 272  VAL A O     1 
ATOM   2602 C CB    . VAL C 3 272 ? 70.135  15.822 30.659  1.00 37.69  ? 272  VAL A CB    1 
ATOM   2603 C CG1   . VAL C 3 272 ? 69.044  15.178 31.469  1.00 42.85  ? 272  VAL A CG1   1 
ATOM   2604 C CG2   . VAL C 3 272 ? 69.726  15.778 29.167  1.00 28.54  ? 272  VAL A CG2   1 
ATOM   2605 N N     . VAL C 3 273 ? 71.692  17.890 33.094  1.00 33.40  ? 273  VAL A N     1 
ATOM   2606 C CA    . VAL C 3 273 ? 72.005  18.084 34.512  1.00 34.29  ? 273  VAL A CA    1 
ATOM   2607 C C     . VAL C 3 273 ? 72.713  19.442 34.633  1.00 35.58  ? 273  VAL A C     1 
ATOM   2608 O O     . VAL C 3 273 ? 73.259  19.946 33.647  1.00 36.79  ? 273  VAL A O     1 
ATOM   2609 C CB    . VAL C 3 273 ? 72.961  17.008 35.066  1.00 34.76  ? 273  VAL A CB    1 
ATOM   2610 C CG1   . VAL C 3 273 ? 72.484  15.631 34.654  1.00 38.01  ? 273  VAL A CG1   1 
ATOM   2611 C CG2   . VAL C 3 273 ? 74.389  17.284 34.617  1.00 33.76  ? 273  VAL A CG2   1 
ATOM   2612 N N     . PRO C 3 274 ? 72.706  20.062 35.825  1.00 36.12  ? 274  PRO A N     1 
ATOM   2613 C CA    . PRO C 3 274 ? 73.389  21.364 35.954  1.00 33.81  ? 274  PRO A CA    1 
ATOM   2614 C C     . PRO C 3 274 ? 74.832  21.230 35.450  1.00 33.93  ? 274  PRO A C     1 
ATOM   2615 O O     . PRO C 3 274 ? 75.510  20.260 35.802  1.00 34.46  ? 274  PRO A O     1 
ATOM   2616 C CB    . PRO C 3 274 ? 73.308  21.642 37.456  1.00 33.18  ? 274  PRO A CB    1 
ATOM   2617 C CG    . PRO C 3 274 ? 72.006  21.042 37.841  1.00 35.59  ? 274  PRO A CG    1 
ATOM   2618 C CD    . PRO C 3 274 ? 71.995  19.713 37.068  1.00 37.66  ? 274  PRO A CD    1 
ATOM   2619 N N     . PRO C 3 275 ? 75.309  22.198 34.630  1.00 32.22  ? 275  PRO A N     1 
ATOM   2620 C CA    . PRO C 3 275 ? 76.654  22.238 34.042  1.00 31.17  ? 275  PRO A CA    1 
ATOM   2621 C C     . PRO C 3 275 ? 77.714  22.347 35.094  1.00 29.34  ? 275  PRO A C     1 
ATOM   2622 O O     . PRO C 3 275 ? 77.443  22.739 36.205  1.00 32.86  ? 275  PRO A O     1 
ATOM   2623 C CB    . PRO C 3 275 ? 76.627  23.501 33.150  1.00 33.53  ? 275  PRO A CB    1 
ATOM   2624 C CG    . PRO C 3 275 ? 75.180  23.727 32.881  1.00 28.13  ? 275  PRO A CG    1 
ATOM   2625 C CD    . PRO C 3 275 ? 74.568  23.413 34.242  1.00 32.61  ? 275  PRO A CD    1 
ATOM   2626 N N     . LYS C 3 276 ? 78.932  21.992 34.735  1.00 32.17  ? 276  LYS A N     1 
ATOM   2627 C CA    . LYS C 3 276 ? 80.038  22.085 35.665  1.00 35.73  ? 276  LYS A CA    1 
ATOM   2628 C C     . LYS C 3 276 ? 80.368  23.574 35.823  1.00 37.21  ? 276  LYS A C     1 
ATOM   2629 O O     . LYS C 3 276 ? 80.458  24.301 34.837  1.00 38.80  ? 276  LYS A O     1 
ATOM   2630 C CB    . LYS C 3 276 ? 81.257  21.337 35.108  1.00 35.84  ? 276  LYS A CB    1 
ATOM   2631 C CG    . LYS C 3 276 ? 82.417  21.258 36.090  1.00 36.76  ? 276  LYS A CG    1 
ATOM   2632 C CD    . LYS C 3 276 ? 83.699  20.864 35.403  1.00 36.11  ? 276  LYS A CD    1 
ATOM   2633 C CE    . LYS C 3 276 ? 83.578  19.526 34.723  1.00 36.70  ? 276  LYS A CE    1 
ATOM   2634 N NZ    . LYS C 3 276 ? 84.826  19.261 33.969  1.00 38.13  ? 276  LYS A NZ    1 
ATOM   2635 N N     . PRO C 3 277 ? 80.567  24.036 37.061  1.00 38.55  ? 277  PRO A N     1 
ATOM   2636 C CA    . PRO C 3 277 ? 80.886  25.434 37.361  1.00 38.18  ? 277  PRO A CA    1 
ATOM   2637 C C     . PRO C 3 277 ? 82.267  25.818 36.895  1.00 38.22  ? 277  PRO A C     1 
ATOM   2638 O O     . PRO C 3 277 ? 83.177  24.998 36.912  1.00 41.17  ? 277  PRO A O     1 
ATOM   2639 C CB    . PRO C 3 277 ? 80.799  25.506 38.883  1.00 37.57  ? 277  PRO A CB    1 
ATOM   2640 C CG    . PRO C 3 277 ? 80.008  24.285 39.270  1.00 39.34  ? 277  PRO A CG    1 
ATOM   2641 C CD    . PRO C 3 277 ? 80.489  23.249 38.300  1.00 38.96  ? 277  PRO A CD    1 
ATOM   2642 N N     . TRP C 3 278 ? 82.421  27.070 36.485  1.00 39.51  ? 278  TRP A N     1 
ATOM   2643 C CA    . TRP C 3 278 ? 83.720  27.550 36.049  1.00 41.90  ? 278  TRP A CA    1 
ATOM   2644 C C     . TRP C 3 278 ? 84.531  27.945 37.288  1.00 43.60  ? 278  TRP A C     1 
ATOM   2645 O O     . TRP C 3 278 ? 84.061  28.691 38.140  1.00 43.33  ? 278  TRP A O     1 
ATOM   2646 C CB    . TRP C 3 278 ? 83.582  28.766 35.121  1.00 41.63  ? 278  TRP A CB    1 
ATOM   2647 C CG    . TRP C 3 278 ? 83.025  28.456 33.769  1.00 41.04  ? 278  TRP A CG    1 
ATOM   2648 C CD1   . TRP C 3 278 ? 81.703  28.496 33.381  1.00 39.68  ? 278  TRP A CD1   1 
ATOM   2649 C CD2   . TRP C 3 278 ? 83.769  28.046 32.623  1.00 39.11  ? 278  TRP A CD2   1 
ATOM   2650 N NE1   . TRP C 3 278 ? 81.593  28.138 32.049  1.00 40.44  ? 278  TRP A NE1   1 
ATOM   2651 C CE2   . TRP C 3 278 ? 82.845  27.855 31.566  1.00 40.54  ? 278  TRP A CE2   1 
ATOM   2652 C CE3   . TRP C 3 278 ? 85.127  27.821 32.383  1.00 40.86  ? 278  TRP A CE3   1 
ATOM   2653 C CZ2   . TRP C 3 278 ? 83.246  27.447 30.288  1.00 42.67  ? 278  TRP A CZ2   1 
ATOM   2654 C CZ3   . TRP C 3 278 ? 85.526  27.419 31.118  1.00 41.74  ? 278  TRP A CZ3   1 
ATOM   2655 C CH2   . TRP C 3 278 ? 84.590  27.233 30.081  1.00 38.44  ? 278  TRP A CH2   1 
ATOM   2656 N N     . THR C 3 279 ? 85.758  27.451 37.354  1.00 42.44  ? 279  THR A N     1 
ATOM   2657 C CA    . THR C 3 279 ? 86.658  27.708 38.455  1.00 43.10  ? 279  THR A CA    1 
ATOM   2658 C C     . THR C 3 279 ? 87.931  28.297 37.898  1.00 44.30  ? 279  THR A C     1 
ATOM   2659 O O     . THR C 3 279 ? 88.708  28.928 38.621  1.00 47.13  ? 279  THR A O     1 
ATOM   2660 C CB    . THR C 3 279 ? 87.005  26.394 39.181  1.00 45.31  ? 279  THR A CB    1 
ATOM   2661 O OG1   . THR C 3 279 ? 85.881  25.975 39.965  1.00 47.19  ? 279  THR A OG1   1 
ATOM   2662 C CG2   . THR C 3 279 ? 88.216  26.572 40.082  1.00 51.66  ? 279  THR A CG2   1 
ATOM   2663 N N     . GLY C 3 280 ? 88.146  28.073 36.606  1.00 43.45  ? 280  GLY A N     1 
ATOM   2664 C CA    . GLY C 3 280 ? 89.334  28.584 35.950  1.00 42.37  ? 280  GLY A CA    1 
ATOM   2665 C C     . GLY C 3 280 ? 89.175  28.869 34.462  1.00 43.61  ? 280  GLY A C     1 
ATOM   2666 O O     . GLY C 3 280 ? 88.072  28.894 33.913  1.00 44.62  ? 280  GLY A O     1 
ATOM   2667 N N     . ILE C 3 281 ? 90.316  29.063 33.818  1.00 42.14  ? 281  ILE A N     1 
ATOM   2668 C CA    . ILE C 3 281 ? 90.438  29.384 32.412  1.00 41.41  ? 281  ILE A CA    1 
ATOM   2669 C C     . ILE C 3 281 ? 89.737  28.432 31.448  1.00 39.22  ? 281  ILE A C     1 
ATOM   2670 O O     . ILE C 3 281 ? 89.246  28.878 30.410  1.00 37.41  ? 281  ILE A O     1 
ATOM   2671 C CB    . ILE C 3 281 ? 91.942  29.472 32.063  1.00 46.62  ? 281  ILE A CB    1 
ATOM   2672 C CG1   . ILE C 3 281 ? 92.203  30.528 31.007  1.00 49.01  ? 281  ILE A CG1   1 
ATOM   2673 C CG2   . ILE C 3 281 ? 92.430  28.155 31.551  1.00 49.21  ? 281  ILE A CG2   1 
ATOM   2674 C CD1   . ILE C 3 281 ? 93.667  30.568 30.595  1.00 48.22  ? 281  ILE A CD1   1 
ATOM   2675 N N     . THR C 3 282 ? 89.689  27.134 31.775  1.00 38.90  ? 282  THR A N     1 
ATOM   2676 C CA    . THR C 3 282 ? 89.047  26.125 30.912  1.00 37.73  ? 282  THR A CA    1 
ATOM   2677 C C     . THR C 3 282 ? 88.313  24.975 31.639  1.00 36.94  ? 282  THR A C     1 
ATOM   2678 O O     . THR C 3 282 ? 88.284  24.898 32.853  1.00 38.64  ? 282  THR A O     1 
ATOM   2679 C CB    . THR C 3 282 ? 90.065  25.426 29.994  1.00 40.33  ? 282  THR A CB    1 
ATOM   2680 O OG1   . THR C 3 282 ? 90.806  24.463 30.757  1.00 36.89  ? 282  THR A OG1   1 
ATOM   2681 C CG2   . THR C 3 282 ? 91.032  26.436 29.360  1.00 41.17  ? 282  THR A CG2   1 
ATOM   2682 N N     . GLY C 3 283 ? 87.704  24.087 30.868  1.00 37.32  ? 283  GLY A N     1 
ATOM   2683 C CA    . GLY C 3 283 ? 87.022  22.935 31.437  1.00 37.83  ? 283  GLY A CA    1 
ATOM   2684 C C     . GLY C 3 283 ? 85.692  23.120 32.132  1.00 36.01  ? 283  GLY A C     1 
ATOM   2685 O O     . GLY C 3 283 ? 85.183  22.198 32.764  1.00 37.47  ? 283  GLY A O     1 
ATOM   2686 N N     . GLY C 3 284 ? 85.105  24.297 32.004  1.00 35.41  ? 284  GLY A N     1 
ATOM   2687 C CA    . GLY C 3 284 ? 83.834  24.528 32.647  1.00 35.00  ? 284  GLY A CA    1 
ATOM   2688 C C     . GLY C 3 284 ? 82.687  24.159 31.738  1.00 31.83  ? 284  GLY A C     1 
ATOM   2689 O O     . GLY C 3 284 ? 82.893  23.871 30.569  1.00 31.70  ? 284  GLY A O     1 
ATOM   2690 N N     . GLY C 3 285 ? 81.475  24.141 32.288  1.00 32.34  ? 285  GLY A N     1 
ATOM   2691 C CA    . GLY C 3 285 ? 80.323  23.824 31.466  1.00 33.54  ? 285  GLY A CA    1 
ATOM   2692 C C     . GLY C 3 285 ? 80.024  22.358 31.264  1.00 34.77  ? 285  GLY A C     1 
ATOM   2693 O O     . GLY C 3 285 ? 79.138  21.824 31.919  1.00 37.47  ? 285  GLY A O     1 
ATOM   2694 N N     . TYR C 3 286 ? 80.750  21.703 30.362  1.00 37.32  ? 286  TYR A N     1 
ATOM   2695 C CA    . TYR C 3 286 ? 80.505  20.287 30.082  1.00 38.36  ? 286  TYR A CA    1 
ATOM   2696 C C     . TYR C 3 286 ? 81.200  19.355 31.043  1.00 38.70  ? 286  TYR A C     1 
ATOM   2697 O O     . TYR C 3 286 ? 82.218  19.699 31.622  1.00 41.17  ? 286  TYR A O     1 
ATOM   2698 C CB    . TYR C 3 286 ? 80.883  19.954 28.639  1.00 36.27  ? 286  TYR A CB    1 
ATOM   2699 C CG    . TYR C 3 286 ? 79.888  20.513 27.619  1.00 34.08  ? 286  TYR A CG    1 
ATOM   2700 C CD1   . TYR C 3 286 ? 78.584  20.022 27.554  1.00 30.94  ? 286  TYR A CD1   1 
ATOM   2701 C CD2   . TYR C 3 286 ? 80.247  21.551 26.751  1.00 30.11  ? 286  TYR A CD2   1 
ATOM   2702 C CE1   . TYR C 3 286 ? 77.654  20.550 26.649  1.00 31.18  ? 286  TYR A CE1   1 
ATOM   2703 C CE2   . TYR C 3 286 ? 79.331  22.086 25.852  1.00 30.30  ? 286  TYR A CE2   1 
ATOM   2704 C CZ    . TYR C 3 286 ? 78.032  21.581 25.804  1.00 29.84  ? 286  TYR A CZ    1 
ATOM   2705 O OH    . TYR C 3 286 ? 77.112  22.100 24.925  1.00 24.75  ? 286  TYR A OH    1 
ATOM   2706 N N     . TRP C 3 287 ? 80.653  18.154 31.200  1.00 40.20  ? 287  TRP A N     1 
ATOM   2707 C CA    . TRP C 3 287 ? 81.217  17.205 32.149  1.00 38.34  ? 287  TRP A CA    1 
ATOM   2708 C C     . TRP C 3 287 ? 82.211  16.168 31.676  1.00 36.49  ? 287  TRP A C     1 
ATOM   2709 O O     . TRP C 3 287 ? 83.135  15.852 32.402  1.00 41.06  ? 287  TRP A O     1 
ATOM   2710 C CB    . TRP C 3 287 ? 80.089  16.502 32.895  1.00 36.95  ? 287  TRP A CB    1 
ATOM   2711 C CG    . TRP C 3 287 ? 79.441  17.379 33.914  1.00 37.79  ? 287  TRP A CG    1 
ATOM   2712 C CD1   . TRP C 3 287 ? 78.293  18.105 33.772  1.00 37.40  ? 287  TRP A CD1   1 
ATOM   2713 C CD2   . TRP C 3 287 ? 79.916  17.631 35.239  1.00 38.01  ? 287  TRP A CD2   1 
ATOM   2714 N NE1   . TRP C 3 287 ? 78.022  18.793 34.929  1.00 39.38  ? 287  TRP A NE1   1 
ATOM   2715 C CE2   . TRP C 3 287 ? 79.004  18.521 35.846  1.00 37.19  ? 287  TRP A CE2   1 
ATOM   2716 C CE3   . TRP C 3 287 ? 81.026  17.189 35.974  1.00 38.01  ? 287  TRP A CE3   1 
ATOM   2717 C CZ2   . TRP C 3 287 ? 79.166  18.980 37.153  1.00 39.39  ? 287  TRP A CZ2   1 
ATOM   2718 C CZ3   . TRP C 3 287 ? 81.187  17.647 37.273  1.00 40.32  ? 287  TRP A CZ3   1 
ATOM   2719 C CH2   . TRP C 3 287 ? 80.260  18.536 37.850  1.00 38.20  ? 287  TRP A CH2   1 
ATOM   2720 N N     . ALA C 3 288 ? 82.040  15.650 30.466  1.00 34.10  ? 288  ALA A N     1 
ATOM   2721 C CA    . ALA C 3 288 ? 82.913  14.588 29.935  1.00 32.12  ? 288  ALA A CA    1 
ATOM   2722 C C     . ALA C 3 288 ? 84.404  14.933 29.918  1.00 32.74  ? 288  ALA A C     1 
ATOM   2723 O O     . ALA C 3 288 ? 84.776  16.104 29.854  1.00 33.16  ? 288  ALA A O     1 
ATOM   2724 C CB    . ALA C 3 288 ? 82.448  14.183 28.500  1.00 23.74  ? 288  ALA A CB    1 
ATOM   2725 N N     . ASN C 3 289 ? 85.255  13.915 29.994  1.00 31.57  ? 289  ASN A N     1 
ATOM   2726 C CA    . ASN C 3 289 ? 86.701  14.144 29.936  1.00 32.52  ? 289  ASN A CA    1 
ATOM   2727 C C     . ASN C 3 289 ? 87.176  13.632 28.596  1.00 32.83  ? 289  ASN A C     1 
ATOM   2728 O O     . ASN C 3 289 ? 88.291  13.886 28.171  1.00 34.66  ? 289  ASN A O     1 
ATOM   2729 C CB    . ASN C 3 289 ? 87.421  13.466 31.095  1.00 28.71  ? 289  ASN A CB    1 
ATOM   2730 C CG    . ASN C 3 289 ? 87.542  14.382 32.309  1.00 34.32  ? 289  ASN A CG    1 
ATOM   2731 O OD1   . ASN C 3 289 ? 87.728  13.924 33.450  1.00 34.08  ? 289  ASN A OD1   1 
ATOM   2732 N ND2   . ASN C 3 289 ? 87.450  15.695 32.070  1.00 31.54  ? 289  ASN A ND2   1 
ATOM   2733 N N     . GLY C 3 290 ? 86.279  12.932 27.915  1.00 35.24  ? 290  GLY A N     1 
ATOM   2734 C CA    . GLY C 3 290 ? 86.580  12.407 26.597  1.00 36.44  ? 290  GLY A CA    1 
ATOM   2735 C C     . GLY C 3 290 ? 86.088  13.389 25.536  1.00 37.53  ? 290  GLY A C     1 
ATOM   2736 O O     . GLY C 3 290 ? 85.493  12.999 24.531  1.00 39.74  ? 290  GLY A O     1 
ATOM   2737 N N     . ARG C 3 291 ? 86.358  14.666 25.768  1.00 35.72  ? 291  ARG A N     1 
ATOM   2738 C CA    . ARG C 3 291 ? 85.946  15.737 24.866  1.00 38.66  ? 291  ARG A CA    1 
ATOM   2739 C C     . ARG C 3 291 ? 86.983  16.852 24.966  1.00 37.35  ? 291  ARG A C     1 
ATOM   2740 O O     . ARG C 3 291 ? 87.820  16.852 25.873  1.00 42.16  ? 291  ARG A O     1 
ATOM   2741 C CB    . ARG C 3 291 ? 84.595  16.330 25.312  1.00 35.97  ? 291  ARG A CB    1 
ATOM   2742 C CG    . ARG C 3 291 ? 84.718  17.121 26.642  1.00 41.44  ? 291  ARG A CG    1 
ATOM   2743 C CD    . ARG C 3 291 ? 83.928  18.446 26.655  1.00 45.02  ? 291  ARG A CD    1 
ATOM   2744 N NE    . ARG C 3 291 ? 82.513  18.199 26.378  1.00 49.45  ? 291  ARG A NE    1 
ATOM   2745 C CZ    . ARG C 3 291 ? 81.845  18.666 25.322  1.00 48.85  ? 291  ARG A CZ    1 
ATOM   2746 N NH1   . ARG C 3 291 ? 82.452  19.434 24.418  1.00 42.30  ? 291  ARG A NH1   1 
ATOM   2747 N NH2   . ARG C 3 291 ? 80.566  18.333 25.162  1.00 50.34  ? 291  ARG A NH2   1 
ATOM   2748 N N     . ARG C 3 292 ? 86.916  17.803 24.046  1.00 35.01  ? 292  ARG A N     1 
ATOM   2749 C CA    . ARG C 3 292 ? 87.798  18.951 24.085  1.00 37.80  ? 292  ARG A CA    1 
ATOM   2750 C C     . ARG C 3 292 ? 87.125  19.953 25.040  1.00 37.52  ? 292  ARG A C     1 
ATOM   2751 O O     . ARG C 3 292 ? 85.998  20.379 24.803  1.00 39.87  ? 292  ARG A O     1 
ATOM   2752 C CB    . ARG C 3 292 ? 87.916  19.549 22.691  1.00 37.14  ? 292  ARG A CB    1 
ATOM   2753 C CG    . ARG C 3 292 ? 88.552  20.932 22.637  1.00 33.90  ? 292  ARG A CG    1 
ATOM   2754 C CD    . ARG C 3 292 ? 89.710  20.915 21.641  1.00 39.15  ? 292  ARG A CD    1 
ATOM   2755 N NE    . ARG C 3 292 ? 90.978  20.771 22.327  1.00 42.37  ? 292  ARG A NE    1 
ATOM   2756 C CZ    . ARG C 3 292 ? 92.142  20.551 21.738  1.00 41.89  ? 292  ARG A CZ    1 
ATOM   2757 N NH1   . ARG C 3 292 ? 92.231  20.439 20.421  1.00 39.86  ? 292  ARG A NH1   1 
ATOM   2758 N NH2   . ARG C 3 292 ? 93.226  20.442 22.487  1.00 48.27  ? 292  ARG A NH2   1 
ATOM   2759 N N     . PRO C 3 293 ? 87.807  20.337 26.133  1.00 37.11  ? 293  PRO A N     1 
ATOM   2760 C CA    . PRO C 3 293 ? 87.212  21.282 27.085  1.00 34.66  ? 293  PRO A CA    1 
ATOM   2761 C C     . PRO C 3 293 ? 86.977  22.649 26.474  1.00 36.51  ? 293  PRO A C     1 
ATOM   2762 O O     . PRO C 3 293 ? 87.622  23.028 25.498  1.00 40.87  ? 293  PRO A O     1 
ATOM   2763 C CB    . PRO C 3 293 ? 88.241  21.317 28.214  1.00 34.06  ? 293  PRO A CB    1 
ATOM   2764 C CG    . PRO C 3 293 ? 89.543  21.175 27.454  1.00 32.54  ? 293  PRO A CG    1 
ATOM   2765 C CD    . PRO C 3 293 ? 89.207  20.032 26.500  1.00 34.88  ? 293  PRO A CD    1 
ATOM   2766 N N     . LEU C 3 294 ? 86.060  23.402 27.057  1.00 35.59  ? 294  LEU A N     1 
ATOM   2767 C CA    . LEU C 3 294 ? 85.751  24.735 26.560  1.00 35.46  ? 294  LEU A CA    1 
ATOM   2768 C C     . LEU C 3 294 ? 86.679  25.774 27.174  1.00 35.65  ? 294  LEU A C     1 
ATOM   2769 O O     . LEU C 3 294 ? 87.307  25.530 28.193  1.00 37.86  ? 294  LEU A O     1 
ATOM   2770 C CB    . LEU C 3 294 ? 84.306  25.106 26.909  1.00 34.46  ? 294  LEU A CB    1 
ATOM   2771 C CG    . LEU C 3 294 ? 83.203  24.163 26.451  1.00 29.73  ? 294  LEU A CG    1 
ATOM   2772 C CD1   . LEU C 3 294 ? 81.891  24.579 27.065  1.00 31.95  ? 294  LEU A CD1   1 
ATOM   2773 C CD2   . LEU C 3 294 ? 83.127  24.173 24.952  1.00 31.03  ? 294  LEU A CD2   1 
ATOM   2774 N N     . ALA C 3 295 ? 86.764  26.929 26.538  1.00 34.83  ? 295  ALA A N     1 
ATOM   2775 C CA    . ALA C 3 295 ? 87.570  28.032 27.048  1.00 36.40  ? 295  ALA A CA    1 
ATOM   2776 C C     . ALA C 3 295 ? 86.603  29.029 27.699  1.00 35.87  ? 295  ALA A C     1 
ATOM   2777 O O     . ALA C 3 295 ? 85.508  29.270 27.172  1.00 34.57  ? 295  ALA A O     1 
ATOM   2778 C CB    . ALA C 3 295 ? 88.329  28.715 25.903  1.00 36.18  ? 295  ALA A CB    1 
ATOM   2779 N N     . LEU C 3 296 ? 86.999  29.591 28.839  1.00 34.22  ? 296  LEU A N     1 
ATOM   2780 C CA    . LEU C 3 296 ? 86.172  30.574 29.539  1.00 33.56  ? 296  LEU A CA    1 
ATOM   2781 C C     . LEU C 3 296 ? 85.992  31.828 28.693  1.00 36.28  ? 296  LEU A C     1 
ATOM   2782 O O     . LEU C 3 296 ? 84.963  32.504 28.792  1.00 38.19  ? 296  LEU A O     1 
ATOM   2783 C CB    . LEU C 3 296 ? 86.822  30.982 30.853  1.00 30.38  ? 296  LEU A CB    1 
ATOM   2784 C CG    . LEU C 3 296 ? 86.139  32.143 31.577  1.00 27.11  ? 296  LEU A CG    1 
ATOM   2785 C CD1   . LEU C 3 296 ? 84.804  31.717 32.133  1.00 28.42  ? 296  LEU A CD1   1 
ATOM   2786 C CD2   . LEU C 3 296 ? 87.042  32.600 32.688  1.00 30.66  ? 296  LEU A CD2   1 
ATOM   2787 N N     . VAL C 3 297 ? 87.007  32.135 27.879  1.00 37.49  ? 297  VAL A N     1 
ATOM   2788 C CA    . VAL C 3 297 ? 87.008  33.308 26.997  1.00 36.54  ? 297  VAL A CA    1 
ATOM   2789 C C     . VAL C 3 297 ? 87.442  32.854 25.604  1.00 40.01  ? 297  VAL A C     1 
ATOM   2790 O O     . VAL C 3 297 ? 88.431  32.138 25.462  1.00 44.35  ? 297  VAL A O     1 
ATOM   2791 C CB    . VAL C 3 297 ? 88.015  34.403 27.501  1.00 35.22  ? 297  VAL A CB    1 
ATOM   2792 C CG1   . VAL C 3 297 ? 87.986  35.646 26.618  1.00 29.38  ? 297  VAL A CG1   1 
ATOM   2793 C CG2   . VAL C 3 297 ? 87.676  34.787 28.918  1.00 33.59  ? 297  VAL A CG2   1 
ATOM   2794 N N     . ARG C 3 298 ? 86.693  33.257 24.582  1.00 42.95  ? 298  ARG A N     1 
ATOM   2795 C CA    . ARG C 3 298 ? 87.024  32.910 23.200  1.00 45.29  ? 298  ARG A CA    1 
ATOM   2796 C C     . ARG C 3 298 ? 88.007  33.941 22.681  1.00 44.62  ? 298  ARG A C     1 
ATOM   2797 O O     . ARG C 3 298 ? 87.641  35.071 22.387  1.00 44.22  ? 298  ARG A O     1 
ATOM   2798 C CB    . ARG C 3 298 ? 85.776  32.942 22.318  1.00 49.45  ? 298  ARG A CB    1 
ATOM   2799 C CG    . ARG C 3 298 ? 84.669  31.976 22.723  1.00 52.90  ? 298  ARG A CG    1 
ATOM   2800 C CD    . ARG C 3 298 ? 83.476  32.207 21.823  1.00 58.71  ? 298  ARG A CD    1 
ATOM   2801 N NE    . ARG C 3 298 ? 82.337  31.411 22.233  1.00 63.29  ? 298  ARG A NE    1 
ATOM   2802 C CZ    . ARG C 3 298 ? 81.120  31.549 21.732  1.00 66.95  ? 298  ARG A CZ    1 
ATOM   2803 N NH1   . ARG C 3 298 ? 80.894  32.462 20.791  1.00 70.07  ? 298  ARG A NH1   1 
ATOM   2804 N NH2   . ARG C 3 298 ? 80.130  30.787 22.184  1.00 66.14  ? 298  ARG A NH2   1 
ATOM   2805 N N     . THR C 3 299 ? 89.265  33.553 22.578  1.00 48.14  ? 299  THR A N     1 
ATOM   2806 C CA    . THR C 3 299 ? 90.287  34.476 22.116  1.00 47.50  ? 299  THR A CA    1 
ATOM   2807 C C     . THR C 3 299 ? 90.764  34.126 20.718  1.00 51.28  ? 299  THR A C     1 
ATOM   2808 O O     . THR C 3 299 ? 90.329  33.139 20.140  1.00 52.11  ? 299  THR A O     1 
ATOM   2809 C CB    . THR C 3 299 ? 91.460  34.465 23.076  1.00 43.28  ? 299  THR A CB    1 
ATOM   2810 O OG1   . THR C 3 299 ? 91.976  33.142 23.167  1.00 41.29  ? 299  THR A OG1   1 
ATOM   2811 C CG2   . THR C 3 299 ? 91.009  34.890 24.456  1.00 39.97  ? 299  THR A CG2   1 
ATOM   2812 N N     . HIS C 3 300 ? 91.659  34.944 20.176  1.00 56.07  ? 300  HIS A N     1 
ATOM   2813 C CA    . HIS C 3 300 ? 92.193  34.720 18.839  1.00 59.41  ? 300  HIS A CA    1 
ATOM   2814 C C     . HIS C 3 300 ? 93.388  33.758 18.880  1.00 58.09  ? 300  HIS A C     1 
ATOM   2815 O O     . HIS C 3 300 ? 93.838  33.264 17.845  1.00 58.06  ? 300  HIS A O     1 
ATOM   2816 C CB    . HIS C 3 300 ? 92.644  36.046 18.222  1.00 66.51  ? 300  HIS A CB    1 
ATOM   2817 C CG    . HIS C 3 300 ? 94.082  36.368 18.484  1.00 76.08  ? 300  HIS A CG    1 
ATOM   2818 N ND1   . HIS C 3 300 ? 94.582  36.564 19.755  1.00 79.05  ? 300  HIS A ND1   1 
ATOM   2819 C CD2   . HIS C 3 300 ? 95.137  36.485 17.642  1.00 79.30  ? 300  HIS A CD2   1 
ATOM   2820 C CE1   . HIS C 3 300 ? 95.883  36.786 19.684  1.00 81.10  ? 300  HIS A CE1   1 
ATOM   2821 N NE2   . HIS C 3 300 ? 96.245  36.743 18.413  1.00 82.88  ? 300  HIS A NE2   1 
ATOM   2822 N N     . SER C 3 301 ? 93.905  33.496 20.074  1.00 55.03  ? 301  SER A N     1 
ATOM   2823 C CA    . SER C 3 301 ? 95.050  32.603 20.197  1.00 52.28  ? 301  SER A CA    1 
ATOM   2824 C C     . SER C 3 301 ? 95.175  32.011 21.595  1.00 50.36  ? 301  SER A C     1 
ATOM   2825 O O     . SER C 3 301 ? 94.603  32.533 22.551  1.00 48.95  ? 301  SER A O     1 
ATOM   2826 C CB    . SER C 3 301 ? 96.325  33.369 19.875  1.00 51.11  ? 301  SER A CB    1 
ATOM   2827 O OG    . SER C 3 301 ? 96.627  34.249 20.937  1.00 53.31  ? 301  SER A OG    1 
ATOM   2828 N N     . LYS C 3 302 ? 95.919  30.916 21.704  1.00 48.20  ? 302  LYS A N     1 
ATOM   2829 C CA    . LYS C 3 302 ? 96.147  30.281 22.993  1.00 48.05  ? 302  LYS A CA    1 
ATOM   2830 C C     . LYS C 3 302 ? 96.807  31.306 23.910  1.00 47.71  ? 302  LYS A C     1 
ATOM   2831 O O     . LYS C 3 302 ? 96.450  31.425 25.087  1.00 45.91  ? 302  LYS A O     1 
ATOM   2832 C CB    . LYS C 3 302 ? 97.072  29.073 22.840  1.00 49.30  ? 302  LYS A CB    1 
ATOM   2833 C CG    . LYS C 3 302 ? 97.416  28.387 24.155  1.00 50.80  ? 302  LYS A CG    1 
ATOM   2834 C CD    . LYS C 3 302 ? 98.464  27.319 23.949  1.00 56.33  ? 302  LYS A CD    1 
ATOM   2835 C CE    . LYS C 3 302 ? 98.690  26.517 25.215  1.00 59.48  ? 302  LYS A CE    1 
ATOM   2836 N NZ    . LYS C 3 302 ? 97.424  25.874 25.669  1.00 61.42  ? 302  LYS A NZ    1 
ATOM   2837 N N     . LYS C 3 303 ? 97.761  32.055 23.357  1.00 48.88  ? 303  LYS A N     1 
ATOM   2838 C CA    . LYS C 3 303 ? 98.483  33.070 24.124  1.00 49.91  ? 303  LYS A CA    1 
ATOM   2839 C C     . LYS C 3 303 ? 97.536  34.063 24.781  1.00 48.02  ? 303  LYS A C     1 
ATOM   2840 O O     . LYS C 3 303 ? 97.642  34.318 25.974  1.00 49.53  ? 303  LYS A O     1 
ATOM   2841 C CB    . LYS C 3 303 ? 99.455  33.844 23.227  1.00 54.09  ? 303  LYS A CB    1 
ATOM   2842 C CG    . LYS C 3 303 ? 100.362 32.977 22.363  1.00 59.73  ? 303  LYS A CG    1 
ATOM   2843 C CD    . LYS C 3 303 ? 100.866 33.767 21.153  1.00 62.71  ? 303  LYS A CD    1 
ATOM   2844 C CE    . LYS C 3 303 ? 99.694  34.187 20.262  1.00 64.00  ? 303  LYS A CE    1 
ATOM   2845 N NZ    . LYS C 3 303 ? 100.068 35.112 19.157  1.00 64.32  ? 303  LYS A NZ    1 
ATOM   2846 N N     . ALA C 3 304 ? 96.618  34.622 23.993  1.00 45.76  ? 304  ALA A N     1 
ATOM   2847 C CA    . ALA C 3 304 ? 95.655  35.603 24.493  1.00 41.72  ? 304  ALA A CA    1 
ATOM   2848 C C     . ALA C 3 304 ? 94.773  35.045 25.600  1.00 41.56  ? 304  ALA A C     1 
ATOM   2849 O O     . ALA C 3 304 ? 94.382  35.766 26.513  1.00 41.98  ? 304  ALA A O     1 
ATOM   2850 C CB    . ALA C 3 304 ? 94.795  36.092 23.363  1.00 42.39  ? 304  ALA A CB    1 
ATOM   2851 N N     . LEU C 3 305 ? 94.460  33.758 25.506  1.00 41.91  ? 305  LEU A N     1 
ATOM   2852 C CA    . LEU C 3 305 ? 93.629  33.089 26.501  1.00 41.97  ? 305  LEU A CA    1 
ATOM   2853 C C     . LEU C 3 305 ? 94.443  32.926 27.774  1.00 44.03  ? 305  LEU A C     1 
ATOM   2854 O O     . LEU C 3 305 ? 93.933  33.165 28.872  1.00 43.61  ? 305  LEU A O     1 
ATOM   2855 C CB    . LEU C 3 305 ? 93.182  31.702 25.999  1.00 41.38  ? 305  LEU A CB    1 
ATOM   2856 C CG    . LEU C 3 305 ? 91.974  30.977 26.619  1.00 43.29  ? 305  LEU A CG    1 
ATOM   2857 C CD1   . LEU C 3 305 ? 92.398  29.573 26.992  1.00 43.69  ? 305  LEU A CD1   1 
ATOM   2858 C CD2   . LEU C 3 305 ? 91.398  31.711 27.839  1.00 38.99  ? 305  LEU A CD2   1 
ATOM   2859 N N     . MET C 3 306 ? 95.707  32.520 27.625  1.00 44.83  ? 306  MET A N     1 
ATOM   2860 C CA    . MET C 3 306 ? 96.582  32.335 28.782  1.00 47.21  ? 306  MET A CA    1 
ATOM   2861 C C     . MET C 3 306 ? 96.651  33.570 29.694  1.00 47.05  ? 306  MET A C     1 
ATOM   2862 O O     . MET C 3 306 ? 96.844  33.450 30.902  1.00 49.06  ? 306  MET A O     1 
ATOM   2863 C CB    . MET C 3 306 ? 97.988  31.907 28.334  1.00 48.58  ? 306  MET A CB    1 
ATOM   2864 C CG    . MET C 3 306 ? 98.065  30.476 27.813  1.00 49.56  ? 306  MET A CG    1 
ATOM   2865 S SD    . MET C 3 306 ? 97.368  29.226 28.955  1.00 55.86  ? 306  MET A SD    1 
ATOM   2866 C CE    . MET C 3 306 ? 98.780  28.846 29.980  1.00 57.22  ? 306  MET A CE    1 
ATOM   2867 N N     . ARG C 3 307 ? 96.469  34.758 29.135  1.00 46.63  ? 307  ARG A N     1 
ATOM   2868 C CA    . ARG C 3 307 ? 96.487  35.961 29.962  1.00 46.04  ? 307  ARG A CA    1 
ATOM   2869 C C     . ARG C 3 307 ? 95.472  35.920 31.130  1.00 46.13  ? 307  ARG A C     1 
ATOM   2870 O O     . ARG C 3 307 ? 95.653  36.584 32.142  1.00 48.89  ? 307  ARG A O     1 
ATOM   2871 C CB    . ARG C 3 307 ? 96.187  37.177 29.107  1.00 44.97  ? 307  ARG A CB    1 
ATOM   2872 C CG    . ARG C 3 307 ? 97.206  37.451 28.056  1.00 44.05  ? 307  ARG A CG    1 
ATOM   2873 C CD    . ARG C 3 307 ? 97.157  38.936 27.701  1.00 45.35  ? 307  ARG A CD    1 
ATOM   2874 N NE    . ARG C 3 307 ? 98.153  39.275 26.687  1.00 48.71  ? 307  ARG A NE    1 
ATOM   2875 C CZ    . ARG C 3 307 ? 97.930  39.252 25.378  1.00 49.86  ? 307  ARG A CZ    1 
ATOM   2876 N NH1   . ARG C 3 307 ? 96.732  38.908 24.903  1.00 45.44  ? 307  ARG A NH1   1 
ATOM   2877 N NH2   . ARG C 3 307 ? 98.909  39.573 24.545  1.00 49.99  ? 307  ARG A NH2   1 
ATOM   2878 N N     . TYR C 3 308 ? 94.410  35.137 30.997  1.00 43.29  ? 308  TYR A N     1 
ATOM   2879 C CA    . TYR C 3 308 ? 93.412  35.084 32.052  1.00 42.95  ? 308  TYR A CA    1 
ATOM   2880 C C     . TYR C 3 308 ? 93.715  34.059 33.131  1.00 44.41  ? 308  TYR A C     1 
ATOM   2881 O O     . TYR C 3 308 ? 93.104  34.087 34.211  1.00 37.38  ? 308  TYR A O     1 
ATOM   2882 C CB    . TYR C 3 308 ? 92.014  34.797 31.461  1.00 39.23  ? 308  TYR A CB    1 
ATOM   2883 C CG    . TYR C 3 308 ? 91.482  35.914 30.594  1.00 39.08  ? 308  TYR A CG    1 
ATOM   2884 C CD1   . TYR C 3 308 ? 91.848  36.026 29.252  1.00 39.29  ? 308  TYR A CD1   1 
ATOM   2885 C CD2   . TYR C 3 308 ? 90.653  36.896 31.131  1.00 41.68  ? 308  TYR A CD2   1 
ATOM   2886 C CE1   . TYR C 3 308 ? 91.404  37.091 28.472  1.00 40.33  ? 308  TYR A CE1   1 
ATOM   2887 C CE2   . TYR C 3 308 ? 90.202  37.966 30.359  1.00 40.22  ? 308  TYR A CE2   1 
ATOM   2888 C CZ    . TYR C 3 308 ? 90.581  38.057 29.039  1.00 41.05  ? 308  TYR A CZ    1 
ATOM   2889 O OH    . TYR C 3 308 ? 90.140  39.125 28.301  1.00 43.38  ? 308  TYR A OH    1 
ATOM   2890 N N     . GLU C 3 309 ? 94.654  33.160 32.836  1.00 50.10  ? 309  GLU A N     1 
ATOM   2891 C CA    . GLU C 3 309 ? 95.010  32.071 33.745  1.00 55.90  ? 309  GLU A CA    1 
ATOM   2892 C C     . GLU C 3 309 ? 95.149  32.440 35.217  1.00 56.70  ? 309  GLU A C     1 
ATOM   2893 O O     . GLU C 3 309 ? 94.582  31.770 36.076  1.00 57.04  ? 309  GLU A O     1 
ATOM   2894 C CB    . GLU C 3 309 ? 96.290  31.370 33.267  1.00 59.24  ? 309  GLU A CB    1 
ATOM   2895 C CG    . GLU C 3 309 ? 96.598  30.080 34.038  1.00 66.27  ? 309  GLU A CG    1 
ATOM   2896 C CD    . GLU C 3 309 ? 97.845  29.375 33.541  1.00 71.18  ? 309  GLU A CD    1 
ATOM   2897 O OE1   . GLU C 3 309 ? 98.934  29.986 33.604  1.00 73.50  ? 309  GLU A OE1   1 
ATOM   2898 O OE2   . GLU C 3 309 ? 97.737  28.214 33.088  1.00 73.68  ? 309  GLU A OE2   1 
ATOM   2899 N N     . ASP C 3 310 ? 95.895  33.491 35.524  1.00 58.06  ? 310  ASP A N     1 
ATOM   2900 C CA    . ASP C 3 310 ? 96.053  33.865 36.922  1.00 62.22  ? 310  ASP A CA    1 
ATOM   2901 C C     . ASP C 3 310 ? 95.569  35.272 37.145  1.00 61.64  ? 310  ASP A C     1 
ATOM   2902 O O     . ASP C 3 310 ? 96.303  36.102 37.687  1.00 63.11  ? 310  ASP A O     1 
ATOM   2903 C CB    . ASP C 3 310 ? 97.523  33.750 37.359  1.00 64.34  ? 310  ASP A CB    1 
ATOM   2904 C CG    . ASP C 3 310 ? 98.017  32.303 37.406  1.00 68.10  ? 310  ASP A CG    1 
ATOM   2905 O OD1   . ASP C 3 310 ? 97.344  31.447 38.038  1.00 67.75  ? 310  ASP A OD1   1 
ATOM   2906 O OD2   . ASP C 3 310 ? 99.087  32.029 36.815  1.00 66.89  ? 310  ASP A OD2   1 
ATOM   2907 N N     . VAL C 3 311 ? 94.328  35.538 36.746  1.00 59.04  ? 311  VAL A N     1 
ATOM   2908 C CA    . VAL C 3 311 ? 93.780  36.873 36.887  1.00 57.93  ? 311  VAL A CA    1 
ATOM   2909 C C     . VAL C 3 311 ? 93.027  37.175 38.172  1.00 59.29  ? 311  VAL A C     1 
ATOM   2910 O O     . VAL C 3 311 ? 93.279  38.203 38.803  1.00 62.15  ? 311  VAL A O     1 
ATOM   2911 C CB    . VAL C 3 311 ? 92.886  37.238 35.695  1.00 55.75  ? 311  VAL A CB    1 
ATOM   2912 C CG1   . VAL C 3 311 ? 92.200  38.572 35.945  1.00 53.47  ? 311  VAL A CG1   1 
ATOM   2913 C CG2   . VAL C 3 311 ? 93.739  37.342 34.440  1.00 54.68  ? 311  VAL A CG2   1 
ATOM   2914 N N     . TYR C 3 312 ? 92.116  36.302 38.576  1.00 58.55  ? 312  TYR A N     1 
ATOM   2915 C CA    . TYR C 3 312 ? 91.353  36.561 39.800  1.00 57.45  ? 312  TYR A CA    1 
ATOM   2916 C C     . TYR C 3 312 ? 90.282  37.624 39.520  1.00 56.40  ? 312  TYR A C     1 
ATOM   2917 O O     . TYR C 3 312 ? 90.563  38.826 39.482  1.00 57.13  ? 312  TYR A O     1 
ATOM   2918 C CB    . TYR C 3 312 ? 92.271  37.048 40.935  1.00 57.06  ? 312  TYR A CB    1 
ATOM   2919 C CG    . TYR C 3 312 ? 91.513  37.389 42.204  1.00 58.77  ? 312  TYR A CG    1 
ATOM   2920 C CD1   . TYR C 3 312 ? 90.924  36.383 42.983  1.00 57.45  ? 312  TYR A CD1   1 
ATOM   2921 C CD2   . TYR C 3 312 ? 91.296  38.719 42.575  1.00 59.64  ? 312  TYR A CD2   1 
ATOM   2922 C CE1   . TYR C 3 312 ? 90.130  36.694 44.094  1.00 57.56  ? 312  TYR A CE1   1 
ATOM   2923 C CE2   . TYR C 3 312 ? 90.498  39.042 43.687  1.00 58.13  ? 312  TYR A CE2   1 
ATOM   2924 C CZ    . TYR C 3 312 ? 89.922  38.025 44.433  1.00 59.33  ? 312  TYR A CZ    1 
ATOM   2925 O OH    . TYR C 3 312 ? 89.122  38.337 45.509  1.00 62.22  ? 312  TYR A OH    1 
ATOM   2926 N N     . MET C 3 313 ? 89.055  37.166 39.323  1.00 52.82  ? 313  MET A N     1 
ATOM   2927 C CA    . MET C 3 313 ? 87.932  38.047 39.020  1.00 51.06  ? 313  MET A CA    1 
ATOM   2928 C C     . MET C 3 313 ? 86.687  37.311 39.498  1.00 49.46  ? 313  MET A C     1 
ATOM   2929 O O     . MET C 3 313 ? 85.914  36.783 38.712  1.00 47.89  ? 313  MET A O     1 
ATOM   2930 C CB    . MET C 3 313 ? 87.884  38.296 37.516  1.00 50.62  ? 313  MET A CB    1 
ATOM   2931 C CG    . MET C 3 313 ? 88.312  37.068 36.712  1.00 51.40  ? 313  MET A CG    1 
ATOM   2932 S SD    . MET C 3 313 ? 88.335  37.293 34.920  1.00 51.96  ? 313  MET A SD    1 
ATOM   2933 C CE    . MET C 3 313 ? 88.139  35.600 34.358  1.00 54.92  ? 313  MET A CE    1 
ATOM   2934 N N     . PRO C 3 314 ? 86.501  37.267 40.818  1.00 48.55  ? 314  PRO A N     1 
ATOM   2935 C CA    . PRO C 3 314 ? 85.410  36.626 41.549  1.00 48.56  ? 314  PRO A CA    1 
ATOM   2936 C C     . PRO C 3 314 ? 84.020  36.899 41.016  1.00 48.44  ? 314  PRO A C     1 
ATOM   2937 O O     . PRO C 3 314 ? 83.201  35.981 40.904  1.00 48.76  ? 314  PRO A O     1 
ATOM   2938 C CB    . PRO C 3 314 ? 85.575  37.169 42.967  1.00 49.23  ? 314  PRO A CB    1 
ATOM   2939 C CG    . PRO C 3 314 ? 86.999  37.454 43.053  1.00 49.90  ? 314  PRO A CG    1 
ATOM   2940 C CD    . PRO C 3 314 ? 87.332  38.062 41.734  1.00 49.09  ? 314  PRO A CD    1 
ATOM   2941 N N     . GLU C 3 315 ? 83.748  38.163 40.720  1.00 48.21  ? 315  GLU A N     1 
ATOM   2942 C CA    . GLU C 3 315 ? 82.438  38.552 40.226  1.00 48.56  ? 315  GLU A CA    1 
ATOM   2943 C C     . GLU C 3 315 ? 82.143  38.013 38.831  1.00 48.45  ? 315  GLU A C     1 
ATOM   2944 O O     . GLU C 3 315 ? 80.990  37.711 38.493  1.00 49.59  ? 315  GLU A O     1 
ATOM   2945 C CB    . GLU C 3 315 ? 82.320  40.062 40.278  1.00 48.99  ? 315  GLU A CB    1 
ATOM   2946 C CG    . GLU C 3 315 ? 82.328  40.569 41.716  1.00 55.48  ? 315  GLU A CG    1 
ATOM   2947 C CD    . GLU C 3 315 ? 81.210  39.953 42.569  1.00 58.63  ? 315  GLU A CD    1 
ATOM   2948 O OE1   . GLU C 3 315 ? 80.025  40.350 42.416  1.00 59.30  ? 315  GLU A OE1   1 
ATOM   2949 O OE2   . GLU C 3 315 ? 81.519  39.060 43.387  1.00 60.22  ? 315  GLU A OE2   1 
ATOM   2950 N N     . VAL C 3 316 ? 83.187  37.873 38.028  1.00 44.97  ? 316  VAL A N     1 
ATOM   2951 C CA    . VAL C 3 316 ? 83.038  37.344 36.694  1.00 42.83  ? 316  VAL A CA    1 
ATOM   2952 C C     . VAL C 3 316 ? 82.592  35.879 36.761  1.00 42.80  ? 316  VAL A C     1 
ATOM   2953 O O     . VAL C 3 316 ? 81.561  35.505 36.164  1.00 42.91  ? 316  VAL A O     1 
ATOM   2954 C CB    . VAL C 3 316 ? 84.363  37.467 35.927  1.00 42.31  ? 316  VAL A CB    1 
ATOM   2955 C CG1   . VAL C 3 316 ? 84.223  36.923 34.501  1.00 40.30  ? 316  VAL A CG1   1 
ATOM   2956 C CG2   . VAL C 3 316 ? 84.786  38.929 35.917  1.00 39.89  ? 316  VAL A CG2   1 
ATOM   2957 N N     . TYR C 3 317 ? 83.349  35.059 37.498  1.00 40.87  ? 317  TYR A N     1 
ATOM   2958 C CA    . TYR C 3 317 ? 83.028  33.637 37.638  1.00 40.26  ? 317  TYR A CA    1 
ATOM   2959 C C     . TYR C 3 317 ? 81.659  33.449 38.300  1.00 41.17  ? 317  TYR A C     1 
ATOM   2960 O O     . TYR C 3 317 ? 80.873  32.576 37.919  1.00 44.73  ? 317  TYR A O     1 
ATOM   2961 C CB    . TYR C 3 317 ? 84.101  32.937 38.472  1.00 38.77  ? 317  TYR A CB    1 
ATOM   2962 C CG    . TYR C 3 317 ? 85.408  32.682 37.747  1.00 39.99  ? 317  TYR A CG    1 
ATOM   2963 C CD1   . TYR C 3 317 ? 85.547  31.573 36.905  1.00 39.59  ? 317  TYR A CD1   1 
ATOM   2964 C CD2   . TYR C 3 317 ? 86.506  33.542 37.896  1.00 34.55  ? 317  TYR A CD2   1 
ATOM   2965 C CE1   . TYR C 3 317 ? 86.717  31.322 36.245  1.00 35.63  ? 317  TYR A CE1   1 
ATOM   2966 C CE2   . TYR C 3 317 ? 87.686  33.297 37.226  1.00 33.07  ? 317  TYR A CE2   1 
ATOM   2967 C CZ    . TYR C 3 317 ? 87.782  32.178 36.403  1.00 35.44  ? 317  TYR A CZ    1 
ATOM   2968 O OH    . TYR C 3 317 ? 88.942  31.889 35.731  1.00 37.64  ? 317  TYR A OH    1 
ATOM   2969 N N     . LYS C 3 318 ? 81.376  34.285 39.287  1.00 38.93  ? 318  LYS A N     1 
ATOM   2970 C CA    . LYS C 3 318 ? 80.120  34.218 40.012  1.00 38.57  ? 318  LYS A CA    1 
ATOM   2971 C C     . LYS C 3 318 ? 78.951  34.440 39.062  1.00 40.44  ? 318  LYS A C     1 
ATOM   2972 O O     . LYS C 3 318 ? 77.936  33.731 39.116  1.00 39.60  ? 318  LYS A O     1 
ATOM   2973 C CB    . LYS C 3 318 ? 80.103  35.284 41.106  1.00 39.34  ? 318  LYS A CB    1 
ATOM   2974 C CG    . LYS C 3 318 ? 79.059  35.059 42.203  1.00 43.22  ? 318  LYS A CG    1 
ATOM   2975 C CD    . LYS C 3 318 ? 79.449  35.752 43.536  1.00 44.77  ? 318  LYS A CD    1 
ATOM   2976 C CE    . LYS C 3 318 ? 79.145  37.242 43.543  1.00 46.44  ? 318  LYS A CE    1 
ATOM   2977 N NZ    . LYS C 3 318 ? 79.491  37.916 44.863  1.00 47.14  ? 318  LYS A NZ    1 
ATOM   2978 N N     . ALA C 3 319 ? 79.109  35.425 38.184  1.00 40.49  ? 319  ALA A N     1 
ATOM   2979 C CA    . ALA C 3 319 ? 78.068  35.771 37.232  1.00 38.45  ? 319  ALA A CA    1 
ATOM   2980 C C     . ALA C 3 319 ? 77.832  34.644 36.232  1.00 36.67  ? 319  ALA A C     1 
ATOM   2981 O O     . ALA C 3 319 ? 76.703  34.179 36.065  1.00 36.71  ? 319  ALA A O     1 
ATOM   2982 C CB    . ALA C 3 319 ? 78.435  37.061 36.515  1.00 37.68  ? 319  ALA A CB    1 
ATOM   2983 N N     . ILE C 3 320 ? 78.893  34.223 35.560  1.00 34.46  ? 320  ILE A N     1 
ATOM   2984 C CA    . ILE C 3 320 ? 78.796  33.134 34.594  1.00 33.02  ? 320  ILE A CA    1 
ATOM   2985 C C     . ILE C 3 320 ? 78.179  31.897 35.253  1.00 34.53  ? 320  ILE A C     1 
ATOM   2986 O O     . ILE C 3 320 ? 77.355  31.216 34.656  1.00 35.20  ? 320  ILE A O     1 
ATOM   2987 C CB    . ILE C 3 320 ? 80.188  32.722 34.052  1.00 34.69  ? 320  ILE A CB    1 
ATOM   2988 C CG1   . ILE C 3 320 ? 80.813  33.851 33.249  1.00 35.52  ? 320  ILE A CG1   1 
ATOM   2989 C CG2   . ILE C 3 320 ? 80.050  31.578 33.128  1.00 31.07  ? 320  ILE A CG2   1 
ATOM   2990 C CD1   . ILE C 3 320 ? 80.157  34.058 31.895  1.00 43.89  ? 320  ILE A CD1   1 
ATOM   2991 N N     . ASN C 3 321 ? 78.569  31.606 36.493  1.00 35.88  ? 321  ASN A N     1 
ATOM   2992 C CA    . ASN C 3 321 ? 78.041  30.419 37.161  1.00 34.33  ? 321  ASN A CA    1 
ATOM   2993 C C     . ASN C 3 321 ? 76.576  30.549 37.556  1.00 34.64  ? 321  ASN A C     1 
ATOM   2994 O O     . ASN C 3 321 ? 75.847  29.552 37.612  1.00 33.89  ? 321  ASN A O     1 
ATOM   2995 C CB    . ASN C 3 321 ? 78.917  30.055 38.365  1.00 33.24  ? 321  ASN A CB    1 
ATOM   2996 C CG    . ASN C 3 321 ? 80.277  29.524 37.944  1.00 35.86  ? 321  ASN A CG    1 
ATOM   2997 O OD1   . ASN C 3 321 ? 81.233  29.554 38.716  1.00 38.07  ? 321  ASN A OD1   1 
ATOM   2998 N ND2   . ASN C 3 321 ? 80.370  29.032 36.713  1.00 33.71  ? 321  ASN A ND2   1 
ATOM   2999 N N     . ILE C 3 322 ? 76.114  31.764 37.809  1.00 34.08  ? 322  ILE A N     1 
ATOM   3000 C CA    . ILE C 3 322 ? 74.713  31.884 38.151  1.00 34.58  ? 322  ILE A CA    1 
ATOM   3001 C C     . ILE C 3 322 ? 73.856  31.706 36.914  1.00 36.06  ? 322  ILE A C     1 
ATOM   3002 O O     . ILE C 3 322 ? 72.824  31.036 36.955  1.00 36.26  ? 322  ILE A O     1 
ATOM   3003 C CB    . ILE C 3 322 ? 74.375  33.226 38.796  1.00 32.87  ? 322  ILE A CB    1 
ATOM   3004 C CG1   . ILE C 3 322 ? 74.963  33.283 40.205  1.00 32.86  ? 322  ILE A CG1   1 
ATOM   3005 C CG2   . ILE C 3 322 ? 72.871  33.389 38.855  1.00 28.31  ? 322  ILE A CG2   1 
ATOM   3006 C CD1   . ILE C 3 322 ? 74.904  34.660 40.827  1.00 31.46  ? 322  ILE A CD1   1 
ATOM   3007 N N     . ALA C 3 323 ? 74.285  32.291 35.805  1.00 36.01  ? 323  ALA A N     1 
ATOM   3008 C CA    . ALA C 3 323 ? 73.502  32.193 34.574  1.00 38.11  ? 323  ALA A CA    1 
ATOM   3009 C C     . ALA C 3 323 ? 73.451  30.737 34.122  1.00 38.36  ? 323  ALA A C     1 
ATOM   3010 O O     . ALA C 3 323 ? 72.414  30.204 33.752  1.00 37.70  ? 323  ALA A O     1 
ATOM   3011 C CB    . ALA C 3 323 ? 74.130  33.061 33.497  1.00 36.10  ? 323  ALA A CB    1 
ATOM   3012 N N     . GLN C 3 324 ? 74.604  30.100 34.181  1.00 37.80  ? 324  GLN A N     1 
ATOM   3013 C CA    . GLN C 3 324 ? 74.748  28.713 33.787  1.00 38.34  ? 324  GLN A CA    1 
ATOM   3014 C C     . GLN C 3 324 ? 73.816  27.808 34.574  1.00 37.71  ? 324  GLN A C     1 
ATOM   3015 O O     . GLN C 3 324 ? 73.323  26.805 34.067  1.00 38.09  ? 324  GLN A O     1 
ATOM   3016 C CB    . GLN C 3 324 ? 76.179  28.304 34.038  1.00 38.07  ? 324  GLN A CB    1 
ATOM   3017 C CG    . GLN C 3 324 ? 76.671  27.305 33.118  1.00 41.18  ? 324  GLN A CG    1 
ATOM   3018 C CD    . GLN C 3 324 ? 78.148  27.137 33.235  1.00 41.99  ? 324  GLN A CD    1 
ATOM   3019 O OE1   . GLN C 3 324 ? 78.661  26.883 34.325  1.00 42.98  ? 324  GLN A OE1   1 
ATOM   3020 N NE2   . GLN C 3 324 ? 78.852  27.274 32.114  1.00 38.64  ? 324  GLN A NE2   1 
ATOM   3021 N N     . ASN C 3 325 ? 73.562  28.180 35.817  1.00 38.40  ? 325  ASN A N     1 
ATOM   3022 C CA    . ASN C 3 325 ? 72.712  27.392 36.689  1.00 38.10  ? 325  ASN A CA    1 
ATOM   3023 C C     . ASN C 3 325 ? 71.201  27.601 36.513  1.00 36.67  ? 325  ASN A C     1 
ATOM   3024 O O     . ASN C 3 325 ? 70.427  27.069 37.307  1.00 36.91  ? 325  ASN A O     1 
ATOM   3025 C CB    . ASN C 3 325 ? 73.128  27.636 38.147  1.00 41.99  ? 325  ASN A CB    1 
ATOM   3026 C CG    . ASN C 3 325 ? 72.430  26.710 39.123  1.00 46.74  ? 325  ASN A CG    1 
ATOM   3027 O OD1   . ASN C 3 325 ? 72.446  25.483 38.970  1.00 50.91  ? 325  ASN A OD1   1 
ATOM   3028 N ND2   . ASN C 3 325 ? 71.810  27.295 40.143  1.00 52.52  ? 325  ASN A ND2   1 
ATOM   3029 N N     . THR C 3 326 ? 70.780  28.351 35.488  1.00 31.38  ? 326  THR A N     1 
ATOM   3030 C CA    . THR C 3 326 ? 69.355  28.571 35.250  1.00 31.29  ? 326  THR A CA    1 
ATOM   3031 C C     . THR C 3 326 ? 68.744  27.341 34.578  1.00 34.60  ? 326  THR A C     1 
ATOM   3032 O O     . THR C 3 326 ? 69.264  26.841 33.583  1.00 32.91  ? 326  THR A O     1 
ATOM   3033 C CB    . THR C 3 326 ? 69.098  29.802 34.350  1.00 32.95  ? 326  THR A CB    1 
ATOM   3034 O OG1   . THR C 3 326 ? 69.460  30.996 35.052  1.00 38.27  ? 326  THR A OG1   1 
ATOM   3035 C CG2   . THR C 3 326 ? 67.644  29.896 33.964  1.00 28.11  ? 326  THR A CG2   1 
ATOM   3036 N N     . ALA C 3 327 ? 67.637  26.844 35.114  1.00 32.50  ? 327  ALA A N     1 
ATOM   3037 C CA    . ALA C 3 327 ? 67.030  25.664 34.528  1.00 30.72  ? 327  ALA A CA    1 
ATOM   3038 C C     . ALA C 3 327 ? 65.940  25.993 33.499  1.00 30.20  ? 327  ALA A C     1 
ATOM   3039 O O     . ALA C 3 327 ? 65.104  26.846 33.719  1.00 29.64  ? 327  ALA A O     1 
ATOM   3040 C CB    . ALA C 3 327 ? 66.474  24.762 35.646  1.00 32.44  ? 327  ALA A CB    1 
ATOM   3041 N N     . TRP C 3 328 ? 65.963  25.311 32.363  1.00 31.28  ? 328  TRP A N     1 
ATOM   3042 C CA    . TRP C 3 328 ? 64.970  25.551 31.324  1.00 29.88  ? 328  TRP A CA    1 
ATOM   3043 C C     . TRP C 3 328 ? 64.227  24.282 30.957  1.00 31.52  ? 328  TRP A C     1 
ATOM   3044 O O     . TRP C 3 328 ? 64.548  23.176 31.414  1.00 28.96  ? 328  TRP A O     1 
ATOM   3045 C CB    . TRP C 3 328 ? 65.629  26.080 30.031  1.00 29.43  ? 328  TRP A CB    1 
ATOM   3046 C CG    . TRP C 3 328 ? 66.289  27.439 30.140  1.00 26.48  ? 328  TRP A CG    1 
ATOM   3047 C CD1   . TRP C 3 328 ? 67.483  27.728 30.748  1.00 27.68  ? 328  TRP A CD1   1 
ATOM   3048 C CD2   . TRP C 3 328 ? 65.805  28.670 29.611  1.00 23.00  ? 328  TRP A CD2   1 
ATOM   3049 N NE1   . TRP C 3 328 ? 67.767  29.053 30.625  1.00 29.58  ? 328  TRP A NE1   1 
ATOM   3050 C CE2   . TRP C 3 328 ? 66.757  29.663 29.931  1.00 26.60  ? 328  TRP A CE2   1 
ATOM   3051 C CE3   . TRP C 3 328 ? 64.656  29.039 28.898  1.00 28.66  ? 328  TRP A CE3   1 
ATOM   3052 C CZ2   . TRP C 3 328 ? 66.601  30.999 29.563  1.00 24.80  ? 328  TRP A CZ2   1 
ATOM   3053 C CZ3   . TRP C 3 328 ? 64.496  30.391 28.531  1.00 27.25  ? 328  TRP A CZ3   1 
ATOM   3054 C CH2   . TRP C 3 328 ? 65.464  31.343 28.867  1.00 24.62  ? 328  TRP A CH2   1 
ATOM   3055 N N     . LYS C 3 329 ? 63.250  24.453 30.080  1.00 28.74  ? 329  LYS A N     1 
ATOM   3056 C CA    . LYS C 3 329 ? 62.512  23.318 29.593  1.00 28.78  ? 329  LYS A CA    1 
ATOM   3057 C C     . LYS C 3 329 ? 61.812  23.719 28.316  1.00 28.05  ? 329  LYS A C     1 
ATOM   3058 O O     . LYS C 3 329 ? 61.547  24.911 28.084  1.00 27.06  ? 329  LYS A O     1 
ATOM   3059 C CB    . LYS C 3 329 ? 61.514  22.836 30.644  1.00 29.24  ? 329  LYS A CB    1 
ATOM   3060 C CG    . LYS C 3 329 ? 60.251  23.640 30.730  1.00 30.05  ? 329  LYS A CG    1 
ATOM   3061 C CD    . LYS C 3 329 ? 59.412  23.196 31.899  1.00 27.35  ? 329  LYS A CD    1 
ATOM   3062 C CE    . LYS C 3 329 ? 58.115  23.960 31.915  1.00 30.01  ? 329  LYS A CE    1 
ATOM   3063 N NZ    . LYS C 3 329 ? 57.259  23.576 33.051  1.00 33.41  ? 329  LYS A NZ    1 
ATOM   3064 N N     . ILE C 3 330 ? 61.535  22.721 27.483  1.00 26.38  ? 330  ILE A N     1 
ATOM   3065 C CA    . ILE C 3 330 ? 60.864  22.919 26.219  1.00 26.17  ? 330  ILE A CA    1 
ATOM   3066 C C     . ILE C 3 330 ? 59.414  23.282 26.425  1.00 30.49  ? 330  ILE A C     1 
ATOM   3067 O O     . ILE C 3 330 ? 58.714  22.676 27.231  1.00 34.18  ? 330  ILE A O     1 
ATOM   3068 C CB    . ILE C 3 330 ? 60.924  21.672 25.363  1.00 24.56  ? 330  ILE A CB    1 
ATOM   3069 C CG1   . ILE C 3 330 ? 62.381  21.312 25.114  1.00 29.20  ? 330  ILE A CG1   1 
ATOM   3070 C CG2   . ILE C 3 330 ? 60.182  21.909 24.061  1.00 25.74  ? 330  ILE A CG2   1 
ATOM   3071 C CD1   . ILE C 3 330 ? 63.255  22.530 24.756  1.00 23.42  ? 330  ILE A CD1   1 
ATOM   3072 N N     . ASN C 3 331 ? 58.965  24.285 25.695  1.00 33.25  ? 331  ASN A N     1 
ATOM   3073 C CA    . ASN C 3 331 ? 57.588  24.735 25.807  1.00 35.09  ? 331  ASN A CA    1 
ATOM   3074 C C     . ASN C 3 331 ? 56.778  23.864 24.871  1.00 35.43  ? 331  ASN A C     1 
ATOM   3075 O O     . ASN C 3 331 ? 56.634  24.183 23.688  1.00 34.01  ? 331  ASN A O     1 
ATOM   3076 C CB    . ASN C 3 331 ? 57.468  26.204 25.393  1.00 34.45  ? 331  ASN A CB    1 
ATOM   3077 C CG    . ASN C 3 331 ? 56.074  26.749 25.621  1.00 34.51  ? 331  ASN A CG    1 
ATOM   3078 O OD1   . ASN C 3 331 ? 55.082  26.121 25.222  1.00 33.48  ? 331  ASN A OD1   1 
ATOM   3079 N ND2   . ASN C 3 331 ? 55.984  27.919 26.259  1.00 30.52  ? 331  ASN A ND2   1 
ATOM   3080 N N     . LYS C 3 332 ? 56.259  22.764 25.404  1.00 34.52  ? 332  LYS A N     1 
ATOM   3081 C CA    . LYS C 3 332 ? 55.488  21.836 24.599  1.00 38.19  ? 332  LYS A CA    1 
ATOM   3082 C C     . LYS C 3 332 ? 54.362  22.423 23.749  1.00 36.58  ? 332  LYS A C     1 
ATOM   3083 O O     . LYS C 3 332 ? 54.209  22.040 22.599  1.00 35.01  ? 332  LYS A O     1 
ATOM   3084 C CB    . LYS C 3 332 ? 54.921  20.722 25.472  1.00 42.04  ? 332  LYS A CB    1 
ATOM   3085 C CG    . LYS C 3 332 ? 55.959  19.841 26.107  1.00 47.55  ? 332  LYS A CG    1 
ATOM   3086 C CD    . LYS C 3 332 ? 55.286  18.703 26.858  1.00 52.85  ? 332  LYS A CD    1 
ATOM   3087 C CE    . LYS C 3 332 ? 56.297  17.727 27.416  1.00 57.92  ? 332  LYS A CE    1 
ATOM   3088 N NZ    . LYS C 3 332 ? 55.647  16.548 28.078  1.00 63.33  ? 332  LYS A NZ    1 
ATOM   3089 N N     . LYS C 3 333 ? 53.572  23.348 24.282  1.00 38.81  ? 333  LYS A N     1 
ATOM   3090 C CA    . LYS C 3 333 ? 52.467  23.872 23.477  1.00 39.75  ? 333  LYS A CA    1 
ATOM   3091 C C     . LYS C 3 333 ? 52.967  24.559 22.214  1.00 38.09  ? 333  LYS A C     1 
ATOM   3092 O O     . LYS C 3 333 ? 52.400  24.381 21.141  1.00 35.71  ? 333  LYS A O     1 
ATOM   3093 C CB    . LYS C 3 333 ? 51.577  24.825 24.292  1.00 44.42  ? 333  LYS A CB    1 
ATOM   3094 C CG    . LYS C 3 333 ? 51.031  24.232 25.597  1.00 49.97  ? 333  LYS A CG    1 
ATOM   3095 C CD    . LYS C 3 333 ? 49.864  25.061 26.152  1.00 54.11  ? 333  LYS A CD    1 
ATOM   3096 C CE    . LYS C 3 333 ? 49.722  24.940 27.663  1.00 54.85  ? 333  LYS A CE    1 
ATOM   3097 N NZ    . LYS C 3 333 ? 50.911  25.509 28.394  1.00 55.41  ? 333  LYS A NZ    1 
ATOM   3098 N N     . VAL C 3 334 ? 54.027  25.352 22.334  1.00 37.60  ? 334  VAL A N     1 
ATOM   3099 C CA    . VAL C 3 334 ? 54.592  26.033 21.161  1.00 37.43  ? 334  VAL A CA    1 
ATOM   3100 C C     . VAL C 3 334 ? 55.248  24.994 20.228  1.00 36.29  ? 334  VAL A C     1 
ATOM   3101 O O     . VAL C 3 334 ? 55.099  25.063 19.013  1.00 38.66  ? 334  VAL A O     1 
ATOM   3102 C CB    . VAL C 3 334 ? 55.628  27.092 21.573  1.00 38.23  ? 334  VAL A CB    1 
ATOM   3103 C CG1   . VAL C 3 334 ? 56.176  27.765 20.356  1.00 38.88  ? 334  VAL A CG1   1 
ATOM   3104 C CG2   . VAL C 3 334 ? 54.989  28.110 22.511  1.00 37.66  ? 334  VAL A CG2   1 
ATOM   3105 N N     . LEU C 3 335 ? 55.950  24.023 20.804  1.00 36.09  ? 335  LEU A N     1 
ATOM   3106 C CA    . LEU C 3 335 ? 56.584  22.953 20.033  1.00 33.90  ? 335  LEU A CA    1 
ATOM   3107 C C     . LEU C 3 335 ? 55.539  22.240 19.177  1.00 33.54  ? 335  LEU A C     1 
ATOM   3108 O O     . LEU C 3 335 ? 55.770  21.986 18.001  1.00 37.63  ? 335  LEU A O     1 
ATOM   3109 C CB    . LEU C 3 335 ? 57.213  21.930 20.972  1.00 34.18  ? 335  LEU A CB    1 
ATOM   3110 C CG    . LEU C 3 335 ? 58.278  20.974 20.414  1.00 34.70  ? 335  LEU A CG    1 
ATOM   3111 C CD1   . LEU C 3 335 ? 58.717  19.976 21.457  1.00 33.58  ? 335  LEU A CD1   1 
ATOM   3112 C CD2   . LEU C 3 335 ? 57.737  20.260 19.252  1.00 36.32  ? 335  LEU A CD2   1 
ATOM   3113 N N     . ALA C 3 336 ? 54.385  21.935 19.765  1.00 31.43  ? 336  ALA A N     1 
ATOM   3114 C CA    . ALA C 3 336 ? 53.332  21.224 19.043  1.00 33.71  ? 336  ALA A CA    1 
ATOM   3115 C C     . ALA C 3 336 ? 52.885  21.983 17.829  1.00 33.80  ? 336  ALA A C     1 
ATOM   3116 O O     . ALA C 3 336 ? 52.545  21.377 16.819  1.00 39.03  ? 336  ALA A O     1 
ATOM   3117 C CB    . ALA C 3 336 ? 52.110  20.949 19.946  1.00 29.57  ? 336  ALA A CB    1 
ATOM   3118 N N     . VAL C 3 337 ? 52.860  23.305 17.929  1.00 34.41  ? 337  VAL A N     1 
ATOM   3119 C CA    . VAL C 3 337 ? 52.446  24.136 16.804  1.00 33.46  ? 337  VAL A CA    1 
ATOM   3120 C C     . VAL C 3 337 ? 53.569  24.276 15.783  1.00 35.29  ? 337  VAL A C     1 
ATOM   3121 O O     . VAL C 3 337 ? 53.343  24.241 14.568  1.00 35.64  ? 337  VAL A O     1 
ATOM   3122 C CB    . VAL C 3 337 ? 52.046  25.533 17.284  1.00 31.95  ? 337  VAL A CB    1 
ATOM   3123 C CG1   . VAL C 3 337 ? 52.009  26.522 16.097  1.00 31.78  ? 337  VAL A CG1   1 
ATOM   3124 C CG2   . VAL C 3 337 ? 50.699  25.455 17.971  1.00 32.23  ? 337  VAL A CG2   1 
ATOM   3125 N N     . ALA C 3 338 ? 54.780  24.454 16.288  1.00 33.43  ? 338  ALA A N     1 
ATOM   3126 C CA    . ALA C 3 338 ? 55.928  24.627 15.425  1.00 32.21  ? 338  ALA A CA    1 
ATOM   3127 C C     . ALA C 3 338 ? 56.080  23.414 14.538  1.00 32.47  ? 338  ALA A C     1 
ATOM   3128 O O     . ALA C 3 338 ? 56.233  23.554 13.331  1.00 33.81  ? 338  ALA A O     1 
ATOM   3129 C CB    . ALA C 3 338 ? 57.162  24.842 16.263  1.00 34.01  ? 338  ALA A CB    1 
ATOM   3130 N N     . ASN C 3 339 ? 56.018  22.233 15.144  1.00 27.84  ? 339  ASN A N     1 
ATOM   3131 C CA    . ASN C 3 339 ? 56.134  20.969 14.428  1.00 30.91  ? 339  ASN A CA    1 
ATOM   3132 C C     . ASN C 3 339 ? 55.155  20.813 13.298  1.00 34.97  ? 339  ASN A C     1 
ATOM   3133 O O     . ASN C 3 339 ? 55.438  20.121 12.335  1.00 39.12  ? 339  ASN A O     1 
ATOM   3134 C CB    . ASN C 3 339 ? 55.897  19.779 15.351  1.00 27.50  ? 339  ASN A CB    1 
ATOM   3135 C CG    . ASN C 3 339 ? 57.102  19.423 16.169  1.00 29.29  ? 339  ASN A CG    1 
ATOM   3136 O OD1   . ASN C 3 339 ? 58.236  19.766 15.826  1.00 28.41  ? 339  ASN A OD1   1 
ATOM   3137 N ND2   . ASN C 3 339 ? 56.872  18.694 17.246  1.00 25.86  ? 339  ASN A ND2   1 
ATOM   3138 N N     . VAL C 3 340 ? 53.987  21.430 13.414  1.00 36.43  ? 340  VAL A N     1 
ATOM   3139 C CA    . VAL C 3 340 ? 52.996  21.264 12.370  1.00 38.51  ? 340  VAL A CA    1 
ATOM   3140 C C     . VAL C 3 340 ? 52.984  22.311 11.265  1.00 39.68  ? 340  VAL A C     1 
ATOM   3141 O O     . VAL C 3 340 ? 52.901  21.956 10.090  1.00 41.64  ? 340  VAL A O     1 
ATOM   3142 C CB    . VAL C 3 340 ? 51.570  21.163 12.961  1.00 37.35  ? 340  VAL A CB    1 
ATOM   3143 C CG1   . VAL C 3 340 ? 50.568  21.111 11.840  1.00 36.68  ? 340  VAL A CG1   1 
ATOM   3144 C CG2   . VAL C 3 340 ? 51.453  19.907 13.838  1.00 33.35  ? 340  VAL A CG2   1 
ATOM   3145 N N     . ILE C 3 341 ? 53.065  23.591 11.617  1.00 39.24  ? 341  ILE A N     1 
ATOM   3146 C CA    . ILE C 3 341 ? 53.011  24.595 10.581  1.00 39.44  ? 341  ILE A CA    1 
ATOM   3147 C C     . ILE C 3 341 ? 54.274  24.739 9.753   1.00 41.97  ? 341  ILE A C     1 
ATOM   3148 O O     . ILE C 3 341 ? 54.183  25.113 8.584   1.00 43.90  ? 341  ILE A O     1 
ATOM   3149 C CB    . ILE C 3 341 ? 52.608  25.971 11.141  1.00 37.93  ? 341  ILE A CB    1 
ATOM   3150 C CG1   . ILE C 3 341 ? 53.667  26.476 12.111  1.00 36.80  ? 341  ILE A CG1   1 
ATOM   3151 C CG2   . ILE C 3 341 ? 51.228  25.858 11.802  1.00 37.03  ? 341  ILE A CG2   1 
ATOM   3152 C CD1   . ILE C 3 341 ? 53.511  27.913 12.482  1.00 36.46  ? 341  ILE A CD1   1 
ATOM   3153 N N     . THR C 3 342 ? 55.438  24.435 10.331  1.00 42.79  ? 342  THR A N     1 
ATOM   3154 C CA    . THR C 3 342 ? 56.696  24.561 9.592   1.00 44.21  ? 342  THR A CA    1 
ATOM   3155 C C     . THR C 3 342 ? 56.785  23.574 8.452   1.00 45.23  ? 342  THR A C     1 
ATOM   3156 O O     . THR C 3 342 ? 57.716  23.643 7.663   1.00 49.73  ? 342  THR A O     1 
ATOM   3157 C CB    . THR C 3 342 ? 57.976  24.358 10.481  1.00 43.60  ? 342  THR A CB    1 
ATOM   3158 O OG1   . THR C 3 342 ? 57.934  23.086 11.143  1.00 49.59  ? 342  THR A OG1   1 
ATOM   3159 C CG2   . THR C 3 342 ? 58.098  25.451 11.493  1.00 40.35  ? 342  THR A CG2   1 
ATOM   3160 N N     . LYS C 3 343 ? 55.828  22.653 8.361   1.00 44.40  ? 343  LYS A N     1 
ATOM   3161 C CA    . LYS C 3 343 ? 55.830  21.672 7.276   1.00 46.66  ? 343  LYS A CA    1 
ATOM   3162 C C     . LYS C 3 343 ? 54.755  22.002 6.236   1.00 47.72  ? 343  LYS A C     1 
ATOM   3163 O O     . LYS C 3 343 ? 54.540  21.247 5.287   1.00 48.07  ? 343  LYS A O     1 
ATOM   3164 C CB    . LYS C 3 343 ? 55.592  20.245 7.813   1.00 48.16  ? 343  LYS A CB    1 
ATOM   3165 C CG    . LYS C 3 343 ? 56.480  19.821 8.986   1.00 49.62  ? 343  LYS A CG    1 
ATOM   3166 C CD    . LYS C 3 343 ? 57.963  20.080 8.724   1.00 52.77  ? 343  LYS A CD    1 
ATOM   3167 C CE    . LYS C 3 343 ? 58.508  19.168 7.633   1.00 54.65  ? 343  LYS A CE    1 
ATOM   3168 N NZ    . LYS C 3 343 ? 59.957  19.424 7.385   1.00 53.85  ? 343  LYS A NZ    1 
ATOM   3169 N N     . TRP C 3 344 ? 54.072  23.122 6.419   1.00 47.04  ? 344  TRP A N     1 
ATOM   3170 C CA    . TRP C 3 344 ? 53.021  23.525 5.493   1.00 46.60  ? 344  TRP A CA    1 
ATOM   3171 C C     . TRP C 3 344 ? 53.623  24.230 4.302   1.00 48.17  ? 344  TRP A C     1 
ATOM   3172 O O     . TRP C 3 344 ? 54.636  24.911 4.430   1.00 52.62  ? 344  TRP A O     1 
ATOM   3173 C CB    . TRP C 3 344 ? 52.015  24.468 6.183   1.00 44.06  ? 344  TRP A CB    1 
ATOM   3174 C CG    . TRP C 3 344 ? 51.116  23.792 7.194   1.00 40.65  ? 344  TRP A CG    1 
ATOM   3175 C CD1   . TRP C 3 344 ? 51.007  22.445 7.428   1.00 39.93  ? 344  TRP A CD1   1 
ATOM   3176 C CD2   . TRP C 3 344 ? 50.160  24.425 8.053   1.00 38.91  ? 344  TRP A CD2   1 
ATOM   3177 N NE1   . TRP C 3 344 ? 50.044  22.204 8.371   1.00 40.64  ? 344  TRP A NE1   1 
ATOM   3178 C CE2   . TRP C 3 344 ? 49.503  23.401 8.772   1.00 39.67  ? 344  TRP A CE2   1 
ATOM   3179 C CE3   . TRP C 3 344 ? 49.788  25.762 8.283   1.00 39.70  ? 344  TRP A CE3   1 
ATOM   3180 C CZ2   . TRP C 3 344 ? 48.491  23.669 9.711   1.00 39.13  ? 344  TRP A CZ2   1 
ATOM   3181 C CZ3   . TRP C 3 344 ? 48.774  26.032 9.224   1.00 37.53  ? 344  TRP A CZ3   1 
ATOM   3182 C CH2   . TRP C 3 344 ? 48.141  24.988 9.921   1.00 34.56  ? 344  TRP A CH2   1 
ATOM   3183 N N     . LYS C 3 345 ? 52.989  24.086 3.145   1.00 49.55  ? 345  LYS A N     1 
ATOM   3184 C CA    . LYS C 3 345 ? 53.477  24.732 1.930   1.00 51.76  ? 345  LYS A CA    1 
ATOM   3185 C C     . LYS C 3 345 ? 53.201  26.246 1.938   1.00 52.51  ? 345  LYS A C     1 
ATOM   3186 O O     . LYS C 3 345 ? 53.582  26.968 1.025   1.00 52.28  ? 345  LYS A O     1 
ATOM   3187 C CB    . LYS C 3 345 ? 52.836  24.075 0.699   1.00 52.45  ? 345  LYS A CB    1 
ATOM   3188 C CG    . LYS C 3 345 ? 53.116  22.561 0.569   1.00 58.13  ? 345  LYS A CG    1 
ATOM   3189 C CD    . LYS C 3 345 ? 54.622  22.253 0.638   1.00 61.12  ? 345  LYS A CD    1 
ATOM   3190 C CE    . LYS C 3 345 ? 54.960  20.806 0.253   1.00 65.22  ? 345  LYS A CE    1 
ATOM   3191 N NZ    . LYS C 3 345 ? 54.542  19.742 1.226   1.00 64.30  ? 345  LYS A NZ    1 
ATOM   3192 N N     . HIS C 3 346 ? 52.535  26.724 2.979   1.00 53.54  ? 346  HIS A N     1 
ATOM   3193 C CA    . HIS C 3 346 ? 52.211  28.143 3.092   1.00 54.12  ? 346  HIS A CA    1 
ATOM   3194 C C     . HIS C 3 346 ? 52.101  28.388 4.578   1.00 54.00  ? 346  HIS A C     1 
ATOM   3195 O O     . HIS C 3 346 ? 51.066  28.137 5.175   1.00 54.36  ? 346  HIS A O     1 
ATOM   3196 C CB    . HIS C 3 346 ? 50.865  28.431 2.421   1.00 55.94  ? 346  HIS A CB    1 
ATOM   3197 C CG    . HIS C 3 346 ? 50.524  29.889 2.322   1.00 55.95  ? 346  HIS A CG    1 
ATOM   3198 N ND1   . HIS C 3 346 ? 51.040  30.709 1.341   1.00 56.65  ? 346  HIS A ND1   1 
ATOM   3199 C CD2   . HIS C 3 346 ? 49.684  30.660 3.053   1.00 55.81  ? 346  HIS A CD2   1 
ATOM   3200 C CE1   . HIS C 3 346 ? 50.528  31.922 1.469   1.00 57.35  ? 346  HIS A CE1   1 
ATOM   3201 N NE2   . HIS C 3 346 ? 49.702  31.919 2.499   1.00 57.73  ? 346  HIS A NE2   1 
ATOM   3202 N N     . CYS C 3 347 ? 53.174  28.871 5.182   1.00 53.42  ? 347  CYS A N     1 
ATOM   3203 C CA    . CYS C 3 347 ? 53.174  29.103 6.617   1.00 50.88  ? 347  CYS A CA    1 
ATOM   3204 C C     . CYS C 3 347 ? 52.627  30.479 7.028   1.00 49.81  ? 347  CYS A C     1 
ATOM   3205 O O     . CYS C 3 347 ? 52.988  31.497 6.433   1.00 49.69  ? 347  CYS A O     1 
ATOM   3206 C CB    . CYS C 3 347 ? 54.595  28.928 7.139   1.00 46.92  ? 347  CYS A CB    1 
ATOM   3207 S SG    . CYS C 3 347 ? 54.745  29.107 8.899   1.00 51.86  ? 347  CYS A SG    1 
ATOM   3208 N N     . PRO C 3 348 ? 51.731  30.520 8.044   1.00 48.65  ? 348  PRO A N     1 
ATOM   3209 C CA    . PRO C 3 348 ? 51.162  31.793 8.514   1.00 48.13  ? 348  PRO A CA    1 
ATOM   3210 C C     . PRO C 3 348 ? 52.261  32.699 9.090   1.00 47.63  ? 348  PRO A C     1 
ATOM   3211 O O     . PRO C 3 348 ? 52.125  33.921 9.101   1.00 47.17  ? 348  PRO A O     1 
ATOM   3212 C CB    . PRO C 3 348 ? 50.127  31.357 9.559   1.00 47.42  ? 348  PRO A CB    1 
ATOM   3213 C CG    . PRO C 3 348 ? 50.593  30.000 9.993   1.00 44.90  ? 348  PRO A CG    1 
ATOM   3214 C CD    . PRO C 3 348 ? 51.086  29.378 8.723   1.00 48.28  ? 348  PRO A CD    1 
ATOM   3215 N N     . VAL C 3 349 ? 53.339  32.098 9.582   1.00 46.42  ? 349  VAL A N     1 
ATOM   3216 C CA    . VAL C 3 349 ? 54.458  32.887 10.080  1.00 47.65  ? 349  VAL A CA    1 
ATOM   3217 C C     . VAL C 3 349 ? 55.326  33.107 8.851   1.00 49.91  ? 349  VAL A C     1 
ATOM   3218 O O     . VAL C 3 349 ? 56.021  32.192 8.398   1.00 50.10  ? 349  VAL A O     1 
ATOM   3219 C CB    . VAL C 3 349 ? 55.260  32.134 11.168  1.00 47.84  ? 349  VAL A CB    1 
ATOM   3220 C CG1   . VAL C 3 349 ? 56.580  32.858 11.456  1.00 43.22  ? 349  VAL A CG1   1 
ATOM   3221 C CG2   . VAL C 3 349 ? 54.423  32.040 12.441  1.00 47.39  ? 349  VAL A CG2   1 
ATOM   3222 N N     . GLU C 3 350 ? 55.272  34.324 8.315   1.00 53.83  ? 350  GLU A N     1 
ATOM   3223 C CA    . GLU C 3 350 ? 55.998  34.686 7.096   1.00 56.55  ? 350  GLU A CA    1 
ATOM   3224 C C     . GLU C 3 350 ? 57.507  34.506 7.097   1.00 54.69  ? 350  GLU A C     1 
ATOM   3225 O O     . GLU C 3 350 ? 58.106  34.390 6.032   1.00 54.55  ? 350  GLU A O     1 
ATOM   3226 C CB    . GLU C 3 350 ? 55.667  36.132 6.700   1.00 60.98  ? 350  GLU A CB    1 
ATOM   3227 C CG    . GLU C 3 350 ? 56.284  37.195 7.598   1.00 68.18  ? 350  GLU A CG    1 
ATOM   3228 C CD    . GLU C 3 350 ? 55.634  38.570 7.422   1.00 72.29  ? 350  GLU A CD    1 
ATOM   3229 O OE1   . GLU C 3 350 ? 55.495  39.032 6.265   1.00 74.36  ? 350  GLU A OE1   1 
ATOM   3230 O OE2   . GLU C 3 350 ? 55.266  39.192 8.448   1.00 74.40  ? 350  GLU A OE2   1 
ATOM   3231 N N     . ASP C 3 351 ? 58.111  34.461 8.277   1.00 54.55  ? 351  ASP A N     1 
ATOM   3232 C CA    . ASP C 3 351 ? 59.558  34.314 8.392   1.00 56.55  ? 351  ASP A CA    1 
ATOM   3233 C C     . ASP C 3 351 ? 60.049  32.874 8.461   1.00 54.54  ? 351  ASP A C     1 
ATOM   3234 O O     . ASP C 3 351 ? 61.138  32.594 8.976   1.00 55.16  ? 351  ASP A O     1 
ATOM   3235 C CB    . ASP C 3 351 ? 60.051  35.085 9.616   1.00 61.72  ? 351  ASP A CB    1 
ATOM   3236 C CG    . ASP C 3 351 ? 59.699  36.550 9.542   1.00 67.68  ? 351  ASP A CG    1 
ATOM   3237 O OD1   . ASP C 3 351 ? 60.193  37.225 8.609   1.00 67.58  ? 351  ASP A OD1   1 
ATOM   3238 O OD2   . ASP C 3 351 ? 58.914  37.021 10.402  1.00 72.40  ? 351  ASP A OD2   1 
ATOM   3239 N N     . ILE C 3 352 ? 59.231  31.961 7.958   1.00 50.49  ? 352  ILE A N     1 
ATOM   3240 C CA    . ILE C 3 352 ? 59.568  30.548 7.920   1.00 45.46  ? 352  ILE A CA    1 
ATOM   3241 C C     . ILE C 3 352 ? 59.924  30.274 6.473   1.00 45.08  ? 352  ILE A C     1 
ATOM   3242 O O     . ILE C 3 352 ? 59.098  30.452 5.582   1.00 47.30  ? 352  ILE A O     1 
ATOM   3243 C CB    . ILE C 3 352 ? 58.370  29.713 8.344   1.00 42.26  ? 352  ILE A CB    1 
ATOM   3244 C CG1   . ILE C 3 352 ? 58.006  30.067 9.790   1.00 41.38  ? 352  ILE A CG1   1 
ATOM   3245 C CG2   . ILE C 3 352 ? 58.651  28.259 8.184   1.00 38.48  ? 352  ILE A CG2   1 
ATOM   3246 C CD1   . ILE C 3 352 ? 59.125  29.863 10.800  1.00 39.40  ? 352  ILE A CD1   1 
ATOM   3247 N N     . PRO C 3 353 ? 61.174  29.867 6.210   1.00 46.35  ? 353  PRO A N     1 
ATOM   3248 C CA    . PRO C 3 353 ? 61.596  29.589 4.833   1.00 43.71  ? 353  PRO A CA    1 
ATOM   3249 C C     . PRO C 3 353 ? 60.598  28.745 4.069   1.00 43.65  ? 353  PRO A C     1 
ATOM   3250 O O     . PRO C 3 353 ? 60.217  27.667 4.522   1.00 45.15  ? 353  PRO A O     1 
ATOM   3251 C CB    . PRO C 3 353 ? 62.946  28.891 5.015   1.00 44.19  ? 353  PRO A CB    1 
ATOM   3252 C CG    . PRO C 3 353 ? 62.852  28.308 6.391   1.00 43.82  ? 353  PRO A CG    1 
ATOM   3253 C CD    . PRO C 3 353 ? 62.199  29.416 7.165   1.00 43.99  ? 353  PRO A CD    1 
ATOM   3254 N N     . ALA C 3 354 ? 60.181  29.242 2.906   1.00 44.13  ? 354  ALA A N     1 
ATOM   3255 C CA    . ALA C 3 354 ? 59.216  28.533 2.077   1.00 45.96  ? 354  ALA A CA    1 
ATOM   3256 C C     . ALA C 3 354 ? 59.805  27.216 1.600   1.00 48.53  ? 354  ALA A C     1 
ATOM   3257 O O     . ALA C 3 354 ? 61.012  27.112 1.394   1.00 48.65  ? 354  ALA A O     1 
ATOM   3258 C CB    . ALA C 3 354 ? 58.818  29.386 0.881   1.00 44.05  ? 354  ALA A CB    1 
ATOM   3259 N N     . ILE C 3 355 ? 58.938  26.224 1.414   1.00 50.20  ? 355  ILE A N     1 
ATOM   3260 C CA    . ILE C 3 355 ? 59.336  24.894 0.972   1.00 52.67  ? 355  ILE A CA    1 
ATOM   3261 C C     . ILE C 3 355 ? 59.673  24.805 -0.524  1.00 56.08  ? 355  ILE A C     1 
ATOM   3262 O O     . ILE C 3 355 ? 60.644  24.156 -0.907  1.00 54.51  ? 355  ILE A O     1 
ATOM   3263 C CB    . ILE C 3 355 ? 58.240  23.876 1.342   1.00 53.30  ? 355  ILE A CB    1 
ATOM   3264 C CG1   . ILE C 3 355 ? 58.160  23.780 2.868   1.00 49.99  ? 355  ILE A CG1   1 
ATOM   3265 C CG2   . ILE C 3 355 ? 58.519  22.512 0.693   1.00 53.41  ? 355  ILE A CG2   1 
ATOM   3266 C CD1   . ILE C 3 355 ? 57.250  22.700 3.361   1.00 55.56  ? 355  ILE A CD1   1 
ATOM   3267 N N     . GLU C 3 356 ? 58.886  25.468 -1.364  1.00 61.97  ? 356  GLU A N     1 
ATOM   3268 C CA    . GLU C 3 356 ? 59.127  25.473 -2.810  1.00 65.86  ? 356  GLU A CA    1 
ATOM   3269 C C     . GLU C 3 356 ? 60.262  26.439 -3.146  1.00 68.84  ? 356  GLU A C     1 
ATOM   3270 O O     . GLU C 3 356 ? 60.489  27.409 -2.426  1.00 68.60  ? 356  GLU A O     1 
ATOM   3271 C CB    . GLU C 3 356 ? 57.862  25.896 -3.549  1.00 63.93  ? 356  GLU A CB    1 
ATOM   3272 N N     . ARG C 3 357 ? 60.970  26.176 -4.241  1.00 73.59  ? 357  ARG A N     1 
ATOM   3273 C CA    . ARG C 3 357 ? 62.068  27.047 -4.654  1.00 77.68  ? 357  ARG A CA    1 
ATOM   3274 C C     . ARG C 3 357 ? 61.524  28.215 -5.461  1.00 79.82  ? 357  ARG A C     1 
ATOM   3275 O O     . ARG C 3 357 ? 60.314  28.395 -5.588  1.00 80.53  ? 357  ARG A O     1 
ATOM   3276 C CB    . ARG C 3 357 ? 63.075  26.290 -5.515  1.00 79.16  ? 357  ARG A CB    1 
ATOM   3277 C CG    . ARG C 3 357 ? 63.694  25.082 -4.860  1.00 83.28  ? 357  ARG A CG    1 
ATOM   3278 C CD    . ARG C 3 357 ? 64.762  24.482 -5.763  1.00 87.37  ? 357  ARG A CD    1 
ATOM   3279 N NE    . ARG C 3 357 ? 64.218  24.040 -7.048  1.00 91.29  ? 357  ARG A NE    1 
ATOM   3280 C CZ    . ARG C 3 357 ? 64.946  23.506 -8.027  1.00 93.02  ? 357  ARG A CZ    1 
ATOM   3281 N NH1   . ARG C 3 357 ? 66.254  23.348 -7.872  1.00 93.79  ? 357  ARG A NH1   1 
ATOM   3282 N NH2   . ARG C 3 357 ? 64.368  23.128 -9.161  1.00 93.24  ? 357  ARG A NH2   1 
ATOM   3283 N N     . GLU C 3 358 ? 62.432  29.012 -6.003  1.00 81.93  ? 358  GLU A N     1 
ATOM   3284 C CA    . GLU C 3 358 ? 62.055  30.157 -6.811  1.00 84.83  ? 358  GLU A CA    1 
ATOM   3285 C C     . GLU C 3 358 ? 62.729  29.997 -8.164  1.00 86.97  ? 358  GLU A C     1 
ATOM   3286 O O     . GLU C 3 358 ? 63.956  30.061 -8.272  1.00 87.35  ? 358  GLU A O     1 
ATOM   3287 C CB    . GLU C 3 358 ? 62.503  31.454 -6.136  1.00 85.12  ? 358  GLU A CB    1 
ATOM   3288 N N     . GLU C 3 359 ? 61.921  29.771 -9.193  1.00 89.46  ? 359  GLU A N     1 
ATOM   3289 C CA    . GLU C 3 359 ? 62.439  29.592 -10.542 1.00 91.87  ? 359  GLU A CA    1 
ATOM   3290 C C     . GLU C 3 359 ? 63.247  30.808 -10.998 1.00 93.49  ? 359  GLU A C     1 
ATOM   3291 O O     . GLU C 3 359 ? 63.000  31.937 -10.561 1.00 93.60  ? 359  GLU A O     1 
ATOM   3292 C CB    . GLU C 3 359 ? 61.284  29.330 -11.504 1.00 91.75  ? 359  GLU A CB    1 
ATOM   3293 N N     . LEU C 3 360 ? 64.221  30.568 -11.870 1.00 95.69  ? 360  LEU A N     1 
ATOM   3294 C CA    . LEU C 3 360 ? 65.057  31.640 -12.396 1.00 97.96  ? 360  LEU A CA    1 
ATOM   3295 C C     . LEU C 3 360 ? 64.227  32.514 -13.322 1.00 100.20 ? 360  LEU A C     1 
ATOM   3296 O O     . LEU C 3 360 ? 63.393  32.013 -14.076 1.00 99.81  ? 360  LEU A O     1 
ATOM   3297 C CB    . LEU C 3 360 ? 66.242  31.066 -13.179 1.00 97.08  ? 360  LEU A CB    1 
ATOM   3298 C CG    . LEU C 3 360 ? 67.320  30.315 -12.399 1.00 96.52  ? 360  LEU A CG    1 
ATOM   3299 C CD1   . LEU C 3 360 ? 68.355  29.775 -13.362 1.00 95.85  ? 360  LEU A CD1   1 
ATOM   3300 C CD2   . LEU C 3 360 ? 67.962  31.250 -11.386 1.00 95.99  ? 360  LEU A CD2   1 
ATOM   3301 N N     . PRO C 3 361 ? 64.442  33.839 -13.276 1.00 102.99 ? 361  PRO A N     1 
ATOM   3302 C CA    . PRO C 3 361 ? 63.674  34.729 -14.151 1.00 105.08 ? 361  PRO A CA    1 
ATOM   3303 C C     . PRO C 3 361 ? 63.899  34.367 -15.623 1.00 106.97 ? 361  PRO A C     1 
ATOM   3304 O O     . PRO C 3 361 ? 64.991  34.568 -16.166 1.00 107.52 ? 361  PRO A O     1 
ATOM   3305 C CB    . PRO C 3 361 ? 64.209  36.116 -13.786 1.00 104.52 ? 361  PRO A CB    1 
ATOM   3306 C CG    . PRO C 3 361 ? 65.628  35.835 -13.356 1.00 104.28 ? 361  PRO A CG    1 
ATOM   3307 C CD    . PRO C 3 361 ? 65.461  34.589 -12.519 1.00 103.87 ? 361  PRO A CD    1 
ATOM   3308 N N     . MET C 3 362 ? 62.864  33.813 -16.252 1.00 108.61 ? 362  MET A N     1 
ATOM   3309 C CA    . MET C 3 362 ? 62.923  33.406 -17.655 1.00 109.89 ? 362  MET A CA    1 
ATOM   3310 C C     . MET C 3 362 ? 63.697  34.422 -18.496 1.00 110.42 ? 362  MET A C     1 
ATOM   3311 O O     . MET C 3 362 ? 63.439  35.625 -18.416 1.00 110.51 ? 362  MET A O     1 
ATOM   3312 C CB    . MET C 3 362 ? 61.499  33.248 -18.207 1.00 110.17 ? 362  MET A CB    1 
ATOM   3313 C CG    . MET C 3 362 ? 61.419  32.822 -19.669 1.00 110.51 ? 362  MET A CG    1 
ATOM   3314 S SD    . MET C 3 362 ? 62.031  31.150 -19.983 1.00 110.51 ? 362  MET A SD    1 
ATOM   3315 C CE    . MET C 3 362 ? 63.713  31.480 -20.530 1.00 110.51 ? 362  MET A CE    1 
ATOM   3316 N N     . LYS C 3 363 ? 64.654  33.936 -19.285 1.00 110.51 ? 363  LYS A N     1 
ATOM   3317 C CA    . LYS C 3 363 ? 65.449  34.807 -20.146 1.00 110.51 ? 363  LYS A CA    1 
ATOM   3318 C C     . LYS C 3 363 ? 64.495  35.535 -21.097 1.00 110.51 ? 363  LYS A C     1 
ATOM   3319 O O     . LYS C 3 363 ? 63.453  34.995 -21.474 1.00 110.51 ? 363  LYS A O     1 
ATOM   3320 C CB    . LYS C 3 363 ? 66.463  33.983 -20.935 1.00 110.51 ? 363  LYS A CB    1 
ATOM   3321 N N     . PRO C 3 364 ? 64.839  36.772 -21.499 1.00 110.51 ? 364  PRO A N     1 
ATOM   3322 C CA    . PRO C 3 364 ? 64.005  37.575 -22.403 1.00 110.51 ? 364  PRO A CA    1 
ATOM   3323 C C     . PRO C 3 364 ? 63.785  37.005 -23.811 1.00 110.51 ? 364  PRO A C     1 
ATOM   3324 O O     . PRO C 3 364 ? 63.204  37.674 -24.670 1.00 110.51 ? 364  PRO A O     1 
ATOM   3325 C CB    . PRO C 3 364 ? 64.729  38.921 -22.428 1.00 110.51 ? 364  PRO A CB    1 
ATOM   3326 C CG    . PRO C 3 364 ? 66.163  38.524 -22.263 1.00 110.51 ? 364  PRO A CG    1 
ATOM   3327 C CD    . PRO C 3 364 ? 66.085  37.488 -21.165 1.00 110.51 ? 364  PRO A CD    1 
ATOM   3328 N N     . GLU C 3 365 ? 64.241  35.774 -24.040 1.00 110.51 ? 365  GLU A N     1 
ATOM   3329 C CA    . GLU C 3 365 ? 64.106  35.125 -25.345 1.00 110.51 ? 365  GLU A CA    1 
ATOM   3330 C C     . GLU C 3 365 ? 64.879  35.922 -26.398 1.00 110.51 ? 365  GLU A C     1 
ATOM   3331 O O     . GLU C 3 365 ? 65.161  35.423 -27.486 1.00 110.51 ? 365  GLU A O     1 
ATOM   3332 C CB    . GLU C 3 365 ? 62.630  35.014 -25.734 1.00 110.20 ? 365  GLU A CB    1 
ATOM   3333 N N     . ASP C 3 366 ? 65.207  37.167 -26.055 1.00 110.35 ? 366  ASP A N     1 
ATOM   3334 C CA    . ASP C 3 366 ? 65.965  38.070 -26.913 1.00 109.40 ? 366  ASP A CA    1 
ATOM   3335 C C     . ASP C 3 366 ? 67.172  38.472 -26.079 1.00 109.54 ? 366  ASP A C     1 
ATOM   3336 O O     . ASP C 3 366 ? 67.645  39.608 -26.142 1.00 109.03 ? 366  ASP A O     1 
ATOM   3337 C CB    . ASP C 3 366 ? 65.135  39.295 -27.260 1.00 109.24 ? 366  ASP A CB    1 
ATOM   3338 N N     . ILE C 3 367 ? 67.644  37.514 -25.284 1.00 110.05 ? 367  ILE A N     1 
ATOM   3339 C CA    . ILE C 3 367 ? 68.788  37.698 -24.398 1.00 110.35 ? 367  ILE A CA    1 
ATOM   3340 C C     . ILE C 3 367 ? 70.039  38.130 -25.159 1.00 110.51 ? 367  ILE A C     1 
ATOM   3341 O O     . ILE C 3 367 ? 70.816  38.950 -24.668 1.00 110.21 ? 367  ILE A O     1 
ATOM   3342 C CB    . ILE C 3 367 ? 69.057  36.406 -23.634 1.00 110.33 ? 367  ILE A CB    1 
ATOM   3343 N N     . ASP C 3 368 ? 70.233  37.572 -26.352 1.00 110.51 ? 368  ASP A N     1 
ATOM   3344 C CA    . ASP C 3 368 ? 71.385  37.917 -27.183 1.00 110.51 ? 368  ASP A CA    1 
ATOM   3345 C C     . ASP C 3 368 ? 71.581  39.435 -27.179 1.00 110.51 ? 368  ASP A C     1 
ATOM   3346 O O     . ASP C 3 368 ? 72.707  39.925 -27.294 1.00 110.03 ? 368  ASP A O     1 
ATOM   3347 C CB    . ASP C 3 368 ? 71.169  37.413 -28.609 1.00 110.45 ? 368  ASP A CB    1 
ATOM   3348 N N     . MET C 3 369 ? 70.470  40.166 -27.050 1.00 110.51 ? 369  MET A N     1 
ATOM   3349 C CA    . MET C 3 369 ? 70.488  41.626 -27.003 1.00 110.51 ? 369  MET A CA    1 
ATOM   3350 C C     . MET C 3 369 ? 71.467  42.006 -25.905 1.00 110.51 ? 369  MET A C     1 
ATOM   3351 O O     . MET C 3 369 ? 71.373  41.502 -24.785 1.00 110.51 ? 369  MET A O     1 
ATOM   3352 C CB    . MET C 3 369 ? 69.091  42.164 -26.675 1.00 109.82 ? 369  MET A CB    1 
ATOM   3353 N N     . ASN C 3 370 ? 72.397  42.904 -26.214 1.00 110.51 ? 370  ASN A N     1 
ATOM   3354 C CA    . ASN C 3 370 ? 73.400  43.299 -25.232 1.00 110.51 ? 370  ASN A CA    1 
ATOM   3355 C C     . ASN C 3 370 ? 73.120  44.565 -24.414 1.00 110.51 ? 370  ASN A C     1 
ATOM   3356 O O     . ASN C 3 370 ? 74.039  45.139 -23.828 1.00 110.51 ? 370  ASN A O     1 
ATOM   3357 C CB    . ASN C 3 370 ? 74.773  43.408 -25.917 1.00 110.51 ? 370  ASN A CB    1 
ATOM   3358 C CG    . ASN C 3 370 ? 75.926  43.494 -24.923 1.00 110.51 ? 370  ASN A CG    1 
ATOM   3359 O OD1   . ASN C 3 370 ? 76.286  44.577 -24.459 1.00 109.63 ? 370  ASN A OD1   1 
ATOM   3360 N ND2   . ASN C 3 370 ? 76.504  42.343 -24.586 1.00 110.51 ? 370  ASN A ND2   1 
ATOM   3361 N N     . PRO C 3 371 ? 71.856  45.026 -24.355 1.00 110.51 ? 371  PRO A N     1 
ATOM   3362 C CA    . PRO C 3 371 ? 71.699  46.233 -23.539 1.00 110.51 ? 371  PRO A CA    1 
ATOM   3363 C C     . PRO C 3 371 ? 71.963  45.835 -22.094 1.00 110.43 ? 371  PRO A C     1 
ATOM   3364 O O     . PRO C 3 371 ? 72.400  44.713 -21.825 1.00 109.89 ? 371  PRO A O     1 
ATOM   3365 C CB    . PRO C 3 371 ? 70.245  46.621 -23.778 1.00 110.51 ? 371  PRO A CB    1 
ATOM   3366 C CG    . PRO C 3 371 ? 69.580  45.289 -23.950 1.00 109.96 ? 371  PRO A CG    1 
ATOM   3367 C CD    . PRO C 3 371 ? 70.549  44.557 -24.850 1.00 109.72 ? 371  PRO A CD    1 
ATOM   3368 N N     . GLU C 3 372 ? 71.700  46.737 -21.159 1.00 110.41 ? 372  GLU A N     1 
ATOM   3369 C CA    . GLU C 3 372 ? 71.916  46.398 -19.760 1.00 110.51 ? 372  GLU A CA    1 
ATOM   3370 C C     . GLU C 3 372 ? 70.894  45.335 -19.353 1.00 110.43 ? 372  GLU A C     1 
ATOM   3371 O O     . GLU C 3 372 ? 70.589  45.171 -18.169 1.00 110.51 ? 372  GLU A O     1 
ATOM   3372 C CB    . GLU C 3 372 ? 71.781  47.643 -18.874 1.00 110.51 ? 372  GLU A CB    1 
ATOM   3373 C CG    . GLU C 3 372 ? 72.778  48.745 -19.218 1.00 110.51 ? 372  GLU A CG    1 
ATOM   3374 C CD    . GLU C 3 372 ? 74.203  48.222 -19.359 1.00 110.51 ? 372  GLU A CD    1 
ATOM   3375 O OE1   . GLU C 3 372 ? 74.725  47.642 -18.384 1.00 110.51 ? 372  GLU A OE1   1 
ATOM   3376 O OE2   . GLU C 3 372 ? 74.800  48.389 -20.446 1.00 109.61 ? 372  GLU A OE2   1 
ATOM   3377 N N     . ALA C 3 373 ? 70.379  44.615 -20.353 1.00 109.20 ? 373  ALA A N     1 
ATOM   3378 C CA    . ALA C 3 373 ? 69.392  43.558 -20.147 1.00 107.63 ? 373  ALA A CA    1 
ATOM   3379 C C     . ALA C 3 373 ? 70.070  42.272 -19.694 1.00 106.50 ? 373  ALA A C     1 
ATOM   3380 O O     . ALA C 3 373 ? 69.697  41.690 -18.674 1.00 106.20 ? 373  ALA A O     1 
ATOM   3381 C CB    . ALA C 3 373 ? 68.615  43.309 -21.435 1.00 106.62 ? 373  ALA A CB    1 
ATOM   3382 N N     . LEU C 3 374 ? 71.066  41.831 -20.455 1.00 104.71 ? 374  LEU A N     1 
ATOM   3383 C CA    . LEU C 3 374 ? 71.780  40.614 -20.106 1.00 102.94 ? 374  LEU A CA    1 
ATOM   3384 C C     . LEU C 3 374 ? 72.767  40.916 -18.994 1.00 101.22 ? 374  LEU A C     1 
ATOM   3385 O O     . LEU C 3 374 ? 73.584  40.076 -18.626 1.00 100.73 ? 374  LEU A O     1 
ATOM   3386 C CB    . LEU C 3 374 ? 72.507  40.045 -21.323 1.00 103.73 ? 374  LEU A CB    1 
ATOM   3387 C CG    . LEU C 3 374 ? 72.261  38.546 -21.545 1.00 104.30 ? 374  LEU A CG    1 
ATOM   3388 C CD1   . LEU C 3 374 ? 70.759  38.271 -21.590 1.00 102.65 ? 374  LEU A CD1   1 
ATOM   3389 C CD2   . LEU C 3 374 ? 72.934  38.092 -22.837 1.00 104.15 ? 374  LEU A CD2   1 
ATOM   3390 N N     . THR C 3 375 ? 72.683  42.135 -18.473 1.00 99.77  ? 375  THR A N     1 
ATOM   3391 C CA    . THR C 3 375 ? 73.533  42.579 -17.376 1.00 97.94  ? 375  THR A CA    1 
ATOM   3392 C C     . THR C 3 375 ? 72.641  42.680 -16.147 1.00 96.17  ? 375  THR A C     1 
ATOM   3393 O O     . THR C 3 375 ? 72.992  42.192 -15.075 1.00 95.94  ? 375  THR A O     1 
ATOM   3394 C CB    . THR C 3 375 ? 74.158  43.961 -17.661 1.00 98.19  ? 375  THR A CB    1 
ATOM   3395 O OG1   . THR C 3 375 ? 74.972  43.885 -18.842 1.00 98.30  ? 375  THR A OG1   1 
ATOM   3396 C CG2   . THR C 3 375 ? 75.015  44.414 -16.480 1.00 97.11  ? 375  THR A CG2   1 
ATOM   3397 N N     . ALA C 3 376 ? 71.481  43.310 -16.321 1.00 94.48  ? 376  ALA A N     1 
ATOM   3398 C CA    . ALA C 3 376 ? 70.510  43.466 -15.242 1.00 92.89  ? 376  ALA A CA    1 
ATOM   3399 C C     . ALA C 3 376 ? 69.900  42.105 -14.930 1.00 91.32  ? 376  ALA A C     1 
ATOM   3400 O O     . ALA C 3 376 ? 69.477  41.846 -13.801 1.00 91.06  ? 376  ALA A O     1 
ATOM   3401 C CB    . ALA C 3 376 ? 69.416  44.449 -15.649 1.00 93.19  ? 376  ALA A CB    1 
ATOM   3402 N N     . TRP C 3 377 ? 69.845  41.249 -15.949 1.00 88.79  ? 377  TRP A N     1 
ATOM   3403 C CA    . TRP C 3 377 ? 69.323  39.896 -15.801 1.00 86.06  ? 377  TRP A CA    1 
ATOM   3404 C C     . TRP C 3 377 ? 70.341  39.076 -15.008 1.00 85.62  ? 377  TRP A C     1 
ATOM   3405 O O     . TRP C 3 377 ? 69.971  38.277 -14.148 1.00 86.24  ? 377  TRP A O     1 
ATOM   3406 C CB    . TRP C 3 377 ? 69.120  39.251 -17.167 1.00 83.82  ? 377  TRP A CB    1 
ATOM   3407 C CG    . TRP C 3 377 ? 68.731  37.817 -17.081 1.00 81.57  ? 377  TRP A CG    1 
ATOM   3408 C CD1   . TRP C 3 377 ? 67.472  37.304 -17.159 1.00 81.00  ? 377  TRP A CD1   1 
ATOM   3409 C CD2   . TRP C 3 377 ? 69.609  36.701 -16.874 1.00 81.07  ? 377  TRP A CD2   1 
ATOM   3410 N NE1   . TRP C 3 377 ? 67.507  35.935 -17.016 1.00 81.11  ? 377  TRP A NE1   1 
ATOM   3411 C CE2   . TRP C 3 377 ? 68.808  35.540 -16.839 1.00 81.04  ? 377  TRP A CE2   1 
ATOM   3412 C CE3   . TRP C 3 377 ? 70.999  36.571 -16.714 1.00 80.14  ? 377  TRP A CE3   1 
ATOM   3413 C CZ2   . TRP C 3 377 ? 69.349  34.260 -16.650 1.00 80.72  ? 377  TRP A CZ2   1 
ATOM   3414 C CZ3   . TRP C 3 377 ? 71.537  35.299 -16.526 1.00 78.78  ? 377  TRP A CZ3   1 
ATOM   3415 C CH2   . TRP C 3 377 ? 70.711  34.162 -16.495 1.00 78.04  ? 377  TRP A CH2   1 
ATOM   3416 N N     . LYS C 3 378 ? 71.622  39.269 -15.320 1.00 84.18  ? 378  LYS A N     1 
ATOM   3417 C CA    . LYS C 3 378 ? 72.706  38.577 -14.632 1.00 82.69  ? 378  LYS A CA    1 
ATOM   3418 C C     . LYS C 3 378 ? 72.656  38.966 -13.158 1.00 82.61  ? 378  LYS A C     1 
ATOM   3419 O O     . LYS C 3 378 ? 73.150  38.242 -12.286 1.00 82.76  ? 378  LYS A O     1 
ATOM   3420 C CB    . LYS C 3 378 ? 74.048  38.980 -15.231 1.00 81.99  ? 378  LYS A CB    1 
ATOM   3421 N N     . ARG C 3 379 ? 72.058  40.122 -12.888 1.00 81.54  ? 379  ARG A N     1 
ATOM   3422 C CA    . ARG C 3 379 ? 71.927  40.616 -11.526 1.00 80.64  ? 379  ARG A CA    1 
ATOM   3423 C C     . ARG C 3 379 ? 70.652  40.062 -10.887 1.00 79.09  ? 379  ARG A C     1 
ATOM   3424 O O     . ARG C 3 379 ? 70.617  39.807 -9.681  1.00 78.48  ? 379  ARG A O     1 
ATOM   3425 C CB    . ARG C 3 379 ? 71.910  42.151 -11.525 1.00 80.97  ? 379  ARG A CB    1 
ATOM   3426 C CG    . ARG C 3 379 ? 71.484  42.777 -10.205 1.00 82.38  ? 379  ARG A CG    1 
ATOM   3427 C CD    . ARG C 3 379 ? 71.591  44.299 -10.233 1.00 82.09  ? 379  ARG A CD    1 
ATOM   3428 N NE    . ARG C 3 379 ? 72.963  44.761 -10.028 1.00 84.20  ? 379  ARG A NE    1 
ATOM   3429 C CZ    . ARG C 3 379 ? 73.327  46.042 -10.007 1.00 86.60  ? 379  ARG A CZ    1 
ATOM   3430 N NH1   . ARG C 3 379 ? 72.422  46.999 -10.183 1.00 87.24  ? 379  ARG A NH1   1 
ATOM   3431 N NH2   . ARG C 3 379 ? 74.598  46.373 -9.801  1.00 84.99  ? 379  ARG A NH2   1 
ATOM   3432 N N     . ALA C 3 380 ? 69.617  39.870 -11.705 1.00 76.37  ? 380  ALA A N     1 
ATOM   3433 C CA    . ALA C 3 380 ? 68.332  39.350 -11.237 1.00 72.86  ? 380  ALA A CA    1 
ATOM   3434 C C     . ALA C 3 380 ? 68.459  37.888 -10.835 1.00 70.94  ? 380  ALA A C     1 
ATOM   3435 O O     . ALA C 3 380 ? 67.966  37.481 -9.782  1.00 70.39  ? 380  ALA A O     1 
ATOM   3436 C CB    . ALA C 3 380 ? 67.266  39.501 -12.324 1.00 71.52  ? 380  ALA A CB    1 
ATOM   3437 N N     . ALA C 3 381 ? 69.119  37.100 -11.674 1.00 68.72  ? 381  ALA A N     1 
ATOM   3438 C CA    . ALA C 3 381 ? 69.312  35.684 -11.381 1.00 67.22  ? 381  ALA A CA    1 
ATOM   3439 C C     . ALA C 3 381 ? 70.226  35.542 -10.155 1.00 65.16  ? 381  ALA A C     1 
ATOM   3440 O O     . ALA C 3 381 ? 69.894  34.837 -9.204  1.00 64.46  ? 381  ALA A O     1 
ATOM   3441 C CB    . ALA C 3 381 ? 69.924  34.967 -12.588 1.00 66.59  ? 381  ALA A CB    1 
ATOM   3442 N N     . ALA C 3 382 ? 71.367  36.222 -10.182 1.00 61.51  ? 382  ALA A N     1 
ATOM   3443 C CA    . ALA C 3 382 ? 72.303  36.175 -9.074  1.00 59.12  ? 382  ALA A CA    1 
ATOM   3444 C C     . ALA C 3 382 ? 71.547  36.349 -7.762  1.00 58.16  ? 382  ALA A C     1 
ATOM   3445 O O     . ALA C 3 382 ? 71.775  35.619 -6.794  1.00 57.19  ? 382  ALA A O     1 
ATOM   3446 C CB    . ALA C 3 382 ? 73.335  37.270 -9.225  1.00 59.19  ? 382  ALA A CB    1 
ATOM   3447 N N     . ALA C 3 383 ? 70.638  37.317 -7.746  1.00 57.15  ? 383  ALA A N     1 
ATOM   3448 C CA    . ALA C 3 383 ? 69.839  37.615 -6.567  1.00 55.21  ? 383  ALA A CA    1 
ATOM   3449 C C     . ALA C 3 383 ? 69.036  36.392 -6.122  1.00 53.88  ? 383  ALA A C     1 
ATOM   3450 O O     . ALA C 3 383 ? 69.065  36.019 -4.956  1.00 53.41  ? 383  ALA A O     1 
ATOM   3451 C CB    . ALA C 3 383 ? 68.907  38.789 -6.859  1.00 53.52  ? 383  ALA A CB    1 
ATOM   3452 N N     . VAL C 3 384 ? 68.332  35.770 -7.063  1.00 51.52  ? 384  VAL A N     1 
ATOM   3453 C CA    . VAL C 3 384 ? 67.528  34.592 -6.790  1.00 51.20  ? 384  VAL A CA    1 
ATOM   3454 C C     . VAL C 3 384 ? 68.342  33.427 -6.214  1.00 50.21  ? 384  VAL A C     1 
ATOM   3455 O O     . VAL C 3 384 ? 67.857  32.635 -5.414  1.00 49.11  ? 384  VAL A O     1 
ATOM   3456 C CB    . VAL C 3 384 ? 66.829  34.129 -8.071  1.00 50.90  ? 384  VAL A CB    1 
ATOM   3457 C CG1   . VAL C 3 384 ? 66.168  32.774 -7.855  1.00 51.06  ? 384  VAL A CG1   1 
ATOM   3458 C CG2   . VAL C 3 384 ? 65.793  35.160 -8.483  1.00 52.06  ? 384  VAL A CG2   1 
ATOM   3459 N N     . TYR C 3 385 ? 69.587  33.320 -6.633  1.00 50.08  ? 385  TYR A N     1 
ATOM   3460 C CA    . TYR C 3 385 ? 70.440  32.266 -6.136  1.00 51.31  ? 385  TYR A CA    1 
ATOM   3461 C C     . TYR C 3 385 ? 70.815  32.612 -4.705  1.00 48.90  ? 385  TYR A C     1 
ATOM   3462 O O     . TYR C 3 385 ? 70.899  31.745 -3.840  1.00 46.61  ? 385  TYR A O     1 
ATOM   3463 C CB    . TYR C 3 385 ? 71.693  32.177 -7.005  1.00 55.20  ? 385  TYR A CB    1 
ATOM   3464 C CG    . TYR C 3 385 ? 71.472  31.506 -8.340  1.00 60.56  ? 385  TYR A CG    1 
ATOM   3465 C CD1   . TYR C 3 385 ? 71.461  30.112 -8.449  1.00 62.34  ? 385  TYR A CD1   1 
ATOM   3466 C CD2   . TYR C 3 385 ? 71.305  32.263 -9.506  1.00 64.25  ? 385  TYR A CD2   1 
ATOM   3467 C CE1   . TYR C 3 385 ? 71.293  29.484 -9.691  1.00 65.72  ? 385  TYR A CE1   1 
ATOM   3468 C CE2   . TYR C 3 385 ? 71.139  31.645 -10.756 1.00 66.61  ? 385  TYR A CE2   1 
ATOM   3469 C CZ    . TYR C 3 385 ? 71.136  30.256 -10.840 1.00 66.19  ? 385  TYR A CZ    1 
ATOM   3470 O OH    . TYR C 3 385 ? 71.002  29.644 -12.067 1.00 67.25  ? 385  TYR A OH    1 
ATOM   3471 N N     . ARG C 3 386 ? 71.030  33.902 -4.477  1.00 48.35  ? 386  ARG A N     1 
ATOM   3472 C CA    . ARG C 3 386 ? 71.403  34.417 -3.171  1.00 49.60  ? 386  ARG A CA    1 
ATOM   3473 C C     . ARG C 3 386 ? 70.264  34.186 -2.171  1.00 49.25  ? 386  ARG A C     1 
ATOM   3474 O O     . ARG C 3 386 ? 70.514  33.864 -1.017  1.00 47.99  ? 386  ARG A O     1 
ATOM   3475 C CB    . ARG C 3 386 ? 71.739  35.905 -3.298  1.00 49.67  ? 386  ARG A CB    1 
ATOM   3476 C CG    . ARG C 3 386 ? 72.129  36.611 -2.025  1.00 54.54  ? 386  ARG A CG    1 
ATOM   3477 C CD    . ARG C 3 386 ? 72.677  38.010 -2.329  1.00 58.38  ? 386  ARG A CD    1 
ATOM   3478 N NE    . ARG C 3 386 ? 73.873  37.958 -3.177  1.00 63.80  ? 386  ARG A NE    1 
ATOM   3479 C CZ    . ARG C 3 386 ? 73.900  38.200 -4.490  1.00 65.45  ? 386  ARG A CZ    1 
ATOM   3480 N NH1   . ARG C 3 386 ? 72.791  38.530 -5.154  1.00 67.46  ? 386  ARG A NH1   1 
ATOM   3481 N NH2   . ARG C 3 386 ? 75.046  38.091 -5.152  1.00 67.55  ? 386  ARG A NH2   1 
ATOM   3482 N N     . LYS C 3 387 ? 69.015  34.335 -2.612  1.00 49.89  ? 387  LYS A N     1 
ATOM   3483 C CA    . LYS C 3 387 ? 67.887  34.119 -1.708  1.00 49.61  ? 387  LYS A CA    1 
ATOM   3484 C C     . LYS C 3 387 ? 67.626  32.630 -1.490  1.00 47.94  ? 387  LYS A C     1 
ATOM   3485 O O     . LYS C 3 387 ? 67.263  32.217 -0.399  1.00 47.97  ? 387  LYS A O     1 
ATOM   3486 C CB    . LYS C 3 387 ? 66.627  34.812 -2.229  1.00 52.43  ? 387  LYS A CB    1 
ATOM   3487 C CG    . LYS C 3 387 ? 66.496  36.249 -1.726  1.00 57.15  ? 387  LYS A CG    1 
ATOM   3488 C CD    . LYS C 3 387 ? 65.112  36.829 -1.986  1.00 61.95  ? 387  LYS A CD    1 
ATOM   3489 C CE    . LYS C 3 387 ? 64.897  38.150 -1.212  1.00 65.14  ? 387  LYS A CE    1 
ATOM   3490 N NZ    . LYS C 3 387 ? 64.941  37.977 0.280   1.00 63.79  ? 387  LYS A NZ    1 
ATOM   3491 N N     . ASP C 3 388 ? 67.814  31.831 -2.530  1.00 44.58  ? 388  ASP A N     1 
ATOM   3492 C CA    . ASP C 3 388 ? 67.633  30.396 -2.427  1.00 45.35  ? 388  ASP A CA    1 
ATOM   3493 C C     . ASP C 3 388 ? 68.635  29.843 -1.399  1.00 45.08  ? 388  ASP A C     1 
ATOM   3494 O O     . ASP C 3 388 ? 68.290  29.011 -0.567  1.00 46.51  ? 388  ASP A O     1 
ATOM   3495 C CB    . ASP C 3 388 ? 67.868  29.752 -3.782  1.00 49.05  ? 388  ASP A CB    1 
ATOM   3496 C CG    . ASP C 3 388 ? 67.671  28.264 -3.755  1.00 54.92  ? 388  ASP A CG    1 
ATOM   3497 O OD1   . ASP C 3 388 ? 68.337  27.588 -2.949  1.00 60.68  ? 388  ASP A OD1   1 
ATOM   3498 O OD2   . ASP C 3 388 ? 66.857  27.758 -4.549  1.00 61.70  ? 388  ASP A OD2   1 
ATOM   3499 N N     . LYS C 3 389 ? 69.872  30.316 -1.445  1.00 42.57  ? 389  LYS A N     1 
ATOM   3500 C CA    . LYS C 3 389 ? 70.868  29.859 -0.492  1.00 40.28  ? 389  LYS A CA    1 
ATOM   3501 C C     . LYS C 3 389 ? 70.418  30.222 0.899   1.00 39.15  ? 389  LYS A C     1 
ATOM   3502 O O     . LYS C 3 389 ? 70.381  29.378 1.769   1.00 42.59  ? 389  LYS A O     1 
ATOM   3503 C CB    . LYS C 3 389 ? 72.234  30.489 -0.764  1.00 41.79  ? 389  LYS A CB    1 
ATOM   3504 C CG    . LYS C 3 389 ? 73.311  29.993 0.184   1.00 44.93  ? 389  LYS A CG    1 
ATOM   3505 C CD    . LYS C 3 389 ? 74.630  30.680 -0.070  1.00 46.99  ? 389  LYS A CD    1 
ATOM   3506 C CE    . LYS C 3 389 ? 75.732  30.076 0.781   1.00 50.03  ? 389  LYS A CE    1 
ATOM   3507 N NZ    . LYS C 3 389 ? 77.061  30.660 0.452   1.00 52.77  ? 389  LYS A NZ    1 
ATOM   3508 N N     . ALA C 3 390 ? 70.081  31.486 1.118   1.00 37.93  ? 390  ALA A N     1 
ATOM   3509 C CA    . ALA C 3 390 ? 69.615  31.923 2.433   1.00 35.87  ? 390  ALA A CA    1 
ATOM   3510 C C     . ALA C 3 390 ? 68.392  31.089 2.873   1.00 35.34  ? 390  ALA A C     1 
ATOM   3511 O O     . ALA C 3 390 ? 68.251  30.737 4.040   1.00 32.99  ? 390  ALA A O     1 
ATOM   3512 C CB    . ALA C 3 390 ? 69.258  33.419 2.395   1.00 33.44  ? 390  ALA A CB    1 
ATOM   3513 N N     . ARG C 3 391 ? 67.524  30.757 1.924   1.00 32.60  ? 391  ARG A N     1 
ATOM   3514 C CA    . ARG C 3 391 ? 66.344  29.982 2.237   1.00 34.48  ? 391  ARG A CA    1 
ATOM   3515 C C     . ARG C 3 391 ? 66.709  28.556 2.659   1.00 34.91  ? 391  ARG A C     1 
ATOM   3516 O O     . ARG C 3 391 ? 66.084  27.986 3.547   1.00 32.80  ? 391  ARG A O     1 
ATOM   3517 C CB    . ARG C 3 391 ? 65.398  29.955 1.027   1.00 39.58  ? 391  ARG A CB    1 
ATOM   3518 C CG    . ARG C 3 391 ? 64.179  29.076 1.219   1.00 41.21  ? 391  ARG A CG    1 
ATOM   3519 C CD    . ARG C 3 391 ? 63.493  28.775 -0.106  1.00 48.73  ? 391  ARG A CD    1 
ATOM   3520 N NE    . ARG C 3 391 ? 63.228  27.340 -0.231  1.00 55.97  ? 391  ARG A NE    1 
ATOM   3521 C CZ    . ARG C 3 391 ? 63.916  26.502 -1.008  1.00 58.45  ? 391  ARG A CZ    1 
ATOM   3522 N NH1   . ARG C 3 391 ? 64.922  26.952 -1.754  1.00 56.84  ? 391  ARG A NH1   1 
ATOM   3523 N NH2   . ARG C 3 391 ? 63.609  25.202 -1.021  1.00 56.94  ? 391  ARG A NH2   1 
ATOM   3524 N N     . LYS C 3 392 ? 67.704  27.960 2.010   1.00 35.52  ? 392  LYS A N     1 
ATOM   3525 C CA    . LYS C 3 392 ? 68.098  26.614 2.399   1.00 34.34  ? 392  LYS A CA    1 
ATOM   3526 C C     . LYS C 3 392 ? 68.803  26.669 3.757   1.00 33.51  ? 392  LYS A C     1 
ATOM   3527 O O     . LYS C 3 392 ? 68.606  25.799 4.608   1.00 33.54  ? 392  LYS A O     1 
ATOM   3528 C CB    . LYS C 3 392 ? 69.024  25.976 1.347   1.00 38.59  ? 392  LYS A CB    1 
ATOM   3529 C CG    . LYS C 3 392 ? 68.352  25.705 -0.020  1.00 38.59  ? 392  LYS A CG    1 
ATOM   3530 C CD    . LYS C 3 392 ? 69.195  24.821 -0.950  1.00 40.76  ? 392  LYS A CD    1 
ATOM   3531 C CE    . LYS C 3 392 ? 70.513  25.479 -1.323  1.00 46.86  ? 392  LYS A CE    1 
ATOM   3532 N NZ    . LYS C 3 392 ? 71.315  24.703 -2.335  1.00 46.16  ? 392  LYS A NZ    1 
ATOM   3533 N N     . SER C 3 393 ? 69.599  27.700 3.994   1.00 31.90  ? 393  SER A N     1 
ATOM   3534 C CA    . SER C 3 393 ? 70.284  27.740 5.264   1.00 35.79  ? 393  SER A CA    1 
ATOM   3535 C C     . SER C 3 393 ? 69.300  27.940 6.426   1.00 38.35  ? 393  SER A C     1 
ATOM   3536 O O     . SER C 3 393 ? 69.380  27.224 7.439   1.00 40.90  ? 393  SER A O     1 
ATOM   3537 C CB    . SER C 3 393 ? 71.376  28.809 5.250   1.00 37.06  ? 393  SER A CB    1 
ATOM   3538 O OG    . SER C 3 393 ? 70.873  30.067 4.867   1.00 44.47  ? 393  SER A OG    1 
ATOM   3539 N N     . ARG C 3 394 ? 68.363  28.881 6.276   1.00 36.22  ? 394  ARG A N     1 
ATOM   3540 C CA    . ARG C 3 394 ? 67.379  29.147 7.316   1.00 32.77  ? 394  ARG A CA    1 
ATOM   3541 C C     . ARG C 3 394 ? 66.555  27.875 7.582   1.00 32.37  ? 394  ARG A C     1 
ATOM   3542 O O     . ARG C 3 394 ? 66.155  27.581 8.706   1.00 32.45  ? 394  ARG A O     1 
ATOM   3543 C CB    . ARG C 3 394 ? 66.487  30.315 6.893   1.00 32.27  ? 394  ARG A CB    1 
ATOM   3544 C CG    . ARG C 3 394 ? 67.150  31.690 7.087   1.00 37.37  ? 394  ARG A CG    1 
ATOM   3545 C CD    . ARG C 3 394 ? 66.504  32.783 6.242   1.00 40.15  ? 394  ARG A CD    1 
ATOM   3546 N NE    . ARG C 3 394 ? 65.045  32.770 6.377   1.00 43.21  ? 394  ARG A NE    1 
ATOM   3547 C CZ    . ARG C 3 394 ? 64.394  33.066 7.497   1.00 46.20  ? 394  ARG A CZ    1 
ATOM   3548 N NH1   . ARG C 3 394 ? 65.062  33.416 8.585   1.00 48.12  ? 394  ARG A NH1   1 
ATOM   3549 N NH2   . ARG C 3 394 ? 63.074  32.970 7.542   1.00 51.42  ? 394  ARG A NH2   1 
ATOM   3550 N N     . ARG C 3 395 ? 66.320  27.107 6.541   1.00 28.90  ? 395  ARG A N     1 
ATOM   3551 C CA    . ARG C 3 395 ? 65.591  25.866 6.670   1.00 28.93  ? 395  ARG A CA    1 
ATOM   3552 C C     . ARG C 3 395 ? 66.371  24.855 7.524   1.00 30.38  ? 395  ARG A C     1 
ATOM   3553 O O     . ARG C 3 395 ? 65.827  24.298 8.481   1.00 30.76  ? 395  ARG A O     1 
ATOM   3554 C CB    . ARG C 3 395 ? 65.357  25.253 5.297   1.00 25.74  ? 395  ARG A CB    1 
ATOM   3555 C CG    . ARG C 3 395 ? 64.398  24.099 5.319   1.00 30.25  ? 395  ARG A CG    1 
ATOM   3556 C CD    . ARG C 3 395 ? 63.023  24.672 5.376   1.00 36.22  ? 395  ARG A CD    1 
ATOM   3557 N NE    . ARG C 3 395 ? 62.146  23.834 6.147   1.00 39.22  ? 395  ARG A NE    1 
ATOM   3558 C CZ    . ARG C 3 395 ? 60.890  24.143 6.447   1.00 38.29  ? 395  ARG A CZ    1 
ATOM   3559 N NH1   . ARG C 3 395 ? 60.354  25.288 6.033   1.00 29.80  ? 395  ARG A NH1   1 
ATOM   3560 N NH2   . ARG C 3 395 ? 60.183  23.292 7.176   1.00 37.49  ? 395  ARG A NH2   1 
ATOM   3561 N N     . ILE C 3 396 ? 67.634  24.613 7.151   1.00 31.17  ? 396  ILE A N     1 
ATOM   3562 C CA    . ILE C 3 396 ? 68.504  23.674 7.845   1.00 29.29  ? 396  ILE A CA    1 
ATOM   3563 C C     . ILE C 3 396 ? 68.537  24.060 9.311   1.00 28.41  ? 396  ILE A C     1 
ATOM   3564 O O     . ILE C 3 396 ? 68.437  23.225 10.219  1.00 27.94  ? 396  ILE A O     1 
ATOM   3565 C CB    . ILE C 3 396 ? 69.979  23.733 7.297   1.00 30.11  ? 396  ILE A CB    1 
ATOM   3566 C CG1   . ILE C 3 396 ? 70.017  23.424 5.805   1.00 34.94  ? 396  ILE A CG1   1 
ATOM   3567 C CG2   . ILE C 3 396 ? 70.867  22.755 8.024   1.00 29.03  ? 396  ILE A CG2   1 
ATOM   3568 C CD1   . ILE C 3 396 ? 69.083  22.289 5.351   1.00 40.56  ? 396  ILE A CD1   1 
ATOM   3569 N N     . SER C 3 397 ? 68.697  25.347 9.526   1.00 28.68  ? 397  SER A N     1 
ATOM   3570 C CA    . SER C 3 397 ? 68.774  25.886 10.875  1.00 31.79  ? 397  SER A CA    1 
ATOM   3571 C C     . SER C 3 397 ? 67.501  25.605 11.684  1.00 29.60  ? 397  SER A C     1 
ATOM   3572 O O     . SER C 3 397 ? 67.555  25.051 12.778  1.00 28.36  ? 397  SER A O     1 
ATOM   3573 C CB    . SER C 3 397 ? 69.025  27.384 10.786  1.00 27.98  ? 397  SER A CB    1 
ATOM   3574 O OG    . SER C 3 397 ? 69.003  27.936 12.075  1.00 44.75  ? 397  SER A OG    1 
ATOM   3575 N N     . LEU C 3 398 ? 66.362  26.005 11.120  1.00 31.26  ? 398  LEU A N     1 
ATOM   3576 C CA    . LEU C 3 398 ? 65.053  25.812 11.725  1.00 33.53  ? 398  LEU A CA    1 
ATOM   3577 C C     . LEU C 3 398 ? 64.860  24.335 12.108  1.00 34.76  ? 398  LEU A C     1 
ATOM   3578 O O     . LEU C 3 398 ? 64.313  24.034 13.171  1.00 29.80  ? 398  LEU A O     1 
ATOM   3579 C CB    . LEU C 3 398 ? 63.979  26.250 10.728  1.00 36.94  ? 398  LEU A CB    1 
ATOM   3580 C CG    . LEU C 3 398 ? 62.502  26.296 11.099  1.00 42.87  ? 398  LEU A CG    1 
ATOM   3581 C CD1   . LEU C 3 398 ? 61.784  27.008 9.959   1.00 43.78  ? 398  LEU A CD1   1 
ATOM   3582 C CD2   . LEU C 3 398 ? 61.916  24.895 11.333  1.00 42.81  ? 398  LEU A CD2   1 
ATOM   3583 N N     . GLU C 3 399 ? 65.310  23.428 11.234  1.00 35.83  ? 399  GLU A N     1 
ATOM   3584 C CA    . GLU C 3 399 ? 65.185  21.994 11.480  1.00 36.88  ? 399  GLU A CA    1 
ATOM   3585 C C     . GLU C 3 399 ? 66.118  21.492 12.603  1.00 37.16  ? 399  GLU A C     1 
ATOM   3586 O O     . GLU C 3 399 ? 65.767  20.560 13.332  1.00 38.24  ? 399  GLU A O     1 
ATOM   3587 C CB    . GLU C 3 399 ? 65.415  21.211 10.188  1.00 35.68  ? 399  GLU A CB    1 
ATOM   3588 C CG    . GLU C 3 399 ? 64.377  21.493 9.103   1.00 44.16  ? 399  GLU A CG    1 
ATOM   3589 C CD    . GLU C 3 399 ? 62.944  20.999 9.429   1.00 46.47  ? 399  GLU A CD    1 
ATOM   3590 O OE1   . GLU C 3 399 ? 62.765  20.149 10.337  1.00 48.57  ? 399  GLU A OE1   1 
ATOM   3591 O OE2   . GLU C 3 399 ? 61.993  21.452 8.749   1.00 48.69  ? 399  GLU A OE2   1 
ATOM   3592 N N     . PHE C 3 400 ? 67.304  22.080 12.743  1.00 32.46  ? 400  PHE A N     1 
ATOM   3593 C CA    . PHE C 3 400 ? 68.174  21.683 13.852  1.00 32.17  ? 400  PHE A CA    1 
ATOM   3594 C C     . PHE C 3 400 ? 67.435  22.050 15.151  1.00 31.41  ? 400  PHE A C     1 
ATOM   3595 O O     . PHE C 3 400 ? 67.347  21.246 16.068  1.00 34.33  ? 400  PHE A O     1 
ATOM   3596 C CB    . PHE C 3 400 ? 69.517  22.433 13.833  1.00 28.52  ? 400  PHE A CB    1 
ATOM   3597 C CG    . PHE C 3 400 ? 70.612  21.733 13.062  1.00 30.26  ? 400  PHE A CG    1 
ATOM   3598 C CD1   . PHE C 3 400 ? 70.996  20.430 13.390  1.00 27.95  ? 400  PHE A CD1   1 
ATOM   3599 C CD2   . PHE C 3 400 ? 71.260  22.374 12.011  1.00 28.99  ? 400  PHE A CD2   1 
ATOM   3600 C CE1   . PHE C 3 400 ? 72.005  19.782 12.679  1.00 29.63  ? 400  PHE A CE1   1 
ATOM   3601 C CE2   . PHE C 3 400 ? 72.269  21.732 11.296  1.00 29.49  ? 400  PHE A CE2   1 
ATOM   3602 C CZ    . PHE C 3 400 ? 72.647  20.423 11.630  1.00 27.07  ? 400  PHE A CZ    1 
ATOM   3603 N N     . MET C 3 401 ? 66.897  23.266 15.216  1.00 32.37  ? 401  MET A N     1 
ATOM   3604 C CA    . MET C 3 401 ? 66.201  23.722 16.416  1.00 31.88  ? 401  MET A CA    1 
ATOM   3605 C C     . MET C 3 401 ? 65.048  22.794 16.780  1.00 29.89  ? 401  MET A C     1 
ATOM   3606 O O     . MET C 3 401 ? 64.902  22.422 17.926  1.00 27.37  ? 401  MET A O     1 
ATOM   3607 C CB    . MET C 3 401 ? 65.678  25.153 16.224  1.00 32.55  ? 401  MET A CB    1 
ATOM   3608 C CG    . MET C 3 401 ? 66.720  26.170 15.691  1.00 32.36  ? 401  MET A CG    1 
ATOM   3609 S SD    . MET C 3 401 ? 68.097  26.599 16.778  1.00 34.28  ? 401  MET A SD    1 
ATOM   3610 C CE    . MET C 3 401 ? 69.158  25.186 16.541  1.00 34.69  ? 401  MET A CE    1 
ATOM   3611 N N     . LEU C 3 402 ? 64.239  22.422 15.792  1.00 31.12  ? 402  LEU A N     1 
ATOM   3612 C CA    . LEU C 3 402 ? 63.120  21.542 16.011  1.00 30.74  ? 402  LEU A CA    1 
ATOM   3613 C C     . LEU C 3 402 ? 63.589  20.158 16.428  1.00 32.48  ? 402  LEU A C     1 
ATOM   3614 O O     . LEU C 3 402 ? 62.953  19.510 17.254  1.00 38.25  ? 402  LEU A O     1 
ATOM   3615 C CB    . LEU C 3 402 ? 62.268  21.433 14.744  1.00 31.93  ? 402  LEU A CB    1 
ATOM   3616 C CG    . LEU C 3 402 ? 61.312  22.578 14.407  1.00 31.16  ? 402  LEU A CG    1 
ATOM   3617 C CD1   . LEU C 3 402 ? 60.534  22.224 13.144  1.00 27.85  ? 402  LEU A CD1   1 
ATOM   3618 C CD2   . LEU C 3 402 ? 60.358  22.820 15.581  1.00 30.28  ? 402  LEU A CD2   1 
ATOM   3619 N N     . GLU C 3 403 ? 64.701  19.698 15.874  1.00 32.99  ? 403  GLU A N     1 
ATOM   3620 C CA    . GLU C 3 403 ? 65.203  18.364 16.215  1.00 35.36  ? 403  GLU A CA    1 
ATOM   3621 C C     . GLU C 3 403 ? 65.654  18.345 17.662  1.00 34.14  ? 403  GLU A C     1 
ATOM   3622 O O     . GLU C 3 403 ? 65.553  17.354 18.355  1.00 37.09  ? 403  GLU A O     1 
ATOM   3623 C CB    . GLU C 3 403 ? 66.368  17.987 15.285  1.00 36.52  ? 403  GLU A CB    1 
ATOM   3624 C CG    . GLU C 3 403 ? 67.014  16.653 15.601  1.00 46.13  ? 403  GLU A CG    1 
ATOM   3625 C CD    . GLU C 3 403 ? 68.369  16.765 16.312  1.00 51.85  ? 403  GLU A CD    1 
ATOM   3626 O OE1   . GLU C 3 403 ? 68.488  17.382 17.406  1.00 52.59  ? 403  GLU A OE1   1 
ATOM   3627 O OE2   . GLU C 3 403 ? 69.336  16.201 15.766  1.00 57.03  ? 403  GLU A OE2   1 
ATOM   3628 N N     . GLN C 3 404 ? 66.145  19.479 18.115  1.00 34.30  ? 404  GLN A N     1 
ATOM   3629 C CA    . GLN C 3 404 ? 66.640  19.610 19.471  1.00 34.24  ? 404  GLN A CA    1 
ATOM   3630 C C     . GLN C 3 404 ? 65.475  19.881 20.464  1.00 34.86  ? 404  GLN A C     1 
ATOM   3631 O O     . GLN C 3 404 ? 65.501  19.415 21.595  1.00 34.37  ? 404  GLN A O     1 
ATOM   3632 C CB    . GLN C 3 404 ? 67.679  20.739 19.464  1.00 36.22  ? 404  GLN A CB    1 
ATOM   3633 C CG    . GLN C 3 404 ? 68.680  20.735 20.601  1.00 41.95  ? 404  GLN A CG    1 
ATOM   3634 C CD    . GLN C 3 404 ? 69.900  19.816 20.420  1.00 35.84  ? 404  GLN A CD    1 
ATOM   3635 O OE1   . GLN C 3 404 ? 70.944  20.093 20.985  1.00 34.23  ? 404  GLN A OE1   1 
ATOM   3636 N NE2   . GLN C 3 404 ? 69.758  18.722 19.674  1.00 35.28  ? 404  GLN A NE2   1 
ATOM   3637 N N     . ALA C 3 405 ? 64.446  20.620 20.045  1.00 30.47  ? 405  ALA A N     1 
ATOM   3638 C CA    . ALA C 3 405 ? 63.339  20.883 20.961  1.00 31.37  ? 405  ALA A CA    1 
ATOM   3639 C C     . ALA C 3 405 ? 62.556  19.593 21.171  1.00 30.01  ? 405  ALA A C     1 
ATOM   3640 O O     . ALA C 3 405 ? 62.125  19.315 22.275  1.00 29.35  ? 405  ALA A O     1 
ATOM   3641 C CB    . ALA C 3 405 ? 62.420  22.011 20.436  1.00 28.49  ? 405  ALA A CB    1 
ATOM   3642 N N     . ASN C 3 406 ? 62.387  18.797 20.116  1.00 34.16  ? 406  ASN A N     1 
ATOM   3643 C CA    . ASN C 3 406 ? 61.692  17.503 20.213  1.00 29.79  ? 406  ASN A CA    1 
ATOM   3644 C C     . ASN C 3 406 ? 62.539  16.452 20.949  1.00 32.17  ? 406  ASN A C     1 
ATOM   3645 O O     . ASN C 3 406 ? 62.010  15.504 21.527  1.00 32.01  ? 406  ASN A O     1 
ATOM   3646 C CB    . ASN C 3 406 ? 61.391  16.960 18.831  1.00 27.98  ? 406  ASN A CB    1 
ATOM   3647 C CG    . ASN C 3 406 ? 60.200  17.607 18.200  1.00 33.14  ? 406  ASN A CG    1 
ATOM   3648 O OD1   . ASN C 3 406 ? 59.112  17.634 18.783  1.00 36.57  ? 406  ASN A OD1   1 
ATOM   3649 N ND2   . ASN C 3 406 ? 60.383  18.126 16.988  1.00 29.84  ? 406  ASN A ND2   1 
ATOM   3650 N N     . LYS C 3 407 ? 63.858  16.586 20.898  1.00 31.61  ? 407  LYS A N     1 
ATOM   3651 C CA    . LYS C 3 407 ? 64.720  15.623 21.582  1.00 30.75  ? 407  LYS A CA    1 
ATOM   3652 C C     . LYS C 3 407 ? 64.584  15.782 23.093  1.00 32.69  ? 407  LYS A C     1 
ATOM   3653 O O     . LYS C 3 407 ? 64.537  14.798 23.825  1.00 35.70  ? 407  LYS A O     1 
ATOM   3654 C CB    . LYS C 3 407 ? 66.164  15.852 21.181  1.00 30.16  ? 407  LYS A CB    1 
ATOM   3655 C CG    . LYS C 3 407 ? 67.153  14.848 21.711  1.00 30.31  ? 407  LYS A CG    1 
ATOM   3656 C CD    . LYS C 3 407 ? 68.521  15.212 21.143  1.00 32.08  ? 407  LYS A CD    1 
ATOM   3657 C CE    . LYS C 3 407 ? 69.601  14.212 21.432  1.00 32.06  ? 407  LYS A CE    1 
ATOM   3658 N NZ    . LYS C 3 407 ? 70.831  14.640 20.692  1.00 36.96  ? 407  LYS A NZ    1 
ATOM   3659 N N     . PHE C 3 408 ? 64.517  17.030 23.562  1.00 30.41  ? 408  PHE A N     1 
ATOM   3660 C CA    . PHE C 3 408 ? 64.391  17.302 24.984  1.00 26.58  ? 408  PHE A CA    1 
ATOM   3661 C C     . PHE C 3 408 ? 62.982  17.640 25.481  1.00 28.53  ? 408  PHE A C     1 
ATOM   3662 O O     . PHE C 3 408 ? 62.814  17.976 26.641  1.00 27.30  ? 408  PHE A O     1 
ATOM   3663 C CB    . PHE C 3 408 ? 65.347  18.424 25.335  1.00 26.69  ? 408  PHE A CB    1 
ATOM   3664 C CG    . PHE C 3 408 ? 66.784  18.103 25.034  1.00 29.10  ? 408  PHE A CG    1 
ATOM   3665 C CD1   . PHE C 3 408 ? 67.517  17.265 25.872  1.00 29.49  ? 408  PHE A CD1   1 
ATOM   3666 C CD2   . PHE C 3 408 ? 67.416  18.650 23.914  1.00 26.15  ? 408  PHE A CD2   1 
ATOM   3667 C CE1   . PHE C 3 408 ? 68.863  16.980 25.594  1.00 26.53  ? 408  PHE A CE1   1 
ATOM   3668 C CE2   . PHE C 3 408 ? 68.750  18.370 23.637  1.00 25.11  ? 408  PHE A CE2   1 
ATOM   3669 C CZ    . PHE C 3 408 ? 69.470  17.534 24.480  1.00 24.55  ? 408  PHE A CZ    1 
ATOM   3670 N N     . ALA C 3 409 ? 61.971  17.505 24.623  1.00 31.07  ? 409  ALA A N     1 
ATOM   3671 C CA    . ALA C 3 409 ? 60.596  17.855 24.977  1.00 32.65  ? 409  ALA A CA    1 
ATOM   3672 C C     . ALA C 3 409 ? 60.021  17.317 26.280  1.00 34.83  ? 409  ALA A C     1 
ATOM   3673 O O     . ALA C 3 409 ? 59.206  17.986 26.926  1.00 38.73  ? 409  ALA A O     1 
ATOM   3674 C CB    . ALA C 3 409 ? 59.652  17.504 23.823  1.00 30.74  ? 409  ALA A CB    1 
ATOM   3675 N N     . ASN C 3 410 ? 60.432  16.123 26.683  1.00 36.93  ? 410  ASN A N     1 
ATOM   3676 C CA    . ASN C 3 410 ? 59.899  15.536 27.904  1.00 37.54  ? 410  ASN A CA    1 
ATOM   3677 C C     . ASN C 3 410 ? 60.798  15.629 29.121  1.00 38.62  ? 410  ASN A C     1 
ATOM   3678 O O     . ASN C 3 410 ? 60.424  15.165 30.196  1.00 41.55  ? 410  ASN A O     1 
ATOM   3679 C CB    . ASN C 3 410 ? 59.504  14.094 27.647  1.00 35.92  ? 410  ASN A CB    1 
ATOM   3680 C CG    . ASN C 3 410 ? 58.328  13.987 26.677  1.00 43.91  ? 410  ASN A CG    1 
ATOM   3681 O OD1   . ASN C 3 410 ? 58.337  13.164 25.755  1.00 46.69  ? 410  ASN A OD1   1 
ATOM   3682 N ND2   . ASN C 3 410 ? 57.307  14.819 26.884  1.00 41.50  ? 410  ASN A ND2   1 
ATOM   3683 N N     . HIS C 3 411 ? 61.970  16.240 28.977  1.00 37.29  ? 411  HIS A N     1 
ATOM   3684 C CA    . HIS C 3 411 ? 62.852  16.378 30.128  1.00 39.11  ? 411  HIS A CA    1 
ATOM   3685 C C     . HIS C 3 411 ? 62.256  17.329 31.149  1.00 40.11  ? 411  HIS A C     1 
ATOM   3686 O O     . HIS C 3 411 ? 61.554  18.266 30.789  1.00 41.56  ? 411  HIS A O     1 
ATOM   3687 C CB    . HIS C 3 411 ? 64.216  16.881 29.695  1.00 35.92  ? 411  HIS A CB    1 
ATOM   3688 C CG    . HIS C 3 411 ? 65.000  15.853 28.967  1.00 36.24  ? 411  HIS A CG    1 
ATOM   3689 N ND1   . HIS C 3 411 ? 66.274  15.486 29.340  1.00 42.01  ? 411  HIS A ND1   1 
ATOM   3690 C CD2   . HIS C 3 411 ? 64.670  15.066 27.922  1.00 34.96  ? 411  HIS A CD2   1 
ATOM   3691 C CE1   . HIS C 3 411 ? 66.693  14.511 28.554  1.00 38.30  ? 411  HIS A CE1   1 
ATOM   3692 N NE2   . HIS C 3 411 ? 65.737  14.238 27.686  1.00 37.35  ? 411  HIS A NE2   1 
ATOM   3693 N N     . LYS C 3 412 ? 62.542  17.087 32.422  1.00 40.25  ? 412  LYS A N     1 
ATOM   3694 C CA    . LYS C 3 412 ? 62.006  17.933 33.477  1.00 41.76  ? 412  LYS A CA    1 
ATOM   3695 C C     . LYS C 3 412 ? 62.716  19.271 33.359  1.00 38.63  ? 412  LYS A C     1 
ATOM   3696 O O     . LYS C 3 412 ? 62.138  20.322 33.588  1.00 34.74  ? 412  LYS A O     1 
ATOM   3697 C CB    . LYS C 3 412 ? 62.285  17.316 34.860  1.00 47.24  ? 412  LYS A CB    1 
ATOM   3698 C CG    . LYS C 3 412 ? 61.291  17.673 35.981  1.00 55.25  ? 412  LYS A CG    1 
ATOM   3699 C CD    . LYS C 3 412 ? 61.013  19.187 36.107  1.00 61.41  ? 412  LYS A CD    1 
ATOM   3700 C CE    . LYS C 3 412 ? 59.923  19.680 35.119  1.00 61.33  ? 412  LYS A CE    1 
ATOM   3701 N NZ    . LYS C 3 412 ? 59.842  21.164 35.077  1.00 54.41  ? 412  LYS A NZ    1 
ATOM   3702 N N     . ALA C 3 413 ? 63.983  19.217 32.988  1.00 38.28  ? 413  ALA A N     1 
ATOM   3703 C CA    . ALA C 3 413 ? 64.734  20.433 32.844  1.00 37.52  ? 413  ALA A CA    1 
ATOM   3704 C C     . ALA C 3 413 ? 66.016  20.212 32.072  1.00 38.38  ? 413  ALA A C     1 
ATOM   3705 O O     . ALA C 3 413 ? 66.548  19.097 32.028  1.00 39.93  ? 413  ALA A O     1 
ATOM   3706 C CB    . ALA C 3 413 ? 65.043  20.996 34.207  1.00 35.16  ? 413  ALA A CB    1 
ATOM   3707 N N     . ILE C 3 414 ? 66.487  21.284 31.443  1.00 35.15  ? 414  ILE A N     1 
ATOM   3708 C CA    . ILE C 3 414 ? 67.737  21.265 30.698  1.00 33.82  ? 414  ILE A CA    1 
ATOM   3709 C C     . ILE C 3 414 ? 68.490  22.540 31.063  1.00 34.13  ? 414  ILE A C     1 
ATOM   3710 O O     . ILE C 3 414 ? 67.882  23.530 31.490  1.00 35.40  ? 414  ILE A O     1 
ATOM   3711 C CB    . ILE C 3 414 ? 67.535  21.239 29.170  1.00 31.37  ? 414  ILE A CB    1 
ATOM   3712 C CG1   . ILE C 3 414 ? 66.824  22.497 28.681  1.00 25.22  ? 414  ILE A CG1   1 
ATOM   3713 C CG2   . ILE C 3 414 ? 66.783  20.025 28.793  1.00 32.42  ? 414  ILE A CG2   1 
ATOM   3714 C CD1   . ILE C 3 414 ? 66.699  22.558 27.158  1.00 21.48  ? 414  ILE A CD1   1 
ATOM   3715 N N     . TRP C 3 415 ? 69.807  22.503 30.886  1.00 32.48  ? 415  TRP A N     1 
ATOM   3716 C CA    . TRP C 3 415 ? 70.668  23.620 31.214  1.00 33.34  ? 415  TRP A CA    1 
ATOM   3717 C C     . TRP C 3 415 ? 71.555  23.971 30.032  1.00 34.00  ? 415  TRP A C     1 
ATOM   3718 O O     . TRP C 3 415 ? 71.751  23.156 29.129  1.00 35.85  ? 415  TRP A O     1 
ATOM   3719 C CB    . TRP C 3 415 ? 71.543  23.258 32.437  1.00 34.35  ? 415  TRP A CB    1 
ATOM   3720 C CG    . TRP C 3 415 ? 70.779  23.231 33.765  1.00 34.15  ? 415  TRP A CG    1 
ATOM   3721 C CD1   . TRP C 3 415 ? 70.619  24.270 34.647  1.00 31.13  ? 415  TRP A CD1   1 
ATOM   3722 C CD2   . TRP C 3 415 ? 70.025  22.130 34.305  1.00 34.53  ? 415  TRP A CD2   1 
ATOM   3723 N NE1   . TRP C 3 415 ? 69.813  23.887 35.691  1.00 34.27  ? 415  TRP A NE1   1 
ATOM   3724 C CE2   . TRP C 3 415 ? 69.434  22.582 35.513  1.00 34.35  ? 415  TRP A CE2   1 
ATOM   3725 C CE3   . TRP C 3 415 ? 69.786  20.807 33.881  1.00 29.80  ? 415  TRP A CE3   1 
ATOM   3726 C CZ2   . TRP C 3 415 ? 68.612  21.753 36.310  1.00 37.10  ? 415  TRP A CZ2   1 
ATOM   3727 C CZ3   . TRP C 3 415 ? 68.970  19.989 34.669  1.00 35.82  ? 415  TRP A CZ3   1 
ATOM   3728 C CH2   . TRP C 3 415 ? 68.391  20.466 35.872  1.00 34.10  ? 415  TRP A CH2   1 
ATOM   3729 N N     . PHE C 3 416 ? 72.105  25.186 30.063  1.00 33.68  ? 416  PHE A N     1 
ATOM   3730 C CA    . PHE C 3 416 ? 72.997  25.686 29.022  1.00 29.10  ? 416  PHE A CA    1 
ATOM   3731 C C     . PHE C 3 416 ? 74.312  26.185 29.617  1.00 30.82  ? 416  PHE A C     1 
ATOM   3732 O O     . PHE C 3 416 ? 74.328  27.070 30.468  1.00 28.02  ? 416  PHE A O     1 
ATOM   3733 C CB    . PHE C 3 416 ? 72.342  26.852 28.246  1.00 25.20  ? 416  PHE A CB    1 
ATOM   3734 C CG    . PHE C 3 416 ? 71.061  26.478 27.524  1.00 25.19  ? 416  PHE A CG    1 
ATOM   3735 C CD1   . PHE C 3 416 ? 71.103  25.904 26.259  1.00 23.66  ? 416  PHE A CD1   1 
ATOM   3736 C CD2   . PHE C 3 416 ? 69.816  26.609 28.157  1.00 20.31  ? 416  PHE A CD2   1 
ATOM   3737 C CE1   . PHE C 3 416 ? 69.932  25.449 25.626  1.00 22.93  ? 416  PHE A CE1   1 
ATOM   3738 C CE2   . PHE C 3 416 ? 68.645  26.153 27.548  1.00 20.62  ? 416  PHE A CE2   1 
ATOM   3739 C CZ    . PHE C 3 416 ? 68.693  25.570 26.285  1.00 22.76  ? 416  PHE A CZ    1 
ATOM   3740 N N     . PRO C 3 417 ? 75.444  25.607 29.199  1.00 33.63  ? 417  PRO A N     1 
ATOM   3741 C CA    . PRO C 3 417 ? 76.701  26.122 29.763  1.00 35.05  ? 417  PRO A CA    1 
ATOM   3742 C C     . PRO C 3 417 ? 76.972  27.478 29.092  1.00 37.22  ? 417  PRO A C     1 
ATOM   3743 O O     . PRO C 3 417 ? 76.449  27.735 28.014  1.00 39.07  ? 417  PRO A O     1 
ATOM   3744 C CB    . PRO C 3 417 ? 77.730  25.054 29.355  1.00 33.72  ? 417  PRO A CB    1 
ATOM   3745 C CG    . PRO C 3 417 ? 77.121  24.435 28.128  1.00 32.54  ? 417  PRO A CG    1 
ATOM   3746 C CD    . PRO C 3 417 ? 75.661  24.352 28.461  1.00 32.35  ? 417  PRO A CD    1 
ATOM   3747 N N     . TYR C 3 418 ? 77.788  28.333 29.700  1.00 38.63  ? 418  TYR A N     1 
ATOM   3748 C CA    . TYR C 3 418 ? 78.076  29.643 29.108  1.00 38.29  ? 418  TYR A CA    1 
ATOM   3749 C C     . TYR C 3 418 ? 79.541  29.987 28.906  1.00 39.02  ? 418  TYR A C     1 
ATOM   3750 O O     . TYR C 3 418 ? 80.401  29.500 29.621  1.00 41.99  ? 418  TYR A O     1 
ATOM   3751 C CB    . TYR C 3 418 ? 77.419  30.758 29.924  1.00 35.54  ? 418  TYR A CB    1 
ATOM   3752 C CG    . TYR C 3 418 ? 75.947  30.885 29.679  1.00 35.98  ? 418  TYR A CG    1 
ATOM   3753 C CD1   . TYR C 3 418 ? 75.068  29.943 30.171  1.00 38.45  ? 418  TYR A CD1   1 
ATOM   3754 C CD2   . TYR C 3 418 ? 75.426  31.954 28.952  1.00 38.35  ? 418  TYR A CD2   1 
ATOM   3755 C CE1   . TYR C 3 418 ? 73.709  30.053 29.962  1.00 36.90  ? 418  TYR A CE1   1 
ATOM   3756 C CE2   . TYR C 3 418 ? 74.053  32.074 28.726  1.00 37.23  ? 418  TYR A CE2   1 
ATOM   3757 C CZ    . TYR C 3 418 ? 73.203  31.114 29.242  1.00 36.94  ? 418  TYR A CZ    1 
ATOM   3758 O OH    . TYR C 3 418 ? 71.841  31.187 29.048  1.00 39.88  ? 418  TYR A OH    1 
ATOM   3759 N N     . ASN C 3 419 ? 79.782  30.879 27.950  1.00 39.30  ? 419  ASN A N     1 
ATOM   3760 C CA    . ASN C 3 419 ? 81.110  31.363 27.546  1.00 38.80  ? 419  ASN A CA    1 
ATOM   3761 C C     . ASN C 3 419 ? 81.107  32.867 27.449  1.00 39.57  ? 419  ASN A C     1 
ATOM   3762 O O     . ASN C 3 419 ? 80.074  33.509 27.589  1.00 42.83  ? 419  ASN A O     1 
ATOM   3763 C CB    . ASN C 3 419 ? 81.459  30.893 26.135  1.00 38.04  ? 419  ASN A CB    1 
ATOM   3764 C CG    . ASN C 3 419 ? 82.423  29.814 26.150  1.00 45.43  ? 419  ASN A CG    1 
ATOM   3765 O OD1   . ASN C 3 419 ? 82.892  29.338 25.109  1.00 46.11  ? 419  ASN A OD1   1 
ATOM   3766 N ND2   . ASN C 3 419 ? 82.754  29.380 27.357  1.00 47.83  ? 419  ASN A ND2   1 
ATOM   3767 N N     . MET C 3 420 ? 82.274  33.414 27.153  1.00 37.62  ? 420  MET A N     1 
ATOM   3768 C CA    . MET C 3 420 ? 82.400  34.827 26.957  1.00 37.84  ? 420  MET A CA    1 
ATOM   3769 C C     . MET C 3 420 ? 83.275  35.063 25.739  1.00 38.78  ? 420  MET A C     1 
ATOM   3770 O O     . MET C 3 420 ? 84.202  34.289 25.497  1.00 38.51  ? 420  MET A O     1 
ATOM   3771 C CB    . MET C 3 420 ? 83.042  35.494 28.163  1.00 40.25  ? 420  MET A CB    1 
ATOM   3772 C CG    . MET C 3 420 ? 82.149  35.616 29.368  1.00 40.12  ? 420  MET A CG    1 
ATOM   3773 S SD    . MET C 3 420 ? 82.957  36.666 30.580  1.00 44.06  ? 420  MET A SD    1 
ATOM   3774 C CE    . MET C 3 420 ? 84.017  35.512 31.396  1.00 43.73  ? 420  MET A CE    1 
ATOM   3775 N N     . ASP C 3 421 ? 82.958  36.100 24.958  1.00 35.74  ? 421  ASP A N     1 
ATOM   3776 C CA    . ASP C 3 421 ? 83.803  36.447 23.829  1.00 35.41  ? 421  ASP A CA    1 
ATOM   3777 C C     . ASP C 3 421 ? 84.951  37.278 24.410  1.00 34.49  ? 421  ASP A C     1 
ATOM   3778 O O     . ASP C 3 421 ? 84.975  37.569 25.609  1.00 32.91  ? 421  ASP A O     1 
ATOM   3779 C CB    . ASP C 3 421 ? 83.043  37.215 22.716  1.00 34.26  ? 421  ASP A CB    1 
ATOM   3780 C CG    . ASP C 3 421 ? 82.596  38.625 23.115  1.00 35.34  ? 421  ASP A CG    1 
ATOM   3781 O OD1   . ASP C 3 421 ? 83.078  39.221 24.100  1.00 36.14  ? 421  ASP A OD1   1 
ATOM   3782 O OD2   . ASP C 3 421 ? 81.730  39.151 22.390  1.00 37.53  ? 421  ASP A OD2   1 
ATOM   3783 N N     . TRP C 3 422 ? 85.890  37.674 23.566  1.00 35.62  ? 422  TRP A N     1 
ATOM   3784 C CA    . TRP C 3 422 ? 87.056  38.403 24.032  1.00 35.64  ? 422  TRP A CA    1 
ATOM   3785 C C     . TRP C 3 422 ? 86.762  39.709 24.775  1.00 36.90  ? 422  TRP A C     1 
ATOM   3786 O O     . TRP C 3 422 ? 87.571  40.158 25.603  1.00 37.80  ? 422  TRP A O     1 
ATOM   3787 C CB    . TRP C 3 422 ? 88.014  38.619 22.852  1.00 32.55  ? 422  TRP A CB    1 
ATOM   3788 C CG    . TRP C 3 422 ? 88.292  40.032 22.539  1.00 37.23  ? 422  TRP A CG    1 
ATOM   3789 C CD1   . TRP C 3 422 ? 88.943  40.955 23.324  1.00 38.11  ? 422  TRP A CD1   1 
ATOM   3790 C CD2   . TRP C 3 422 ? 87.928  40.702 21.356  1.00 35.92  ? 422  TRP A CD2   1 
ATOM   3791 N NE1   . TRP C 3 422 ? 89.003  42.178 22.688  1.00 35.86  ? 422  TRP A NE1   1 
ATOM   3792 C CE2   . TRP C 3 422 ? 88.389  42.051 21.471  1.00 38.58  ? 422  TRP A CE2   1 
ATOM   3793 C CE3   . TRP C 3 422 ? 87.260  40.307 20.207  1.00 32.74  ? 422  TRP A CE3   1 
ATOM   3794 C CZ2   . TRP C 3 422 ? 88.199  43.002 20.467  1.00 34.58  ? 422  TRP A CZ2   1 
ATOM   3795 C CZ3   . TRP C 3 422 ? 87.068  41.251 19.213  1.00 41.64  ? 422  TRP A CZ3   1 
ATOM   3796 C CH2   . TRP C 3 422 ? 87.541  42.594 19.352  1.00 38.04  ? 422  TRP A CH2   1 
ATOM   3797 N N     . ARG C 3 423 ? 85.626  40.329 24.485  1.00 35.10  ? 423  ARG A N     1 
ATOM   3798 C CA    . ARG C 3 423 ? 85.281  41.560 25.184  1.00 35.50  ? 423  ARG A CA    1 
ATOM   3799 C C     . ARG C 3 423 ? 84.510  41.311 26.464  1.00 34.09  ? 423  ARG A C     1 
ATOM   3800 O O     . ARG C 3 423 ? 84.175  42.267 27.153  1.00 38.33  ? 423  ARG A O     1 
ATOM   3801 C CB    . ARG C 3 423 ? 84.450  42.501 24.306  1.00 36.71  ? 423  ARG A CB    1 
ATOM   3802 C CG    . ARG C 3 423 ? 85.136  42.947 23.057  1.00 37.69  ? 423  ARG A CG    1 
ATOM   3803 C CD    . ARG C 3 423 ? 84.669  42.088 21.934  1.00 48.50  ? 423  ARG A CD    1 
ATOM   3804 N NE    . ARG C 3 423 ? 83.221  42.195 21.807  1.00 55.52  ? 423  ARG A NE    1 
ATOM   3805 C CZ    . ARG C 3 423 ? 82.528  41.696 20.794  1.00 60.23  ? 423  ARG A CZ    1 
ATOM   3806 N NH1   . ARG C 3 423 ? 83.160  41.051 19.816  1.00 63.81  ? 423  ARG A NH1   1 
ATOM   3807 N NH2   . ARG C 3 423 ? 81.208  41.847 20.752  1.00 61.78  ? 423  ARG A NH2   1 
ATOM   3808 N N     . GLY C 3 424 ? 84.222  40.041 26.776  1.00 33.56  ? 424  GLY A N     1 
ATOM   3809 C CA    . GLY C 3 424 ? 83.480  39.708 27.986  1.00 29.84  ? 424  GLY A CA    1 
ATOM   3810 C C     . GLY C 3 424 ? 81.979  39.447 27.828  1.00 31.66  ? 424  GLY A C     1 
ATOM   3811 O O     . GLY C 3 424 ? 81.319  39.104 28.800  1.00 32.07  ? 424  GLY A O     1 
ATOM   3812 N N     . ARG C 3 425 ? 81.416  39.610 26.632  1.00 34.04  ? 425  ARG A N     1 
ATOM   3813 C CA    . ARG C 3 425 ? 79.995  39.337 26.445  1.00 34.58  ? 425  ARG A CA    1 
ATOM   3814 C C     . ARG C 3 425 ? 79.683  37.852 26.680  1.00 36.92  ? 425  ARG A C     1 
ATOM   3815 O O     . ARG C 3 425 ? 80.452  36.965 26.295  1.00 39.38  ? 425  ARG A O     1 
ATOM   3816 C CB    . ARG C 3 425 ? 79.546  39.765 25.056  1.00 38.10  ? 425  ARG A CB    1 
ATOM   3817 C CG    . ARG C 3 425 ? 79.141  41.236 24.994  1.00 39.58  ? 425  ARG A CG    1 
ATOM   3818 C CD    . ARG C 3 425 ? 78.310  41.505 23.764  1.00 42.01  ? 425  ARG A CD    1 
ATOM   3819 N NE    . ARG C 3 425 ? 77.591  42.768 23.846  1.00 40.75  ? 425  ARG A NE    1 
ATOM   3820 C CZ    . ARG C 3 425 ? 76.728  43.192 22.930  1.00 41.45  ? 425  ARG A CZ    1 
ATOM   3821 N NH1   . ARG C 3 425 ? 76.474  42.456 21.849  1.00 41.47  ? 425  ARG A NH1   1 
ATOM   3822 N NH2   . ARG C 3 425 ? 76.102  44.345 23.109  1.00 43.17  ? 425  ARG A NH2   1 
ATOM   3823 N N     . VAL C 3 426 ? 78.545  37.600 27.316  1.00 36.36  ? 426  VAL A N     1 
ATOM   3824 C CA    . VAL C 3 426 ? 78.121  36.276 27.707  1.00 34.30  ? 426  VAL A CA    1 
ATOM   3825 C C     . VAL C 3 426 ? 77.269  35.552 26.680  1.00 35.73  ? 426  VAL A C     1 
ATOM   3826 O O     . VAL C 3 426 ? 76.209  36.033 26.302  1.00 35.97  ? 426  VAL A O     1 
ATOM   3827 C CB    . VAL C 3 426 ? 77.387  36.400 29.052  1.00 35.82  ? 426  VAL A CB    1 
ATOM   3828 C CG1   . VAL C 3 426 ? 76.868  35.043 29.539  1.00 35.41  ? 426  VAL A CG1   1 
ATOM   3829 C CG2   . VAL C 3 426 ? 78.351  37.017 30.070  1.00 33.36  ? 426  VAL A CG2   1 
ATOM   3830 N N     . TYR C 3 427 ? 77.735  34.383 26.239  1.00 34.44  ? 427  TYR A N     1 
ATOM   3831 C CA    . TYR C 3 427 ? 77.020  33.592 25.235  1.00 33.07  ? 427  TYR A CA    1 
ATOM   3832 C C     . TYR C 3 427 ? 76.717  32.176 25.682  1.00 31.66  ? 427  TYR A C     1 
ATOM   3833 O O     . TYR C 3 427 ? 77.534  31.550 26.367  1.00 31.32  ? 427  TYR A O     1 
ATOM   3834 C CB    . TYR C 3 427 ? 77.842  33.465 23.940  1.00 33.35  ? 427  TYR A CB    1 
ATOM   3835 C CG    . TYR C 3 427 ? 78.160  34.748 23.229  1.00 33.79  ? 427  TYR A CG    1 
ATOM   3836 C CD1   . TYR C 3 427 ? 79.172  35.586 23.696  1.00 33.89  ? 427  TYR A CD1   1 
ATOM   3837 C CD2   . TYR C 3 427 ? 77.459  35.130 22.070  1.00 30.49  ? 427  TYR A CD2   1 
ATOM   3838 C CE1   . TYR C 3 427 ? 79.490  36.768 23.041  1.00 28.21  ? 427  TYR A CE1   1 
ATOM   3839 C CE2   . TYR C 3 427 ? 77.771  36.319 21.403  1.00 24.89  ? 427  TYR A CE2   1 
ATOM   3840 C CZ    . TYR C 3 427 ? 78.787  37.134 21.891  1.00 32.01  ? 427  TYR A CZ    1 
ATOM   3841 O OH    . TYR C 3 427 ? 79.127  38.324 21.242  1.00 34.73  ? 427  TYR A OH    1 
ATOM   3842 N N     . ALA C 3 428 ? 75.555  31.664 25.273  1.00 31.21  ? 428  ALA A N     1 
ATOM   3843 C CA    . ALA C 3 428 ? 75.177  30.281 25.570  1.00 30.23  ? 428  ALA A CA    1 
ATOM   3844 C C     . ALA C 3 428 ? 75.948  29.472 24.527  1.00 30.31  ? 428  ALA A C     1 
ATOM   3845 O O     . ALA C 3 428 ? 76.104  29.909 23.398  1.00 31.30  ? 428  ALA A O     1 
ATOM   3846 C CB    . ALA C 3 428 ? 73.685  30.076 25.398  1.00 31.67  ? 428  ALA A CB    1 
ATOM   3847 N N     . VAL C 3 429 ? 76.414  28.290 24.900  1.00 31.04  ? 429  VAL A N     1 
ATOM   3848 C CA    . VAL C 3 429 ? 77.224  27.474 24.001  1.00 32.43  ? 429  VAL A CA    1 
ATOM   3849 C C     . VAL C 3 429 ? 76.528  26.595 22.960  1.00 34.85  ? 429  VAL A C     1 
ATOM   3850 O O     . VAL C 3 429 ? 76.957  26.534 21.807  1.00 38.93  ? 429  VAL A O     1 
ATOM   3851 C CB    . VAL C 3 429 ? 78.184  26.621 24.829  1.00 31.31  ? 429  VAL A CB    1 
ATOM   3852 C CG1   . VAL C 3 429 ? 78.832  25.557 23.966  1.00 39.69  ? 429  VAL A CG1   1 
ATOM   3853 C CG2   . VAL C 3 429 ? 79.256  27.526 25.442  1.00 32.14  ? 429  VAL A CG2   1 
ATOM   3854 N N     . SER C 3 430 ? 75.460  25.920 23.351  1.00 33.43  ? 430  SER A N     1 
ATOM   3855 C CA    . SER C 3 430 ? 74.754  25.047 22.431  1.00 32.33  ? 430  SER A CA    1 
ATOM   3856 C C     . SER C 3 430 ? 74.104  25.839 21.300  1.00 33.75  ? 430  SER A C     1 
ATOM   3857 O O     . SER C 3 430 ? 73.692  26.983 21.503  1.00 35.10  ? 430  SER A O     1 
ATOM   3858 C CB    . SER C 3 430 ? 73.703  24.250 23.200  1.00 33.61  ? 430  SER A CB    1 
ATOM   3859 O OG    . SER C 3 430 ? 72.869  25.123 23.939  1.00 37.21  ? 430  SER A OG    1 
ATOM   3860 N N     . MET C 3 431 ? 74.001  25.223 20.117  1.00 33.10  ? 431  MET A N     1 
ATOM   3861 C CA    . MET C 3 431 ? 73.414  25.893 18.954  1.00 32.37  ? 431  MET A CA    1 
ATOM   3862 C C     . MET C 3 431 ? 71.958  26.316 19.224  1.00 32.33  ? 431  MET A C     1 
ATOM   3863 O O     . MET C 3 431 ? 71.520  27.394 18.834  1.00 29.14  ? 431  MET A O     1 
ATOM   3864 C CB    . MET C 3 431 ? 73.453  24.972 17.730  1.00 30.24  ? 431  MET A CB    1 
ATOM   3865 C CG    . MET C 3 431 ? 72.938  25.653 16.473  1.00 35.65  ? 431  MET A CG    1 
ATOM   3866 S SD    . MET C 3 431 ? 72.576  24.543 15.110  1.00 38.95  ? 431  MET A SD    1 
ATOM   3867 C CE    . MET C 3 431 ? 74.200  24.443 14.341  1.00 35.32  ? 431  MET A CE    1 
ATOM   3868 N N     . PHE C 3 432 ? 71.216  25.427 19.875  1.00 30.72  ? 432  PHE A N     1 
ATOM   3869 C CA    . PHE C 3 432 ? 69.826  25.687 20.237  1.00 31.13  ? 432  PHE A CA    1 
ATOM   3870 C C     . PHE C 3 432 ? 69.930  26.317 21.628  1.00 31.38  ? 432  PHE A C     1 
ATOM   3871 O O     . PHE C 3 432 ? 70.343  25.638 22.561  1.00 33.11  ? 432  PHE A O     1 
ATOM   3872 C CB    . PHE C 3 432 ? 69.062  24.358 20.285  1.00 25.57  ? 432  PHE A CB    1 
ATOM   3873 C CG    . PHE C 3 432 ? 67.703  24.446 20.927  1.00 26.57  ? 432  PHE A CG    1 
ATOM   3874 C CD1   . PHE C 3 432 ? 66.634  25.016 20.249  1.00 24.00  ? 432  PHE A CD1   1 
ATOM   3875 C CD2   . PHE C 3 432 ? 67.477  23.891 22.194  1.00 28.30  ? 432  PHE A CD2   1 
ATOM   3876 C CE1   . PHE C 3 432 ? 65.370  25.034 20.795  1.00 17.05  ? 432  PHE A CE1   1 
ATOM   3877 C CE2   . PHE C 3 432 ? 66.197  23.902 22.762  1.00 24.26  ? 432  PHE A CE2   1 
ATOM   3878 C CZ    . PHE C 3 432 ? 65.142  24.477 22.052  1.00 23.08  ? 432  PHE A CZ    1 
ATOM   3879 N N     . ASN C 3 433 ? 69.607  27.605 21.763  1.00 30.39  ? 433  ASN A N     1 
ATOM   3880 C CA    . ASN C 3 433 ? 69.709  28.257 23.075  1.00 32.75  ? 433  ASN A CA    1 
ATOM   3881 C C     . ASN C 3 433 ? 68.779  29.465 23.262  1.00 29.93  ? 433  ASN A C     1 
ATOM   3882 O O     . ASN C 3 433 ? 68.180  29.933 22.316  1.00 28.37  ? 433  ASN A O     1 
ATOM   3883 C CB    . ASN C 3 433 ? 71.172  28.644 23.389  1.00 32.14  ? 433  ASN A CB    1 
ATOM   3884 C CG    . ASN C 3 433 ? 71.683  29.783 22.520  1.00 33.61  ? 433  ASN A CG    1 
ATOM   3885 O OD1   . ASN C 3 433 ? 71.008  30.797 22.350  1.00 33.59  ? 433  ASN A OD1   1 
ATOM   3886 N ND2   . ASN C 3 433 ? 72.884  29.624 21.980  1.00 33.22  ? 433  ASN A ND2   1 
ATOM   3887 N N     . PRO C 3 434 ? 68.677  29.992 24.495  1.00 31.64  ? 434  PRO A N     1 
ATOM   3888 C CA    . PRO C 3 434 ? 67.803  31.129 24.784  1.00 32.44  ? 434  PRO A CA    1 
ATOM   3889 C C     . PRO C 3 434 ? 68.154  32.437 24.096  1.00 32.16  ? 434  PRO A C     1 
ATOM   3890 O O     . PRO C 3 434 ? 67.386  33.374 24.149  1.00 34.57  ? 434  PRO A O     1 
ATOM   3891 C CB    . PRO C 3 434 ? 67.896  31.262 26.304  1.00 31.90  ? 434  PRO A CB    1 
ATOM   3892 C CG    . PRO C 3 434 ? 68.449  29.946 26.771  1.00 32.29  ? 434  PRO A CG    1 
ATOM   3893 C CD    . PRO C 3 434 ? 69.439  29.635 25.702  1.00 30.67  ? 434  PRO A CD    1 
ATOM   3894 N N     . GLN C 3 435 ? 69.315  32.505 23.462  1.00 33.38  ? 435  GLN A N     1 
ATOM   3895 C CA    . GLN C 3 435 ? 69.735  33.729 22.794  1.00 31.07  ? 435  GLN A CA    1 
ATOM   3896 C C     . GLN C 3 435 ? 69.388  33.718 21.325  1.00 30.37  ? 435  GLN A C     1 
ATOM   3897 O O     . GLN C 3 435 ? 69.740  34.651 20.609  1.00 34.34  ? 435  GLN A O     1 
ATOM   3898 C CB    . GLN C 3 435 ? 71.247  33.929 22.964  1.00 26.16  ? 435  GLN A CB    1 
ATOM   3899 C CG    . GLN C 3 435 ? 71.635  34.046 24.397  1.00 28.12  ? 435  GLN A CG    1 
ATOM   3900 C CD    . GLN C 3 435 ? 73.130  34.220 24.614  1.00 33.83  ? 435  GLN A CD    1 
ATOM   3901 O OE1   . GLN C 3 435 ? 73.537  34.901 25.558  1.00 31.79  ? 435  GLN A OE1   1 
ATOM   3902 N NE2   . GLN C 3 435 ? 73.957  33.591 23.760  1.00 30.22  ? 435  GLN A NE2   1 
ATOM   3903 N N     . GLY C 3 436 ? 68.673  32.676 20.898  1.00 29.73  ? 436  GLY A N     1 
ATOM   3904 C CA    . GLY C 3 436 ? 68.295  32.521 19.505  1.00 32.07  ? 436  GLY A CA    1 
ATOM   3905 C C     . GLY C 3 436 ? 67.208  33.411 18.937  1.00 32.19  ? 436  GLY A C     1 
ATOM   3906 O O     . GLY C 3 436 ? 66.904  34.467 19.479  1.00 36.11  ? 436  GLY A O     1 
ATOM   3907 N N     . ASN C 3 437 ? 66.627  32.967 17.822  1.00 32.40  ? 437  ASN A N     1 
ATOM   3908 C CA    . ASN C 3 437 ? 65.587  33.715 17.139  1.00 32.51  ? 437  ASN A CA    1 
ATOM   3909 C C     . ASN C 3 437 ? 64.187  33.558 17.750  1.00 33.48  ? 437  ASN A C     1 
ATOM   3910 O O     . ASN C 3 437 ? 64.003  32.862 18.743  1.00 32.39  ? 437  ASN A O     1 
ATOM   3911 C CB    . ASN C 3 437 ? 65.568  33.357 15.649  1.00 33.16  ? 437  ASN A CB    1 
ATOM   3912 C CG    . ASN C 3 437 ? 65.236  31.896 15.380  1.00 39.69  ? 437  ASN A CG    1 
ATOM   3913 O OD1   . ASN C 3 437 ? 65.374  31.436 14.248  1.00 44.41  ? 437  ASN A OD1   1 
ATOM   3914 N ND2   . ASN C 3 437 ? 64.793  31.168 16.395  1.00 42.12  ? 437  ASN A ND2   1 
ATOM   3915 N N     . ASP C 3 438 ? 63.202  34.217 17.153  1.00 34.44  ? 438  ASP A N     1 
ATOM   3916 C CA    . ASP C 3 438 ? 61.852  34.159 17.683  1.00 32.32  ? 438  ASP A CA    1 
ATOM   3917 C C     . ASP C 3 438 ? 61.369  32.728 17.945  1.00 29.00  ? 438  ASP A C     1 
ATOM   3918 O O     . ASP C 3 438 ? 60.951  32.416 19.052  1.00 24.23  ? 438  ASP A O     1 
ATOM   3919 C CB    . ASP C 3 438 ? 60.859  34.904 16.766  1.00 32.76  ? 438  ASP A CB    1 
ATOM   3920 C CG    . ASP C 3 438 ? 59.417  34.727 17.223  1.00 32.64  ? 438  ASP A CG    1 
ATOM   3921 O OD1   . ASP C 3 438 ? 59.088  35.155 18.355  1.00 36.99  ? 438  ASP A OD1   1 
ATOM   3922 O OD2   . ASP C 3 438 ? 58.615  34.147 16.469  1.00 35.52  ? 438  ASP A OD2   1 
ATOM   3923 N N     . MET C 3 439 ? 61.420  31.857 16.952  1.00 29.03  ? 439  MET A N     1 
ATOM   3924 C CA    . MET C 3 439 ? 60.966  30.481 17.187  1.00 31.24  ? 439  MET A CA    1 
ATOM   3925 C C     . MET C 3 439 ? 61.685  29.816 18.368  1.00 32.28  ? 439  MET A C     1 
ATOM   3926 O O     . MET C 3 439 ? 61.052  29.357 19.343  1.00 34.56  ? 439  MET A O     1 
ATOM   3927 C CB    . MET C 3 439 ? 61.168  29.620 15.952  1.00 30.06  ? 439  MET A CB    1 
ATOM   3928 C CG    . MET C 3 439 ? 60.584  28.237 16.118  1.00 36.12  ? 439  MET A CG    1 
ATOM   3929 S SD    . MET C 3 439 ? 60.532  27.217 14.637  1.00 40.48  ? 439  MET A SD    1 
ATOM   3930 C CE    . MET C 3 439 ? 62.136  26.420 14.760  1.00 38.71  ? 439  MET A CE    1 
ATOM   3931 N N     . THR C 3 440 ? 63.009  29.781 18.288  1.00 32.32  ? 440  THR A N     1 
ATOM   3932 C CA    . THR C 3 440 ? 63.826  29.167 19.322  1.00 31.84  ? 440  THR A CA    1 
ATOM   3933 C C     . THR C 3 440 ? 63.474  29.658 20.705  1.00 31.26  ? 440  THR A C     1 
ATOM   3934 O O     . THR C 3 440 ? 63.323  28.869 21.622  1.00 33.14  ? 440  THR A O     1 
ATOM   3935 C CB    . THR C 3 440 ? 65.320  29.395 19.025  1.00 31.90  ? 440  THR A CB    1 
ATOM   3936 O OG1   . THR C 3 440 ? 65.606  28.816 17.755  1.00 37.02  ? 440  THR A OG1   1 
ATOM   3937 C CG2   . THR C 3 440 ? 66.204  28.713 20.042  1.00 28.53  ? 440  THR A CG2   1 
ATOM   3938 N N     . LYS C 3 441 ? 63.335  30.957 20.870  1.00 32.24  ? 441  LYS A N     1 
ATOM   3939 C CA    . LYS C 3 441 ? 62.967  31.468 22.166  1.00 33.00  ? 441  LYS A CA    1 
ATOM   3940 C C     . LYS C 3 441 ? 61.537  31.017 22.516  1.00 33.14  ? 441  LYS A C     1 
ATOM   3941 O O     . LYS C 3 441 ? 61.239  30.766 23.662  1.00 30.09  ? 441  LYS A O     1 
ATOM   3942 C CB    . LYS C 3 441 ? 63.104  32.996 22.186  1.00 31.43  ? 441  LYS A CB    1 
ATOM   3943 C CG    . LYS C 3 441 ? 64.574  33.468 22.109  1.00 33.73  ? 441  LYS A CG    1 
ATOM   3944 C CD    . LYS C 3 441 ? 64.712  34.967 22.278  1.00 33.55  ? 441  LYS A CD    1 
ATOM   3945 C CE    . LYS C 3 441 ? 64.037  35.719 21.129  1.00 32.17  ? 441  LYS A CE    1 
ATOM   3946 N NZ    . LYS C 3 441 ? 64.340  37.191 21.186  1.00 37.73  ? 441  LYS A NZ    1 
ATOM   3947 N N     . GLY C 3 442 ? 60.662  30.900 21.520  1.00 33.93  ? 442  GLY A N     1 
ATOM   3948 C CA    . GLY C 3 442 ? 59.306  30.455 21.790  1.00 33.29  ? 442  GLY A CA    1 
ATOM   3949 C C     . GLY C 3 442 ? 59.289  29.026 22.298  1.00 35.52  ? 442  GLY A C     1 
ATOM   3950 O O     . GLY C 3 442 ? 58.450  28.671 23.125  1.00 35.49  ? 442  GLY A O     1 
ATOM   3951 N N     . LEU C 3 443 ? 60.226  28.213 21.812  1.00 34.28  ? 443  LEU A N     1 
ATOM   3952 C CA    . LEU C 3 443 ? 60.343  26.807 22.199  1.00 33.13  ? 443  LEU A CA    1 
ATOM   3953 C C     . LEU C 3 443 ? 60.893  26.614 23.606  1.00 33.90  ? 443  LEU A C     1 
ATOM   3954 O O     . LEU C 3 443 ? 60.794  25.523 24.185  1.00 32.35  ? 443  LEU A O     1 
ATOM   3955 C CB    . LEU C 3 443 ? 61.244  26.057 21.210  1.00 34.60  ? 443  LEU A CB    1 
ATOM   3956 C CG    . LEU C 3 443 ? 60.730  25.940 19.765  1.00 32.97  ? 443  LEU A CG    1 
ATOM   3957 C CD1   . LEU C 3 443 ? 61.742  25.175 18.899  1.00 30.76  ? 443  LEU A CD1   1 
ATOM   3958 C CD2   . LEU C 3 443 ? 59.378  25.232 19.773  1.00 31.53  ? 443  LEU A CD2   1 
ATOM   3959 N N     . LEU C 3 444 ? 61.461  27.680 24.159  1.00 31.03  ? 444  LEU A N     1 
ATOM   3960 C CA    . LEU C 3 444 ? 62.036  27.624 25.487  1.00 29.97  ? 444  LEU A CA    1 
ATOM   3961 C C     . LEU C 3 444 ? 61.272  28.442 26.513  1.00 32.57  ? 444  LEU A C     1 
ATOM   3962 O O     . LEU C 3 444 ? 60.753  29.529 26.219  1.00 33.73  ? 444  LEU A O     1 
ATOM   3963 C CB    . LEU C 3 444 ? 63.496  28.091 25.466  1.00 27.84  ? 444  LEU A CB    1 
ATOM   3964 C CG    . LEU C 3 444 ? 64.511  27.198 24.738  1.00 30.50  ? 444  LEU A CG    1 
ATOM   3965 C CD1   . LEU C 3 444 ? 65.829  27.918 24.546  1.00 29.99  ? 444  LEU A CD1   1 
ATOM   3966 C CD2   . LEU C 3 444 ? 64.729  25.904 25.550  1.00 30.07  ? 444  LEU A CD2   1 
ATOM   3967 N N     . THR C 3 445 ? 61.224  27.904 27.731  1.00 33.11  ? 445  THR A N     1 
ATOM   3968 C CA    . THR C 3 445 ? 60.574  28.555 28.860  1.00 36.06  ? 445  THR A CA    1 
ATOM   3969 C C     . THR C 3 445 ? 61.387  28.218 30.110  1.00 34.46  ? 445  THR A C     1 
ATOM   3970 O O     . THR C 3 445 ? 62.208  27.303 30.093  1.00 35.52  ? 445  THR A O     1 
ATOM   3971 C CB    . THR C 3 445 ? 59.085  28.107 29.000  1.00 37.42  ? 445  THR A CB    1 
ATOM   3972 O OG1   . THR C 3 445 ? 58.435  28.969 29.937  1.00 38.13  ? 445  THR A OG1   1 
ATOM   3973 C CG2   . THR C 3 445 ? 58.965  26.640 29.478  1.00 40.05  ? 445  THR A CG2   1 
ATOM   3974 N N     . LEU C 3 446 ? 61.198  28.964 31.185  1.00 36.03  ? 446  LEU A N     1 
ATOM   3975 C CA    . LEU C 3 446 ? 61.985  28.699 32.379  1.00 37.98  ? 446  LEU A CA    1 
ATOM   3976 C C     . LEU C 3 446 ? 61.382  27.525 33.163  1.00 40.64  ? 446  LEU A C     1 
ATOM   3977 O O     . LEU C 3 446 ? 60.159  27.351 33.196  1.00 41.91  ? 446  LEU A O     1 
ATOM   3978 C CB    . LEU C 3 446 ? 62.074  29.973 33.238  1.00 34.52  ? 446  LEU A CB    1 
ATOM   3979 C CG    . LEU C 3 446 ? 62.991  31.095 32.705  1.00 35.49  ? 446  LEU A CG    1 
ATOM   3980 C CD1   . LEU C 3 446 ? 62.807  32.428 33.502  1.00 31.49  ? 446  LEU A CD1   1 
ATOM   3981 C CD2   . LEU C 3 446 ? 64.431  30.620 32.777  1.00 28.49  ? 446  LEU A CD2   1 
ATOM   3982 N N     . ALA C 3 447 ? 62.223  26.696 33.774  1.00 41.77  ? 447  ALA A N     1 
ATOM   3983 C CA    . ALA C 3 447 ? 61.677  25.570 34.532  1.00 47.11  ? 447  ALA A CA    1 
ATOM   3984 C C     . ALA C 3 447 ? 61.005  26.003 35.854  1.00 50.06  ? 447  ALA A C     1 
ATOM   3985 O O     . ALA C 3 447 ? 59.800  26.114 35.911  1.00 54.43  ? 447  ALA A O     1 
ATOM   3986 C CB    . ALA C 3 447 ? 62.760  24.523 34.800  1.00 48.39  ? 447  ALA A CB    1 
ATOM   3987 N N     . LYS C 3 448 ? 61.759  26.274 36.909  1.00 49.98  ? 448  LYS A N     1 
ATOM   3988 C CA    . LYS C 3 448 ? 61.121  26.664 38.168  1.00 49.54  ? 448  LYS A CA    1 
ATOM   3989 C C     . LYS C 3 448 ? 60.388  28.005 38.116  1.00 48.68  ? 448  LYS A C     1 
ATOM   3990 O O     . LYS C 3 448 ? 61.005  29.065 38.003  1.00 49.23  ? 448  LYS A O     1 
ATOM   3991 C CB    . LYS C 3 448 ? 62.156  26.694 39.295  1.00 50.05  ? 448  LYS A CB    1 
ATOM   3992 C CG    . LYS C 3 448 ? 63.206  27.721 39.099  1.00 57.30  ? 448  LYS A CG    1 
ATOM   3993 C CD    . LYS C 3 448 ? 64.501  27.353 39.822  1.00 64.38  ? 448  LYS A CD    1 
ATOM   3994 C CE    . LYS C 3 448 ? 65.588  28.391 39.503  1.00 68.50  ? 448  LYS A CE    1 
ATOM   3995 N NZ    . LYS C 3 448 ? 66.987  27.944 39.794  1.00 69.85  ? 448  LYS A NZ    1 
ATOM   3996 N N     . GLY C 3 449 ? 59.066  27.949 38.205  1.00 46.62  ? 449  GLY A N     1 
ATOM   3997 C CA    . GLY C 3 449 ? 58.275  29.163 38.206  1.00 46.19  ? 449  GLY A CA    1 
ATOM   3998 C C     . GLY C 3 449 ? 57.684  29.438 39.583  1.00 43.44  ? 449  GLY A C     1 
ATOM   3999 O O     . GLY C 3 449 ? 58.054  28.798 40.561  1.00 42.15  ? 449  GLY A O     1 
ATOM   4000 N N     . LYS C 3 450 ? 56.773  30.399 39.661  1.00 42.95  ? 450  LYS A N     1 
ATOM   4001 C CA    . LYS C 3 450 ? 56.112  30.726 40.918  1.00 42.49  ? 450  LYS A CA    1 
ATOM   4002 C C     . LYS C 3 450 ? 54.733  31.275 40.629  1.00 43.43  ? 450  LYS A C     1 
ATOM   4003 O O     . LYS C 3 450 ? 54.455  31.717 39.510  1.00 43.56  ? 450  LYS A O     1 
ATOM   4004 C CB    . LYS C 3 450 ? 56.874  31.795 41.667  1.00 44.08  ? 450  LYS A CB    1 
ATOM   4005 C CG    . LYS C 3 450 ? 58.288  31.465 42.034  1.00 47.45  ? 450  LYS A CG    1 
ATOM   4006 C CD    . LYS C 3 450 ? 58.849  32.700 42.706  1.00 47.70  ? 450  LYS A CD    1 
ATOM   4007 C CE    . LYS C 3 450 ? 60.306  32.574 43.021  1.00 51.15  ? 450  LYS A CE    1 
ATOM   4008 N NZ    . LYS C 3 450 ? 60.774  33.898 43.506  1.00 54.45  ? 450  LYS A NZ    1 
ATOM   4009 N N     . PRO C 3 451 ? 53.842  31.257 41.630  1.00 44.58  ? 451  PRO A N     1 
ATOM   4010 C CA    . PRO C 3 451 ? 52.482  31.791 41.428  1.00 44.69  ? 451  PRO A CA    1 
ATOM   4011 C C     . PRO C 3 451 ? 52.655  33.231 40.923  1.00 41.87  ? 451  PRO A C     1 
ATOM   4012 O O     . PRO C 3 451 ? 53.349  34.025 41.555  1.00 38.96  ? 451  PRO A O     1 
ATOM   4013 C CB    . PRO C 3 451 ? 51.874  31.745 42.827  1.00 45.81  ? 451  PRO A CB    1 
ATOM   4014 C CG    . PRO C 3 451 ? 52.569  30.583 43.461  1.00 47.54  ? 451  PRO A CG    1 
ATOM   4015 C CD    . PRO C 3 451 ? 54.017  30.747 43.002  1.00 45.42  ? 451  PRO A CD    1 
ATOM   4016 N N     . ILE C 3 452 ? 52.018  33.557 39.802  1.00 40.99  ? 452  ILE A N     1 
ATOM   4017 C CA    . ILE C 3 452 ? 52.171  34.866 39.178  1.00 40.11  ? 452  ILE A CA    1 
ATOM   4018 C C     . ILE C 3 452 ? 51.823  36.106 39.984  1.00 40.03  ? 452  ILE A C     1 
ATOM   4019 O O     . ILE C 3 452 ? 52.649  37.013 40.107  1.00 39.53  ? 452  ILE A O     1 
ATOM   4020 C CB    . ILE C 3 452 ? 51.435  34.903 37.811  1.00 38.42  ? 452  ILE A CB    1 
ATOM   4021 C CG1   . ILE C 3 452 ? 51.951  36.085 36.988  1.00 37.42  ? 452  ILE A CG1   1 
ATOM   4022 C CG2   . ILE C 3 452 ? 49.917  34.947 38.010  1.00 35.69  ? 452  ILE A CG2   1 
ATOM   4023 C CD1   . ILE C 3 452 ? 51.611  36.004 35.509  1.00 31.87  ? 452  ILE A CD1   1 
ATOM   4024 N N     . GLY C 3 453 ? 50.607  36.160 40.521  1.00 43.39  ? 453  GLY A N     1 
ATOM   4025 C CA    . GLY C 3 453 ? 50.192  37.314 41.306  1.00 44.03  ? 453  GLY A CA    1 
ATOM   4026 C C     . GLY C 3 453 ? 49.824  38.509 40.441  1.00 47.40  ? 453  GLY A C     1 
ATOM   4027 O O     . GLY C 3 453 ? 49.972  38.457 39.218  1.00 47.29  ? 453  GLY A O     1 
ATOM   4028 N N     . LYS C 3 454 ? 49.369  39.592 41.076  1.00 48.51  ? 454  LYS A N     1 
ATOM   4029 C CA    . LYS C 3 454 ? 48.965  40.808 40.370  1.00 48.34  ? 454  LYS A CA    1 
ATOM   4030 C C     . LYS C 3 454 ? 50.098  41.489 39.603  1.00 47.42  ? 454  LYS A C     1 
ATOM   4031 O O     . LYS C 3 454 ? 49.966  41.776 38.421  1.00 50.25  ? 454  LYS A O     1 
ATOM   4032 C CB    . LYS C 3 454 ? 48.357  41.800 41.357  1.00 49.43  ? 454  LYS A CB    1 
ATOM   4033 C CG    . LYS C 3 454 ? 47.941  43.133 40.752  1.00 55.73  ? 454  LYS A CG    1 
ATOM   4034 C CD    . LYS C 3 454 ? 48.710  44.313 41.394  1.00 59.91  ? 454  LYS A CD    1 
ATOM   4035 C CE    . LYS C 3 454 ? 50.002  44.694 40.648  1.00 59.58  ? 454  LYS A CE    1 
ATOM   4036 N NZ    . LYS C 3 454 ? 49.761  45.542 39.434  1.00 60.44  ? 454  LYS A NZ    1 
ATOM   4037 N N     . GLU C 3 455 ? 51.191  41.767 40.298  1.00 46.66  ? 455  GLU A N     1 
ATOM   4038 C CA    . GLU C 3 455 ? 52.372  42.415 39.729  1.00 45.84  ? 455  GLU A CA    1 
ATOM   4039 C C     . GLU C 3 455 ? 52.939  41.624 38.542  1.00 44.74  ? 455  GLU A C     1 
ATOM   4040 O O     . GLU C 3 455 ? 53.172  42.178 37.470  1.00 41.09  ? 455  GLU A O     1 
ATOM   4041 C CB    . GLU C 3 455 ? 53.425  42.526 40.818  1.00 45.64  ? 455  GLU A CB    1 
ATOM   4042 C CG    . GLU C 3 455 ? 54.671  43.251 40.434  1.00 54.70  ? 455  GLU A CG    1 
ATOM   4043 C CD    . GLU C 3 455 ? 54.646  44.687 40.881  1.00 58.42  ? 455  GLU A CD    1 
ATOM   4044 O OE1   . GLU C 3 455 ? 53.885  45.479 40.285  1.00 62.35  ? 455  GLU A OE1   1 
ATOM   4045 O OE2   . GLU C 3 455 ? 55.377  45.018 41.839  1.00 61.17  ? 455  GLU A OE2   1 
ATOM   4046 N N     . GLY C 3 456 ? 53.144  40.325 38.747  1.00 44.38  ? 456  GLY A N     1 
ATOM   4047 C CA    . GLY C 3 456 ? 53.668  39.454 37.708  1.00 43.12  ? 456  GLY A CA    1 
ATOM   4048 C C     . GLY C 3 456 ? 52.748  39.363 36.513  1.00 42.32  ? 456  GLY A C     1 
ATOM   4049 O O     . GLY C 3 456 ? 53.202  39.215 35.393  1.00 43.03  ? 456  GLY A O     1 
ATOM   4050 N N     . TYR C 3 457 ? 51.447  39.460 36.750  1.00 41.44  ? 457  TYR A N     1 
ATOM   4051 C CA    . TYR C 3 457 ? 50.458  39.390 35.682  1.00 41.30  ? 457  TYR A CA    1 
ATOM   4052 C C     . TYR C 3 457 ? 50.444  40.680 34.881  1.00 39.59  ? 457  TYR A C     1 
ATOM   4053 O O     . TYR C 3 457 ? 50.095  40.699 33.708  1.00 41.97  ? 457  TYR A O     1 
ATOM   4054 C CB    . TYR C 3 457 ? 49.062  39.133 36.269  1.00 43.64  ? 457  TYR A CB    1 
ATOM   4055 C CG    . TYR C 3 457 ? 47.953  39.077 35.247  1.00 43.32  ? 457  TYR A CG    1 
ATOM   4056 C CD1   . TYR C 3 457 ? 47.989  38.162 34.211  1.00 41.12  ? 457  TYR A CD1   1 
ATOM   4057 C CD2   . TYR C 3 457 ? 46.834  39.903 35.360  1.00 45.76  ? 457  TYR A CD2   1 
ATOM   4058 C CE1   . TYR C 3 457 ? 46.939  38.049 33.318  1.00 43.91  ? 457  TYR A CE1   1 
ATOM   4059 C CE2   . TYR C 3 457 ? 45.771  39.800 34.464  1.00 46.41  ? 457  TYR A CE2   1 
ATOM   4060 C CZ    . TYR C 3 457 ? 45.830  38.862 33.447  1.00 45.97  ? 457  TYR A CZ    1 
ATOM   4061 O OH    . TYR C 3 457 ? 44.767  38.710 32.579  1.00 47.99  ? 457  TYR A OH    1 
ATOM   4062 N N     . TYR C 3 458 ? 50.813  41.770 35.519  1.00 38.41  ? 458  TYR A N     1 
ATOM   4063 C CA    . TYR C 3 458 ? 50.843  43.037 34.822  1.00 35.39  ? 458  TYR A CA    1 
ATOM   4064 C C     . TYR C 3 458 ? 52.006  43.013 33.811  1.00 37.73  ? 458  TYR A C     1 
ATOM   4065 O O     . TYR C 3 458 ? 51.851  43.370 32.633  1.00 37.86  ? 458  TYR A O     1 
ATOM   4066 C CB    . TYR C 3 458 ? 50.979  44.159 35.847  1.00 33.05  ? 458  TYR A CB    1 
ATOM   4067 C CG    . TYR C 3 458 ? 51.360  45.486 35.272  1.00 36.87  ? 458  TYR A CG    1 
ATOM   4068 C CD1   . TYR C 3 458 ? 52.701  45.816 35.070  1.00 39.18  ? 458  TYR A CD1   1 
ATOM   4069 C CD2   . TYR C 3 458 ? 50.394  46.428 34.953  1.00 41.62  ? 458  TYR A CD2   1 
ATOM   4070 C CE1   . TYR C 3 458 ? 53.064  47.057 34.567  1.00 42.69  ? 458  TYR A CE1   1 
ATOM   4071 C CE2   . TYR C 3 458 ? 50.748  47.682 34.449  1.00 44.21  ? 458  TYR A CE2   1 
ATOM   4072 C CZ    . TYR C 3 458 ? 52.082  47.979 34.261  1.00 43.60  ? 458  TYR A CZ    1 
ATOM   4073 O OH    . TYR C 3 458 ? 52.432  49.188 33.762  1.00 46.98  ? 458  TYR A OH    1 
ATOM   4074 N N     . TRP C 3 459 ? 53.172  42.566 34.250  1.00 38.52  ? 459  TRP A N     1 
ATOM   4075 C CA    . TRP C 3 459 ? 54.297  42.492 33.336  1.00 39.75  ? 459  TRP A CA    1 
ATOM   4076 C C     . TRP C 3 459 ? 54.144  41.367 32.292  1.00 38.34  ? 459  TRP A C     1 
ATOM   4077 O O     . TRP C 3 459 ? 54.691  41.431 31.206  1.00 34.58  ? 459  TRP A O     1 
ATOM   4078 C CB    . TRP C 3 459 ? 55.592  42.382 34.133  1.00 40.13  ? 459  TRP A CB    1 
ATOM   4079 C CG    . TRP C 3 459 ? 56.161  43.744 34.369  1.00 45.05  ? 459  TRP A CG    1 
ATOM   4080 C CD1   . TRP C 3 459 ? 56.655  44.613 33.413  1.00 49.05  ? 459  TRP A CD1   1 
ATOM   4081 C CD2   . TRP C 3 459 ? 56.210  44.451 35.602  1.00 47.95  ? 459  TRP A CD2   1 
ATOM   4082 N NE1   . TRP C 3 459 ? 57.000  45.811 33.985  1.00 50.60  ? 459  TRP A NE1   1 
ATOM   4083 C CE2   . TRP C 3 459 ? 56.740  45.743 35.327  1.00 51.48  ? 459  TRP A CE2   1 
ATOM   4084 C CE3   . TRP C 3 459 ? 55.854  44.131 36.911  1.00 48.93  ? 459  TRP A CE3   1 
ATOM   4085 C CZ2   . TRP C 3 459 ? 56.919  46.703 36.317  1.00 56.00  ? 459  TRP A CZ2   1 
ATOM   4086 C CZ3   . TRP C 3 459 ? 56.029  45.092 37.902  1.00 55.07  ? 459  TRP A CZ3   1 
ATOM   4087 C CH2   . TRP C 3 459 ? 56.557  46.363 37.599  1.00 58.86  ? 459  TRP A CH2   1 
ATOM   4088 N N     . LEU C 3 460 ? 53.363  40.346 32.591  1.00 38.59  ? 460  LEU A N     1 
ATOM   4089 C CA    . LEU C 3 460 ? 53.193  39.312 31.584  1.00 38.04  ? 460  LEU A CA    1 
ATOM   4090 C C     . LEU C 3 460 ? 52.489  39.990 30.406  1.00 37.91  ? 460  LEU A C     1 
ATOM   4091 O O     . LEU C 3 460 ? 52.755  39.671 29.242  1.00 40.64  ? 460  LEU A O     1 
ATOM   4092 C CB    . LEU C 3 460 ? 52.336  38.155 32.104  1.00 36.08  ? 460  LEU A CB    1 
ATOM   4093 C CG    . LEU C 3 460 ? 51.924  37.103 31.055  1.00 38.71  ? 460  LEU A CG    1 
ATOM   4094 C CD1   . LEU C 3 460 ? 53.135  36.324 30.652  1.00 37.12  ? 460  LEU A CD1   1 
ATOM   4095 C CD2   . LEU C 3 460 ? 50.850  36.136 31.597  1.00 36.84  ? 460  LEU A CD2   1 
ATOM   4096 N N     . LYS C 3 461 ? 51.593  40.930 30.703  1.00 36.08  ? 461  LYS A N     1 
ATOM   4097 C CA    . LYS C 3 461 ? 50.861  41.603 29.633  1.00 36.17  ? 461  LYS A CA    1 
ATOM   4098 C C     . LYS C 3 461 ? 51.744  42.571 28.874  1.00 35.46  ? 461  LYS A C     1 
ATOM   4099 O O     . LYS C 3 461 ? 51.640  42.699 27.656  1.00 35.73  ? 461  LYS A O     1 
ATOM   4100 C CB    . LYS C 3 461 ? 49.618  42.300 30.193  1.00 36.63  ? 461  LYS A CB    1 
ATOM   4101 C CG    . LYS C 3 461 ? 48.599  41.303 30.716  1.00 41.26  ? 461  LYS A CG    1 
ATOM   4102 C CD    . LYS C 3 461 ? 47.262  41.939 31.081  1.00 43.04  ? 461  LYS A CD    1 
ATOM   4103 C CE    . LYS C 3 461 ? 47.370  42.875 32.265  1.00 50.17  ? 461  LYS A CE    1 
ATOM   4104 N NZ    . LYS C 3 461 ? 46.019  43.395 32.656  1.00 51.71  ? 461  LYS A NZ    1 
ATOM   4105 N N     . ILE C 3 462 ? 52.611  43.269 29.587  1.00 34.96  ? 462  ILE A N     1 
ATOM   4106 C CA    . ILE C 3 462 ? 53.537  44.173 28.920  1.00 36.45  ? 462  ILE A CA    1 
ATOM   4107 C C     . ILE C 3 462 ? 54.443  43.342 27.982  1.00 35.09  ? 462  ILE A C     1 
ATOM   4108 O O     . ILE C 3 462 ? 54.783  43.772 26.892  1.00 36.50  ? 462  ILE A O     1 
ATOM   4109 C CB    . ILE C 3 462 ? 54.413  44.903 29.935  1.00 36.35  ? 462  ILE A CB    1 
ATOM   4110 C CG1   . ILE C 3 462 ? 53.525  45.778 30.831  1.00 36.03  ? 462  ILE A CG1   1 
ATOM   4111 C CG2   . ILE C 3 462 ? 55.516  45.678 29.208  1.00 33.13  ? 462  ILE A CG2   1 
ATOM   4112 C CD1   . ILE C 3 462 ? 52.759  46.837 30.093  1.00 39.44  ? 462  ILE A CD1   1 
ATOM   4113 N N     . HIS C 3 463 ? 54.821  42.147 28.407  1.00 33.02  ? 463  HIS A N     1 
ATOM   4114 C CA    . HIS C 3 463 ? 55.667  41.282 27.584  1.00 33.31  ? 463  HIS A CA    1 
ATOM   4115 C C     . HIS C 3 463 ? 54.882  40.820 26.350  1.00 33.87  ? 463  HIS A C     1 
ATOM   4116 O O     . HIS C 3 463 ? 55.429  40.674 25.250  1.00 32.82  ? 463  HIS A O     1 
ATOM   4117 C CB    . HIS C 3 463 ? 56.146  40.089 28.410  1.00 30.75  ? 463  HIS A CB    1 
ATOM   4118 C CG    . HIS C 3 463 ? 57.001  39.132 27.643  1.00 32.16  ? 463  HIS A CG    1 
ATOM   4119 N ND1   . HIS C 3 463 ? 56.482  38.060 26.956  1.00 31.68  ? 463  HIS A ND1   1 
ATOM   4120 C CD2   . HIS C 3 463 ? 58.335  39.118 27.411  1.00 32.49  ? 463  HIS A CD2   1 
ATOM   4121 C CE1   . HIS C 3 463 ? 57.457  37.430 26.331  1.00 32.39  ? 463  HIS A CE1   1 
ATOM   4122 N NE2   . HIS C 3 463 ? 58.591  38.053 26.591  1.00 32.71  ? 463  HIS A NE2   1 
ATOM   4123 N N     . GLY C 3 464 ? 53.582  40.600 26.544  1.00 37.18  ? 464  GLY A N     1 
ATOM   4124 C CA    . GLY C 3 464 ? 52.716  40.204 25.450  1.00 33.18  ? 464  GLY A CA    1 
ATOM   4125 C C     . GLY C 3 464 ? 52.668  41.361 24.469  1.00 34.06  ? 464  GLY A C     1 
ATOM   4126 O O     . GLY C 3 464 ? 52.766  41.167 23.248  1.00 33.26  ? 464  GLY A O     1 
ATOM   4127 N N     . ALA C 3 465 ? 52.566  42.578 24.994  1.00 33.03  ? 465  ALA A N     1 
ATOM   4128 C CA    . ALA C 3 465 ? 52.496  43.759 24.117  1.00 36.58  ? 465  ALA A CA    1 
ATOM   4129 C C     . ALA C 3 465 ? 53.787  43.891 23.332  1.00 37.29  ? 465  ALA A C     1 
ATOM   4130 O O     . ALA C 3 465 ? 53.761  44.081 22.125  1.00 39.27  ? 465  ALA A O     1 
ATOM   4131 C CB    . ALA C 3 465 ? 52.251  45.044 24.936  1.00 34.01  ? 465  ALA A CB    1 
ATOM   4132 N N     . ASN C 3 466 ? 54.911  43.785 24.034  1.00 39.06  ? 466  ASN A N     1 
ATOM   4133 C CA    . ASN C 3 466 ? 56.226  43.887 23.418  1.00 37.43  ? 466  ASN A CA    1 
ATOM   4134 C C     . ASN C 3 466 ? 56.385  42.825 22.344  1.00 38.68  ? 466  ASN A C     1 
ATOM   4135 O O     . ASN C 3 466 ? 57.000  43.091 21.325  1.00 38.67  ? 466  ASN A O     1 
ATOM   4136 C CB    . ASN C 3 466 ? 57.345  43.750 24.479  1.00 37.08  ? 466  ASN A CB    1 
ATOM   4137 C CG    . ASN C 3 466 ? 57.458  44.984 25.386  1.00 34.40  ? 466  ASN A CG    1 
ATOM   4138 O OD1   . ASN C 3 466 ? 56.728  45.956 25.214  1.00 36.16  ? 466  ASN A OD1   1 
ATOM   4139 N ND2   . ASN C 3 466 ? 58.375  44.942 26.353  1.00 37.60  ? 466  ASN A ND2   1 
ATOM   4140 N N     . CYS C 3 467 ? 55.831  41.630 22.562  1.00 40.24  ? 467  CYS A N     1 
ATOM   4141 C CA    . CYS C 3 467 ? 55.962  40.572 21.566  1.00 42.59  ? 467  CYS A CA    1 
ATOM   4142 C C     . CYS C 3 467 ? 55.216  40.972 20.315  1.00 43.68  ? 467  CYS A C     1 
ATOM   4143 O O     . CYS C 3 467 ? 55.564  40.539 19.227  1.00 46.96  ? 467  CYS A O     1 
ATOM   4144 C CB    . CYS C 3 467 ? 55.440  39.229 22.082  1.00 44.73  ? 467  CYS A CB    1 
ATOM   4145 S SG    . CYS C 3 467 ? 56.563  38.376 23.189  1.00 38.73  ? 467  CYS A SG    1 
ATOM   4146 N N     . ALA C 3 468 ? 54.162  41.768 20.464  1.00 44.74  ? 468  ALA A N     1 
ATOM   4147 C CA    . ALA C 3 468 ? 53.460  42.269 19.290  1.00 45.43  ? 468  ALA A CA    1 
ATOM   4148 C C     . ALA C 3 468 ? 54.328  43.497 18.964  1.00 48.12  ? 468  ALA A C     1 
ATOM   4149 O O     . ALA C 3 468 ? 55.467  43.588 19.420  1.00 49.88  ? 468  ALA A O     1 
ATOM   4150 C CB    . ALA C 3 468 ? 52.045  42.675 19.639  1.00 40.37  ? 468  ALA A CB    1 
ATOM   4151 N N     . GLY C 3 469 ? 53.840  44.458 18.203  1.00 50.60  ? 469  GLY A N     1 
ATOM   4152 C CA    . GLY C 3 469 ? 54.730  45.578 17.941  1.00 51.84  ? 469  GLY A CA    1 
ATOM   4153 C C     . GLY C 3 469 ? 54.636  46.732 18.915  1.00 51.19  ? 469  GLY A C     1 
ATOM   4154 O O     . GLY C 3 469 ? 55.379  47.707 18.803  1.00 49.77  ? 469  GLY A O     1 
ATOM   4155 N N     . VAL C 3 470 ? 53.746  46.599 19.892  1.00 51.10  ? 470  VAL A N     1 
ATOM   4156 C CA    . VAL C 3 470 ? 53.476  47.653 20.866  1.00 48.35  ? 470  VAL A CA    1 
ATOM   4157 C C     . VAL C 3 470 ? 54.508  47.892 21.956  1.00 48.53  ? 470  VAL A C     1 
ATOM   4158 O O     . VAL C 3 470 ? 54.267  47.565 23.112  1.00 46.69  ? 470  VAL A O     1 
ATOM   4159 C CB    . VAL C 3 470 ? 52.108  47.394 21.516  1.00 46.13  ? 470  VAL A CB    1 
ATOM   4160 C CG1   . VAL C 3 470 ? 51.625  48.631 22.240  1.00 44.95  ? 470  VAL A CG1   1 
ATOM   4161 C CG2   . VAL C 3 470 ? 51.111  46.969 20.434  1.00 42.99  ? 470  VAL A CG2   1 
ATOM   4162 N N     . ASP C 3 471 ? 55.639  48.502 21.592  1.00 51.47  ? 471  ASP A N     1 
ATOM   4163 C CA    . ASP C 3 471 ? 56.715  48.773 22.555  1.00 52.66  ? 471  ASP A CA    1 
ATOM   4164 C C     . ASP C 3 471 ? 57.253  50.194 22.586  1.00 51.79  ? 471  ASP A C     1 
ATOM   4165 O O     . ASP C 3 471 ? 58.050  50.542 23.457  1.00 52.55  ? 471  ASP A O     1 
ATOM   4166 C CB    . ASP C 3 471 ? 57.899  47.825 22.329  1.00 55.31  ? 471  ASP A CB    1 
ATOM   4167 C CG    . ASP C 3 471 ? 58.334  47.758 20.871  1.00 62.55  ? 471  ASP A CG    1 
ATOM   4168 O OD1   . ASP C 3 471 ? 58.402  48.818 20.203  1.00 62.69  ? 471  ASP A OD1   1 
ATOM   4169 O OD2   . ASP C 3 471 ? 58.623  46.634 20.392  1.00 64.28  ? 471  ASP A OD2   1 
ATOM   4170 N N     . LYS C 3 472 ? 56.854  51.020 21.636  1.00 52.09  ? 472  LYS A N     1 
ATOM   4171 C CA    . LYS C 3 472 ? 57.335  52.391 21.628  1.00 54.11  ? 472  LYS A CA    1 
ATOM   4172 C C     . LYS C 3 472 ? 56.223  53.296 22.139  1.00 52.45  ? 472  LYS A C     1 
ATOM   4173 O O     . LYS C 3 472 ? 56.108  54.454 21.761  1.00 52.89  ? 472  LYS A O     1 
ATOM   4174 C CB    . LYS C 3 472 ? 57.779  52.771 20.214  1.00 57.56  ? 472  LYS A CB    1 
ATOM   4175 C CG    . LYS C 3 472 ? 59.026  51.996 19.767  1.00 62.23  ? 472  LYS A CG    1 
ATOM   4176 C CD    . LYS C 3 472 ? 59.115  51.840 18.247  1.00 66.02  ? 472  LYS A CD    1 
ATOM   4177 C CE    . LYS C 3 472 ? 60.236  50.875 17.854  1.00 64.89  ? 472  LYS A CE    1 
ATOM   4178 N NZ    . LYS C 3 472 ? 60.231  50.560 16.392  1.00 66.66  ? 472  LYS A NZ    1 
ATOM   4179 N N     . VAL C 3 473 ? 55.416  52.734 23.029  1.00 51.14  ? 473  VAL A N     1 
ATOM   4180 C CA    . VAL C 3 473 ? 54.288  53.417 23.630  1.00 46.70  ? 473  VAL A CA    1 
ATOM   4181 C C     . VAL C 3 473 ? 54.308  53.167 25.152  1.00 46.47  ? 473  VAL A C     1 
ATOM   4182 O O     . VAL C 3 473 ? 54.821  52.154 25.622  1.00 47.66  ? 473  VAL A O     1 
ATOM   4183 C CB    . VAL C 3 473 ? 52.978  52.885 22.995  1.00 46.43  ? 473  VAL A CB    1 
ATOM   4184 C CG1   . VAL C 3 473 ? 52.324  51.838 23.883  1.00 42.77  ? 473  VAL A CG1   1 
ATOM   4185 C CG2   . VAL C 3 473 ? 52.054  54.022 22.682  1.00 45.89  ? 473  VAL A CG2   1 
ATOM   4186 N N     . PRO C 3 474 ? 53.733  54.149 25.910  1.00 43.70  ? 474  PRO A N     1 
ATOM   4187 C CA    . PRO C 3 474 ? 53.718  54.003 27.375  1.00 39.97  ? 474  PRO A CA    1 
ATOM   4188 C C     . PRO C 3 474 ? 52.996  52.743 27.848  1.00 42.05  ? 474  PRO A C     1 
ATOM   4189 O O     . PRO C 3 474 ? 52.092  52.262 27.170  1.00 35.88  ? 474  PRO A O     1 
ATOM   4190 C CB    . PRO C 3 474 ? 52.990  55.251 27.828  1.00 41.05  ? 474  PRO A CB    1 
ATOM   4191 C CG    . PRO C 3 474 ? 52.000  55.414 26.724  1.00 43.66  ? 474  PRO A CG    1 
ATOM   4192 C CD    . PRO C 3 474 ? 52.871  55.280 25.518  1.00 44.02  ? 474  PRO A CD    1 
ATOM   4193 N N     . PHE C 3 475 ? 53.427  52.191 29.000  1.00 39.79  ? 475  PHE A N     1 
ATOM   4194 C CA    . PHE C 3 475 ? 52.876  50.960 29.566  1.00 38.58  ? 475  PHE A CA    1 
ATOM   4195 C C     . PHE C 3 475 ? 51.349  50.867 29.600  1.00 40.63  ? 475  PHE A C     1 
ATOM   4196 O O     . PHE C 3 475 ? 50.779  49.866 29.161  1.00 42.51  ? 475  PHE A O     1 
ATOM   4197 C CB    . PHE C 3 475 ? 53.438  50.716 30.967  1.00 38.17  ? 475  PHE A CB    1 
ATOM   4198 C CG    . PHE C 3 475 ? 54.952  50.534 31.013  1.00 43.22  ? 475  PHE A CG    1 
ATOM   4199 C CD1   . PHE C 3 475 ? 55.651  49.991 29.931  1.00 43.32  ? 475  PHE A CD1   1 
ATOM   4200 C CD2   . PHE C 3 475 ? 55.672  50.884 32.155  1.00 40.69  ? 475  PHE A CD2   1 
ATOM   4201 C CE1   . PHE C 3 475 ? 57.047  49.806 29.992  1.00 44.33  ? 475  PHE A CE1   1 
ATOM   4202 C CE2   . PHE C 3 475 ? 57.063  50.699 32.218  1.00 42.71  ? 475  PHE A CE2   1 
ATOM   4203 C CZ    . PHE C 3 475 ? 57.751  50.163 31.137  1.00 39.25  ? 475  PHE A CZ    1 
ATOM   4204 N N     . PRO C 3 476 ? 50.658  51.896 30.122  1.00 41.50  ? 476  PRO A N     1 
ATOM   4205 C CA    . PRO C 3 476 ? 49.192  51.807 30.151  1.00 43.02  ? 476  PRO A CA    1 
ATOM   4206 C C     . PRO C 3 476 ? 48.588  51.473 28.790  1.00 43.43  ? 476  PRO A C     1 
ATOM   4207 O O     . PRO C 3 476 ? 47.611  50.725 28.703  1.00 41.88  ? 476  PRO A O     1 
ATOM   4208 C CB    . PRO C 3 476 ? 48.762  53.184 30.685  1.00 42.27  ? 476  PRO A CB    1 
ATOM   4209 C CG    . PRO C 3 476 ? 49.956  54.070 30.388  1.00 46.18  ? 476  PRO A CG    1 
ATOM   4210 C CD    . PRO C 3 476 ? 51.115  53.168 30.702  1.00 40.66  ? 476  PRO A CD    1 
ATOM   4211 N N     . GLU C 3 477 ? 49.181  52.005 27.727  1.00 45.18  ? 477  GLU A N     1 
ATOM   4212 C CA    . GLU C 3 477 ? 48.697  51.722 26.377  1.00 45.47  ? 477  GLU A CA    1 
ATOM   4213 C C     . GLU C 3 477 ? 48.991  50.265 26.027  1.00 43.38  ? 477  GLU A C     1 
ATOM   4214 O O     . GLU C 3 477 ? 48.165  49.595 25.392  1.00 43.93  ? 477  GLU A O     1 
ATOM   4215 C CB    . GLU C 3 477 ? 49.379  52.620 25.342  1.00 49.88  ? 477  GLU A CB    1 
ATOM   4216 C CG    . GLU C 3 477 ? 48.945  54.079 25.350  1.00 57.32  ? 477  GLU A CG    1 
ATOM   4217 C CD    . GLU C 3 477 ? 49.377  54.812 24.076  1.00 63.57  ? 477  GLU A CD    1 
ATOM   4218 O OE1   . GLU C 3 477 ? 49.156  54.262 22.967  1.00 67.41  ? 477  GLU A OE1   1 
ATOM   4219 O OE2   . GLU C 3 477 ? 49.929  55.935 24.172  1.00 64.88  ? 477  GLU A OE2   1 
ATOM   4220 N N     . ARG C 3 478 ? 50.157  49.771 26.442  1.00 38.00  ? 478  ARG A N     1 
ATOM   4221 C CA    . ARG C 3 478 ? 50.504  48.389 26.141  1.00 36.06  ? 478  ARG A CA    1 
ATOM   4222 C C     . ARG C 3 478 ? 49.503  47.498 26.829  1.00 34.16  ? 478  ARG A C     1 
ATOM   4223 O O     . ARG C 3 478 ? 49.026  46.530 26.242  1.00 34.54  ? 478  ARG A O     1 
ATOM   4224 C CB    . ARG C 3 478 ? 51.912  48.036 26.632  1.00 30.54  ? 478  ARG A CB    1 
ATOM   4225 C CG    . ARG C 3 478 ? 52.965  48.996 26.132  1.00 33.54  ? 478  ARG A CG    1 
ATOM   4226 C CD    . ARG C 3 478 ? 54.366  48.481 26.305  1.00 31.83  ? 478  ARG A CD    1 
ATOM   4227 N NE    . ARG C 3 478 ? 55.278  49.609 26.263  1.00 36.70  ? 478  ARG A NE    1 
ATOM   4228 C CZ    . ARG C 3 478 ? 56.601  49.511 26.313  1.00 35.98  ? 478  ARG A CZ    1 
ATOM   4229 N NH1   . ARG C 3 478 ? 57.176  48.317 26.391  1.00 32.44  ? 478  ARG A NH1   1 
ATOM   4230 N NH2   . ARG C 3 478 ? 57.338  50.613 26.334  1.00 33.98  ? 478  ARG A NH2   1 
ATOM   4231 N N     . ILE C 3 479 ? 49.193  47.845 28.074  1.00 32.82  ? 479  ILE A N     1 
ATOM   4232 C CA    . ILE C 3 479 ? 48.236  47.082 28.880  1.00 36.47  ? 479  ILE A CA    1 
ATOM   4233 C C     . ILE C 3 479 ? 46.860  47.182 28.238  1.00 40.19  ? 479  ILE A C     1 
ATOM   4234 O O     . ILE C 3 479 ? 46.078  46.245 28.274  1.00 42.61  ? 479  ILE A O     1 
ATOM   4235 C CB    . ILE C 3 479 ? 48.128  47.643 30.317  1.00 37.24  ? 479  ILE A CB    1 
ATOM   4236 C CG1   . ILE C 3 479 ? 49.437  47.432 31.078  1.00 37.74  ? 479  ILE A CG1   1 
ATOM   4237 C CG2   . ILE C 3 479 ? 46.955  46.983 31.039  1.00 34.47  ? 479  ILE A CG2   1 
ATOM   4238 C CD1   . ILE C 3 479 ? 49.769  45.975 31.324  1.00 37.38  ? 479  ILE A CD1   1 
ATOM   4239 N N     . LYS C 3 480 ? 46.574  48.342 27.652  1.00 44.01  ? 480  LYS A N     1 
ATOM   4240 C CA    . LYS C 3 480 ? 45.300  48.579 26.996  1.00 45.55  ? 480  LYS A CA    1 
ATOM   4241 C C     . LYS C 3 480 ? 45.232  47.673 25.792  1.00 45.00  ? 480  LYS A C     1 
ATOM   4242 O O     . LYS C 3 480 ? 44.190  47.059 25.520  1.00 44.44  ? 480  LYS A O     1 
ATOM   4243 C CB    . LYS C 3 480 ? 45.202  50.036 26.548  1.00 48.74  ? 480  LYS A CB    1 
ATOM   4244 C CG    . LYS C 3 480 ? 43.818  50.461 26.125  1.00 53.39  ? 480  LYS A CG    1 
ATOM   4245 C CD    . LYS C 3 480 ? 42.870  50.409 27.305  1.00 60.42  ? 480  LYS A CD    1 
ATOM   4246 C CE    . LYS C 3 480 ? 41.496  50.946 26.940  1.00 62.30  ? 480  LYS A CE    1 
ATOM   4247 N NZ    . LYS C 3 480 ? 40.598  50.968 28.127  1.00 63.83  ? 480  LYS A NZ    1 
ATOM   4248 N N     . PHE C 3 481 ? 46.359  47.591 25.084  1.00 43.57  ? 481  PHE A N     1 
ATOM   4249 C CA    . PHE C 3 481 ? 46.478  46.771 23.877  1.00 40.35  ? 481  PHE A CA    1 
ATOM   4250 C C     . PHE C 3 481 ? 46.105  45.308 24.124  1.00 40.03  ? 481  PHE A C     1 
ATOM   4251 O O     . PHE C 3 481 ? 45.323  44.730 23.376  1.00 40.44  ? 481  PHE A O     1 
ATOM   4252 C CB    . PHE C 3 481 ? 47.910  46.868 23.297  1.00 41.49  ? 481  PHE A CB    1 
ATOM   4253 C CG    . PHE C 3 481 ? 48.171  45.910 22.165  1.00 40.82  ? 481  PHE A CG    1 
ATOM   4254 C CD1   . PHE C 3 481 ? 47.668  46.156 20.903  1.00 41.01  ? 481  PHE A CD1   1 
ATOM   4255 C CD2   . PHE C 3 481 ? 48.832  44.709 22.394  1.00 41.03  ? 481  PHE A CD2   1 
ATOM   4256 C CE1   . PHE C 3 481 ? 47.808  45.223 19.887  1.00 42.84  ? 481  PHE A CE1   1 
ATOM   4257 C CE2   . PHE C 3 481 ? 48.974  43.771 21.385  1.00 40.52  ? 481  PHE A CE2   1 
ATOM   4258 C CZ    . PHE C 3 481 ? 48.458  44.028 20.126  1.00 41.13  ? 481  PHE A CZ    1 
ATOM   4259 N N     . ILE C 3 482 ? 46.640  44.702 25.171  1.00 39.87  ? 482  ILE A N     1 
ATOM   4260 C CA    . ILE C 3 482 ? 46.308  43.303 25.425  1.00 43.39  ? 482  ILE A CA    1 
ATOM   4261 C C     . ILE C 3 482 ? 44.835  43.115 25.782  1.00 46.16  ? 482  ILE A C     1 
ATOM   4262 O O     . ILE C 3 482 ? 44.154  42.255 25.239  1.00 46.26  ? 482  ILE A O     1 
ATOM   4263 C CB    . ILE C 3 482 ? 47.206  42.694 26.551  1.00 42.89  ? 482  ILE A CB    1 
ATOM   4264 C CG1   . ILE C 3 482 ? 48.580  42.331 25.974  1.00 39.79  ? 482  ILE A CG1   1 
ATOM   4265 C CG2   . ILE C 3 482 ? 46.554  41.460 27.173  1.00 40.58  ? 482  ILE A CG2   1 
ATOM   4266 C CD1   . ILE C 3 482 ? 49.461  43.504 25.828  1.00 42.71  ? 482  ILE A CD1   1 
ATOM   4267 N N     . GLU C 3 483 ? 44.338  43.944 26.685  1.00 50.92  ? 483  GLU A N     1 
ATOM   4268 C CA    . GLU C 3 483 ? 42.959  43.828 27.109  1.00 55.89  ? 483  GLU A CA    1 
ATOM   4269 C C     . GLU C 3 483 ? 41.957  43.968 25.977  1.00 56.29  ? 483  GLU A C     1 
ATOM   4270 O O     . GLU C 3 483 ? 41.014  43.192 25.897  1.00 57.39  ? 483  GLU A O     1 
ATOM   4271 C CB    . GLU C 3 483 ? 42.696  44.835 28.213  1.00 60.00  ? 483  GLU A CB    1 
ATOM   4272 C CG    . GLU C 3 483 ? 43.600  44.595 29.403  1.00 64.97  ? 483  GLU A CG    1 
ATOM   4273 C CD    . GLU C 3 483 ? 43.249  45.462 30.581  1.00 70.78  ? 483  GLU A CD    1 
ATOM   4274 O OE1   . GLU C 3 483 ? 42.050  45.524 30.932  1.00 75.57  ? 483  GLU A OE1   1 
ATOM   4275 O OE2   . GLU C 3 483 ? 44.170  46.072 31.162  1.00 73.76  ? 483  GLU A OE2   1 
ATOM   4276 N N     . GLU C 3 484 ? 42.170  44.938 25.095  1.00 55.99  ? 484  GLU A N     1 
ATOM   4277 C CA    . GLU C 3 484 ? 41.280  45.133 23.960  1.00 56.85  ? 484  GLU A CA    1 
ATOM   4278 C C     . GLU C 3 484 ? 41.237  43.902 23.063  1.00 56.31  ? 484  GLU A C     1 
ATOM   4279 O O     . GLU C 3 484 ? 40.312  43.751 22.259  1.00 57.84  ? 484  GLU A O     1 
ATOM   4280 C CB    . GLU C 3 484 ? 41.740  46.311 23.107  1.00 61.54  ? 484  GLU A CB    1 
ATOM   4281 C CG    . GLU C 3 484 ? 41.839  47.628 23.842  1.00 70.43  ? 484  GLU A CG    1 
ATOM   4282 C CD    . GLU C 3 484 ? 42.318  48.767 22.948  1.00 74.79  ? 484  GLU A CD    1 
ATOM   4283 O OE1   . GLU C 3 484 ? 43.344  48.597 22.245  1.00 76.27  ? 484  GLU A OE1   1 
ATOM   4284 O OE2   . GLU C 3 484 ? 41.671  49.839 22.960  1.00 77.86  ? 484  GLU A OE2   1 
ATOM   4285 N N     . ASN C 3 485 ? 42.240  43.033 23.175  1.00 52.64  ? 485  ASN A N     1 
ATOM   4286 C CA    . ASN C 3 485 ? 42.286  41.835 22.344  1.00 50.13  ? 485  ASN A CA    1 
ATOM   4287 C C     . ASN C 3 485 ? 42.079  40.576 23.155  1.00 50.62  ? 485  ASN A C     1 
ATOM   4288 O O     . ASN C 3 485 ? 42.426  39.477 22.704  1.00 51.34  ? 485  ASN A O     1 
ATOM   4289 C CB    . ASN C 3 485 ? 43.627  41.722 21.610  1.00 46.65  ? 485  ASN A CB    1 
ATOM   4290 C CG    . ASN C 3 485 ? 43.783  42.739 20.512  1.00 44.73  ? 485  ASN A CG    1 
ATOM   4291 O OD1   . ASN C 3 485 ? 44.265  43.844 20.739  1.00 47.21  ? 485  ASN A OD1   1 
ATOM   4292 N ND2   . ASN C 3 485 ? 43.373  42.377 19.309  1.00 41.58  ? 485  ASN A ND2   1 
ATOM   4293 N N     . HIS C 3 486 ? 41.507  40.723 24.342  1.00 50.06  ? 486  HIS A N     1 
ATOM   4294 C CA    . HIS C 3 486 ? 41.299  39.574 25.209  1.00 50.44  ? 486  HIS A CA    1 
ATOM   4295 C C     . HIS C 3 486 ? 40.760  38.342 24.497  1.00 51.51  ? 486  HIS A C     1 
ATOM   4296 O O     . HIS C 3 486 ? 41.257  37.235 24.706  1.00 51.47  ? 486  HIS A O     1 
ATOM   4297 C CB    . HIS C 3 486 ? 40.374  39.933 26.377  1.00 48.70  ? 486  HIS A CB    1 
ATOM   4298 C CG    . HIS C 3 486 ? 40.138  38.797 27.325  1.00 48.70  ? 486  HIS A CG    1 
ATOM   4299 N ND1   . HIS C 3 486 ? 39.022  37.988 27.258  1.00 48.67  ? 486  HIS A ND1   1 
ATOM   4300 C CD2   . HIS C 3 486 ? 40.894  38.312 28.341  1.00 48.55  ? 486  HIS A CD2   1 
ATOM   4301 C CE1   . HIS C 3 486 ? 39.101  37.055 28.193  1.00 48.44  ? 486  HIS A CE1   1 
ATOM   4302 N NE2   . HIS C 3 486 ? 40.228  37.229 28.863  1.00 48.98  ? 486  HIS A NE2   1 
ATOM   4303 N N     . GLU C 3 487 ? 39.740  38.530 23.667  1.00 50.95  ? 487  GLU A N     1 
ATOM   4304 C CA    . GLU C 3 487 ? 39.132  37.412 22.963  1.00 52.88  ? 487  GLU A CA    1 
ATOM   4305 C C     . GLU C 3 487 ? 40.000  36.874 21.830  1.00 51.61  ? 487  GLU A C     1 
ATOM   4306 O O     . GLU C 3 487 ? 39.886  35.712 21.452  1.00 50.71  ? 487  GLU A O     1 
ATOM   4307 C CB    . GLU C 3 487 ? 37.744  37.813 22.433  1.00 56.73  ? 487  GLU A CB    1 
ATOM   4308 C CG    . GLU C 3 487 ? 36.702  37.950 23.551  1.00 62.26  ? 487  GLU A CG    1 
ATOM   4309 C CD    . GLU C 3 487 ? 36.830  39.269 24.302  1.00 62.28  ? 487  GLU A CD    1 
ATOM   4310 O OE1   . GLU C 3 487 ? 37.719  40.074 23.952  1.00 63.21  ? 487  GLU A OE1   1 
ATOM   4311 O OE2   . GLU C 3 487 ? 36.036  39.492 25.240  1.00 64.47  ? 487  GLU A OE2   1 
ATOM   4312 N N     . ASN C 3 488 ? 40.860  37.721 21.278  1.00 51.11  ? 488  ASN A N     1 
ATOM   4313 C CA    . ASN C 3 488 ? 41.743  37.278 20.205  1.00 50.70  ? 488  ASN A CA    1 
ATOM   4314 C C     . ASN C 3 488 ? 42.798  36.382 20.860  1.00 47.32  ? 488  ASN A C     1 
ATOM   4315 O O     . ASN C 3 488 ? 43.041  35.249 20.419  1.00 45.36  ? 488  ASN A O     1 
ATOM   4316 C CB    . ASN C 3 488 ? 42.416  38.473 19.522  1.00 53.76  ? 488  ASN A CB    1 
ATOM   4317 C CG    . ASN C 3 488 ? 41.453  39.273 18.663  1.00 58.03  ? 488  ASN A CG    1 
ATOM   4318 O OD1   . ASN C 3 488 ? 40.720  38.708 17.857  1.00 63.26  ? 488  ASN A OD1   1 
ATOM   4319 N ND2   . ASN C 3 488 ? 41.461  40.593 18.820  1.00 58.39  ? 488  ASN A ND2   1 
ATOM   4320 N N     . ILE C 3 489 ? 43.398  36.898 21.925  1.00 41.36  ? 489  ILE A N     1 
ATOM   4321 C CA    . ILE C 3 489 ? 44.405  36.160 22.650  1.00 41.67  ? 489  ILE A CA    1 
ATOM   4322 C C     . ILE C 3 489 ? 43.880  34.786 23.061  1.00 43.03  ? 489  ILE A C     1 
ATOM   4323 O O     . ILE C 3 489 ? 44.539  33.764 22.827  1.00 42.15  ? 489  ILE A O     1 
ATOM   4324 C CB    . ILE C 3 489 ? 44.863  36.946 23.881  1.00 40.07  ? 489  ILE A CB    1 
ATOM   4325 C CG1   . ILE C 3 489 ? 45.505  38.261 23.423  1.00 40.81  ? 489  ILE A CG1   1 
ATOM   4326 C CG2   . ILE C 3 489 ? 45.833  36.122 24.677  1.00 42.34  ? 489  ILE A CG2   1 
ATOM   4327 C CD1   . ILE C 3 489 ? 46.047  39.181 24.528  1.00 38.40  ? 489  ILE A CD1   1 
ATOM   4328 N N     . MET C 3 490 ? 42.682  34.756 23.642  1.00 43.32  ? 490  MET A N     1 
ATOM   4329 C CA    . MET C 3 490 ? 42.086  33.490 24.073  1.00 43.25  ? 490  MET A CA    1 
ATOM   4330 C C     . MET C 3 490 ? 41.827  32.542 22.910  1.00 41.00  ? 490  MET A C     1 
ATOM   4331 O O     . MET C 3 490 ? 42.062  31.335 23.022  1.00 42.26  ? 490  MET A O     1 
ATOM   4332 C CB    . MET C 3 490 ? 40.757  33.723 24.808  1.00 44.44  ? 490  MET A CB    1 
ATOM   4333 C CG    . MET C 3 490 ? 40.859  34.632 26.011  1.00 44.38  ? 490  MET A CG    1 
ATOM   4334 S SD    . MET C 3 490 ? 42.067  34.080 27.209  1.00 50.16  ? 490  MET A SD    1 
ATOM   4335 C CE    . MET C 3 490 ? 41.303  32.638 27.890  1.00 44.71  ? 490  MET A CE    1 
ATOM   4336 N N     . ALA C 3 491 ? 41.313  33.070 21.806  1.00 39.23  ? 491  ALA A N     1 
ATOM   4337 C CA    . ALA C 3 491 ? 41.031  32.216 20.646  1.00 39.14  ? 491  ALA A CA    1 
ATOM   4338 C C     . ALA C 3 491 ? 42.323  31.554 20.108  1.00 38.58  ? 491  ALA A C     1 
ATOM   4339 O O     . ALA C 3 491 ? 42.332  30.391 19.695  1.00 34.34  ? 491  ALA A O     1 
ATOM   4340 C CB    . ALA C 3 491 ? 40.349  33.031 19.561  1.00 37.77  ? 491  ALA A CB    1 
ATOM   4341 N N     . CYS C 3 492 ? 43.420  32.300 20.137  1.00 39.20  ? 492  CYS A N     1 
ATOM   4342 C CA    . CYS C 3 492 ? 44.703  31.777 19.692  1.00 40.80  ? 492  CYS A CA    1 
ATOM   4343 C C     . CYS C 3 492 ? 45.210  30.684 20.615  1.00 39.74  ? 492  CYS A C     1 
ATOM   4344 O O     . CYS C 3 492 ? 45.732  29.680 20.155  1.00 38.69  ? 492  CYS A O     1 
ATOM   4345 C CB    . CYS C 3 492 ? 45.727  32.898 19.608  1.00 41.41  ? 492  CYS A CB    1 
ATOM   4346 S SG    . CYS C 3 492 ? 45.382  34.008 18.232  1.00 50.69  ? 492  CYS A SG    1 
ATOM   4347 N N     . ALA C 3 493 ? 45.041  30.867 21.920  1.00 41.41  ? 493  ALA A N     1 
ATOM   4348 C CA    . ALA C 3 493 ? 45.499  29.872 22.873  1.00 39.89  ? 493  ALA A CA    1 
ATOM   4349 C C     . ALA C 3 493 ? 44.698  28.597 22.735  1.00 41.62  ? 493  ALA A C     1 
ATOM   4350 O O     . ALA C 3 493 ? 45.227  27.507 22.877  1.00 43.17  ? 493  ALA A O     1 
ATOM   4351 C CB    . ALA C 3 493 ? 45.382  30.402 24.275  1.00 39.14  ? 493  ALA A CB    1 
ATOM   4352 N N     . LYS C 3 494 ? 43.419  28.753 22.431  1.00 42.60  ? 494  LYS A N     1 
ATOM   4353 C CA    . LYS C 3 494 ? 42.495  27.639 22.266  1.00 43.83  ? 494  LYS A CA    1 
ATOM   4354 C C     . LYS C 3 494 ? 42.674  26.826 20.972  1.00 42.90  ? 494  LYS A C     1 
ATOM   4355 O O     . LYS C 3 494 ? 42.651  25.598 21.002  1.00 43.67  ? 494  LYS A O     1 
ATOM   4356 C CB    . LYS C 3 494 ? 41.060  28.183 22.343  1.00 48.44  ? 494  LYS A CB    1 
ATOM   4357 C CG    . LYS C 3 494 ? 39.968  27.149 22.315  1.00 52.88  ? 494  LYS A CG    1 
ATOM   4358 C CD    . LYS C 3 494 ? 39.767  26.537 23.681  1.00 57.85  ? 494  LYS A CD    1 
ATOM   4359 C CE    . LYS C 3 494 ? 38.466  25.726 23.714  1.00 62.68  ? 494  LYS A CE    1 
ATOM   4360 N NZ    . LYS C 3 494 ? 38.223  25.096 25.048  1.00 65.82  ? 494  LYS A NZ    1 
ATOM   4361 N N     . SER C 3 495 ? 42.834  27.506 19.840  1.00 42.08  ? 495  SER A N     1 
ATOM   4362 C CA    . SER C 3 495 ? 42.995  26.835 18.537  1.00 41.26  ? 495  SER A CA    1 
ATOM   4363 C C     . SER C 3 495 ? 44.000  27.587 17.653  1.00 39.09  ? 495  SER A C     1 
ATOM   4364 O O     . SER C 3 495 ? 43.622  28.162 16.609  1.00 36.70  ? 495  SER A O     1 
ATOM   4365 C CB    . SER C 3 495 ? 41.656  26.785 17.810  1.00 44.87  ? 495  SER A CB    1 
ATOM   4366 O OG    . SER C 3 495 ? 40.643  26.334 18.686  1.00 51.75  ? 495  SER A OG    1 
ATOM   4367 N N     . PRO C 3 496 ? 45.294  27.558 18.039  1.00 36.41  ? 496  PRO A N     1 
ATOM   4368 C CA    . PRO C 3 496 ? 46.385  28.233 17.321  1.00 37.31  ? 496  PRO A CA    1 
ATOM   4369 C C     . PRO C 3 496 ? 46.446  27.934 15.833  1.00 38.22  ? 496  PRO A C     1 
ATOM   4370 O O     . PRO C 3 496 ? 46.798  28.803 15.056  1.00 40.65  ? 496  PRO A O     1 
ATOM   4371 C CB    . PRO C 3 496 ? 47.638  27.790 18.083  1.00 34.02  ? 496  PRO A CB    1 
ATOM   4372 C CG    . PRO C 3 496 ? 47.259  26.430 18.573  1.00 37.93  ? 496  PRO A CG    1 
ATOM   4373 C CD    . PRO C 3 496 ? 45.829  26.609 19.033  1.00 37.27  ? 496  PRO A CD    1 
ATOM   4374 N N     . LEU C 3 497 ? 46.095  26.711 15.443  1.00 38.97  ? 497  LEU A N     1 
ATOM   4375 C CA    . LEU C 3 497 ? 46.091  26.327 14.044  1.00 40.83  ? 497  LEU A CA    1 
ATOM   4376 C C     . LEU C 3 497 ? 44.930  26.940 13.278  1.00 42.01  ? 497  LEU A C     1 
ATOM   4377 O O     . LEU C 3 497 ? 45.030  27.170 12.076  1.00 41.26  ? 497  LEU A O     1 
ATOM   4378 C CB    . LEU C 3 497 ? 46.014  24.811 13.915  1.00 38.24  ? 497  LEU A CB    1 
ATOM   4379 C CG    . LEU C 3 497 ? 47.140  24.007 14.575  1.00 41.27  ? 497  LEU A CG    1 
ATOM   4380 C CD1   . LEU C 3 497 ? 46.962  22.547 14.187  1.00 38.67  ? 497  LEU A CD1   1 
ATOM   4381 C CD2   . LEU C 3 497 ? 48.527  24.497 14.118  1.00 35.27  ? 497  LEU A CD2   1 
ATOM   4382 N N     . GLU C 3 498 ? 43.820  27.199 13.965  1.00 45.86  ? 498  GLU A N     1 
ATOM   4383 C CA    . GLU C 3 498 ? 42.643  27.775 13.316  1.00 48.32  ? 498  GLU A CA    1 
ATOM   4384 C C     . GLU C 3 498 ? 42.695  29.300 13.346  1.00 47.87  ? 498  GLU A C     1 
ATOM   4385 O O     . GLU C 3 498 ? 42.464  29.961 12.336  1.00 47.38  ? 498  GLU A O     1 
ATOM   4386 C CB    . GLU C 3 498 ? 41.374  27.290 14.019  1.00 52.38  ? 498  GLU A CB    1 
ATOM   4387 C CG    . GLU C 3 498 ? 40.068  27.598 13.287  1.00 59.08  ? 498  GLU A CG    1 
ATOM   4388 C CD    . GLU C 3 498 ? 38.856  26.973 13.981  1.00 62.28  ? 498  GLU A CD    1 
ATOM   4389 O OE1   . GLU C 3 498 ? 38.470  27.445 15.069  1.00 63.21  ? 498  GLU A OE1   1 
ATOM   4390 O OE2   . GLU C 3 498 ? 38.296  25.994 13.442  1.00 64.47  ? 498  GLU A OE2   1 
ATOM   4391 N N     . ASN C 3 499 ? 43.007  29.852 14.510  1.00 46.14  ? 499  ASN A N     1 
ATOM   4392 C CA    . ASN C 3 499 ? 43.082  31.294 14.660  1.00 46.30  ? 499  ASN A CA    1 
ATOM   4393 C C     . ASN C 3 499 ? 44.544  31.695 14.693  1.00 45.97  ? 499  ASN A C     1 
ATOM   4394 O O     . ASN C 3 499 ? 45.221  31.578 15.709  1.00 47.41  ? 499  ASN A O     1 
ATOM   4395 C CB    . ASN C 3 499 ? 42.355  31.694 15.933  1.00 45.24  ? 499  ASN A CB    1 
ATOM   4396 C CG    . ASN C 3 499 ? 40.936  31.172 15.953  1.00 44.38  ? 499  ASN A CG    1 
ATOM   4397 O OD1   . ASN C 3 499 ? 40.115  31.569 15.133  1.00 49.71  ? 499  ASN A OD1   1 
ATOM   4398 N ND2   . ASN C 3 499 ? 40.648  30.262 16.870  1.00 41.78  ? 499  ASN A ND2   1 
ATOM   4399 N N     . THR C 3 500 ? 45.015  32.191 13.562  1.00 43.03  ? 500  THR A N     1 
ATOM   4400 C CA    . THR C 3 500 ? 46.400  32.545 13.420  1.00 42.84  ? 500  THR A CA    1 
ATOM   4401 C C     . THR C 3 500 ? 46.717  34.026 13.542  1.00 44.55  ? 500  THR A C     1 
ATOM   4402 O O     . THR C 3 500 ? 47.617  34.545 12.877  1.00 46.61  ? 500  THR A O     1 
ATOM   4403 C CB    . THR C 3 500 ? 46.892  32.011 12.082  1.00 44.18  ? 500  THR A CB    1 
ATOM   4404 O OG1   . THR C 3 500 ? 46.280  32.748 11.011  1.00 42.02  ? 500  THR A OG1   1 
ATOM   4405 C CG2   . THR C 3 500 ? 46.498  30.533 11.957  1.00 38.76  ? 500  THR A CG2   1 
ATOM   4406 N N     . TRP C 3 501 ? 45.985  34.709 14.405  1.00 44.91  ? 501  TRP A N     1 
ATOM   4407 C CA    . TRP C 3 501 ? 46.207  36.127 14.599  1.00 42.46  ? 501  TRP A CA    1 
ATOM   4408 C C     . TRP C 3 501 ? 47.599  36.292 15.205  1.00 42.02  ? 501  TRP A C     1 
ATOM   4409 O O     . TRP C 3 501 ? 48.272  37.304 15.000  1.00 42.53  ? 501  TRP A O     1 
ATOM   4410 C CB    . TRP C 3 501 ? 45.142  36.695 15.541  1.00 40.61  ? 501  TRP A CB    1 
ATOM   4411 C CG    . TRP C 3 501 ? 45.405  38.089 15.946  1.00 38.42  ? 501  TRP A CG    1 
ATOM   4412 C CD1   . TRP C 3 501 ? 45.452  39.184 15.130  1.00 37.17  ? 501  TRP A CD1   1 
ATOM   4413 C CD2   . TRP C 3 501 ? 45.666  38.561 17.273  1.00 36.17  ? 501  TRP A CD2   1 
ATOM   4414 N NE1   . TRP C 3 501 ? 45.722  40.310 15.868  1.00 35.83  ? 501  TRP A NE1   1 
ATOM   4415 C CE2   . TRP C 3 501 ? 45.858  39.964 17.186  1.00 34.75  ? 501  TRP A CE2   1 
ATOM   4416 C CE3   . TRP C 3 501 ? 45.756  37.940 18.529  1.00 38.68  ? 501  TRP A CE3   1 
ATOM   4417 C CZ2   . TRP C 3 501 ? 46.133  40.763 18.309  1.00 32.75  ? 501  TRP A CZ2   1 
ATOM   4418 C CZ3   . TRP C 3 501 ? 46.033  38.746 19.661  1.00 37.73  ? 501  TRP A CZ3   1 
ATOM   4419 C CH2   . TRP C 3 501 ? 46.216  40.139 19.532  1.00 34.28  ? 501  TRP A CH2   1 
ATOM   4420 N N     . TRP C 3 502 ? 48.015  35.273 15.945  1.00 37.02  ? 502  TRP A N     1 
ATOM   4421 C CA    . TRP C 3 502 ? 49.305  35.272 16.603  1.00 39.11  ? 502  TRP A CA    1 
ATOM   4422 C C     . TRP C 3 502 ? 50.467  35.257 15.608  1.00 38.17  ? 502  TRP A C     1 
ATOM   4423 O O     . TRP C 3 502 ? 51.446  35.982 15.767  1.00 39.31  ? 502  TRP A O     1 
ATOM   4424 C CB    . TRP C 3 502 ? 49.411  34.062 17.553  1.00 38.99  ? 502  TRP A CB    1 
ATOM   4425 C CG    . TRP C 3 502 ? 49.424  32.718 16.855  1.00 39.06  ? 502  TRP A CG    1 
ATOM   4426 C CD1   . TRP C 3 502 ? 48.348  31.923 16.580  1.00 37.41  ? 502  TRP A CD1   1 
ATOM   4427 C CD2   . TRP C 3 502 ? 50.573  32.038 16.324  1.00 36.37  ? 502  TRP A CD2   1 
ATOM   4428 N NE1   . TRP C 3 502 ? 48.756  30.783 15.908  1.00 40.40  ? 502  TRP A NE1   1 
ATOM   4429 C CE2   . TRP C 3 502 ? 50.114  30.830 15.739  1.00 37.06  ? 502  TRP A CE2   1 
ATOM   4430 C CE3   . TRP C 3 502 ? 51.945  32.330 16.287  1.00 37.93  ? 502  TRP A CE3   1 
ATOM   4431 C CZ2   . TRP C 3 502 ? 50.979  29.915 15.125  1.00 34.64  ? 502  TRP A CZ2   1 
ATOM   4432 C CZ3   . TRP C 3 502 ? 52.806  31.415 15.677  1.00 37.82  ? 502  TRP A CZ3   1 
ATOM   4433 C CH2   . TRP C 3 502 ? 52.311  30.216 15.105  1.00 34.29  ? 502  TRP A CH2   1 
ATOM   4434 N N     . ALA C 3 503 ? 50.341  34.420 14.589  1.00 38.79  ? 503  ALA A N     1 
ATOM   4435 C CA    . ALA C 3 503 ? 51.356  34.277 13.567  1.00 38.40  ? 503  ALA A CA    1 
ATOM   4436 C C     . ALA C 3 503 ? 51.631  35.575 12.829  1.00 38.73  ? 503  ALA A C     1 
ATOM   4437 O O     . ALA C 3 503 ? 52.605  35.672 12.097  1.00 35.79  ? 503  ALA A O     1 
ATOM   4438 C CB    . ALA C 3 503 ? 50.942  33.204 12.577  1.00 41.32  ? 503  ALA A CB    1 
ATOM   4439 N N     . GLU C 3 504 ? 50.796  36.584 13.030  1.00 41.24  ? 504  GLU A N     1 
ATOM   4440 C CA    . GLU C 3 504 ? 50.997  37.850 12.336  1.00 40.03  ? 504  GLU A CA    1 
ATOM   4441 C C     . GLU C 3 504 ? 51.711  38.875 13.185  1.00 41.11  ? 504  GLU A C     1 
ATOM   4442 O O     . GLU C 3 504 ? 52.027  39.967 12.707  1.00 42.19  ? 504  GLU A O     1 
ATOM   4443 C CB    . GLU C 3 504 ? 49.649  38.436 11.912  1.00 42.10  ? 504  GLU A CB    1 
ATOM   4444 C CG    . GLU C 3 504 ? 48.908  37.644 10.866  1.00 45.42  ? 504  GLU A CG    1 
ATOM   4445 C CD    . GLU C 3 504 ? 47.406  37.869 10.939  1.00 48.63  ? 504  GLU A CD    1 
ATOM   4446 O OE1   . GLU C 3 504 ? 46.814  37.559 11.992  1.00 55.45  ? 504  GLU A OE1   1 
ATOM   4447 O OE2   . GLU C 3 504 ? 46.816  38.348 9.952   1.00 49.52  ? 504  GLU A OE2   1 
ATOM   4448 N N     . GLN C 3 505 ? 51.951  38.545 14.446  1.00 38.07  ? 505  GLN A N     1 
ATOM   4449 C CA    . GLN C 3 505 ? 52.582  39.504 15.326  1.00 39.40  ? 505  GLN A CA    1 
ATOM   4450 C C     . GLN C 3 505 ? 54.093  39.666 15.139  1.00 40.91  ? 505  GLN A C     1 
ATOM   4451 O O     . GLN C 3 505 ? 54.746  38.837 14.521  1.00 43.67  ? 505  GLN A O     1 
ATOM   4452 C CB    . GLN C 3 505 ? 52.238  39.152 16.766  1.00 39.66  ? 505  GLN A CB    1 
ATOM   4453 C CG    . GLN C 3 505 ? 50.734  38.993 16.995  1.00 40.36  ? 505  GLN A CG    1 
ATOM   4454 C CD    . GLN C 3 505 ? 49.941  40.196 16.490  1.00 42.76  ? 505  GLN A CD    1 
ATOM   4455 O OE1   . GLN C 3 505 ? 50.139  41.328 16.947  1.00 41.17  ? 505  GLN A OE1   1 
ATOM   4456 N NE2   . GLN C 3 505 ? 49.043  39.953 15.532  1.00 41.04  ? 505  GLN A NE2   1 
ATOM   4457 N N     . ASP C 3 506 ? 54.632  40.751 15.676  1.00 41.62  ? 506  ASP A N     1 
ATOM   4458 C CA    . ASP C 3 506 ? 56.054  41.065 15.578  1.00 44.12  ? 506  ASP A CA    1 
ATOM   4459 C C     . ASP C 3 506 ? 56.955  39.852 15.871  1.00 42.42  ? 506  ASP A C     1 
ATOM   4460 O O     . ASP C 3 506 ? 57.810  39.490 15.065  1.00 43.34  ? 506  ASP A O     1 
ATOM   4461 C CB    . ASP C 3 506 ? 56.355  42.211 16.537  1.00 51.19  ? 506  ASP A CB    1 
ATOM   4462 C CG    . ASP C 3 506 ? 57.720  42.806 16.334  1.00 60.21  ? 506  ASP A CG    1 
ATOM   4463 O OD1   . ASP C 3 506 ? 58.717  42.069 16.516  1.00 63.91  ? 506  ASP A OD1   1 
ATOM   4464 O OD2   . ASP C 3 506 ? 57.795  44.019 16.004  1.00 64.27  ? 506  ASP A OD2   1 
ATOM   4465 N N     . SER C 3 507 ? 56.784  39.238 17.034  1.00 40.22  ? 507  SER A N     1 
ATOM   4466 C CA    . SER C 3 507 ? 57.556  38.057 17.399  1.00 35.39  ? 507  SER A CA    1 
ATOM   4467 C C     . SER C 3 507 ? 56.487  37.020 17.571  1.00 33.86  ? 507  SER A C     1 
ATOM   4468 O O     . SER C 3 507 ? 56.003  36.789 18.673  1.00 33.67  ? 507  SER A O     1 
ATOM   4469 C CB    . SER C 3 507 ? 58.286  38.265 18.717  1.00 34.59  ? 507  SER A CB    1 
ATOM   4470 O OG    . SER C 3 507 ? 59.105  39.412 18.667  1.00 35.16  ? 507  SER A OG    1 
ATOM   4471 N N     . PRO C 3 508 ? 56.098  36.381 16.471  1.00 34.88  ? 508  PRO A N     1 
ATOM   4472 C CA    . PRO C 3 508 ? 55.054  35.348 16.449  1.00 35.27  ? 508  PRO A CA    1 
ATOM   4473 C C     . PRO C 3 508 ? 55.107  34.256 17.499  1.00 37.01  ? 508  PRO A C     1 
ATOM   4474 O O     . PRO C 3 508 ? 54.226  34.186 18.354  1.00 38.88  ? 508  PRO A O     1 
ATOM   4475 C CB    . PRO C 3 508 ? 55.133  34.795 15.032  1.00 33.58  ? 508  PRO A CB    1 
ATOM   4476 C CG    . PRO C 3 508 ? 56.622  35.022 14.675  1.00 33.50  ? 508  PRO A CG    1 
ATOM   4477 C CD    . PRO C 3 508 ? 56.834  36.428 15.194  1.00 34.48  ? 508  PRO A CD    1 
ATOM   4478 N N     . PHE C 3 509 ? 56.109  33.387 17.430  1.00 37.28  ? 509  PHE A N     1 
ATOM   4479 C CA    . PHE C 3 509 ? 56.209  32.298 18.394  1.00 33.91  ? 509  PHE A CA    1 
ATOM   4480 C C     . PHE C 3 509 ? 56.291  32.771 19.836  1.00 31.15  ? 509  PHE A C     1 
ATOM   4481 O O     . PHE C 3 509 ? 55.733  32.154 20.716  1.00 31.16  ? 509  PHE A O     1 
ATOM   4482 C CB    . PHE C 3 509 ? 57.384  31.390 18.039  1.00 33.56  ? 509  PHE A CB    1 
ATOM   4483 C CG    . PHE C 3 509 ? 57.166  30.622 16.779  1.00 33.07  ? 509  PHE A CG    1 
ATOM   4484 C CD1   . PHE C 3 509 ? 56.252  29.578 16.740  1.00 32.19  ? 509  PHE A CD1   1 
ATOM   4485 C CD2   . PHE C 3 509 ? 57.828  30.972 15.609  1.00 39.12  ? 509  PHE A CD2   1 
ATOM   4486 C CE1   . PHE C 3 509 ? 55.996  28.891 15.559  1.00 33.79  ? 509  PHE A CE1   1 
ATOM   4487 C CE2   . PHE C 3 509 ? 57.573  30.282 14.410  1.00 37.44  ? 509  PHE A CE2   1 
ATOM   4488 C CZ    . PHE C 3 509 ? 56.657  29.244 14.393  1.00 36.23  ? 509  PHE A CZ    1 
ATOM   4489 N N     . CYS C 3 510 ? 56.981  33.869 20.096  1.00 34.15  ? 510  CYS A N     1 
ATOM   4490 C CA    . CYS C 3 510 ? 57.032  34.351 21.473  1.00 35.66  ? 510  CYS A CA    1 
ATOM   4491 C C     . CYS C 3 510 ? 55.663  34.916 21.872  1.00 33.91  ? 510  CYS A C     1 
ATOM   4492 O O     . CYS C 3 510 ? 55.256  34.843 23.027  1.00 33.89  ? 510  CYS A O     1 
ATOM   4493 C CB    . CYS C 3 510 ? 58.116  35.401 21.632  1.00 33.40  ? 510  CYS A CB    1 
ATOM   4494 S SG    . CYS C 3 510 ? 59.748  34.666 21.615  1.00 42.56  ? 510  CYS A SG    1 
ATOM   4495 N N     . PHE C 3 511 ? 54.942  35.440 20.898  1.00 32.50  ? 511  PHE A N     1 
ATOM   4496 C CA    . PHE C 3 511 ? 53.630  35.976 21.162  1.00 34.18  ? 511  PHE A CA    1 
ATOM   4497 C C     . PHE C 3 511 ? 52.686  34.810 21.446  1.00 33.27  ? 511  PHE A C     1 
ATOM   4498 O O     . PHE C 3 511 ? 51.802  34.907 22.302  1.00 34.21  ? 511  PHE A O     1 
ATOM   4499 C CB    . PHE C 3 511 ? 53.108  36.777 19.968  1.00 31.95  ? 511  PHE A CB    1 
ATOM   4500 C CG    . PHE C 3 511 ? 51.801  37.451 20.245  1.00 34.04  ? 511  PHE A CG    1 
ATOM   4501 C CD1   . PHE C 3 511 ? 51.767  38.680 20.915  1.00 32.29  ? 511  PHE A CD1   1 
ATOM   4502 C CD2   . PHE C 3 511 ? 50.600  36.822 19.923  1.00 34.35  ? 511  PHE A CD2   1 
ATOM   4503 C CE1   . PHE C 3 511 ? 50.555  39.268 21.266  1.00 28.09  ? 511  PHE A CE1   1 
ATOM   4504 C CE2   . PHE C 3 511 ? 49.380  37.401 20.269  1.00 34.09  ? 511  PHE A CE2   1 
ATOM   4505 C CZ    . PHE C 3 511 ? 49.360  38.632 20.948  1.00 33.33  ? 511  PHE A CZ    1 
ATOM   4506 N N     . LEU C 3 512 ? 52.877  33.706 20.728  1.00 32.01  ? 512  LEU A N     1 
ATOM   4507 C CA    . LEU C 3 512 ? 52.036  32.540 20.935  1.00 31.33  ? 512  LEU A CA    1 
ATOM   4508 C C     . LEU C 3 512 ? 52.290  32.020 22.331  1.00 30.64  ? 512  LEU A C     1 
ATOM   4509 O O     . LEU C 3 512 ? 51.348  31.717 23.054  1.00 32.20  ? 512  LEU A O     1 
ATOM   4510 C CB    . LEU C 3 512 ? 52.325  31.433 19.907  1.00 31.81  ? 512  LEU A CB    1 
ATOM   4511 C CG    . LEU C 3 512 ? 51.565  30.096 20.032  1.00 31.79  ? 512  LEU A CG    1 
ATOM   4512 C CD1   . LEU C 3 512 ? 50.052  30.345 20.145  1.00 33.41  ? 512  LEU A CD1   1 
ATOM   4513 C CD2   . LEU C 3 512 ? 51.850  29.223 18.836  1.00 31.54  ? 512  LEU A CD2   1 
ATOM   4514 N N     . ALA C 3 513 ? 53.555  31.947 22.730  1.00 30.31  ? 513  ALA A N     1 
ATOM   4515 C CA    . ALA C 3 513 ? 53.851  31.432 24.055  1.00 30.57  ? 513  ALA A CA    1 
ATOM   4516 C C     . ALA C 3 513 ? 53.127  32.262 25.103  1.00 31.13  ? 513  ALA A C     1 
ATOM   4517 O O     . ALA C 3 513 ? 52.585  31.721 26.061  1.00 31.89  ? 513  ALA A O     1 
ATOM   4518 C CB    . ALA C 3 513 ? 55.346  31.441 24.322  1.00 27.95  ? 513  ALA A CB    1 
ATOM   4519 N N     . PHE C 3 514 ? 53.147  33.579 24.926  1.00 32.15  ? 514  PHE A N     1 
ATOM   4520 C CA    . PHE C 3 514 ? 52.489  34.491 25.840  1.00 30.40  ? 514  PHE A CA    1 
ATOM   4521 C C     . PHE C 3 514 ? 50.982  34.194 25.890  1.00 31.80  ? 514  PHE A C     1 
ATOM   4522 O O     . PHE C 3 514 ? 50.381  34.237 26.949  1.00 31.88  ? 514  PHE A O     1 
ATOM   4523 C CB    . PHE C 3 514 ? 52.719  35.948 25.398  1.00 28.78  ? 514  PHE A CB    1 
ATOM   4524 C CG    . PHE C 3 514 ? 51.562  36.854 25.710  1.00 31.08  ? 514  PHE A CG    1 
ATOM   4525 C CD1   . PHE C 3 514 ? 50.485  36.971 24.817  1.00 27.96  ? 514  PHE A CD1   1 
ATOM   4526 C CD2   . PHE C 3 514 ? 51.521  37.569 26.922  1.00 31.55  ? 514  PHE A CD2   1 
ATOM   4527 C CE1   . PHE C 3 514 ? 49.388  37.784 25.127  1.00 29.08  ? 514  PHE A CE1   1 
ATOM   4528 C CE2   . PHE C 3 514 ? 50.414  38.394 27.241  1.00 29.52  ? 514  PHE A CE2   1 
ATOM   4529 C CZ    . PHE C 3 514 ? 49.345  38.502 26.344  1.00 25.25  ? 514  PHE A CZ    1 
ATOM   4530 N N     . CYS C 3 515 ? 50.389  33.897 24.738  1.00 32.00  ? 515  CYS A N     1 
ATOM   4531 C CA    . CYS C 3 515 ? 48.970  33.596 24.656  1.00 34.28  ? 515  CYS A CA    1 
ATOM   4532 C C     . CYS C 3 515 ? 48.557  32.364 25.465  1.00 34.40  ? 515  CYS A C     1 
ATOM   4533 O O     . CYS C 3 515 ? 47.457  32.334 26.024  1.00 35.17  ? 515  CYS A O     1 
ATOM   4534 C CB    . CYS C 3 515 ? 48.553  33.402 23.192  1.00 34.61  ? 515  CYS A CB    1 
ATOM   4535 S SG    . CYS C 3 515 ? 48.549  34.888 22.143  1.00 32.40  ? 515  CYS A SG    1 
ATOM   4536 N N     . PHE C 3 516 ? 49.405  31.338 25.499  1.00 32.78  ? 516  PHE A N     1 
ATOM   4537 C CA    . PHE C 3 516 ? 49.099  30.137 26.273  1.00 34.82  ? 516  PHE A CA    1 
ATOM   4538 C C     . PHE C 3 516 ? 49.174  30.472 27.769  1.00 35.16  ? 516  PHE A C     1 
ATOM   4539 O O     . PHE C 3 516 ? 48.329  30.080 28.554  1.00 33.44  ? 516  PHE A O     1 
ATOM   4540 C CB    . PHE C 3 516 ? 50.086  28.993 25.958  1.00 33.64  ? 516  PHE A CB    1 
ATOM   4541 C CG    . PHE C 3 516 ? 49.884  28.358 24.598  1.00 32.19  ? 516  PHE A CG    1 
ATOM   4542 C CD1   . PHE C 3 516 ? 48.595  28.028 24.146  1.00 27.37  ? 516  PHE A CD1   1 
ATOM   4543 C CD2   . PHE C 3 516 ? 50.990  28.087 23.764  1.00 30.22  ? 516  PHE A CD2   1 
ATOM   4544 C CE1   . PHE C 3 516 ? 48.395  27.435 22.867  1.00 27.38  ? 516  PHE A CE1   1 
ATOM   4545 C CE2   . PHE C 3 516 ? 50.823  27.499 22.494  1.00 29.33  ? 516  PHE A CE2   1 
ATOM   4546 C CZ    . PHE C 3 516 ? 49.522  27.166 22.029  1.00 29.82  ? 516  PHE A CZ    1 
ATOM   4547 N N     . GLU C 3 517 ? 50.214  31.191 28.148  1.00 35.70  ? 517  GLU A N     1 
ATOM   4548 C CA    . GLU C 3 517 ? 50.409  31.615 29.530  1.00 41.46  ? 517  GLU A CA    1 
ATOM   4549 C C     . GLU C 3 517 ? 49.221  32.497 29.997  1.00 41.70  ? 517  GLU A C     1 
ATOM   4550 O O     . GLU C 3 517 ? 48.663  32.309 31.069  1.00 43.90  ? 517  GLU A O     1 
ATOM   4551 C CB    . GLU C 3 517 ? 51.704  32.423 29.606  1.00 42.65  ? 517  GLU A CB    1 
ATOM   4552 C CG    . GLU C 3 517 ? 52.772  31.891 30.520  1.00 46.57  ? 517  GLU A CG    1 
ATOM   4553 C CD    . GLU C 3 517 ? 52.691  30.406 30.736  1.00 48.73  ? 517  GLU A CD    1 
ATOM   4554 O OE1   . GLU C 3 517 ? 52.453  29.651 29.767  1.00 51.60  ? 517  GLU A OE1   1 
ATOM   4555 O OE2   . GLU C 3 517 ? 52.889  29.989 31.890  1.00 51.31  ? 517  GLU A OE2   1 
ATOM   4556 N N     . TYR C 3 518 ? 48.856  33.467 29.178  1.00 39.10  ? 518  TYR A N     1 
ATOM   4557 C CA    . TYR C 3 518 ? 47.777  34.371 29.497  1.00 40.04  ? 518  TYR A CA    1 
ATOM   4558 C C     . TYR C 3 518 ? 46.453  33.622 29.700  1.00 43.02  ? 518  TYR A C     1 
ATOM   4559 O O     . TYR C 3 518 ? 45.654  33.957 30.576  1.00 42.07  ? 518  TYR A O     1 
ATOM   4560 C CB    . TYR C 3 518 ? 47.657  35.384 28.366  1.00 35.74  ? 518  TYR A CB    1 
ATOM   4561 C CG    . TYR C 3 518 ? 46.525  36.364 28.488  1.00 35.82  ? 518  TYR A CG    1 
ATOM   4562 C CD1   . TYR C 3 518 ? 45.210  35.990 28.232  1.00 34.09  ? 518  TYR A CD1   1 
ATOM   4563 C CD2   . TYR C 3 518 ? 46.782  37.689 28.793  1.00 32.98  ? 518  TYR A CD2   1 
ATOM   4564 C CE1   . TYR C 3 518 ? 44.175  36.940 28.269  1.00 36.59  ? 518  TYR A CE1   1 
ATOM   4565 C CE2   . TYR C 3 518 ? 45.785  38.626 28.837  1.00 34.61  ? 518  TYR A CE2   1 
ATOM   4566 C CZ    . TYR C 3 518 ? 44.483  38.255 28.575  1.00 34.29  ? 518  TYR A CZ    1 
ATOM   4567 O OH    . TYR C 3 518 ? 43.512  39.219 28.632  1.00 39.15  ? 518  TYR A OH    1 
ATOM   4568 N N     . ALA C 3 519 ? 46.228  32.607 28.876  1.00 44.23  ? 519  ALA A N     1 
ATOM   4569 C CA    . ALA C 3 519 ? 45.011  31.829 28.957  1.00 46.76  ? 519  ALA A CA    1 
ATOM   4570 C C     . ALA C 3 519 ? 45.030  31.032 30.246  1.00 47.75  ? 519  ALA A C     1 
ATOM   4571 O O     . ALA C 3 519 ? 43.990  30.773 30.841  1.00 46.88  ? 519  ALA A O     1 
ATOM   4572 C CB    . ALA C 3 519 ? 44.908  30.900 27.760  1.00 45.24  ? 519  ALA A CB    1 
ATOM   4573 N N     . GLY C 3 520 ? 46.227  30.645 30.672  1.00 48.51  ? 520  GLY A N     1 
ATOM   4574 C CA    . GLY C 3 520 ? 46.354  29.890 31.901  1.00 48.79  ? 520  GLY A CA    1 
ATOM   4575 C C     . GLY C 3 520 ? 45.880  30.727 33.070  1.00 49.13  ? 520  GLY A C     1 
ATOM   4576 O O     . GLY C 3 520 ? 45.142  30.246 33.931  1.00 48.63  ? 520  GLY A O     1 
ATOM   4577 N N     . VAL C 3 521 ? 46.298  31.990 33.092  1.00 48.73  ? 521  VAL A N     1 
ATOM   4578 C CA    . VAL C 3 521 ? 45.919  32.886 34.164  1.00 49.49  ? 521  VAL A CA    1 
ATOM   4579 C C     . VAL C 3 521 ? 44.395  32.967 34.209  1.00 51.15  ? 521  VAL A C     1 
ATOM   4580 O O     . VAL C 3 521 ? 43.797  32.834 35.274  1.00 52.18  ? 521  VAL A O     1 
ATOM   4581 C CB    . VAL C 3 521 ? 46.541  34.307 33.966  1.00 47.62  ? 521  VAL A CB    1 
ATOM   4582 C CG1   . VAL C 3 521 ? 46.133  35.218 35.087  1.00 45.56  ? 521  VAL A CG1   1 
ATOM   4583 C CG2   . VAL C 3 521 ? 48.070  34.215 33.938  1.00 47.22  ? 521  VAL A CG2   1 
ATOM   4584 N N     . GLN C 3 522 ? 43.769  33.154 33.050  1.00 52.06  ? 522  GLN A N     1 
ATOM   4585 C CA    . GLN C 3 522 ? 42.315  33.260 32.988  1.00 52.81  ? 522  GLN A CA    1 
ATOM   4586 C C     . GLN C 3 522 ? 41.602  32.053 33.593  1.00 55.82  ? 522  GLN A C     1 
ATOM   4587 O O     . GLN C 3 522 ? 40.513  32.189 34.138  1.00 58.05  ? 522  GLN A O     1 
ATOM   4588 C CB    . GLN C 3 522 ? 41.832  33.427 31.546  1.00 51.58  ? 522  GLN A CB    1 
ATOM   4589 C CG    . GLN C 3 522 ? 42.479  34.547 30.761  1.00 49.22  ? 522  GLN A CG    1 
ATOM   4590 C CD    . GLN C 3 522 ? 42.598  35.823 31.540  1.00 48.28  ? 522  GLN A CD    1 
ATOM   4591 O OE1   . GLN C 3 522 ? 41.602  36.399 31.973  1.00 47.68  ? 522  GLN A OE1   1 
ATOM   4592 N NE2   . GLN C 3 522 ? 43.835  36.285 31.725  1.00 49.29  ? 522  GLN A NE2   1 
ATOM   4593 N N     . HIS C 3 523 ? 42.213  30.876 33.500  1.00 58.12  ? 523  HIS A N     1 
ATOM   4594 C CA    . HIS C 3 523 ? 41.603  29.662 34.022  1.00 57.30  ? 523  HIS A CA    1 
ATOM   4595 C C     . HIS C 3 523 ? 41.911  29.332 35.466  1.00 54.79  ? 523  HIS A C     1 
ATOM   4596 O O     . HIS C 3 523 ? 41.083  28.735 36.143  1.00 55.20  ? 523  HIS A O     1 
ATOM   4597 C CB    . HIS C 3 523 ? 41.989  28.456 33.170  1.00 62.03  ? 523  HIS A CB    1 
ATOM   4598 C CG    . HIS C 3 523 ? 41.315  28.413 31.835  1.00 67.11  ? 523  HIS A CG    1 
ATOM   4599 N ND1   . HIS C 3 523 ? 41.566  29.336 30.841  1.00 68.41  ? 523  HIS A ND1   1 
ATOM   4600 C CD2   . HIS C 3 523 ? 40.409  27.545 31.322  1.00 69.49  ? 523  HIS A CD2   1 
ATOM   4601 C CE1   . HIS C 3 523 ? 40.849  29.037 29.773  1.00 69.63  ? 523  HIS A CE1   1 
ATOM   4602 N NE2   . HIS C 3 523 ? 40.138  27.955 30.038  1.00 71.14  ? 523  HIS A NE2   1 
ATOM   4603 N N     . HIS C 3 524 ? 43.092  29.708 35.936  1.00 52.51  ? 524  HIS A N     1 
ATOM   4604 C CA    . HIS C 3 524 ? 43.491  29.403 37.303  1.00 48.76  ? 524  HIS A CA    1 
ATOM   4605 C C     . HIS C 3 524 ? 43.607  30.590 38.262  1.00 47.02  ? 524  HIS A C     1 
ATOM   4606 O O     . HIS C 3 524 ? 43.811  30.388 39.463  1.00 47.31  ? 524  HIS A O     1 
ATOM   4607 C CB    . HIS C 3 524 ? 44.821  28.634 37.287  1.00 50.42  ? 524  HIS A CB    1 
ATOM   4608 C CG    . HIS C 3 524 ? 44.729  27.285 36.649  1.00 53.56  ? 524  HIS A CG    1 
ATOM   4609 N ND1   . HIS C 3 524 ? 44.274  27.100 35.361  1.00 54.28  ? 524  HIS A ND1   1 
ATOM   4610 C CD2   . HIS C 3 524 ? 45.011  26.049 37.129  1.00 54.72  ? 524  HIS A CD2   1 
ATOM   4611 C CE1   . HIS C 3 524 ? 44.277  25.810 35.074  1.00 54.22  ? 524  HIS A CE1   1 
ATOM   4612 N NE2   . HIS C 3 524 ? 44.719  25.150 36.130  1.00 55.47  ? 524  HIS A NE2   1 
ATOM   4613 N N     . GLY C 3 525 ? 43.476  31.817 37.756  1.00 44.93  ? 525  GLY A N     1 
ATOM   4614 C CA    . GLY C 3 525 ? 43.600  32.981 38.626  1.00 41.63  ? 525  GLY A CA    1 
ATOM   4615 C C     . GLY C 3 525 ? 45.038  33.361 38.949  1.00 41.46  ? 525  GLY A C     1 
ATOM   4616 O O     . GLY C 3 525 ? 45.977  32.681 38.519  1.00 43.56  ? 525  GLY A O     1 
ATOM   4617 N N     . LEU C 3 526 ? 45.222  34.442 39.705  1.00 40.89  ? 526  LEU A N     1 
ATOM   4618 C CA    . LEU C 3 526 ? 46.557  34.920 40.051  1.00 40.29  ? 526  LEU A CA    1 
ATOM   4619 C C     . LEU C 3 526 ? 47.459  33.942 40.773  1.00 41.26  ? 526  LEU A C     1 
ATOM   4620 O O     . LEU C 3 526 ? 48.643  34.222 40.984  1.00 42.94  ? 526  LEU A O     1 
ATOM   4621 C CB    . LEU C 3 526 ? 46.468  36.198 40.864  1.00 39.12  ? 526  LEU A CB    1 
ATOM   4622 C CG    . LEU C 3 526 ? 45.754  37.365 40.184  1.00 42.41  ? 526  LEU A CG    1 
ATOM   4623 C CD1   . LEU C 3 526 ? 46.166  38.654 40.893  1.00 41.71  ? 526  LEU A CD1   1 
ATOM   4624 C CD2   . LEU C 3 526 ? 46.117  37.450 38.706  1.00 40.46  ? 526  LEU A CD2   1 
ATOM   4625 N N     . SER C 3 527 ? 46.919  32.793 41.153  1.00 41.49  ? 527  SER A N     1 
ATOM   4626 C CA    . SER C 3 527 ? 47.721  31.775 41.836  1.00 42.74  ? 527  SER A CA    1 
ATOM   4627 C C     . SER C 3 527 ? 48.465  30.920 40.807  1.00 42.70  ? 527  SER A C     1 
ATOM   4628 O O     . SER C 3 527 ? 49.281  30.082 41.170  1.00 42.84  ? 527  SER A O     1 
ATOM   4629 C CB    . SER C 3 527 ? 46.827  30.856 42.681  1.00 42.17  ? 527  SER A CB    1 
ATOM   4630 O OG    . SER C 3 527 ? 46.007  30.039 41.850  1.00 41.02  ? 527  SER A OG    1 
ATOM   4631 N N     . TYR C 3 528 ? 48.157  31.134 39.527  1.00 43.08  ? 528  TYR A N     1 
ATOM   4632 C CA    . TYR C 3 528 ? 48.765  30.401 38.413  1.00 43.12  ? 528  TYR A CA    1 
ATOM   4633 C C     . TYR C 3 528 ? 50.282  30.380 38.496  1.00 42.56  ? 528  TYR A C     1 
ATOM   4634 O O     . TYR C 3 528 ? 50.920  31.410 38.685  1.00 38.83  ? 528  TYR A O     1 
ATOM   4635 C CB    . TYR C 3 528 ? 48.331  31.025 37.085  1.00 46.53  ? 528  TYR A CB    1 
ATOM   4636 C CG    . TYR C 3 528 ? 48.842  30.301 35.864  1.00 47.92  ? 528  TYR A CG    1 
ATOM   4637 C CD1   . TYR C 3 528 ? 48.384  29.023 35.542  1.00 50.27  ? 528  TYR A CD1   1 
ATOM   4638 C CD2   . TYR C 3 528 ? 49.806  30.885 35.038  1.00 48.64  ? 528  TYR A CD2   1 
ATOM   4639 C CE1   . TYR C 3 528 ? 48.871  28.349 34.432  1.00 48.84  ? 528  TYR A CE1   1 
ATOM   4640 C CE2   . TYR C 3 528 ? 50.299  30.219 33.926  1.00 46.03  ? 528  TYR A CE2   1 
ATOM   4641 C CZ    . TYR C 3 528 ? 49.826  28.954 33.625  1.00 47.87  ? 528  TYR A CZ    1 
ATOM   4642 O OH    . TYR C 3 528 ? 50.272  28.306 32.498  1.00 44.29  ? 528  TYR A OH    1 
ATOM   4643 N N     . ASN C 3 529 ? 50.858  29.191 38.375  1.00 44.99  ? 529  ASN A N     1 
ATOM   4644 C CA    . ASN C 3 529 ? 52.303  29.058 38.443  1.00 47.51  ? 529  ASN A CA    1 
ATOM   4645 C C     . ASN C 3 529 ? 52.889  29.358 37.045  1.00 47.01  ? 529  ASN A C     1 
ATOM   4646 O O     . ASN C 3 529 ? 52.762  28.548 36.113  1.00 45.74  ? 529  ASN A O     1 
ATOM   4647 C CB    . ASN C 3 529 ? 52.664  27.641 38.916  1.00 52.95  ? 529  ASN A CB    1 
ATOM   4648 C CG    . ASN C 3 529 ? 54.119  27.522 39.376  1.00 57.70  ? 529  ASN A CG    1 
ATOM   4649 O OD1   . ASN C 3 529 ? 54.563  28.237 40.276  1.00 59.69  ? 529  ASN A OD1   1 
ATOM   4650 N ND2   . ASN C 3 529 ? 54.861  26.609 38.758  1.00 61.55  ? 529  ASN A ND2   1 
ATOM   4651 N N     . CYS C 3 530 ? 53.515  30.528 36.900  1.00 42.13  ? 530  CYS A N     1 
ATOM   4652 C CA    . CYS C 3 530 ? 54.082  30.927 35.608  1.00 40.76  ? 530  CYS A CA    1 
ATOM   4653 C C     . CYS C 3 530 ? 55.619  30.966 35.562  1.00 38.71  ? 530  CYS A C     1 
ATOM   4654 O O     . CYS C 3 530 ? 56.266  31.363 36.528  1.00 39.56  ? 530  CYS A O     1 
ATOM   4655 C CB    . CYS C 3 530 ? 53.514  32.297 35.205  1.00 39.68  ? 530  CYS A CB    1 
ATOM   4656 S SG    . CYS C 3 530 ? 53.660  32.659 33.446  1.00 44.84  ? 530  CYS A SG    1 
ATOM   4657 N N     . SER C 3 531 ? 56.205  30.566 34.434  1.00 37.45  ? 531  SER A N     1 
ATOM   4658 C CA    . SER C 3 531 ? 57.670  30.568 34.292  1.00 37.10  ? 531  SER A CA    1 
ATOM   4659 C C     . SER C 3 531 ? 58.132  31.071 32.939  1.00 38.66  ? 531  SER A C     1 
ATOM   4660 O O     . SER C 3 531 ? 59.297  30.905 32.560  1.00 40.14  ? 531  SER A O     1 
ATOM   4661 C CB    . SER C 3 531 ? 58.242  29.174 34.502  1.00 36.13  ? 531  SER A CB    1 
ATOM   4662 O OG    . SER C 3 531 ? 57.798  28.293 33.490  1.00 33.32  ? 531  SER A OG    1 
ATOM   4663 N N     . LEU C 3 532 ? 57.220  31.687 32.201  1.00 38.61  ? 532  LEU A N     1 
ATOM   4664 C CA    . LEU C 3 532 ? 57.564  32.249 30.904  1.00 36.15  ? 532  LEU A CA    1 
ATOM   4665 C C     . LEU C 3 532 ? 58.561  33.347 31.167  1.00 35.43  ? 532  LEU A C     1 
ATOM   4666 O O     . LEU C 3 532 ? 58.335  34.204 31.996  1.00 35.34  ? 532  LEU A O     1 
ATOM   4667 C CB    . LEU C 3 532 ? 56.345  32.868 30.244  1.00 34.55  ? 532  LEU A CB    1 
ATOM   4668 C CG    . LEU C 3 532 ? 56.556  33.154 28.757  1.00 35.50  ? 532  LEU A CG    1 
ATOM   4669 C CD1   . LEU C 3 532 ? 56.672  31.818 28.029  1.00 33.59  ? 532  LEU A CD1   1 
ATOM   4670 C CD2   . LEU C 3 532 ? 55.409  33.976 28.201  1.00 30.73  ? 532  LEU A CD2   1 
ATOM   4671 N N     . PRO C 3 533 ? 59.689  33.338 30.465  1.00 35.69  ? 533  PRO A N     1 
ATOM   4672 C CA    . PRO C 3 533 ? 60.646  34.412 30.731  1.00 37.06  ? 533  PRO A CA    1 
ATOM   4673 C C     . PRO C 3 533 ? 60.210  35.734 30.082  1.00 37.91  ? 533  PRO A C     1 
ATOM   4674 O O     . PRO C 3 533 ? 60.103  35.808 28.870  1.00 41.34  ? 533  PRO A O     1 
ATOM   4675 C CB    . PRO C 3 533 ? 61.939  33.857 30.138  1.00 37.24  ? 533  PRO A CB    1 
ATOM   4676 C CG    . PRO C 3 533 ? 61.466  33.084 28.970  1.00 35.44  ? 533  PRO A CG    1 
ATOM   4677 C CD    . PRO C 3 533 ? 60.245  32.352 29.523  1.00 36.74  ? 533  PRO A CD    1 
ATOM   4678 N N     . LEU C 3 534 ? 59.968  36.764 30.896  1.00 38.77  ? 534  LEU A N     1 
ATOM   4679 C CA    . LEU C 3 534 ? 59.547  38.084 30.409  1.00 38.51  ? 534  LEU A CA    1 
ATOM   4680 C C     . LEU C 3 534 ? 60.830  38.905 30.206  1.00 40.68  ? 534  LEU A C     1 
ATOM   4681 O O     . LEU C 3 534 ? 61.726  38.853 31.047  1.00 42.52  ? 534  LEU A O     1 
ATOM   4682 C CB    . LEU C 3 534 ? 58.628  38.751 31.449  1.00 35.52  ? 534  LEU A CB    1 
ATOM   4683 C CG    . LEU C 3 534 ? 57.521  37.861 32.042  1.00 34.84  ? 534  LEU A CG    1 
ATOM   4684 C CD1   . LEU C 3 534 ? 56.565  38.688 32.905  1.00 33.07  ? 534  LEU A CD1   1 
ATOM   4685 C CD2   . LEU C 3 534 ? 56.722  37.205 30.925  1.00 35.41  ? 534  LEU A CD2   1 
ATOM   4686 N N     . ALA C 3 535 ? 60.927  39.668 29.117  1.00 38.02  ? 535  ALA A N     1 
ATOM   4687 C CA    . ALA C 3 535 ? 62.169  40.420 28.856  1.00 38.59  ? 535  ALA A CA    1 
ATOM   4688 C C     . ALA C 3 535 ? 62.152  41.958 28.814  1.00 38.82  ? 535  ALA A C     1 
ATOM   4689 O O     . ALA C 3 535 ? 61.219  42.585 28.327  1.00 37.24  ? 535  ALA A O     1 
ATOM   4690 C CB    . ALA C 3 535 ? 62.808  39.896 27.570  1.00 36.64  ? 535  ALA A CB    1 
ATOM   4691 N N     . PHE C 3 536 ? 63.226  42.539 29.332  1.00 38.82  ? 536  PHE A N     1 
ATOM   4692 C CA    . PHE C 3 536 ? 63.430  43.973 29.375  1.00 42.50  ? 536  PHE A CA    1 
ATOM   4693 C C     . PHE C 3 536 ? 64.639  44.240 28.489  1.00 44.31  ? 536  PHE A C     1 
ATOM   4694 O O     . PHE C 3 536 ? 65.660  43.556 28.596  1.00 45.48  ? 536  PHE A O     1 
ATOM   4695 C CB    . PHE C 3 536 ? 63.731  44.430 30.806  1.00 42.81  ? 536  PHE A CB    1 
ATOM   4696 C CG    . PHE C 3 536 ? 62.606  44.187 31.767  1.00 46.08  ? 536  PHE A CG    1 
ATOM   4697 C CD1   . PHE C 3 536 ? 61.356  44.756 31.550  1.00 46.81  ? 536  PHE A CD1   1 
ATOM   4698 C CD2   . PHE C 3 536 ? 62.783  43.361 32.875  1.00 45.58  ? 536  PHE A CD2   1 
ATOM   4699 C CE1   . PHE C 3 536 ? 60.301  44.503 32.417  1.00 47.52  ? 536  PHE A CE1   1 
ATOM   4700 C CE2   . PHE C 3 536 ? 61.736  43.105 33.746  1.00 45.53  ? 536  PHE A CE2   1 
ATOM   4701 C CZ    . PHE C 3 536 ? 60.492  43.675 33.517  1.00 47.99  ? 536  PHE A CZ    1 
ATOM   4702 N N     . ASP C 3 537 ? 64.521  45.233 27.620  1.00 46.52  ? 537  ASP A N     1 
ATOM   4703 C CA    . ASP C 3 537 ? 65.585  45.583 26.689  1.00 47.45  ? 537  ASP A CA    1 
ATOM   4704 C C     . ASP C 3 537 ? 66.096  46.999 26.891  1.00 46.56  ? 537  ASP A C     1 
ATOM   4705 O O     . ASP C 3 537 ? 65.340  47.891 27.249  1.00 45.77  ? 537  ASP A O     1 
ATOM   4706 C CB    . ASP C 3 537 ? 65.064  45.456 25.258  1.00 49.85  ? 537  ASP A CB    1 
ATOM   4707 C CG    . ASP C 3 537 ? 64.789  44.026 24.863  1.00 56.10  ? 537  ASP A CG    1 
ATOM   4708 O OD1   . ASP C 3 537 ? 64.399  43.212 25.734  1.00 57.60  ? 537  ASP A OD1   1 
ATOM   4709 O OD2   . ASP C 3 537 ? 64.953  43.721 23.665  1.00 59.48  ? 537  ASP A OD2   1 
ATOM   4710 N N     . GLY C 3 538 ? 67.387  47.207 26.665  1.00 46.06  ? 538  GLY A N     1 
ATOM   4711 C CA    . GLY C 3 538 ? 67.919  48.547 26.790  1.00 50.09  ? 538  GLY A CA    1 
ATOM   4712 C C     . GLY C 3 538 ? 67.496  49.239 25.510  1.00 52.60  ? 538  GLY A C     1 
ATOM   4713 O O     . GLY C 3 538 ? 67.377  48.575 24.484  1.00 51.13  ? 538  GLY A O     1 
ATOM   4714 N N     . SER C 3 539 ? 67.235  50.542 25.563  1.00 56.87  ? 539  SER A N     1 
ATOM   4715 C CA    . SER C 3 539 ? 66.834  51.286 24.363  1.00 60.64  ? 539  SER A CA    1 
ATOM   4716 C C     . SER C 3 539 ? 67.888  51.018 23.304  1.00 61.45  ? 539  SER A C     1 
ATOM   4717 O O     . SER C 3 539 ? 67.893  49.969 22.665  1.00 65.46  ? 539  SER A O     1 
ATOM   4718 C CB    . SER C 3 539 ? 66.792  52.789 24.643  1.00 61.95  ? 539  SER A CB    1 
ATOM   4719 O OG    . SER C 3 539 ? 65.987  53.086 25.767  1.00 64.65  ? 539  SER A OG    1 
ATOM   4720 N N     . CYS C 3 540 ? 68.761  51.988 23.092  1.00 59.09  ? 540  CYS A N     1 
ATOM   4721 C CA    . CYS C 3 540 ? 69.856  51.820 22.144  1.00 58.35  ? 540  CYS A CA    1 
ATOM   4722 C C     . CYS C 3 540 ? 70.915  51.411 23.162  1.00 57.50  ? 540  CYS A C     1 
ATOM   4723 O O     . CYS C 3 540 ? 70.920  51.921 24.272  1.00 63.01  ? 540  CYS A O     1 
ATOM   4724 C CB    . CYS C 3 540 ? 70.191  53.175 21.501  1.00 58.38  ? 540  CYS A CB    1 
ATOM   4725 S SG    . CYS C 3 540 ? 71.497  53.188 20.247  1.00 60.10  ? 540  CYS A SG    1 
ATOM   4726 N N     . SER C 3 541 ? 71.790  50.482 22.864  1.00 53.66  ? 541  SER A N     1 
ATOM   4727 C CA    . SER C 3 541 ? 72.744  50.129 23.905  1.00 52.53  ? 541  SER A CA    1 
ATOM   4728 C C     . SER C 3 541 ? 74.140  50.607 23.504  1.00 52.38  ? 541  SER A C     1 
ATOM   4729 O O     . SER C 3 541 ? 74.644  50.295 22.424  1.00 54.64  ? 541  SER A O     1 
ATOM   4730 C CB    . SER C 3 541 ? 72.719  48.615 24.129  1.00 52.51  ? 541  SER A CB    1 
ATOM   4731 O OG    . SER C 3 541 ? 73.396  48.287 25.315  1.00 53.63  ? 541  SER A OG    1 
ATOM   4732 N N     . GLY C 3 542 ? 74.789  51.361 24.362  1.00 49.52  ? 542  GLY A N     1 
ATOM   4733 C CA    . GLY C 3 542 ? 76.086  51.845 23.936  1.00 49.92  ? 542  GLY A CA    1 
ATOM   4734 C C     . GLY C 3 542 ? 76.005  53.343 24.062  1.00 49.17  ? 542  GLY A C     1 
ATOM   4735 O O     . GLY C 3 542 ? 76.851  53.960 24.722  1.00 49.20  ? 542  GLY A O     1 
ATOM   4736 N N     . ILE C 3 543 ? 74.981  53.933 23.440  1.00 47.30  ? 543  ILE A N     1 
ATOM   4737 C CA    . ILE C 3 543 ? 74.791  55.367 23.576  1.00 46.35  ? 543  ILE A CA    1 
ATOM   4738 C C     . ILE C 3 543 ? 74.287  55.594 25.000  1.00 43.80  ? 543  ILE A C     1 
ATOM   4739 O O     . ILE C 3 543 ? 74.481  56.667 25.574  1.00 46.52  ? 543  ILE A O     1 
ATOM   4740 C CB    . ILE C 3 543 ? 73.814  55.934 22.504  1.00 48.51  ? 543  ILE A CB    1 
ATOM   4741 C CG1   . ILE C 3 543 ? 74.557  56.017 21.159  1.00 49.81  ? 543  ILE A CG1   1 
ATOM   4742 C CG2   . ILE C 3 543 ? 73.340  57.342 22.894  1.00 48.97  ? 543  ILE A CG2   1 
ATOM   4743 C CD1   . ILE C 3 543 ? 73.673  56.223 19.941  1.00 53.27  ? 543  ILE A CD1   1 
ATOM   4744 N N     . GLN C 3 544 ? 73.675  54.573 25.588  1.00 40.88  ? 544  GLN A N     1 
ATOM   4745 C CA    . GLN C 3 544 ? 73.214  54.673 26.978  1.00 40.27  ? 544  GLN A CA    1 
ATOM   4746 C C     . GLN C 3 544 ? 74.463  54.661 27.843  1.00 40.57  ? 544  GLN A C     1 
ATOM   4747 O O     . GLN C 3 544 ? 74.600  55.467 28.764  1.00 40.22  ? 544  GLN A O     1 
ATOM   4748 C CB    . GLN C 3 544 ? 72.348  53.479 27.377  1.00 37.80  ? 544  GLN A CB    1 
ATOM   4749 C CG    . GLN C 3 544 ? 70.991  53.429 26.733  1.00 37.60  ? 544  GLN A CG    1 
ATOM   4750 C CD    . GLN C 3 544 ? 70.138  52.310 27.308  1.00 38.87  ? 544  GLN A CD    1 
ATOM   4751 O OE1   . GLN C 3 544 ? 69.165  52.558 28.001  1.00 39.30  ? 544  GLN A OE1   1 
ATOM   4752 N NE2   . GLN C 3 544 ? 70.516  51.078 27.030  1.00 36.50  ? 544  GLN A NE2   1 
ATOM   4753 N N     . HIS C 3 545 ? 75.365  53.727 27.535  1.00 38.96  ? 545  HIS A N     1 
ATOM   4754 C CA    . HIS C 3 545 ? 76.610  53.612 28.256  1.00 39.69  ? 545  HIS A CA    1 
ATOM   4755 C C     . HIS C 3 545 ? 77.487  54.837 28.054  1.00 40.33  ? 545  HIS A C     1 
ATOM   4756 O O     . HIS C 3 545 ? 78.105  55.320 29.005  1.00 41.75  ? 545  HIS A O     1 
ATOM   4757 C CB    . HIS C 3 545 ? 77.349  52.335 27.848  1.00 37.56  ? 545  HIS A CB    1 
ATOM   4758 C CG    . HIS C 3 545 ? 76.808  51.111 28.507  1.00 38.25  ? 545  HIS A CG    1 
ATOM   4759 N ND1   . HIS C 3 545 ? 77.069  50.807 29.824  1.00 33.80  ? 545  HIS A ND1   1 
ATOM   4760 C CD2   . HIS C 3 545 ? 75.911  50.191 28.077  1.00 35.25  ? 545  HIS A CD2   1 
ATOM   4761 C CE1   . HIS C 3 545 ? 76.351  49.758 30.181  1.00 36.16  ? 545  HIS A CE1   1 
ATOM   4762 N NE2   . HIS C 3 545 ? 75.638  49.367 29.140  1.00 37.50  ? 545  HIS A NE2   1 
ATOM   4763 N N     . PHE C 3 546 ? 77.566  55.347 26.834  1.00 41.53  ? 546  PHE A N     1 
ATOM   4764 C CA    . PHE C 3 546 ? 78.375  56.546 26.650  1.00 44.83  ? 546  PHE A CA    1 
ATOM   4765 C C     . PHE C 3 546 ? 77.720  57.724 27.395  1.00 45.46  ? 546  PHE A C     1 
ATOM   4766 O O     . PHE C 3 546 ? 78.395  58.472 28.109  1.00 47.77  ? 546  PHE A O     1 
ATOM   4767 C CB    . PHE C 3 546 ? 78.552  56.882 25.163  1.00 45.70  ? 546  PHE A CB    1 
ATOM   4768 C CG    . PHE C 3 546 ? 79.685  56.129 24.502  1.00 47.52  ? 546  PHE A CG    1 
ATOM   4769 C CD1   . PHE C 3 546 ? 80.926  56.020 25.132  1.00 51.02  ? 546  PHE A CD1   1 
ATOM   4770 C CD2   . PHE C 3 546 ? 79.520  55.532 23.264  1.00 48.39  ? 546  PHE A CD2   1 
ATOM   4771 C CE1   . PHE C 3 546 ? 81.984  55.327 24.538  1.00 50.92  ? 546  PHE A CE1   1 
ATOM   4772 C CE2   . PHE C 3 546 ? 80.570  54.837 22.660  1.00 51.50  ? 546  PHE A CE2   1 
ATOM   4773 C CZ    . PHE C 3 546 ? 81.806  54.736 23.301  1.00 50.48  ? 546  PHE A CZ    1 
ATOM   4774 N N     . SER C 3 547 ? 76.403  57.863 27.265  1.00 42.37  ? 547  SER A N     1 
ATOM   4775 C CA    . SER C 3 547 ? 75.714  58.963 27.922  1.00 42.46  ? 547  SER A CA    1 
ATOM   4776 C C     . SER C 3 547 ? 75.840  58.892 29.431  1.00 45.04  ? 547  SER A C     1 
ATOM   4777 O O     . SER C 3 547 ? 75.978  59.919 30.104  1.00 42.50  ? 547  SER A O     1 
ATOM   4778 C CB    . SER C 3 547 ? 74.237  58.971 27.549  1.00 40.91  ? 547  SER A CB    1 
ATOM   4779 O OG    . SER C 3 547 ? 74.066  59.090 26.157  1.00 35.30  ? 547  SER A OG    1 
ATOM   4780 N N     . ALA C 3 548 ? 75.786  57.673 29.960  1.00 45.52  ? 548  ALA A N     1 
ATOM   4781 C CA    . ALA C 3 548 ? 75.880  57.473 31.387  1.00 46.25  ? 548  ALA A CA    1 
ATOM   4782 C C     . ALA C 3 548 ? 77.282  57.728 31.926  1.00 47.18  ? 548  ALA A C     1 
ATOM   4783 O O     . ALA C 3 548 ? 77.432  58.357 32.966  1.00 49.01  ? 548  ALA A O     1 
ATOM   4784 C CB    . ALA C 3 548 ? 75.432  56.073 31.738  1.00 45.73  ? 548  ALA A CB    1 
ATOM   4785 N N     . MET C 3 549 ? 78.310  57.253 31.227  1.00 49.36  ? 549  MET A N     1 
ATOM   4786 C CA    . MET C 3 549 ? 79.679  57.441 31.699  1.00 48.49  ? 549  MET A CA    1 
ATOM   4787 C C     . MET C 3 549 ? 80.136  58.880 31.537  1.00 47.62  ? 549  MET A C     1 
ATOM   4788 O O     . MET C 3 549 ? 81.064  59.317 32.210  1.00 48.76  ? 549  MET A O     1 
ATOM   4789 C CB    . MET C 3 549 ? 80.652  56.492 30.979  1.00 49.24  ? 549  MET A CB    1 
ATOM   4790 C CG    . MET C 3 549 ? 80.785  56.695 29.481  1.00 51.12  ? 549  MET A CG    1 
ATOM   4791 S SD    . MET C 3 549 ? 82.170  55.722 28.777  1.00 57.04  ? 549  MET A SD    1 
ATOM   4792 C CE    . MET C 3 549 ? 81.434  54.092 28.587  1.00 49.05  ? 549  MET A CE    1 
ATOM   4793 N N     . LEU C 3 550 ? 79.487  59.610 30.638  1.00 45.97  ? 550  LEU A N     1 
ATOM   4794 C CA    . LEU C 3 550 ? 79.824  61.002 30.415  1.00 46.91  ? 550  LEU A CA    1 
ATOM   4795 C C     . LEU C 3 550 ? 78.799  61.929 31.075  1.00 46.41  ? 550  LEU A C     1 
ATOM   4796 O O     . LEU C 3 550 ? 78.985  63.142 31.119  1.00 43.92  ? 550  LEU A O     1 
ATOM   4797 C CB    . LEU C 3 550 ? 79.884  61.299 28.925  1.00 47.81  ? 550  LEU A CB    1 
ATOM   4798 C CG    . LEU C 3 550 ? 81.029  60.686 28.125  1.00 46.24  ? 550  LEU A CG    1 
ATOM   4799 C CD1   . LEU C 3 550 ? 80.988  61.282 26.754  1.00 49.36  ? 550  LEU A CD1   1 
ATOM   4800 C CD2   . LEU C 3 550 ? 82.364  60.965 28.764  1.00 47.02  ? 550  LEU A CD2   1 
ATOM   4801 N N     . ARG C 3 551 ? 77.724  61.341 31.589  1.00 47.42  ? 551  ARG A N     1 
ATOM   4802 C CA    . ARG C 3 551 ? 76.659  62.091 32.237  1.00 48.82  ? 551  ARG A CA    1 
ATOM   4803 C C     . ARG C 3 551 ? 76.083  63.157 31.301  1.00 48.95  ? 551  ARG A C     1 
ATOM   4804 O O     . ARG C 3 551 ? 75.910  64.320 31.665  1.00 47.62  ? 551  ARG A O     1 
ATOM   4805 C CB    . ARG C 3 551 ? 77.168  62.702 33.548  1.00 49.73  ? 551  ARG A CB    1 
ATOM   4806 C CG    . ARG C 3 551 ? 77.700  61.629 34.489  1.00 53.63  ? 551  ARG A CG    1 
ATOM   4807 C CD    . ARG C 3 551 ? 78.039  62.121 35.881  1.00 59.48  ? 551  ARG A CD    1 
ATOM   4808 N NE    . ARG C 3 551 ? 78.720  61.061 36.630  1.00 66.66  ? 551  ARG A NE    1 
ATOM   4809 C CZ    . ARG C 3 551 ? 79.006  61.097 37.931  1.00 69.14  ? 551  ARG A CZ    1 
ATOM   4810 N NH1   . ARG C 3 551 ? 78.670  62.150 38.675  1.00 69.31  ? 551  ARG A NH1   1 
ATOM   4811 N NH2   . ARG C 3 551 ? 79.637  60.073 38.488  1.00 67.35  ? 551  ARG A NH2   1 
ATOM   4812 N N     . ASP C 3 552 ? 75.794  62.728 30.079  1.00 47.95  ? 552  ASP A N     1 
ATOM   4813 C CA    . ASP C 3 552 ? 75.215  63.597 29.089  1.00 49.01  ? 552  ASP A CA    1 
ATOM   4814 C C     . ASP C 3 552 ? 73.684  63.476 29.139  1.00 50.98  ? 552  ASP A C     1 
ATOM   4815 O O     . ASP C 3 552 ? 73.103  62.525 28.627  1.00 48.84  ? 552  ASP A O     1 
ATOM   4816 C CB    . ASP C 3 552 ? 75.736  63.234 27.707  1.00 48.60  ? 552  ASP A CB    1 
ATOM   4817 C CG    . ASP C 3 552 ? 74.986  63.950 26.605  1.00 54.96  ? 552  ASP A CG    1 
ATOM   4818 O OD1   . ASP C 3 552 ? 74.490  65.081 26.840  1.00 58.14  ? 552  ASP A OD1   1 
ATOM   4819 O OD2   . ASP C 3 552 ? 74.895  63.390 25.495  1.00 57.08  ? 552  ASP A OD2   1 
ATOM   4820 N N     . GLU C 3 553 ? 73.047  64.463 29.762  1.00 54.65  ? 553  GLU A N     1 
ATOM   4821 C CA    . GLU C 3 553 ? 71.596  64.490 29.914  1.00 57.55  ? 553  GLU A CA    1 
ATOM   4822 C C     . GLU C 3 553 ? 70.850  64.571 28.598  1.00 56.45  ? 553  GLU A C     1 
ATOM   4823 O O     . GLU C 3 553 ? 69.770  63.990 28.457  1.00 58.60  ? 553  GLU A O     1 
ATOM   4824 C CB    . GLU C 3 553 ? 71.171  65.661 30.818  1.00 62.81  ? 553  GLU A CB    1 
ATOM   4825 C CG    . GLU C 3 553 ? 71.533  67.069 30.312  1.00 71.78  ? 553  GLU A CG    1 
ATOM   4826 C CD    . GLU C 3 553 ? 73.040  67.351 30.297  1.00 77.58  ? 553  GLU A CD    1 
ATOM   4827 O OE1   . GLU C 3 553 ? 73.703  67.123 31.334  1.00 78.63  ? 553  GLU A OE1   1 
ATOM   4828 O OE2   . GLU C 3 553 ? 73.559  67.809 29.250  1.00 80.88  ? 553  GLU A OE2   1 
ATOM   4829 N N     . VAL C 3 554 ? 71.408  65.282 27.626  1.00 54.42  ? 554  VAL A N     1 
ATOM   4830 C CA    . VAL C 3 554 ? 70.719  65.406 26.349  1.00 51.62  ? 554  VAL A CA    1 
ATOM   4831 C C     . VAL C 3 554 ? 70.870  64.108 25.568  1.00 50.82  ? 554  VAL A C     1 
ATOM   4832 O O     . VAL C 3 554 ? 69.923  63.648 24.922  1.00 50.20  ? 554  VAL A O     1 
ATOM   4833 C CB    . VAL C 3 554 ? 71.217  66.666 25.546  1.00 50.95  ? 554  VAL A CB    1 
ATOM   4834 C CG1   . VAL C 3 554 ? 72.694  66.941 25.829  1.00 51.37  ? 554  VAL A CG1   1 
ATOM   4835 C CG2   . VAL C 3 554 ? 70.982  66.470 24.075  1.00 49.10  ? 554  VAL A CG2   1 
ATOM   4836 N N     . GLY C 3 555 ? 72.049  63.496 25.649  1.00 50.48  ? 555  GLY A N     1 
ATOM   4837 C CA    . GLY C 3 555 ? 72.252  62.227 24.969  1.00 46.81  ? 555  GLY A CA    1 
ATOM   4838 C C     . GLY C 3 555 ? 71.449  61.149 25.691  1.00 45.90  ? 555  GLY A C     1 
ATOM   4839 O O     . GLY C 3 555 ? 70.734  60.354 25.073  1.00 46.53  ? 555  GLY A O     1 
ATOM   4840 N N     . GLY C 3 556 ? 71.553  61.139 27.014  1.00 41.37  ? 556  GLY A N     1 
ATOM   4841 C CA    . GLY C 3 556 ? 70.838  60.158 27.800  1.00 42.19  ? 556  GLY A CA    1 
ATOM   4842 C C     . GLY C 3 556 ? 69.346  60.176 27.557  1.00 43.31  ? 556  GLY A C     1 
ATOM   4843 O O     . GLY C 3 556 ? 68.702  59.125 27.532  1.00 41.33  ? 556  GLY A O     1 
ATOM   4844 N N     . ARG C 3 557 ? 68.797  61.373 27.364  1.00 40.82  ? 557  ARG A N     1 
ATOM   4845 C CA    . ARG C 3 557 ? 67.374  61.521 27.136  1.00 39.46  ? 557  ARG A CA    1 
ATOM   4846 C C     . ARG C 3 557 ? 66.914  60.926 25.825  1.00 36.17  ? 557  ARG A C     1 
ATOM   4847 O O     . ARG C 3 557 ? 65.784  60.450 25.744  1.00 35.59  ? 557  ARG A O     1 
ATOM   4848 C CB    . ARG C 3 557 ? 66.984  62.994 27.215  1.00 44.91  ? 557  ARG A CB    1 
ATOM   4849 C CG    . ARG C 3 557 ? 65.491  63.248 27.081  1.00 50.80  ? 557  ARG A CG    1 
ATOM   4850 C CD    . ARG C 3 557 ? 65.162  64.715 27.354  1.00 60.95  ? 557  ARG A CD    1 
ATOM   4851 N NE    . ARG C 3 557 ? 63.755  65.027 27.091  1.00 68.86  ? 557  ARG A NE    1 
ATOM   4852 C CZ    . ARG C 3 557 ? 63.191  65.015 25.882  1.00 72.29  ? 557  ARG A CZ    1 
ATOM   4853 N NH1   . ARG C 3 557 ? 63.914  64.706 24.810  1.00 73.29  ? 557  ARG A NH1   1 
ATOM   4854 N NH2   . ARG C 3 557 ? 61.901  65.314 25.742  1.00 72.60  ? 557  ARG A NH2   1 
ATOM   4855 N N     . ALA C 3 558 ? 67.766  60.956 24.795  1.00 34.30  ? 558  ALA A N     1 
ATOM   4856 C CA    . ALA C 3 558 ? 67.426  60.380 23.477  1.00 34.17  ? 558  ALA A CA    1 
ATOM   4857 C C     . ALA C 3 558 ? 67.334  58.848 23.639  1.00 35.82  ? 558  ALA A C     1 
ATOM   4858 O O     . ALA C 3 558 ? 66.487  58.181 23.046  1.00 34.56  ? 558  ALA A O     1 
ATOM   4859 C CB    . ALA C 3 558 ? 68.481  60.727 22.480  1.00 33.68  ? 558  ALA A CB    1 
ATOM   4860 N N     . VAL C 3 559 ? 68.244  58.272 24.411  1.00 36.94  ? 559  VAL A N     1 
ATOM   4861 C CA    . VAL C 3 559 ? 68.111  56.857 24.679  1.00 39.55  ? 559  VAL A CA    1 
ATOM   4862 C C     . VAL C 3 559 ? 67.130  57.006 25.843  1.00 42.35  ? 559  VAL A C     1 
ATOM   4863 O O     . VAL C 3 559 ? 66.495  58.055 25.947  1.00 47.16  ? 559  VAL A O     1 
ATOM   4864 C CB    . VAL C 3 559 ? 69.464  56.225 25.017  1.00 37.10  ? 559  VAL A CB    1 
ATOM   4865 C CG1   . VAL C 3 559 ? 70.176  55.957 23.736  1.00 36.00  ? 559  VAL A CG1   1 
ATOM   4866 C CG2   . VAL C 3 559 ? 70.327  57.158 25.832  1.00 38.89  ? 559  VAL A CG2   1 
ATOM   4867 N N     . ASN C 3 560 ? 66.943  56.076 26.750  1.00 43.27  ? 560  ASN A N     1 
ATOM   4868 C CA    . ASN C 3 560 ? 65.888  56.436 27.725  1.00 42.22  ? 560  ASN A CA    1 
ATOM   4869 C C     . ASN C 3 560 ? 66.271  56.569 29.189  1.00 42.58  ? 560  ASN A C     1 
ATOM   4870 O O     . ASN C 3 560 ? 65.534  56.139 30.066  1.00 38.53  ? 560  ASN A O     1 
ATOM   4871 C CB    . ASN C 3 560 ? 64.720  55.459 27.582  1.00 40.84  ? 560  ASN A CB    1 
ATOM   4872 C CG    . ASN C 3 560 ? 63.909  55.712 26.333  1.00 41.79  ? 560  ASN A CG    1 
ATOM   4873 O OD1   . ASN C 3 560 ? 63.120  56.661 26.275  1.00 48.59  ? 560  ASN A OD1   1 
ATOM   4874 N ND2   . ASN C 3 560 ? 64.097  54.882 25.323  1.00 38.48  ? 560  ASN A ND2   1 
ATOM   4875 N N     . LEU C 3 561 ? 67.404  57.211 29.440  1.00 42.09  ? 561  LEU A N     1 
ATOM   4876 C CA    . LEU C 3 561 ? 67.917  57.387 30.792  1.00 44.07  ? 561  LEU A CA    1 
ATOM   4877 C C     . LEU C 3 561 ? 67.146  58.316 31.736  1.00 45.12  ? 561  LEU A C     1 
ATOM   4878 O O     . LEU C 3 561 ? 67.402  58.316 32.927  1.00 48.79  ? 561  LEU A O     1 
ATOM   4879 C CB    . LEU C 3 561 ? 69.373  57.853 30.711  1.00 42.79  ? 561  LEU A CB    1 
ATOM   4880 C CG    . LEU C 3 561 ? 70.436  56.769 30.547  1.00 42.89  ? 561  LEU A CG    1 
ATOM   4881 C CD1   . LEU C 3 561 ? 69.961  55.697 29.594  1.00 41.15  ? 561  LEU A CD1   1 
ATOM   4882 C CD2   . LEU C 3 561 ? 71.732  57.418 30.088  1.00 38.51  ? 561  LEU A CD2   1 
ATOM   4883 N N     . LEU C 3 562 ? 66.209  59.100 31.219  1.00 46.06  ? 562  LEU A N     1 
ATOM   4884 C CA    . LEU C 3 562 ? 65.461  60.031 32.061  1.00 48.47  ? 562  LEU A CA    1 
ATOM   4885 C C     . LEU C 3 562 ? 63.976  59.727 32.032  1.00 51.29  ? 562  LEU A C     1 
ATOM   4886 O O     . LEU C 3 562 ? 63.422  59.376 30.988  1.00 52.28  ? 562  LEU A O     1 
ATOM   4887 C CB    . LEU C 3 562 ? 65.683  61.464 31.585  1.00 47.45  ? 562  LEU A CB    1 
ATOM   4888 C CG    . LEU C 3 562 ? 67.145  61.865 31.386  1.00 47.89  ? 562  LEU A CG    1 
ATOM   4889 C CD1   . LEU C 3 562 ? 67.225  63.250 30.766  1.00 50.15  ? 562  LEU A CD1   1 
ATOM   4890 C CD2   . LEU C 3 562 ? 67.865  61.818 32.712  1.00 46.84  ? 562  LEU A CD2   1 
ATOM   4891 N N     . PRO C 3 563 ? 63.305  59.856 33.185  1.00 53.59  ? 563  PRO A N     1 
ATOM   4892 C CA    . PRO C 3 563 ? 61.867  59.575 33.216  1.00 54.52  ? 563  PRO A CA    1 
ATOM   4893 C C     . PRO C 3 563 ? 61.087  60.566 32.352  1.00 56.96  ? 563  PRO A C     1 
ATOM   4894 O O     . PRO C 3 563 ? 60.942  61.736 32.700  1.00 58.34  ? 563  PRO A O     1 
ATOM   4895 C CB    . PRO C 3 563 ? 61.530  59.668 34.706  1.00 53.34  ? 563  PRO A CB    1 
ATOM   4896 C CG    . PRO C 3 563 ? 62.554  60.636 35.238  1.00 51.30  ? 563  PRO A CG    1 
ATOM   4897 C CD    . PRO C 3 563 ? 63.809  60.249 34.516  1.00 52.00  ? 563  PRO A CD    1 
ATOM   4898 N N     . SER C 3 564 ? 60.602  60.086 31.215  1.00 57.25  ? 564  SER A N     1 
ATOM   4899 C CA    . SER C 3 564 ? 59.841  60.899 30.279  1.00 57.92  ? 564  SER A CA    1 
ATOM   4900 C C     . SER C 3 564 ? 58.385  60.443 30.275  1.00 57.91  ? 564  SER A C     1 
ATOM   4901 O O     . SER C 3 564 ? 58.055  59.437 30.886  1.00 58.45  ? 564  SER A O     1 
ATOM   4902 C CB    . SER C 3 564 ? 60.444  60.744 28.879  1.00 61.09  ? 564  SER A CB    1 
ATOM   4903 O OG    . SER C 3 564 ? 59.592  61.279 27.880  1.00 67.56  ? 564  SER A OG    1 
ATOM   4904 N N     . GLU C 3 565 ? 57.509  61.177 29.596  1.00 58.87  ? 565  GLU A N     1 
ATOM   4905 C CA    . GLU C 3 565 ? 56.103  60.781 29.536  1.00 58.42  ? 565  GLU A CA    1 
ATOM   4906 C C     . GLU C 3 565 ? 55.900  59.778 28.418  1.00 55.91  ? 565  GLU A C     1 
ATOM   4907 O O     . GLU C 3 565 ? 55.044  58.898 28.510  1.00 56.32  ? 565  GLU A O     1 
ATOM   4908 C CB    . GLU C 3 565 ? 55.196  61.998 29.316  1.00 61.19  ? 565  GLU A CB    1 
ATOM   4909 C CG    . GLU C 3 565 ? 55.251  62.983 30.470  1.00 69.44  ? 565  GLU A CG    1 
ATOM   4910 C CD    . GLU C 3 565 ? 54.115  63.991 30.462  1.00 73.55  ? 565  GLU A CD    1 
ATOM   4911 O OE1   . GLU C 3 565 ? 53.973  64.739 29.466  1.00 74.95  ? 565  GLU A OE1   1 
ATOM   4912 O OE2   . GLU C 3 565 ? 53.365  64.037 31.466  1.00 76.34  ? 565  GLU A OE2   1 
ATOM   4913 N N     . THR C 3 566 ? 56.706  59.910 27.367  1.00 53.92  ? 566  THR A N     1 
ATOM   4914 C CA    . THR C 3 566 ? 56.637  59.013 26.221  1.00 51.23  ? 566  THR A CA    1 
ATOM   4915 C C     . THR C 3 566 ? 58.000  58.352 25.986  1.00 50.11  ? 566  THR A C     1 
ATOM   4916 O O     . THR C 3 566 ? 59.006  58.717 26.622  1.00 46.16  ? 566  THR A O     1 
ATOM   4917 C CB    . THR C 3 566 ? 56.225  59.779 24.929  1.00 53.54  ? 566  THR A CB    1 
ATOM   4918 O OG1   . THR C 3 566 ? 57.212  60.775 24.614  1.00 54.03  ? 566  THR A OG1   1 
ATOM   4919 C CG2   . THR C 3 566 ? 54.866  60.458 25.116  1.00 53.52  ? 566  THR A CG2   1 
ATOM   4920 N N     . VAL C 3 567 ? 58.027  57.378 25.077  1.00 48.11  ? 567  VAL A N     1 
ATOM   4921 C CA    . VAL C 3 567 ? 59.261  56.678 24.754  1.00 45.46  ? 567  VAL A CA    1 
ATOM   4922 C C     . VAL C 3 567 ? 60.052  57.479 23.708  1.00 46.57  ? 567  VAL A C     1 
ATOM   4923 O O     . VAL C 3 567 ? 59.516  57.860 22.667  1.00 47.48  ? 567  VAL A O     1 
ATOM   4924 C CB    . VAL C 3 567 ? 58.990  55.262 24.180  1.00 42.71  ? 567  VAL A CB    1 
ATOM   4925 C CG1   . VAL C 3 567 ? 60.269  54.406 24.286  1.00 40.31  ? 567  VAL A CG1   1 
ATOM   4926 C CG2   . VAL C 3 567 ? 57.831  54.602 24.900  1.00 40.47  ? 567  VAL A CG2   1 
ATOM   4927 N N     . GLN C 3 568 ? 61.324  57.742 23.983  1.00 46.26  ? 568  GLN A N     1 
ATOM   4928 C CA    . GLN C 3 568 ? 62.150  58.480 23.032  1.00 45.52  ? 568  GLN A CA    1 
ATOM   4929 C C     . GLN C 3 568 ? 62.758  57.490 22.035  1.00 44.54  ? 568  GLN A C     1 
ATOM   4930 O O     . GLN C 3 568 ? 63.185  56.408 22.415  1.00 44.96  ? 568  GLN A O     1 
ATOM   4931 C CB    . GLN C 3 568 ? 63.266  59.225 23.769  1.00 47.16  ? 568  GLN A CB    1 
ATOM   4932 C CG    . GLN C 3 568 ? 62.764  60.081 24.913  1.00 49.93  ? 568  GLN A CG    1 
ATOM   4933 C CD    . GLN C 3 568 ? 61.795  61.145 24.449  1.00 53.05  ? 568  GLN A CD    1 
ATOM   4934 O OE1   . GLN C 3 568 ? 62.188  62.131 23.828  1.00 56.51  ? 568  GLN A OE1   1 
ATOM   4935 N NE2   . GLN C 3 568 ? 60.516  60.944 24.733  1.00 56.67  ? 568  GLN A NE2   1 
ATOM   4936 N N     . ASP C 3 569 ? 62.781  57.860 20.761  1.00 45.96  ? 569  ASP A N     1 
ATOM   4937 C CA    . ASP C 3 569 ? 63.333  57.014 19.713  1.00 45.32  ? 569  ASP A CA    1 
ATOM   4938 C C     . ASP C 3 569 ? 64.440  57.758 18.987  1.00 45.13  ? 569  ASP A C     1 
ATOM   4939 O O     . ASP C 3 569 ? 64.167  58.500 18.043  1.00 45.82  ? 569  ASP A O     1 
ATOM   4940 C CB    . ASP C 3 569 ? 62.241  56.628 18.719  1.00 47.54  ? 569  ASP A CB    1 
ATOM   4941 C CG    . ASP C 3 569 ? 62.763  55.775 17.576  1.00 53.17  ? 569  ASP A CG    1 
ATOM   4942 O OD1   . ASP C 3 569 ? 63.506  54.802 17.835  1.00 58.93  ? 569  ASP A OD1   1 
ATOM   4943 O OD2   . ASP C 3 569 ? 62.417  56.063 16.414  1.00 53.43  ? 569  ASP A OD2   1 
ATOM   4944 N N     . ILE C 3 570 ? 65.684  57.546 19.420  1.00 45.02  ? 570  ILE A N     1 
ATOM   4945 C CA    . ILE C 3 570 ? 66.841  58.200 18.828  1.00 42.64  ? 570  ILE A CA    1 
ATOM   4946 C C     . ILE C 3 570 ? 66.901  58.010 17.318  1.00 42.89  ? 570  ILE A C     1 
ATOM   4947 O O     . ILE C 3 570 ? 67.447  58.841 16.609  1.00 45.43  ? 570  ILE A O     1 
ATOM   4948 C CB    . ILE C 3 570 ? 68.169  57.713 19.501  1.00 43.57  ? 570  ILE A CB    1 
ATOM   4949 C CG1   . ILE C 3 570 ? 69.335  58.615 19.081  1.00 43.51  ? 570  ILE A CG1   1 
ATOM   4950 C CG2   . ILE C 3 570 ? 68.470  56.265 19.148  1.00 39.03  ? 570  ILE A CG2   1 
ATOM   4951 C CD1   . ILE C 3 570 ? 70.635  58.301 19.804  1.00 41.01  ? 570  ILE A CD1   1 
ATOM   4952 N N     . TYR C 3 571 ? 66.318  56.930 16.815  1.00 43.55  ? 571  TYR A N     1 
ATOM   4953 C CA    . TYR C 3 571 ? 66.314  56.687 15.371  1.00 44.51  ? 571  TYR A CA    1 
ATOM   4954 C C     . TYR C 3 571 ? 65.343  57.645 14.698  1.00 42.27  ? 571  TYR A C     1 
ATOM   4955 O O     . TYR C 3 571 ? 65.562  58.113 13.570  1.00 42.60  ? 571  TYR A O     1 
ATOM   4956 C CB    . TYR C 3 571 ? 65.917  55.229 15.085  1.00 48.82  ? 571  TYR A CB    1 
ATOM   4957 C CG    . TYR C 3 571 ? 66.882  54.247 15.720  1.00 54.69  ? 571  TYR A CG    1 
ATOM   4958 C CD1   . TYR C 3 571 ? 68.222  54.200 15.318  1.00 54.93  ? 571  TYR A CD1   1 
ATOM   4959 C CD2   . TYR C 3 571 ? 66.486  53.427 16.777  1.00 55.78  ? 571  TYR A CD2   1 
ATOM   4960 C CE1   . TYR C 3 571 ? 69.142  53.371 15.956  1.00 56.84  ? 571  TYR A CE1   1 
ATOM   4961 C CE2   . TYR C 3 571 ? 67.405  52.590 17.423  1.00 58.17  ? 571  TYR A CE2   1 
ATOM   4962 C CZ    . TYR C 3 571 ? 68.731  52.572 17.006  1.00 57.83  ? 571  TYR A CZ    1 
ATOM   4963 O OH    . TYR C 3 571 ? 69.648  51.770 17.642  1.00 59.25  ? 571  TYR A OH    1 
ATOM   4964 N N     . GLY C 3 572 ? 64.261  57.932 15.404  1.00 39.53  ? 572  GLY A N     1 
ATOM   4965 C CA    . GLY C 3 572 ? 63.270  58.839 14.883  1.00 38.00  ? 572  GLY A CA    1 
ATOM   4966 C C     . GLY C 3 572 ? 63.750  60.278 14.984  1.00 35.89  ? 572  GLY A C     1 
ATOM   4967 O O     . GLY C 3 572 ? 63.486  61.072 14.094  1.00 35.15  ? 572  GLY A O     1 
ATOM   4968 N N     . ILE C 3 573 ? 64.468  60.636 16.038  1.00 34.20  ? 573  ILE A N     1 
ATOM   4969 C CA    . ILE C 3 573 ? 64.897  62.013 16.104  1.00 38.65  ? 573  ILE A CA    1 
ATOM   4970 C C     . ILE C 3 573 ? 66.070  62.308 15.157  1.00 39.66  ? 573  ILE A C     1 
ATOM   4971 O O     . ILE C 3 573 ? 66.215  63.438 14.681  1.00 39.00  ? 573  ILE A O     1 
ATOM   4972 C CB    . ILE C 3 573 ? 65.164  62.464 17.583  1.00 41.07  ? 573  ILE A CB    1 
ATOM   4973 C CG1   . ILE C 3 573 ? 66.628  62.850 17.782  1.00 38.80  ? 573  ILE A CG1   1 
ATOM   4974 C CG2   . ILE C 3 573 ? 64.677  61.384 18.551  1.00 41.03  ? 573  ILE A CG2   1 
ATOM   4975 C CD1   . ILE C 3 573 ? 66.902  63.442 19.136  1.00 37.72  ? 573  ILE A CD1   1 
ATOM   4976 N N     . VAL C 3 574 ? 66.893  61.309 14.848  1.00 38.13  ? 574  VAL A N     1 
ATOM   4977 C CA    . VAL C 3 574 ? 67.978  61.567 13.902  1.00 37.99  ? 574  VAL A CA    1 
ATOM   4978 C C     . VAL C 3 574 ? 67.292  61.779 12.539  1.00 38.24  ? 574  VAL A C     1 
ATOM   4979 O O     . VAL C 3 574 ? 67.697  62.653 11.756  1.00 37.49  ? 574  VAL A O     1 
ATOM   4980 C CB    . VAL C 3 574 ? 69.001  60.372 13.837  1.00 36.43  ? 574  VAL A CB    1 
ATOM   4981 C CG1   . VAL C 3 574 ? 70.072  60.636 12.804  1.00 33.00  ? 574  VAL A CG1   1 
ATOM   4982 C CG2   . VAL C 3 574 ? 69.664  60.204 15.169  1.00 31.01  ? 574  VAL A CG2   1 
ATOM   4983 N N     . ALA C 3 575 ? 66.227  61.004 12.296  1.00 36.26  ? 575  ALA A N     1 
ATOM   4984 C CA    . ALA C 3 575 ? 65.439  61.081 11.062  1.00 37.24  ? 575  ALA A CA    1 
ATOM   4985 C C     . ALA C 3 575 ? 64.785  62.441 10.822  1.00 38.94  ? 575  ALA A C     1 
ATOM   4986 O O     . ALA C 3 575 ? 64.836  62.971 9.710   1.00 41.73  ? 575  ALA A O     1 
ATOM   4987 C CB    . ALA C 3 575 ? 64.364  60.022 11.065  1.00 36.67  ? 575  ALA A CB    1 
ATOM   4988 N N     . LYS C 3 576 ? 64.145  62.987 11.850  1.00 41.02  ? 576  LYS A N     1 
ATOM   4989 C CA    . LYS C 3 576 ? 63.483  64.285 11.725  1.00 45.40  ? 576  LYS A CA    1 
ATOM   4990 C C     . LYS C 3 576 ? 64.565  65.332 11.455  1.00 44.85  ? 576  LYS A C     1 
ATOM   4991 O O     . LYS C 3 576 ? 64.342  66.278 10.714  1.00 46.14  ? 576  LYS A O     1 
ATOM   4992 C CB    . LYS C 3 576 ? 62.716  64.652 13.008  1.00 46.31  ? 576  LYS A CB    1 
ATOM   4993 C CG    . LYS C 3 576 ? 63.579  65.371 14.032  1.00 54.75  ? 576  LYS A CG    1 
ATOM   4994 C CD    . LYS C 3 576 ? 62.936  65.493 15.426  1.00 59.91  ? 576  LYS A CD    1 
ATOM   4995 C CE    . LYS C 3 576 ? 63.988  65.905 16.494  1.00 58.71  ? 576  LYS A CE    1 
ATOM   4996 N NZ    . LYS C 3 576 ? 63.471  65.781 17.910  1.00 59.75  ? 576  LYS A NZ    1 
ATOM   4997 N N     . LYS C 3 577 ? 65.738  65.158 12.061  1.00 45.08  ? 577  LYS A N     1 
ATOM   4998 C CA    . LYS C 3 577 ? 66.839  66.095 11.847  1.00 43.79  ? 577  LYS A CA    1 
ATOM   4999 C C     . LYS C 3 577 ? 67.379  66.020 10.419  1.00 42.40  ? 577  LYS A C     1 
ATOM   5000 O O     . LYS C 3 577 ? 67.727  67.048 9.835   1.00 40.93  ? 577  LYS A O     1 
ATOM   5001 C CB    . LYS C 3 577 ? 67.951  65.855 12.870  1.00 45.06  ? 577  LYS A CB    1 
ATOM   5002 C CG    . LYS C 3 577 ? 67.488  66.162 14.306  1.00 48.19  ? 577  LYS A CG    1 
ATOM   5003 C CD    . LYS C 3 577 ? 68.632  66.153 15.302  1.00 49.26  ? 577  LYS A CD    1 
ATOM   5004 C CE    . LYS C 3 577 ? 68.143  66.537 16.687  1.00 49.42  ? 577  LYS A CE    1 
ATOM   5005 N NZ    . LYS C 3 577 ? 67.504  67.884 16.691  1.00 51.16  ? 577  LYS A NZ    1 
ATOM   5006 N N     . VAL C 3 578 ? 67.429  64.812 9.851   1.00 40.90  ? 578  VAL A N     1 
ATOM   5007 C CA    . VAL C 3 578 ? 67.883  64.633 8.467   1.00 40.23  ? 578  VAL A CA    1 
ATOM   5008 C C     . VAL C 3 578 ? 66.895  65.303 7.515   1.00 41.53  ? 578  VAL A C     1 
ATOM   5009 O O     . VAL C 3 578 ? 67.293  65.958 6.546   1.00 40.31  ? 578  VAL A O     1 
ATOM   5010 C CB    . VAL C 3 578 ? 67.971  63.139 8.078   1.00 40.49  ? 578  VAL A CB    1 
ATOM   5011 C CG1   . VAL C 3 578 ? 68.015  62.990 6.555   1.00 34.65  ? 578  VAL A CG1   1 
ATOM   5012 C CG2   . VAL C 3 578 ? 69.214  62.513 8.705   1.00 40.27  ? 578  VAL A CG2   1 
ATOM   5013 N N     . ASN C 3 579 ? 65.605  65.120 7.796   1.00 42.25  ? 579  ASN A N     1 
ATOM   5014 C CA    . ASN C 3 579 ? 64.551  65.706 6.979   1.00 42.16  ? 579  ASN A CA    1 
ATOM   5015 C C     . ASN C 3 579 ? 64.533  67.219 6.974   1.00 40.93  ? 579  ASN A C     1 
ATOM   5016 O O     . ASN C 3 579 ? 64.258  67.823 5.936   1.00 42.08  ? 579  ASN A O     1 
ATOM   5017 C CB    . ASN C 3 579 ? 63.179  65.195 7.418   1.00 40.42  ? 579  ASN A CB    1 
ATOM   5018 C CG    . ASN C 3 579 ? 62.823  63.906 6.752   1.00 41.77  ? 579  ASN A CG    1 
ATOM   5019 O OD1   . ASN C 3 579 ? 62.350  63.888 5.615   1.00 45.36  ? 579  ASN A OD1   1 
ATOM   5020 N ND2   . ASN C 3 579 ? 63.079  62.804 7.438   1.00 44.01  ? 579  ASN A ND2   1 
ATOM   5021 N N     . GLU C 3 580 ? 64.813  67.848 8.108   1.00 40.71  ? 580  GLU A N     1 
ATOM   5022 C CA    . GLU C 3 580 ? 64.795  69.299 8.096   1.00 45.08  ? 580  GLU A CA    1 
ATOM   5023 C C     . GLU C 3 580 ? 65.983  69.857 7.354   1.00 44.55  ? 580  GLU A C     1 
ATOM   5024 O O     . GLU C 3 580 ? 65.982  71.019 6.974   1.00 44.45  ? 580  GLU A O     1 
ATOM   5025 C CB    . GLU C 3 580 ? 64.692  69.900 9.496   1.00 47.88  ? 580  GLU A CB    1 
ATOM   5026 C CG    . GLU C 3 580 ? 65.613  69.366 10.540  1.00 57.42  ? 580  GLU A CG    1 
ATOM   5027 C CD    . GLU C 3 580 ? 65.251  69.907 11.925  1.00 61.12  ? 580  GLU A CD    1 
ATOM   5028 O OE1   . GLU C 3 580 ? 64.091  69.706 12.364  1.00 59.71  ? 580  GLU A OE1   1 
ATOM   5029 O OE2   . GLU C 3 580 ? 66.126  70.534 12.569  1.00 62.92  ? 580  GLU A OE2   1 
ATOM   5030 N N     . ILE C 3 581 ? 66.986  69.021 7.113   1.00 45.20  ? 581  ILE A N     1 
ATOM   5031 C CA    . ILE C 3 581 ? 68.148  69.472 6.359   1.00 45.88  ? 581  ILE A CA    1 
ATOM   5032 C C     . ILE C 3 581 ? 67.806  69.290 4.890   1.00 45.83  ? 581  ILE A C     1 
ATOM   5033 O O     . ILE C 3 581 ? 68.253  70.043 4.026   1.00 47.03  ? 581  ILE A O     1 
ATOM   5034 C CB    . ILE C 3 581 ? 69.395  68.649 6.678   1.00 46.68  ? 581  ILE A CB    1 
ATOM   5035 C CG1   . ILE C 3 581 ? 69.913  68.998 8.071   1.00 46.46  ? 581  ILE A CG1   1 
ATOM   5036 C CG2   . ILE C 3 581 ? 70.465  68.922 5.646   1.00 47.22  ? 581  ILE A CG2   1 
ATOM   5037 C CD1   . ILE C 3 581 ? 71.070  68.084 8.532   1.00 47.55  ? 581  ILE A CD1   1 
ATOM   5038 N N     . LEU C 3 582 ? 67.012  68.269 4.606   1.00 44.89  ? 582  LEU A N     1 
ATOM   5039 C CA    . LEU C 3 582 ? 66.596  68.026 3.241   1.00 43.15  ? 582  LEU A CA    1 
ATOM   5040 C C     . LEU C 3 582 ? 65.631  69.146 2.841   1.00 42.28  ? 582  LEU A C     1 
ATOM   5041 O O     . LEU C 3 582 ? 65.716  69.661 1.742   1.00 41.28  ? 582  LEU A O     1 
ATOM   5042 C CB    . LEU C 3 582 ? 65.914  66.663 3.135   1.00 43.66  ? 582  LEU A CB    1 
ATOM   5043 C CG    . LEU C 3 582 ? 66.848  65.460 3.197   1.00 42.51  ? 582  LEU A CG    1 
ATOM   5044 C CD1   . LEU C 3 582 ? 66.049  64.182 3.330   1.00 41.34  ? 582  LEU A CD1   1 
ATOM   5045 C CD2   . LEU C 3 582 ? 67.688  65.414 1.918   1.00 42.82  ? 582  LEU A CD2   1 
ATOM   5046 N N     . GLN C 3 583 ? 64.710  69.518 3.721   1.00 41.98  ? 583  GLN A N     1 
ATOM   5047 C CA    . GLN C 3 583 ? 63.792  70.595 3.381   1.00 44.41  ? 583  GLN A CA    1 
ATOM   5048 C C     . GLN C 3 583 ? 64.626  71.876 3.191   1.00 47.19  ? 583  GLN A C     1 
ATOM   5049 O O     . GLN C 3 583 ? 64.292  72.752 2.390   1.00 48.61  ? 583  GLN A O     1 
ATOM   5050 C CB    . GLN C 3 583 ? 62.741  70.814 4.485   1.00 41.17  ? 583  GLN A CB    1 
ATOM   5051 C CG    . GLN C 3 583 ? 61.684  69.702 4.669   1.00 44.44  ? 583  GLN A CG    1 
ATOM   5052 C CD    . GLN C 3 583 ? 60.720  69.562 3.488   1.00 46.28  ? 583  GLN A CD    1 
ATOM   5053 O OE1   . GLN C 3 583 ? 60.296  70.553 2.884   1.00 48.78  ? 583  GLN A OE1   1 
ATOM   5054 N NE2   . GLN C 3 583 ? 60.354  68.325 3.169   1.00 44.67  ? 583  GLN A NE2   1 
ATOM   5055 N N     . ALA C 3 584 ? 65.730  71.961 3.916   1.00 48.43  ? 584  ALA A N     1 
ATOM   5056 C CA    . ALA C 3 584 ? 66.610  73.117 3.853   1.00 49.58  ? 584  ALA A CA    1 
ATOM   5057 C C     . ALA C 3 584 ? 67.318  73.208 2.509   1.00 51.91  ? 584  ALA A C     1 
ATOM   5058 O O     . ALA C 3 584 ? 67.422  74.290 1.930   1.00 51.74  ? 584  ALA A O     1 
ATOM   5059 C CB    . ALA C 3 584 ? 67.635  73.048 4.984   1.00 49.09  ? 584  ALA A CB    1 
ATOM   5060 N N     . ASP C 3 585 ? 67.810  72.070 2.025   1.00 53.03  ? 585  ASP A N     1 
ATOM   5061 C CA    . ASP C 3 585 ? 68.500  72.006 0.744   1.00 53.67  ? 585  ASP A CA    1 
ATOM   5062 C C     . ASP C 3 585 ? 67.556  72.022 -0.446  1.00 53.94  ? 585  ASP A C     1 
ATOM   5063 O O     . ASP C 3 585 ? 67.941  72.414 -1.539  1.00 55.15  ? 585  ASP A O     1 
ATOM   5064 C CB    . ASP C 3 585 ? 69.349  70.743 0.671   1.00 56.81  ? 585  ASP A CB    1 
ATOM   5065 C CG    . ASP C 3 585 ? 70.583  70.823 1.533   1.00 58.60  ? 585  ASP A CG    1 
ATOM   5066 O OD1   . ASP C 3 585 ? 70.824  71.897 2.126   1.00 58.21  ? 585  ASP A OD1   1 
ATOM   5067 O OD2   . ASP C 3 585 ? 71.314  69.811 1.607   1.00 60.99  ? 585  ASP A OD2   1 
ATOM   5068 N N     . ALA C 3 586 ? 66.327  71.565 -0.237  1.00 54.37  ? 586  ALA A N     1 
ATOM   5069 C CA    . ALA C 3 586 ? 65.331  71.527 -1.292  1.00 53.23  ? 586  ALA A CA    1 
ATOM   5070 C C     . ALA C 3 586 ? 64.962  72.954 -1.685  1.00 55.00  ? 586  ALA A C     1 
ATOM   5071 O O     . ALA C 3 586 ? 64.622  73.214 -2.837  1.00 55.75  ? 586  ALA A O     1 
ATOM   5072 C CB    . ALA C 3 586 ? 64.099  70.776 -0.819  1.00 52.71  ? 586  ALA A CB    1 
ATOM   5073 N N     . ILE C 3 587 ? 65.017  73.879 -0.730  1.00 55.54  ? 587  ILE A N     1 
ATOM   5074 C CA    . ILE C 3 587 ? 64.709  75.270 -1.038  1.00 57.23  ? 587  ILE A CA    1 
ATOM   5075 C C     . ILE C 3 587 ? 65.953  75.927 -1.639  1.00 57.59  ? 587  ILE A C     1 
ATOM   5076 O O     . ILE C 3 587 ? 65.913  76.447 -2.744  1.00 59.09  ? 587  ILE A O     1 
ATOM   5077 C CB    . ILE C 3 587 ? 64.298  76.084 0.217   1.00 56.66  ? 587  ILE A CB    1 
ATOM   5078 C CG1   . ILE C 3 587 ? 63.095  75.439 0.915   1.00 58.16  ? 587  ILE A CG1   1 
ATOM   5079 C CG2   . ILE C 3 587 ? 63.971  77.520 -0.193  1.00 53.92  ? 587  ILE A CG2   1 
ATOM   5080 C CD1   . ILE C 3 587 ? 61.835  75.366 0.078   1.00 56.67  ? 587  ILE A CD1   1 
ATOM   5081 N N     . ASN C 3 588 ? 67.057  75.906 -0.906  1.00 58.24  ? 588  ASN A N     1 
ATOM   5082 C CA    . ASN C 3 588 ? 68.289  76.501 -1.392  1.00 61.22  ? 588  ASN A CA    1 
ATOM   5083 C C     . ASN C 3 588 ? 69.288  75.414 -1.750  1.00 63.76  ? 588  ASN A C     1 
ATOM   5084 O O     . ASN C 3 588 ? 68.933  74.421 -2.389  1.00 65.76  ? 588  ASN A O     1 
ATOM   5085 C CB    . ASN C 3 588 ? 68.874  77.432 -0.332  1.00 63.08  ? 588  ASN A CB    1 
ATOM   5086 C CG    . ASN C 3 588 ? 67.860  78.457 0.156   1.00 65.28  ? 588  ASN A CG    1 
ATOM   5087 O OD1   . ASN C 3 588 ? 67.004  78.148 0.983   1.00 65.41  ? 588  ASN A OD1   1 
ATOM   5088 N ND2   . ASN C 3 588 ? 67.943  79.681 -0.372  1.00 63.58  ? 588  ASN A ND2   1 
ATOM   5089 N N     . GLY C 3 589 ? 70.541  75.590 -1.365  1.00 65.58  ? 589  GLY A N     1 
ATOM   5090 C CA    . GLY C 3 589 ? 71.516  74.565 -1.685  1.00 68.44  ? 589  GLY A CA    1 
ATOM   5091 C C     . GLY C 3 589 ? 71.985  74.555 -3.128  1.00 69.70  ? 589  GLY A C     1 
ATOM   5092 O O     . GLY C 3 589 ? 71.297  75.031 -4.029  1.00 68.32  ? 589  GLY A O     1 
ATOM   5093 N N     . THR C 3 590 ? 73.175  73.991 -3.319  1.00 73.00  ? 590  THR A N     1 
ATOM   5094 C CA    . THR C 3 590 ? 73.862  73.864 -4.605  1.00 76.12  ? 590  THR A CA    1 
ATOM   5095 C C     . THR C 3 590 ? 73.027  73.424 -5.804  1.00 78.73  ? 590  THR A C     1 
ATOM   5096 O O     . THR C 3 590 ? 72.029  72.718 -5.666  1.00 80.26  ? 590  THR A O     1 
ATOM   5097 C CB    . THR C 3 590 ? 75.019  72.879 -4.467  1.00 76.72  ? 590  THR A CB    1 
ATOM   5098 O OG1   . THR C 3 590 ? 75.818  73.270 -3.346  1.00 78.70  ? 590  THR A OG1   1 
ATOM   5099 C CG2   . THR C 3 590 ? 75.882  72.858 -5.729  1.00 78.58  ? 590  THR A CG2   1 
ATOM   5100 N N     . ASP C 3 591 ? 73.461  73.841 -6.990  1.00 81.32  ? 591  ASP A N     1 
ATOM   5101 C CA    . ASP C 3 591 ? 72.780  73.498 -8.229  1.00 83.54  ? 591  ASP A CA    1 
ATOM   5102 C C     . ASP C 3 591 ? 73.609  72.478 -9.006  1.00 84.60  ? 591  ASP A C     1 
ATOM   5103 O O     . ASP C 3 591 ? 74.815  72.345 -8.787  1.00 83.07  ? 591  ASP A O     1 
ATOM   5104 C CB    . ASP C 3 591 ? 72.556  74.759 -9.052  1.00 85.39  ? 591  ASP A CB    1 
ATOM   5105 C CG    . ASP C 3 591 ? 71.838  75.837 -8.262  1.00 88.93  ? 591  ASP A CG    1 
ATOM   5106 O OD1   . ASP C 3 591 ? 70.661  75.618 -7.885  1.00 90.80  ? 591  ASP A OD1   1 
ATOM   5107 O OD2   . ASP C 3 591 ? 72.455  76.896 -8.004  1.00 89.87  ? 591  ASP A OD2   1 
ATOM   5108 N N     . ASN C 3 592 ? 72.956  71.748 -9.901  1.00 85.54  ? 592  ASN A N     1 
ATOM   5109 C CA    . ASN C 3 592 ? 73.640  70.724 -10.668 1.00 88.45  ? 592  ASN A CA    1 
ATOM   5110 C C     . ASN C 3 592 ? 74.716  71.288 -11.570 1.00 91.12  ? 592  ASN A C     1 
ATOM   5111 O O     . ASN C 3 592 ? 74.433  71.725 -12.683 1.00 92.09  ? 592  ASN A O     1 
ATOM   5112 C CB    . ASN C 3 592 ? 72.641  69.953 -11.506 1.00 87.91  ? 592  ASN A CB    1 
ATOM   5113 C CG    . ASN C 3 592 ? 71.498  69.401 -10.718 1.00 88.33  ? 592  ASN A CG    1 
ATOM   5114 O OD1   . ASN C 3 592 ? 71.458  69.525 -9.473  1.00 89.92  ? 592  ASN A OD1   1 
ATOM   5115 N ND2   . ASN C 3 592 ? 70.474  68.918 -11.341 1.00 89.18  ? 592  ASN A ND2   1 
ATOM   5116 N N     . GLU C 3 593 ? 75.952  71.273 -11.085 1.00 94.62  ? 593  GLU A N     1 
ATOM   5117 C CA    . GLU C 3 593 ? 77.094  71.764 -11.853 1.00 97.43  ? 593  GLU A CA    1 
ATOM   5118 C C     . GLU C 3 593 ? 77.090  70.956 -13.138 1.00 98.88  ? 593  GLU A C     1 
ATOM   5119 O O     . GLU C 3 593 ? 76.947  69.728 -13.104 1.00 98.25  ? 593  GLU A O     1 
ATOM   5120 C CB    . GLU C 3 593 ? 78.405  71.499 -11.101 1.00 98.64  ? 593  GLU A CB    1 
ATOM   5121 C CG    . GLU C 3 593 ? 79.506  72.528 -11.306 1.00 99.62  ? 593  GLU A CG    1 
ATOM   5122 C CD    . GLU C 3 593 ? 79.558  73.549 -10.179 1.00 99.75  ? 593  GLU A CD    1 
ATOM   5123 O OE1   . GLU C 3 593 ? 79.636  73.126 -9.006  1.00 100.27 ? 593  GLU A OE1   1 
ATOM   5124 O OE2   . GLU C 3 593 ? 79.525  74.766 -10.461 1.00 99.55  ? 593  GLU A OE2   1 
ATOM   5125 N N     . VAL C 3 594 ? 77.235  71.641 -14.267 1.00 101.55 ? 594  VAL A N     1 
ATOM   5126 C CA    . VAL C 3 594 ? 77.247  70.976 -15.566 1.00 104.46 ? 594  VAL A CA    1 
ATOM   5127 C C     . VAL C 3 594 ? 78.256  69.833 -15.551 1.00 105.71 ? 594  VAL A C     1 
ATOM   5128 O O     . VAL C 3 594 ? 78.819  69.501 -14.507 1.00 106.97 ? 594  VAL A O     1 
ATOM   5129 C CB    . VAL C 3 594 ? 77.600  71.979 -16.667 1.00 103.93 ? 594  VAL A CB    1 
ATOM   5130 N N     . VAL C 3 595 ? 78.484  69.228 -16.708 1.00 106.82 ? 595  VAL A N     1 
ATOM   5131 C CA    . VAL C 3 595 ? 79.437  68.135 -16.796 1.00 107.91 ? 595  VAL A CA    1 
ATOM   5132 C C     . VAL C 3 595 ? 80.720  68.502 -16.046 1.00 108.45 ? 595  VAL A C     1 
ATOM   5133 O O     . VAL C 3 595 ? 80.997  69.683 -15.797 1.00 107.18 ? 595  VAL A O     1 
ATOM   5134 C CB    . VAL C 3 595 ? 79.744  67.822 -18.266 1.00 108.92 ? 595  VAL A CB    1 
ATOM   5135 N N     . THR C 3 596 ? 81.491  67.483 -15.675 1.00 109.23 ? 596  THR A N     1 
ATOM   5136 C CA    . THR C 3 596 ? 82.742  67.690 -14.963 1.00 109.73 ? 596  THR A CA    1 
ATOM   5137 C C     . THR C 3 596 ? 83.504  68.828 -15.629 1.00 110.51 ? 596  THR A C     1 
ATOM   5138 O O     . THR C 3 596 ? 83.657  69.902 -15.042 1.00 110.51 ? 596  THR A O     1 
ATOM   5139 C CB    . THR C 3 596 ? 83.577  66.413 -14.988 1.00 110.28 ? 596  THR A CB    1 
ATOM   5140 N N     . VAL C 3 597 ? 83.958  68.581 -16.861 1.00 110.51 ? 597  VAL A N     1 
ATOM   5141 C CA    . VAL C 3 597 ? 84.715  69.551 -17.658 1.00 110.51 ? 597  VAL A CA    1 
ATOM   5142 C C     . VAL C 3 597 ? 84.494  71.000 -17.222 1.00 110.51 ? 597  VAL A C     1 
ATOM   5143 O O     . VAL C 3 597 ? 83.599  71.685 -17.724 1.00 110.51 ? 597  VAL A O     1 
ATOM   5144 C CB    . VAL C 3 597 ? 84.366  69.393 -19.139 1.00 110.01 ? 597  VAL A CB    1 
ATOM   5145 N N     . THR C 3 598 ? 85.320  71.452 -16.282 1.00 110.51 ? 598  THR A N     1 
ATOM   5146 C CA    . THR C 3 598 ? 85.251  72.812 -15.752 1.00 110.51 ? 598  THR A CA    1 
ATOM   5147 C C     . THR C 3 598 ? 86.459  73.056 -14.844 1.00 110.51 ? 598  THR A C     1 
ATOM   5148 O O     . THR C 3 598 ? 86.442  73.935 -13.980 1.00 110.51 ? 598  THR A O     1 
ATOM   5149 C CB    . THR C 3 598 ? 83.945  73.015 -14.971 1.00 110.51 ? 598  THR A CB    1 
ATOM   5150 N N     . ASP C 3 599 ? 87.505  72.260 -15.050 1.00 110.51 ? 599  ASP A N     1 
ATOM   5151 C CA    . ASP C 3 599 ? 88.735  72.367 -14.272 1.00 110.51 ? 599  ASP A CA    1 
ATOM   5152 C C     . ASP C 3 599 ? 89.903  71.875 -15.121 1.00 110.51 ? 599  ASP A C     1 
ATOM   5153 O O     . ASP C 3 599 ? 90.893  71.367 -14.597 1.00 110.51 ? 599  ASP A O     1 
ATOM   5154 C CB    . ASP C 3 599 ? 88.623  71.536 -12.992 1.00 110.08 ? 599  ASP A CB    1 
ATOM   5155 N N     . GLU C 3 600 ? 89.766  72.028 -16.436 1.00 110.46 ? 600  GLU A N     1 
ATOM   5156 C CA    . GLU C 3 600 ? 90.796  71.599 -17.368 1.00 110.44 ? 600  GLU A CA    1 
ATOM   5157 C C     . GLU C 3 600 ? 90.478  72.074 -18.776 1.00 110.51 ? 600  GLU A C     1 
ATOM   5158 O O     . GLU C 3 600 ? 90.451  73.281 -19.029 1.00 110.51 ? 600  GLU A O     1 
ATOM   5159 N N     . ASN C 3 601 ? 90.233  71.136 -19.694 1.00 110.51 ? 601  ASN A N     1 
ATOM   5160 C CA    . ASN C 3 601 ? 89.905  71.485 -21.079 1.00 110.51 ? 601  ASN A CA    1 
ATOM   5161 C C     . ASN C 3 601 ? 89.725  70.285 -22.012 1.00 110.51 ? 601  ASN A C     1 
ATOM   5162 O O     . ASN C 3 601 ? 90.621  69.447 -22.134 1.00 110.51 ? 601  ASN A O     1 
ATOM   5163 C CB    . ASN C 3 601 ? 90.977  72.420 -21.652 1.00 110.51 ? 601  ASN A CB    1 
ATOM   5164 N N     . THR C 3 602 ? 88.556  70.219 -22.658 1.00 110.51 ? 602  THR A N     1 
ATOM   5165 C CA    . THR C 3 602 ? 88.208  69.171 -23.633 1.00 110.51 ? 602  THR A CA    1 
ATOM   5166 C C     . THR C 3 602 ? 87.794  67.772 -23.143 1.00 110.51 ? 602  THR A C     1 
ATOM   5167 O O     . THR C 3 602 ? 87.574  67.538 -21.950 1.00 110.51 ? 602  THR A O     1 
ATOM   5168 C CB    . THR C 3 602 ? 89.344  69.032 -24.658 1.00 110.51 ? 602  THR A CB    1 
ATOM   5169 N N     . GLY C 3 603 ? 87.676  66.863 -24.113 1.00 110.51 ? 603  GLY A N     1 
ATOM   5170 C CA    . GLY C 3 603 ? 87.313  65.452 -23.930 1.00 110.51 ? 603  GLY A CA    1 
ATOM   5171 C C     . GLY C 3 603 ? 86.383  65.053 -22.779 1.00 110.51 ? 603  GLY A C     1 
ATOM   5172 O O     . GLY C 3 603 ? 85.161  65.053 -22.935 1.00 110.51 ? 603  GLY A O     1 
ATOM   5173 N N     . GLU C 3 604 ? 86.977  64.690 -21.641 1.00 110.51 ? 604  GLU A N     1 
ATOM   5174 C CA    . GLU C 3 604 ? 86.249  64.240 -20.450 1.00 110.46 ? 604  GLU A CA    1 
ATOM   5175 C C     . GLU C 3 604 ? 85.001  65.030 -20.040 1.00 110.15 ? 604  GLU A C     1 
ATOM   5176 O O     . GLU C 3 604 ? 84.997  65.709 -19.006 1.00 110.51 ? 604  GLU A O     1 
ATOM   5177 C CB    . GLU C 3 604 ? 87.215  64.151 -19.265 1.00 109.73 ? 604  GLU A CB    1 
ATOM   5178 N N     . ILE C 3 605 ? 83.944  64.925 -20.844 1.00 109.39 ? 605  ILE A N     1 
ATOM   5179 C CA    . ILE C 3 605 ? 82.680  65.600 -20.557 1.00 108.87 ? 605  ILE A CA    1 
ATOM   5180 C C     . ILE C 3 605 ? 81.983  64.723 -19.532 1.00 108.96 ? 605  ILE A C     1 
ATOM   5181 O O     . ILE C 3 605 ? 80.904  65.050 -19.026 1.00 107.74 ? 605  ILE A O     1 
ATOM   5182 C CB    . ILE C 3 605 ? 81.832  65.708 -21.819 1.00 108.59 ? 605  ILE A CB    1 
ATOM   5183 N N     . SER C 3 606 ? 82.631  63.595 -19.245 1.00 109.39 ? 606  SER A N     1 
ATOM   5184 C CA    . SER C 3 606 ? 82.143  62.613 -18.287 1.00 109.23 ? 606  SER A CA    1 
ATOM   5185 C C     . SER C 3 606 ? 81.796  63.304 -16.980 1.00 109.09 ? 606  SER A C     1 
ATOM   5186 O O     . SER C 3 606 ? 81.932  64.528 -16.860 1.00 109.14 ? 606  SER A O     1 
ATOM   5187 C CB    . SER C 3 606 ? 83.204  61.542 -18.050 1.00 109.22 ? 606  SER A CB    1 
ATOM   5188 N N     . GLU C 3 607 ? 81.363  62.519 -15.995 1.00 108.14 ? 607  GLU A N     1 
ATOM   5189 C CA    . GLU C 3 607 ? 80.975  63.076 -14.705 1.00 106.59 ? 607  GLU A CA    1 
ATOM   5190 C C     . GLU C 3 607 ? 80.069  64.247 -15.049 1.00 105.11 ? 607  GLU A C     1 
ATOM   5191 O O     . GLU C 3 607 ? 80.025  65.251 -14.339 1.00 105.44 ? 607  GLU A O     1 
ATOM   5192 C CB    . GLU C 3 607 ? 82.203  63.559 -13.936 1.00 106.60 ? 607  GLU A CB    1 
ATOM   5193 N N     . LYS C 3 608 ? 79.373  64.103 -16.175 1.00 103.06 ? 608  LYS A N     1 
ATOM   5194 C CA    . LYS C 3 608 ? 78.453  65.115 -16.666 1.00 100.16 ? 608  LYS A CA    1 
ATOM   5195 C C     . LYS C 3 608 ? 77.332  65.245 -15.649 1.00 97.95  ? 608  LYS A C     1 
ATOM   5196 O O     . LYS C 3 608 ? 76.167  64.965 -15.946 1.00 98.39  ? 608  LYS A O     1 
ATOM   5197 C CB    . LYS C 3 608 ? 77.897  64.702 -18.032 1.00 100.21 ? 608  LYS A CB    1 
ATOM   5198 N N     . VAL C 3 609 ? 77.701  65.674 -14.447 1.00 94.25  ? 609  VAL A N     1 
ATOM   5199 C CA    . VAL C 3 609 ? 76.753  65.831 -13.361 1.00 90.03  ? 609  VAL A CA    1 
ATOM   5200 C C     . VAL C 3 609 ? 77.491  65.899 -12.039 1.00 85.87  ? 609  VAL A C     1 
ATOM   5201 O O     . VAL C 3 609 ? 78.382  65.102 -11.784 1.00 85.02  ? 609  VAL A O     1 
ATOM   5202 C CB    . VAL C 3 609 ? 75.791  64.628 -13.294 1.00 90.79  ? 609  VAL A CB    1 
ATOM   5203 C CG1   . VAL C 3 609 ? 76.588  63.338 -13.095 1.00 91.30  ? 609  VAL A CG1   1 
ATOM   5204 C CG2   . VAL C 3 609 ? 74.794  64.820 -12.168 1.00 91.66  ? 609  VAL A CG2   1 
ATOM   5205 N N     . LYS C 3 610 ? 77.118  66.856 -11.203 1.00 82.79  ? 610  LYS A N     1 
ATOM   5206 C CA    . LYS C 3 610 ? 77.722  66.979 -9.884  1.00 80.46  ? 610  LYS A CA    1 
ATOM   5207 C C     . LYS C 3 610 ? 76.536  66.933 -8.935  1.00 77.66  ? 610  LYS A C     1 
ATOM   5208 O O     . LYS C 3 610 ? 76.693  66.803 -7.723  1.00 79.52  ? 610  LYS A O     1 
ATOM   5209 C CB    . LYS C 3 610 ? 78.445  68.320 -9.724  1.00 81.93  ? 610  LYS A CB    1 
ATOM   5210 N N     . LEU C 3 611 ? 75.344  67.024 -9.514  1.00 72.83  ? 611  LEU A N     1 
ATOM   5211 C CA    . LEU C 3 611 ? 74.115  67.037 -8.745  1.00 67.64  ? 611  LEU A CA    1 
ATOM   5212 C C     . LEU C 3 611 ? 74.322  67.874 -7.502  1.00 64.98  ? 611  LEU A C     1 
ATOM   5213 O O     . LEU C 3 611 ? 74.980  67.460 -6.552  1.00 66.78  ? 611  LEU A O     1 
ATOM   5214 C CB    . LEU C 3 611 ? 73.677  65.621 -8.358  1.00 66.05  ? 611  LEU A CB    1 
ATOM   5215 C CG    . LEU C 3 611 ? 73.031  64.767 -9.453  1.00 65.05  ? 611  LEU A CG    1 
ATOM   5216 C CD1   . LEU C 3 611 ? 72.357  63.575 -8.828  1.00 61.75  ? 611  LEU A CD1   1 
ATOM   5217 C CD2   . LEU C 3 611 ? 72.011  65.578 -10.219 1.00 65.09  ? 611  LEU A CD2   1 
ATOM   5218 N N     . GLY C 3 612 ? 73.779  69.075 -7.519  1.00 61.44  ? 612  GLY A N     1 
ATOM   5219 C CA    . GLY C 3 612 ? 73.920  69.915 -6.356  1.00 58.44  ? 612  GLY A CA    1 
ATOM   5220 C C     . GLY C 3 612 ? 73.108  69.284 -5.249  1.00 56.34  ? 612  GLY A C     1 
ATOM   5221 O O     . GLY C 3 612 ? 72.388  68.311 -5.481  1.00 54.15  ? 612  GLY A O     1 
ATOM   5222 N N     . THR C 3 613 ? 73.221  69.840 -4.048  1.00 55.92  ? 613  THR A N     1 
ATOM   5223 C CA    . THR C 3 613 ? 72.488  69.338 -2.899  1.00 52.77  ? 613  THR A CA    1 
ATOM   5224 C C     . THR C 3 613 ? 70.981  69.541 -3.074  1.00 52.43  ? 613  THR A C     1 
ATOM   5225 O O     . THR C 3 613 ? 70.179  68.808 -2.494  1.00 52.25  ? 613  THR A O     1 
ATOM   5226 C CB    . THR C 3 613 ? 72.958  70.035 -1.620  1.00 50.93  ? 613  THR A CB    1 
ATOM   5227 O OG1   . THR C 3 613 ? 72.946  71.444 -1.826  1.00 50.41  ? 613  THR A OG1   1 
ATOM   5228 C CG2   . THR C 3 613 ? 74.369  69.600 -1.260  1.00 51.34  ? 613  THR A CG2   1 
ATOM   5229 N N     . LYS C 3 614 ? 70.602  70.527 -3.887  1.00 51.06  ? 614  LYS A N     1 
ATOM   5230 C CA    . LYS C 3 614 ? 69.196  70.807 -4.130  1.00 50.48  ? 614  LYS A CA    1 
ATOM   5231 C C     . LYS C 3 614 ? 68.513  69.656 -4.864  1.00 48.86  ? 614  LYS A C     1 
ATOM   5232 O O     . LYS C 3 614 ? 67.361  69.332 -4.592  1.00 47.74  ? 614  LYS A O     1 
ATOM   5233 C CB    . LYS C 3 614 ? 69.056  72.082 -4.935  1.00 52.72  ? 614  LYS A CB    1 
ATOM   5234 C CG    . LYS C 3 614 ? 67.621  72.530 -5.165  1.00 56.82  ? 614  LYS A CG    1 
ATOM   5235 C CD    . LYS C 3 614 ? 67.630  73.928 -5.768  1.00 59.98  ? 614  LYS A CD    1 
ATOM   5236 C CE    . LYS C 3 614 ? 66.241  74.455 -6.057  1.00 62.21  ? 614  LYS A CE    1 
ATOM   5237 N NZ    . LYS C 3 614 ? 66.319  75.893 -6.452  1.00 65.76  ? 614  LYS A NZ    1 
ATOM   5238 N N     . ALA C 3 615 ? 69.229  69.043 -5.799  1.00 46.53  ? 615  ALA A N     1 
ATOM   5239 C CA    . ALA C 3 615 ? 68.694  67.920 -6.558  1.00 45.98  ? 615  ALA A CA    1 
ATOM   5240 C C     . ALA C 3 615 ? 68.808  66.668 -5.696  1.00 44.91  ? 615  ALA A C     1 
ATOM   5241 O O     . ALA C 3 615 ? 67.936  65.824 -5.728  1.00 44.70  ? 615  ALA A O     1 
ATOM   5242 C CB    . ALA C 3 615 ? 69.486  67.726 -7.862  1.00 46.99  ? 615  ALA A CB    1 
ATOM   5243 N N     . LEU C 3 616 ? 69.897  66.563 -4.932  1.00 44.24  ? 616  LEU A N     1 
ATOM   5244 C CA    . LEU C 3 616 ? 70.122  65.417 -4.055  1.00 41.69  ? 616  LEU A CA    1 
ATOM   5245 C C     . LEU C 3 616 ? 69.053  65.365 -2.970  1.00 40.30  ? 616  LEU A C     1 
ATOM   5246 O O     . LEU C 3 616 ? 68.545  64.298 -2.647  1.00 40.81  ? 616  LEU A O     1 
ATOM   5247 C CB    . LEU C 3 616 ? 71.506  65.501 -3.409  1.00 40.51  ? 616  LEU A CB    1 
ATOM   5248 C CG    . LEU C 3 616 ? 72.715  64.851 -4.103  1.00 43.10  ? 616  LEU A CG    1 
ATOM   5249 C CD1   . LEU C 3 616 ? 72.254  63.940 -5.208  1.00 37.58  ? 616  LEU A CD1   1 
ATOM   5250 C CD2   . LEU C 3 616 ? 73.647  65.913 -4.632  1.00 39.60  ? 616  LEU A CD2   1 
ATOM   5251 N N     . ALA C 3 617 ? 68.738  66.528 -2.410  1.00 38.10  ? 617  ALA A N     1 
ATOM   5252 C CA    . ALA C 3 617 ? 67.722  66.655 -1.379  1.00 36.59  ? 617  ALA A CA    1 
ATOM   5253 C C     . ALA C 3 617 ? 66.376  66.261 -1.952  1.00 35.98  ? 617  ALA A C     1 
ATOM   5254 O O     . ALA C 3 617 ? 65.621  65.534 -1.315  1.00 37.21  ? 617  ALA A O     1 
ATOM   5255 C CB    . ALA C 3 617 ? 67.658  68.096 -0.864  1.00 36.40  ? 617  ALA A CB    1 
ATOM   5256 N N     . GLY C 3 618 ? 66.077  66.741 -3.154  1.00 35.47  ? 618  GLY A N     1 
ATOM   5257 C CA    . GLY C 3 618 ? 64.805  66.415 -3.779  1.00 33.11  ? 618  GLY A CA    1 
ATOM   5258 C C     . GLY C 3 618 ? 64.653  64.918 -4.043  1.00 36.81  ? 618  GLY A C     1 
ATOM   5259 O O     . GLY C 3 618 ? 63.576  64.348 -3.839  1.00 34.82  ? 618  GLY A O     1 
ATOM   5260 N N     . GLN C 3 619 ? 65.723  64.258 -4.477  1.00 36.87  ? 619  GLN A N     1 
ATOM   5261 C CA    . GLN C 3 619 ? 65.633  62.833 -4.745  1.00 38.82  ? 619  GLN A CA    1 
ATOM   5262 C C     . GLN C 3 619 ? 65.263  62.094 -3.464  1.00 38.61  ? 619  GLN A C     1 
ATOM   5263 O O     . GLN C 3 619 ? 64.347  61.287 -3.443  1.00 38.30  ? 619  GLN A O     1 
ATOM   5264 C CB    . GLN C 3 619 ? 66.959  62.299 -5.290  1.00 39.58  ? 619  GLN A CB    1 
ATOM   5265 C CG    . GLN C 3 619 ? 67.505  63.098 -6.445  1.00 44.57  ? 619  GLN A CG    1 
ATOM   5266 C CD    . GLN C 3 619 ? 68.719  62.454 -7.083  1.00 48.72  ? 619  GLN A CD    1 
ATOM   5267 O OE1   . GLN C 3 619 ? 69.517  61.827 -6.359  1.00 51.79  ? 619  GLN A OE1   1 
ATOM   5268 N NE2   . GLN C 3 619 ? 68.879  62.584 -8.311  1.00 49.23  ? 619  GLN A NE2   1 
ATOM   5269 N N     . TRP C 3 620 ? 65.971  62.404 -2.385  1.00 39.16  ? 620  TRP A N     1 
ATOM   5270 C CA    . TRP C 3 620 ? 65.719  61.752 -1.114  1.00 39.19  ? 620  TRP A CA    1 
ATOM   5271 C C     . TRP C 3 620 ? 64.330  62.020 -0.578  1.00 38.74  ? 620  TRP A C     1 
ATOM   5272 O O     . TRP C 3 620 ? 63.745  61.143 0.043   1.00 37.94  ? 620  TRP A O     1 
ATOM   5273 C CB    . TRP C 3 620 ? 66.778  62.159 -0.077  1.00 39.22  ? 620  TRP A CB    1 
ATOM   5274 C CG    . TRP C 3 620 ? 68.014  61.375 -0.209  1.00 36.96  ? 620  TRP A CG    1 
ATOM   5275 C CD1   . TRP C 3 620 ? 69.221  61.815 -0.640  1.00 39.19  ? 620  TRP A CD1   1 
ATOM   5276 C CD2   . TRP C 3 620 ? 68.152  59.978 0.024   1.00 40.00  ? 620  TRP A CD2   1 
ATOM   5277 N NE1   . TRP C 3 620 ? 70.110  60.782 -0.700  1.00 38.11  ? 620  TRP A NE1   1 
ATOM   5278 C CE2   . TRP C 3 620 ? 69.483  59.636 -0.295  1.00 40.42  ? 620  TRP A CE2   1 
ATOM   5279 C CE3   . TRP C 3 620 ? 67.276  58.974 0.470   1.00 40.31  ? 620  TRP A CE3   1 
ATOM   5280 C CZ2   . TRP C 3 620 ? 69.969  58.333 -0.184  1.00 39.98  ? 620  TRP A CZ2   1 
ATOM   5281 C CZ3   . TRP C 3 620 ? 67.757  57.678 0.580   1.00 42.28  ? 620  TRP A CZ3   1 
ATOM   5282 C CH2   . TRP C 3 620 ? 69.099  57.368 0.251   1.00 41.25  ? 620  TRP A CH2   1 
ATOM   5283 N N     . LEU C 3 621 ? 63.821  63.233 -0.787  1.00 38.12  ? 621  LEU A N     1 
ATOM   5284 C CA    . LEU C 3 621 ? 62.470  63.596 -0.348  1.00 39.39  ? 621  LEU A CA    1 
ATOM   5285 C C     . LEU C 3 621 ? 61.441  62.822 -1.181  1.00 40.09  ? 621  LEU A C     1 
ATOM   5286 O O     . LEU C 3 621 ? 60.337  62.548 -0.736  1.00 41.23  ? 621  LEU A O     1 
ATOM   5287 C CB    . LEU C 3 621 ? 62.225  65.081 -0.547  1.00 40.33  ? 621  LEU A CB    1 
ATOM   5288 C CG    . LEU C 3 621 ? 62.952  66.040 0.383   1.00 41.07  ? 621  LEU A CG    1 
ATOM   5289 C CD1   . LEU C 3 621 ? 62.658  67.451 -0.071  1.00 38.03  ? 621  LEU A CD1   1 
ATOM   5290 C CD2   . LEU C 3 621 ? 62.494  65.823 1.823   1.00 40.51  ? 621  LEU A CD2   1 
ATOM   5291 N N     . ALA C 3 622 ? 61.807  62.497 -2.408  1.00 41.12  ? 622  ALA A N     1 
ATOM   5292 C CA    . ALA C 3 622 ? 60.917  61.746 -3.269  1.00 42.85  ? 622  ALA A CA    1 
ATOM   5293 C C     . ALA C 3 622 ? 60.875  60.329 -2.723  1.00 44.00  ? 622  ALA A C     1 
ATOM   5294 O O     . ALA C 3 622 ? 59.830  59.686 -2.721  1.00 45.01  ? 622  ALA A O     1 
ATOM   5295 C CB    . ALA C 3 622 ? 61.444  61.739 -4.705  1.00 40.00  ? 622  ALA A CB    1 
ATOM   5296 N N     . TYR C 3 623 ? 62.020  59.851 -2.251  1.00 46.59  ? 623  TYR A N     1 
ATOM   5297 C CA    . TYR C 3 623 ? 62.108  58.503 -1.715  1.00 49.02  ? 623  TYR A CA    1 
ATOM   5298 C C     . TYR C 3 623 ? 61.399  58.414 -0.376  1.00 50.26  ? 623  TYR A C     1 
ATOM   5299 O O     . TYR C 3 623 ? 60.499  57.603 -0.203  1.00 51.73  ? 623  TYR A O     1 
ATOM   5300 C CB    . TYR C 3 623 ? 63.567  58.087 -1.549  1.00 50.79  ? 623  TYR A CB    1 
ATOM   5301 C CG    . TYR C 3 623 ? 63.749  56.687 -1.017  1.00 52.98  ? 623  TYR A CG    1 
ATOM   5302 C CD1   . TYR C 3 623 ? 63.438  55.578 -1.796  1.00 53.64  ? 623  TYR A CD1   1 
ATOM   5303 C CD2   . TYR C 3 623 ? 64.220  56.469 0.275   1.00 55.69  ? 623  TYR A CD2   1 
ATOM   5304 C CE1   . TYR C 3 623 ? 63.592  54.273 -1.296  1.00 56.47  ? 623  TYR A CE1   1 
ATOM   5305 C CE2   . TYR C 3 623 ? 64.376  55.165 0.788   1.00 56.68  ? 623  TYR A CE2   1 
ATOM   5306 C CZ    . TYR C 3 623 ? 64.057  54.078 -0.004  1.00 56.89  ? 623  TYR A CZ    1 
ATOM   5307 O OH    . TYR C 3 623 ? 64.177  52.805 0.503   1.00 59.60  ? 623  TYR A OH    1 
ATOM   5308 N N     . GLY C 3 624 ? 61.810  59.248 0.573   1.00 52.52  ? 624  GLY A N     1 
ATOM   5309 C CA    . GLY C 3 624 ? 61.173  59.231 1.878   1.00 53.48  ? 624  GLY A CA    1 
ATOM   5310 C C     . GLY C 3 624 ? 62.034  59.637 3.057   1.00 53.62  ? 624  GLY A C     1 
ATOM   5311 O O     . GLY C 3 624 ? 61.895  60.745 3.606   1.00 57.90  ? 624  GLY A O     1 
ATOM   5312 N N     . VAL C 3 625 ? 62.933  58.745 3.446   1.00 50.98  ? 625  VAL A N     1 
ATOM   5313 C CA    . VAL C 3 625 ? 63.816  58.985 4.590   1.00 49.42  ? 625  VAL A CA    1 
ATOM   5314 C C     . VAL C 3 625 ? 63.014  58.956 5.883   1.00 48.41  ? 625  VAL A C     1 
ATOM   5315 O O     . VAL C 3 625 ? 62.630  59.990 6.444   1.00 44.57  ? 625  VAL A O     1 
ATOM   5316 C CB    . VAL C 3 625 ? 64.563  60.328 4.507   1.00 44.97  ? 625  VAL A CB    1 
ATOM   5317 C CG1   . VAL C 3 625 ? 65.434  60.495 5.742   1.00 42.54  ? 625  VAL A CG1   1 
ATOM   5318 C CG2   . VAL C 3 625 ? 65.437  60.353 3.266   1.00 41.67  ? 625  VAL A CG2   1 
ATOM   5319 N N     . THR C 3 626 ? 62.762  57.736 6.340   1.00 51.25  ? 626  THR A N     1 
ATOM   5320 C CA    . THR C 3 626 ? 62.005  57.503 7.557   1.00 51.44  ? 626  THR A CA    1 
ATOM   5321 C C     . THR C 3 626 ? 62.919  56.901 8.599   1.00 53.88  ? 626  THR A C     1 
ATOM   5322 O O     . THR C 3 626 ? 64.107  56.656 8.348   1.00 54.50  ? 626  THR A O     1 
ATOM   5323 C CB    . THR C 3 626 ? 60.873  56.516 7.306   1.00 51.62  ? 626  THR A CB    1 
ATOM   5324 O OG1   . THR C 3 626 ? 61.424  55.280 6.815   1.00 48.94  ? 626  THR A OG1   1 
ATOM   5325 C CG2   . THR C 3 626 ? 59.883  57.096 6.286   1.00 50.65  ? 626  THR A CG2   1 
ATOM   5326 N N     . ARG C 3 627 ? 62.352  56.677 9.774   1.00 55.73  ? 627  ARG A N     1 
ATOM   5327 C CA    . ARG C 3 627 ? 63.071  56.072 10.887  1.00 57.49  ? 627  ARG A CA    1 
ATOM   5328 C C     . ARG C 3 627 ? 63.828  54.824 10.399  1.00 58.91  ? 627  ARG A C     1 
ATOM   5329 O O     . ARG C 3 627 ? 65.018  54.653 10.677  1.00 57.13  ? 627  ARG A O     1 
ATOM   5330 C CB    . ARG C 3 627 ? 62.052  55.709 11.965  1.00 56.72  ? 627  ARG A CB    1 
ATOM   5331 C CG    . ARG C 3 627 ? 62.601  54.976 13.159  1.00 59.05  ? 627  ARG A CG    1 
ATOM   5332 C CD    . ARG C 3 627 ? 61.486  54.707 14.157  1.00 55.60  ? 627  ARG A CD    1 
ATOM   5333 N NE    . ARG C 3 627 ? 61.946  53.909 15.281  1.00 56.32  ? 627  ARG A NE    1 
ATOM   5334 C CZ    . ARG C 3 627 ? 62.337  52.647 15.178  1.00 55.50  ? 627  ARG A CZ    1 
ATOM   5335 N NH1   . ARG C 3 627 ? 62.319  52.053 13.994  1.00 53.32  ? 627  ARG A NH1   1 
ATOM   5336 N NH2   . ARG C 3 627 ? 62.735  51.979 16.255  1.00 55.74  ? 627  ARG A NH2   1 
ATOM   5337 N N     . SER C 3 628 ? 63.135  53.973 9.642   1.00 60.62  ? 628  SER A N     1 
ATOM   5338 C CA    . SER C 3 628 ? 63.721  52.741 9.100   1.00 60.89  ? 628  SER A CA    1 
ATOM   5339 C C     . SER C 3 628 ? 65.002  52.982 8.314   1.00 60.64  ? 628  SER A C     1 
ATOM   5340 O O     . SER C 3 628 ? 66.012  52.325 8.534   1.00 61.01  ? 628  SER A O     1 
ATOM   5341 C CB    . SER C 3 628 ? 62.712  52.042 8.194   1.00 60.75  ? 628  SER A CB    1 
ATOM   5342 O OG    . SER C 3 628 ? 61.580  51.621 8.933   1.00 62.37  ? 628  SER A OG    1 
ATOM   5343 N N     . VAL C 3 629 ? 64.939  53.925 7.384   1.00 61.60  ? 629  VAL A N     1 
ATOM   5344 C CA    . VAL C 3 629 ? 66.076  54.284 6.549   1.00 61.49  ? 629  VAL A CA    1 
ATOM   5345 C C     . VAL C 3 629 ? 67.270  54.800 7.346   1.00 60.27  ? 629  VAL A C     1 
ATOM   5346 O O     . VAL C 3 629 ? 68.415  54.591 6.952   1.00 62.18  ? 629  VAL A O     1 
ATOM   5347 C CB    . VAL C 3 629 ? 65.675  55.372 5.514   1.00 61.31  ? 629  VAL A CB    1 
ATOM   5348 C CG1   . VAL C 3 629 ? 66.901  55.918 4.810   1.00 60.83  ? 629  VAL A CG1   1 
ATOM   5349 C CG2   . VAL C 3 629 ? 64.714  54.789 4.506   1.00 61.85  ? 629  VAL A CG2   1 
ATOM   5350 N N     . THR C 3 630 ? 67.013  55.467 8.466   1.00 59.16  ? 630  THR A N     1 
ATOM   5351 C CA    . THR C 3 630 ? 68.102  56.034 9.248   1.00 57.03  ? 630  THR A CA    1 
ATOM   5352 C C     . THR C 3 630 ? 68.606  55.059 10.288  1.00 58.32  ? 630  THR A C     1 
ATOM   5353 O O     . THR C 3 630 ? 69.788  55.078 10.655  1.00 57.05  ? 630  THR A O     1 
ATOM   5354 C CB    . THR C 3 630 ? 67.671  57.352 9.958   1.00 53.23  ? 630  THR A CB    1 
ATOM   5355 O OG1   . THR C 3 630 ? 67.036  57.048 11.200  1.00 55.54  ? 630  THR A OG1   1 
ATOM   5356 C CG2   . THR C 3 630 ? 66.675  58.111 9.105   1.00 51.41  ? 630  THR A CG2   1 
ATOM   5357 N N     . LYS C 3 631 ? 67.712  54.195 10.754  1.00 60.07  ? 631  LYS A N     1 
ATOM   5358 C CA    . LYS C 3 631 ? 68.082  53.225 11.781  1.00 66.06  ? 631  LYS A CA    1 
ATOM   5359 C C     . LYS C 3 631 ? 69.150  52.225 11.385  1.00 67.85  ? 631  LYS A C     1 
ATOM   5360 O O     . LYS C 3 631 ? 70.238  52.206 11.954  1.00 66.56  ? 631  LYS A O     1 
ATOM   5361 C CB    . LYS C 3 631 ? 66.864  52.448 12.258  1.00 67.00  ? 631  LYS A CB    1 
ATOM   5362 C CG    . LYS C 3 631 ? 67.244  51.317 13.175  1.00 69.41  ? 631  LYS A CG    1 
ATOM   5363 C CD    . LYS C 3 631 ? 66.123  50.973 14.107  1.00 72.92  ? 631  LYS A CD    1 
ATOM   5364 C CE    . LYS C 3 631 ? 66.620  50.052 15.192  1.00 75.77  ? 631  LYS A CE    1 
ATOM   5365 N NZ    . LYS C 3 631 ? 65.718  50.114 16.370  1.00 80.49  ? 631  LYS A NZ    1 
ATOM   5366 N N     . ARG C 3 632 ? 68.816  51.364 10.433  1.00 71.56  ? 632  ARG A N     1 
ATOM   5367 C CA    . ARG C 3 632 ? 69.763  50.363 9.982   1.00 76.70  ? 632  ARG A CA    1 
ATOM   5368 C C     . ARG C 3 632 ? 71.029  51.072 9.517   1.00 77.44  ? 632  ARG A C     1 
ATOM   5369 O O     . ARG C 3 632 ? 72.142  50.615 9.785   1.00 76.61  ? 632  ARG A O     1 
ATOM   5370 C CB    . ARG C 3 632 ? 69.149  49.524 8.854   1.00 79.24  ? 632  ARG A CB    1 
ATOM   5371 C CG    . ARG C 3 632 ? 68.688  50.323 7.654   1.00 82.68  ? 632  ARG A CG    1 
ATOM   5372 C CD    . ARG C 3 632 ? 68.006  49.431 6.628   1.00 86.54  ? 632  ARG A CD    1 
ATOM   5373 N NE    . ARG C 3 632 ? 67.646  50.174 5.422   1.00 90.29  ? 632  ARG A NE    1 
ATOM   5374 C CZ    . ARG C 3 632 ? 67.108  49.630 4.335   1.00 92.58  ? 632  ARG A CZ    1 
ATOM   5375 N NH1   . ARG C 3 632 ? 66.862  48.325 4.290   1.00 94.80  ? 632  ARG A NH1   1 
ATOM   5376 N NH2   . ARG C 3 632 ? 66.813  50.392 3.291   1.00 93.08  ? 632  ARG A NH2   1 
ATOM   5377 N N     . SER C 3 633 ? 70.844  52.201 8.839   1.00 79.44  ? 633  SER A N     1 
ATOM   5378 C CA    . SER C 3 633 ? 71.960  52.994 8.343   1.00 82.21  ? 633  SER A CA    1 
ATOM   5379 C C     . SER C 3 633 ? 72.845  53.456 9.492   1.00 82.79  ? 633  SER A C     1 
ATOM   5380 O O     . SER C 3 633 ? 74.065  53.421 9.399   1.00 83.40  ? 633  SER A O     1 
ATOM   5381 C CB    . SER C 3 633 ? 71.446  54.211 7.571   1.00 82.71  ? 633  SER A CB    1 
ATOM   5382 O OG    . SER C 3 633 ? 70.756  53.818 6.395   1.00 85.01  ? 633  SER A OG    1 
ATOM   5383 N N     . VAL C 3 634 ? 72.224  53.899 10.575  1.00 84.57  ? 634  VAL A N     1 
ATOM   5384 C CA    . VAL C 3 634 ? 72.973  54.343 11.734  1.00 86.04  ? 634  VAL A CA    1 
ATOM   5385 C C     . VAL C 3 634 ? 73.708  53.158 12.344  1.00 88.71  ? 634  VAL A C     1 
ATOM   5386 O O     . VAL C 3 634 ? 74.828  53.297 12.826  1.00 89.18  ? 634  VAL A O     1 
ATOM   5387 C CB    . VAL C 3 634 ? 72.033  54.958 12.806  1.00 84.70  ? 634  VAL A CB    1 
ATOM   5388 C CG1   . VAL C 3 634 ? 72.751  55.069 14.147  1.00 82.29  ? 634  VAL A CG1   1 
ATOM   5389 C CG2   . VAL C 3 634 ? 71.566  56.330 12.357  1.00 84.70  ? 634  VAL A CG2   1 
ATOM   5390 N N     . MET C 3 635 ? 73.080  51.987 12.296  1.00 91.76  ? 635  MET A N     1 
ATOM   5391 C CA    . MET C 3 635 ? 73.646  50.776 12.889  1.00 95.76  ? 635  MET A CA    1 
ATOM   5392 C C     . MET C 3 635 ? 74.809  50.090 12.174  1.00 98.20  ? 635  MET A C     1 
ATOM   5393 O O     . MET C 3 635 ? 75.640  49.444 12.817  1.00 98.99  ? 635  MET A O     1 
ATOM   5394 C CB    . MET C 3 635 ? 72.533  49.752 13.109  1.00 95.50  ? 635  MET A CB    1 
ATOM   5395 C CG    . MET C 3 635 ? 71.448  50.224 14.048  1.00 94.84  ? 635  MET A CG    1 
ATOM   5396 S SD    . MET C 3 635 ? 70.197  48.963 14.264  1.00 96.18  ? 635  MET A SD    1 
ATOM   5397 C CE    . MET C 3 635 ? 70.650  48.317 15.878  1.00 95.42  ? 635  MET A CE    1 
ATOM   5398 N N     . THR C 3 636 ? 74.872  50.218 10.855  1.00 100.18 ? 636  THR A N     1 
ATOM   5399 C CA    . THR C 3 636 ? 75.936  49.576 10.099  1.00 102.10 ? 636  THR A CA    1 
ATOM   5400 C C     . THR C 3 636 ? 77.197  50.425 9.965   1.00 103.96 ? 636  THR A C     1 
ATOM   5401 O O     . THR C 3 636 ? 78.177  49.987 9.366   1.00 105.89 ? 636  THR A O     1 
ATOM   5402 C CB    . THR C 3 636 ? 75.425  49.188 8.722   1.00 100.84 ? 636  THR A CB    1 
ATOM   5403 N N     . LEU C 3 637 ? 77.183  51.630 10.522  1.00 105.15 ? 637  LEU A N     1 
ATOM   5404 C CA    . LEU C 3 637 ? 78.348  52.505 10.429  1.00 107.23 ? 637  LEU A CA    1 
ATOM   5405 C C     . LEU C 3 637 ? 79.029  52.697 11.783  1.00 107.96 ? 637  LEU A C     1 
ATOM   5406 O O     . LEU C 3 637 ? 78.361  52.867 12.803  1.00 107.64 ? 637  LEU A O     1 
ATOM   5407 C CB    . LEU C 3 637 ? 77.941  53.857 9.846   1.00 106.79 ? 637  LEU A CB    1 
ATOM   5408 N N     . ALA C 3 638 ? 80.360  52.668 11.781  1.00 109.08 ? 638  ALA A N     1 
ATOM   5409 C CA    . ALA C 3 638 ? 81.147  52.837 13.000  1.00 109.87 ? 638  ALA A CA    1 
ATOM   5410 C C     . ALA C 3 638 ? 80.826  51.731 14.002  1.00 110.17 ? 638  ALA A C     1 
ATOM   5411 O O     . ALA C 3 638 ? 81.334  50.613 13.885  1.00 109.12 ? 638  ALA A O     1 
ATOM   5412 C CB    . ALA C 3 638 ? 80.873  54.215 13.619  1.00 110.05 ? 638  ALA A CB    1 
ATOM   5413 N N     . TYR C 3 639 ? 79.978  52.051 14.979  1.00 110.51 ? 639  TYR A N     1 
ATOM   5414 C CA    . TYR C 3 639 ? 79.576  51.094 16.010  1.00 110.51 ? 639  TYR A CA    1 
ATOM   5415 C C     . TYR C 3 639 ? 78.701  49.983 15.425  1.00 110.51 ? 639  TYR A C     1 
ATOM   5416 O O     . TYR C 3 639 ? 77.540  50.212 15.071  1.00 110.51 ? 639  TYR A O     1 
ATOM   5417 C CB    . TYR C 3 639 ? 78.828  51.818 17.134  1.00 110.26 ? 639  TYR A CB    1 
ATOM   5418 N N     . GLY C 3 640 ? 79.269  48.782 15.333  1.00 110.51 ? 640  GLY A N     1 
ATOM   5419 C CA    . GLY C 3 640 ? 78.547  47.646 14.788  1.00 110.51 ? 640  GLY A CA    1 
ATOM   5420 C C     . GLY C 3 640 ? 79.407  46.841 13.829  1.00 110.51 ? 640  GLY A C     1 
ATOM   5421 O O     . GLY C 3 640 ? 80.240  46.038 14.260  1.00 110.51 ? 640  GLY A O     1 
ATOM   5422 N N     . SER C 3 641 ? 79.210  47.057 12.528  1.00 110.51 ? 641  SER A N     1 
ATOM   5423 C CA    . SER C 3 641 ? 79.972  46.352 11.495  1.00 110.51 ? 641  SER A CA    1 
ATOM   5424 C C     . SER C 3 641 ? 80.014  47.129 10.173  1.00 110.51 ? 641  SER A C     1 
ATOM   5425 O O     . SER C 3 641 ? 79.098  47.031 9.354   1.00 110.51 ? 641  SER A O     1 
ATOM   5426 C CB    . SER C 3 641 ? 79.378  44.958 11.267  1.00 110.36 ? 641  SER A CB    1 
ATOM   5427 N N     . LYS C 3 642 ? 81.086  47.895 9.975   1.00 110.51 ? 642  LYS A N     1 
ATOM   5428 C CA    . LYS C 3 642 ? 81.275  48.690 8.761   1.00 110.51 ? 642  LYS A CA    1 
ATOM   5429 C C     . LYS C 3 642 ? 82.645  48.389 8.146   1.00 110.51 ? 642  LYS A C     1 
ATOM   5430 O O     . LYS C 3 642 ? 83.637  48.227 8.865   1.00 110.51 ? 642  LYS A O     1 
ATOM   5431 C CB    . LYS C 3 642 ? 81.159  50.183 9.084   1.00 110.39 ? 642  LYS A CB    1 
ATOM   5432 N N     . GLU C 3 643 ? 82.698  48.316 6.819   1.00 110.51 ? 643  GLU A N     1 
ATOM   5433 C CA    . GLU C 3 643 ? 83.949  48.022 6.127   1.00 110.51 ? 643  GLU A CA    1 
ATOM   5434 C C     . GLU C 3 643 ? 84.256  49.049 5.043   1.00 110.51 ? 643  GLU A C     1 
ATOM   5435 O O     . GLU C 3 643 ? 83.793  48.924 3.908   1.00 110.51 ? 643  GLU A O     1 
ATOM   5436 C CB    . GLU C 3 643 ? 83.888  46.623 5.519   1.00 110.34 ? 643  GLU A CB    1 
ATOM   5437 N N     . PHE C 3 644 ? 85.039  50.060 5.407   1.00 110.35 ? 644  PHE A N     1 
ATOM   5438 C CA    . PHE C 3 644 ? 85.435  51.127 4.488   1.00 109.75 ? 644  PHE A CA    1 
ATOM   5439 C C     . PHE C 3 644 ? 84.288  51.664 3.623   1.00 109.36 ? 644  PHE A C     1 
ATOM   5440 O O     . PHE C 3 644 ? 83.913  51.058 2.611   1.00 109.42 ? 644  PHE A O     1 
ATOM   5441 C CB    . PHE C 3 644 ? 86.579  50.645 3.599   1.00 109.53 ? 644  PHE A CB    1 
ATOM   5442 N N     . GLY C 3 645 ? 83.742  52.810 4.029   1.00 108.13 ? 645  GLY A N     1 
ATOM   5443 C CA    . GLY C 3 645 ? 82.653  53.432 3.292   1.00 106.82 ? 645  GLY A CA    1 
ATOM   5444 C C     . GLY C 3 645 ? 81.311  53.388 4.006   1.00 105.69 ? 645  GLY A C     1 
ATOM   5445 O O     . GLY C 3 645 ? 80.571  52.416 3.868   1.00 105.12 ? 645  GLY A O     1 
ATOM   5446 N N     . PHE C 3 646 ? 80.996  54.439 4.764   1.00 104.76 ? 646  PHE A N     1 
ATOM   5447 C CA    . PHE C 3 646 ? 79.730  54.522 5.501   1.00 103.46 ? 646  PHE A CA    1 
ATOM   5448 C C     . PHE C 3 646 ? 78.589  54.858 4.549   1.00 102.82 ? 646  PHE A C     1 
ATOM   5449 O O     . PHE C 3 646 ? 77.417  54.886 4.939   1.00 101.82 ? 646  PHE A O     1 
ATOM   5450 C CB    . PHE C 3 646 ? 79.826  55.584 6.593   1.00 103.57 ? 646  PHE A CB    1 
ATOM   5451 N N     . ARG C 3 647 ? 78.953  55.122 3.297   1.00 101.44 ? 647  ARG A N     1 
ATOM   5452 C CA    . ARG C 3 647 ? 77.995  55.457 2.254   1.00 99.52  ? 647  ARG A CA    1 
ATOM   5453 C C     . ARG C 3 647 ? 77.953  54.304 1.272   1.00 98.74  ? 647  ARG A C     1 
ATOM   5454 O O     . ARG C 3 647 ? 76.904  53.991 0.711   1.00 97.90  ? 647  ARG A O     1 
ATOM   5455 C CB    . ARG C 3 647 ? 78.424  56.729 1.522   1.00 99.37  ? 647  ARG A CB    1 
ATOM   5456 C CG    . ARG C 3 647 ? 79.568  56.541 0.542   1.00 97.85  ? 647  ARG A CG    1 
ATOM   5457 C CD    . ARG C 3 647 ? 79.911  57.853 -0.131  1.00 97.76  ? 647  ARG A CD    1 
ATOM   5458 N NE    . ARG C 3 647 ? 80.692  57.661 -1.346  1.00 98.77  ? 647  ARG A NE    1 
ATOM   5459 C CZ    . ARG C 3 647 ? 81.122  58.652 -2.121  1.00 99.44  ? 647  ARG A CZ    1 
ATOM   5460 N NH1   . ARG C 3 647 ? 80.847  59.911 -1.801  1.00 99.25  ? 647  ARG A NH1   1 
ATOM   5461 N NH2   . ARG C 3 647 ? 81.825  58.384 -3.217  1.00 99.93  ? 647  ARG A NH2   1 
ATOM   5462 N N     . GLN C 3 648 ? 79.115  53.684 1.070   1.00 98.81  ? 648  GLN A N     1 
ATOM   5463 C CA    . GLN C 3 648 ? 79.256  52.544 0.168   1.00 97.95  ? 648  GLN A CA    1 
ATOM   5464 C C     . GLN C 3 648 ? 78.404  51.403 0.726   1.00 96.13  ? 648  GLN A C     1 
ATOM   5465 O O     . GLN C 3 648 ? 78.402  50.289 0.204   1.00 96.30  ? 648  GLN A O     1 
ATOM   5466 C CB    . GLN C 3 648 ? 80.732  52.132 0.075   1.00 99.26  ? 648  GLN A CB    1 
ATOM   5467 C CG    . GLN C 3 648 ? 81.032  51.020 -0.925  1.00 101.09 ? 648  GLN A CG    1 
ATOM   5468 C CD    . GLN C 3 648 ? 82.526  50.766 -1.082  1.00 102.07 ? 648  GLN A CD    1 
ATOM   5469 O OE1   . GLN C 3 648 ? 83.267  51.629 -1.559  1.00 102.16 ? 648  GLN A OE1   1 
ATOM   5470 N NE2   . GLN C 3 648 ? 82.975  49.580 -0.677  1.00 102.10 ? 648  GLN A NE2   1 
ATOM   5471 N N     . GLN C 3 649 ? 77.684  51.710 1.800   1.00 93.33  ? 649  GLN A N     1 
ATOM   5472 C CA    . GLN C 3 649 ? 76.798  50.768 2.453   1.00 90.84  ? 649  GLN A CA    1 
ATOM   5473 C C     . GLN C 3 649 ? 75.384  51.287 2.247   1.00 88.86  ? 649  GLN A C     1 
ATOM   5474 O O     . GLN C 3 649 ? 74.439  50.509 2.127   1.00 89.61  ? 649  GLN A O     1 
ATOM   5475 C CB    . GLN C 3 649 ? 77.114  50.696 3.947   1.00 92.71  ? 649  GLN A CB    1 
ATOM   5476 C CG    . GLN C 3 649 ? 78.550  50.302 4.253   1.00 95.71  ? 649  GLN A CG    1 
ATOM   5477 C CD    . GLN C 3 649 ? 78.852  50.257 5.743   1.00 97.34  ? 649  GLN A CD    1 
ATOM   5478 O OE1   . GLN C 3 649 ? 78.615  51.227 6.470   1.00 97.70  ? 649  GLN A OE1   1 
ATOM   5479 N NE2   . GLN C 3 649 ? 79.389  49.129 6.204   1.00 97.96  ? 649  GLN A NE2   1 
ATOM   5480 N N     . VAL C 3 650 ? 75.253  52.613 2.206   1.00 86.26  ? 650  VAL A N     1 
ATOM   5481 C CA    . VAL C 3 650 ? 73.960  53.263 2.004   1.00 83.32  ? 650  VAL A CA    1 
ATOM   5482 C C     . VAL C 3 650 ? 73.517  53.032 0.566   1.00 83.39  ? 650  VAL A C     1 
ATOM   5483 O O     . VAL C 3 650 ? 72.326  52.958 0.271   1.00 82.67  ? 650  VAL A O     1 
ATOM   5484 C CB    . VAL C 3 650 ? 74.047  54.783 2.262   1.00 81.82  ? 650  VAL A CB    1 
ATOM   5485 C CG1   . VAL C 3 650 ? 72.691  55.430 2.061   1.00 80.58  ? 650  VAL A CG1   1 
ATOM   5486 C CG2   . VAL C 3 650 ? 74.540  55.039 3.670   1.00 81.92  ? 650  VAL A CG2   1 
ATOM   5487 N N     . LEU C 3 651 ? 74.495  52.909 -0.324  1.00 83.24  ? 651  LEU A N     1 
ATOM   5488 C CA    . LEU C 3 651 ? 74.229  52.672 -1.734  1.00 83.14  ? 651  LEU A CA    1 
ATOM   5489 C C     . LEU C 3 651 ? 73.811  51.230 -1.960  1.00 82.65  ? 651  LEU A C     1 
ATOM   5490 O O     . LEU C 3 651 ? 73.102  50.936 -2.922  1.00 83.62  ? 651  LEU A O     1 
ATOM   5491 C CB    . LEU C 3 651 ? 75.481  52.972 -2.573  1.00 83.74  ? 651  LEU A CB    1 
ATOM   5492 C CG    . LEU C 3 651 ? 75.439  52.869 -4.109  1.00 85.73  ? 651  LEU A CG    1 
ATOM   5493 C CD1   . LEU C 3 651 ? 76.666  53.568 -4.693  1.00 86.44  ? 651  LEU A CD1   1 
ATOM   5494 C CD2   . LEU C 3 651 ? 75.408  51.421 -4.566  1.00 86.17  ? 651  LEU A CD2   1 
ATOM   5495 N N     . GLU C 3 652 ? 74.239  50.335 -1.071  1.00 81.69  ? 652  GLU A N     1 
ATOM   5496 C CA    . GLU C 3 652 ? 73.929  48.916 -1.221  1.00 80.23  ? 652  GLU A CA    1 
ATOM   5497 C C     . GLU C 3 652 ? 72.770  48.425 -0.376  1.00 77.79  ? 652  GLU A C     1 
ATOM   5498 O O     . GLU C 3 652 ? 72.191  47.380 -0.666  1.00 78.48  ? 652  GLU A O     1 
ATOM   5499 C CB    . GLU C 3 652 ? 75.164  48.063 -0.915  1.00 82.10  ? 652  GLU A CB    1 
ATOM   5500 C CG    . GLU C 3 652 ? 75.536  48.009 0.561   1.00 84.97  ? 652  GLU A CG    1 
ATOM   5501 C CD    . GLU C 3 652 ? 76.775  47.168 0.827   1.00 85.86  ? 652  GLU A CD    1 
ATOM   5502 O OE1   . GLU C 3 652 ? 77.870  47.548 0.345   1.00 84.82  ? 652  GLU A OE1   1 
ATOM   5503 O OE2   . GLU C 3 652 ? 76.649  46.129 1.521   1.00 84.88  ? 652  GLU A OE2   1 
ATOM   5504 N N     . ASP C 3 653 ? 72.421  49.160 0.668   1.00 75.01  ? 653  ASP A N     1 
ATOM   5505 C CA    . ASP C 3 653 ? 71.317  48.718 1.495   1.00 73.39  ? 653  ASP A CA    1 
ATOM   5506 C C     . ASP C 3 653 ? 70.025  49.483 1.273   1.00 70.82  ? 653  ASP A C     1 
ATOM   5507 O O     . ASP C 3 653 ? 68.960  49.022 1.677   1.00 69.85  ? 653  ASP A O     1 
ATOM   5508 C CB    . ASP C 3 653 ? 71.691  48.783 2.969   1.00 77.13  ? 653  ASP A CB    1 
ATOM   5509 C CG    . ASP C 3 653 ? 70.560  48.310 3.871   1.00 80.89  ? 653  ASP A CG    1 
ATOM   5510 O OD1   . ASP C 3 653 ? 70.056  47.186 3.643   1.00 83.34  ? 653  ASP A OD1   1 
ATOM   5511 O OD2   . ASP C 3 653 ? 70.173  49.052 4.804   1.00 81.34  ? 653  ASP A OD2   1 
ATOM   5512 N N     . THR C 3 654 ? 70.108  50.643 0.626   1.00 69.48  ? 654  THR A N     1 
ATOM   5513 C CA    . THR C 3 654 ? 68.913  51.456 0.380   1.00 67.62  ? 654  THR A CA    1 
ATOM   5514 C C     . THR C 3 654 ? 68.652  51.770 -1.087  1.00 65.49  ? 654  THR A C     1 
ATOM   5515 O O     . THR C 3 654 ? 67.628  51.377 -1.650  1.00 64.23  ? 654  THR A O     1 
ATOM   5516 C CB    . THR C 3 654 ? 68.982  52.803 1.144   1.00 68.51  ? 654  THR A CB    1 
ATOM   5517 O OG1   . THR C 3 654 ? 70.294  52.965 1.704   1.00 71.45  ? 654  THR A OG1   1 
ATOM   5518 C CG2   . THR C 3 654 ? 67.935  52.851 2.260   1.00 67.98  ? 654  THR A CG2   1 
ATOM   5519 N N     . ILE C 3 655 ? 69.578  52.494 -1.703  1.00 63.75  ? 655  ILE A N     1 
ATOM   5520 C CA    . ILE C 3 655 ? 69.424  52.875 -3.098  1.00 62.35  ? 655  ILE A CA    1 
ATOM   5521 C C     . ILE C 3 655 ? 69.402  51.662 -4.015  1.00 61.56  ? 655  ILE A C     1 
ATOM   5522 O O     . ILE C 3 655 ? 68.444  51.456 -4.756  1.00 60.99  ? 655  ILE A O     1 
ATOM   5523 C CB    . ILE C 3 655 ? 70.556  53.823 -3.551  1.00 60.54  ? 655  ILE A CB    1 
ATOM   5524 C CG1   . ILE C 3 655 ? 70.596  55.057 -2.647  1.00 59.28  ? 655  ILE A CG1   1 
ATOM   5525 C CG2   . ILE C 3 655 ? 70.325  54.238 -4.993  1.00 57.25  ? 655  ILE A CG2   1 
ATOM   5526 C CD1   . ILE C 3 655 ? 71.795  55.956 -2.892  1.00 57.00  ? 655  ILE A CD1   1 
ATOM   5527 N N     . GLN C 3 656 ? 70.456  50.856 -3.959  1.00 61.69  ? 656  GLN A N     1 
ATOM   5528 C CA    . GLN C 3 656 ? 70.547  49.677 -4.811  1.00 62.09  ? 656  GLN A CA    1 
ATOM   5529 C C     . GLN C 3 656 ? 69.284  48.829 -4.785  1.00 61.94  ? 656  GLN A C     1 
ATOM   5530 O O     . GLN C 3 656 ? 68.661  48.614 -5.817  1.00 62.04  ? 656  GLN A O     1 
ATOM   5531 C CB    . GLN C 3 656 ? 71.750  48.825 -4.422  1.00 61.42  ? 656  GLN A CB    1 
ATOM   5532 C CG    . GLN C 3 656 ? 72.214  47.917 -5.538  1.00 62.25  ? 656  GLN A CG    1 
ATOM   5533 C CD    . GLN C 3 656 ? 72.488  48.677 -6.825  1.00 60.69  ? 656  GLN A CD    1 
ATOM   5534 O OE1   . GLN C 3 656 ? 71.564  49.100 -7.520  1.00 58.24  ? 656  GLN A OE1   1 
ATOM   5535 N NE2   . GLN C 3 656 ? 73.767  48.861 -7.143  1.00 61.07  ? 656  GLN A NE2   1 
ATOM   5536 N N     . PRO C 3 657 ? 68.891  48.330 -3.606  1.00 62.75  ? 657  PRO A N     1 
ATOM   5537 C CA    . PRO C 3 657 ? 67.678  47.514 -3.542  1.00 63.20  ? 657  PRO A CA    1 
ATOM   5538 C C     . PRO C 3 657 ? 66.446  48.247 -4.055  1.00 63.56  ? 657  PRO A C     1 
ATOM   5539 O O     . PRO C 3 657 ? 65.540  47.620 -4.587  1.00 65.24  ? 657  PRO A O     1 
ATOM   5540 C CB    . PRO C 3 657 ? 67.569  47.163 -2.064  1.00 63.30  ? 657  PRO A CB    1 
ATOM   5541 C CG    . PRO C 3 657 ? 68.260  48.303 -1.391  1.00 64.35  ? 657  PRO A CG    1 
ATOM   5542 C CD    . PRO C 3 657 ? 69.470  48.500 -2.263  1.00 63.44  ? 657  PRO A CD    1 
ATOM   5543 N N     . ALA C 3 658 ? 66.401  49.566 -3.900  1.00 63.31  ? 658  ALA A N     1 
ATOM   5544 C CA    . ALA C 3 658 ? 65.246  50.326 -4.390  1.00 62.45  ? 658  ALA A CA    1 
ATOM   5545 C C     . ALA C 3 658 ? 65.238  50.250 -5.914  1.00 62.11  ? 658  ALA A C     1 
ATOM   5546 O O     . ALA C 3 658 ? 64.221  49.925 -6.526  1.00 60.81  ? 658  ALA A O     1 
ATOM   5547 C CB    . ALA C 3 658 ? 65.320  51.780 -3.932  1.00 60.72  ? 658  ALA A CB    1 
ATOM   5548 N N     . ILE C 3 659 ? 66.389  50.546 -6.516  1.00 62.68  ? 659  ILE A N     1 
ATOM   5549 C CA    . ILE C 3 659 ? 66.547  50.497 -7.963  1.00 61.98  ? 659  ILE A CA    1 
ATOM   5550 C C     . ILE C 3 659 ? 66.187  49.103 -8.463  1.00 64.49  ? 659  ILE A C     1 
ATOM   5551 O O     . ILE C 3 659 ? 65.383  48.957 -9.389  1.00 64.84  ? 659  ILE A O     1 
ATOM   5552 C CB    . ILE C 3 659 ? 67.999  50.794 -8.375  1.00 60.36  ? 659  ILE A CB    1 
ATOM   5553 C CG1   . ILE C 3 659 ? 68.371  52.209 -7.962  1.00 56.77  ? 659  ILE A CG1   1 
ATOM   5554 C CG2   . ILE C 3 659 ? 68.179  50.610 -9.877  1.00 60.47  ? 659  ILE A CG2   1 
ATOM   5555 C CD1   . ILE C 3 659 ? 69.818  52.550 -8.218  1.00 53.28  ? 659  ILE A CD1   1 
ATOM   5556 N N     . ASP C 3 660 ? 66.774  48.082 -7.843  1.00 65.21  ? 660  ASP A N     1 
ATOM   5557 C CA    . ASP C 3 660 ? 66.522  46.704 -8.247  1.00 67.56  ? 660  ASP A CA    1 
ATOM   5558 C C     . ASP C 3 660 ? 65.058  46.281 -8.165  1.00 67.95  ? 660  ASP A C     1 
ATOM   5559 O O     . ASP C 3 660 ? 64.632  45.368 -8.873  1.00 68.94  ? 660  ASP A O     1 
ATOM   5560 C CB    . ASP C 3 660 ? 67.363  45.732 -7.413  1.00 69.70  ? 660  ASP A CB    1 
ATOM   5561 C CG    . ASP C 3 660 ? 68.840  45.811 -7.732  1.00 71.52  ? 660  ASP A CG    1 
ATOM   5562 O OD1   . ASP C 3 660 ? 69.455  46.846 -7.414  1.00 74.22  ? 660  ASP A OD1   1 
ATOM   5563 O OD2   . ASP C 3 660 ? 69.387  44.841 -8.303  1.00 73.11  ? 660  ASP A OD2   1 
ATOM   5564 N N     . SER C 3 661 ? 64.286  46.938 -7.309  1.00 68.56  ? 661  SER A N     1 
ATOM   5565 C CA    . SER C 3 661 ? 62.876  46.583 -7.147  1.00 68.98  ? 661  SER A CA    1 
ATOM   5566 C C     . SER C 3 661 ? 61.926  47.450 -7.966  1.00 68.20  ? 661  SER A C     1 
ATOM   5567 O O     . SER C 3 661 ? 60.725  47.472 -7.716  1.00 66.59  ? 661  SER A O     1 
ATOM   5568 C CB    . SER C 3 661 ? 62.480  46.643 -5.659  1.00 68.67  ? 661  SER A CB    1 
ATOM   5569 O OG    . SER C 3 661 ? 62.567  47.963 -5.139  1.00 69.67  ? 661  SER A OG    1 
ATOM   5570 N N     . GLY C 3 662 ? 62.464  48.161 -8.950  1.00 69.00  ? 662  GLY A N     1 
ATOM   5571 C CA    . GLY C 3 662 ? 61.618  49.007 -9.769  1.00 69.49  ? 662  GLY A CA    1 
ATOM   5572 C C     . GLY C 3 662 ? 61.708  50.463 -9.373  1.00 68.57  ? 662  GLY A C     1 
ATOM   5573 O O     . GLY C 3 662 ? 61.870  51.323 -10.231 1.00 70.85  ? 662  GLY A O     1 
ATOM   5574 N N     . LYS C 3 663 ? 61.597  50.748 -8.079  1.00 67.61  ? 663  LYS A N     1 
ATOM   5575 C CA    . LYS C 3 663 ? 61.694  52.123 -7.600  1.00 66.18  ? 663  LYS A CA    1 
ATOM   5576 C C     . LYS C 3 663 ? 63.137  52.636 -7.753  1.00 64.79  ? 663  LYS A C     1 
ATOM   5577 O O     . LYS C 3 663 ? 63.953  52.052 -8.486  1.00 63.85  ? 663  LYS A O     1 
ATOM   5578 C CB    . LYS C 3 663 ? 61.278  52.208 -6.128  1.00 68.18  ? 663  LYS A CB    1 
ATOM   5579 C CG    . LYS C 3 663 ? 61.221  53.647 -5.577  1.00 69.88  ? 663  LYS A CG    1 
ATOM   5580 C CD    . LYS C 3 663 ? 60.947  53.668 -4.077  1.00 70.86  ? 663  LYS A CD    1 
ATOM   5581 C CE    . LYS C 3 663 ? 60.659  55.076 -3.568  1.00 69.22  ? 663  LYS A CE    1 
ATOM   5582 N NZ    . LYS C 3 663 ? 59.401  55.653 -4.135  1.00 68.74  ? 663  LYS A NZ    1 
ATOM   5583 N N     . GLY C 3 664 ? 63.443  53.726 -7.058  1.00 60.30  ? 664  GLY A N     1 
ATOM   5584 C CA    . GLY C 3 664 ? 64.775  54.291 -7.125  1.00 57.29  ? 664  GLY A CA    1 
ATOM   5585 C C     . GLY C 3 664 ? 65.044  55.113 -8.370  1.00 55.40  ? 664  GLY A C     1 
ATOM   5586 O O     . GLY C 3 664 ? 66.193  55.454 -8.639  1.00 55.12  ? 664  GLY A O     1 
ATOM   5587 N N     . LEU C 3 665 ? 63.996  55.428 -9.130  1.00 53.21  ? 665  LEU A N     1 
ATOM   5588 C CA    . LEU C 3 665 ? 64.162  56.215 -10.342 1.00 50.19  ? 665  LEU A CA    1 
ATOM   5589 C C     . LEU C 3 665 ? 64.544  57.657 -10.029 1.00 49.19  ? 665  LEU A C     1 
ATOM   5590 O O     . LEU C 3 665 ? 65.013  58.391 -10.892 1.00 48.98  ? 665  LEU A O     1 
ATOM   5591 C CB    . LEU C 3 665 ? 62.893  56.167 -11.194 1.00 50.80  ? 665  LEU A CB    1 
ATOM   5592 C CG    . LEU C 3 665 ? 62.566  54.811 -11.836 1.00 54.04  ? 665  LEU A CG    1 
ATOM   5593 C CD1   . LEU C 3 665 ? 61.422  54.975 -12.825 1.00 51.00  ? 665  LEU A CD1   1 
ATOM   5594 C CD2   . LEU C 3 665 ? 63.792  54.270 -12.570 1.00 53.04  ? 665  LEU A CD2   1 
ATOM   5595 N N     . MET C 3 666 ? 64.352  58.075 -8.789  1.00 46.61  ? 666  MET A N     1 
ATOM   5596 C CA    . MET C 3 666 ? 64.736  59.430 -8.430  1.00 45.94  ? 666  MET A CA    1 
ATOM   5597 C C     . MET C 3 666 ? 66.269  59.543 -8.271  1.00 47.44  ? 666  MET A C     1 
ATOM   5598 O O     . MET C 3 666 ? 66.815  60.654 -8.233  1.00 44.03  ? 666  MET A O     1 
ATOM   5599 C CB    . MET C 3 666 ? 64.038  59.862 -7.137  1.00 44.15  ? 666  MET A CB    1 
ATOM   5600 C CG    . MET C 3 666 ? 64.426  59.076 -5.891  1.00 45.14  ? 666  MET A CG    1 
ATOM   5601 S SD    . MET C 3 666 ? 63.896  57.335 -5.858  1.00 48.67  ? 666  MET A SD    1 
ATOM   5602 C CE    . MET C 3 666 ? 62.101  57.506 -5.623  1.00 42.37  ? 666  MET A CE    1 
ATOM   5603 N N     . PHE C 3 667 ? 66.957  58.399 -8.190  1.00 46.89  ? 667  PHE A N     1 
ATOM   5604 C CA    . PHE C 3 667 ? 68.413  58.406 -8.031  1.00 46.77  ? 667  PHE A CA    1 
ATOM   5605 C C     . PHE C 3 667 ? 69.095  58.289 -9.382  1.00 48.57  ? 667  PHE A C     1 
ATOM   5606 O O     . PHE C 3 667 ? 69.531  57.211 -9.792  1.00 48.49  ? 667  PHE A O     1 
ATOM   5607 C CB    . PHE C 3 667 ? 68.896  57.262 -7.105  1.00 42.66  ? 667  PHE A CB    1 
ATOM   5608 C CG    . PHE C 3 667 ? 68.323  57.320 -5.702  1.00 41.14  ? 667  PHE A CG    1 
ATOM   5609 C CD1   . PHE C 3 667 ? 68.438  58.480 -4.926  1.00 37.23  ? 667  PHE A CD1   1 
ATOM   5610 C CD2   . PHE C 3 667 ? 67.626  56.228 -5.171  1.00 41.21  ? 667  PHE A CD2   1 
ATOM   5611 C CE1   . PHE C 3 667 ? 67.867  58.553 -3.660  1.00 32.13  ? 667  PHE A CE1   1 
ATOM   5612 C CE2   . PHE C 3 667 ? 67.052  56.295 -3.899  1.00 38.29  ? 667  PHE A CE2   1 
ATOM   5613 C CZ    . PHE C 3 667 ? 67.175  57.463 -3.149  1.00 37.09  ? 667  PHE A CZ    1 
ATOM   5614 N N     . THR C 3 668 ? 69.178  59.415 -10.074 1.00 51.42  ? 668  THR A N     1 
ATOM   5615 C CA    . THR C 3 668 ? 69.822  59.476 -11.383 1.00 54.78  ? 668  THR A CA    1 
ATOM   5616 C C     . THR C 3 668 ? 71.323  59.122 -11.261 1.00 56.68  ? 668  THR A C     1 
ATOM   5617 O O     . THR C 3 668 ? 71.869  58.418 -12.115 1.00 57.32  ? 668  THR A O     1 
ATOM   5618 C CB    . THR C 3 668 ? 69.658  60.888 -11.991 1.00 54.41  ? 668  THR A CB    1 
ATOM   5619 O OG1   . THR C 3 668 ? 70.279  61.851 -11.136 1.00 53.58  ? 668  THR A OG1   1 
ATOM   5620 C CG2   . THR C 3 668 ? 68.179  61.242 -12.118 1.00 54.14  ? 668  THR A CG2   1 
ATOM   5621 N N     . GLN C 3 669 ? 71.971  59.619 -10.204 1.00 56.91  ? 669  GLN A N     1 
ATOM   5622 C CA    . GLN C 3 669 ? 73.389  59.346 -9.922  1.00 56.87  ? 669  GLN A CA    1 
ATOM   5623 C C     . GLN C 3 669 ? 73.444  58.641 -8.567  1.00 57.26  ? 669  GLN A C     1 
ATOM   5624 O O     . GLN C 3 669 ? 73.822  59.227 -7.549  1.00 54.62  ? 669  GLN A O     1 
ATOM   5625 C CB    . GLN C 3 669 ? 74.196  60.646 -9.854  1.00 58.53  ? 669  GLN A CB    1 
ATOM   5626 C CG    . GLN C 3 669 ? 74.143  61.470 -11.124 1.00 63.58  ? 669  GLN A CG    1 
ATOM   5627 C CD    . GLN C 3 669 ? 74.690  60.729 -12.332 1.00 65.97  ? 669  GLN A CD    1 
ATOM   5628 O OE1   . GLN C 3 669 ? 74.508  61.160 -13.473 1.00 65.47  ? 669  GLN A OE1   1 
ATOM   5629 N NE2   . GLN C 3 669 ? 75.373  59.614 -12.085 1.00 67.60  ? 669  GLN A NE2   1 
ATOM   5630 N N     . PRO C 3 670 ? 73.068  57.356 -8.548  1.00 56.97  ? 670  PRO A N     1 
ATOM   5631 C CA    . PRO C 3 670 ? 73.045  56.526 -7.339  1.00 55.99  ? 670  PRO A CA    1 
ATOM   5632 C C     . PRO C 3 670 ? 74.205  56.675 -6.388  1.00 55.49  ? 670  PRO A C     1 
ATOM   5633 O O     . PRO C 3 670 ? 74.010  56.632 -5.180  1.00 57.21  ? 670  PRO A O     1 
ATOM   5634 C CB    . PRO C 3 670 ? 72.908  55.100 -7.887  1.00 55.08  ? 670  PRO A CB    1 
ATOM   5635 C CG    . PRO C 3 670 ? 73.372  55.211 -9.314  1.00 56.87  ? 670  PRO A CG    1 
ATOM   5636 C CD    . PRO C 3 670 ? 72.824  56.536 -9.746  1.00 55.66  ? 670  PRO A CD    1 
ATOM   5637 N N     . ASN C 3 671 ? 75.407  56.867 -6.914  1.00 56.36  ? 671  ASN A N     1 
ATOM   5638 C CA    . ASN C 3 671 ? 76.577  56.994 -6.049  1.00 56.42  ? 671  ASN A CA    1 
ATOM   5639 C C     . ASN C 3 671 ? 76.598  58.320 -5.289  1.00 53.20  ? 671  ASN A C     1 
ATOM   5640 O O     . ASN C 3 671 ? 76.833  58.357 -4.092  1.00 51.03  ? 671  ASN A O     1 
ATOM   5641 C CB    . ASN C 3 671 ? 77.856  56.831 -6.874  1.00 62.28  ? 671  ASN A CB    1 
ATOM   5642 C CG    . ASN C 3 671 ? 79.104  56.786 -6.012  1.00 68.49  ? 671  ASN A CG    1 
ATOM   5643 O OD1   . ASN C 3 671 ? 80.226  56.795 -6.522  1.00 72.64  ? 671  ASN A OD1   1 
ATOM   5644 N ND2   . ASN C 3 671 ? 78.917  56.735 -4.696  1.00 71.43  ? 671  ASN A ND2   1 
ATOM   5645 N N     . GLN C 3 672 ? 76.348  59.414 -5.989  1.00 52.94  ? 672  GLN A N     1 
ATOM   5646 C CA    . GLN C 3 672 ? 76.324  60.731 -5.348  1.00 52.43  ? 672  GLN A CA    1 
ATOM   5647 C C     . GLN C 3 672 ? 75.185  60.855 -4.319  1.00 51.23  ? 672  GLN A C     1 
ATOM   5648 O O     . GLN C 3 672 ? 75.309  61.560 -3.307  1.00 50.33  ? 672  GLN A O     1 
ATOM   5649 C CB    . GLN C 3 672 ? 76.179  61.812 -6.415  1.00 51.64  ? 672  GLN A CB    1 
ATOM   5650 C CG    . GLN C 3 672 ? 77.345  61.870 -7.386  1.00 50.77  ? 672  GLN A CG    1 
ATOM   5651 C CD    . GLN C 3 672 ? 77.111  62.855 -8.515  1.00 54.46  ? 672  GLN A CD    1 
ATOM   5652 O OE1   . GLN C 3 672 ? 76.685  64.003 -8.285  1.00 51.70  ? 672  GLN A OE1   1 
ATOM   5653 N NE2   . GLN C 3 672 ? 77.384  62.416 -9.750  1.00 55.02  ? 672  GLN A NE2   1 
ATOM   5654 N N     . ALA C 3 673 ? 74.075  60.168 -4.573  1.00 47.92  ? 673  ALA A N     1 
ATOM   5655 C CA    . ALA C 3 673 ? 72.957  60.227 -3.647  1.00 47.93  ? 673  ALA A CA    1 
ATOM   5656 C C     . ALA C 3 673 ? 73.384  59.591 -2.341  1.00 46.57  ? 673  ALA A C     1 
ATOM   5657 O O     . ALA C 3 673 ? 73.135  60.136 -1.272  1.00 47.23  ? 673  ALA A O     1 
ATOM   5658 C CB    . ALA C 3 673 ? 71.752  59.492 -4.219  1.00 48.11  ? 673  ALA A CB    1 
ATOM   5659 N N     . ALA C 3 674 ? 74.035  58.437 -2.440  1.00 44.96  ? 674  ALA A N     1 
ATOM   5660 C CA    . ALA C 3 674 ? 74.512  57.711 -1.258  1.00 46.39  ? 674  ALA A CA    1 
ATOM   5661 C C     . ALA C 3 674 ? 75.561  58.532 -0.513  1.00 47.43  ? 674  ALA A C     1 
ATOM   5662 O O     . ALA C 3 674 ? 75.537  58.638 0.718   1.00 48.00  ? 674  ALA A O     1 
ATOM   5663 C CB    . ALA C 3 674 ? 75.102  56.369 -1.673  1.00 47.09  ? 674  ALA A CB    1 
ATOM   5664 N N     . GLY C 3 675 ? 76.478  59.125 -1.270  1.00 45.24  ? 675  GLY A N     1 
ATOM   5665 C CA    . GLY C 3 675 ? 77.498  59.936 -0.649  1.00 46.49  ? 675  GLY A CA    1 
ATOM   5666 C C     . GLY C 3 675 ? 76.880  61.086 0.116   1.00 48.04  ? 675  GLY A C     1 
ATOM   5667 O O     . GLY C 3 675 ? 77.305  61.424 1.225   1.00 49.09  ? 675  GLY A O     1 
ATOM   5668 N N     . TYR C 3 676 ? 75.855  61.685 -0.475  1.00 49.17  ? 676  TYR A N     1 
ATOM   5669 C CA    . TYR C 3 676 ? 75.180  62.822 0.134   1.00 49.15  ? 676  TYR A CA    1 
ATOM   5670 C C     . TYR C 3 676 ? 74.420  62.482 1.426   1.00 49.91  ? 676  TYR A C     1 
ATOM   5671 O O     . TYR C 3 676 ? 74.450  63.250 2.387   1.00 51.69  ? 676  TYR A O     1 
ATOM   5672 C CB    . TYR C 3 676 ? 74.239  63.452 -0.897  1.00 46.80  ? 676  TYR A CB    1 
ATOM   5673 C CG    . TYR C 3 676 ? 73.314  64.489 -0.325  1.00 44.59  ? 676  TYR A CG    1 
ATOM   5674 C CD1   . TYR C 3 676 ? 73.783  65.752 0.048   1.00 43.53  ? 676  TYR A CD1   1 
ATOM   5675 C CD2   . TYR C 3 676 ? 71.957  64.207 -0.146  1.00 44.85  ? 676  TYR A CD2   1 
ATOM   5676 C CE1   . TYR C 3 676 ? 72.921  66.701 0.584   1.00 45.01  ? 676  TYR A CE1   1 
ATOM   5677 C CE2   . TYR C 3 676 ? 71.092  65.152 0.385   1.00 44.82  ? 676  TYR A CE2   1 
ATOM   5678 C CZ    . TYR C 3 676 ? 71.571  66.389 0.747   1.00 45.15  ? 676  TYR A CZ    1 
ATOM   5679 O OH    . TYR C 3 676 ? 70.692  67.314 1.268   1.00 46.66  ? 676  TYR A OH    1 
ATOM   5680 N N     . MET C 3 677 ? 73.752  61.335 1.463   1.00 49.71  ? 677  MET A N     1 
ATOM   5681 C CA    . MET C 3 677 ? 72.989  60.953 2.656   1.00 49.37  ? 677  MET A CA    1 
ATOM   5682 C C     . MET C 3 677 ? 73.856  60.518 3.830   1.00 49.88  ? 677  MET A C     1 
ATOM   5683 O O     . MET C 3 677 ? 73.478  60.694 4.991   1.00 50.28  ? 677  MET A O     1 
ATOM   5684 C CB    . MET C 3 677 ? 72.003  59.828 2.316   1.00 47.92  ? 677  MET A CB    1 
ATOM   5685 C CG    . MET C 3 677 ? 71.202  59.293 3.496   1.00 45.62  ? 677  MET A CG    1 
ATOM   5686 S SD    . MET C 3 677 ? 70.200  60.522 4.377   1.00 46.22  ? 677  MET A SD    1 
ATOM   5687 C CE    . MET C 3 677 ? 69.176  61.188 3.028   1.00 49.65  ? 677  MET A CE    1 
ATOM   5688 N N     . ALA C 3 678 ? 75.005  59.922 3.539   1.00 51.03  ? 678  ALA A N     1 
ATOM   5689 C CA    . ALA C 3 678 ? 75.892  59.487 4.613   1.00 52.30  ? 678  ALA A CA    1 
ATOM   5690 C C     . ALA C 3 678 ? 76.270  60.704 5.451   1.00 52.48  ? 678  ALA A C     1 
ATOM   5691 O O     . ALA C 3 678 ? 76.203  60.674 6.682   1.00 56.70  ? 678  ALA A O     1 
ATOM   5692 C CB    . ALA C 3 678 ? 77.137  58.834 4.038   1.00 53.26  ? 678  ALA A CB    1 
ATOM   5693 N N     . LYS C 3 679 ? 76.642  61.782 4.769   1.00 51.41  ? 679  LYS A N     1 
ATOM   5694 C CA    . LYS C 3 679 ? 77.027  63.019 5.428   1.00 50.53  ? 679  LYS A CA    1 
ATOM   5695 C C     . LYS C 3 679 ? 75.877  63.605 6.240   1.00 48.86  ? 679  LYS A C     1 
ATOM   5696 O O     . LYS C 3 679 ? 76.097  64.191 7.289   1.00 49.12  ? 679  LYS A O     1 
ATOM   5697 C CB    . LYS C 3 679 ? 77.525  64.028 4.378   1.00 53.42  ? 679  LYS A CB    1 
ATOM   5698 C CG    . LYS C 3 679 ? 77.945  65.392 4.921   1.00 56.84  ? 679  LYS A CG    1 
ATOM   5699 C CD    . LYS C 3 679 ? 78.710  66.177 3.848   1.00 62.62  ? 679  LYS A CD    1 
ATOM   5700 C CE    . LYS C 3 679 ? 79.378  67.434 4.417   1.00 63.51  ? 679  LYS A CE    1 
ATOM   5701 N NZ    . LYS C 3 679 ? 80.343  68.066 3.459   1.00 61.07  ? 679  LYS A NZ    1 
ATOM   5702 N N     . LEU C 3 680 ? 74.646  63.465 5.760   1.00 48.41  ? 680  LEU A N     1 
ATOM   5703 C CA    . LEU C 3 680 ? 73.512  64.002 6.500   1.00 46.44  ? 680  LEU A CA    1 
ATOM   5704 C C     . LEU C 3 680 ? 73.250  63.193 7.754   1.00 45.47  ? 680  LEU A C     1 
ATOM   5705 O O     . LEU C 3 680 ? 73.023  63.753 8.826   1.00 43.96  ? 680  LEU A O     1 
ATOM   5706 C CB    . LEU C 3 680 ? 72.249  64.030 5.637   1.00 46.62  ? 680  LEU A CB    1 
ATOM   5707 C CG    . LEU C 3 680 ? 71.779  65.444 5.277   1.00 45.79  ? 680  LEU A CG    1 
ATOM   5708 C CD1   . LEU C 3 680 ? 72.813  66.063 4.340   1.00 47.75  ? 680  LEU A CD1   1 
ATOM   5709 C CD2   . LEU C 3 680 ? 70.412  65.407 4.624   1.00 43.07  ? 680  LEU A CD2   1 
ATOM   5710 N N     . ILE C 3 681 ? 73.285  61.871 7.628   1.00 46.30  ? 681  ILE A N     1 
ATOM   5711 C CA    . ILE C 3 681 ? 73.051  61.014 8.790   1.00 46.83  ? 681  ILE A CA    1 
ATOM   5712 C C     . ILE C 3 681 ? 74.145  61.227 9.826   1.00 50.07  ? 681  ILE A C     1 
ATOM   5713 O O     . ILE C 3 681 ? 73.844  61.443 11.014  1.00 51.15  ? 681  ILE A O     1 
ATOM   5714 C CB    . ILE C 3 681 ? 73.015  59.547 8.397   1.00 44.78  ? 681  ILE A CB    1 
ATOM   5715 C CG1   . ILE C 3 681 ? 71.847  59.324 7.419   1.00 43.46  ? 681  ILE A CG1   1 
ATOM   5716 C CG2   . ILE C 3 681 ? 72.919  58.686 9.648   1.00 39.33  ? 681  ILE A CG2   1 
ATOM   5717 C CD1   . ILE C 3 681 ? 71.868  58.000 6.700   1.00 39.33  ? 681  ILE A CD1   1 
ATOM   5718 N N     . TRP C 3 682 ? 75.407  61.189 9.382   1.00 49.65  ? 682  TRP A N     1 
ATOM   5719 C CA    . TRP C 3 682 ? 76.522  61.392 10.302  1.00 52.18  ? 682  TRP A CA    1 
ATOM   5720 C C     . TRP C 3 682 ? 76.479  62.783 10.928  1.00 50.02  ? 682  TRP A C     1 
ATOM   5721 O O     . TRP C 3 682 ? 76.817  62.969 12.101  1.00 50.13  ? 682  TRP A O     1 
ATOM   5722 C CB    . TRP C 3 682 ? 77.875  61.183 9.599   1.00 55.70  ? 682  TRP A CB    1 
ATOM   5723 C CG    . TRP C 3 682 ? 79.042  61.587 10.476  1.00 60.83  ? 682  TRP A CG    1 
ATOM   5724 C CD1   . TRP C 3 682 ? 79.855  62.679 10.312  1.00 61.79  ? 682  TRP A CD1   1 
ATOM   5725 C CD2   . TRP C 3 682 ? 79.458  60.960 11.708  1.00 62.99  ? 682  TRP A CD2   1 
ATOM   5726 N NE1   . TRP C 3 682 ? 80.744  62.773 11.364  1.00 63.92  ? 682  TRP A NE1   1 
ATOM   5727 C CE2   . TRP C 3 682 ? 80.523  61.735 12.233  1.00 63.64  ? 682  TRP A CE2   1 
ATOM   5728 C CE3   . TRP C 3 682 ? 79.030  59.826 12.419  1.00 61.73  ? 682  TRP A CE3   1 
ATOM   5729 C CZ2   . TRP C 3 682 ? 81.164  61.411 13.434  1.00 62.67  ? 682  TRP A CZ2   1 
ATOM   5730 C CZ3   . TRP C 3 682 ? 79.670  59.506 13.616  1.00 62.44  ? 682  TRP A CZ3   1 
ATOM   5731 C CH2   . TRP C 3 682 ? 80.726  60.298 14.109  1.00 62.03  ? 682  TRP A CH2   1 
ATOM   5732 N N     . GLU C 3 683 ? 76.064  63.759 10.136  1.00 50.25  ? 683  GLU A N     1 
ATOM   5733 C CA    . GLU C 3 683 ? 75.958  65.134 10.599  1.00 50.20  ? 683  GLU A CA    1 
ATOM   5734 C C     . GLU C 3 683 ? 74.777  65.226 11.579  1.00 49.87  ? 683  GLU A C     1 
ATOM   5735 O O     . GLU C 3 683 ? 74.812  65.996 12.533  1.00 50.07  ? 683  GLU A O     1 
ATOM   5736 C CB    . GLU C 3 683 ? 75.756  66.036 9.384   1.00 53.81  ? 683  GLU A CB    1 
ATOM   5737 C CG    . GLU C 3 683 ? 75.698  67.538 9.618   1.00 62.33  ? 683  GLU A CG    1 
ATOM   5738 C CD    . GLU C 3 683 ? 75.374  68.295 8.312   1.00 67.14  ? 683  GLU A CD    1 
ATOM   5739 O OE1   . GLU C 3 683 ? 76.174  68.199 7.345   1.00 68.33  ? 683  GLU A OE1   1 
ATOM   5740 O OE2   . GLU C 3 683 ? 74.316  68.969 8.247   1.00 66.28  ? 683  GLU A OE2   1 
ATOM   5741 N N     . SER C 3 684 ? 73.737  64.423 11.361  1.00 49.73  ? 684  SER A N     1 
ATOM   5742 C CA    . SER C 3 684 ? 72.579  64.439 12.258  1.00 49.47  ? 684  SER A CA    1 
ATOM   5743 C C     . SER C 3 684 ? 72.907  63.826 13.602  1.00 50.85  ? 684  SER A C     1 
ATOM   5744 O O     . SER C 3 684 ? 72.610  64.415 14.647  1.00 51.33  ? 684  SER A O     1 
ATOM   5745 C CB    . SER C 3 684 ? 71.398  63.679 11.656  1.00 48.02  ? 684  SER A CB    1 
ATOM   5746 O OG    . SER C 3 684 ? 70.813  64.411 10.597  1.00 48.80  ? 684  SER A OG    1 
ATOM   5747 N N     . VAL C 3 685 ? 73.512  62.640 13.575  1.00 47.76  ? 685  VAL A N     1 
ATOM   5748 C CA    . VAL C 3 685 ? 73.867  61.968 14.809  1.00 48.84  ? 685  VAL A CA    1 
ATOM   5749 C C     . VAL C 3 685 ? 74.897  62.787 15.583  1.00 49.13  ? 685  VAL A C     1 
ATOM   5750 O O     . VAL C 3 685 ? 74.865  62.834 16.805  1.00 48.58  ? 685  VAL A O     1 
ATOM   5751 C CB    . VAL C 3 685 ? 74.437  60.540 14.553  1.00 49.81  ? 685  VAL A CB    1 
ATOM   5752 C CG1   . VAL C 3 685 ? 73.433  59.704 13.798  1.00 50.85  ? 685  VAL A CG1   1 
ATOM   5753 C CG2   . VAL C 3 685 ? 75.723  60.618 13.783  1.00 53.01  ? 685  VAL A CG2   1 
ATOM   5754 N N     . SER C 3 686 ? 75.803  63.448 14.878  1.00 48.89  ? 686  SER A N     1 
ATOM   5755 C CA    . SER C 3 686 ? 76.827  64.234 15.553  1.00 52.86  ? 686  SER A CA    1 
ATOM   5756 C C     . SER C 3 686 ? 76.307  65.335 16.466  1.00 53.57  ? 686  SER A C     1 
ATOM   5757 O O     . SER C 3 686 ? 76.988  65.707 17.421  1.00 54.28  ? 686  SER A O     1 
ATOM   5758 C CB    . SER C 3 686 ? 77.795  64.834 14.535  1.00 51.86  ? 686  SER A CB    1 
ATOM   5759 O OG    . SER C 3 686 ? 78.568  63.805 13.955  1.00 56.05  ? 686  SER A OG    1 
ATOM   5760 N N     . VAL C 3 687 ? 75.116  65.859 16.178  1.00 54.95  ? 687  VAL A N     1 
ATOM   5761 C CA    . VAL C 3 687 ? 74.537  66.924 17.002  1.00 55.61  ? 687  VAL A CA    1 
ATOM   5762 C C     . VAL C 3 687 ? 73.444  66.390 17.921  1.00 56.39  ? 687  VAL A C     1 
ATOM   5763 O O     . VAL C 3 687 ? 72.946  67.105 18.787  1.00 55.93  ? 687  VAL A O     1 
ATOM   5764 C CB    . VAL C 3 687 ? 73.948  68.068 16.130  1.00 57.93  ? 687  VAL A CB    1 
ATOM   5765 C CG1   . VAL C 3 687 ? 74.994  68.533 15.099  1.00 59.08  ? 687  VAL A CG1   1 
ATOM   5766 C CG2   . VAL C 3 687 ? 72.665  67.609 15.437  1.00 57.95  ? 687  VAL A CG2   1 
ATOM   5767 N N     . THR C 3 688 ? 73.081  65.123 17.724  1.00 56.05  ? 688  THR A N     1 
ATOM   5768 C CA    . THR C 3 688 ? 72.059  64.461 18.528  1.00 53.17  ? 688  THR A CA    1 
ATOM   5769 C C     . THR C 3 688 ? 72.734  63.832 19.745  1.00 52.10  ? 688  THR A C     1 
ATOM   5770 O O     . THR C 3 688 ? 72.222  63.907 20.856  1.00 53.76  ? 688  THR A O     1 
ATOM   5771 C CB    . THR C 3 688 ? 71.366  63.335 17.735  1.00 54.90  ? 688  THR A CB    1 
ATOM   5772 O OG1   . THR C 3 688 ? 70.905  63.840 16.480  1.00 56.12  ? 688  THR A OG1   1 
ATOM   5773 C CG2   . THR C 3 688 ? 70.181  62.780 18.518  1.00 54.94  ? 688  THR A CG2   1 
ATOM   5774 N N     . VAL C 3 689 ? 73.882  63.200 19.527  1.00 48.81  ? 689  VAL A N     1 
ATOM   5775 C CA    . VAL C 3 689 ? 74.626  62.566 20.608  1.00 47.28  ? 689  VAL A CA    1 
ATOM   5776 C C     . VAL C 3 689 ? 76.066  63.080 20.642  1.00 49.05  ? 689  VAL A C     1 
ATOM   5777 O O     . VAL C 3 689 ? 77.040  62.313 20.598  1.00 47.63  ? 689  VAL A O     1 
ATOM   5778 C CB    . VAL C 3 689 ? 74.595  61.029 20.465  1.00 46.49  ? 689  VAL A CB    1 
ATOM   5779 C CG1   . VAL C 3 689 ? 73.173  60.544 20.613  1.00 44.08  ? 689  VAL A CG1   1 
ATOM   5780 C CG2   . VAL C 3 689 ? 75.143  60.602 19.128  1.00 42.43  ? 689  VAL A CG2   1 
ATOM   5781 N N     . VAL C 3 690 ? 76.168  64.406 20.715  1.00 51.69  ? 690  VAL A N     1 
ATOM   5782 C CA    . VAL C 3 690 ? 77.431  65.127 20.753  1.00 54.16  ? 690  VAL A CA    1 
ATOM   5783 C C     . VAL C 3 690 ? 78.435  64.505 21.718  1.00 56.39  ? 690  VAL A C     1 
ATOM   5784 O O     . VAL C 3 690 ? 79.512  64.049 21.306  1.00 57.25  ? 690  VAL A O     1 
ATOM   5785 C CB    . VAL C 3 690 ? 77.212  66.602 21.174  1.00 53.99  ? 690  VAL A CB    1 
ATOM   5786 C CG1   . VAL C 3 690 ? 78.549  67.333 21.251  1.00 51.85  ? 690  VAL A CG1   1 
ATOM   5787 C CG2   . VAL C 3 690 ? 76.293  67.290 20.189  1.00 56.06  ? 690  VAL A CG2   1 
ATOM   5788 N N     . ALA C 3 691 ? 78.078  64.494 22.999  1.00 56.02  ? 691  ALA A N     1 
ATOM   5789 C CA    . ALA C 3 691 ? 78.954  63.948 24.026  1.00 56.62  ? 691  ALA A CA    1 
ATOM   5790 C C     . ALA C 3 691 ? 79.478  62.530 23.730  1.00 56.00  ? 691  ALA A C     1 
ATOM   5791 O O     . ALA C 3 691 ? 80.620  62.208 24.077  1.00 55.94  ? 691  ALA A O     1 
ATOM   5792 C CB    . ALA C 3 691 ? 78.241  63.985 25.370  1.00 58.44  ? 691  ALA A CB    1 
ATOM   5793 N N     . ALA C 3 692 ? 78.663  61.695 23.082  1.00 54.67  ? 692  ALA A N     1 
ATOM   5794 C CA    . ALA C 3 692 ? 79.066  60.316 22.750  1.00 52.85  ? 692  ALA A CA    1 
ATOM   5795 C C     . ALA C 3 692 ? 80.108  60.253 21.627  1.00 52.33  ? 692  ALA A C     1 
ATOM   5796 O O     . ALA C 3 692 ? 81.081  59.514 21.714  1.00 52.60  ? 692  ALA A O     1 
ATOM   5797 C CB    . ALA C 3 692 ? 77.853  59.495 22.365  1.00 51.83  ? 692  ALA A CB    1 
ATOM   5798 N N     . VAL C 3 693 ? 79.903  61.026 20.567  1.00 52.57  ? 693  VAL A N     1 
ATOM   5799 C CA    . VAL C 3 693 ? 80.850  61.044 19.455  1.00 50.66  ? 693  VAL A CA    1 
ATOM   5800 C C     . VAL C 3 693 ? 82.233  61.495 19.913  1.00 51.83  ? 693  VAL A C     1 
ATOM   5801 O O     . VAL C 3 693 ? 83.248  60.925 19.489  1.00 51.92  ? 693  VAL A O     1 
ATOM   5802 C CB    . VAL C 3 693 ? 80.384  61.989 18.331  1.00 48.93  ? 693  VAL A CB    1 
ATOM   5803 C CG1   . VAL C 3 693 ? 81.539  62.262 17.364  1.00 45.84  ? 693  VAL A CG1   1 
ATOM   5804 C CG2   . VAL C 3 693 ? 79.191  61.377 17.601  1.00 48.59  ? 693  VAL A CG2   1 
ATOM   5805 N N     . GLU C 3 694 ? 82.279  62.506 20.780  1.00 52.53  ? 694  GLU A N     1 
ATOM   5806 C CA    . GLU C 3 694 ? 83.564  63.001 21.248  1.00 55.95  ? 694  GLU A CA    1 
ATOM   5807 C C     . GLU C 3 694 ? 84.296  61.921 22.030  1.00 55.35  ? 694  GLU A C     1 
ATOM   5808 O O     . GLU C 3 694 ? 85.521  61.836 21.980  1.00 54.96  ? 694  GLU A O     1 
ATOM   5809 C CB    . GLU C 3 694 ? 83.399  64.253 22.115  1.00 58.35  ? 694  GLU A CB    1 
ATOM   5810 C CG    . GLU C 3 694 ? 84.693  65.085 22.173  1.00 63.63  ? 694  GLU A CG    1 
ATOM   5811 C CD    . GLU C 3 694 ? 84.747  66.047 23.350  1.00 66.46  ? 694  GLU A CD    1 
ATOM   5812 O OE1   . GLU C 3 694 ? 83.757  66.783 23.552  1.00 67.61  ? 694  GLU A OE1   1 
ATOM   5813 O OE2   . GLU C 3 694 ? 85.780  66.069 24.063  1.00 63.80  ? 694  GLU A OE2   1 
ATOM   5814 N N     . ALA C 3 695 ? 83.537  61.090 22.741  1.00 56.00  ? 695  ALA A N     1 
ATOM   5815 C CA    . ALA C 3 695 ? 84.109  59.992 23.517  1.00 54.72  ? 695  ALA A CA    1 
ATOM   5816 C C     . ALA C 3 695 ? 84.662  58.890 22.596  1.00 54.35  ? 695  ALA A C     1 
ATOM   5817 O O     . ALA C 3 695 ? 85.646  58.218 22.926  1.00 51.68  ? 695  ALA A O     1 
ATOM   5818 C CB    . ALA C 3 695 ? 83.064  59.415 24.450  1.00 53.96  ? 695  ALA A CB    1 
ATOM   5819 N N     . MET C 3 696 ? 84.017  58.696 21.451  1.00 53.44  ? 696  MET A N     1 
ATOM   5820 C CA    . MET C 3 696 ? 84.479  57.707 20.497  1.00 53.58  ? 696  MET A CA    1 
ATOM   5821 C C     . MET C 3 696 ? 85.795  58.177 19.908  1.00 51.35  ? 696  MET A C     1 
ATOM   5822 O O     . MET C 3 696 ? 86.748  57.411 19.810  1.00 51.04  ? 696  MET A O     1 
ATOM   5823 C CB    . MET C 3 696 ? 83.450  57.511 19.387  1.00 56.36  ? 696  MET A CB    1 
ATOM   5824 C CG    . MET C 3 696 ? 82.222  56.761 19.868  1.00 64.84  ? 696  MET A CG    1 
ATOM   5825 S SD    . MET C 3 696 ? 80.945  56.493 18.603  1.00 72.74  ? 696  MET A SD    1 
ATOM   5826 C CE    . MET C 3 696 ? 79.491  57.277 19.401  1.00 70.22  ? 696  MET A CE    1 
ATOM   5827 N N     . ASN C 3 697 ? 85.851  59.447 19.525  1.00 50.38  ? 697  ASN A N     1 
ATOM   5828 C CA    . ASN C 3 697 ? 87.074  59.994 18.949  1.00 48.62  ? 697  ASN A CA    1 
ATOM   5829 C C     . ASN C 3 697 ? 88.220  59.937 19.952  1.00 47.85  ? 697  ASN A C     1 
ATOM   5830 O O     . ASN C 3 697 ? 89.366  59.657 19.601  1.00 48.78  ? 697  ASN A O     1 
ATOM   5831 C CB    . ASN C 3 697 ? 86.837  61.424 18.485  1.00 48.39  ? 697  ASN A CB    1 
ATOM   5832 C CG    . ASN C 3 697 ? 85.958  61.485 17.249  1.00 51.31  ? 697  ASN A CG    1 
ATOM   5833 O OD1   . ASN C 3 697 ? 85.422  62.544 16.899  1.00 48.96  ? 697  ASN A OD1   1 
ATOM   5834 N ND2   . ASN C 3 697 ? 85.810  60.341 16.571  1.00 49.61  ? 697  ASN A ND2   1 
ATOM   5835 N N     . TRP C 3 698 ? 87.909  60.192 21.210  1.00 45.59  ? 698  TRP A N     1 
ATOM   5836 C CA    . TRP C 3 698 ? 88.928  60.135 22.227  1.00 43.79  ? 698  TRP A CA    1 
ATOM   5837 C C     . TRP C 3 698 ? 89.477  58.712 22.294  1.00 44.62  ? 698  TRP A C     1 
ATOM   5838 O O     . TRP C 3 698 ? 90.709  58.507 22.311  1.00 45.55  ? 698  TRP A O     1 
ATOM   5839 C CB    . TRP C 3 698 ? 88.331  60.570 23.561  1.00 48.44  ? 698  TRP A CB    1 
ATOM   5840 C CG    . TRP C 3 698 ? 88.962  59.959 24.743  1.00 51.91  ? 698  TRP A CG    1 
ATOM   5841 C CD1   . TRP C 3 698 ? 88.669  58.740 25.301  1.00 53.55  ? 698  TRP A CD1   1 
ATOM   5842 C CD2   . TRP C 3 698 ? 90.042  60.495 25.494  1.00 52.30  ? 698  TRP A CD2   1 
ATOM   5843 N NE1   . TRP C 3 698 ? 89.510  58.488 26.354  1.00 55.48  ? 698  TRP A NE1   1 
ATOM   5844 C CE2   . TRP C 3 698 ? 90.366  59.548 26.495  1.00 54.87  ? 698  TRP A CE2   1 
ATOM   5845 C CE3   . TRP C 3 698 ? 90.773  61.678 25.419  1.00 54.30  ? 698  TRP A CE3   1 
ATOM   5846 C CZ2   . TRP C 3 698 ? 91.392  59.753 27.411  1.00 56.77  ? 698  TRP A CZ2   1 
ATOM   5847 C CZ3   . TRP C 3 698 ? 91.794  61.884 26.327  1.00 58.83  ? 698  TRP A CZ3   1 
ATOM   5848 C CH2   . TRP C 3 698 ? 92.095  60.923 27.313  1.00 60.23  ? 698  TRP A CH2   1 
ATOM   5849 N N     . LEU C 3 699 ? 88.575  57.728 22.314  1.00 42.35  ? 699  LEU A N     1 
ATOM   5850 C CA    . LEU C 3 699 ? 88.984  56.327 22.378  1.00 40.29  ? 699  LEU A CA    1 
ATOM   5851 C C     . LEU C 3 699 ? 89.773  55.959 21.140  1.00 42.91  ? 699  LEU A C     1 
ATOM   5852 O O     . LEU C 3 699 ? 90.737  55.178 21.211  1.00 40.35  ? 699  LEU A O     1 
ATOM   5853 C CB    . LEU C 3 699 ? 87.776  55.412 22.490  1.00 41.97  ? 699  LEU A CB    1 
ATOM   5854 C CG    . LEU C 3 699 ? 87.061  55.387 23.845  1.00 44.05  ? 699  LEU A CG    1 
ATOM   5855 C CD1   . LEU C 3 699 ? 85.683  54.762 23.686  1.00 42.00  ? 699  LEU A CD1   1 
ATOM   5856 C CD2   . LEU C 3 699 ? 87.910  54.620 24.868  1.00 44.07  ? 699  LEU A CD2   1 
ATOM   5857 N N     . LYS C 3 700 ? 89.366  56.526 20.007  1.00 43.90  ? 700  LYS A N     1 
ATOM   5858 C CA    . LYS C 3 700 ? 90.046  56.261 18.748  1.00 46.39  ? 700  LYS A CA    1 
ATOM   5859 C C     . LYS C 3 700 ? 91.471  56.798 18.767  1.00 47.82  ? 700  LYS A C     1 
ATOM   5860 O O     . LYS C 3 700 ? 92.402  56.111 18.370  1.00 46.49  ? 700  LYS A O     1 
ATOM   5861 C CB    . LYS C 3 700 ? 89.265  56.870 17.586  1.00 44.86  ? 700  LYS A CB    1 
ATOM   5862 C CG    . LYS C 3 700 ? 87.826  56.369 17.502  1.00 45.72  ? 700  LYS A CG    1 
ATOM   5863 C CD    . LYS C 3 700 ? 87.160  56.724 16.176  1.00 45.35  ? 700  LYS A CD    1 
ATOM   5864 C CE    . LYS C 3 700 ? 87.717  55.866 15.072  1.00 48.78  ? 700  LYS A CE    1 
ATOM   5865 N NZ    . LYS C 3 700 ? 87.058  56.127 13.766  1.00 51.08  ? 700  LYS A NZ    1 
ATOM   5866 N N     . SER C 3 701 ? 91.633  58.019 19.256  1.00 50.34  ? 701  SER A N     1 
ATOM   5867 C CA    . SER C 3 701 ? 92.939  58.655 19.315  1.00 50.42  ? 701  SER A CA    1 
ATOM   5868 C C     . SER C 3 701 ? 93.885  57.817 20.128  1.00 49.08  ? 701  SER A C     1 
ATOM   5869 O O     . SER C 3 701 ? 95.029  57.577 19.716  1.00 51.82  ? 701  SER A O     1 
ATOM   5870 C CB    . SER C 3 701 ? 92.837  60.055 19.949  1.00 50.51  ? 701  SER A CB    1 
ATOM   5871 O OG    . SER C 3 701 ? 92.003  60.921 19.183  1.00 51.61  ? 701  SER A OG    1 
ATOM   5872 N N     . ALA C 3 702 ? 93.415  57.372 21.289  1.00 46.38  ? 702  ALA A N     1 
ATOM   5873 C CA    . ALA C 3 702 ? 94.260  56.567 22.164  1.00 47.39  ? 702  ALA A CA    1 
ATOM   5874 C C     . ALA C 3 702 ? 94.696  55.280 21.481  1.00 47.27  ? 702  ALA A C     1 
ATOM   5875 O O     . ALA C 3 702 ? 95.820  54.817 21.664  1.00 46.08  ? 702  ALA A O     1 
ATOM   5876 C CB    . ALA C 3 702 ? 93.538  56.244 23.462  1.00 48.00  ? 702  ALA A CB    1 
ATOM   5877 N N     . ALA C 3 703 ? 93.798  54.706 20.696  1.00 47.67  ? 703  ALA A N     1 
ATOM   5878 C CA    . ALA C 3 703 ? 94.102  53.476 19.992  1.00 50.35  ? 703  ALA A CA    1 
ATOM   5879 C C     . ALA C 3 703 ? 95.188  53.679 18.933  1.00 52.58  ? 703  ALA A C     1 
ATOM   5880 O O     . ALA C 3 703 ? 96.094  52.869 18.828  1.00 51.75  ? 703  ALA A O     1 
ATOM   5881 C CB    . ALA C 3 703 ? 92.851  52.930 19.349  1.00 50.21  ? 703  ALA A CB    1 
ATOM   5882 N N     . LYS C 3 704 ? 95.093  54.769 18.172  1.00 55.44  ? 704  LYS A N     1 
ATOM   5883 C CA    . LYS C 3 704 ? 96.051  55.070 17.114  1.00 58.95  ? 704  LYS A CA    1 
ATOM   5884 C C     . LYS C 3 704 ? 97.475  55.232 17.619  1.00 61.93  ? 704  LYS A C     1 
ATOM   5885 O O     . LYS C 3 704 ? 98.432  54.845 16.938  1.00 62.09  ? 704  LYS A O     1 
ATOM   5886 C CB    . LYS C 3 704 ? 95.640  56.335 16.357  1.00 60.70  ? 704  LYS A CB    1 
ATOM   5887 C CG    . LYS C 3 704 ? 96.655  56.772 15.291  1.00 64.95  ? 704  LYS A CG    1 
ATOM   5888 C CD    . LYS C 3 704 ? 96.165  57.951 14.446  1.00 66.05  ? 704  LYS A CD    1 
ATOM   5889 C CE    . LYS C 3 704 ? 95.013  57.531 13.540  1.00 67.80  ? 704  LYS A CE    1 
ATOM   5890 N NZ    . LYS C 3 704 ? 94.481  58.628 12.683  1.00 69.06  ? 704  LYS A NZ    1 
ATOM   5891 N N     . LEU C 3 705 ? 97.613  55.799 18.814  1.00 62.79  ? 705  LEU A N     1 
ATOM   5892 C CA    . LEU C 3 705 ? 98.927  56.010 19.403  1.00 63.26  ? 705  LEU A CA    1 
ATOM   5893 C C     . LEU C 3 705 ? 99.496  54.729 20.000  1.00 64.74  ? 705  LEU A C     1 
ATOM   5894 O O     . LEU C 3 705 ? 100.696 54.476 19.930  1.00 66.96  ? 705  LEU A O     1 
ATOM   5895 C CB    . LEU C 3 705 ? 98.832  57.087 20.473  1.00 64.89  ? 705  LEU A CB    1 
ATOM   5896 C CG    . LEU C 3 705 ? 98.133  58.363 20.001  1.00 66.66  ? 705  LEU A CG    1 
ATOM   5897 C CD1   . LEU C 3 705 ? 98.257  59.409 21.089  1.00 66.62  ? 705  LEU A CD1   1 
ATOM   5898 C CD2   . LEU C 3 705 ? 98.752  58.865 18.705  1.00 66.90  ? 705  LEU A CD2   1 
ATOM   5899 N N     . LEU C 3 706 ? 98.628  53.923 20.592  1.00 65.47  ? 706  LEU A N     1 
ATOM   5900 C CA    . LEU C 3 706 ? 99.032  52.656 21.187  1.00 66.55  ? 706  LEU A CA    1 
ATOM   5901 C C     . LEU C 3 706 ? 99.489  51.671 20.105  1.00 67.79  ? 706  LEU A C     1 
ATOM   5902 O O     . LEU C 3 706 ? 100.331 50.803 20.341  1.00 66.13  ? 706  LEU A O     1 
ATOM   5903 C CB    . LEU C 3 706 ? 97.845  52.047 21.934  1.00 66.73  ? 706  LEU A CB    1 
ATOM   5904 C CG    . LEU C 3 706 ? 97.369  52.768 23.190  1.00 65.22  ? 706  LEU A CG    1 
ATOM   5905 C CD1   . LEU C 3 706 ? 95.962  52.329 23.550  1.00 63.40  ? 706  LEU A CD1   1 
ATOM   5906 C CD2   . LEU C 3 706 ? 98.330  52.462 24.302  1.00 63.96  ? 706  LEU A CD2   1 
ATOM   5907 N N     . ALA C 3 707 ? 98.907  51.811 18.922  1.00 69.76  ? 707  ALA A N     1 
ATOM   5908 C CA    . ALA C 3 707 ? 99.220  50.931 17.811  1.00 72.90  ? 707  ALA A CA    1 
ATOM   5909 C C     . ALA C 3 707 ? 100.327 51.503 16.938  1.00 74.77  ? 707  ALA A C     1 
ATOM   5910 O O     . ALA C 3 707 ? 100.817 50.831 16.028  1.00 75.40  ? 707  ALA A O     1 
ATOM   5911 C CB    . ALA C 3 707 ? 97.961  50.683 16.976  1.00 71.47  ? 707  ALA A CB    1 
ATOM   5912 N N     . ALA C 3 708 ? 100.715 52.745 17.207  1.00 76.83  ? 708  ALA A N     1 
ATOM   5913 C CA    . ALA C 3 708 ? 101.772 53.383 16.436  1.00 78.60  ? 708  ALA A CA    1 
ATOM   5914 C C     . ALA C 3 708 ? 103.114 52.775 16.812  1.00 80.08  ? 708  ALA A C     1 
ATOM   5915 O O     . ALA C 3 708 ? 103.213 51.987 17.759  1.00 80.31  ? 708  ALA A O     1 
ATOM   5916 C CB    . ALA C 3 708 ? 101.786 54.874 16.702  1.00 78.38  ? 708  ALA A CB    1 
ATOM   5917 N N     . GLU C 3 709 ? 104.149 53.140 16.063  1.00 83.30  ? 709  GLU A N     1 
ATOM   5918 C CA    . GLU C 3 709 ? 105.495 52.633 16.327  1.00 85.32  ? 709  GLU A CA    1 
ATOM   5919 C C     . GLU C 3 709 ? 106.456 53.792 16.620  1.00 85.57  ? 709  GLU A C     1 
ATOM   5920 O O     . GLU C 3 709 ? 106.393 54.839 15.977  1.00 85.26  ? 709  GLU A O     1 
ATOM   5921 C CB    . GLU C 3 709 ? 105.977 51.811 15.126  1.00 84.58  ? 709  GLU A CB    1 
ATOM   5922 C CG    . GLU C 3 709 ? 107.240 51.010 15.371  1.00 84.23  ? 709  GLU A CG    1 
ATOM   5923 C CD    . GLU C 3 709 ? 107.509 49.996 14.264  1.00 84.36  ? 709  GLU A CD    1 
ATOM   5924 O OE1   . GLU C 3 709 ? 107.447 50.370 13.069  1.00 82.68  ? 709  GLU A OE1   1 
ATOM   5925 O OE2   . GLU C 3 709 ? 107.789 48.821 14.587  1.00 83.08  ? 709  GLU A OE2   1 
ATOM   5926 N N     . VAL C 3 710 ? 107.322 53.605 17.612  1.00 88.02  ? 710  VAL A N     1 
ATOM   5927 C CA    . VAL C 3 710 ? 108.304 54.624 17.994  1.00 91.17  ? 710  VAL A CA    1 
ATOM   5928 C C     . VAL C 3 710 ? 109.392 54.816 16.927  1.00 93.46  ? 710  VAL A C     1 
ATOM   5929 O O     . VAL C 3 710 ? 110.335 54.025 16.832  1.00 92.17  ? 710  VAL A O     1 
ATOM   5930 C CB    . VAL C 3 710 ? 108.984 54.245 19.316  1.00 90.53  ? 710  VAL A CB    1 
ATOM   5931 C CG1   . VAL C 3 710 ? 109.451 52.832 19.235  1.00 89.96  ? 710  VAL A CG1   1 
ATOM   5932 C CG2   . VAL C 3 710 ? 110.168 55.164 19.593  1.00 91.20  ? 710  VAL A CG2   1 
ATOM   5933 N N     . LYS C 3 711 ? 109.263 55.881 16.142  1.00 96.71  ? 711  LYS A N     1 
ATOM   5934 C CA    . LYS C 3 711 ? 110.221 56.173 15.078  1.00 100.58 ? 711  LYS A CA    1 
ATOM   5935 C C     . LYS C 3 711 ? 111.207 57.286 15.463  1.00 103.35 ? 711  LYS A C     1 
ATOM   5936 O O     . LYS C 3 711 ? 111.625 57.385 16.619  1.00 103.79 ? 711  LYS A O     1 
ATOM   5937 C CB    . LYS C 3 711 ? 109.461 56.557 13.800  1.00 100.24 ? 711  LYS A CB    1 
ATOM   5938 C CG    . LYS C 3 711 ? 110.290 56.497 12.518  1.00 99.40  ? 711  LYS A CG    1 
ATOM   5939 C CD    . LYS C 3 711 ? 109.406 56.598 11.285  1.00 99.06  ? 711  LYS A CD    1 
ATOM   5940 C CE    . LYS C 3 711 ? 110.192 56.336 10.008  1.00 98.44  ? 711  LYS A CE    1 
ATOM   5941 N NZ    . LYS C 3 711 ? 109.301 56.301 8.814   1.00 97.80  ? 711  LYS A NZ    1 
ATOM   5942 N N     . ASP C 3 712 ? 111.569 58.105 14.474  1.00 106.09 ? 712  ASP A N     1 
ATOM   5943 C CA    . ASP C 3 712 ? 112.498 59.230 14.616  1.00 108.19 ? 712  ASP A CA    1 
ATOM   5944 C C     . ASP C 3 712 ? 113.268 59.388 13.314  1.00 108.91 ? 712  ASP A C     1 
ATOM   5945 O O     . ASP C 3 712 ? 113.242 58.495 12.466  1.00 109.75 ? 712  ASP A O     1 
ATOM   5946 C CB    . ASP C 3 712 ? 113.501 58.999 15.746  1.00 109.11 ? 712  ASP A CB    1 
ATOM   5947 C CG    . ASP C 3 712 ? 114.507 60.127 15.862  1.00 110.51 ? 712  ASP A CG    1 
ATOM   5948 O OD1   . ASP C 3 712 ? 114.078 61.293 16.014  1.00 110.51 ? 712  ASP A OD1   1 
ATOM   5949 O OD2   . ASP C 3 712 ? 115.722 59.850 15.798  1.00 110.51 ? 712  ASP A OD2   1 
ATOM   5950 N N     . LYS C 3 713 ? 113.954 60.517 13.150  1.00 109.53 ? 713  LYS A N     1 
ATOM   5951 C CA    . LYS C 3 713 ? 114.732 60.737 11.935  1.00 110.51 ? 713  LYS A CA    1 
ATOM   5952 C C     . LYS C 3 713 ? 115.901 59.764 11.905  1.00 110.51 ? 713  LYS A C     1 
ATOM   5953 O O     . LYS C 3 713 ? 116.534 59.524 12.935  1.00 110.51 ? 713  LYS A O     1 
ATOM   5954 C CB    . LYS C 3 713 ? 115.248 62.183 11.865  1.00 110.51 ? 713  LYS A CB    1 
ATOM   5955 C CG    . LYS C 3 713 ? 116.247 62.461 10.723  1.00 109.88 ? 713  LYS A CG    1 
ATOM   5956 C CD    . LYS C 3 713 ? 115.916 61.690 9.441   1.00 109.24 ? 713  LYS A CD    1 
ATOM   5957 C CE    . LYS C 3 713 ? 114.481 61.907 8.985   1.00 109.03 ? 713  LYS A CE    1 
ATOM   5958 N NZ    . LYS C 3 713 ? 114.094 60.915 7.947   1.00 108.68 ? 713  LYS A NZ    1 
ATOM   5959 N N     . LYS C 3 714 ? 116.170 59.210 10.722  1.00 110.51 ? 714  LYS A N     1 
ATOM   5960 C CA    . LYS C 3 714 ? 117.243 58.242 10.529  1.00 110.23 ? 714  LYS A CA    1 
ATOM   5961 C C     . LYS C 3 714 ? 117.933 57.869 11.830  1.00 110.27 ? 714  LYS A C     1 
ATOM   5962 O O     . LYS C 3 714 ? 118.755 58.613 12.360  1.00 110.51 ? 714  LYS A O     1 
ATOM   5963 C CB    . LYS C 3 714 ? 118.254 58.759 9.504   1.00 110.51 ? 714  LYS A CB    1 
ATOM   5964 C CG    . LYS C 3 714 ? 117.865 58.473 8.048   1.00 110.51 ? 714  LYS A CG    1 
ATOM   5965 C CD    . LYS C 3 714 ? 118.019 56.992 7.679   1.00 109.72 ? 714  LYS A CD    1 
ATOM   5966 C CE    . LYS C 3 714 ? 116.989 56.105 8.368   1.00 109.73 ? 714  LYS A CE    1 
ATOM   5967 N NZ    . LYS C 3 714 ? 117.219 54.663 8.091   1.00 110.28 ? 714  LYS A NZ    1 
ATOM   5968 N N     . THR C 3 715 ? 117.550 56.695 12.316  1.00 109.88 ? 715  THR A N     1 
ATOM   5969 C CA    . THR C 3 715 ? 117.988 56.050 13.557  1.00 109.75 ? 715  THR A CA    1 
ATOM   5970 C C     . THR C 3 715 ? 116.630 55.555 14.023  1.00 109.23 ? 715  THR A C     1 
ATOM   5971 O O     . THR C 3 715 ? 116.230 55.733 15.174  1.00 109.71 ? 715  THR A O     1 
ATOM   5972 C CB    . THR C 3 715 ? 118.580 57.027 14.626  1.00 109.66 ? 715  THR A CB    1 
ATOM   5973 O OG1   . THR C 3 715 ? 119.866 57.492 14.203  1.00 110.10 ? 715  THR A OG1   1 
ATOM   5974 C CG2   . THR C 3 715 ? 118.768 56.313 15.959  1.00 108.12 ? 715  THR A CG2   1 
ATOM   5975 N N     . GLY C 3 716 ? 115.912 54.963 13.073  1.00 108.17 ? 716  GLY A N     1 
ATOM   5976 C CA    . GLY C 3 716 ? 114.585 54.446 13.330  1.00 105.87 ? 716  GLY A CA    1 
ATOM   5977 C C     . GLY C 3 716 ? 114.555 53.250 14.253  1.00 104.67 ? 716  GLY A C     1 
ATOM   5978 O O     . GLY C 3 716 ? 113.741 52.345 14.068  1.00 105.34 ? 716  GLY A O     1 
ATOM   5979 N N     . GLU C 3 717 ? 115.448 53.226 15.238  1.00 102.71 ? 717  GLU A N     1 
ATOM   5980 C CA    . GLU C 3 717 ? 115.460 52.132 16.194  1.00 100.48 ? 717  GLU A CA    1 
ATOM   5981 C C     . GLU C 3 717 ? 114.091 52.193 16.873  1.00 99.43  ? 717  GLU A C     1 
ATOM   5982 O O     . GLU C 3 717 ? 113.351 53.172 16.714  1.00 98.55  ? 717  GLU A O     1 
ATOM   5983 C CB    . GLU C 3 717 ? 116.589 52.314 17.222  1.00 99.54  ? 717  GLU A CB    1 
ATOM   5984 C CG    . GLU C 3 717 ? 116.539 51.321 18.386  1.00 98.74  ? 717  GLU A CG    1 
ATOM   5985 C CD    . GLU C 3 717 ? 117.637 51.534 19.418  1.00 98.58  ? 717  GLU A CD    1 
ATOM   5986 O OE1   . GLU C 3 717 ? 117.993 52.701 19.691  1.00 98.46  ? 717  GLU A OE1   1 
ATOM   5987 O OE2   . GLU C 3 717 ? 118.134 50.528 19.974  1.00 98.70  ? 717  GLU A OE2   1 
ATOM   5988 N N     . ILE C 3 718 ? 113.750 51.158 17.627  1.00 98.31  ? 718  ILE A N     1 
ATOM   5989 C CA    . ILE C 3 718 ? 112.456 51.125 18.285  1.00 97.05  ? 718  ILE A CA    1 
ATOM   5990 C C     . ILE C 3 718 ? 112.509 51.104 19.819  1.00 96.06  ? 718  ILE A C     1 
ATOM   5991 O O     . ILE C 3 718 ? 113.120 50.224 20.430  1.00 94.83  ? 718  ILE A O     1 
ATOM   5992 C CB    . ILE C 3 718 ? 111.646 49.920 17.750  1.00 97.35  ? 718  ILE A CB    1 
ATOM   5993 C CG1   . ILE C 3 718 ? 111.486 50.065 16.230  1.00 96.96  ? 718  ILE A CG1   1 
ATOM   5994 C CG2   . ILE C 3 718 ? 110.289 49.840 18.430  1.00 96.69  ? 718  ILE A CG2   1 
ATOM   5995 C CD1   . ILE C 3 718 ? 110.815 48.891 15.559  1.00 96.69  ? 718  ILE A CD1   1 
ATOM   5996 N N     . LEU C 3 719 ? 111.874 52.102 20.428  1.00 95.85  ? 719  LEU A N     1 
ATOM   5997 C CA    . LEU C 3 719 ? 111.802 52.221 21.881  1.00 95.75  ? 719  LEU A CA    1 
ATOM   5998 C C     . LEU C 3 719 ? 110.585 51.440 22.356  1.00 94.25  ? 719  LEU A C     1 
ATOM   5999 O O     . LEU C 3 719 ? 110.646 50.717 23.350  1.00 95.26  ? 719  LEU A O     1 
ATOM   6000 C CB    . LEU C 3 719 ? 111.650 53.687 22.295  1.00 98.29  ? 719  LEU A CB    1 
ATOM   6001 C CG    . LEU C 3 719 ? 111.315 53.939 23.772  1.00 100.60 ? 719  LEU A CG    1 
ATOM   6002 C CD1   . LEU C 3 719 ? 112.488 53.518 24.658  1.00 100.97 ? 719  LEU A CD1   1 
ATOM   6003 C CD2   . LEU C 3 719 ? 110.992 55.414 23.978  1.00 101.18 ? 719  LEU A CD2   1 
ATOM   6004 N N     . ARG C 3 720 ? 109.478 51.604 21.637  1.00 92.05  ? 720  ARG A N     1 
ATOM   6005 C CA    . ARG C 3 720 ? 108.235 50.915 21.952  1.00 88.81  ? 720  ARG A CA    1 
ATOM   6006 C C     . ARG C 3 720 ? 107.583 50.362 20.693  1.00 87.64  ? 720  ARG A C     1 
ATOM   6007 O O     . ARG C 3 720 ? 107.065 51.124 19.873  1.00 86.82  ? 720  ARG A O     1 
ATOM   6008 C CB    . ARG C 3 720 ? 107.245 51.858 22.643  1.00 87.81  ? 720  ARG A CB    1 
ATOM   6009 C CG    . ARG C 3 720 ? 105.912 51.192 22.973  1.00 86.02  ? 720  ARG A CG    1 
ATOM   6010 C CD    . ARG C 3 720 ? 104.865 52.179 23.477  1.00 86.03  ? 720  ARG A CD    1 
ATOM   6011 N NE    . ARG C 3 720 ? 104.384 53.102 22.445  1.00 84.80  ? 720  ARG A NE    1 
ATOM   6012 C CZ    . ARG C 3 720 ? 103.737 52.736 21.339  1.00 83.51  ? 720  ARG A CZ    1 
ATOM   6013 N NH1   . ARG C 3 720 ? 103.486 51.457 21.103  1.00 82.81  ? 720  ARG A NH1   1 
ATOM   6014 N NH2   . ARG C 3 720 ? 103.327 53.653 20.471  1.00 81.76  ? 720  ARG A NH2   1 
ATOM   6015 N N     . LYS C 3 721 ? 107.624 49.037 20.541  1.00 86.57  ? 721  LYS A N     1 
ATOM   6016 C CA    . LYS C 3 721 ? 106.998 48.369 19.402  1.00 84.81  ? 721  LYS A CA    1 
ATOM   6017 C C     . LYS C 3 721 ? 105.492 48.560 19.556  1.00 82.71  ? 721  LYS A C     1 
ATOM   6018 O O     . LYS C 3 721 ? 105.021 48.959 20.623  1.00 83.41  ? 721  LYS A O     1 
ATOM   6019 C CB    . LYS C 3 721 ? 107.318 46.870 19.395  1.00 86.28  ? 721  LYS A CB    1 
ATOM   6020 C CG    . LYS C 3 721 ? 108.702 46.508 18.885  1.00 87.82  ? 721  LYS A CG    1 
ATOM   6021 C CD    . LYS C 3 721 ? 108.806 45.007 18.633  1.00 89.89  ? 721  LYS A CD    1 
ATOM   6022 C CE    . LYS C 3 721 ? 110.114 44.651 17.935  1.00 91.84  ? 721  LYS A CE    1 
ATOM   6023 N NZ    . LYS C 3 721 ? 110.229 43.193 17.618  1.00 93.23  ? 721  LYS A NZ    1 
ATOM   6024 N N     . ARG C 3 722 ? 104.738 48.271 18.501  1.00 78.12  ? 722  ARG A N     1 
ATOM   6025 C CA    . ARG C 3 722 ? 103.290 48.436 18.538  1.00 72.47  ? 722  ARG A CA    1 
ATOM   6026 C C     . ARG C 3 722 ? 102.672 47.730 19.733  1.00 70.62  ? 722  ARG A C     1 
ATOM   6027 O O     . ARG C 3 722 ? 103.106 46.642 20.107  1.00 69.07  ? 722  ARG A O     1 
ATOM   6028 C CB    . ARG C 3 722 ? 102.689 47.938 17.221  1.00 70.52  ? 722  ARG A CB    1 
ATOM   6029 C CG    . ARG C 3 722 ? 103.101 48.825 16.070  1.00 65.78  ? 722  ARG A CG    1 
ATOM   6030 C CD    . ARG C 3 722 ? 102.611 48.397 14.718  1.00 63.41  ? 722  ARG A CD    1 
ATOM   6031 N NE    . ARG C 3 722 ? 102.735 49.527 13.798  1.00 63.88  ? 722  ARG A NE    1 
ATOM   6032 C CZ    . ARG C 3 722 ? 102.730 49.440 12.472  1.00 64.53  ? 722  ARG A CZ    1 
ATOM   6033 N NH1   . ARG C 3 722 ? 102.611 48.258 11.882  1.00 64.91  ? 722  ARG A NH1   1 
ATOM   6034 N NH2   . ARG C 3 722 ? 102.835 50.540 11.732  1.00 63.86  ? 722  ARG A NH2   1 
ATOM   6035 N N     . CYS C 3 723 ? 101.675 48.371 20.341  1.00 69.76  ? 723  CYS A N     1 
ATOM   6036 C CA    . CYS C 3 723 ? 100.990 47.815 21.509  1.00 69.58  ? 723  CYS A CA    1 
ATOM   6037 C C     . CYS C 3 723 ? 99.491  47.601 21.317  1.00 68.46  ? 723  CYS A C     1 
ATOM   6038 O O     . CYS C 3 723 ? 98.843  48.284 20.525  1.00 69.15  ? 723  CYS A O     1 
ATOM   6039 C CB    . CYS C 3 723 ? 101.198 48.717 22.729  1.00 69.10  ? 723  CYS A CB    1 
ATOM   6040 S SG    . CYS C 3 723 ? 102.852 48.632 23.471  1.00 75.40  ? 723  CYS A SG    1 
ATOM   6041 N N     . ALA C 3 724 ? 98.954  46.638 22.054  1.00 66.59  ? 724  ALA A N     1 
ATOM   6042 C CA    . ALA C 3 724 ? 97.534  46.326 22.019  1.00 63.14  ? 724  ALA A CA    1 
ATOM   6043 C C     . ALA C 3 724 ? 96.836  47.178 23.086  1.00 61.98  ? 724  ALA A C     1 
ATOM   6044 O O     . ALA C 3 724 ? 97.436  47.513 24.108  1.00 63.63  ? 724  ALA A O     1 
ATOM   6045 C CB    . ALA C 3 724 ? 97.328  44.857 22.319  1.00 62.37  ? 724  ALA A CB    1 
ATOM   6046 N N     . VAL C 3 725 ? 95.576  47.531 22.861  1.00 58.25  ? 725  VAL A N     1 
ATOM   6047 C CA    . VAL C 3 725 ? 94.852  48.331 23.836  1.00 53.91  ? 725  VAL A CA    1 
ATOM   6048 C C     . VAL C 3 725 ? 94.284  47.449 24.933  1.00 51.38  ? 725  VAL A C     1 
ATOM   6049 O O     . VAL C 3 725 ? 93.497  46.557 24.650  1.00 55.07  ? 725  VAL A O     1 
ATOM   6050 C CB    . VAL C 3 725 ? 93.689  49.077 23.194  1.00 54.26  ? 725  VAL A CB    1 
ATOM   6051 C CG1   . VAL C 3 725 ? 93.072  50.031 24.216  1.00 53.18  ? 725  VAL A CG1   1 
ATOM   6052 C CG2   . VAL C 3 725 ? 94.165  49.806 21.950  1.00 52.50  ? 725  VAL A CG2   1 
ATOM   6053 N N     . HIS C 3 726 ? 94.684  47.700 26.177  1.00 47.97  ? 726  HIS A N     1 
ATOM   6054 C CA    . HIS C 3 726 ? 94.211  46.930 27.325  1.00 44.91  ? 726  HIS A CA    1 
ATOM   6055 C C     . HIS C 3 726 ? 93.364  47.803 28.255  1.00 44.44  ? 726  HIS A C     1 
ATOM   6056 O O     . HIS C 3 726 ? 93.598  48.999 28.375  1.00 42.45  ? 726  HIS A O     1 
ATOM   6057 C CB    . HIS C 3 726 ? 95.404  46.361 28.110  1.00 42.33  ? 726  HIS A CB    1 
ATOM   6058 C CG    . HIS C 3 726 ? 95.020  45.651 29.378  1.00 44.13  ? 726  HIS A CG    1 
ATOM   6059 N ND1   . HIS C 3 726 ? 95.619  45.917 30.591  1.00 43.03  ? 726  HIS A ND1   1 
ATOM   6060 C CD2   . HIS C 3 726 ? 94.072  44.712 29.630  1.00 44.55  ? 726  HIS A CD2   1 
ATOM   6061 C CE1   . HIS C 3 726 ? 95.055  45.182 31.535  1.00 40.22  ? 726  HIS A CE1   1 
ATOM   6062 N NE2   . HIS C 3 726 ? 94.112  44.442 30.979  1.00 41.26  ? 726  HIS A NE2   1 
ATOM   6063 N N     . TRP C 3 727 ? 92.369  47.207 28.901  1.00 43.57  ? 727  TRP A N     1 
ATOM   6064 C CA    . TRP C 3 727 ? 91.535  47.940 29.847  1.00 44.72  ? 727  TRP A CA    1 
ATOM   6065 C C     . TRP C 3 727 ? 90.777  46.954 30.715  1.00 44.77  ? 727  TRP A C     1 
ATOM   6066 O O     . TRP C 3 727 ? 90.692  45.773 30.388  1.00 48.38  ? 727  TRP A O     1 
ATOM   6067 C CB    . TRP C 3 727 ? 90.590  48.910 29.128  1.00 43.92  ? 727  TRP A CB    1 
ATOM   6068 C CG    . TRP C 3 727 ? 89.470  48.299 28.374  1.00 43.94  ? 727  TRP A CG    1 
ATOM   6069 C CD1   . TRP C 3 727 ? 88.209  48.054 28.837  1.00 44.13  ? 727  TRP A CD1   1 
ATOM   6070 C CD2   . TRP C 3 727 ? 89.480  47.899 27.002  1.00 44.09  ? 727  TRP A CD2   1 
ATOM   6071 N NE1   . TRP C 3 727 ? 87.431  47.533 27.836  1.00 44.29  ? 727  TRP A NE1   1 
ATOM   6072 C CE2   . TRP C 3 727 ? 88.184  47.426 26.697  1.00 44.13  ? 727  TRP A CE2   1 
ATOM   6073 C CE3   . TRP C 3 727 ? 90.457  47.896 25.997  1.00 43.96  ? 727  TRP A CE3   1 
ATOM   6074 C CZ2   . TRP C 3 727 ? 87.837  46.957 25.429  1.00 45.00  ? 727  TRP A CZ2   1 
ATOM   6075 C CZ3   . TRP C 3 727 ? 90.113  47.430 24.735  1.00 42.62  ? 727  TRP A CZ3   1 
ATOM   6076 C CH2   . TRP C 3 727 ? 88.811  46.967 24.461  1.00 44.72  ? 727  TRP A CH2   1 
ATOM   6077 N N     . VAL C 3 728 ? 90.242  47.426 31.832  1.00 43.67  ? 728  VAL A N     1 
ATOM   6078 C CA    . VAL C 3 728 ? 89.558  46.537 32.754  1.00 41.40  ? 728  VAL A CA    1 
ATOM   6079 C C     . VAL C 3 728 ? 88.136  46.974 33.041  1.00 40.81  ? 728  VAL A C     1 
ATOM   6080 O O     . VAL C 3 728 ? 87.879  48.119 33.381  1.00 42.13  ? 728  VAL A O     1 
ATOM   6081 C CB    . VAL C 3 728 ? 90.366  46.446 34.068  1.00 42.13  ? 728  VAL A CB    1 
ATOM   6082 C CG1   . VAL C 3 728 ? 89.749  45.395 35.028  1.00 39.72  ? 728  VAL A CG1   1 
ATOM   6083 C CG2   . VAL C 3 728 ? 91.821  46.108 33.732  1.00 37.34  ? 728  VAL A CG2   1 
ATOM   6084 N N     . THR C 3 729 ? 87.202  46.051 32.905  1.00 39.97  ? 729  THR A N     1 
ATOM   6085 C CA    . THR C 3 729 ? 85.792  46.373 33.134  1.00 41.06  ? 729  THR A CA    1 
ATOM   6086 C C     . THR C 3 729 ? 85.507  46.583 34.633  1.00 41.72  ? 729  THR A C     1 
ATOM   6087 O O     . THR C 3 729 ? 86.206  46.039 35.489  1.00 46.13  ? 729  THR A O     1 
ATOM   6088 C CB    . THR C 3 729 ? 84.891  45.243 32.547  1.00 36.38  ? 729  THR A CB    1 
ATOM   6089 O OG1   . THR C 3 729 ? 83.519  45.603 32.655  1.00 42.54  ? 729  THR A OG1   1 
ATOM   6090 C CG2   . THR C 3 729 ? 85.045  44.016 33.294  1.00 34.28  ? 729  THR A CG2   1 
ATOM   6091 N N     . PRO C 3 730 ? 84.476  47.375 34.968  1.00 41.47  ? 730  PRO A N     1 
ATOM   6092 C CA    . PRO C 3 730 ? 84.094  47.660 36.358  1.00 40.72  ? 730  PRO A CA    1 
ATOM   6093 C C     . PRO C 3 730 ? 83.986  46.431 37.261  1.00 44.80  ? 730  PRO A C     1 
ATOM   6094 O O     . PRO C 3 730 ? 84.383  46.480 38.430  1.00 45.34  ? 730  PRO A O     1 
ATOM   6095 C CB    . PRO C 3 730 ? 82.742  48.353 36.211  1.00 38.49  ? 730  PRO A CB    1 
ATOM   6096 C CG    . PRO C 3 730 ? 82.893  49.082 34.914  1.00 43.12  ? 730  PRO A CG    1 
ATOM   6097 C CD    . PRO C 3 730 ? 83.575  48.068 34.027  1.00 38.76  ? 730  PRO A CD    1 
ATOM   6098 N N     . ASP C 3 731 ? 83.443  45.330 36.744  1.00 43.85  ? 731  ASP A N     1 
ATOM   6099 C CA    . ASP C 3 731 ? 83.308  44.168 37.592  1.00 43.13  ? 731  ASP A CA    1 
ATOM   6100 C C     . ASP C 3 731 ? 84.585  43.350 37.668  1.00 42.31  ? 731  ASP A C     1 
ATOM   6101 O O     . ASP C 3 731 ? 84.638  42.317 38.331  1.00 40.66  ? 731  ASP A O     1 
ATOM   6102 C CB    . ASP C 3 731 ? 82.096  43.323 37.162  1.00 45.57  ? 731  ASP A CB    1 
ATOM   6103 C CG    . ASP C 3 731 ? 82.373  42.424 35.975  1.00 47.41  ? 731  ASP A CG    1 
ATOM   6104 O OD1   . ASP C 3 731 ? 83.334  42.676 35.221  1.00 46.69  ? 731  ASP A OD1   1 
ATOM   6105 O OD2   . ASP C 3 731 ? 81.592  41.462 35.799  1.00 47.87  ? 731  ASP A OD2   1 
ATOM   6106 N N     . GLY C 3 732 ? 85.633  43.841 37.012  1.00 41.48  ? 732  GLY A N     1 
ATOM   6107 C CA    . GLY C 3 732 ? 86.906  43.149 37.048  1.00 39.12  ? 732  GLY A CA    1 
ATOM   6108 C C     . GLY C 3 732 ? 87.290  42.268 35.872  1.00 38.02  ? 732  GLY A C     1 
ATOM   6109 O O     . GLY C 3 732 ? 88.189  41.443 36.001  1.00 39.27  ? 732  GLY A O     1 
ATOM   6110 N N     . PHE C 3 733 ? 86.630  42.417 34.730  1.00 35.93  ? 733  PHE A N     1 
ATOM   6111 C CA    . PHE C 3 733 ? 86.996  41.614 33.578  1.00 35.39  ? 733  PHE A CA    1 
ATOM   6112 C C     . PHE C 3 733 ? 87.992  42.353 32.700  1.00 35.08  ? 733  PHE A C     1 
ATOM   6113 O O     . PHE C 3 733 ? 87.700  43.407 32.133  1.00 30.31  ? 733  PHE A O     1 
ATOM   6114 C CB    . PHE C 3 733 ? 85.780  41.237 32.715  1.00 38.13  ? 733  PHE A CB    1 
ATOM   6115 C CG    . PHE C 3 733 ? 86.125  40.348 31.535  1.00 33.94  ? 733  PHE A CG    1 
ATOM   6116 C CD1   . PHE C 3 733 ? 86.304  38.974 31.710  1.00 32.38  ? 733  PHE A CD1   1 
ATOM   6117 C CD2   . PHE C 3 733 ? 86.272  40.888 30.266  1.00 30.52  ? 733  PHE A CD2   1 
ATOM   6118 C CE1   . PHE C 3 733 ? 86.623  38.138 30.627  1.00 33.18  ? 733  PHE A CE1   1 
ATOM   6119 C CE2   . PHE C 3 733 ? 86.592  40.073 29.171  1.00 33.67  ? 733  PHE A CE2   1 
ATOM   6120 C CZ    . PHE C 3 733 ? 86.767  38.686 29.354  1.00 32.39  ? 733  PHE A CZ    1 
ATOM   6121 N N     . PRO C 3 734 ? 89.197  41.796 32.579  1.00 36.52  ? 734  PRO A N     1 
ATOM   6122 C CA    . PRO C 3 734 ? 90.225  42.425 31.746  1.00 35.39  ? 734  PRO A CA    1 
ATOM   6123 C C     . PRO C 3 734 ? 90.012  42.070 30.274  1.00 34.35  ? 734  PRO A C     1 
ATOM   6124 O O     . PRO C 3 734 ? 89.518  40.993 29.947  1.00 34.01  ? 734  PRO A O     1 
ATOM   6125 C CB    . PRO C 3 734 ? 91.519  41.839 32.300  1.00 34.58  ? 734  PRO A CB    1 
ATOM   6126 C CG    . PRO C 3 734 ? 91.099  40.448 32.742  1.00 35.16  ? 734  PRO A CG    1 
ATOM   6127 C CD    . PRO C 3 734 ? 89.751  40.697 33.396  1.00 34.49  ? 734  PRO A CD    1 
ATOM   6128 N N     . VAL C 3 735 ? 90.341  42.993 29.385  1.00 34.76  ? 735  VAL A N     1 
ATOM   6129 C CA    . VAL C 3 735 ? 90.216  42.717 27.959  1.00 35.66  ? 735  VAL A CA    1 
ATOM   6130 C C     . VAL C 3 735 ? 91.434  43.309 27.281  1.00 35.62  ? 735  VAL A C     1 
ATOM   6131 O O     . VAL C 3 735 ? 91.949  44.343 27.702  1.00 36.45  ? 735  VAL A O     1 
ATOM   6132 C CB    . VAL C 3 735 ? 88.877  43.272 27.311  1.00 34.57  ? 735  VAL A CB    1 
ATOM   6133 C CG1   . VAL C 3 735 ? 88.162  44.256 28.239  1.00 37.63  ? 735  VAL A CG1   1 
ATOM   6134 C CG2   . VAL C 3 735 ? 89.172  43.906 25.992  1.00 34.33  ? 735  VAL A CG2   1 
ATOM   6135 N N     . TRP C 3 736 ? 91.895  42.621 26.246  1.00 36.65  ? 736  TRP A N     1 
ATOM   6136 C CA    . TRP C 3 736 ? 93.076  43.034 25.480  1.00 39.16  ? 736  TRP A CA    1 
ATOM   6137 C C     . TRP C 3 736 ? 92.729  43.068 23.999  1.00 38.22  ? 736  TRP A C     1 
ATOM   6138 O O     . TRP C 3 736 ? 92.536  42.011 23.400  1.00 36.91  ? 736  TRP A O     1 
ATOM   6139 C CB    . TRP C 3 736 ? 94.210  42.020 25.667  1.00 37.36  ? 736  TRP A CB    1 
ATOM   6140 C CG    . TRP C 3 736 ? 94.839  41.987 27.027  1.00 41.35  ? 736  TRP A CG    1 
ATOM   6141 C CD1   . TRP C 3 736 ? 95.950  42.679 27.435  1.00 41.69  ? 736  TRP A CD1   1 
ATOM   6142 C CD2   . TRP C 3 736 ? 94.440  41.177 28.140  1.00 42.85  ? 736  TRP A CD2   1 
ATOM   6143 N NE1   . TRP C 3 736 ? 96.270  42.338 28.726  1.00 43.24  ? 736  TRP A NE1   1 
ATOM   6144 C CE2   . TRP C 3 736 ? 95.360  41.423 29.185  1.00 43.27  ? 736  TRP A CE2   1 
ATOM   6145 C CE3   . TRP C 3 736 ? 93.392  40.263 28.357  1.00 42.77  ? 736  TRP A CE3   1 
ATOM   6146 C CZ2   . TRP C 3 736 ? 95.269  40.787 30.429  1.00 45.23  ? 736  TRP A CZ2   1 
ATOM   6147 C CZ3   . TRP C 3 736 ? 93.301  39.626 29.596  1.00 41.74  ? 736  TRP A CZ3   1 
ATOM   6148 C CH2   . TRP C 3 736 ? 94.237  39.891 30.616  1.00 44.51  ? 736  TRP A CH2   1 
ATOM   6149 N N     . GLN C 3 737 ? 92.648  44.259 23.406  1.00 38.67  ? 737  GLN A N     1 
ATOM   6150 C CA    . GLN C 3 737 ? 92.345  44.341 21.978  1.00 41.40  ? 737  GLN A CA    1 
ATOM   6151 C C     . GLN C 3 737 ? 93.653  44.223 21.190  1.00 42.94  ? 737  GLN A C     1 
ATOM   6152 O O     . GLN C 3 737 ? 94.519  45.086 21.294  1.00 43.94  ? 737  GLN A O     1 
ATOM   6153 C CB    . GLN C 3 737 ? 91.655  45.657 21.626  1.00 38.70  ? 737  GLN A CB    1 
ATOM   6154 C CG    . GLN C 3 737 ? 90.968  45.583 20.263  1.00 41.59  ? 737  GLN A CG    1 
ATOM   6155 C CD    . GLN C 3 737 ? 90.513  46.926 19.729  1.00 42.59  ? 737  GLN A CD    1 
ATOM   6156 O OE1   . GLN C 3 737 ? 91.326  47.736 19.284  1.00 45.82  ? 737  GLN A OE1   1 
ATOM   6157 N NE2   . GLN C 3 737 ? 89.212  47.169 19.771  1.00 39.70  ? 737  GLN A NE2   1 
ATOM   6158 N N     . GLU C 3 738 ? 93.794  43.156 20.407  1.00 45.76  ? 738  GLU A N     1 
ATOM   6159 C CA    . GLU C 3 738 ? 95.015  42.935 19.638  1.00 49.06  ? 738  GLU A CA    1 
ATOM   6160 C C     . GLU C 3 738 ? 94.773  42.424 18.225  1.00 47.90  ? 738  GLU A C     1 
ATOM   6161 O O     . GLU C 3 738 ? 95.108  41.284 17.895  1.00 46.72  ? 738  GLU A O     1 
ATOM   6162 C CB    . GLU C 3 738 ? 95.941  41.951 20.371  1.00 54.83  ? 738  GLU A CB    1 
ATOM   6163 C CG    . GLU C 3 738 ? 95.347  40.545 20.544  1.00 65.92  ? 738  GLU A CG    1 
ATOM   6164 C CD    . GLU C 3 738 ? 96.350  39.529 21.082  1.00 71.76  ? 738  GLU A CD    1 
ATOM   6165 O OE1   . GLU C 3 738 ? 97.410  39.341 20.442  1.00 74.50  ? 738  GLU A OE1   1 
ATOM   6166 O OE2   . GLU C 3 738 ? 96.075  38.916 22.141  1.00 73.86  ? 738  GLU A OE2   1 
ATOM   6167 N N     . TYR C 3 739 ? 94.188  43.262 17.384  1.00 47.20  ? 739  TYR A N     1 
ATOM   6168 C CA    . TYR C 3 739 ? 93.970  42.861 16.012  1.00 48.67  ? 739  TYR A CA    1 
ATOM   6169 C C     . TYR C 3 739 ? 95.355  42.739 15.373  1.00 52.57  ? 739  TYR A C     1 
ATOM   6170 O O     . TYR C 3 739 ? 96.232  43.594 15.569  1.00 54.42  ? 739  TYR A O     1 
ATOM   6171 C CB    . TYR C 3 739 ? 93.144  43.910 15.287  1.00 44.42  ? 739  TYR A CB    1 
ATOM   6172 C CG    . TYR C 3 739 ? 91.696  43.892 15.661  1.00 43.35  ? 739  TYR A CG    1 
ATOM   6173 C CD1   . TYR C 3 739 ? 90.837  42.922 15.151  1.00 43.59  ? 739  TYR A CD1   1 
ATOM   6174 C CD2   . TYR C 3 739 ? 91.161  44.871 16.496  1.00 42.03  ? 739  TYR A CD2   1 
ATOM   6175 C CE1   . TYR C 3 739 ? 89.479  42.935 15.465  1.00 43.46  ? 739  TYR A CE1   1 
ATOM   6176 C CE2   . TYR C 3 739 ? 89.816  44.895 16.807  1.00 38.73  ? 739  TYR A CE2   1 
ATOM   6177 C CZ    . TYR C 3 739 ? 88.980  43.930 16.295  1.00 42.24  ? 739  TYR A CZ    1 
ATOM   6178 O OH    . TYR C 3 739 ? 87.644  43.954 16.622  1.00 42.56  ? 739  TYR A OH    1 
ATOM   6179 N N     . LYS C 3 740 ? 95.558  41.668 14.620  1.00 55.35  ? 740  LYS A N     1 
ATOM   6180 C CA    . LYS C 3 740 ? 96.836  41.437 13.969  1.00 54.63  ? 740  LYS A CA    1 
ATOM   6181 C C     . LYS C 3 740 ? 96.630  41.091 12.515  1.00 55.83  ? 740  LYS A C     1 
ATOM   6182 O O     . LYS C 3 740 ? 95.523  40.733 12.100  1.00 59.20  ? 740  LYS A O     1 
ATOM   6183 C CB    . LYS C 3 740 ? 97.572  40.299 14.666  1.00 55.64  ? 740  LYS A CB    1 
ATOM   6184 C CG    . LYS C 3 740 ? 97.999  40.624 16.102  1.00 59.53  ? 740  LYS A CG    1 
ATOM   6185 C CD    . LYS C 3 740 ? 98.786  39.476 16.726  1.00 60.90  ? 740  LYS A CD    1 
ATOM   6186 C CE    . LYS C 3 740 ? 99.347  39.852 18.088  1.00 63.23  ? 740  LYS A CE    1 
ATOM   6187 N NZ    . LYS C 3 740 ? 100.169 38.749 18.683  1.00 64.17  ? 740  LYS A NZ    1 
ATOM   6188 N N     . LYS C 3 741 ? 97.690  41.230 11.731  1.00 55.80  ? 741  LYS A N     1 
ATOM   6189 C CA    . LYS C 3 741 ? 97.639  40.901 10.315  1.00 56.95  ? 741  LYS A CA    1 
ATOM   6190 C C     . LYS C 3 741 ? 98.073  39.440 10.208  1.00 57.23  ? 741  LYS A C     1 
ATOM   6191 O O     . LYS C 3 741 ? 99.120  39.057 10.725  1.00 58.90  ? 741  LYS A O     1 
ATOM   6192 C CB    . LYS C 3 741 ? 98.599  41.800 9.530   1.00 59.19  ? 741  LYS A CB    1 
ATOM   6193 C CG    . LYS C 3 741 ? 98.229  43.279 9.529   1.00 59.10  ? 741  LYS A CG    1 
ATOM   6194 C CD    . LYS C 3 741 ? 99.482  44.131 9.377   1.00 59.09  ? 741  LYS A CD    1 
ATOM   6195 C CE    . LYS C 3 741 ? 99.170  45.593 9.050   1.00 59.87  ? 741  LYS A CE    1 
ATOM   6196 N NZ    . LYS C 3 741 ? 98.870  45.796 7.602   1.00 57.04  ? 741  LYS A NZ    1 
ATOM   6197 N N     . PRO C 3 742 ? 97.264  38.599 9.558   1.00 55.90  ? 742  PRO A N     1 
ATOM   6198 C CA    . PRO C 3 742 ? 97.620  37.184 9.418   1.00 54.04  ? 742  PRO A CA    1 
ATOM   6199 C C     . PRO C 3 742 ? 98.648  36.936 8.311   1.00 51.61  ? 742  PRO A C     1 
ATOM   6200 O O     . PRO C 3 742 ? 98.693  37.655 7.317   1.00 49.00  ? 742  PRO A O     1 
ATOM   6201 C CB    . PRO C 3 742 ? 96.281  36.505 9.083   1.00 55.96  ? 742  PRO A CB    1 
ATOM   6202 C CG    . PRO C 3 742 ? 95.233  37.524 9.445   1.00 59.74  ? 742  PRO A CG    1 
ATOM   6203 C CD    . PRO C 3 742 ? 95.892  38.834 9.093   1.00 57.75  ? 742  PRO A CD    1 
ATOM   6204 N N     . ILE C 3 743 ? 99.476  35.916 8.512   1.00 49.15  ? 743  ILE A N     1 
ATOM   6205 C CA    . ILE C 3 743 ? 100.469 35.500 7.537   1.00 45.34  ? 743  ILE A CA    1 
ATOM   6206 C C     . ILE C 3 743 ? 99.726  34.442 6.722   1.00 44.50  ? 743  ILE A C     1 
ATOM   6207 O O     . ILE C 3 743 ? 99.417  33.348 7.226   1.00 39.28  ? 743  ILE A O     1 
ATOM   6208 C CB    . ILE C 3 743 ? 101.701 34.856 8.226   1.00 44.90  ? 743  ILE A CB    1 
ATOM   6209 C CG1   . ILE C 3 743 ? 102.566 35.940 8.859   1.00 45.00  ? 743  ILE A CG1   1 
ATOM   6210 C CG2   . ILE C 3 743 ? 102.513 34.026 7.214   1.00 41.79  ? 743  ILE A CG2   1 
ATOM   6211 C CD1   . ILE C 3 743 ? 103.741 35.401 9.635   1.00 44.32  ? 743  ILE A CD1   1 
ATOM   6212 N N     . GLN C 3 744 ? 99.417  34.778 5.476   1.00 44.22  ? 744  GLN A N     1 
ATOM   6213 C CA    . GLN C 3 744 ? 98.683  33.864 4.609   1.00 44.39  ? 744  GLN A CA    1 
ATOM   6214 C C     . GLN C 3 744 ? 99.586  32.905 3.847   1.00 45.45  ? 744  GLN A C     1 
ATOM   6215 O O     . GLN C 3 744 ? 100.816 32.973 3.933   1.00 45.89  ? 744  GLN A O     1 
ATOM   6216 C CB    . GLN C 3 744 ? 97.829  34.656 3.608   1.00 44.64  ? 744  GLN A CB    1 
ATOM   6217 C CG    . GLN C 3 744 ? 96.821  35.622 4.246   1.00 46.24  ? 744  GLN A CG    1 
ATOM   6218 C CD    . GLN C 3 744 ? 95.814  36.171 3.239   1.00 47.36  ? 744  GLN A CD    1 
ATOM   6219 O OE1   . GLN C 3 744 ? 94.603  35.951 3.365   1.00 49.64  ? 744  GLN A OE1   1 
ATOM   6220 N NE2   . GLN C 3 744 ? 96.310  36.880 2.227   1.00 47.80  ? 744  GLN A NE2   1 
ATOM   6221 N N     . THR C 3 745 ? 98.951  31.996 3.119   1.00 44.68  ? 745  THR A N     1 
ATOM   6222 C CA    . THR C 3 745 ? 99.637  31.029 2.284   1.00 45.28  ? 745  THR A CA    1 
ATOM   6223 C C     . THR C 3 745 ? 98.548  30.297 1.538   1.00 44.67  ? 745  THR A C     1 
ATOM   6224 O O     . THR C 3 745 ? 97.378  30.494 1.823   1.00 45.37  ? 745  THR A O     1 
ATOM   6225 C CB    . THR C 3 745 ? 100.512 30.024 3.099   1.00 46.53  ? 745  THR A CB    1 
ATOM   6226 O OG1   . THR C 3 745 ? 101.276 29.217 2.188   1.00 45.14  ? 745  THR A OG1   1 
ATOM   6227 C CG2   . THR C 3 745 ? 99.653  29.119 3.977   1.00 48.63  ? 745  THR A CG2   1 
ATOM   6228 N N     . ARG C 3 746 ? 98.922  29.488 0.560   1.00 43.14  ? 746  ARG A N     1 
ATOM   6229 C CA    . ARG C 3 746 ? 97.940  28.742 -0.190  1.00 42.22  ? 746  ARG A CA    1 
ATOM   6230 C C     . ARG C 3 746 ? 98.337  27.276 -0.156  1.00 43.19  ? 746  ARG A C     1 
ATOM   6231 O O     . ARG C 3 746 ? 99.527  26.951 -0.072  1.00 45.04  ? 746  ARG A O     1 
ATOM   6232 C CB    . ARG C 3 746 ? 97.889  29.216 -1.644  1.00 43.54  ? 746  ARG A CB    1 
ATOM   6233 C CG    . ARG C 3 746 ? 97.514  30.678 -1.845  1.00 44.35  ? 746  ARG A CG    1 
ATOM   6234 C CD    . ARG C 3 746 ? 97.314  31.015 -3.320  1.00 39.57  ? 746  ARG A CD    1 
ATOM   6235 N NE    . ARG C 3 746 ? 96.108  30.395 -3.875  1.00 43.81  ? 746  ARG A NE    1 
ATOM   6236 C CZ    . ARG C 3 746 ? 95.826  30.354 -5.175  1.00 45.23  ? 746  ARG A CZ    1 
ATOM   6237 N NH1   . ARG C 3 746 ? 96.669  30.893 -6.046  1.00 44.74  ? 746  ARG A NH1   1 
ATOM   6238 N NH2   . ARG C 3 746 ? 94.709  29.782 -5.613  1.00 43.74  ? 746  ARG A NH2   1 
ATOM   6239 N N     . LEU C 3 747 ? 97.336  26.398 -0.196  1.00 41.99  ? 747  LEU A N     1 
ATOM   6240 C CA    . LEU C 3 747 ? 97.582  24.974 -0.208  1.00 41.33  ? 747  LEU A CA    1 
ATOM   6241 C C     . LEU C 3 747 ? 97.338  24.586 -1.650  1.00 41.81  ? 747  LEU A C     1 
ATOM   6242 O O     . LEU C 3 747 ? 96.792  25.388 -2.413  1.00 39.72  ? 747  LEU A O     1 
ATOM   6243 C CB    . LEU C 3 747 ? 96.610  24.222 0.707   1.00 40.35  ? 747  LEU A CB    1 
ATOM   6244 C CG    . LEU C 3 747 ? 96.572  24.588 2.188   1.00 38.58  ? 747  LEU A CG    1 
ATOM   6245 C CD1   . LEU C 3 747 ? 95.621  23.639 2.910   1.00 37.50  ? 747  LEU A CD1   1 
ATOM   6246 C CD2   . LEU C 3 747 ? 97.962  24.494 2.785   1.00 39.47  ? 747  LEU A CD2   1 
ATOM   6247 N N     . ASN C 3 748 ? 97.756  23.379 -2.036  1.00 42.48  ? 748  ASN A N     1 
ATOM   6248 C CA    . ASN C 3 748 ? 97.555  22.913 -3.411  1.00 44.91  ? 748  ASN A CA    1 
ATOM   6249 C C     . ASN C 3 748 ? 97.001  21.496 -3.309  1.00 45.69  ? 748  ASN A C     1 
ATOM   6250 O O     . ASN C 3 748 ? 97.753  20.526 -3.204  1.00 48.57  ? 748  ASN A O     1 
ATOM   6251 C CB    . ASN C 3 748 ? 98.885  22.958 -4.195  1.00 43.82  ? 748  ASN A CB    1 
ATOM   6252 C CG    . ASN C 3 748 ? 98.774  22.344 -5.586  1.00 47.19  ? 748  ASN A CG    1 
ATOM   6253 O OD1   . ASN C 3 748 ? 97.694  22.273 -6.171  1.00 49.93  ? 748  ASN A OD1   1 
ATOM   6254 N ND2   . ASN C 3 748 ? 99.901  21.906 -6.122  1.00 46.47  ? 748  ASN A ND2   1 
ATOM   6255 N N     . LEU C 3 749 ? 95.673  21.394 -3.325  1.00 45.16  ? 749  LEU A N     1 
ATOM   6256 C CA    . LEU C 3 749 ? 94.999  20.118 -3.181  1.00 43.99  ? 749  LEU A CA    1 
ATOM   6257 C C     . LEU C 3 749 ? 94.317  19.619 -4.439  1.00 45.21  ? 749  LEU A C     1 
ATOM   6258 O O     . LEU C 3 749 ? 93.472  20.298 -4.996  1.00 47.41  ? 749  LEU A O     1 
ATOM   6259 C CB    . LEU C 3 749 ? 93.969  20.219 -2.061  1.00 44.20  ? 749  LEU A CB    1 
ATOM   6260 C CG    . LEU C 3 749 ? 94.374  20.968 -0.775  1.00 47.33  ? 749  LEU A CG    1 
ATOM   6261 C CD1   . LEU C 3 749 ? 93.197  20.976 0.185   1.00 47.53  ? 749  LEU A CD1   1 
ATOM   6262 C CD2   . LEU C 3 749 ? 95.559  20.315 -0.104  1.00 46.31  ? 749  LEU A CD2   1 
ATOM   6263 N N     . MET C 3 750 ? 94.702  18.431 -4.892  1.00 45.85  ? 750  MET A N     1 
ATOM   6264 C CA    . MET C 3 750 ? 94.087  17.813 -6.056  1.00 44.58  ? 750  MET A CA    1 
ATOM   6265 C C     . MET C 3 750 ? 92.736  17.387 -5.490  1.00 43.65  ? 750  MET A C     1 
ATOM   6266 O O     . MET C 3 750 ? 92.684  16.568 -4.589  1.00 40.97  ? 750  MET A O     1 
ATOM   6267 C CB    . MET C 3 750 ? 94.905  16.593 -6.497  1.00 46.32  ? 750  MET A CB    1 
ATOM   6268 C CG    . MET C 3 750 ? 94.377  15.869 -7.728  1.00 47.85  ? 750  MET A CG    1 
ATOM   6269 S SD    . MET C 3 750 ? 94.250  16.917 -9.205  1.00 57.33  ? 750  MET A SD    1 
ATOM   6270 C CE    . MET C 3 750 ? 92.535  16.879 -9.470  1.00 59.36  ? 750  MET A CE    1 
ATOM   6271 N N     . PHE C 3 751 ? 91.658  17.952 -6.021  1.00 45.12  ? 751  PHE A N     1 
ATOM   6272 C CA    . PHE C 3 751 ? 90.303  17.696 -5.540  1.00 44.59  ? 751  PHE A CA    1 
ATOM   6273 C C     . PHE C 3 751 ? 89.483  16.776 -6.442  1.00 45.53  ? 751  PHE A C     1 
ATOM   6274 O O     . PHE C 3 751 ? 89.163  17.138 -7.575  1.00 44.79  ? 751  PHE A O     1 
ATOM   6275 C CB    . PHE C 3 751 ? 89.586  19.040 -5.405  1.00 46.59  ? 751  PHE A CB    1 
ATOM   6276 C CG    . PHE C 3 751 ? 88.327  18.997 -4.586  1.00 46.59  ? 751  PHE A CG    1 
ATOM   6277 C CD1   . PHE C 3 751 ? 88.387  19.027 -3.202  1.00 46.57  ? 751  PHE A CD1   1 
ATOM   6278 C CD2   . PHE C 3 751 ? 87.077  18.972 -5.204  1.00 49.33  ? 751  PHE A CD2   1 
ATOM   6279 C CE1   . PHE C 3 751 ? 87.221  19.040 -2.436  1.00 50.92  ? 751  PHE A CE1   1 
ATOM   6280 C CE2   . PHE C 3 751 ? 85.893  18.985 -4.448  1.00 51.29  ? 751  PHE A CE2   1 
ATOM   6281 C CZ    . PHE C 3 751 ? 85.971  19.020 -3.060  1.00 50.68  ? 751  PHE A CZ    1 
ATOM   6282 N N     . LEU C 3 752 ? 89.137  15.596 -5.933  1.00 44.76  ? 752  LEU A N     1 
ATOM   6283 C CA    . LEU C 3 752 ? 88.338  14.640 -6.679  1.00 46.66  ? 752  LEU A CA    1 
ATOM   6284 C C     . LEU C 3 752 ? 88.992  14.261 -7.995  1.00 50.32  ? 752  LEU A C     1 
ATOM   6285 O O     . LEU C 3 752 ? 88.312  13.925 -8.975  1.00 53.11  ? 752  LEU A O     1 
ATOM   6286 C CB    . LEU C 3 752 ? 86.933  15.214 -6.950  1.00 47.72  ? 752  LEU A CB    1 
ATOM   6287 C CG    . LEU C 3 752 ? 85.964  15.413 -5.762  1.00 50.63  ? 752  LEU A CG    1 
ATOM   6288 C CD1   . LEU C 3 752 ? 84.650  16.031 -6.255  1.00 47.32  ? 752  LEU A CD1   1 
ATOM   6289 C CD2   . LEU C 3 752 ? 85.683  14.070 -5.064  1.00 47.20  ? 752  LEU A CD2   1 
ATOM   6290 N N     . GLY C 3 753 ? 90.318  14.310 -8.025  1.00 53.11  ? 753  GLY A N     1 
ATOM   6291 C CA    . GLY C 3 753 ? 91.029  13.981 -9.246  1.00 53.39  ? 753  GLY A CA    1 
ATOM   6292 C C     . GLY C 3 753 ? 90.500  14.786 -10.416 1.00 53.84  ? 753  GLY A C     1 
ATOM   6293 O O     . GLY C 3 753 ? 90.655  14.392 -11.568 1.00 55.05  ? 753  GLY A O     1 
ATOM   6294 N N     . GLN C 3 754 ? 89.878  15.921 -10.121 1.00 53.31  ? 754  GLN A N     1 
ATOM   6295 C CA    . GLN C 3 754 ? 89.317  16.781 -11.158 1.00 53.85  ? 754  GLN A CA    1 
ATOM   6296 C C     . GLN C 3 754 ? 90.136  18.046 -11.409 1.00 51.18  ? 754  GLN A C     1 
ATOM   6297 O O     . GLN C 3 754 ? 90.469  18.349 -12.543 1.00 50.71  ? 754  GLN A O     1 
ATOM   6298 C CB    . GLN C 3 754 ? 87.888  17.170 -10.800 1.00 55.42  ? 754  GLN A CB    1 
ATOM   6299 C CG    . GLN C 3 754 ? 86.876  16.058 -10.982 1.00 62.72  ? 754  GLN A CG    1 
ATOM   6300 C CD    . GLN C 3 754 ? 85.526  16.426 -10.389 1.00 68.39  ? 754  GLN A CD    1 
ATOM   6301 O OE1   . GLN C 3 754 ? 84.981  17.506 -10.662 1.00 71.14  ? 754  GLN A OE1   1 
ATOM   6302 N NE2   . GLN C 3 754 ? 84.979  15.533 -9.570  1.00 69.90  ? 754  GLN A NE2   1 
ATOM   6303 N N     . PHE C 3 755 ? 90.443  18.788 -10.350 1.00 47.70  ? 755  PHE A N     1 
ATOM   6304 C CA    . PHE C 3 755 ? 91.218  20.009 -10.474 1.00 43.78  ? 755  PHE A CA    1 
ATOM   6305 C C     . PHE C 3 755 ? 91.986  20.217 -9.195  1.00 42.49  ? 755  PHE A C     1 
ATOM   6306 O O     . PHE C 3 755 ? 91.828  19.461 -8.242  1.00 43.32  ? 755  PHE A O     1 
ATOM   6307 C CB    . PHE C 3 755 ? 90.307  21.222 -10.706 1.00 43.73  ? 755  PHE A CB    1 
ATOM   6308 C CG    . PHE C 3 755 ? 89.305  21.472 -9.591  1.00 42.10  ? 755  PHE A CG    1 
ATOM   6309 C CD1   . PHE C 3 755 ? 88.120  20.729 -9.510  1.00 41.36  ? 755  PHE A CD1   1 
ATOM   6310 C CD2   . PHE C 3 755 ? 89.537  22.468 -8.638  1.00 40.36  ? 755  PHE A CD2   1 
ATOM   6311 C CE1   . PHE C 3 755 ? 87.178  20.979 -8.497  1.00 41.09  ? 755  PHE A CE1   1 
ATOM   6312 C CE2   . PHE C 3 755 ? 88.606  22.728 -7.620  1.00 37.41  ? 755  PHE A CE2   1 
ATOM   6313 C CZ    . PHE C 3 755 ? 87.427  21.984 -7.551  1.00 39.79  ? 755  PHE A CZ    1 
ATOM   6314 N N     . ARG C 3 756 ? 92.818  21.251 -9.180  1.00 40.47  ? 756  ARG A N     1 
ATOM   6315 C CA    . ARG C 3 756 ? 93.615  21.583 -8.010  1.00 39.26  ? 756  ARG A CA    1 
ATOM   6316 C C     . ARG C 3 756 ? 92.983  22.721 -7.185  1.00 41.19  ? 756  ARG A C     1 
ATOM   6317 O O     . ARG C 3 756 ? 93.014  23.905 -7.554  1.00 41.39  ? 756  ARG A O     1 
ATOM   6318 C CB    . ARG C 3 756 ? 95.031  21.963 -8.452  1.00 38.87  ? 756  ARG A CB    1 
ATOM   6319 C CG    . ARG C 3 756 ? 95.860  20.770 -8.981  1.00 39.22  ? 756  ARG A CG    1 
ATOM   6320 C CD    . ARG C 3 756 ? 97.036  21.236 -9.848  1.00 35.57  ? 756  ARG A CD    1 
ATOM   6321 N NE    . ARG C 3 756 ? 97.852  22.208 -9.139  1.00 36.12  ? 756  ARG A NE    1 
ATOM   6322 C CZ    . ARG C 3 756 ? 98.663  23.080 -9.721  1.00 36.15  ? 756  ARG A CZ    1 
ATOM   6323 N NH1   . ARG C 3 756 ? 98.777  23.110 -11.042 1.00 39.30  ? 756  ARG A NH1   1 
ATOM   6324 N NH2   . ARG C 3 756 ? 99.345  23.933 -8.977  1.00 38.42  ? 756  ARG A NH2   1 
ATOM   6325 N N     . LEU C 3 757 ? 92.384  22.358 -6.063  1.00 41.95  ? 757  LEU A N     1 
ATOM   6326 C CA    . LEU C 3 757 ? 91.783  23.352 -5.194  1.00 38.73  ? 757  LEU A CA    1 
ATOM   6327 C C     . LEU C 3 757 ? 92.944  23.991 -4.464  1.00 37.91  ? 757  LEU A C     1 
ATOM   6328 O O     . LEU C 3 757 ? 93.625  23.335 -3.671  1.00 38.32  ? 757  LEU A O     1 
ATOM   6329 C CB    . LEU C 3 757 ? 90.851  22.675 -4.186  1.00 37.37  ? 757  LEU A CB    1 
ATOM   6330 C CG    . LEU C 3 757 ? 90.098  23.617 -3.266  1.00 37.26  ? 757  LEU A CG    1 
ATOM   6331 C CD1   . LEU C 3 757 ? 89.066  24.382 -4.077  1.00 33.11  ? 757  LEU A CD1   1 
ATOM   6332 C CD2   . LEU C 3 757 ? 89.432  22.822 -2.158  1.00 39.06  ? 757  LEU A CD2   1 
ATOM   6333 N N     . GLN C 3 758 ? 93.183  25.262 -4.732  1.00 37.46  ? 758  GLN A N     1 
ATOM   6334 C CA    . GLN C 3 758 ? 94.274  25.960 -4.080  1.00 38.59  ? 758  GLN A CA    1 
ATOM   6335 C C     . GLN C 3 758 ? 93.740  27.084 -3.224  1.00 40.63  ? 758  GLN A C     1 
ATOM   6336 O O     . GLN C 3 758 ? 93.765  28.248 -3.601  1.00 43.32  ? 758  GLN A O     1 
ATOM   6337 C CB    . GLN C 3 758 ? 95.240  26.492 -5.120  1.00 36.11  ? 758  GLN A CB    1 
ATOM   6338 C CG    . GLN C 3 758 ? 95.880  25.373 -5.919  1.00 38.08  ? 758  GLN A CG    1 
ATOM   6339 C CD    . GLN C 3 758 ? 96.329  25.826 -7.281  1.00 37.16  ? 758  GLN A CD    1 
ATOM   6340 O OE1   . GLN C 3 758 ? 97.187  26.700 -7.423  1.00 35.05  ? 758  GLN A OE1   1 
ATOM   6341 N NE2   . GLN C 3 758 ? 95.740  25.243 -8.294  1.00 37.15  ? 758  GLN A NE2   1 
ATOM   6342 N N     . PRO C 3 759 ? 93.278  26.745 -2.026  1.00 41.11  ? 759  PRO A N     1 
ATOM   6343 C CA    . PRO C 3 759 ? 92.722  27.712 -1.086  1.00 40.51  ? 759  PRO A CA    1 
ATOM   6344 C C     . PRO C 3 759 ? 93.705  28.625 -0.355  1.00 41.42  ? 759  PRO A C     1 
ATOM   6345 O O     . PRO C 3 759 ? 94.735  28.186 0.152   1.00 44.96  ? 759  PRO A O     1 
ATOM   6346 C CB    . PRO C 3 759 ? 91.955  26.817 -0.127  1.00 40.98  ? 759  PRO A CB    1 
ATOM   6347 C CG    . PRO C 3 759 ? 92.861  25.625 -0.034  1.00 37.11  ? 759  PRO A CG    1 
ATOM   6348 C CD    . PRO C 3 759 ? 93.194  25.376 -1.484  1.00 41.71  ? 759  PRO A CD    1 
ATOM   6349 N N     . THR C 3 760 ? 93.364  29.903 -0.303  1.00 40.00  ? 760  THR A N     1 
ATOM   6350 C CA    . THR C 3 760 ? 94.148  30.891 0.403   1.00 39.30  ? 760  THR A CA    1 
ATOM   6351 C C     . THR C 3 760 ? 93.679  30.720 1.832   1.00 39.36  ? 760  THR A C     1 
ATOM   6352 O O     . THR C 3 760 ? 92.471  30.651 2.066   1.00 40.58  ? 760  THR A O     1 
ATOM   6353 C CB    . THR C 3 760 ? 93.766  32.304 -0.044  1.00 40.02  ? 760  THR A CB    1 
ATOM   6354 O OG1   . THR C 3 760 ? 93.996  32.433 -1.448  1.00 41.17  ? 760  THR A OG1   1 
ATOM   6355 C CG2   . THR C 3 760 ? 94.574  33.352 0.724   1.00 35.29  ? 760  THR A CG2   1 
ATOM   6356 N N     . ILE C 3 761 ? 94.606  30.647 2.781   1.00 38.10  ? 761  ILE A N     1 
ATOM   6357 C CA    . ILE C 3 761 ? 94.234  30.482 4.181   1.00 40.24  ? 761  ILE A CA    1 
ATOM   6358 C C     . ILE C 3 761 ? 95.041  31.356 5.112   1.00 43.60  ? 761  ILE A C     1 
ATOM   6359 O O     . ILE C 3 761 ? 96.200  31.668 4.835   1.00 44.43  ? 761  ILE A O     1 
ATOM   6360 C CB    . ILE C 3 761 ? 94.456  29.057 4.680   1.00 38.77  ? 761  ILE A CB    1 
ATOM   6361 C CG1   . ILE C 3 761 ? 95.950  28.754 4.697   1.00 38.93  ? 761  ILE A CG1   1 
ATOM   6362 C CG2   . ILE C 3 761 ? 93.709  28.070 3.812   1.00 40.38  ? 761  ILE A CG2   1 
ATOM   6363 C CD1   . ILE C 3 761 ? 96.314  27.509 5.463   1.00 41.79  ? 761  ILE A CD1   1 
ATOM   6364 N N     . ASN C 3 762 ? 94.424  31.747 6.225   1.00 45.67  ? 762  ASN A N     1 
ATOM   6365 C CA    . ASN C 3 762 ? 95.112  32.540 7.221   1.00 45.45  ? 762  ASN A CA    1 
ATOM   6366 C C     . ASN C 3 762 ? 95.743  31.527 8.165   1.00 48.11  ? 762  ASN A C     1 
ATOM   6367 O O     . ASN C 3 762 ? 95.066  30.642 8.689   1.00 47.72  ? 762  ASN A O     1 
ATOM   6368 C CB    . ASN C 3 762 ? 94.146  33.420 8.003   1.00 43.77  ? 762  ASN A CB    1 
ATOM   6369 C CG    . ASN C 3 762 ? 93.570  34.549 7.174   1.00 44.41  ? 762  ASN A CG    1 
ATOM   6370 O OD1   . ASN C 3 762 ? 94.244  35.133 6.329   1.00 46.38  ? 762  ASN A OD1   1 
ATOM   6371 N ND2   . ASN C 3 762 ? 92.317  34.877 7.429   1.00 48.08  ? 762  ASN A ND2   1 
ATOM   6372 N N     . THR C 3 763 ? 97.047  31.668 8.368   1.00 49.91  ? 763  THR A N     1 
ATOM   6373 C CA    . THR C 3 763 ? 97.834  30.805 9.242   1.00 50.42  ? 763  THR A CA    1 
ATOM   6374 C C     . THR C 3 763 ? 97.680  31.192 10.718  1.00 52.02  ? 763  THR A C     1 
ATOM   6375 O O     . THR C 3 763 ? 97.209  32.289 11.039  1.00 53.82  ? 763  THR A O     1 
ATOM   6376 C CB    . THR C 3 763 ? 99.325  30.887 8.822   1.00 52.80  ? 763  THR A CB    1 
ATOM   6377 O OG1   . THR C 3 763 ? 99.528  30.057 7.666   1.00 53.68  ? 763  THR A OG1   1 
ATOM   6378 C CG2   . THR C 3 763 ? 100.248 30.468 9.939   1.00 51.83  ? 763  THR A CG2   1 
ATOM   6379 N N     . ASN C 3 764 ? 98.072  30.285 11.609  1.00 52.87  ? 764  ASN A N     1 
ATOM   6380 C CA    . ASN C 3 764 ? 98.000  30.519 13.047  1.00 55.09  ? 764  ASN A CA    1 
ATOM   6381 C C     . ASN C 3 764 ? 99.136  31.440 13.472  1.00 56.68  ? 764  ASN A C     1 
ATOM   6382 O O     . ASN C 3 764 ? 99.291  31.771 14.653  1.00 55.49  ? 764  ASN A O     1 
ATOM   6383 C CB    . ASN C 3 764 ? 98.124  29.193 13.790  1.00 55.46  ? 764  ASN A CB    1 
ATOM   6384 C CG    . ASN C 3 764 ? 96.969  28.271 13.523  1.00 55.54  ? 764  ASN A CG    1 
ATOM   6385 O OD1   . ASN C 3 764 ? 97.009  27.096 13.872  1.00 59.69  ? 764  ASN A OD1   1 
ATOM   6386 N ND2   . ASN C 3 764 ? 95.925  28.797 12.912  1.00 57.87  ? 764  ASN A ND2   1 
ATOM   6387 N N     . LYS C 3 765 ? 99.940  31.838 12.495  1.00 58.78  ? 765  LYS A N     1 
ATOM   6388 C CA    . LYS C 3 765 ? 101.073 32.715 12.744  1.00 61.28  ? 765  LYS A CA    1 
ATOM   6389 C C     . LYS C 3 765 ? 100.684 34.163 12.429  1.00 61.52  ? 765  LYS A C     1 
ATOM   6390 O O     . LYS C 3 765 ? 100.003 34.440 11.434  1.00 59.13  ? 765  LYS A O     1 
ATOM   6391 C CB    . LYS C 3 765 ? 102.259 32.279 11.877  1.00 62.07  ? 765  LYS A CB    1 
ATOM   6392 C CG    . LYS C 3 765 ? 103.595 32.825 12.311  1.00 65.64  ? 765  LYS A CG    1 
ATOM   6393 C CD    . LYS C 3 765 ? 104.119 32.110 13.555  1.00 67.21  ? 765  LYS A CD    1 
ATOM   6394 C CE    . LYS C 3 765 ? 105.531 32.583 13.899  1.00 66.84  ? 765  LYS A CE    1 
ATOM   6395 N NZ    . LYS C 3 765 ? 106.093 31.851 15.062  1.00 67.66  ? 765  LYS A NZ    1 
ATOM   6396 N N     . ASP C 3 766 ? 101.103 35.083 13.292  1.00 63.99  ? 766  ASP A N     1 
ATOM   6397 C CA    . ASP C 3 766 ? 100.800 36.494 13.084  1.00 68.30  ? 766  ASP A CA    1 
ATOM   6398 C C     . ASP C 3 766 ? 102.059 37.287 12.746  1.00 68.22  ? 766  ASP A C     1 
ATOM   6399 O O     . ASP C 3 766 ? 103.149 36.918 13.166  1.00 67.82  ? 766  ASP A O     1 
ATOM   6400 C CB    . ASP C 3 766 ? 100.110 37.081 14.315  1.00 70.34  ? 766  ASP A CB    1 
ATOM   6401 C CG    . ASP C 3 766 ? 98.754  36.456 14.564  1.00 73.04  ? 766  ASP A CG    1 
ATOM   6402 O OD1   . ASP C 3 766 ? 97.973  36.351 13.590  1.00 73.10  ? 766  ASP A OD1   1 
ATOM   6403 O OD2   . ASP C 3 766 ? 98.466  36.076 15.723  1.00 73.30  ? 766  ASP A OD2   1 
ATOM   6404 N N     . SER C 3 767 ? 101.900 38.364 11.977  1.00 68.96  ? 767  SER A N     1 
ATOM   6405 C CA    . SER C 3 767 ? 103.037 39.188 11.583  1.00 70.22  ? 767  SER A CA    1 
ATOM   6406 C C     . SER C 3 767 ? 103.172 40.456 12.415  1.00 71.39  ? 767  SER A C     1 
ATOM   6407 O O     . SER C 3 767 ? 104.164 40.636 13.122  1.00 72.88  ? 767  SER A O     1 
ATOM   6408 C CB    . SER C 3 767 ? 102.954 39.558 10.092  1.00 68.97  ? 767  SER A CB    1 
ATOM   6409 O OG    . SER C 3 767 ? 101.870 40.424 9.816   1.00 69.20  ? 767  SER A OG    1 
ATOM   6410 N N     . GLU C 3 768 ? 102.170 41.325 12.350  1.00 71.77  ? 768  GLU A N     1 
ATOM   6411 C CA    . GLU C 3 768 ? 102.224 42.585 13.081  1.00 71.60  ? 768  GLU A CA    1 
ATOM   6412 C C     . GLU C 3 768 ? 100.831 43.177 13.320  1.00 68.68  ? 768  GLU A C     1 
ATOM   6413 O O     . GLU C 3 768 ? 99.926  43.002 12.506  1.00 67.63  ? 768  GLU A O     1 
ATOM   6414 C CB    . GLU C 3 768 ? 103.096 43.562 12.285  1.00 75.52  ? 768  GLU A CB    1 
ATOM   6415 C CG    . GLU C 3 768 ? 103.070 45.011 12.733  1.00 82.92  ? 768  GLU A CG    1 
ATOM   6416 C CD    . GLU C 3 768 ? 103.881 45.912 11.802  1.00 87.56  ? 768  GLU A CD    1 
ATOM   6417 O OE1   . GLU C 3 768 ? 103.625 45.874 10.573  1.00 89.93  ? 768  GLU A OE1   1 
ATOM   6418 O OE2   . GLU C 3 768 ? 104.764 46.658 12.294  1.00 88.46  ? 768  GLU A OE2   1 
ATOM   6419 N N     . ILE C 3 769 ? 100.674 43.874 14.443  1.00 65.09  ? 769  ILE A N     1 
ATOM   6420 C CA    . ILE C 3 769 ? 99.410  44.506 14.800  1.00 60.21  ? 769  ILE A CA    1 
ATOM   6421 C C     . ILE C 3 769 ? 98.827  45.302 13.642  1.00 58.87  ? 769  ILE A C     1 
ATOM   6422 O O     . ILE C 3 769 ? 99.543  46.019 12.945  1.00 58.06  ? 769  ILE A O     1 
ATOM   6423 C CB    . ILE C 3 769 ? 99.587  45.450 16.016  1.00 57.91  ? 769  ILE A CB    1 
ATOM   6424 C CG1   . ILE C 3 769 ? 99.797  44.627 17.287  1.00 58.13  ? 769  ILE A CG1   1 
ATOM   6425 C CG2   . ILE C 3 769 ? 98.364  46.330 16.194  1.00 60.05  ? 769  ILE A CG2   1 
ATOM   6426 C CD1   . ILE C 3 769 ? 99.955  45.458 18.531  1.00 54.39  ? 769  ILE A CD1   1 
ATOM   6427 N N     . ASP C 3 770 ? 97.520  45.165 13.436  1.00 58.37  ? 770  ASP A N     1 
ATOM   6428 C CA    . ASP C 3 770 ? 96.836  45.883 12.367  1.00 58.50  ? 770  ASP A CA    1 
ATOM   6429 C C     . ASP C 3 770 ? 96.401  47.236 12.907  1.00 58.28  ? 770  ASP A C     1 
ATOM   6430 O O     . ASP C 3 770 ? 95.385  47.347 13.597  1.00 59.02  ? 770  ASP A O     1 
ATOM   6431 C CB    . ASP C 3 770 ? 95.603  45.111 11.899  1.00 58.29  ? 770  ASP A CB    1 
ATOM   6432 C CG    . ASP C 3 770 ? 95.046  45.643 10.592  1.00 57.97  ? 770  ASP A CG    1 
ATOM   6433 O OD1   . ASP C 3 770 ? 95.056  46.883 10.396  1.00 57.19  ? 770  ASP A OD1   1 
ATOM   6434 O OD2   . ASP C 3 770 ? 94.586  44.822 9.767   1.00 56.62  ? 770  ASP A OD2   1 
ATOM   6435 N N     . ALA C 3 771 ? 97.176  48.264 12.588  1.00 57.45  ? 771  ALA A N     1 
ATOM   6436 C CA    . ALA C 3 771 ? 96.889  49.613 13.054  1.00 57.10  ? 771  ALA A CA    1 
ATOM   6437 C C     . ALA C 3 771 ? 95.485  50.110 12.722  1.00 54.84  ? 771  ALA A C     1 
ATOM   6438 O O     . ALA C 3 771 ? 94.804  50.666 13.577  1.00 52.81  ? 771  ALA A O     1 
ATOM   6439 C CB    . ALA C 3 771 ? 97.914  50.572 12.490  1.00 59.47  ? 771  ALA A CB    1 
ATOM   6440 N N     . HIS C 3 772 ? 95.057  49.924 11.482  1.00 55.10  ? 772  HIS A N     1 
ATOM   6441 C CA    . HIS C 3 772 ? 93.744  50.391 11.108  1.00 56.71  ? 772  HIS A CA    1 
ATOM   6442 C C     . HIS C 3 772 ? 92.648  49.673 11.895  1.00 56.49  ? 772  HIS A C     1 
ATOM   6443 O O     . HIS C 3 772 ? 91.856  50.327 12.574  1.00 56.35  ? 772  HIS A O     1 
ATOM   6444 C CB    . HIS C 3 772 ? 93.499  50.222 9.610   1.00 60.86  ? 772  HIS A CB    1 
ATOM   6445 C CG    . HIS C 3 772 ? 92.259  50.914 9.126   1.00 67.73  ? 772  HIS A CG    1 
ATOM   6446 N ND1   . HIS C 3 772 ? 91.643  50.599 7.934   1.00 69.85  ? 772  HIS A ND1   1 
ATOM   6447 C CD2   . HIS C 3 772 ? 91.536  51.928 9.665   1.00 70.45  ? 772  HIS A CD2   1 
ATOM   6448 C CE1   . HIS C 3 772 ? 90.596  51.387 7.757   1.00 71.69  ? 772  HIS A CE1   1 
ATOM   6449 N NE2   . HIS C 3 772 ? 90.509  52.203 8.793   1.00 71.76  ? 772  HIS A NE2   1 
ATOM   6450 N N     . LYS C 3 773 ? 92.607  48.340 11.811  1.00 54.27  ? 773  LYS A N     1 
ATOM   6451 C CA    . LYS C 3 773 ? 91.589  47.560 12.518  1.00 50.44  ? 773  LYS A CA    1 
ATOM   6452 C C     . LYS C 3 773 ? 91.579  47.927 13.990  1.00 48.21  ? 773  LYS A C     1 
ATOM   6453 O O     . LYS C 3 773 ? 90.531  47.997 14.626  1.00 43.75  ? 773  LYS A O     1 
ATOM   6454 C CB    . LYS C 3 773 ? 91.836  46.052 12.372  1.00 50.99  ? 773  LYS A CB    1 
ATOM   6455 C CG    . LYS C 3 773 ? 91.390  45.458 11.034  1.00 54.21  ? 773  LYS A CG    1 
ATOM   6456 C CD    . LYS C 3 773 ? 91.332  43.928 11.100  1.00 56.61  ? 773  LYS A CD    1 
ATOM   6457 C CE    . LYS C 3 773 ? 91.106  43.296 9.725   1.00 59.15  ? 773  LYS A CE    1 
ATOM   6458 N NZ    . LYS C 3 773 ? 89.727  43.497 9.195   1.00 62.65  ? 773  LYS A NZ    1 
ATOM   6459 N N     . GLN C 3 774 ? 92.761  48.179 14.530  1.00 49.31  ? 774  GLN A N     1 
ATOM   6460 C CA    . GLN C 3 774 ? 92.855  48.539 15.923  1.00 50.15  ? 774  GLN A CA    1 
ATOM   6461 C C     . GLN C 3 774 ? 91.981  49.753 16.241  1.00 52.19  ? 774  GLN A C     1 
ATOM   6462 O O     . GLN C 3 774 ? 90.994  49.622 16.952  1.00 54.48  ? 774  GLN A O     1 
ATOM   6463 C CB    . GLN C 3 774 ? 94.308  48.812 16.297  1.00 49.18  ? 774  GLN A CB    1 
ATOM   6464 C CG    . GLN C 3 774 ? 94.617  48.565 17.752  1.00 48.84  ? 774  GLN A CG    1 
ATOM   6465 C CD    . GLN C 3 774 ? 94.583  47.088 18.134  1.00 50.73  ? 774  GLN A CD    1 
ATOM   6466 O OE1   . GLN C 3 774 ? 93.698  46.340 17.717  1.00 53.84  ? 774  GLN A OE1   1 
ATOM   6467 N NE2   . GLN C 3 774 ? 95.544  46.669 18.951  1.00 52.77  ? 774  GLN A NE2   1 
ATOM   6468 N N     . GLU C 3 775 ? 92.283  50.918 15.677  1.00 52.69  ? 775  GLU A N     1 
ATOM   6469 C CA    . GLU C 3 775 ? 91.497  52.117 16.002  1.00 52.98  ? 775  GLU A CA    1 
ATOM   6470 C C     . GLU C 3 775 ? 90.066  52.176 15.469  1.00 50.26  ? 775  GLU A C     1 
ATOM   6471 O O     . GLU C 3 775 ? 89.290  53.053 15.839  1.00 50.12  ? 775  GLU A O     1 
ATOM   6472 C CB    . GLU C 3 775 ? 92.267  53.384 15.580  1.00 55.38  ? 775  GLU A CB    1 
ATOM   6473 C CG    . GLU C 3 775 ? 91.773  54.072 14.320  1.00 62.88  ? 775  GLU A CG    1 
ATOM   6474 C CD    . GLU C 3 775 ? 92.664  55.246 13.917  1.00 67.21  ? 775  GLU A CD    1 
ATOM   6475 O OE1   . GLU C 3 775 ? 93.873  55.024 13.672  1.00 68.62  ? 775  GLU A OE1   1 
ATOM   6476 O OE2   . GLU C 3 775 ? 92.158  56.386 13.842  1.00 68.81  ? 775  GLU A OE2   1 
ATOM   6477 N N     . SER C 3 776 ? 89.701  51.257 14.596  1.00 47.88  ? 776  SER A N     1 
ATOM   6478 C CA    . SER C 3 776 ? 88.347  51.262 14.082  1.00 45.09  ? 776  SER A CA    1 
ATOM   6479 C C     . SER C 3 776 ? 87.430  50.451 15.002  1.00 43.91  ? 776  SER A C     1 
ATOM   6480 O O     . SER C 3 776 ? 86.223  50.625 14.992  1.00 44.15  ? 776  SER A O     1 
ATOM   6481 C CB    . SER C 3 776 ? 88.316  50.694 12.658  1.00 46.37  ? 776  SER A CB    1 
ATOM   6482 O OG    . SER C 3 776 ? 88.803  49.364 12.606  1.00 52.21  ? 776  SER A OG    1 
ATOM   6483 N N     . GLY C 3 777 ? 88.007  49.578 15.815  1.00 41.24  ? 777  GLY A N     1 
ATOM   6484 C CA    . GLY C 3 777 ? 87.181  48.783 16.694  1.00 42.72  ? 777  GLY A CA    1 
ATOM   6485 C C     . GLY C 3 777 ? 87.157  49.153 18.166  1.00 42.98  ? 777  GLY A C     1 
ATOM   6486 O O     . GLY C 3 777 ? 86.278  48.675 18.892  1.00 43.99  ? 777  GLY A O     1 
ATOM   6487 N N     . ILE C 3 778 ? 88.089  50.003 18.607  1.00 39.62  ? 778  ILE A N     1 
ATOM   6488 C CA    . ILE C 3 778 ? 88.168  50.375 20.010  1.00 34.51  ? 778  ILE A CA    1 
ATOM   6489 C C     . ILE C 3 778 ? 86.854  50.848 20.654  1.00 35.42  ? 778  ILE A C     1 
ATOM   6490 O O     . ILE C 3 778 ? 86.514  50.416 21.761  1.00 32.44  ? 778  ILE A O     1 
ATOM   6491 C CB    . ILE C 3 778 ? 89.263  51.459 20.252  1.00 32.63  ? 778  ILE A CB    1 
ATOM   6492 C CG1   . ILE C 3 778 ? 89.377  51.775 21.749  1.00 32.11  ? 778  ILE A CG1   1 
ATOM   6493 C CG2   . ILE C 3 778 ? 88.934  52.729 19.497  1.00 28.25  ? 778  ILE A CG2   1 
ATOM   6494 C CD1   . ILE C 3 778 ? 89.757  50.578 22.611  1.00 36.77  ? 778  ILE A CD1   1 
ATOM   6495 N N     . ALA C 3 779 ? 86.131  51.733 19.978  1.00 35.50  ? 779  ALA A N     1 
ATOM   6496 C CA    . ALA C 3 779 ? 84.883  52.265 20.525  1.00 37.72  ? 779  ALA A CA    1 
ATOM   6497 C C     . ALA C 3 779 ? 83.812  51.177 20.695  1.00 38.14  ? 779  ALA A C     1 
ATOM   6498 O O     . ALA C 3 779 ? 83.336  50.937 21.801  1.00 40.85  ? 779  ALA A O     1 
ATOM   6499 C CB    . ALA C 3 779 ? 84.359  53.405 19.646  1.00 36.14  ? 779  ALA A CB    1 
ATOM   6500 N N     . PRO C 3 780 ? 83.426  50.496 19.608  1.00 36.15  ? 780  PRO A N     1 
ATOM   6501 C CA    . PRO C 3 780 ? 82.399  49.471 19.851  1.00 35.12  ? 780  PRO A CA    1 
ATOM   6502 C C     . PRO C 3 780 ? 82.825  48.322 20.802  1.00 33.35  ? 780  PRO A C     1 
ATOM   6503 O O     . PRO C 3 780 ? 82.000  47.808 21.554  1.00 33.14  ? 780  PRO A O     1 
ATOM   6504 C CB    . PRO C 3 780 ? 82.026  48.999 18.433  1.00 34.77  ? 780  PRO A CB    1 
ATOM   6505 C CG    . PRO C 3 780 ? 83.250  49.304 17.617  1.00 34.40  ? 780  PRO A CG    1 
ATOM   6506 C CD    . PRO C 3 780 ? 83.740  50.625 18.174  1.00 34.70  ? 780  PRO A CD    1 
ATOM   6507 N N     . ASN C 3 781 ? 84.103  47.945 20.791  1.00 33.49  ? 781  ASN A N     1 
ATOM   6508 C CA    . ASN C 3 781 ? 84.585  46.872 21.657  1.00 31.24  ? 781  ASN A CA    1 
ATOM   6509 C C     . ASN C 3 781 ? 84.622  47.305 23.115  1.00 33.86  ? 781  ASN A C     1 
ATOM   6510 O O     . ASN C 3 781 ? 84.502  46.468 24.026  1.00 32.93  ? 781  ASN A O     1 
ATOM   6511 C CB    . ASN C 3 781 ? 85.977  46.428 21.236  1.00 32.57  ? 781  ASN A CB    1 
ATOM   6512 C CG    . ASN C 3 781 ? 85.981  45.646 19.947  1.00 31.82  ? 781  ASN A CG    1 
ATOM   6513 O OD1   . ASN C 3 781 ? 87.018  45.512 19.322  1.00 36.43  ? 781  ASN A OD1   1 
ATOM   6514 N ND2   . ASN C 3 781 ? 84.827  45.112 19.546  1.00 36.39  ? 781  ASN A ND2   1 
ATOM   6515 N N     . PHE C 3 782 ? 84.790  48.612 23.330  1.00 33.03  ? 782  PHE A N     1 
ATOM   6516 C CA    . PHE C 3 782 ? 84.814  49.174 24.673  1.00 32.32  ? 782  PHE A CA    1 
ATOM   6517 C C     . PHE C 3 782 ? 83.402  49.230 25.249  1.00 34.29  ? 782  PHE A C     1 
ATOM   6518 O O     . PHE C 3 782 ? 83.183  48.835 26.399  1.00 35.13  ? 782  PHE A O     1 
ATOM   6519 C CB    . PHE C 3 782 ? 85.403  50.579 24.651  1.00 31.83  ? 782  PHE A CB    1 
ATOM   6520 C CG    . PHE C 3 782 ? 85.543  51.190 26.008  1.00 32.97  ? 782  PHE A CG    1 
ATOM   6521 C CD1   . PHE C 3 782 ? 86.471  50.684 26.915  1.00 31.74  ? 782  PHE A CD1   1 
ATOM   6522 C CD2   . PHE C 3 782 ? 84.754  52.279 26.384  1.00 31.48  ? 782  PHE A CD2   1 
ATOM   6523 C CE1   . PHE C 3 782 ? 86.620  51.253 28.182  1.00 29.67  ? 782  PHE A CE1   1 
ATOM   6524 C CE2   . PHE C 3 782 ? 84.899  52.847 27.638  1.00 29.42  ? 782  PHE A CE2   1 
ATOM   6525 C CZ    . PHE C 3 782 ? 85.838  52.333 28.542  1.00 27.53  ? 782  PHE A CZ    1 
ATOM   6526 N N     . VAL C 3 783 ? 82.436  49.711 24.463  1.00 34.05  ? 783  VAL A N     1 
ATOM   6527 C CA    . VAL C 3 783 ? 81.072  49.758 24.969  1.00 35.23  ? 783  VAL A CA    1 
ATOM   6528 C C     . VAL C 3 783 ? 80.502  48.361 25.169  1.00 35.41  ? 783  VAL A C     1 
ATOM   6529 O O     . VAL C 3 783 ? 79.727  48.147 26.091  1.00 36.34  ? 783  VAL A O     1 
ATOM   6530 C CB    . VAL C 3 783 ? 80.111  50.555 24.057  1.00 37.08  ? 783  VAL A CB    1 
ATOM   6531 C CG1   . VAL C 3 783 ? 80.351  52.019 24.239  1.00 36.03  ? 783  VAL A CG1   1 
ATOM   6532 C CG2   . VAL C 3 783 ? 80.296  50.168 22.612  1.00 38.07  ? 783  VAL A CG2   1 
ATOM   6533 N N     . HIS C 3 784 ? 80.889  47.405 24.328  1.00 35.94  ? 784  HIS A N     1 
ATOM   6534 C CA    . HIS C 3 784 ? 80.369  46.056 24.491  1.00 36.93  ? 784  HIS A CA    1 
ATOM   6535 C C     . HIS C 3 784 ? 80.900  45.399 25.746  1.00 38.22  ? 784  HIS A C     1 
ATOM   6536 O O     . HIS C 3 784 ? 80.172  44.687 26.438  1.00 36.94  ? 784  HIS A O     1 
ATOM   6537 C CB    . HIS C 3 784 ? 80.696  45.189 23.286  1.00 38.51  ? 784  HIS A CB    1 
ATOM   6538 C CG    . HIS C 3 784 ? 79.876  45.516 22.078  1.00 44.28  ? 784  HIS A CG    1 
ATOM   6539 N ND1   . HIS C 3 784 ? 78.728  46.277 22.146  1.00 45.21  ? 784  HIS A ND1   1 
ATOM   6540 C CD2   . HIS C 3 784 ? 80.005  45.144 20.782  1.00 43.67  ? 784  HIS A CD2   1 
ATOM   6541 C CE1   . HIS C 3 784 ? 78.186  46.357 20.944  1.00 45.42  ? 784  HIS A CE1   1 
ATOM   6542 N NE2   . HIS C 3 784 ? 78.942  45.678 20.100  1.00 45.44  ? 784  HIS A NE2   1 
ATOM   6543 N N     . SER C 3 785 ? 82.175  45.631 26.041  1.00 39.51  ? 785  SER A N     1 
ATOM   6544 C CA    . SER C 3 785 ? 82.782  45.051 27.233  1.00 39.10  ? 785  SER A CA    1 
ATOM   6545 C C     . SER C 3 785 ? 82.122  45.734 28.417  1.00 39.26  ? 785  SER A C     1 
ATOM   6546 O O     . SER C 3 785 ? 82.008  45.175 29.507  1.00 39.20  ? 785  SER A O     1 
ATOM   6547 C CB    . SER C 3 785 ? 84.280  45.341 27.261  1.00 39.40  ? 785  SER A CB    1 
ATOM   6548 O OG    . SER C 3 785 ? 84.497  46.731 27.441  1.00 41.73  ? 785  SER A OG    1 
ATOM   6549 N N     . GLN C 3 786 ? 81.683  46.958 28.172  1.00 37.86  ? 786  GLN A N     1 
ATOM   6550 C CA    . GLN C 3 786 ? 81.045  47.760 29.184  1.00 39.08  ? 786  GLN A CA    1 
ATOM   6551 C C     . GLN C 3 786 ? 79.622  47.243 29.490  1.00 39.08  ? 786  GLN A C     1 
ATOM   6552 O O     . GLN C 3 786 ? 79.226  47.153 30.657  1.00 36.73  ? 786  GLN A O     1 
ATOM   6553 C CB    . GLN C 3 786 ? 81.027  49.217 28.697  1.00 41.70  ? 786  GLN A CB    1 
ATOM   6554 C CG    . GLN C 3 786 ? 81.233  50.239 29.770  1.00 44.08  ? 786  GLN A CG    1 
ATOM   6555 C CD    . GLN C 3 786 ? 82.447  49.956 30.643  1.00 42.30  ? 786  GLN A CD    1 
ATOM   6556 O OE1   . GLN C 3 786 ? 83.535  49.726 30.138  1.00 42.72  ? 786  GLN A OE1   1 
ATOM   6557 N NE2   . GLN C 3 786 ? 82.257  49.992 31.967  1.00 41.48  ? 786  GLN A NE2   1 
ATOM   6558 N N     . ASP C 3 787 ? 78.845  46.916 28.454  1.00 37.38  ? 787  ASP A N     1 
ATOM   6559 C CA    . ASP C 3 787 ? 77.505  46.409 28.710  1.00 38.26  ? 787  ASP A CA    1 
ATOM   6560 C C     . ASP C 3 787 ? 77.646  44.970 29.219  1.00 40.00  ? 787  ASP A C     1 
ATOM   6561 O O     . ASP C 3 787 ? 76.812  44.483 29.993  1.00 41.35  ? 787  ASP A O     1 
ATOM   6562 C CB    . ASP C 3 787 ? 76.609  46.492 27.456  1.00 37.56  ? 787  ASP A CB    1 
ATOM   6563 C CG    . ASP C 3 787 ? 76.936  45.447 26.384  1.00 39.14  ? 787  ASP A CG    1 
ATOM   6564 O OD1   . ASP C 3 787 ? 76.766  44.228 26.609  1.00 44.16  ? 787  ASP A OD1   1 
ATOM   6565 O OD2   . ASP C 3 787 ? 77.334  45.855 25.279  1.00 43.44  ? 787  ASP A OD2   1 
ATOM   6566 N N     . GLY C 3 788 ? 78.736  44.324 28.811  1.00 35.43  ? 788  GLY A N     1 
ATOM   6567 C CA    . GLY C 3 788 ? 79.003  42.970 29.222  1.00 33.87  ? 788  GLY A CA    1 
ATOM   6568 C C     . GLY C 3 788 ? 79.156  42.880 30.724  1.00 34.02  ? 788  GLY A C     1 
ATOM   6569 O O     . GLY C 3 788 ? 78.627  41.949 31.333  1.00 32.02  ? 788  GLY A O     1 
ATOM   6570 N N     . SER C 3 789 ? 79.861  43.827 31.340  1.00 28.29  ? 789  SER A N     1 
ATOM   6571 C CA    . SER C 3 789 ? 79.996  43.754 32.779  1.00 32.89  ? 789  SER A CA    1 
ATOM   6572 C C     . SER C 3 789 ? 78.739  44.297 33.483  1.00 34.56  ? 789  SER A C     1 
ATOM   6573 O O     . SER C 3 789 ? 78.469  43.967 34.644  1.00 33.89  ? 789  SER A O     1 
ATOM   6574 C CB    . SER C 3 789 ? 81.253  44.477 33.257  1.00 30.51  ? 789  SER A CB    1 
ATOM   6575 O OG    . SER C 3 789 ? 81.111  45.865 33.177  1.00 36.53  ? 789  SER A OG    1 
ATOM   6576 N N     . HIS C 3 790 ? 77.958  45.113 32.781  1.00 34.75  ? 790  HIS A N     1 
ATOM   6577 C CA    . HIS C 3 790 ? 76.742  45.620 33.377  1.00 33.64  ? 790  HIS A CA    1 
ATOM   6578 C C     . HIS C 3 790 ? 75.811  44.423 33.542  1.00 37.07  ? 790  HIS A C     1 
ATOM   6579 O O     . HIS C 3 790 ? 75.137  44.273 34.566  1.00 35.09  ? 790  HIS A O     1 
ATOM   6580 C CB    . HIS C 3 790 ? 76.045  46.654 32.490  1.00 31.55  ? 790  HIS A CB    1 
ATOM   6581 C CG    . HIS C 3 790 ? 74.729  47.111 33.051  1.00 26.53  ? 790  HIS A CG    1 
ATOM   6582 N ND1   . HIS C 3 790 ? 73.618  47.336 32.267  1.00 30.32  ? 790  HIS A ND1   1 
ATOM   6583 C CD2   . HIS C 3 790 ? 74.328  47.300 34.328  1.00 25.06  ? 790  HIS A CD2   1 
ATOM   6584 C CE1   . HIS C 3 790 ? 72.588  47.638 33.037  1.00 26.99  ? 790  HIS A CE1   1 
ATOM   6585 N NE2   . HIS C 3 790 ? 72.993  47.620 34.292  1.00 30.44  ? 790  HIS A NE2   1 
ATOM   6586 N N     . LEU C 3 791 ? 75.773  43.573 32.521  1.00 37.78  ? 791  LEU A N     1 
ATOM   6587 C CA    . LEU C 3 791 ? 74.921  42.397 32.577  1.00 38.36  ? 791  LEU A CA    1 
ATOM   6588 C C     . LEU C 3 791 ? 75.391  41.443 33.683  1.00 39.39  ? 791  LEU A C     1 
ATOM   6589 O O     . LEU C 3 791 ? 74.574  40.906 34.441  1.00 42.46  ? 791  LEU A O     1 
ATOM   6590 C CB    . LEU C 3 791 ? 74.890  41.693 31.206  1.00 35.26  ? 791  LEU A CB    1 
ATOM   6591 C CG    . LEU C 3 791 ? 74.070  40.392 31.094  1.00 36.22  ? 791  LEU A CG    1 
ATOM   6592 C CD1   . LEU C 3 791 ? 73.410  40.254 29.715  1.00 34.00  ? 791  LEU A CD1   1 
ATOM   6593 C CD2   . LEU C 3 791 ? 74.998  39.231 31.348  1.00 35.79  ? 791  LEU A CD2   1 
ATOM   6594 N N     . ARG C 3 792 ? 76.703  41.253 33.804  1.00 39.50  ? 792  ARG A N     1 
ATOM   6595 C CA    . ARG C 3 792 ? 77.222  40.343 34.826  1.00 37.94  ? 792  ARG A CA    1 
ATOM   6596 C C     . ARG C 3 792 ? 76.896  40.844 36.226  1.00 38.10  ? 792  ARG A C     1 
ATOM   6597 O O     . ARG C 3 792 ? 76.492  40.069 37.092  1.00 38.29  ? 792  ARG A O     1 
ATOM   6598 C CB    . ARG C 3 792 ? 78.740  40.149 34.668  1.00 34.95  ? 792  ARG A CB    1 
ATOM   6599 C CG    . ARG C 3 792 ? 79.131  39.391 33.403  1.00 34.17  ? 792  ARG A CG    1 
ATOM   6600 C CD    . ARG C 3 792 ? 80.574  38.933 33.435  1.00 30.32  ? 792  ARG A CD    1 
ATOM   6601 N NE    . ARG C 3 792 ? 81.498  40.057 33.411  1.00 33.61  ? 792  ARG A NE    1 
ATOM   6602 C CZ    . ARG C 3 792 ? 81.881  40.708 32.319  1.00 36.91  ? 792  ARG A CZ    1 
ATOM   6603 N NH1   . ARG C 3 792 ? 81.419  40.350 31.133  1.00 36.10  ? 792  ARG A NH1   1 
ATOM   6604 N NH2   . ARG C 3 792 ? 82.751  41.709 32.416  1.00 36.89  ? 792  ARG A NH2   1 
ATOM   6605 N N     . LYS C 3 793 ? 77.053  42.146 36.443  1.00 37.52  ? 793  LYS A N     1 
ATOM   6606 C CA    . LYS C 3 793 ? 76.774  42.723 37.750  1.00 37.64  ? 793  LYS A CA    1 
ATOM   6607 C C     . LYS C 3 793 ? 75.287  42.636 38.048  1.00 38.20  ? 793  LYS A C     1 
ATOM   6608 O O     . LYS C 3 793 ? 74.891  42.405 39.188  1.00 37.52  ? 793  LYS A O     1 
ATOM   6609 C CB    . LYS C 3 793 ? 77.249  44.178 37.800  1.00 40.10  ? 793  LYS A CB    1 
ATOM   6610 C CG    . LYS C 3 793 ? 78.751  44.286 37.614  1.00 42.31  ? 793  LYS A CG    1 
ATOM   6611 C CD    . LYS C 3 793 ? 79.277  45.695 37.850  1.00 48.17  ? 793  LYS A CD    1 
ATOM   6612 C CE    . LYS C 3 793 ? 79.393  45.981 39.330  1.00 49.36  ? 793  LYS A CE    1 
ATOM   6613 N NZ    . LYS C 3 793 ? 80.314  47.122 39.555  1.00 53.68  ? 793  LYS A NZ    1 
ATOM   6614 N N     . THR C 3 794 ? 74.468  42.811 37.014  1.00 37.31  ? 794  THR A N     1 
ATOM   6615 C CA    . THR C 3 794 ? 73.038  42.730 37.199  1.00 35.59  ? 794  THR A CA    1 
ATOM   6616 C C     . THR C 3 794 ? 72.667  41.320 37.623  1.00 35.69  ? 794  THR A C     1 
ATOM   6617 O O     . THR C 3 794 ? 71.794  41.159 38.463  1.00 36.92  ? 794  THR A O     1 
ATOM   6618 C CB    . THR C 3 794 ? 72.249  43.042 35.910  1.00 37.25  ? 794  THR A CB    1 
ATOM   6619 O OG1   . THR C 3 794 ? 72.528  44.372 35.494  1.00 39.05  ? 794  THR A OG1   1 
ATOM   6620 C CG2   . THR C 3 794 ? 70.745  42.886 36.152  1.00 34.68  ? 794  THR A CG2   1 
ATOM   6621 N N     . VAL C 3 795 ? 73.306  40.314 37.022  1.00 31.99  ? 795  VAL A N     1 
ATOM   6622 C CA    . VAL C 3 795 ? 73.002  38.935 37.369  1.00 34.86  ? 795  VAL A CA    1 
ATOM   6623 C C     . VAL C 3 795 ? 73.309  38.683 38.855  1.00 36.16  ? 795  VAL A C     1 
ATOM   6624 O O     . VAL C 3 795 ? 72.470  38.157 39.601  1.00 35.50  ? 795  VAL A O     1 
ATOM   6625 C CB    . VAL C 3 795 ? 73.820  37.912 36.518  1.00 35.26  ? 795  VAL A CB    1 
ATOM   6626 C CG1   . VAL C 3 795 ? 73.775  36.553 37.178  1.00 34.56  ? 795  VAL A CG1   1 
ATOM   6627 C CG2   . VAL C 3 795 ? 73.231  37.786 35.112  1.00 33.39  ? 795  VAL A CG2   1 
ATOM   6628 N N     . VAL C 3 796 ? 74.515  39.069 39.265  1.00 31.52  ? 796  VAL A N     1 
ATOM   6629 C CA    . VAL C 3 796 ? 74.953  38.891 40.628  1.00 30.70  ? 796  VAL A CA    1 
ATOM   6630 C C     . VAL C 3 796 ? 74.018  39.571 41.621  1.00 35.24  ? 796  VAL A C     1 
ATOM   6631 O O     . VAL C 3 796 ? 73.587  38.947 42.594  1.00 41.07  ? 796  VAL A O     1 
ATOM   6632 C CB    . VAL C 3 796 ? 76.377  39.446 40.804  1.00 27.53  ? 796  VAL A CB    1 
ATOM   6633 C CG1   . VAL C 3 796 ? 76.742  39.491 42.255  1.00 21.62  ? 796  VAL A CG1   1 
ATOM   6634 C CG2   . VAL C 3 796 ? 77.366  38.581 40.036  1.00 24.80  ? 796  VAL A CG2   1 
ATOM   6635 N N     . TRP C 3 797 ? 73.696  40.838 41.356  1.00 36.50  ? 797  TRP A N     1 
ATOM   6636 C CA    . TRP C 3 797 ? 72.842  41.655 42.206  1.00 35.76  ? 797  TRP A CA    1 
ATOM   6637 C C     . TRP C 3 797 ? 71.378  41.206 42.264  1.00 37.99  ? 797  TRP A C     1 
ATOM   6638 O O     . TRP C 3 797 ? 70.733  41.304 43.310  1.00 41.01  ? 797  TRP A O     1 
ATOM   6639 C CB    . TRP C 3 797 ? 72.941  43.125 41.742  1.00 37.42  ? 797  TRP A CB    1 
ATOM   6640 C CG    . TRP C 3 797 ? 72.096  44.110 42.507  1.00 37.10  ? 797  TRP A CG    1 
ATOM   6641 C CD1   . TRP C 3 797 ? 70.990  44.739 42.050  1.00 38.88  ? 797  TRP A CD1   1 
ATOM   6642 C CD2   . TRP C 3 797 ? 72.286  44.566 43.862  1.00 39.39  ? 797  TRP A CD2   1 
ATOM   6643 N NE1   . TRP C 3 797 ? 70.471  45.560 43.019  1.00 41.12  ? 797  TRP A NE1   1 
ATOM   6644 C CE2   . TRP C 3 797 ? 71.247  45.475 44.143  1.00 40.97  ? 797  TRP A CE2   1 
ATOM   6645 C CE3   . TRP C 3 797 ? 73.234  44.291 44.867  1.00 42.06  ? 797  TRP A CE3   1 
ATOM   6646 C CZ2   . TRP C 3 797 ? 71.119  46.124 45.391  1.00 39.02  ? 797  TRP A CZ2   1 
ATOM   6647 C CZ3   . TRP C 3 797 ? 73.107  44.941 46.123  1.00 40.43  ? 797  TRP A CZ3   1 
ATOM   6648 C CH2   . TRP C 3 797 ? 72.057  45.841 46.361  1.00 36.80  ? 797  TRP A CH2   1 
ATOM   6649 N N     . ALA C 3 798 ? 70.846  40.714 41.152  1.00 37.26  ? 798  ALA A N     1 
ATOM   6650 C CA    . ALA C 3 798 ? 69.458  40.289 41.127  1.00 34.66  ? 798  ALA A CA    1 
ATOM   6651 C C     . ALA C 3 798 ? 69.330  38.978 41.882  1.00 36.52  ? 798  ALA A C     1 
ATOM   6652 O O     . ALA C 3 798 ? 68.268  38.653 42.435  1.00 34.70  ? 798  ALA A O     1 
ATOM   6653 C CB    . ALA C 3 798 ? 68.983  40.122 39.689  1.00 32.46  ? 798  ALA A CB    1 
ATOM   6654 N N     . HIS C 3 799 ? 70.439  38.244 41.911  1.00 36.63  ? 799  HIS A N     1 
ATOM   6655 C CA    . HIS C 3 799 ? 70.514  36.950 42.571  1.00 40.21  ? 799  HIS A CA    1 
ATOM   6656 C C     . HIS C 3 799 ? 70.651  37.109 44.069  1.00 42.17  ? 799  HIS A C     1 
ATOM   6657 O O     . HIS C 3 799 ? 69.830  36.628 44.826  1.00 42.26  ? 799  HIS A O     1 
ATOM   6658 C CB    . HIS C 3 799 ? 71.718  36.153 42.043  1.00 41.45  ? 799  HIS A CB    1 
ATOM   6659 C CG    . HIS C 3 799 ? 71.748  34.728 42.497  1.00 41.43  ? 799  HIS A CG    1 
ATOM   6660 N ND1   . HIS C 3 799 ? 70.792  33.807 42.123  1.00 45.55  ? 799  HIS A ND1   1 
ATOM   6661 C CD2   . HIS C 3 799 ? 72.626  34.060 43.278  1.00 40.89  ? 799  HIS A CD2   1 
ATOM   6662 C CE1   . HIS C 3 799 ? 71.087  32.631 42.646  1.00 43.02  ? 799  HIS A CE1   1 
ATOM   6663 N NE2   . HIS C 3 799 ? 72.194  32.757 43.351  1.00 42.02  ? 799  HIS A NE2   1 
ATOM   6664 N N     . GLU C 3 800 ? 71.707  37.787 44.494  1.00 45.61  ? 800  GLU A N     1 
ATOM   6665 C CA    . GLU C 3 800 ? 71.954  37.973 45.916  1.00 47.40  ? 800  GLU A CA    1 
ATOM   6666 C C     . GLU C 3 800 ? 70.985  38.929 46.612  1.00 47.53  ? 800  GLU A C     1 
ATOM   6667 O O     . GLU C 3 800 ? 70.505  38.631 47.700  1.00 45.20  ? 800  GLU A O     1 
ATOM   6668 C CB    . GLU C 3 800 ? 73.389  38.441 46.117  1.00 46.82  ? 800  GLU A CB    1 
ATOM   6669 C CG    . GLU C 3 800 ? 74.369  37.628 45.297  1.00 47.91  ? 800  GLU A CG    1 
ATOM   6670 C CD    . GLU C 3 800 ? 75.816  37.924 45.640  1.00 53.55  ? 800  GLU A CD    1 
ATOM   6671 O OE1   . GLU C 3 800 ? 76.136  39.120 45.858  1.00 54.18  ? 800  GLU A OE1   1 
ATOM   6672 O OE2   . GLU C 3 800 ? 76.634  36.964 45.676  1.00 54.53  ? 800  GLU A OE2   1 
ATOM   6673 N N     . LYS C 3 801 ? 70.687  40.064 45.981  1.00 47.54  ? 801  LYS A N     1 
ATOM   6674 C CA    . LYS C 3 801 ? 69.792  41.041 46.588  1.00 48.56  ? 801  LYS A CA    1 
ATOM   6675 C C     . LYS C 3 801 ? 68.347  40.571 46.583  1.00 48.74  ? 801  LYS A C     1 
ATOM   6676 O O     . LYS C 3 801 ? 67.733  40.453 47.628  1.00 49.77  ? 801  LYS A O     1 
ATOM   6677 C CB    . LYS C 3 801 ? 69.898  42.389 45.878  1.00 50.31  ? 801  LYS A CB    1 
ATOM   6678 C CG    . LYS C 3 801 ? 69.734  43.576 46.811  1.00 49.28  ? 801  LYS A CG    1 
ATOM   6679 C CD    . LYS C 3 801 ? 68.359  43.625 47.433  1.00 52.19  ? 801  LYS A CD    1 
ATOM   6680 C CE    . LYS C 3 801 ? 68.236  44.795 48.385  1.00 55.21  ? 801  LYS A CE    1 
ATOM   6681 N NZ    . LYS C 3 801 ? 69.167  44.671 49.532  1.00 57.42  ? 801  LYS A NZ    1 
ATOM   6682 N N     . TYR C 3 802 ? 67.780  40.340 45.414  1.00 47.80  ? 802  TYR A N     1 
ATOM   6683 C CA    . TYR C 3 802 ? 66.409  39.853 45.367  1.00 47.10  ? 802  TYR A CA    1 
ATOM   6684 C C     . TYR C 3 802 ? 66.605  38.345 45.241  1.00 50.05  ? 802  TYR A C     1 
ATOM   6685 O O     . TYR C 3 802 ? 67.747  37.879 45.220  1.00 54.66  ? 802  TYR A O     1 
ATOM   6686 C CB    . TYR C 3 802 ? 65.691  40.464 44.167  1.00 45.17  ? 802  TYR A CB    1 
ATOM   6687 C CG    . TYR C 3 802 ? 65.815  41.968 44.174  1.00 45.24  ? 802  TYR A CG    1 
ATOM   6688 C CD1   . TYR C 3 802 ? 65.025  42.751 45.024  1.00 45.16  ? 802  TYR A CD1   1 
ATOM   6689 C CD2   . TYR C 3 802 ? 66.796  42.606 43.412  1.00 44.17  ? 802  TYR A CD2   1 
ATOM   6690 C CE1   . TYR C 3 802 ? 65.214  44.144 45.124  1.00 44.58  ? 802  TYR A CE1   1 
ATOM   6691 C CE2   . TYR C 3 802 ? 66.999  43.989 43.503  1.00 46.80  ? 802  TYR A CE2   1 
ATOM   6692 C CZ    . TYR C 3 802 ? 66.203  44.752 44.361  1.00 46.68  ? 802  TYR A CZ    1 
ATOM   6693 O OH    . TYR C 3 802 ? 66.411  46.106 44.441  1.00 45.39  ? 802  TYR A OH    1 
ATOM   6694 N N     . GLY C 3 803 ? 65.555  37.550 45.164  1.00 48.53  ? 803  GLY A N     1 
ATOM   6695 C CA    . GLY C 3 803 ? 65.855  36.125 45.085  1.00 53.44  ? 803  GLY A CA    1 
ATOM   6696 C C     . GLY C 3 803 ? 65.809  35.497 43.704  1.00 53.30  ? 803  GLY A C     1 
ATOM   6697 O O     . GLY C 3 803 ? 65.397  34.345 43.579  1.00 56.63  ? 803  GLY A O     1 
ATOM   6698 N N     . ILE C 3 804 ? 66.255  36.221 42.679  1.00 50.79  ? 804  ILE A N     1 
ATOM   6699 C CA    . ILE C 3 804 ? 66.183  35.716 41.312  1.00 48.08  ? 804  ILE A CA    1 
ATOM   6700 C C     . ILE C 3 804 ? 67.138  34.567 41.007  1.00 46.82  ? 804  ILE A C     1 
ATOM   6701 O O     . ILE C 3 804 ? 68.367  34.699 41.106  1.00 44.32  ? 804  ILE A O     1 
ATOM   6702 C CB    . ILE C 3 804 ? 66.374  36.870 40.310  1.00 48.09  ? 804  ILE A CB    1 
ATOM   6703 C CG1   . ILE C 3 804 ? 65.400  38.003 40.663  1.00 50.04  ? 804  ILE A CG1   1 
ATOM   6704 C CG2   . ILE C 3 804 ? 66.098  36.388 38.894  1.00 48.38  ? 804  ILE A CG2   1 
ATOM   6705 C CD1   . ILE C 3 804 ? 65.577  39.253 39.840  1.00 51.76  ? 804  ILE A CD1   1 
ATOM   6706 N N     . GLU C 3 805 ? 66.554  33.426 40.647  1.00 43.61  ? 805  GLU A N     1 
ATOM   6707 C CA    . GLU C 3 805 ? 67.341  32.230 40.347  1.00 44.63  ? 805  GLU A CA    1 
ATOM   6708 C C     . GLU C 3 805 ? 67.448  31.939 38.857  1.00 42.94  ? 805  GLU A C     1 
ATOM   6709 O O     . GLU C 3 805 ? 68.459  31.426 38.388  1.00 44.02  ? 805  GLU A O     1 
ATOM   6710 C CB    . GLU C 3 805 ? 66.735  31.008 41.050  1.00 45.60  ? 805  GLU A CB    1 
ATOM   6711 C CG    . GLU C 3 805 ? 66.694  31.089 42.573  1.00 50.49  ? 805  GLU A CG    1 
ATOM   6712 C CD    . GLU C 3 805 ? 66.016  29.877 43.203  1.00 53.85  ? 805  GLU A CD    1 
ATOM   6713 O OE1   . GLU C 3 805 ? 66.514  28.747 43.114  1.00 54.39  ? 805  GLU A OE1   1 
ATOM   6714 O OE2   . GLU C 3 805 ? 64.867  30.106 43.840  1.00 55.95  ? 805  GLU A OE2   1 
ATOM   6715 N N     . SER C 3 806 ? 66.402  32.286 38.119  1.00 40.77  ? 806  SER A N     1 
ATOM   6716 C CA    . SER C 3 806 ? 66.352  32.049 36.692  1.00 37.50  ? 806  SER A CA    1 
ATOM   6717 C C     . SER C 3 806 ? 66.614  33.311 35.883  1.00 35.92  ? 806  SER A C     1 
ATOM   6718 O O     . SER C 3 806 ? 66.045  34.358 36.153  1.00 38.77  ? 806  SER A O     1 
ATOM   6719 C CB    . SER C 3 806 ? 64.982  31.478 36.336  1.00 36.05  ? 806  SER A CB    1 
ATOM   6720 O OG    . SER C 3 806 ? 64.688  30.364 37.167  1.00 35.06  ? 806  SER A OG    1 
ATOM   6721 N N     . PHE C 3 807 ? 67.480  33.204 34.887  1.00 35.62  ? 807  PHE A N     1 
ATOM   6722 C CA    . PHE C 3 807 ? 67.799  34.335 34.018  1.00 33.63  ? 807  PHE A CA    1 
ATOM   6723 C C     . PHE C 3 807 ? 67.751  34.069 32.523  1.00 33.45  ? 807  PHE A C     1 
ATOM   6724 O O     . PHE C 3 807 ? 68.152  32.990 32.036  1.00 31.11  ? 807  PHE A O     1 
ATOM   6725 C CB    . PHE C 3 807 ? 69.180  34.877 34.337  1.00 34.89  ? 807  PHE A CB    1 
ATOM   6726 C CG    . PHE C 3 807 ? 69.303  35.424 35.718  1.00 39.44  ? 807  PHE A CG    1 
ATOM   6727 C CD1   . PHE C 3 807 ? 69.639  34.596 36.781  1.00 40.56  ? 807  PHE A CD1   1 
ATOM   6728 C CD2   . PHE C 3 807 ? 69.051  36.767 35.965  1.00 40.25  ? 807  PHE A CD2   1 
ATOM   6729 C CE1   . PHE C 3 807 ? 69.721  35.107 38.082  1.00 38.20  ? 807  PHE A CE1   1 
ATOM   6730 C CE2   . PHE C 3 807 ? 69.134  37.278 37.257  1.00 39.67  ? 807  PHE A CE2   1 
ATOM   6731 C CZ    . PHE C 3 807 ? 69.470  36.435 38.310  1.00 39.39  ? 807  PHE A CZ    1 
ATOM   6732 N N     . ALA C 3 808 ? 67.226  35.054 31.798  1.00 30.34  ? 808  ALA A N     1 
ATOM   6733 C CA    . ALA C 3 808 ? 67.189  35.000 30.339  1.00 33.07  ? 808  ALA A CA    1 
ATOM   6734 C C     . ALA C 3 808 ? 68.082  36.194 29.910  1.00 32.35  ? 808  ALA A C     1 
ATOM   6735 O O     . ALA C 3 808 ? 67.681  37.361 30.007  1.00 32.34  ? 808  ALA A O     1 
ATOM   6736 C CB    . ALA C 3 808 ? 65.773  35.140 29.823  1.00 28.99  ? 808  ALA A CB    1 
ATOM   6737 N N     . LEU C 3 809 ? 69.301  35.879 29.469  1.00 29.74  ? 809  LEU A N     1 
ATOM   6738 C CA    . LEU C 3 809 ? 70.276  36.893 29.089  1.00 29.90  ? 809  LEU A CA    1 
ATOM   6739 C C     . LEU C 3 809 ? 70.629  36.918 27.598  1.00 32.80  ? 809  LEU A C     1 
ATOM   6740 O O     . LEU C 3 809 ? 71.009  35.906 26.994  1.00 31.83  ? 809  LEU A O     1 
ATOM   6741 C CB    . LEU C 3 809 ? 71.539  36.703 29.917  1.00 29.32  ? 809  LEU A CB    1 
ATOM   6742 C CG    . LEU C 3 809 ? 71.281  36.463 31.420  1.00 30.67  ? 809  LEU A CG    1 
ATOM   6743 C CD1   . LEU C 3 809 ? 72.513  35.879 32.093  1.00 29.92  ? 809  LEU A CD1   1 
ATOM   6744 C CD2   . LEU C 3 809 ? 70.867  37.770 32.092  1.00 30.14  ? 809  LEU A CD2   1 
ATOM   6745 N N     . ILE C 3 810 ? 70.490  38.096 27.005  1.00 32.52  ? 810  ILE A N     1 
ATOM   6746 C CA    . ILE C 3 810 ? 70.798  38.274 25.597  1.00 33.31  ? 810  ILE A CA    1 
ATOM   6747 C C     . ILE C 3 810 ? 71.441  39.635 25.363  1.00 32.65  ? 810  ILE A C     1 
ATOM   6748 O O     . ILE C 3 810 ? 70.836  40.521 24.777  1.00 33.17  ? 810  ILE A O     1 
ATOM   6749 C CB    . ILE C 3 810 ? 69.532  38.182 24.700  1.00 31.60  ? 810  ILE A CB    1 
ATOM   6750 C CG1   . ILE C 3 810 ? 68.591  37.076 25.185  1.00 31.76  ? 810  ILE A CG1   1 
ATOM   6751 C CG2   . ILE C 3 810 ? 69.954  37.920 23.260  1.00 29.48  ? 810  ILE A CG2   1 
ATOM   6752 C CD1   . ILE C 3 810 ? 67.338  36.878 24.271  1.00 28.75  ? 810  ILE A CD1   1 
ATOM   6753 N N     . HIS C 3 811 ? 72.661  39.802 25.847  1.00 37.71  ? 811  HIS A N     1 
ATOM   6754 C CA    . HIS C 3 811 ? 73.433  41.024 25.643  1.00 40.95  ? 811  HIS A CA    1 
ATOM   6755 C C     . HIS C 3 811 ? 72.842  42.395 26.002  1.00 44.83  ? 811  HIS A C     1 
ATOM   6756 O O     . HIS C 3 811 ? 73.597  43.328 26.198  1.00 50.58  ? 811  HIS A O     1 
ATOM   6757 C CB    . HIS C 3 811 ? 73.952  41.040 24.195  1.00 39.45  ? 811  HIS A CB    1 
ATOM   6758 C CG    . HIS C 3 811 ? 74.582  39.748 23.775  1.00 41.64  ? 811  HIS A CG    1 
ATOM   6759 N ND1   . HIS C 3 811 ? 75.699  39.230 24.395  1.00 40.27  ? 811  HIS A ND1   1 
ATOM   6760 C CD2   . HIS C 3 811 ? 74.205  38.834 22.850  1.00 39.08  ? 811  HIS A CD2   1 
ATOM   6761 C CE1   . HIS C 3 811 ? 75.977  38.050 23.874  1.00 44.17  ? 811  HIS A CE1   1 
ATOM   6762 N NE2   . HIS C 3 811 ? 75.085  37.786 22.934  1.00 42.04  ? 811  HIS A NE2   1 
ATOM   6763 N N     . ASP C 3 812 ? 71.532  42.572 26.051  1.00 45.09  ? 812  ASP A N     1 
ATOM   6764 C CA    . ASP C 3 812 ? 70.985  43.871 26.459  1.00 48.97  ? 812  ASP A CA    1 
ATOM   6765 C C     . ASP C 3 812 ? 69.487  43.725 26.599  1.00 49.23  ? 812  ASP A C     1 
ATOM   6766 O O     . ASP C 3 812 ? 68.714  44.676 26.464  1.00 51.27  ? 812  ASP A O     1 
ATOM   6767 C CB    . ASP C 3 812 ? 71.360  45.012 25.480  1.00 50.40  ? 812  ASP A CB    1 
ATOM   6768 C CG    . ASP C 3 812 ? 70.785  44.824 24.095  1.00 57.22  ? 812  ASP A CG    1 
ATOM   6769 O OD1   . ASP C 3 812 ? 70.434  43.685 23.723  1.00 60.71  ? 812  ASP A OD1   1 
ATOM   6770 O OD2   . ASP C 3 812 ? 70.700  45.822 23.362  1.00 62.52  ? 812  ASP A OD2   1 
ATOM   6771 N N     . SER C 3 813 ? 69.119  42.487 26.883  1.00 48.38  ? 813  SER A N     1 
ATOM   6772 C CA    . SER C 3 813 ? 67.762  42.057 27.094  1.00 47.68  ? 813  SER A CA    1 
ATOM   6773 C C     . SER C 3 813 ? 67.902  41.206 28.359  1.00 46.61  ? 813  SER A C     1 
ATOM   6774 O O     . SER C 3 813 ? 68.711  40.284 28.396  1.00 46.66  ? 813  SER A O     1 
ATOM   6775 C CB    . SER C 3 813 ? 67.309  41.203 25.907  1.00 48.48  ? 813  SER A CB    1 
ATOM   6776 O OG    . SER C 3 813 ? 65.971  40.787 26.059  1.00 48.60  ? 813  SER A OG    1 
ATOM   6777 N N     . PHE C 3 814 ? 67.151  41.546 29.401  1.00 44.87  ? 814  PHE A N     1 
ATOM   6778 C CA    . PHE C 3 814 ? 67.197  40.823 30.668  1.00 41.73  ? 814  PHE A CA    1 
ATOM   6779 C C     . PHE C 3 814 ? 65.824  40.221 30.918  1.00 40.64  ? 814  PHE A C     1 
ATOM   6780 O O     . PHE C 3 814 ? 64.824  40.925 30.871  1.00 40.85  ? 814  PHE A O     1 
ATOM   6781 C CB    . PHE C 3 814 ? 67.541  41.780 31.817  1.00 43.01  ? 814  PHE A CB    1 
ATOM   6782 C CG    . PHE C 3 814 ? 68.837  42.500 31.639  1.00 46.22  ? 814  PHE A CG    1 
ATOM   6783 C CD1   . PHE C 3 814 ? 68.944  43.562 30.747  1.00 47.70  ? 814  PHE A CD1   1 
ATOM   6784 C CD2   . PHE C 3 814 ? 69.962  42.117 32.358  1.00 47.49  ? 814  PHE A CD2   1 
ATOM   6785 C CE1   . PHE C 3 814 ? 70.162  44.241 30.570  1.00 48.28  ? 814  PHE A CE1   1 
ATOM   6786 C CE2   . PHE C 3 814 ? 71.189  42.786 32.192  1.00 47.75  ? 814  PHE A CE2   1 
ATOM   6787 C CZ    . PHE C 3 814 ? 71.288  43.849 31.296  1.00 46.75  ? 814  PHE A CZ    1 
ATOM   6788 N N     . GLY C 3 815 ? 65.769  38.924 31.200  1.00 40.29  ? 815  GLY A N     1 
ATOM   6789 C CA    . GLY C 3 815 ? 64.483  38.286 31.432  1.00 36.75  ? 815  GLY A CA    1 
ATOM   6790 C C     . GLY C 3 815 ? 64.473  37.314 32.593  1.00 37.32  ? 815  GLY A C     1 
ATOM   6791 O O     . GLY C 3 815 ? 65.537  36.871 33.048  1.00 36.63  ? 815  GLY A O     1 
ATOM   6792 N N     . THR C 3 816 ? 63.262  37.003 33.065  1.00 35.96  ? 816  THR A N     1 
ATOM   6793 C CA    . THR C 3 816 ? 63.003  36.068 34.150  1.00 34.01  ? 816  THR A CA    1 
ATOM   6794 C C     . THR C 3 816 ? 61.509  35.797 34.234  1.00 32.23  ? 816  THR A C     1 
ATOM   6795 O O     . THR C 3 816 ? 60.724  36.329 33.450  1.00 32.35  ? 816  THR A O     1 
ATOM   6796 C CB    . THR C 3 816 ? 63.451  36.621 35.505  1.00 38.64  ? 816  THR A CB    1 
ATOM   6797 O OG1   . THR C 3 816 ? 64.817  37.040 35.405  1.00 48.36  ? 816  THR A OG1   1 
ATOM   6798 C CG2   . THR C 3 816 ? 63.357  35.547 36.591  1.00 33.13  ? 816  THR A CG2   1 
ATOM   6799 N N     . ILE C 3 817 ? 61.115  34.970 35.190  1.00 30.71  ? 817  ILE A N     1 
ATOM   6800 C CA    . ILE C 3 817 ? 59.705  34.625 35.380  1.00 28.71  ? 817  ILE A CA    1 
ATOM   6801 C C     . ILE C 3 817 ? 58.932  35.830 35.904  1.00 29.31  ? 817  ILE A C     1 
ATOM   6802 O O     . ILE C 3 817 ? 59.494  36.678 36.594  1.00 28.32  ? 817  ILE A O     1 
ATOM   6803 C CB    . ILE C 3 817 ? 59.580  33.475 36.375  1.00 29.81  ? 817  ILE A CB    1 
ATOM   6804 C CG1   . ILE C 3 817 ? 60.114  33.932 37.740  1.00 25.82  ? 817  ILE A CG1   1 
ATOM   6805 C CG2   . ILE C 3 817 ? 60.412  32.262 35.846  1.00 33.28  ? 817  ILE A CG2   1 
ATOM   6806 C CD1   . ILE C 3 817 ? 59.908  32.953 38.870  1.00 26.94  ? 817  ILE A CD1   1 
ATOM   6807 N N     . PRO C 3 818 ? 57.626  35.898 35.610  1.00 30.18  ? 818  PRO A N     1 
ATOM   6808 C CA    . PRO C 3 818 ? 56.735  36.982 36.024  1.00 32.09  ? 818  PRO A CA    1 
ATOM   6809 C C     . PRO C 3 818 ? 56.833  37.487 37.455  1.00 37.45  ? 818  PRO A C     1 
ATOM   6810 O O     . PRO C 3 818 ? 56.996  38.693 37.682  1.00 44.90  ? 818  PRO A O     1 
ATOM   6811 C CB    . PRO C 3 818 ? 55.361  36.431 35.689  1.00 32.26  ? 818  PRO A CB    1 
ATOM   6812 C CG    . PRO C 3 818 ? 55.640  35.634 34.442  1.00 27.73  ? 818  PRO A CG    1 
ATOM   6813 C CD    . PRO C 3 818 ? 56.876  34.887 34.836  1.00 31.49  ? 818  PRO A CD    1 
ATOM   6814 N N     . ALA C 3 819 ? 56.751  36.600 38.434  1.00 37.81  ? 819  ALA A N     1 
ATOM   6815 C CA    . ALA C 3 819 ? 56.809  37.062 39.817  1.00 36.53  ? 819  ALA A CA    1 
ATOM   6816 C C     . ALA C 3 819 ? 58.115  37.768 40.239  1.00 38.27  ? 819  ALA A C     1 
ATOM   6817 O O     . ALA C 3 819 ? 58.143  38.445 41.283  1.00 40.38  ? 819  ALA A O     1 
ATOM   6818 C CB    . ALA C 3 819 ? 56.519  35.922 40.737  1.00 30.38  ? 819  ALA A CB    1 
ATOM   6819 N N     . ASP C 3 820 ? 59.185  37.619 39.455  1.00 37.48  ? 820  ASP A N     1 
ATOM   6820 C CA    . ASP C 3 820 ? 60.476  38.249 39.783  1.00 35.95  ? 820  ASP A CA    1 
ATOM   6821 C C     . ASP C 3 820 ? 60.782  39.411 38.841  1.00 34.30  ? 820  ASP A C     1 
ATOM   6822 O O     . ASP C 3 820 ? 61.782  40.114 38.995  1.00 34.41  ? 820  ASP A O     1 
ATOM   6823 C CB    . ASP C 3 820 ? 61.628  37.228 39.712  1.00 41.96  ? 820  ASP A CB    1 
ATOM   6824 C CG    . ASP C 3 820 ? 61.529  36.139 40.787  1.00 45.83  ? 820  ASP A CG    1 
ATOM   6825 O OD1   . ASP C 3 820 ? 61.173  36.446 41.951  1.00 51.05  ? 820  ASP A OD1   1 
ATOM   6826 O OD2   . ASP C 3 820 ? 61.829  34.968 40.480  1.00 51.57  ? 820  ASP A OD2   1 
ATOM   6827 N N     . ALA C 3 821 ? 59.899  39.621 37.874  1.00 31.80  ? 821  ALA A N     1 
ATOM   6828 C CA    . ALA C 3 821 ? 60.075  40.692 36.913  1.00 32.77  ? 821  ALA A CA    1 
ATOM   6829 C C     . ALA C 3 821 ? 60.219  42.048 37.591  1.00 36.55  ? 821  ALA A C     1 
ATOM   6830 O O     . ALA C 3 821 ? 61.171  42.788 37.336  1.00 39.94  ? 821  ALA A O     1 
ATOM   6831 C CB    . ALA C 3 821 ? 58.894  40.706 35.942  1.00 30.77  ? 821  ALA A CB    1 
ATOM   6832 N N     . ALA C 3 822 ? 59.273  42.371 38.461  1.00 36.72  ? 822  ALA A N     1 
ATOM   6833 C CA    . ALA C 3 822 ? 59.290  43.654 39.152  1.00 37.20  ? 822  ALA A CA    1 
ATOM   6834 C C     . ALA C 3 822 ? 60.649  43.991 39.773  1.00 34.65  ? 822  ALA A C     1 
ATOM   6835 O O     . ALA C 3 822 ? 61.082  45.141 39.750  1.00 38.81  ? 822  ALA A O     1 
ATOM   6836 C CB    . ALA C 3 822 ? 58.183  43.693 40.223  1.00 33.30  ? 822  ALA A CB    1 
ATOM   6837 N N     . ASN C 3 823 ? 61.325  43.002 40.323  1.00 35.53  ? 823  ASN A N     1 
ATOM   6838 C CA    . ASN C 3 823 ? 62.624  43.258 40.937  1.00 36.56  ? 823  ASN A CA    1 
ATOM   6839 C C     . ASN C 3 823 ? 63.721  43.261 39.889  1.00 35.48  ? 823  ASN A C     1 
ATOM   6840 O O     . ASN C 3 823 ? 64.742  43.945 40.067  1.00 35.96  ? 823  ASN A O     1 
ATOM   6841 C CB    . ASN C 3 823 ? 62.963  42.193 41.997  1.00 36.09  ? 823  ASN A CB    1 
ATOM   6842 C CG    . ASN C 3 823 ? 62.055  42.248 43.223  1.00 37.97  ? 823  ASN A CG    1 
ATOM   6843 O OD1   . ASN C 3 823 ? 61.682  41.215 43.785  1.00 39.82  ? 823  ASN A OD1   1 
ATOM   6844 N ND2   . ASN C 3 823 ? 61.718  43.445 43.652  1.00 41.61  ? 823  ASN A ND2   1 
ATOM   6845 N N     . LEU C 3 824 ? 63.544  42.483 38.811  1.00 33.01  ? 824  LEU A N     1 
ATOM   6846 C CA    . LEU C 3 824 ? 64.589  42.455 37.788  1.00 32.35  ? 824  LEU A CA    1 
ATOM   6847 C C     . LEU C 3 824 ? 64.646  43.846 37.170  1.00 30.37  ? 824  LEU A C     1 
ATOM   6848 O O     . LEU C 3 824 ? 65.721  44.403 36.948  1.00 32.27  ? 824  LEU A O     1 
ATOM   6849 C CB    . LEU C 3 824 ? 64.299  41.407 36.703  1.00 27.17  ? 824  LEU A CB    1 
ATOM   6850 C CG    . LEU C 3 824 ? 65.311  41.476 35.549  1.00 26.33  ? 824  LEU A CG    1 
ATOM   6851 C CD1   . LEU C 3 824 ? 66.723  41.432 36.108  1.00 22.48  ? 824  LEU A CD1   1 
ATOM   6852 C CD2   . LEU C 3 824 ? 65.087  40.340 34.563  1.00 21.32  ? 824  LEU A CD2   1 
ATOM   6853 N N     . PHE C 3 825 ? 63.459  44.387 36.935  1.00 30.49  ? 825  PHE A N     1 
ATOM   6854 C CA    . PHE C 3 825 ? 63.252  45.704 36.356  1.00 32.45  ? 825  PHE A CA    1 
ATOM   6855 C C     . PHE C 3 825 ? 63.939  46.753 37.212  1.00 34.81  ? 825  PHE A C     1 
ATOM   6856 O O     . PHE C 3 825 ? 64.469  47.757 36.714  1.00 34.30  ? 825  PHE A O     1 
ATOM   6857 C CB    . PHE C 3 825 ? 61.741  45.973 36.281  1.00 32.43  ? 825  PHE A CB    1 
ATOM   6858 C CG    . PHE C 3 825 ? 61.375  47.339 35.756  1.00 32.38  ? 825  PHE A CG    1 
ATOM   6859 C CD1   . PHE C 3 825 ? 61.530  48.473 36.546  1.00 30.42  ? 825  PHE A CD1   1 
ATOM   6860 C CD2   . PHE C 3 825 ? 60.834  47.480 34.492  1.00 32.16  ? 825  PHE A CD2   1 
ATOM   6861 C CE1   . PHE C 3 825 ? 61.140  49.727 36.079  1.00 34.37  ? 825  PHE A CE1   1 
ATOM   6862 C CE2   . PHE C 3 825 ? 60.440  48.736 34.009  1.00 32.18  ? 825  PHE A CE2   1 
ATOM   6863 C CZ    . PHE C 3 825 ? 60.590  49.854 34.801  1.00 31.49  ? 825  PHE A CZ    1 
ATOM   6864 N N     . LYS C 3 826 ? 63.924  46.520 38.512  1.00 35.07  ? 826  LYS A N     1 
ATOM   6865 C CA    . LYS C 3 826 ? 64.561  47.444 39.432  1.00 38.47  ? 826  LYS A CA    1 
ATOM   6866 C C     . LYS C 3 826 ? 66.086  47.240 39.469  1.00 37.27  ? 826  LYS A C     1 
ATOM   6867 O O     . LYS C 3 826 ? 66.849  48.217 39.509  1.00 39.78  ? 826  LYS A O     1 
ATOM   6868 C CB    . LYS C 3 826 ? 63.938  47.258 40.831  1.00 41.35  ? 826  LYS A CB    1 
ATOM   6869 C CG    . LYS C 3 826 ? 64.562  48.049 41.977  1.00 43.62  ? 826  LYS A CG    1 
ATOM   6870 C CD    . LYS C 3 826 ? 63.735  47.798 43.251  1.00 49.92  ? 826  LYS A CD    1 
ATOM   6871 C CE    . LYS C 3 826 ? 64.357  48.393 44.501  1.00 54.60  ? 826  LYS A CE    1 
ATOM   6872 N NZ    . LYS C 3 826 ? 64.156  49.887 44.607  1.00 59.36  ? 826  LYS A NZ    1 
ATOM   6873 N N     . ALA C 3 827 ? 66.519  45.980 39.417  1.00 34.04  ? 827  ALA A N     1 
ATOM   6874 C CA    . ALA C 3 827 ? 67.933  45.647 39.492  1.00 32.51  ? 827  ALA A CA    1 
ATOM   6875 C C     . ALA C 3 827 ? 68.806  46.138 38.330  1.00 33.45  ? 827  ALA A C     1 
ATOM   6876 O O     . ALA C 3 827 ? 69.966  46.492 38.556  1.00 29.98  ? 827  ALA A O     1 
ATOM   6877 C CB    . ALA C 3 827 ? 68.105  44.108 39.683  1.00 33.66  ? 827  ALA A CB    1 
ATOM   6878 N N     . VAL C 3 828 ? 68.288  46.145 37.096  1.00 33.84  ? 828  VAL A N     1 
ATOM   6879 C CA    . VAL C 3 828 ? 69.110  46.631 35.969  1.00 36.42  ? 828  VAL A CA    1 
ATOM   6880 C C     . VAL C 3 828 ? 69.442  48.095 36.123  1.00 34.82  ? 828  VAL A C     1 
ATOM   6881 O O     . VAL C 3 828 ? 70.542  48.527 35.778  1.00 30.59  ? 828  VAL A O     1 
ATOM   6882 C CB    . VAL C 3 828 ? 68.430  46.501 34.584  1.00 38.18  ? 828  VAL A CB    1 
ATOM   6883 C CG1   . VAL C 3 828 ? 69.021  45.329 33.848  1.00 40.12  ? 828  VAL A CG1   1 
ATOM   6884 C CG2   . VAL C 3 828 ? 66.926  46.380 34.735  1.00 34.14  ? 828  VAL A CG2   1 
ATOM   6885 N N     . ARG C 3 829 ? 68.461  48.858 36.603  1.00 34.40  ? 829  ARG A N     1 
ATOM   6886 C CA    . ARG C 3 829 ? 68.651  50.285 36.836  1.00 37.01  ? 829  ARG A CA    1 
ATOM   6887 C C     . ARG C 3 829 ? 69.640  50.474 37.963  1.00 36.82  ? 829  ARG A C     1 
ATOM   6888 O O     . ARG C 3 829 ? 70.578  51.225 37.830  1.00 38.97  ? 829  ARG A O     1 
ATOM   6889 C CB    . ARG C 3 829 ? 67.350  50.970 37.269  1.00 40.22  ? 829  ARG A CB    1 
ATOM   6890 C CG    . ARG C 3 829 ? 66.172  50.665 36.422  1.00 41.22  ? 829  ARG A CG    1 
ATOM   6891 C CD    . ARG C 3 829 ? 66.500  51.044 35.022  1.00 44.51  ? 829  ARG A CD    1 
ATOM   6892 N NE    . ARG C 3 829 ? 65.406  50.762 34.103  1.00 45.81  ? 829  ARG A NE    1 
ATOM   6893 C CZ    . ARG C 3 829 ? 64.130  50.919 34.400  1.00 36.43  ? 829  ARG A CZ    1 
ATOM   6894 N NH1   . ARG C 3 829 ? 63.820  51.340 35.605  1.00 34.66  ? 829  ARG A NH1   1 
ATOM   6895 N NH2   . ARG C 3 829 ? 63.203  50.701 33.475  1.00 27.79  ? 829  ARG A NH2   1 
ATOM   6896 N N     . GLU C 3 830 ? 69.399  49.805 39.090  1.00 38.10  ? 830  GLU A N     1 
ATOM   6897 C CA    . GLU C 3 830 ? 70.279  49.942 40.252  1.00 41.48  ? 830  GLU A CA    1 
ATOM   6898 C C     . GLU C 3 830 ? 71.736  49.619 39.923  1.00 43.23  ? 830  GLU A C     1 
ATOM   6899 O O     . GLU C 3 830 ? 72.646  50.359 40.276  1.00 39.67  ? 830  GLU A O     1 
ATOM   6900 C CB    . GLU C 3 830 ? 69.795  49.048 41.392  1.00 41.90  ? 830  GLU A CB    1 
ATOM   6901 C CG    . GLU C 3 830 ? 68.366  49.319 41.771  1.00 51.67  ? 830  GLU A CG    1 
ATOM   6902 C CD    . GLU C 3 830 ? 67.970  48.693 43.098  1.00 54.66  ? 830  GLU A CD    1 
ATOM   6903 O OE1   . GLU C 3 830 ? 68.122  47.464 43.255  1.00 56.33  ? 830  GLU A OE1   1 
ATOM   6904 O OE2   . GLU C 3 830 ? 67.499  49.442 43.982  1.00 57.69  ? 830  GLU A OE2   1 
ATOM   6905 N N     . THR C 3 831 ? 71.945  48.510 39.224  1.00 45.68  ? 831  THR A N     1 
ATOM   6906 C CA    . THR C 3 831 ? 73.285  48.092 38.863  1.00 45.85  ? 831  THR A CA    1 
ATOM   6907 C C     . THR C 3 831 ? 73.897  49.108 37.887  1.00 44.76  ? 831  THR A C     1 
ATOM   6908 O O     . THR C 3 831 ? 75.085  49.415 37.959  1.00 43.63  ? 831  THR A O     1 
ATOM   6909 C CB    . THR C 3 831 ? 73.236  46.662 38.289  1.00 46.08  ? 831  THR A CB    1 
ATOM   6910 O OG1   . THR C 3 831 ? 74.562  46.191 38.080  1.00 53.27  ? 831  THR A OG1   1 
ATOM   6911 C CG2   . THR C 3 831 ? 72.484  46.628 37.000  1.00 46.80  ? 831  THR A CG2   1 
ATOM   6912 N N     . MET C 3 832 ? 73.073  49.662 37.005  1.00 44.57  ? 832  MET A N     1 
ATOM   6913 C CA    . MET C 3 832 ? 73.528  50.672 36.043  1.00 44.67  ? 832  MET A CA    1 
ATOM   6914 C C     . MET C 3 832 ? 73.971  51.935 36.795  1.00 44.85  ? 832  MET A C     1 
ATOM   6915 O O     . MET C 3 832 ? 75.080  52.443 36.604  1.00 42.90  ? 832  MET A O     1 
ATOM   6916 C CB    . MET C 3 832 ? 72.389  51.024 35.076  1.00 46.63  ? 832  MET A CB    1 
ATOM   6917 C CG    . MET C 3 832 ? 72.726  52.029 33.999  1.00 48.83  ? 832  MET A CG    1 
ATOM   6918 S SD    . MET C 3 832 ? 73.646  51.354 32.620  1.00 56.90  ? 832  MET A SD    1 
ATOM   6919 C CE    . MET C 3 832 ? 73.390  52.633 31.379  1.00 55.24  ? 832  MET A CE    1 
ATOM   6920 N N     . VAL C 3 833 ? 73.096  52.436 37.660  1.00 43.70  ? 833  VAL A N     1 
ATOM   6921 C CA    . VAL C 3 833 ? 73.404  53.625 38.446  1.00 43.51  ? 833  VAL A CA    1 
ATOM   6922 C C     . VAL C 3 833 ? 74.675  53.462 39.274  1.00 42.12  ? 833  VAL A C     1 
ATOM   6923 O O     . VAL C 3 833 ? 75.562  54.293 39.223  1.00 42.91  ? 833  VAL A O     1 
ATOM   6924 C CB    . VAL C 3 833 ? 72.231  53.971 39.381  1.00 43.84  ? 833  VAL A CB    1 
ATOM   6925 C CG1   . VAL C 3 833 ? 72.634  55.074 40.355  1.00 41.45  ? 833  VAL A CG1   1 
ATOM   6926 C CG2   . VAL C 3 833 ? 71.020  54.378 38.545  1.00 43.44  ? 833  VAL A CG2   1 
ATOM   6927 N N     . ASP C 3 834 ? 74.765  52.371 40.017  1.00 45.42  ? 834  ASP A N     1 
ATOM   6928 C CA    . ASP C 3 834 ? 75.923  52.106 40.862  1.00 47.34  ? 834  ASP A CA    1 
ATOM   6929 C C     . ASP C 3 834 ? 77.282  52.061 40.143  1.00 47.03  ? 834  ASP A C     1 
ATOM   6930 O O     . ASP C 3 834 ? 78.250  52.632 40.612  1.00 46.64  ? 834  ASP A O     1 
ATOM   6931 C CB    . ASP C 3 834 ? 75.706  50.801 41.644  1.00 48.84  ? 834  ASP A CB    1 
ATOM   6932 C CG    . ASP C 3 834 ? 76.896  50.451 42.534  1.00 52.94  ? 834  ASP A CG    1 
ATOM   6933 O OD1   . ASP C 3 834 ? 77.307  51.325 43.330  1.00 50.84  ? 834  ASP A OD1   1 
ATOM   6934 O OD2   . ASP C 3 834 ? 77.425  49.310 42.439  1.00 54.51  ? 834  ASP A OD2   1 
ATOM   6935 N N     . THR C 3 835 ? 77.364  51.389 39.010  1.00 45.80  ? 835  THR A N     1 
ATOM   6936 C CA    . THR C 3 835 ? 78.641  51.304 38.321  1.00 48.28  ? 835  THR A CA    1 
ATOM   6937 C C     . THR C 3 835 ? 79.204  52.640 37.859  1.00 49.14  ? 835  THR A C     1 
ATOM   6938 O O     . THR C 3 835 ? 80.400  52.918 38.010  1.00 47.65  ? 835  THR A O     1 
ATOM   6939 C CB    . THR C 3 835 ? 78.560  50.375 37.100  1.00 46.15  ? 835  THR A CB    1 
ATOM   6940 O OG1   . THR C 3 835 ? 78.534  49.021 37.556  1.00 49.76  ? 835  THR A OG1   1 
ATOM   6941 C CG2   . THR C 3 835 ? 79.773  50.567 36.179  1.00 48.20  ? 835  THR A CG2   1 
ATOM   6942 N N     . TYR C 3 836 ? 78.352  53.475 37.293  1.00 47.76  ? 836  TYR A N     1 
ATOM   6943 C CA    . TYR C 3 836 ? 78.846  54.737 36.804  1.00 49.04  ? 836  TYR A CA    1 
ATOM   6944 C C     . TYR C 3 836 ? 79.026  55.794 37.880  1.00 51.17  ? 836  TYR A C     1 
ATOM   6945 O O     . TYR C 3 836 ? 79.733  56.777 37.662  1.00 49.70  ? 836  TYR A O     1 
ATOM   6946 C CB    . TYR C 3 836 ? 77.970  55.213 35.644  1.00 46.23  ? 836  TYR A CB    1 
ATOM   6947 C CG    . TYR C 3 836 ? 78.241  54.378 34.403  1.00 47.53  ? 836  TYR A CG    1 
ATOM   6948 C CD1   . TYR C 3 836 ? 79.518  54.349 33.830  1.00 47.44  ? 836  TYR A CD1   1 
ATOM   6949 C CD2   . TYR C 3 836 ? 77.249  53.570 33.839  1.00 45.29  ? 836  TYR A CD2   1 
ATOM   6950 C CE1   . TYR C 3 836 ? 79.801  53.542 32.741  1.00 48.12  ? 836  TYR A CE1   1 
ATOM   6951 C CE2   . TYR C 3 836 ? 77.523  52.761 32.748  1.00 47.13  ? 836  TYR A CE2   1 
ATOM   6952 C CZ    . TYR C 3 836 ? 78.804  52.748 32.203  1.00 47.86  ? 836  TYR A CZ    1 
ATOM   6953 O OH    . TYR C 3 836 ? 79.101  51.929 31.134  1.00 49.35  ? 836  TYR A OH    1 
ATOM   6954 N N     . GLU C 3 837 ? 78.414  55.586 39.047  1.00 52.03  ? 837  GLU A N     1 
ATOM   6955 C CA    . GLU C 3 837 ? 78.589  56.537 40.140  1.00 53.88  ? 837  GLU A CA    1 
ATOM   6956 C C     . GLU C 3 837 ? 79.935  56.275 40.807  1.00 54.12  ? 837  GLU A C     1 
ATOM   6957 O O     . GLU C 3 837 ? 80.654  57.215 41.161  1.00 54.34  ? 837  GLU A O     1 
ATOM   6958 C CB    . GLU C 3 837 ? 77.475  56.413 41.187  1.00 53.18  ? 837  GLU A CB    1 
ATOM   6959 C CG    . GLU C 3 837 ? 76.119  56.887 40.693  1.00 56.76  ? 837  GLU A CG    1 
ATOM   6960 C CD    . GLU C 3 837 ? 75.075  57.009 41.803  1.00 58.82  ? 837  GLU A CD    1 
ATOM   6961 O OE1   . GLU C 3 837 ? 74.905  56.055 42.596  1.00 60.42  ? 837  GLU A OE1   1 
ATOM   6962 O OE2   . GLU C 3 837 ? 74.406  58.067 41.876  1.00 62.52  ? 837  GLU A OE2   1 
ATOM   6963 N N     . SER C 3 838 ? 80.272  54.993 40.945  1.00 53.66  ? 838  SER A N     1 
ATOM   6964 C CA    . SER C 3 838 ? 81.510  54.561 41.588  1.00 53.32  ? 838  SER A CA    1 
ATOM   6965 C C     . SER C 3 838 ? 82.681  54.357 40.624  1.00 52.83  ? 838  SER A C     1 
ATOM   6966 O O     . SER C 3 838 ? 83.776  54.037 41.060  1.00 53.22  ? 838  SER A O     1 
ATOM   6967 C CB    . SER C 3 838 ? 81.281  53.239 42.339  1.00 54.79  ? 838  SER A CB    1 
ATOM   6968 O OG    . SER C 3 838 ? 80.083  53.248 43.097  1.00 58.11  ? 838  SER A OG    1 
ATOM   6969 N N     . CYS C 3 839 ? 82.462  54.524 39.326  1.00 51.83  ? 839  CYS A N     1 
ATOM   6970 C CA    . CYS C 3 839 ? 83.535  54.320 38.365  1.00 49.93  ? 839  CYS A CA    1 
ATOM   6971 C C     . CYS C 3 839 ? 83.557  55.310 37.222  1.00 50.61  ? 839  CYS A C     1 
ATOM   6972 O O     . CYS C 3 839 ? 82.532  55.597 36.596  1.00 51.05  ? 839  CYS A O     1 
ATOM   6973 C CB    . CYS C 3 839 ? 83.465  52.921 37.746  1.00 50.12  ? 839  CYS A CB    1 
ATOM   6974 S SG    . CYS C 3 839 ? 83.692  51.540 38.853  1.00 54.97  ? 839  CYS A SG    1 
ATOM   6975 N N     . ASP C 3 840 ? 84.750  55.815 36.943  1.00 50.95  ? 840  ASP A N     1 
ATOM   6976 C CA    . ASP C 3 840 ? 84.963  56.734 35.837  1.00 49.25  ? 840  ASP A CA    1 
ATOM   6977 C C     . ASP C 3 840 ? 85.805  55.899 34.858  1.00 46.74  ? 840  ASP A C     1 
ATOM   6978 O O     . ASP C 3 840 ? 87.022  56.030 34.796  1.00 44.68  ? 840  ASP A O     1 
ATOM   6979 C CB    . ASP C 3 840 ? 85.738  57.960 36.305  1.00 51.23  ? 840  ASP A CB    1 
ATOM   6980 C CG    . ASP C 3 840 ? 85.869  59.002 35.227  1.00 54.42  ? 840  ASP A CG    1 
ATOM   6981 O OD1   . ASP C 3 840 ? 86.032  58.615 34.044  1.00 57.89  ? 840  ASP A OD1   1 
ATOM   6982 O OD2   . ASP C 3 840 ? 85.818  60.204 35.561  1.00 58.09  ? 840  ASP A OD2   1 
ATOM   6983 N N     . VAL C 3 841 ? 85.127  55.032 34.114  1.00 45.91  ? 841  VAL A N     1 
ATOM   6984 C CA    . VAL C 3 841 ? 85.760  54.125 33.164  1.00 46.43  ? 841  VAL A CA    1 
ATOM   6985 C C     . VAL C 3 841 ? 86.747  54.752 32.176  1.00 46.38  ? 841  VAL A C     1 
ATOM   6986 O O     . VAL C 3 841 ? 87.767  54.152 31.843  1.00 44.99  ? 841  VAL A O     1 
ATOM   6987 C CB    . VAL C 3 841 ? 84.683  53.341 32.407  1.00 44.37  ? 841  VAL A CB    1 
ATOM   6988 C CG1   . VAL C 3 841 ? 83.787  52.614 33.424  1.00 43.50  ? 841  VAL A CG1   1 
ATOM   6989 C CG2   . VAL C 3 841 ? 83.872  54.276 31.559  1.00 43.74  ? 841  VAL A CG2   1 
ATOM   6990 N N     . LEU C 3 842 ? 86.444  55.959 31.719  1.00 45.77  ? 842  LEU A N     1 
ATOM   6991 C CA    . LEU C 3 842 ? 87.324  56.647 30.792  1.00 44.60  ? 842  LEU A CA    1 
ATOM   6992 C C     . LEU C 3 842 ? 88.615  57.032 31.501  1.00 44.37  ? 842  LEU A C     1 
ATOM   6993 O O     . LEU C 3 842 ? 89.707  56.799 30.990  1.00 42.27  ? 842  LEU A O     1 
ATOM   6994 C CB    . LEU C 3 842 ? 86.618  57.882 30.221  1.00 41.93  ? 842  LEU A CB    1 
ATOM   6995 C CG    . LEU C 3 842 ? 86.101  57.707 28.786  1.00 40.23  ? 842  LEU A CG    1 
ATOM   6996 C CD1   . LEU C 3 842 ? 85.682  56.283 28.526  1.00 37.90  ? 842  LEU A CD1   1 
ATOM   6997 C CD2   . LEU C 3 842 ? 84.941  58.657 28.552  1.00 40.92  ? 842  LEU A CD2   1 
ATOM   6998 N N     . ALA C 3 843 ? 88.488  57.622 32.680  1.00 45.04  ? 843  ALA A N     1 
ATOM   6999 C CA    . ALA C 3 843 ? 89.662  58.007 33.447  1.00 47.47  ? 843  ALA A CA    1 
ATOM   7000 C C     . ALA C 3 843 ? 90.411  56.729 33.845  1.00 50.04  ? 843  ALA A C     1 
ATOM   7001 O O     . ALA C 3 843 ? 91.645  56.704 33.863  1.00 50.72  ? 843  ALA A O     1 
ATOM   7002 C CB    . ALA C 3 843 ? 89.237  58.796 34.696  1.00 45.43  ? 843  ALA A CB    1 
ATOM   7003 N N     . ASP C 3 844 ? 89.666  55.667 34.161  1.00 52.05  ? 844  ASP A N     1 
ATOM   7004 C CA    . ASP C 3 844 ? 90.291  54.401 34.539  1.00 53.95  ? 844  ASP A CA    1 
ATOM   7005 C C     . ASP C 3 844 ? 91.024  53.849 33.334  1.00 54.34  ? 844  ASP A C     1 
ATOM   7006 O O     . ASP C 3 844 ? 92.058  53.212 33.465  1.00 55.28  ? 844  ASP A O     1 
ATOM   7007 C CB    . ASP C 3 844 ? 89.255  53.380 35.017  1.00 55.55  ? 844  ASP A CB    1 
ATOM   7008 C CG    . ASP C 3 844 ? 88.651  53.743 36.360  1.00 58.78  ? 844  ASP A CG    1 
ATOM   7009 O OD1   . ASP C 3 844 ? 89.427  54.037 37.292  1.00 61.90  ? 844  ASP A OD1   1 
ATOM   7010 O OD2   . ASP C 3 844 ? 87.403  53.725 36.490  1.00 61.57  ? 844  ASP A OD2   1 
ATOM   7011 N N     . PHE C 3 845 ? 90.479  54.104 32.157  1.00 55.06  ? 845  PHE A N     1 
ATOM   7012 C CA    . PHE C 3 845 ? 91.085  53.643 30.920  1.00 57.54  ? 845  PHE A CA    1 
ATOM   7013 C C     . PHE C 3 845 ? 92.378  54.443 30.722  1.00 59.72  ? 845  PHE A C     1 
ATOM   7014 O O     . PHE C 3 845 ? 93.424  53.890 30.405  1.00 59.03  ? 845  PHE A O     1 
ATOM   7015 C CB    . PHE C 3 845 ? 90.102  53.874 29.770  1.00 57.11  ? 845  PHE A CB    1 
ATOM   7016 C CG    . PHE C 3 845 ? 90.594  53.418 28.432  1.00 58.32  ? 845  PHE A CG    1 
ATOM   7017 C CD1   . PHE C 3 845 ? 90.914  52.087 28.205  1.00 59.22  ? 845  PHE A CD1   1 
ATOM   7018 C CD2   . PHE C 3 845 ? 90.696  54.316 27.375  1.00 57.87  ? 845  PHE A CD2   1 
ATOM   7019 C CE1   . PHE C 3 845 ? 91.322  51.658 26.946  1.00 58.32  ? 845  PHE A CE1   1 
ATOM   7020 C CE2   . PHE C 3 845 ? 91.103  53.893 26.113  1.00 56.72  ? 845  PHE A CE2   1 
ATOM   7021 C CZ    . PHE C 3 845 ? 91.415  52.566 25.902  1.00 57.49  ? 845  PHE A CZ    1 
ATOM   7022 N N     . TYR C 3 846 ? 92.296  55.750 30.940  1.00 62.54  ? 846  TYR A N     1 
ATOM   7023 C CA    . TYR C 3 846 ? 93.446  56.625 30.801  1.00 64.26  ? 846  TYR A CA    1 
ATOM   7024 C C     . TYR C 3 846 ? 94.591  56.122 31.664  1.00 65.71  ? 846  TYR A C     1 
ATOM   7025 O O     . TYR C 3 846 ? 95.724  56.031 31.200  1.00 67.21  ? 846  TYR A O     1 
ATOM   7026 C CB    . TYR C 3 846 ? 93.059  58.039 31.221  1.00 69.15  ? 846  TYR A CB    1 
ATOM   7027 C CG    . TYR C 3 846 ? 94.084  59.116 30.922  1.00 73.03  ? 846  TYR A CG    1 
ATOM   7028 C CD1   . TYR C 3 846 ? 95.364  59.072 31.476  1.00 74.37  ? 846  TYR A CD1   1 
ATOM   7029 C CD2   . TYR C 3 846 ? 93.747  60.211 30.121  1.00 74.60  ? 846  TYR A CD2   1 
ATOM   7030 C CE1   . TYR C 3 846 ? 96.282  60.095 31.243  1.00 77.13  ? 846  TYR A CE1   1 
ATOM   7031 C CE2   . TYR C 3 846 ? 94.653  61.239 29.880  1.00 76.97  ? 846  TYR A CE2   1 
ATOM   7032 C CZ    . TYR C 3 846 ? 95.917  61.177 30.443  1.00 78.78  ? 846  TYR A CZ    1 
ATOM   7033 O OH    . TYR C 3 846 ? 96.812  62.196 30.204  1.00 81.09  ? 846  TYR A OH    1 
ATOM   7034 N N     . ASP C 3 847 ? 94.293  55.787 32.917  1.00 65.87  ? 847  ASP A N     1 
ATOM   7035 C CA    . ASP C 3 847 ? 95.316  55.308 33.838  1.00 68.04  ? 847  ASP A CA    1 
ATOM   7036 C C     . ASP C 3 847 ? 95.819  53.910 33.466  1.00 69.97  ? 847  ASP A C     1 
ATOM   7037 O O     . ASP C 3 847 ? 96.462  53.236 34.273  1.00 71.02  ? 847  ASP A O     1 
ATOM   7038 C CB    . ASP C 3 847 ? 94.777  55.295 35.281  1.00 69.19  ? 847  ASP A CB    1 
ATOM   7039 C CG    . ASP C 3 847 ? 94.448  56.694 35.811  1.00 70.86  ? 847  ASP A CG    1 
ATOM   7040 O OD1   . ASP C 3 847 ? 95.345  57.564 35.835  1.00 70.75  ? 847  ASP A OD1   1 
ATOM   7041 O OD2   . ASP C 3 847 ? 93.289  56.926 36.218  1.00 71.65  ? 847  ASP A OD2   1 
ATOM   7042 N N     . GLN C 3 848 ? 95.532  53.478 32.243  1.00 71.21  ? 848  GLN A N     1 
ATOM   7043 C CA    . GLN C 3 848 ? 95.949  52.156 31.785  1.00 71.52  ? 848  GLN A CA    1 
ATOM   7044 C C     . GLN C 3 848 ? 96.885  52.254 30.593  1.00 72.60  ? 848  GLN A C     1 
ATOM   7045 O O     . GLN C 3 848 ? 97.772  51.414 30.420  1.00 73.35  ? 848  GLN A O     1 
ATOM   7046 C CB    . GLN C 3 848 ? 94.722  51.325 31.414  1.00 71.54  ? 848  GLN A CB    1 
ATOM   7047 C CG    . GLN C 3 848 ? 93.883  50.912 32.609  1.00 72.35  ? 848  GLN A CG    1 
ATOM   7048 C CD    . GLN C 3 848 ? 94.374  49.631 33.249  1.00 71.99  ? 848  GLN A CD    1 
ATOM   7049 O OE1   . GLN C 3 848 ? 95.560  49.316 33.201  1.00 69.61  ? 848  GLN A OE1   1 
ATOM   7050 N NE2   . GLN C 3 848 ? 93.460  48.889 33.864  1.00 73.91  ? 848  GLN A NE2   1 
ATOM   7051 N N     . PHE C 3 849 ? 96.678  53.270 29.762  1.00 73.10  ? 849  PHE A N     1 
ATOM   7052 C CA    . PHE C 3 849 ? 97.532  53.470 28.600  1.00 75.54  ? 849  PHE A CA    1 
ATOM   7053 C C     . PHE C 3 849 ? 98.343  54.753 28.773  1.00 78.06  ? 849  PHE A C     1 
ATOM   7054 O O     . PHE C 3 849 ? 98.610  55.478 27.817  1.00 79.43  ? 849  PHE A O     1 
ATOM   7055 C CB    . PHE C 3 849 ? 96.702  53.539 27.313  1.00 72.83  ? 849  PHE A CB    1 
ATOM   7056 C CG    . PHE C 3 849 ? 95.850  54.761 27.202  1.00 72.08  ? 849  PHE A CG    1 
ATOM   7057 C CD1   . PHE C 3 849 ? 94.659  54.863 27.906  1.00 72.88  ? 849  PHE A CD1   1 
ATOM   7058 C CD2   . PHE C 3 849 ? 96.248  55.826 26.403  1.00 71.97  ? 849  PHE A CD2   1 
ATOM   7059 C CE1   . PHE C 3 849 ? 93.874  56.012 27.816  1.00 73.56  ? 849  PHE A CE1   1 
ATOM   7060 C CE2   . PHE C 3 849 ? 95.475  56.976 26.307  1.00 72.81  ? 849  PHE A CE2   1 
ATOM   7061 C CZ    . PHE C 3 849 ? 94.285  57.071 27.015  1.00 72.90  ? 849  PHE A CZ    1 
ATOM   7062 N N     . ALA C 3 850 ? 98.724  55.035 30.012  1.00 80.60  ? 850  ALA A N     1 
ATOM   7063 C CA    . ALA C 3 850 ? 99.510  56.220 30.308  1.00 82.91  ? 850  ALA A CA    1 
ATOM   7064 C C     . ALA C 3 850 ? 100.955 55.785 30.472  1.00 84.56  ? 850  ALA A C     1 
ATOM   7065 O O     . ALA C 3 850 ? 101.845 56.238 29.745  1.00 83.71  ? 850  ALA A O     1 
ATOM   7066 C CB    . ALA C 3 850 ? 99.009  56.873 31.591  1.00 83.32  ? 850  ALA A CB    1 
ATOM   7067 N N     . ASP C 3 851 ? 101.166 54.889 31.433  1.00 87.63  ? 851  ASP A N     1 
ATOM   7068 C CA    . ASP C 3 851 ? 102.487 54.352 31.743  1.00 91.02  ? 851  ASP A CA    1 
ATOM   7069 C C     . ASP C 3 851 ? 102.989 53.450 30.620  1.00 92.97  ? 851  ASP A C     1 
ATOM   7070 O O     . ASP C 3 851 ? 103.975 53.767 29.953  1.00 94.72  ? 851  ASP A O     1 
ATOM   7071 C CB    . ASP C 3 851 ? 102.437 53.571 33.063  1.00 90.05  ? 851  ASP A CB    1 
ATOM   7072 N N     . GLN C 3 852 ? 102.304 52.329 30.415  1.00 94.53  ? 852  GLN A N     1 
ATOM   7073 C CA    . GLN C 3 852 ? 102.676 51.369 29.380  1.00 95.58  ? 852  GLN A CA    1 
ATOM   7074 C C     . GLN C 3 852 ? 102.762 52.006 27.997  1.00 95.84  ? 852  GLN A C     1 
ATOM   7075 O O     . GLN C 3 852 ? 103.713 51.780 27.243  1.00 95.20  ? 852  GLN A O     1 
ATOM   7076 C CB    . GLN C 3 852 ? 101.665 50.220 29.353  1.00 96.12  ? 852  GLN A CB    1 
ATOM   7077 N N     . LEU C 3 853 ? 101.764 52.817 27.680  1.00 96.86  ? 853  LEU A N     1 
ATOM   7078 C CA    . LEU C 3 853 ? 101.674 53.468 26.382  1.00 97.92  ? 853  LEU A CA    1 
ATOM   7079 C C     . LEU C 3 853 ? 102.712 54.525 26.062  1.00 97.76  ? 853  LEU A C     1 
ATOM   7080 O O     . LEU C 3 853 ? 103.820 54.506 26.577  1.00 97.89  ? 853  LEU A O     1 
ATOM   7081 C CB    . LEU C 3 853 ? 100.293 54.063 26.218  1.00 99.00  ? 853  LEU A CB    1 
ATOM   7082 N N     . HIS C 3 854 ? 102.306 55.439 25.185  1.00 98.50  ? 854  HIS A N     1 
ATOM   7083 C CA    . HIS C 3 854 ? 103.110 56.555 24.699  1.00 99.71  ? 854  HIS A CA    1 
ATOM   7084 C C     . HIS C 3 854 ? 104.486 56.721 25.338  1.00 100.00 ? 854  HIS A C     1 
ATOM   7085 O O     . HIS C 3 854 ? 104.616 56.794 26.564  1.00 100.70 ? 854  HIS A O     1 
ATOM   7086 C CB    . HIS C 3 854 ? 102.311 57.848 24.832  1.00 99.38  ? 854  HIS A CB    1 
ATOM   7087 N N     . GLU C 3 855 ? 105.509 56.789 24.490  1.00 99.57  ? 855  GLU A N     1 
ATOM   7088 C CA    . GLU C 3 855 ? 106.884 56.949 24.944  1.00 98.85  ? 855  GLU A CA    1 
ATOM   7089 C C     . GLU C 3 855 ? 107.131 58.380 25.419  1.00 98.84  ? 855  GLU A C     1 
ATOM   7090 O O     . GLU C 3 855 ? 106.822 58.718 26.561  1.00 99.58  ? 855  GLU A O     1 
ATOM   7091 C CB    . GLU C 3 855 ? 107.850 56.593 23.818  1.00 98.69  ? 855  GLU A CB    1 
ATOM   7092 N N     . SER C 3 856 ? 107.684 59.216 24.544  1.00 97.84  ? 856  SER A N     1 
ATOM   7093 C CA    . SER C 3 856 ? 107.968 60.598 24.903  1.00 96.45  ? 856  SER A CA    1 
ATOM   7094 C C     . SER C 3 856 ? 106.801 61.509 24.566  1.00 95.84  ? 856  SER A C     1 
ATOM   7095 O O     . SER C 3 856 ? 106.073 61.924 25.458  1.00 95.78  ? 856  SER A O     1 
ATOM   7096 C CB    . SER C 3 856 ? 109.232 61.079 24.199  1.00 97.86  ? 856  SER A CB    1 
ATOM   7097 N N     . GLN C 3 857 ? 106.626 61.807 23.280  1.00 95.80  ? 857  GLN A N     1 
ATOM   7098 C CA    . GLN C 3 857 ? 105.555 62.686 22.809  1.00 96.10  ? 857  GLN A CA    1 
ATOM   7099 C C     . GLN C 3 857 ? 104.403 62.847 23.811  1.00 96.93  ? 857  GLN A C     1 
ATOM   7100 O O     . GLN C 3 857 ? 104.455 63.718 24.685  1.00 98.10  ? 857  GLN A O     1 
ATOM   7101 C CB    . GLN C 3 857 ? 105.024 62.186 21.466  1.00 95.33  ? 857  GLN A CB    1 
ATOM   7102 N N     . LEU C 3 858 ? 103.367 62.019 23.684  1.00 95.62  ? 858  LEU A N     1 
ATOM   7103 C CA    . LEU C 3 858 ? 102.217 62.073 24.590  1.00 93.72  ? 858  LEU A CA    1 
ATOM   7104 C C     . LEU C 3 858 ? 101.410 63.369 24.513  1.00 93.56  ? 858  LEU A C     1 
ATOM   7105 O O     . LEU C 3 858 ? 101.005 63.912 25.540  1.00 93.51  ? 858  LEU A O     1 
ATOM   7106 C CB    . LEU C 3 858 ? 102.678 61.843 26.027  1.00 92.25  ? 858  LEU A CB    1 
ATOM   7107 N N     . ASP C 3 859 ? 101.169 63.863 23.305  1.00 93.04  ? 859  ASP A N     1 
ATOM   7108 C CA    . ASP C 3 859 ? 100.394 65.087 23.138  1.00 93.86  ? 859  ASP A CA    1 
ATOM   7109 C C     . ASP C 3 859 ? 99.419  64.939 21.981  1.00 94.82  ? 859  ASP A C     1 
ATOM   7110 O O     . ASP C 3 859 ? 99.408  63.912 21.295  1.00 94.48  ? 859  ASP A O     1 
ATOM   7111 C CB    . ASP C 3 859 ? 101.318 66.264 22.887  1.00 94.37  ? 859  ASP A CB    1 
ATOM   7112 N N     . LYS C 3 860 ? 98.602  65.970 21.776  1.00 95.01  ? 860  LYS A N     1 
ATOM   7113 C CA    . LYS C 3 860 ? 97.608  65.993 20.698  1.00 94.95  ? 860  LYS A CA    1 
ATOM   7114 C C     . LYS C 3 860 ? 96.414  65.044 20.891  1.00 93.93  ? 860  LYS A C     1 
ATOM   7115 O O     . LYS C 3 860 ? 95.319  65.317 20.393  1.00 94.23  ? 860  LYS A O     1 
ATOM   7116 C CB    . LYS C 3 860 ? 98.282  65.699 19.349  1.00 95.97  ? 860  LYS A CB    1 
ATOM   7117 C CG    . LYS C 3 860 ? 99.291  66.754 18.898  1.00 96.78  ? 860  LYS A CG    1 
ATOM   7118 C CD    . LYS C 3 860 ? 98.624  68.101 18.626  1.00 97.27  ? 860  LYS A CD    1 
ATOM   7119 C CE    . LYS C 3 860 ? 99.632  69.127 18.109  1.00 97.38  ? 860  LYS A CE    1 
ATOM   7120 N NZ    . LYS C 3 860 ? 99.023  70.466 17.845  1.00 97.29  ? 860  LYS A NZ    1 
ATOM   7121 N N     . MET C 3 861 ? 96.621  63.943 21.611  1.00 91.58  ? 861  MET A N     1 
ATOM   7122 C CA    . MET C 3 861 ? 95.558  62.963 21.856  1.00 89.62  ? 861  MET A CA    1 
ATOM   7123 C C     . MET C 3 861 ? 94.633  63.298 23.026  1.00 87.77  ? 861  MET A C     1 
ATOM   7124 O O     . MET C 3 861 ? 93.414  63.397 22.856  1.00 86.30  ? 861  MET A O     1 
ATOM   7125 C CB    . MET C 3 861 ? 96.172  61.573 22.102  1.00 90.41  ? 861  MET A CB    1 
ATOM   7126 C CG    . MET C 3 861 ? 95.178  60.396 22.308  1.00 88.80  ? 861  MET A CG    1 
ATOM   7127 S SD    . MET C 3 861 ? 94.383  60.194 23.947  1.00 87.39  ? 861  MET A SD    1 
ATOM   7128 C CE    . MET C 3 861 ? 95.793  59.906 24.990  1.00 86.38  ? 861  MET A CE    1 
ATOM   7129 N N     . PRO C 3 862 ? 95.211  63.487 24.226  1.00 85.76  ? 862  PRO A N     1 
ATOM   7130 C CA    . PRO C 3 862 ? 94.523  63.800 25.487  1.00 83.26  ? 862  PRO A CA    1 
ATOM   7131 C C     . PRO C 3 862 ? 93.256  64.654 25.474  1.00 79.35  ? 862  PRO A C     1 
ATOM   7132 O O     . PRO C 3 862 ? 92.630  64.871 24.433  1.00 77.41  ? 862  PRO A O     1 
ATOM   7133 C CB    . PRO C 3 862 ? 95.634  64.424 26.344  1.00 84.62  ? 862  PRO A CB    1 
ATOM   7134 C CG    . PRO C 3 862 ? 96.622  64.944 25.327  1.00 85.05  ? 862  PRO A CG    1 
ATOM   7135 C CD    . PRO C 3 862 ? 96.646  63.800 24.355  1.00 85.84  ? 862  PRO A CD    1 
ATOM   7136 N N     . ALA C 3 863 ? 92.901  65.122 26.670  1.00 76.38  ? 863  ALA A N     1 
ATOM   7137 C CA    . ALA C 3 863 ? 91.726  65.951 26.915  1.00 72.90  ? 863  ALA A CA    1 
ATOM   7138 C C     . ALA C 3 863 ? 90.495  65.085 27.109  1.00 70.07  ? 863  ALA A C     1 
ATOM   7139 O O     . ALA C 3 863 ? 89.678  64.949 26.194  1.00 70.56  ? 863  ALA A O     1 
ATOM   7140 C CB    . ALA C 3 863 ? 91.498  66.931 25.764  1.00 72.51  ? 863  ALA A CB    1 
ATOM   7141 N N     . LEU C 3 864 ? 90.380  64.491 28.294  1.00 65.81  ? 864  LEU A N     1 
ATOM   7142 C CA    . LEU C 3 864 ? 89.233  63.656 28.625  1.00 63.39  ? 864  LEU A CA    1 
ATOM   7143 C C     . LEU C 3 864 ? 87.971  64.464 28.387  1.00 61.20  ? 864  LEU A C     1 
ATOM   7144 O O     . LEU C 3 864 ? 87.896  65.626 28.766  1.00 62.11  ? 864  LEU A O     1 
ATOM   7145 C CB    . LEU C 3 864 ? 89.269  63.238 30.099  1.00 61.72  ? 864  LEU A CB    1 
ATOM   7146 C CG    . LEU C 3 864 ? 90.166  62.095 30.580  1.00 62.28  ? 864  LEU A CG    1 
ATOM   7147 C CD1   . LEU C 3 864 ? 90.176  62.063 32.108  1.00 60.51  ? 864  LEU A CD1   1 
ATOM   7148 C CD2   . LEU C 3 864 ? 89.662  60.766 30.019  1.00 63.06  ? 864  LEU A CD2   1 
ATOM   7149 N N     . PRO C 3 865 ? 86.968  63.871 27.735  1.00 59.94  ? 865  PRO A N     1 
ATOM   7150 C CA    . PRO C 3 865 ? 85.732  64.621 27.497  1.00 60.12  ? 865  PRO A CA    1 
ATOM   7151 C C     . PRO C 3 865 ? 85.080  65.037 28.816  1.00 58.71  ? 865  PRO A C     1 
ATOM   7152 O O     . PRO C 3 865 ? 85.135  64.322 29.810  1.00 60.30  ? 865  PRO A O     1 
ATOM   7153 C CB    . PRO C 3 865 ? 84.882  63.640 26.690  1.00 59.72  ? 865  PRO A CB    1 
ATOM   7154 C CG    . PRO C 3 865 ? 85.383  62.321 27.130  1.00 60.90  ? 865  PRO A CG    1 
ATOM   7155 C CD    . PRO C 3 865 ? 86.877  62.526 27.155  1.00 59.38  ? 865  PRO A CD    1 
ATOM   7156 N N     . ALA C 3 866 ? 84.472  66.211 28.813  1.00 58.14  ? 866  ALA A N     1 
ATOM   7157 C CA    . ALA C 3 866 ? 83.832  66.744 30.001  1.00 56.94  ? 866  ALA A CA    1 
ATOM   7158 C C     . ALA C 3 866 ? 82.640  65.919 30.482  1.00 55.92  ? 866  ALA A C     1 
ATOM   7159 O O     . ALA C 3 866 ? 81.932  65.306 29.688  1.00 56.56  ? 866  ALA A O     1 
ATOM   7160 C CB    . ALA C 3 866 ? 83.393  68.166 29.727  1.00 57.36  ? 866  ALA A CB    1 
ATOM   7161 N N     . LYS C 3 867 ? 82.430  65.922 31.794  1.00 54.52  ? 867  LYS A N     1 
ATOM   7162 C CA    . LYS C 3 867 ? 81.319  65.225 32.432  1.00 53.57  ? 867  LYS A CA    1 
ATOM   7163 C C     . LYS C 3 867 ? 80.099  66.162 32.324  1.00 52.80  ? 867  LYS A C     1 
ATOM   7164 O O     . LYS C 3 867 ? 80.210  67.361 32.592  1.00 52.00  ? 867  LYS A O     1 
ATOM   7165 C CB    . LYS C 3 867 ? 81.670  64.972 33.902  1.00 55.78  ? 867  LYS A CB    1 
ATOM   7166 C CG    . LYS C 3 867 ? 80.873  63.879 34.600  1.00 60.71  ? 867  LYS A CG    1 
ATOM   7167 C CD    . LYS C 3 867 ? 81.266  63.740 36.076  1.00 60.47  ? 867  LYS A CD    1 
ATOM   7168 C CE    . LYS C 3 867 ? 82.770  63.514 36.258  1.00 62.01  ? 867  LYS A CE    1 
ATOM   7169 N NZ    . LYS C 3 867 ? 83.287  62.286 35.579  1.00 63.00  ? 867  LYS A NZ    1 
ATOM   7170 N N     . GLY C 3 868 ? 78.949  65.622 31.921  1.00 50.94  ? 868  GLY A N     1 
ATOM   7171 C CA    . GLY C 3 868 ? 77.746  66.426 31.768  1.00 47.99  ? 868  GLY A CA    1 
ATOM   7172 C C     . GLY C 3 868 ? 76.935  66.644 33.035  1.00 47.10  ? 868  GLY A C     1 
ATOM   7173 O O     . GLY C 3 868 ? 77.394  66.376 34.143  1.00 45.12  ? 868  GLY A O     1 
ATOM   7174 N N     . ASN C 3 869 ? 75.707  67.125 32.865  1.00 47.16  ? 869  ASN A N     1 
ATOM   7175 C CA    . ASN C 3 869 ? 74.830  67.413 34.003  1.00 46.70  ? 869  ASN A CA    1 
ATOM   7176 C C     . ASN C 3 869 ? 73.792  66.351 34.285  1.00 46.63  ? 869  ASN A C     1 
ATOM   7177 O O     . ASN C 3 869 ? 72.856  66.593 35.047  1.00 48.70  ? 869  ASN A O     1 
ATOM   7178 C CB    . ASN C 3 869 ? 74.121  68.763 33.794  1.00 46.03  ? 869  ASN A CB    1 
ATOM   7179 C CG    . ASN C 3 869 ? 75.074  69.945 33.914  1.00 46.34  ? 869  ASN A CG    1 
ATOM   7180 O OD1   . ASN C 3 869 ? 74.981  70.907 33.160  1.00 48.04  ? 869  ASN A OD1   1 
ATOM   7181 N ND2   . ASN C 3 869 ? 75.996  69.873 34.873  1.00 48.02  ? 869  ASN A ND2   1 
ATOM   7182 N N     . LEU C 3 870 ? 73.948  65.180 33.670  1.00 47.76  ? 870  LEU A N     1 
ATOM   7183 C CA    . LEU C 3 870 ? 73.002  64.087 33.873  1.00 44.88  ? 870  LEU A CA    1 
ATOM   7184 C C     . LEU C 3 870 ? 73.067  63.578 35.308  1.00 45.87  ? 870  LEU A C     1 
ATOM   7185 O O     . LEU C 3 870 ? 74.147  63.411 35.889  1.00 44.23  ? 870  LEU A O     1 
ATOM   7186 C CB    . LEU C 3 870 ? 73.289  62.924 32.911  1.00 43.58  ? 870  LEU A CB    1 
ATOM   7187 C CG    . LEU C 3 870 ? 72.459  61.631 33.047  1.00 40.10  ? 870  LEU A CG    1 
ATOM   7188 C CD1   . LEU C 3 870 ? 71.150  61.765 32.310  1.00 36.70  ? 870  LEU A CD1   1 
ATOM   7189 C CD2   . LEU C 3 870 ? 73.243  60.465 32.458  1.00 41.86  ? 870  LEU A CD2   1 
ATOM   7190 N N     . ASN C 3 871 ? 71.892  63.349 35.877  1.00 47.40  ? 871  ASN A N     1 
ATOM   7191 C CA    . ASN C 3 871 ? 71.795  62.824 37.219  1.00 47.73  ? 871  ASN A CA    1 
ATOM   7192 C C     . ASN C 3 871 ? 71.537  61.329 37.098  1.00 45.56  ? 871  ASN A C     1 
ATOM   7193 O O     . ASN C 3 871 ? 70.428  60.916 36.779  1.00 43.05  ? 871  ASN A O     1 
ATOM   7194 C CB    . ASN C 3 871 ? 70.640  63.482 37.958  1.00 52.69  ? 871  ASN A CB    1 
ATOM   7195 C CG    . ASN C 3 871 ? 70.612  63.103 39.414  1.00 58.39  ? 871  ASN A CG    1 
ATOM   7196 O OD1   . ASN C 3 871 ? 70.429  61.937 39.766  1.00 62.22  ? 871  ASN A OD1   1 
ATOM   7197 N ND2   . ASN C 3 871 ? 70.816  64.086 40.276  1.00 61.88  ? 871  ASN A ND2   1 
ATOM   7198 N N     . LEU C 3 872 ? 72.561  60.521 37.347  1.00 44.32  ? 872  LEU A N     1 
ATOM   7199 C CA    . LEU C 3 872 ? 72.425  59.068 37.243  1.00 43.40  ? 872  LEU A CA    1 
ATOM   7200 C C     . LEU C 3 872 ? 71.289  58.463 38.061  1.00 44.57  ? 872  LEU A C     1 
ATOM   7201 O O     . LEU C 3 872 ? 70.763  57.405 37.723  1.00 46.13  ? 872  LEU A O     1 
ATOM   7202 C CB    . LEU C 3 872 ? 73.740  58.399 37.623  1.00 41.98  ? 872  LEU A CB    1 
ATOM   7203 C CG    . LEU C 3 872 ? 74.892  58.686 36.649  1.00 37.80  ? 872  LEU A CG    1 
ATOM   7204 C CD1   . LEU C 3 872 ? 76.208  58.220 37.232  1.00 38.56  ? 872  LEU A CD1   1 
ATOM   7205 C CD2   . LEU C 3 872 ? 74.601  58.013 35.340  1.00 37.16  ? 872  LEU A CD2   1 
ATOM   7206 N N     . ARG C 3 873 ? 70.902  59.138 39.131  1.00 46.33  ? 873  ARG A N     1 
ATOM   7207 C CA    . ARG C 3 873 ? 69.834  58.651 39.993  1.00 47.19  ? 873  ARG A CA    1 
ATOM   7208 C C     . ARG C 3 873 ? 68.482  58.681 39.312  1.00 47.27  ? 873  ARG A C     1 
ATOM   7209 O O     . ARG C 3 873 ? 67.553  57.982 39.723  1.00 45.34  ? 873  ARG A O     1 
ATOM   7210 C CB    . ARG C 3 873 ? 69.785  59.484 41.266  1.00 51.43  ? 873  ARG A CB    1 
ATOM   7211 C CG    . ARG C 3 873 ? 70.996  59.302 42.148  1.00 52.65  ? 873  ARG A CG    1 
ATOM   7212 C CD    . ARG C 3 873 ? 70.963  57.948 42.771  1.00 53.72  ? 873  ARG A CD    1 
ATOM   7213 N NE    . ARG C 3 873 ? 72.170  57.690 43.537  1.00 60.26  ? 873  ARG A NE    1 
ATOM   7214 C CZ    . ARG C 3 873 ? 72.313  56.656 44.354  1.00 64.43  ? 873  ARG A CZ    1 
ATOM   7215 N NH1   . ARG C 3 873 ? 71.312  55.791 44.505  1.00 66.21  ? 873  ARG A NH1   1 
ATOM   7216 N NH2   . ARG C 3 873 ? 73.452  56.481 45.014  1.00 65.93  ? 873  ARG A NH2   1 
ATOM   7217 N N     . ASP C 3 874 ? 68.375  59.491 38.265  1.00 49.41  ? 874  ASP A N     1 
ATOM   7218 C CA    . ASP C 3 874 ? 67.123  59.605 37.531  1.00 50.56  ? 874  ASP A CA    1 
ATOM   7219 C C     . ASP C 3 874 ? 66.853  58.388 36.657  1.00 50.13  ? 874  ASP A C     1 
ATOM   7220 O O     . ASP C 3 874 ? 65.781  58.277 36.067  1.00 50.72  ? 874  ASP A O     1 
ATOM   7221 C CB    . ASP C 3 874 ? 67.120  60.869 36.675  1.00 55.11  ? 874  ASP A CB    1 
ATOM   7222 C CG    . ASP C 3 874 ? 67.203  62.147 37.513  1.00 60.12  ? 874  ASP A CG    1 
ATOM   7223 O OD1   . ASP C 3 874 ? 66.473  62.235 38.527  1.00 62.46  ? 874  ASP A OD1   1 
ATOM   7224 O OD2   . ASP C 3 874 ? 67.980  63.065 37.155  1.00 62.30  ? 874  ASP A OD2   1 
ATOM   7225 N N     . ILE C 3 875 ? 67.822  57.476 36.580  1.00 49.18  ? 875  ILE A N     1 
ATOM   7226 C CA    . ILE C 3 875 ? 67.671  56.260 35.782  1.00 45.91  ? 875  ILE A CA    1 
ATOM   7227 C C     . ILE C 3 875 ? 66.823  55.288 36.591  1.00 46.99  ? 875  ILE A C     1 
ATOM   7228 O O     . ILE C 3 875 ? 66.186  54.370 36.046  1.00 44.98  ? 875  ILE A O     1 
ATOM   7229 C CB    . ILE C 3 875 ? 69.062  55.602 35.458  1.00 44.75  ? 875  ILE A CB    1 
ATOM   7230 C CG1   . ILE C 3 875 ? 69.803  56.462 34.430  1.00 41.38  ? 875  ILE A CG1   1 
ATOM   7231 C CG2   . ILE C 3 875 ? 68.882  54.125 34.920  1.00 41.27  ? 875  ILE A CG2   1 
ATOM   7232 C CD1   . ILE C 3 875 ? 71.220  56.032 34.176  1.00 40.80  ? 875  ILE A CD1   1 
ATOM   7233 N N     . LEU C 3 876 ? 66.813  55.503 37.903  1.00 46.30  ? 876  LEU A N     1 
ATOM   7234 C CA    . LEU C 3 876 ? 66.059  54.638 38.784  1.00 46.70  ? 876  LEU A CA    1 
ATOM   7235 C C     . LEU C 3 876 ? 64.568  54.870 38.610  1.00 46.81  ? 876  LEU A C     1 
ATOM   7236 O O     . LEU C 3 876 ? 63.764  53.993 38.923  1.00 46.42  ? 876  LEU A O     1 
ATOM   7237 C CB    . LEU C 3 876 ? 66.474  54.871 40.233  1.00 44.96  ? 876  LEU A CB    1 
ATOM   7238 C CG    . LEU C 3 876 ? 67.936  54.575 40.556  1.00 48.43  ? 876  LEU A CG    1 
ATOM   7239 C CD1   . LEU C 3 876 ? 68.205  54.902 42.009  1.00 47.75  ? 876  LEU A CD1   1 
ATOM   7240 C CD2   . LEU C 3 876 ? 68.244  53.107 40.283  1.00 48.04  ? 876  LEU A CD2   1 
ATOM   7241 N N     . GLU C 3 877 ? 64.208  56.039 38.079  1.00 47.86  ? 877  GLU A N     1 
ATOM   7242 C CA    . GLU C 3 877 ? 62.803  56.394 37.866  1.00 50.18  ? 877  GLU A CA    1 
ATOM   7243 C C     . GLU C 3 877 ? 62.365  56.378 36.400  1.00 51.09  ? 877  GLU A C     1 
ATOM   7244 O O     . GLU C 3 877 ? 61.220  56.736 36.094  1.00 50.28  ? 877  GLU A O     1 
ATOM   7245 C CB    . GLU C 3 877 ? 62.518  57.777 38.463  1.00 54.57  ? 877  GLU A CB    1 
ATOM   7246 C CG    . GLU C 3 877 ? 62.595  57.815 39.986  1.00 59.61  ? 877  GLU A CG    1 
ATOM   7247 C CD    . GLU C 3 877 ? 61.476  57.008 40.641  1.00 65.31  ? 877  GLU A CD    1 
ATOM   7248 O OE1   . GLU C 3 877 ? 60.295  57.427 40.533  1.00 68.68  ? 877  GLU A OE1   1 
ATOM   7249 O OE2   . GLU C 3 877 ? 61.768  55.953 41.253  1.00 63.89  ? 877  GLU A OE2   1 
ATOM   7250 N N     . SER C 3 878 ? 63.266  55.954 35.507  1.00 49.03  ? 878  SER A N     1 
ATOM   7251 C CA    . SER C 3 878 ? 62.987  55.898 34.074  1.00 47.73  ? 878  SER A CA    1 
ATOM   7252 C C     . SER C 3 878 ? 62.288  54.610 33.631  1.00 49.34  ? 878  SER A C     1 
ATOM   7253 O O     . SER C 3 878 ? 62.868  53.518 33.715  1.00 50.12  ? 878  SER A O     1 
ATOM   7254 C CB    . SER C 3 878 ? 64.288  56.060 33.285  1.00 47.76  ? 878  SER A CB    1 
ATOM   7255 O OG    . SER C 3 878 ? 64.048  55.924 31.897  1.00 44.25  ? 878  SER A OG    1 
ATOM   7256 N N     . ASP C 3 879 ? 61.054  54.744 33.138  1.00 47.43  ? 879  ASP A N     1 
ATOM   7257 C CA    . ASP C 3 879 ? 60.269  53.591 32.702  1.00 49.23  ? 879  ASP A CA    1 
ATOM   7258 C C     . ASP C 3 879 ? 60.817  52.843 31.503  1.00 47.49  ? 879  ASP A C     1 
ATOM   7259 O O     . ASP C 3 879 ? 60.800  51.619 31.455  1.00 47.12  ? 879  ASP A O     1 
ATOM   7260 C CB    . ASP C 3 879 ? 58.829  53.999 32.333  1.00 53.10  ? 879  ASP A CB    1 
ATOM   7261 C CG    . ASP C 3 879 ? 57.892  54.059 33.534  1.00 56.98  ? 879  ASP A CG    1 
ATOM   7262 O OD1   . ASP C 3 879 ? 58.003  53.201 34.440  1.00 59.77  ? 879  ASP A OD1   1 
ATOM   7263 O OD2   . ASP C 3 879 ? 57.023  54.961 33.557  1.00 57.90  ? 879  ASP A OD2   1 
ATOM   7264 N N     . PHE C 3 880 ? 61.309  53.593 30.535  1.00 45.75  ? 880  PHE A N     1 
ATOM   7265 C CA    . PHE C 3 880 ? 61.746  53.007 29.295  1.00 44.88  ? 880  PHE A CA    1 
ATOM   7266 C C     . PHE C 3 880 ? 63.231  52.769 29.142  1.00 44.65  ? 880  PHE A C     1 
ATOM   7267 O O     . PHE C 3 880 ? 63.699  52.295 28.107  1.00 41.55  ? 880  PHE A O     1 
ATOM   7268 C CB    . PHE C 3 880 ? 61.180  53.864 28.168  1.00 43.44  ? 880  PHE A CB    1 
ATOM   7269 C CG    . PHE C 3 880 ? 59.720  54.191 28.367  1.00 43.81  ? 880  PHE A CG    1 
ATOM   7270 C CD1   . PHE C 3 880 ? 58.804  53.175 28.657  1.00 41.14  ? 880  PHE A CD1   1 
ATOM   7271 C CD2   . PHE C 3 880 ? 59.276  55.508 28.373  1.00 41.29  ? 880  PHE A CD2   1 
ATOM   7272 C CE1   . PHE C 3 880 ? 57.479  53.471 28.956  1.00 40.92  ? 880  PHE A CE1   1 
ATOM   7273 C CE2   . PHE C 3 880 ? 57.951  55.812 28.671  1.00 43.11  ? 880  PHE A CE2   1 
ATOM   7274 C CZ    . PHE C 3 880 ? 57.054  54.802 28.964  1.00 43.32  ? 880  PHE A CZ    1 
ATOM   7275 N N     . ALA C 3 881 ? 63.963  53.078 30.194  1.00 45.36  ? 881  ALA A N     1 
ATOM   7276 C CA    . ALA C 3 881 ? 65.395  52.882 30.170  1.00 47.77  ? 881  ALA A CA    1 
ATOM   7277 C C     . ALA C 3 881 ? 65.641  51.490 30.619  1.00 50.53  ? 881  ALA A C     1 
ATOM   7278 O O     . ALA C 3 881 ? 66.366  51.340 31.597  1.00 57.19  ? 881  ALA A O     1 
ATOM   7279 C CB    . ALA C 3 881 ? 66.062  53.784 31.161  1.00 45.13  ? 881  ALA A CB    1 
ATOM   7280 N N     . PHE C 3 882 ? 65.058  50.458 30.020  1.00 50.30  ? 882  PHE A N     1 
ATOM   7281 C CA    . PHE C 3 882 ? 65.393  49.160 30.580  1.00 51.03  ? 882  PHE A CA    1 
ATOM   7282 C C     . PHE C 3 882 ? 66.891  49.184 30.363  1.00 55.65  ? 882  PHE A C     1 
ATOM   7283 O O     . PHE C 3 882 ? 67.383  50.023 29.539  1.00 61.73  ? 882  PHE A O     1 
ATOM   7284 C CB    . PHE C 3 882 ? 64.800  48.010 29.790  1.00 46.82  ? 882  PHE A CB    1 
ATOM   7285 C CG    . PHE C 3 882 ? 63.340  48.080 29.617  1.00 41.55  ? 882  PHE A CG    1 
ATOM   7286 C CD1   . PHE C 3 882 ? 62.549  48.627 30.591  1.00 42.00  ? 882  PHE A CD1   1 
ATOM   7287 C CD2   . PHE C 3 882 ? 62.748  47.572 28.460  1.00 44.42  ? 882  PHE A CD2   1 
ATOM   7288 C CE1   . PHE C 3 882 ? 61.155  48.676 30.416  1.00 48.35  ? 882  PHE A CE1   1 
ATOM   7289 C CE2   . PHE C 3 882 ? 61.374  47.605 28.267  1.00 43.09  ? 882  PHE A CE2   1 
ATOM   7290 C CZ    . PHE C 3 882 ? 60.569  48.161 29.247  1.00 45.01  ? 882  PHE A CZ    1 
ATOM   7291 N N     . ALA C 3 883 ? 67.611  48.338 31.092  1.00 52.97  ? 883  ALA A N     1 
ATOM   7292 C CA    . ALA C 3 883 ? 69.064  48.230 30.964  1.00 54.24  ? 883  ALA A CA    1 
ATOM   7293 C C     . ALA C 3 883 ? 69.785  49.495 31.355  1.00 55.02  ? 883  ALA A C     1 
ATOM   7294 O O     . ALA C 3 883 ? 69.047  50.485 31.494  1.00 58.77  ? 883  ALA A O     1 
ATOM   7295 C CB    . ALA C 3 883 ? 69.428  47.858 29.571  1.00 50.81  ? 883  ALA A CB    1 
HETATM 7296 O O     . HOH D 4 .   ? 90.178  27.584 -2.797  1.00 29.10  ? 18   HOH T O     1 
HETATM 7297 O O     . HOH D 4 .   ? 87.682  30.118 -1.702  1.00 52.56  ? 19   HOH T O     1 
HETATM 7298 O O     . HOH D 4 .   ? 83.297  31.991 17.713  1.00 49.60  ? 20   HOH T O     1 
HETATM 7299 O O     . HOH D 4 .   ? 104.138 21.279 -18.331 1.00 67.45  ? 21   HOH T O     1 
HETATM 7300 O O     . HOH D 4 .   ? 94.300  39.528 0.869   1.00 82.04  ? 22   HOH T O     1 
HETATM 7301 O O     . HOH D 4 .   ? 117.078 22.363 -14.784 1.00 74.92  ? 23   HOH T O     1 
HETATM 7302 O O     . HOH D 4 .   ? 111.929 17.991 -12.954 1.00 61.74  ? 24   HOH T O     1 
HETATM 7303 O O     . HOH D 4 .   ? 107.634 19.240 -15.189 1.00 49.21  ? 25   HOH T O     1 
HETATM 7304 O O     . HOH D 4 .   ? 113.251 21.731 -16.720 1.00 47.06  ? 26   HOH T O     1 
HETATM 7305 O O     . HOH D 4 .   ? 83.200  38.724 3.957   1.00 76.54  ? 27   HOH T O     1 
HETATM 7306 O O     . HOH D 4 .   ? 80.013  35.404 10.482  1.00 54.06  ? 28   HOH T O     1 
HETATM 7307 O O     . HOH D 4 .   ? 104.904 3.046  5.108   1.00 65.29  ? 29   HOH T O     1 
HETATM 7308 O O     . HOH D 4 .   ? 116.698 11.271 -2.664  1.00 57.14  ? 30   HOH T O     1 
HETATM 7309 O O     . HOH D 4 .   ? 85.793  38.178 12.847  1.00 58.82  ? 31   HOH T O     1 
HETATM 7310 O O     . HOH E 4 .   ? 120.119 4.623  -7.258  1.00 59.83  ? 61   HOH N O     1 
HETATM 7311 O O     . HOH E 4 .   ? 101.315 20.589 -8.390  1.00 51.99  ? 132  HOH N O     1 
HETATM 7312 O O     . HOH E 4 .   ? 97.185  8.793  -2.878  1.00 45.09  ? 134  HOH N O     1 
HETATM 7313 O O     . HOH E 4 .   ? 96.107  15.919 1.791   1.00 35.47  ? 150  HOH N O     1 
HETATM 7314 O O     . HOH E 4 .   ? 107.067 30.135 -14.087 1.00 59.28  ? 202  HOH N O     1 
HETATM 7315 O O     . HOH E 4 .   ? 98.351  3.620  -11.326 1.00 73.53  ? 210  HOH N O     1 
HETATM 7316 O O     . HOH E 4 .   ? 105.363 2.819  -14.773 1.00 63.31  ? 225  HOH N O     1 
HETATM 7317 O O     . HOH E 4 .   ? 109.256 8.601  -15.423 1.00 53.44  ? 273  HOH N O     1 
HETATM 7318 O O     . HOH E 4 .   ? 99.470  13.174 -8.530  1.00 60.07  ? 278  HOH N O     1 
HETATM 7319 O O     . HOH E 4 .   ? 93.789  39.423 -17.296 1.00 76.76  ? 290  HOH N O     1 
HETATM 7320 O O     . HOH E 4 .   ? 108.688 23.224 -2.879  1.00 58.37  ? 319  HOH N O     1 
HETATM 7321 O O     . HOH E 4 .   ? 107.676 29.132 3.574   1.00 75.34  ? 321  HOH N O     1 
HETATM 7322 O O     . HOH E 4 .   ? 99.904  30.452 -5.754  1.00 40.25  ? 332  HOH N O     1 
HETATM 7323 O O     . HOH E 4 .   ? 91.264  41.087 -12.921 1.00 76.61  ? 338  HOH N O     1 
HETATM 7324 O O     . HOH E 4 .   ? 100.754 25.725 -4.014  1.00 43.42  ? 341  HOH N O     1 
HETATM 7325 O O     . HOH E 4 .   ? 111.614 -0.251 -14.501 1.00 65.25  ? 352  HOH N O     1 
HETATM 7326 O O     . HOH E 4 .   ? 120.960 1.579  -11.560 1.00 77.08  ? 428  HOH N O     1 
HETATM 7327 O O     . HOH E 4 .   ? 105.033 39.010 -18.147 1.00 73.47  ? 468  HOH N O     1 
HETATM 7328 O O     . HOH F 4 .   ? 62.775  48.907 16.465  1.00 33.47  ? 884  HOH A O     1 
HETATM 7329 O O     . HOH F 4 .   ? 58.224  63.869 26.961  1.00 34.09  ? 885  HOH A O     1 
HETATM 7330 O O     . HOH F 4 .   ? 61.893  8.111  6.017   1.00 50.87  ? 886  HOH A O     1 
HETATM 7331 O O     . HOH F 4 .   ? 49.550  18.996 8.701   1.00 36.63  ? 887  HOH A O     1 
HETATM 7332 O O     . HOH F 4 .   ? 66.617  33.864 11.120  1.00 44.64  ? 888  HOH A O     1 
HETATM 7333 O O     . HOH F 4 .   ? 62.152  19.870 28.386  1.00 28.31  ? 889  HOH A O     1 
HETATM 7334 O O     . HOH F 4 .   ? 76.783  23.660 17.687  1.00 33.40  ? 890  HOH A O     1 
HETATM 7335 O O     . HOH F 4 .   ? 108.540 60.030 21.498  1.00 49.72  ? 891  HOH A O     1 
HETATM 7336 O O     . HOH F 4 .   ? 75.407  46.731 43.331  1.00 56.30  ? 892  HOH A O     1 
HETATM 7337 O O     . HOH F 4 .   ? 84.356  23.928 -8.845  1.00 40.81  ? 893  HOH A O     1 
HETATM 7338 O O     . HOH F 4 .   ? 62.949  30.760 39.184  1.00 33.01  ? 894  HOH A O     1 
HETATM 7339 O O     . HOH F 4 .   ? 102.627 57.356 21.184  1.00 45.54  ? 895  HOH A O     1 
HETATM 7340 O O     . HOH F 4 .   ? 93.953  17.841 28.130  1.00 31.32  ? 896  HOH A O     1 
HETATM 7341 O O     . HOH F 4 .   ? 76.248  2.073  21.903  1.00 46.24  ? 897  HOH A O     1 
HETATM 7342 O O     . HOH F 4 .   ? 51.571  40.587 44.099  1.00 44.39  ? 898  HOH A O     1 
HETATM 7343 O O     . HOH F 4 .   ? 90.430  39.797 25.846  1.00 34.03  ? 899  HOH A O     1 
HETATM 7344 O O     . HOH F 4 .   ? 89.646  11.178 -2.499  1.00 56.44  ? 900  HOH A O     1 
HETATM 7345 O O     . HOH F 4 .   ? 48.922  25.928 38.164  1.00 41.25  ? 901  HOH A O     1 
HETATM 7346 O O     . HOH F 4 .   ? 80.321  59.448 -8.947  1.00 50.96  ? 902  HOH A O     1 
HETATM 7347 O O     . HOH F 4 .   ? 61.571  32.556 14.029  1.00 43.25  ? 903  HOH A O     1 
HETATM 7348 O O     . HOH F 4 .   ? 42.218  35.323 40.861  1.00 40.79  ? 904  HOH A O     1 
HETATM 7349 O O     . HOH F 4 .   ? 94.389  26.248 26.546  1.00 46.01  ? 905  HOH A O     1 
HETATM 7350 O O     . HOH F 4 .   ? 65.888  38.075 27.632  1.00 31.89  ? 906  HOH A O     1 
HETATM 7351 O O     . HOH F 4 .   ? 60.751  62.421 9.945   1.00 53.23  ? 907  HOH A O     1 
HETATM 7352 O O     . HOH F 4 .   ? 67.577  49.353 19.824  1.00 47.76  ? 908  HOH A O     1 
HETATM 7353 O O     . HOH F 4 .   ? 54.961  50.704 36.049  1.00 42.06  ? 909  HOH A O     1 
HETATM 7354 O O     . HOH F 4 .   ? 60.541  32.598 2.262   1.00 66.12  ? 910  HOH A O     1 
HETATM 7355 O O     . HOH F 4 .   ? 90.639  1.762  9.256   1.00 46.83  ? 911  HOH A O     1 
HETATM 7356 O O     . HOH F 4 .   ? 48.738  39.547 44.480  1.00 64.54  ? 912  HOH A O     1 
HETATM 7357 O O     . HOH F 4 .   ? 94.341  25.257 13.082  1.00 42.33  ? 913  HOH A O     1 
HETATM 7358 O O     . HOH F 4 .   ? 99.593  48.134 11.177  1.00 40.56  ? 914  HOH A O     1 
HETATM 7359 O O     . HOH F 4 .   ? 84.891  28.045 10.614  1.00 48.34  ? 915  HOH A O     1 
HETATM 7360 O O     . HOH F 4 .   ? 65.818  29.780 10.629  1.00 41.28  ? 916  HOH A O     1 
HETATM 7361 O O     . HOH F 4 .   ? 68.954  12.076 10.075  1.00 44.36  ? 917  HOH A O     1 
HETATM 7362 O O     . HOH F 4 .   ? 85.800  23.411 21.481  1.00 48.07  ? 918  HOH A O     1 
HETATM 7363 O O     . HOH F 4 .   ? 68.413  30.318 16.933  1.00 39.05  ? 919  HOH A O     1 
HETATM 7364 O O     . HOH F 4 .   ? 58.468  20.325 28.859  1.00 42.08  ? 920  HOH A O     1 
HETATM 7365 O O     . HOH F 4 .   ? 77.900  26.768 12.962  1.00 39.92  ? 921  HOH A O     1 
HETATM 7366 O O     . HOH F 4 .   ? 97.645  6.373  31.019  1.00 45.73  ? 922  HOH A O     1 
HETATM 7367 O O     . HOH F 4 .   ? 77.223  39.782 20.507  1.00 42.78  ? 923  HOH A O     1 
HETATM 7368 O O     . HOH F 4 .   ? 91.975  23.995 14.360  1.00 42.48  ? 924  HOH A O     1 
HETATM 7369 O O     . HOH F 4 .   ? 39.573  40.849 20.625  1.00 55.21  ? 925  HOH A O     1 
HETATM 7370 O O     . HOH F 4 .   ? 76.706  16.336 22.023  1.00 46.23  ? 926  HOH A O     1 
HETATM 7371 O O     . HOH F 4 .   ? 85.354  29.235 19.819  1.00 57.91  ? 927  HOH A O     1 
HETATM 7372 O O     . HOH F 4 .   ? 54.467  18.160 20.791  1.00 56.53  ? 928  HOH A O     1 
HETATM 7373 O O     . HOH F 4 .   ? 91.782  15.251 43.534  1.00 59.12  ? 929  HOH A O     1 
HETATM 7374 O O     . HOH F 4 .   ? 88.375  21.527 38.965  1.00 43.15  ? 930  HOH A O     1 
HETATM 7375 O O     . HOH F 4 .   ? 67.565  37.498 20.080  1.00 47.21  ? 931  HOH A O     1 
HETATM 7376 O O     . HOH F 4 .   ? 55.514  29.554 3.369   1.00 49.34  ? 932  HOH A O     1 
HETATM 7377 O O     . HOH F 4 .   ? 69.734  29.350 18.669  1.00 55.43  ? 933  HOH A O     1 
HETATM 7378 O O     . HOH F 4 .   ? 84.685  21.054 22.899  1.00 47.29  ? 934  HOH A O     1 
HETATM 7379 O O     . HOH F 4 .   ? 80.175  28.069 7.526   1.00 45.32  ? 935  HOH A O     1 
HETATM 7380 O O     . HOH F 4 .   ? 77.902  16.679 -4.782  1.00 56.27  ? 936  HOH A O     1 
HETATM 7381 O O     . HOH F 4 .   ? 60.018  47.556 40.913  1.00 59.84  ? 937  HOH A O     1 
HETATM 7382 O O     . HOH F 4 .   ? 61.143  60.446 17.222  1.00 51.38  ? 938  HOH A O     1 
HETATM 7383 O O     . HOH F 4 .   ? 89.044  65.494 23.846  1.00 55.44  ? 939  HOH A O     1 
HETATM 7384 O O     . HOH F 4 .   ? 69.144  64.540 35.091  1.00 53.46  ? 940  HOH A O     1 
HETATM 7385 O O     . HOH F 4 .   ? 73.354  29.707 17.075  1.00 50.50  ? 941  HOH A O     1 
HETATM 7386 O O     . HOH F 4 .   ? 100.419 26.455 32.508  1.00 67.64  ? 942  HOH A O     1 
HETATM 7387 O O     . HOH F 4 .   ? 52.653  21.663 28.353  1.00 57.00  ? 943  HOH A O     1 
HETATM 7388 O O     . HOH F 4 .   ? 90.452  26.468 18.329  1.00 56.71  ? 944  HOH A O     1 
HETATM 7389 O O     . HOH F 4 .   ? 87.452  2.668  31.429  1.00 52.36  ? 945  HOH A O     1 
HETATM 7390 O O     . HOH F 4 .   ? 79.714  26.838 42.366  1.00 61.91  ? 946  HOH A O     1 
HETATM 7391 O O     . HOH F 4 .   ? 63.983  27.880 36.092  1.00 30.43  ? 947  HOH A O     1 
HETATM 7392 O O     . HOH F 4 .   ? 65.832  40.363 22.433  1.00 66.48  ? 948  HOH A O     1 
HETATM 7393 O O     . HOH F 4 .   ? 95.072  23.151 31.793  1.00 50.60  ? 949  HOH A O     1 
HETATM 7394 O O     . HOH F 4 .   ? 63.262  4.342  23.502  1.00 67.98  ? 950  HOH A O     1 
HETATM 7395 O O     . HOH F 4 .   ? 71.794  36.454 19.980  1.00 37.40  ? 951  HOH A O     1 
HETATM 7396 O O     . HOH F 4 .   ? 64.820  14.826 17.426  1.00 39.87  ? 952  HOH A O     1 
HETATM 7397 O O     . HOH F 4 .   ? 76.662  20.779 38.715  1.00 42.57  ? 953  HOH A O     1 
HETATM 7398 O O     . HOH F 4 .   ? 57.190  12.729 6.654   1.00 63.43  ? 954  HOH A O     1 
HETATM 7399 O O     . HOH F 4 .   ? 59.621  58.299 11.033  1.00 50.06  ? 955  HOH A O     1 
HETATM 7400 O O     . HOH F 4 .   ? 76.138  48.069 23.777  1.00 61.94  ? 956  HOH A O     1 
HETATM 7401 O O     . HOH F 4 .   ? 100.072 18.030 41.340  1.00 74.94  ? 957  HOH A O     1 
HETATM 7402 O O     . HOH F 4 .   ? 60.166  10.494 0.444   1.00 63.47  ? 958  HOH A O     1 
HETATM 7403 O O     . HOH F 4 .   ? 79.617  48.770 32.925  1.00 40.88  ? 959  HOH A O     1 
HETATM 7404 O O     . HOH F 4 .   ? 58.891  64.113 23.593  1.00 49.62  ? 960  HOH A O     1 
HETATM 7405 O O     . HOH F 4 .   ? 66.059  10.315 27.692  1.00 42.50  ? 961  HOH A O     1 
HETATM 7406 O O     . HOH F 4 .   ? 58.820  32.826 24.983  1.00 43.64  ? 962  HOH A O     1 
HETATM 7407 O O     . HOH F 4 .   ? 90.216  50.452 33.031  1.00 42.99  ? 963  HOH A O     1 
HETATM 7408 O O     . HOH F 4 .   ? 55.394  39.685 42.032  1.00 43.39  ? 964  HOH A O     1 
HETATM 7409 O O     . HOH F 4 .   ? 83.376  57.577 33.302  1.00 58.01  ? 965  HOH A O     1 
HETATM 7410 O O     . HOH F 4 .   ? 81.256  58.346 7.031   1.00 68.13  ? 966  HOH A O     1 
HETATM 7411 O O     . HOH F 4 .   ? 46.264  26.840 26.638  1.00 62.95  ? 967  HOH A O     1 
HETATM 7412 O O     . HOH F 4 .   ? 59.641  41.799 46.799  1.00 52.15  ? 968  HOH A O     1 
HETATM 7413 O O     . HOH F 4 .   ? 86.460  -0.527 20.803  1.00 57.96  ? 969  HOH A O     1 
HETATM 7414 O O     . HOH F 4 .   ? 59.284  41.031 41.712  1.00 54.98  ? 970  HOH A O     1 
HETATM 7415 O O     . HOH F 4 .   ? 98.391  43.649 31.987  1.00 52.70  ? 971  HOH A O     1 
HETATM 7416 O O     . HOH F 4 .   ? 53.197  16.459 24.889  1.00 57.04  ? 972  HOH A O     1 
HETATM 7417 O O     . HOH F 4 .   ? 73.955  35.645 20.714  1.00 56.21  ? 973  HOH A O     1 
HETATM 7418 O O     . HOH F 4 .   ? 76.639  56.398 7.572   1.00 59.19  ? 974  HOH A O     1 
HETATM 7419 O O     . HOH F 4 .   ? 94.953  3.609  30.966  1.00 65.03  ? 975  HOH A O     1 
HETATM 7420 O O     . HOH F 4 .   ? 92.814  29.400 36.034  1.00 48.29  ? 976  HOH A O     1 
HETATM 7421 O O     . HOH F 4 .   ? 52.441  19.293 8.972   1.00 45.13  ? 977  HOH A O     1 
HETATM 7422 O O     . HOH F 4 .   ? 53.118  48.442 39.049  1.00 63.00  ? 978  HOH A O     1 
HETATM 7423 O O     . HOH F 4 .   ? 73.504  45.768 20.889  1.00 52.34  ? 979  HOH A O     1 
HETATM 7424 O O     . HOH F 4 .   ? 81.296  44.615 6.718   1.00 52.77  ? 980  HOH A O     1 
HETATM 7425 O O     . HOH F 4 .   ? 87.318  31.361 40.798  1.00 54.94  ? 981  HOH A O     1 
HETATM 7426 O O     . HOH F 4 .   ? 101.870 18.830 3.030   1.00 43.76  ? 982  HOH A O     1 
HETATM 7427 O O     . HOH F 4 .   ? 62.506  9.262  34.936  1.00 70.88  ? 983  HOH A O     1 
HETATM 7428 O O     . HOH F 4 .   ? 76.641  56.816 -10.346 1.00 85.64  ? 984  HOH A O     1 
HETATM 7429 O O     . HOH F 4 .   ? 58.524  23.047 35.533  1.00 32.96  ? 985  HOH A O     1 
HETATM 7430 O O     . HOH F 4 .   ? 69.235  12.190 25.610  1.00 51.86  ? 986  HOH A O     1 
HETATM 7431 O O     . HOH F 4 .   ? 61.373  2.132  13.082  1.00 60.82  ? 987  HOH A O     1 
HETATM 7432 O O     . HOH F 4 .   ? 80.442  67.678 -7.947  1.00 65.05  ? 988  HOH A O     1 
HETATM 7433 O O     . HOH F 4 .   ? 75.259  29.448 19.264  1.00 77.12  ? 989  HOH A O     1 
HETATM 7434 O O     . HOH F 4 .   ? 74.294  38.264 27.129  1.00 55.00  ? 990  HOH A O     1 
HETATM 7435 O O     . HOH F 4 .   ? 64.321  37.433 16.041  1.00 57.85  ? 991  HOH A O     1 
HETATM 7436 O O     . HOH F 4 .   ? 70.592  31.822 7.930   1.00 61.23  ? 992  HOH A O     1 
HETATM 7437 O O     . HOH F 4 .   ? 79.745  50.262 -3.540  1.00 46.82  ? 993  HOH A O     1 
HETATM 7438 O O     . HOH F 4 .   ? 75.330  68.597 2.955   1.00 61.07  ? 994  HOH A O     1 
HETATM 7439 O O     . HOH F 4 .   ? 61.143  24.199 42.720  1.00 78.33  ? 995  HOH A O     1 
HETATM 7440 O O     . HOH F 4 .   ? 53.316  29.441 26.967  1.00 37.66  ? 996  HOH A O     1 
HETATM 7441 O O     . HOH F 4 .   ? 97.404  17.910 -4.021  1.00 47.87  ? 997  HOH A O     1 
HETATM 7442 O O     . HOH F 4 .   ? 93.960  31.045 11.228  1.00 60.27  ? 998  HOH A O     1 
HETATM 7443 O O     . HOH F 4 .   ? 83.426  19.318 -8.171  1.00 55.35  ? 999  HOH A O     1 
HETATM 7444 O O     . HOH F 4 .   ? 59.538  53.508 9.588   1.00 64.04  ? 1000 HOH A O     1 
HETATM 7445 O O     . HOH F 4 .   ? 51.093  44.814 43.583  1.00 60.38  ? 1001 HOH A O     1 
HETATM 7446 O O     . HOH F 4 .   ? 71.376  27.734 31.634  1.00 46.95  ? 1002 HOH A O     1 
HETATM 7447 O O     . HOH F 4 .   ? 102.417 27.425 9.322   1.00 62.47  ? 1003 HOH A O     1 
HETATM 7448 O O     . HOH F 4 .   ? 79.311  58.713 35.902  1.00 57.51  ? 1004 HOH A O     1 
HETATM 7449 O O     . HOH F 4 .   ? 84.012  22.882 14.925  1.00 46.38  ? 1005 HOH A O     1 
HETATM 7450 O O     . HOH F 4 .   ? 100.745 57.184 27.397  1.00 69.97  ? 1006 HOH A O     1 
HETATM 7451 O O     . HOH F 4 .   ? 81.940  57.471 11.088  1.00 57.06  ? 1007 HOH A O     1 
HETATM 7452 O O     . HOH F 4 .   ? 71.921  31.947 19.477  1.00 63.24  ? 1008 HOH A O     1 
HETATM 7453 O O     . HOH F 4 .   ? 71.857  6.996  28.288  1.00 45.94  ? 1009 HOH A O     1 
HETATM 7454 O O     . HOH F 4 .   ? 66.552  27.527 46.445  1.00 60.03  ? 1010 HOH A O     1 
HETATM 7455 O O     . HOH F 4 .   ? 76.124  37.339 -17.159 1.00 67.23  ? 1011 HOH A O     1 
HETATM 7456 O O     . HOH F 4 .   ? 92.648  10.658 24.840  1.00 44.19  ? 1012 HOH A O     1 
HETATM 7457 O O     . HOH F 4 .   ? 90.043  51.382 39.808  1.00 64.92  ? 1013 HOH A O     1 
HETATM 7458 O O     . HOH F 4 .   ? 85.480  40.597 39.844  1.00 52.15  ? 1014 HOH A O     1 
HETATM 7459 O O     . HOH F 4 .   ? 77.157  4.615  45.120  1.00 51.65  ? 1015 HOH A O     1 
HETATM 7460 O O     . HOH F 4 .   ? 89.633  7.929  17.104  1.00 52.76  ? 1016 HOH A O     1 
HETATM 7461 O O     . HOH F 4 .   ? 49.516  44.578 16.235  1.00 48.30  ? 1017 HOH A O     1 
HETATM 7462 O O     . HOH F 4 .   ? 58.082  49.630 38.952  1.00 74.04  ? 1018 HOH A O     1 
HETATM 7463 O O     . HOH F 4 .   ? 56.465  40.932 39.362  1.00 62.25  ? 1019 HOH A O     1 
HETATM 7464 O O     . HOH F 4 .   ? 63.422  51.809 2.692   1.00 62.84  ? 1020 HOH A O     1 
HETATM 7465 O O     . HOH F 4 .   ? 72.532  57.399 48.123  1.00 63.50  ? 1021 HOH A O     1 
HETATM 7466 O O     . HOH F 4 .   ? 55.740  21.177 32.061  1.00 56.06  ? 1022 HOH A O     1 
HETATM 7467 O O     . HOH F 4 .   ? 82.755  45.345 16.184  1.00 70.74  ? 1023 HOH A O     1 
HETATM 7468 O O     . HOH F 4 .   ? 72.118  22.390 20.497  1.00 31.19  ? 1024 HOH A O     1 
HETATM 7469 O O     . HOH F 4 .   ? 62.425  13.760 47.466  1.00 55.44  ? 1025 HOH A O     1 
HETATM 7470 O O     . HOH F 4 .   ? 61.697  56.860 30.070  1.00 48.94  ? 1026 HOH A O     1 
HETATM 7471 O O     . HOH F 4 .   ? 55.889  33.705 37.663  1.00 56.08  ? 1027 HOH A O     1 
HETATM 7472 O O     . HOH F 4 .   ? 91.730  13.634 -5.305  1.00 62.75  ? 1028 HOH A O     1 
HETATM 7473 O O     . HOH F 4 .   ? 77.018  26.464 18.367  1.00 46.55  ? 1029 HOH A O     1 
HETATM 7474 O O     . HOH F 4 .   ? 77.303  8.441  22.096  1.00 62.30  ? 1030 HOH A O     1 
HETATM 7475 O O     . HOH F 4 .   ? 66.266  43.186 -26.060 1.00 62.67  ? 1031 HOH A O     1 
HETATM 7476 O O     . HOH F 4 .   ? 95.726  16.748 18.795  1.00 47.56  ? 1032 HOH A O     1 
HETATM 7477 O O     . HOH F 4 .   ? 71.980  44.966 -7.220  1.00 55.90  ? 1033 HOH A O     1 
HETATM 7478 O O     . HOH F 4 .   ? 102.798 27.142 4.876   1.00 59.86  ? 1034 HOH A O     1 
HETATM 7479 O O     . HOH F 4 .   ? 59.672  62.736 1.970   1.00 47.13  ? 1035 HOH A O     1 
HETATM 7480 O O     . HOH F 4 .   ? 83.776  -0.790 2.471   1.00 57.48  ? 1036 HOH A O     1 
HETATM 7481 O O     . HOH F 4 .   ? 43.487  48.898 30.478  1.00 57.48  ? 1037 HOH A O     1 
HETATM 7482 O O     . HOH F 4 .   ? 62.865  28.947 -15.430 1.00 68.98  ? 1038 HOH A O     1 
HETATM 7483 O O     . HOH F 4 .   ? 44.256  24.172 16.916  1.00 67.81  ? 1039 HOH A O     1 
HETATM 7484 O O     . HOH F 4 .   ? 79.493  7.039  14.391  1.00 37.26  ? 1040 HOH A O     1 
HETATM 7485 O O     . HOH F 4 .   ? 58.536  53.444 -11.546 1.00 59.46  ? 1041 HOH A O     1 
HETATM 7486 O O     . HOH F 4 .   ? 86.887  62.038 33.533  1.00 69.76  ? 1042 HOH A O     1 
HETATM 7487 O O     . HOH F 4 .   ? 85.593  53.271 12.078  1.00 63.73  ? 1043 HOH A O     1 
HETATM 7488 O O     . HOH F 4 .   ? 77.610  48.066 17.486  1.00 84.08  ? 1044 HOH A O     1 
HETATM 7489 O O     . HOH F 4 .   ? 88.166  48.773 36.937  1.00 51.48  ? 1045 HOH A O     1 
HETATM 7490 O O     . HOH F 4 .   ? 54.256  53.940 31.567  1.00 52.11  ? 1046 HOH A O     1 
HETATM 7491 O O     . HOH F 4 .   ? 84.241  -0.115 9.491   1.00 87.49  ? 1047 HOH A O     1 
HETATM 7492 O O     . HOH F 4 .   ? 61.643  63.931 27.865  1.00 70.00  ? 1048 HOH A O     1 
HETATM 7493 O O     . HOH F 4 .   ? 62.450  32.470 26.039  1.00 31.97  ? 1049 HOH A O     1 
HETATM 7494 O O     . HOH F 4 .   ? 83.185  28.029 22.497  1.00 45.49  ? 1050 HOH A O     1 
HETATM 7495 O O     . HOH F 4 .   ? 63.255  65.413 20.960  1.00 53.28  ? 1051 HOH A O     1 
HETATM 7496 O O     . HOH F 4 .   ? 77.699  28.842 -8.372  1.00 62.21  ? 1052 HOH A O     1 
HETATM 7497 O O     . HOH F 4 .   ? 85.814  42.420 15.289  1.00 56.47  ? 1053 HOH A O     1 
HETATM 7498 O O     . HOH F 4 .   ? 103.497 24.105 8.033   1.00 64.23  ? 1054 HOH A O     1 
HETATM 7499 O O     . HOH F 4 .   ? 119.469 59.814 17.399  1.00 79.65  ? 1055 HOH A O     1 
HETATM 7500 O O     . HOH F 4 .   ? 72.589  22.890 -6.142  1.00 63.46  ? 1056 HOH A O     1 
HETATM 7501 O O     . HOH F 4 .   ? 76.257  39.721 27.250  1.00 38.05  ? 1057 HOH A O     1 
HETATM 7502 O O     . HOH F 4 .   ? 81.385  19.176 -6.356  1.00 52.70  ? 1058 HOH A O     1 
HETATM 7503 O O     . HOH F 4 .   ? 100.770 51.707 32.227  1.00 75.56  ? 1059 HOH A O     1 
HETATM 7504 O O     . HOH F 4 .   ? 72.297  9.528  0.855   1.00 59.50  ? 1060 HOH A O     1 
HETATM 7505 O O     . HOH F 4 .   ? 101.297 21.176 5.527   1.00 58.17  ? 1061 HOH A O     1 
HETATM 7506 O O     . HOH F 4 .   ? 104.721 60.090 23.492  1.00 83.12  ? 1062 HOH A O     1 
HETATM 7507 O O     . HOH F 4 .   ? 59.655  10.078 27.335  1.00 61.41  ? 1063 HOH A O     1 
HETATM 7508 O O     . HOH F 4 .   ? 87.388  -1.457 3.155   1.00 69.61  ? 1064 HOH A O     1 
HETATM 7509 O O     . HOH F 4 .   ? 91.222  34.096 36.243  1.00 66.50  ? 1065 HOH A O     1 
HETATM 7510 O O     . HOH F 4 .   ? 59.295  61.724 6.461   1.00 54.81  ? 1066 HOH A O     1 
HETATM 7511 O O     . HOH F 4 .   ? 78.282  69.112 36.845  1.00 54.61  ? 1067 HOH A O     1 
HETATM 7512 O O     . HOH F 4 .   ? 52.080  57.942 22.214  1.00 57.51  ? 1068 HOH A O     1 
HETATM 7513 O O     . HOH F 4 .   ? 60.747  30.825 -2.581  1.00 48.38  ? 1069 HOH A O     1 
HETATM 7514 O O     . HOH F 4 .   ? 67.526  70.527 14.510  1.00 70.59  ? 1070 HOH A O     1 
HETATM 7515 O O     . HOH F 4 .   ? 65.772  42.565 -14.033 1.00 53.54  ? 1071 HOH A O     1 
HETATM 7516 O O     . HOH F 4 .   ? 54.059  36.676 10.640  1.00 55.40  ? 1072 HOH A O     1 
HETATM 7517 O O     . HOH F 4 .   ? 99.293  35.627 -0.044  1.00 62.15  ? 1073 HOH A O     1 
HETATM 7518 O O     . HOH F 4 .   ? 64.821  14.372 32.776  1.00 49.02  ? 1074 HOH A O     1 
HETATM 7519 O O     . HOH F 4 .   ? 72.727  28.773 13.913  1.00 70.30  ? 1075 HOH A O     1 
HETATM 7520 O O     . HOH F 4 .   ? 75.401  17.865 26.055  1.00 54.29  ? 1076 HOH A O     1 
HETATM 7521 O O     . HOH F 4 .   ? 76.089  16.424 18.707  1.00 74.70  ? 1077 HOH A O     1 
HETATM 7522 O O     . HOH F 4 .   ? 59.779  53.025 5.211   1.00 68.05  ? 1078 HOH A O     1 
HETATM 7523 O O     . HOH F 4 .   ? 95.227  9.913  17.023  1.00 56.65  ? 1079 HOH A O     1 
HETATM 7524 O O     . HOH F 4 .   ? 60.380  50.351 25.103  1.00 43.90  ? 1080 HOH A O     1 
HETATM 7525 O O     . HOH F 4 .   ? 107.658 65.581 23.697  1.00 77.11  ? 1081 HOH A O     1 
HETATM 7526 O O     . HOH F 4 .   ? 76.069  37.312 -12.335 1.00 59.37  ? 1082 HOH A O     1 
HETATM 7527 O O     . HOH F 4 .   ? 99.724  20.592 22.852  1.00 62.70  ? 1083 HOH A O     1 
HETATM 7528 O O     . HOH F 4 .   ? 69.038  9.876  37.589  1.00 61.15  ? 1084 HOH A O     1 
HETATM 7529 O O     . HOH F 4 .   ? 77.915  63.483 -2.415  1.00 49.29  ? 1085 HOH A O     1 
HETATM 7530 O O     . HOH F 4 .   ? 82.653  42.378 29.852  1.00 47.20  ? 1086 HOH A O     1 
HETATM 7531 O O     . HOH F 4 .   ? 37.130  34.895 28.638  1.00 70.86  ? 1087 HOH A O     1 
HETATM 7532 O O     . HOH F 4 .   ? 96.981  6.948  -5.928  1.00 63.12  ? 1088 HOH A O     1 
HETATM 7533 O O     . HOH F 4 .   ? 88.408  11.188 -5.948  1.00 81.02  ? 1089 HOH A O     1 
HETATM 7534 O O     . HOH F 4 .   ? 81.020  65.239 27.556  1.00 54.34  ? 1090 HOH A O     1 
HETATM 7535 O O     . HOH F 4 .   ? 56.454  26.150 6.333   1.00 52.63  ? 1091 HOH A O     1 
HETATM 7536 O O     . HOH F 4 .   ? 63.697  50.535 -13.684 1.00 61.62  ? 1092 HOH A O     1 
HETATM 7537 O O     . HOH F 4 .   ? 106.377 54.044 32.305  1.00 69.78  ? 1093 HOH A O     1 
HETATM 7538 O O     . HOH F 4 .   ? 73.143  10.119 18.262  1.00 67.92  ? 1094 HOH A O     1 
HETATM 7539 O O     . HOH F 4 .   ? 69.009  24.553 -4.731  1.00 67.34  ? 1095 HOH A O     1 
HETATM 7540 O O     . HOH F 4 .   ? 72.609  66.231 38.403  1.00 57.83  ? 1096 HOH A O     1 
HETATM 7541 O O     . HOH F 4 .   ? 81.421  7.105  22.996  1.00 39.73  ? 1097 HOH A O     1 
HETATM 7542 O O     . HOH F 4 .   ? 65.660  37.425 48.772  1.00 62.06  ? 1098 HOH A O     1 
HETATM 7543 O O     . HOH F 4 .   ? 54.190  28.208 33.076  1.00 54.14  ? 1099 HOH A O     1 
HETATM 7544 O O     . HOH F 4 .   ? 74.497  19.660 -6.670  1.00 60.01  ? 1100 HOH A O     1 
HETATM 7545 O O     . HOH F 4 .   ? 57.276  35.024 25.126  1.00 45.09  ? 1101 HOH A O     1 
HETATM 7546 O O     . HOH F 4 .   ? 72.048  49.726 -23.198 1.00 59.88  ? 1102 HOH A O     1 
HETATM 7547 O O     . HOH F 4 .   ? 63.091  17.548 39.407  1.00 51.95  ? 1103 HOH A O     1 
HETATM 7548 O O     . HOH F 4 .   ? 67.005  19.240 -8.976  1.00 43.86  ? 1104 HOH A O     1 
HETATM 7549 O O     . HOH F 4 .   ? 91.233  29.339 39.030  1.00 56.46  ? 1105 HOH A O     1 
HETATM 7550 O O     . HOH F 4 .   ? 62.652  7.013  44.690  1.00 47.66  ? 1106 HOH A O     1 
HETATM 7551 O O     . HOH F 4 .   ? 68.800  3.599  36.410  1.00 68.46  ? 1107 HOH A O     1 
HETATM 7552 O O     . HOH F 4 .   ? 61.508  2.525  19.009  1.00 71.24  ? 1108 HOH A O     1 
HETATM 7553 O O     . HOH F 4 .   ? 63.062  6.445  12.093  1.00 55.95  ? 1109 HOH A O     1 
HETATM 7554 O O     . HOH F 4 .   ? 86.163  19.053 30.317  1.00 54.31  ? 1110 HOH A O     1 
HETATM 7555 O O     . HOH F 4 .   ? 55.566  56.901 23.775  1.00 52.85  ? 1111 HOH A O     1 
HETATM 7556 O O     . HOH F 4 .   ? 96.941  39.290 36.825  1.00 61.01  ? 1112 HOH A O     1 
HETATM 7557 O O     . HOH F 4 .   ? 78.757  2.313  26.621  1.00 64.80  ? 1113 HOH A O     1 
HETATM 7558 O O     . HOH F 4 .   ? 37.483  33.493 22.328  1.00 65.23  ? 1114 HOH A O     1 
HETATM 7559 O O     . HOH F 4 .   ? 80.332  4.881  -0.201  1.00 50.67  ? 1115 HOH A O     1 
HETATM 7560 O O     . HOH F 4 .   ? 86.688  24.524 45.606  1.00 82.40  ? 1116 HOH A O     1 
HETATM 7561 O O     . HOH F 4 .   ? 87.042  27.043 12.744  1.00 54.36  ? 1117 HOH A O     1 
HETATM 7562 O O     . HOH F 4 .   ? 58.339  59.244 4.000   1.00 55.98  ? 1118 HOH A O     1 
HETATM 7563 O O     . HOH F 4 .   ? 73.960  22.829 46.890  1.00 64.64  ? 1119 HOH A O     1 
HETATM 7564 O O     . HOH F 4 .   ? 62.412  30.104 12.327  1.00 51.67  ? 1120 HOH A O     1 
HETATM 7565 O O     . HOH F 4 .   ? 99.874  53.105 11.905  1.00 41.29  ? 1121 HOH A O     1 
HETATM 7566 O O     . HOH F 4 .   ? 77.125  26.038 36.879  1.00 54.55  ? 1122 HOH A O     1 
HETATM 7567 O O     . HOH F 4 .   ? 83.017  16.206 -12.896 1.00 62.91  ? 1123 HOH A O     1 
HETATM 7568 O O     . HOH F 4 .   ? 38.331  30.772 25.579  1.00 60.21  ? 1124 HOH A O     1 
HETATM 7569 O O     . HOH F 4 .   ? 84.484  43.999 -8.909  1.00 62.97  ? 1125 HOH A O     1 
HETATM 7570 O O     . HOH F 4 .   ? 84.066  22.032 29.146  1.00 79.26  ? 1126 HOH A O     1 
HETATM 7571 O O     . HOH F 4 .   ? 61.503  33.737 -10.015 1.00 75.39  ? 1127 HOH A O     1 
HETATM 7572 O O     . HOH F 4 .   ? 66.977  14.219 -7.623  1.00 65.78  ? 1128 HOH A O     1 
HETATM 7573 O O     . HOH F 4 .   ? 63.705  18.655 12.274  1.00 48.70  ? 1129 HOH A O     1 
HETATM 7574 O O     . HOH F 4 .   ? 65.583  22.246 -3.682  1.00 61.80  ? 1130 HOH A O     1 
HETATM 7575 O O     . HOH F 4 .   ? 85.055  61.912 31.958  1.00 73.94  ? 1131 HOH A O     1 
HETATM 7576 O O     . HOH F 4 .   ? 95.399  13.246 29.471  1.00 47.56  ? 1132 HOH A O     1 
HETATM 7577 O O     . HOH F 4 .   ? 80.192  61.293 2.832   1.00 66.51  ? 1133 HOH A O     1 
HETATM 7578 O O     . HOH F 4 .   ? 63.324  35.862 14.150  1.00 54.16  ? 1134 HOH A O     1 
HETATM 7579 O O     . HOH F 4 .   ? 54.484  18.031 31.027  1.00 71.13  ? 1135 HOH A O     1 
HETATM 7580 O O     . HOH F 4 .   ? 67.121  16.922 33.398  1.00 46.65  ? 1136 HOH A O     1 
HETATM 7581 O O     . HOH F 4 .   ? 75.575  51.334 14.824  1.00 80.90  ? 1137 HOH A O     1 
HETATM 7582 O O     . HOH F 4 .   ? 78.005  27.704 39.908  1.00 61.14  ? 1138 HOH A O     1 
HETATM 7583 O O     . HOH F 4 .   ? 67.527  15.489 42.177  1.00 64.91  ? 1139 HOH A O     1 
HETATM 7584 O O     . HOH F 4 .   ? 101.706 31.927 26.984  1.00 64.62  ? 1140 HOH A O     1 
HETATM 7585 O O     . HOH F 4 .   ? 64.281  48.547 22.950  1.00 64.38  ? 1141 HOH A O     1 
HETATM 7586 O O     . HOH F 4 .   ? 113.907 62.101 5.567   1.00 60.26  ? 1142 HOH A O     1 
HETATM 7587 O O     . HOH F 4 .   ? 74.747  7.595  -2.966  1.00 52.48  ? 1143 HOH A O     1 
HETATM 7588 O O     . HOH F 4 .   ? 93.211  70.077 26.294  1.00 57.36  ? 1144 HOH A O     1 
HETATM 7589 O O     . HOH F 4 .   ? 61.339  49.901 45.888  1.00 59.39  ? 1145 HOH A O     1 
HETATM 7590 O O     . HOH F 4 .   ? 72.978  69.184 21.659  1.00 61.49  ? 1146 HOH A O     1 
HETATM 7591 O O     . HOH F 4 .   ? 59.068  57.890 16.201  1.00 59.47  ? 1147 HOH A O     1 
HETATM 7592 O O     . HOH F 4 .   ? 78.471  60.897 40.766  1.00 75.18  ? 1148 HOH A O     1 
HETATM 7593 O O     . HOH F 4 .   ? 48.880  21.543 17.409  1.00 66.98  ? 1149 HOH A O     1 
HETATM 7594 O O     . HOH F 4 .   ? 106.052 30.182 18.148  1.00 58.80  ? 1150 HOH A O     1 
HETATM 7595 O O     . HOH F 4 .   ? 70.520  32.092 31.839  1.00 65.09  ? 1151 HOH A O     1 
HETATM 7596 O O     . HOH F 4 .   ? 63.031  13.080 19.294  1.00 67.23  ? 1152 HOH A O     1 
HETATM 7597 O O     . HOH F 4 .   ? 58.189  29.844 25.361  1.00 44.51  ? 1153 HOH A O     1 
HETATM 7598 O O     . HOH F 4 .   ? 62.667  38.628 43.253  1.00 45.16  ? 1154 HOH A O     1 
HETATM 7599 O O     . HOH F 4 .   ? 76.389  38.672 -25.757 1.00 62.49  ? 1155 HOH A O     1 
HETATM 7600 O O     . HOH F 4 .   ? 78.758  -2.520 41.913  1.00 62.57  ? 1156 HOH A O     1 
HETATM 7601 O O     . HOH F 4 .   ? 100.127 34.606 28.192  1.00 54.84  ? 1157 HOH A O     1 
HETATM 7602 O O     . HOH F 4 .   ? 72.893  9.578  23.404  1.00 39.87  ? 1158 HOH A O     1 
HETATM 7603 O O     . HOH F 4 .   ? 84.942  -3.309 24.363  1.00 67.83  ? 1159 HOH A O     1 
HETATM 7604 O O     . HOH F 4 .   ? 69.939  33.427 28.103  1.00 49.65  ? 1160 HOH A O     1 
HETATM 7605 O O     . HOH F 4 .   ? 67.107  28.111 37.077  1.00 66.61  ? 1161 HOH A O     1 
HETATM 7606 O O     . HOH F 4 .   ? 63.367  68.115 27.902  1.00 82.75  ? 1162 HOH A O     1 
HETATM 7607 O O     . HOH F 4 .   ? 82.880  1.377  46.052  1.00 68.13  ? 1163 HOH A O     1 
HETATM 7608 O O     . HOH F 4 .   ? 58.099  15.077 20.060  1.00 77.79  ? 1164 HOH A O     1 
HETATM 7609 O O     . HOH F 4 .   ? 93.206  1.284  -6.265  1.00 54.20  ? 1165 HOH A O     1 
HETATM 7610 O O     . HOH F 4 .   ? 89.784  30.995 24.065  1.00 54.57  ? 1166 HOH A O     1 
HETATM 7611 O O     . HOH F 4 .   ? 71.694  52.095 43.640  1.00 65.32  ? 1167 HOH A O     1 
HETATM 7612 O O     . HOH F 4 .   ? 86.666  48.576 7.238   1.00 64.84  ? 1168 HOH A O     1 
HETATM 7613 O O     . HOH F 4 .   ? 73.696  25.525 0.084   1.00 55.46  ? 1169 HOH A O     1 
HETATM 7614 O O     . HOH F 4 .   ? 68.536  31.480 11.461  1.00 62.84  ? 1170 HOH A O     1 
HETATM 7615 O O     . HOH F 4 .   ? 57.118  47.841 -6.923  1.00 59.16  ? 1171 HOH A O     1 
HETATM 7616 O O     . HOH F 4 .   ? 39.805  44.449 18.777  1.00 74.68  ? 1172 HOH A O     1 
HETATM 7617 O O     . HOH F 4 .   ? 59.058  73.053 5.108   1.00 69.47  ? 1173 HOH A O     1 
HETATM 7618 O O     . HOH F 4 .   ? 79.051  1.380  8.939   1.00 45.58  ? 1174 HOH A O     1 
HETATM 7619 O O     . HOH F 4 .   ? 71.776  -0.108 31.313  1.00 77.95  ? 1175 HOH A O     1 
HETATM 7620 O O     . HOH F 4 .   ? 72.319  69.595 30.206  1.00 64.13  ? 1176 HOH A O     1 
HETATM 7621 O O     . HOH F 4 .   ? 70.434  4.623  32.146  1.00 66.65  ? 1177 HOH A O     1 
HETATM 7622 O O     . HOH F 4 .   ? 83.829  20.473 -11.075 1.00 76.57  ? 1178 HOH A O     1 
HETATM 7623 O O     . HOH F 4 .   ? 74.542  30.180 -5.437  1.00 45.87  ? 1179 HOH A O     1 
HETATM 7624 O O     . HOH F 4 .   ? 86.443  11.768 -11.559 1.00 82.22  ? 1180 HOH A O     1 
HETATM 7625 O O     . HOH F 4 .   ? 70.647  41.049 20.776  1.00 63.08  ? 1181 HOH A O     1 
HETATM 7626 O O     . HOH F 4 .   ? 105.591 50.287 30.899  1.00 63.49  ? 1182 HOH A O     1 
HETATM 7627 O O     . HOH F 4 .   ? 88.516  54.188 11.632  1.00 65.61  ? 1183 HOH A O     1 
HETATM 7628 O O     . HOH F 4 .   ? 83.231  60.762 -0.472  1.00 72.65  ? 1184 HOH A O     1 
HETATM 7629 O O     . HOH F 4 .   ? 96.756  3.736  17.057  1.00 71.04  ? 1185 HOH A O     1 
HETATM 7630 O O     . HOH F 4 .   ? 67.969  24.538 42.179  1.00 75.78  ? 1186 HOH A O     1 
HETATM 7631 O O     . HOH F 4 .   ? 61.387  38.873 16.053  1.00 71.45  ? 1187 HOH A O     1 
HETATM 7632 O O     . HOH F 4 .   ? 70.447  21.272 46.567  1.00 72.35  ? 1188 HOH A O     1 
HETATM 7633 O O     . HOH F 4 .   ? 65.731  18.553 37.827  1.00 58.19  ? 1189 HOH A O     1 
HETATM 7634 O O     . HOH F 4 .   ? 103.236 31.347 4.637   1.00 68.32  ? 1190 HOH A O     1 
HETATM 7635 O O     . HOH F 4 .   ? 72.744  66.231 42.910  1.00 65.02  ? 1191 HOH A O     1 
HETATM 7636 O O     . HOH F 4 .   ? 45.945  25.394 24.608  1.00 67.77  ? 1192 HOH A O     1 
HETATM 7637 O O     . HOH F 4 .   ? 53.176  62.454 33.174  1.00 69.57  ? 1193 HOH A O     1 
HETATM 7638 O O     . HOH F 4 .   ? 71.049  72.816 4.848   1.00 53.99  ? 1194 HOH A O     1 
HETATM 7639 O O     . HOH F 4 .   ? 73.714  50.057 19.866  1.00 69.89  ? 1195 HOH A O     1 
HETATM 7640 O O     . HOH F 4 .   ? 81.442  58.306 3.894   1.00 83.26  ? 1196 HOH A O     1 
HETATM 7641 O O     . HOH F 4 .   ? 98.503  72.265 19.614  1.00 86.00  ? 1197 HOH A O     1 
HETATM 7642 O O     . HOH F 4 .   ? 93.332  5.107  41.468  1.00 65.21  ? 1198 HOH A O     1 
HETATM 7643 O O     . HOH F 4 .   ? 58.033  36.837 3.674   1.00 62.51  ? 1199 HOH A O     1 
HETATM 7644 O O     . HOH F 4 .   ? 73.477  29.664 41.330  1.00 54.20  ? 1200 HOH A O     1 
HETATM 7645 O O     . HOH F 4 .   ? 62.387  14.015 25.574  1.00 50.93  ? 1201 HOH A O     1 
HETATM 7646 O O     . HOH F 4 .   ? 88.641  -4.627 -0.997  1.00 66.64  ? 1202 HOH A O     1 
HETATM 7647 O O     . HOH F 4 .   ? 92.771  51.499 35.953  1.00 56.09  ? 1203 HOH A O     1 
HETATM 7648 O O     . HOH F 4 .   ? 60.645  16.234 40.911  1.00 83.08  ? 1204 HOH A O     1 
HETATM 7649 O O     . HOH F 4 .   ? 71.502  72.469 -14.917 1.00 63.62  ? 1205 HOH A O     1 
HETATM 7650 O O     . HOH F 4 .   ? 37.036  33.773 16.277  1.00 81.27  ? 1206 HOH A O     1 
HETATM 7651 O O     . HOH F 4 .   ? 100.754 18.193 31.819  1.00 74.64  ? 1207 HOH A O     1 
HETATM 7652 O O     . HOH F 4 .   ? 68.001  14.506 17.246  1.00 50.92  ? 1208 HOH A O     1 
HETATM 7653 O O     . HOH F 4 .   ? 91.926  40.011 12.751  1.00 68.51  ? 1209 HOH A O     1 
HETATM 7654 O O     . HOH F 4 .   ? 93.265  38.922 15.584  1.00 65.66  ? 1210 HOH A O     1 
HETATM 7655 O O     . HOH F 4 .   ? 75.176  65.125 23.601  1.00 60.18  ? 1211 HOH A O     1 
HETATM 7656 O O     . HOH F 4 .   ? 83.556  55.530 13.234  1.00 74.19  ? 1212 HOH A O     1 
HETATM 7657 O O     . HOH F 4 .   ? 101.417 39.495 26.504  1.00 64.22  ? 1213 HOH A O     1 
HETATM 7658 O O     . HOH F 4 .   ? 94.366  12.868 -2.378  1.00 61.24  ? 1214 HOH A O     1 
HETATM 7659 O O     . HOH F 4 .   ? 73.480  30.448 45.331  1.00 54.10  ? 1215 HOH A O     1 
HETATM 7660 O O     . HOH F 4 .   ? 70.248  2.782  4.962   1.00 66.54  ? 1216 HOH A O     1 
HETATM 7661 O O     . HOH F 4 .   ? 77.247  48.418 -8.321  1.00 72.65  ? 1217 HOH A O     1 
HETATM 7662 O O     . HOH F 4 .   ? 92.516  3.713  16.930  1.00 71.06  ? 1218 HOH A O     1 
HETATM 7663 O O     . HOH F 4 .   ? 112.279 60.554 11.088  1.00 71.14  ? 1219 HOH A O     1 
HETATM 7664 O O     . HOH F 4 .   ? 50.007  57.243 29.403  1.00 60.00  ? 1220 HOH A O     1 
HETATM 7665 O O     . HOH F 4 .   ? 88.120  43.172 -7.902  1.00 68.36  ? 1221 HOH A O     1 
HETATM 7666 O O     . HOH F 4 .   ? 103.515 30.683 7.701   1.00 78.55  ? 1222 HOH A O     1 
HETATM 7667 O O     . HOH F 4 .   ? 52.887  24.544 36.943  1.00 49.94  ? 1223 HOH A O     1 
HETATM 7668 O O     . HOH F 4 .   ? 72.629  34.344 0.736   1.00 55.58  ? 1224 HOH A O     1 
HETATM 7669 O O     . HOH F 4 .   ? 93.029  2.746  25.554  1.00 61.42  ? 1225 HOH A O     1 
HETATM 7670 O O     . HOH F 4 .   ? 77.526  14.593 48.304  1.00 77.35  ? 1226 HOH A O     1 
HETATM 7671 O O     . HOH F 4 .   ? 60.880  61.011 12.601  1.00 59.18  ? 1227 HOH A O     1 
HETATM 7672 O O     . HOH F 4 .   ? 93.062  46.159 7.961   1.00 78.46  ? 1228 HOH A O     1 
HETATM 7673 O O     . HOH F 4 .   ? 103.345 68.204 22.921  1.00 81.40  ? 1229 HOH A O     1 
HETATM 7674 O O     . HOH F 4 .   ? 60.935  38.460 22.405  1.00 67.76  ? 1230 HOH A O     1 
HETATM 7675 O O     . HOH F 4 .   ? 55.789  43.522 13.483  1.00 57.38  ? 1231 HOH A O     1 
HETATM 7676 O O     . HOH F 4 .   ? 83.512  50.321 12.919  1.00 77.04  ? 1232 HOH A O     1 
HETATM 7677 O O     . HOH F 4 .   ? 72.804  62.144 40.667  1.00 48.90  ? 1233 HOH A O     1 
HETATM 7678 O O     . HOH F 4 .   ? 75.771  36.688 -0.635  1.00 79.78  ? 1234 HOH A O     1 
HETATM 7679 O O     . HOH F 4 .   ? 67.445  28.458 -8.388  1.00 70.76  ? 1235 HOH A O     1 
HETATM 7680 O O     . HOH F 4 .   ? 86.935  12.533 21.462  1.00 55.36  ? 1236 HOH A O     1 
HETATM 7681 O O     . HOH F 4 .   ? 97.223  7.092  18.176  1.00 75.33  ? 1237 HOH A O     1 
HETATM 7682 O O     . HOH F 4 .   ? 94.297  23.567 35.776  1.00 82.75  ? 1238 HOH A O     1 
HETATM 7683 O O     . HOH F 4 .   ? 102.818 28.561 13.687  1.00 84.96  ? 1239 HOH A O     1 
HETATM 7684 O O     . HOH F 4 .   ? 95.668  10.587 42.112  1.00 67.69  ? 1240 HOH A O     1 
HETATM 7685 O O     . HOH F 4 .   ? 94.479  46.845 36.439  1.00 60.82  ? 1241 HOH A O     1 
HETATM 7686 O O     . HOH F 4 .   ? 72.770  36.600 -31.282 1.00 61.53  ? 1242 HOH A O     1 
HETATM 7687 O O     . HOH F 4 .   ? 84.766  46.933 -0.470  1.00 73.02  ? 1243 HOH A O     1 
HETATM 7688 O O     . HOH F 4 .   ? 97.975  16.670 22.134  1.00 81.55  ? 1244 HOH A O     1 
HETATM 7689 O O     . HOH F 4 .   ? 45.324  54.044 25.398  1.00 72.37  ? 1245 HOH A O     1 
HETATM 7690 O O     . HOH F 4 .   ? 97.295  14.167 16.399  1.00 47.96  ? 1246 HOH A O     1 
HETATM 7691 O O     . HOH F 4 .   ? 50.770  62.971 32.903  1.00 78.80  ? 1247 HOH A O     1 
HETATM 7692 O O     . HOH F 4 .   ? 68.116  10.796 44.969  1.00 74.66  ? 1248 HOH A O     1 
HETATM 7693 O O     . HOH F 4 .   ? 99.252  21.683 26.476  1.00 71.17  ? 1249 HOH A O     1 
HETATM 7694 O O     . HOH F 4 .   ? 70.290  48.144 22.270  1.00 49.42  ? 1250 HOH A O     1 
HETATM 7695 O O     . HOH F 4 .   ? 105.440 34.488 4.594   1.00 77.28  ? 1251 HOH A O     1 
HETATM 7696 O O     . HOH F 4 .   ? 80.651  62.020 -3.848  1.00 83.45  ? 1252 HOH A O     1 
HETATM 7697 O O     . HOH F 4 .   ? 111.850 57.462 18.912  1.00 83.67  ? 1253 HOH A O     1 
HETATM 7698 O O     . HOH F 4 .   ? 61.162  36.310 24.717  1.00 72.73  ? 1254 HOH A O     1 
HETATM 7699 O O     . HOH F 4 .   ? 74.908  32.205 21.066  1.00 57.96  ? 1255 HOH A O     1 
HETATM 7700 O O     . HOH F 4 .   ? 90.423  41.773 7.193   1.00 60.86  ? 1256 HOH A O     1 
HETATM 7701 O O     . HOH F 4 .   ? 64.032  34.269 -0.189  1.00 84.47  ? 1257 HOH A O     1 
HETATM 7702 O O     . HOH F 4 .   ? 55.009  20.202 44.505  1.00 83.39  ? 1258 HOH A O     1 
HETATM 7703 O O     . HOH F 4 .   ? 84.657  15.076 41.832  1.00 56.41  ? 1259 HOH A O     1 
HETATM 7704 O O     . HOH F 4 .   ? 77.548  4.253  52.895  1.00 67.55  ? 1260 HOH A O     1 
HETATM 7705 O O     . HOH F 4 .   ? 63.301  40.268 -25.172 1.00 62.60  ? 1261 HOH A O     1 
HETATM 7706 O O     . HOH F 4 .   ? 96.059  14.922 42.799  1.00 65.98  ? 1262 HOH A O     1 
HETATM 7707 O O     . HOH F 4 .   ? 61.764  36.065 -16.834 1.00 65.73  ? 1263 HOH A O     1 
HETATM 7708 O O     . HOH F 4 .   ? 64.472  51.463 40.094  1.00 57.41  ? 1264 HOH A O     1 
HETATM 7709 O O     . HOH F 4 .   ? 97.543  29.985 18.527  1.00 63.62  ? 1265 HOH A O     1 
HETATM 7710 O O     . HOH F 4 .   ? 78.062  40.565 -4.300  1.00 76.98  ? 1266 HOH A O     1 
HETATM 7711 O O     . HOH F 4 .   ? 77.706  38.911 7.446   1.00 75.14  ? 1267 HOH A O     1 
HETATM 7712 O O     . HOH F 4 .   ? 43.489  39.515 10.278  1.00 74.00  ? 1268 HOH A O     1 
HETATM 7713 O O     . HOH F 4 .   ? 76.067  34.875 44.702  1.00 70.96  ? 1269 HOH A O     1 
HETATM 7714 O O     . HOH F 4 .   ? 81.753  32.109 -11.881 1.00 79.75  ? 1270 HOH A O     1 
HETATM 7715 O O     . HOH F 4 .   ? 49.761  27.858 42.462  1.00 56.33  ? 1271 HOH A O     1 
HETATM 7716 O O     . HOH F 4 .   ? 91.206  -4.946 3.194   1.00 87.04  ? 1272 HOH A O     1 
HETATM 7717 O O     . HOH F 4 .   ? 66.145  55.456 22.000  1.00 44.81  ? 1273 HOH A O     1 
HETATM 7718 O O     . HOH F 4 .   ? 64.019  14.352 -1.593  1.00 75.80  ? 1274 HOH A O     1 
HETATM 7719 O O     . HOH F 4 .   ? 45.281  23.480 20.940  1.00 55.87  ? 1275 HOH A O     1 
HETATM 7720 O O     . HOH F 4 .   ? 96.133  9.466  22.881  1.00 65.79  ? 1276 HOH A O     1 
HETATM 7721 O O     . HOH F 4 .   ? 90.624  67.245 -19.811 1.00 76.45  ? 1277 HOH A O     1 
HETATM 7722 O O     . HOH F 4 .   ? 73.899  72.738 7.295   1.00 68.14  ? 1278 HOH A O     1 
HETATM 7723 O O     . HOH F 4 .   ? 64.156  22.808 -1.551  1.00 63.88  ? 1279 HOH A O     1 
HETATM 7724 O O     . HOH F 4 .   ? 91.447  42.407 42.630  1.00 59.35  ? 1280 HOH A O     1 
HETATM 7725 O O     . HOH F 4 .   ? 70.555  30.502 38.872  1.00 75.21  ? 1281 HOH A O     1 
HETATM 7726 O O     . HOH F 4 .   ? 64.954  26.722 -10.222 1.00 76.56  ? 1282 HOH A O     1 
HETATM 7727 O O     . HOH F 4 .   ? 84.283  25.041 14.580  1.00 63.58  ? 1283 HOH A O     1 
HETATM 7728 O O     . HOH F 4 .   ? 86.346  50.112 32.770  1.00 59.87  ? 1284 HOH A O     1 
HETATM 7729 O O     . HOH F 4 .   ? 103.803 44.154 17.142  1.00 66.46  ? 1285 HOH A O     1 
HETATM 7730 O O     . HOH F 4 .   ? 70.937  44.220 -0.079  1.00 73.47  ? 1286 HOH A O     1 
HETATM 7731 O O     . HOH F 4 .   ? 62.699  38.415 18.112  1.00 81.90  ? 1287 HOH A O     1 
HETATM 7732 O O     . HOH F 4 .   ? 101.833 45.122 24.215  1.00 63.51  ? 1288 HOH A O     1 
HETATM 7733 O O     . HOH F 4 .   ? 76.063  60.627 44.169  1.00 58.08  ? 1289 HOH A O     1 
HETATM 7734 O O     . HOH F 4 .   ? 62.623  25.479 2.817   1.00 66.34  ? 1290 HOH A O     1 
HETATM 7735 O O     . HOH F 4 .   ? 78.766  19.255 -8.863  1.00 83.53  ? 1291 HOH A O     1 
HETATM 7736 O O     . HOH F 4 .   ? 38.817  42.084 17.030  1.00 62.26  ? 1292 HOH A O     1 
HETATM 7737 O O     . HOH F 4 .   ? 93.499  54.400 7.939   1.00 60.41  ? 1293 HOH A O     1 
HETATM 7738 O O     . HOH F 4 .   ? 77.083  44.040 17.318  1.00 52.86  ? 1294 HOH A O     1 
HETATM 7739 O O     . HOH F 4 .   ? 112.456 54.960 15.443  1.00 74.35  ? 1295 HOH A O     1 
HETATM 7740 O O     . HOH F 4 .   ? 95.004  3.479  -4.748  1.00 49.70  ? 1296 HOH A O     1 
HETATM 7741 O O     . HOH F 4 .   ? 64.655  41.450 -0.694  1.00 62.57  ? 1297 HOH A O     1 
HETATM 7742 O O     . HOH F 4 .   ? 80.131  23.362 -10.772 1.00 60.95  ? 1298 HOH A O     1 
HETATM 7743 O O     . HOH F 4 .   ? 37.363  42.938 25.100  1.00 70.56  ? 1299 HOH A O     1 
HETATM 7744 O O     . HOH F 4 .   ? 75.997  55.329 15.636  1.00 75.26  ? 1300 HOH A O     1 
HETATM 7745 O O     . HOH F 4 .   ? 69.552  21.963 -9.505  1.00 72.56  ? 1301 HOH A O     1 
HETATM 7746 O O     . HOH F 4 .   ? 58.553  14.906 15.666  1.00 86.11  ? 1302 HOH A O     1 
HETATM 7747 O O     . HOH F 4 .   ? 63.398  6.269  14.699  1.00 82.14  ? 1303 HOH A O     1 
HETATM 7748 O O     . HOH F 4 .   ? 78.470  25.817 50.639  1.00 73.45  ? 1304 HOH A O     1 
HETATM 7749 O O     . HOH F 4 .   ? 99.988  25.478 28.099  1.00 76.35  ? 1305 HOH A O     1 
HETATM 7750 O O     . HOH F 4 .   ? 90.731  14.950 30.277  1.00 59.09  ? 1306 HOH A O     1 
HETATM 7751 O O     . HOH F 4 .   ? 64.139  32.691 3.914   1.00 60.84  ? 1307 HOH A O     1 
HETATM 7752 O O     . HOH F 4 .   ? 105.690 32.052 8.901   1.00 70.42  ? 1308 HOH A O     1 
HETATM 7753 O O     . HOH F 4 .   ? 100.385 48.838 32.498  1.00 63.64  ? 1309 HOH A O     1 
HETATM 7754 O O     . HOH F 4 .   ? 48.024  33.323 4.606   1.00 58.06  ? 1310 HOH A O     1 
HETATM 7755 O O     . HOH F 4 .   ? 92.808  15.305 -14.175 1.00 66.52  ? 1311 HOH A O     1 
HETATM 7756 O O     . HOH F 4 .   ? 110.760 51.370 13.881  1.00 76.02  ? 1312 HOH A O     1 
HETATM 7757 O O     . HOH F 4 .   ? 66.250  28.957 13.421  1.00 62.81  ? 1313 HOH A O     1 
HETATM 7758 O O     . HOH F 4 .   ? 68.967  42.205 -5.279  1.00 61.68  ? 1314 HOH A O     1 
HETATM 7759 O O     . HOH F 4 .   ? 102.429 6.927  6.780   1.00 59.42  ? 1315 HOH A O     1 
HETATM 7760 O O     . HOH F 4 .   ? 59.514  30.372 45.719  1.00 81.47  ? 1316 HOH A O     1 
HETATM 7761 O O     . HOH F 4 .   ? 86.202  44.267 41.149  1.00 83.67  ? 1317 HOH A O     1 
HETATM 7762 O O     . HOH F 4 .   ? 101.322 16.830 38.171  1.00 87.24  ? 1318 HOH A O     1 
HETATM 7763 O O     . HOH F 4 .   ? 74.857  68.517 24.511  1.00 90.69  ? 1319 HOH A O     1 
HETATM 7764 O O     . HOH F 4 .   ? 89.416  62.610 -20.974 1.00 77.31  ? 1320 HOH A O     1 
HETATM 7765 O O     . HOH F 4 .   ? 69.134  47.006 11.327  1.00 75.62  ? 1321 HOH A O     1 
HETATM 7766 O O     . HOH F 4 .   ? 49.300  23.620 21.033  1.00 57.13  ? 1322 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DT  1   1   1   DT  T   T . n 
A 1 2   DA  2   2   2   DA  A   T . n 
A 1 3   DT  3   3   3   DT  T   T . n 
A 1 4   DA  4   4   4   DA  A   T . n 
A 1 5   DG  5   5   5   DG  G   T . n 
A 1 6   DT  6   6   6   DT  T   T . n 
A 1 7   DG  7   7   7   DG  G   T . n 
A 1 8   DA  8   8   8   DA  A   T . n 
A 1 9   DG  9   9   9   DG  G   T . n 
A 1 10  DT  10  10  10  DT  T   T . n 
A 1 11  DC  11  11  11  DC  C   T . n 
A 1 12  DG  12  12  12  DG  G   T . n 
A 1 13  DT  13  13  13  DT  T   T . n 
A 1 14  DA  14  14  14  DA  A   T . n 
A 1 15  DT  15  15  15  DT  T   T . n 
A 1 16  DT  16  16  16  DT  T   T . n 
A 1 17  DA  17  17  17  DA  A   T . n 
B 2 1   DT  1   101 101 DT  T   N . n 
B 2 2   DA  2   102 102 DA  A   N . n 
B 2 3   DA  3   103 103 DA  A   N . n 
B 2 4   DT  4   104 104 DT  T   N . n 
B 2 5   DA  5   105 105 DA  A   N . n 
B 2 6   DC  6   106 106 DC  C   N . n 
B 2 7   DG  7   107 107 DG  G   N . n 
B 2 8   DA  8   108 108 DA  A   N . n 
B 2 9   DC  9   109 109 DC  C   N . n 
B 2 10  DT  10  110 110 DT  T   N . n 
B 2 11  DC  11  111 111 DC  C   N . n 
B 2 12  DA  12  112 112 DA  A   N . n 
B 2 13  DC  13  113 113 DC  C   N . n 
B 2 14  DT  14  114 114 DT  T   N . n 
B 2 15  DA  15  115 115 DA  A   N . n 
C 3 1   MET 1   1   ?   ?   ?   A . n 
C 3 2   ASN 2   2   ?   ?   ?   A . n 
C 3 3   THR 3   3   ?   ?   ?   A . n 
C 3 4   ILE 4   4   ?   ?   ?   A . n 
C 3 5   ASN 5   5   ?   ?   ?   A . n 
C 3 6   ILE 6   6   6   ILE ILE A . n 
C 3 7   ALA 7   7   7   ALA ALA A . n 
C 3 8   LYS 8   8   8   LYS LYS A . n 
C 3 9   ASN 9   9   9   ASN ASN A . n 
C 3 10  ASP 10  10  10  ASP ASP A . n 
C 3 11  PHE 11  11  11  PHE PHE A . n 
C 3 12  SER 12  12  12  SER SER A . n 
C 3 13  ASP 13  13  13  ASP ASP A . n 
C 3 14  ILE 14  14  14  ILE ILE A . n 
C 3 15  GLU 15  15  15  GLU GLU A . n 
C 3 16  LEU 16  16  16  LEU LEU A . n 
C 3 17  ALA 17  17  17  ALA ALA A . n 
C 3 18  ALA 18  18  18  ALA ALA A . n 
C 3 19  ILE 19  19  19  ILE ILE A . n 
C 3 20  PRO 20  20  20  PRO PRO A . n 
C 3 21  PHE 21  21  21  PHE PHE A . n 
C 3 22  ASN 22  22  22  ASN ASN A . n 
C 3 23  THR 23  23  23  THR THR A . n 
C 3 24  LEU 24  24  24  LEU LEU A . n 
C 3 25  ALA 25  25  25  ALA ALA A . n 
C 3 26  ASP 26  26  26  ASP ASP A . n 
C 3 27  HIS 27  27  27  HIS HIS A . n 
C 3 28  TYR 28  28  28  TYR TYR A . n 
C 3 29  GLY 29  29  29  GLY GLY A . n 
C 3 30  GLU 30  30  30  GLU GLU A . n 
C 3 31  ARG 31  31  31  ARG ARG A . n 
C 3 32  LEU 32  32  32  LEU LEU A . n 
C 3 33  ALA 33  33  33  ALA ALA A . n 
C 3 34  ARG 34  34  34  ARG ARG A . n 
C 3 35  GLU 35  35  35  GLU GLU A . n 
C 3 36  GLN 36  36  36  GLN GLN A . n 
C 3 37  LEU 37  37  37  LEU LEU A . n 
C 3 38  ALA 38  38  38  ALA ALA A . n 
C 3 39  LEU 39  39  39  LEU LEU A . n 
C 3 40  GLU 40  40  40  GLU GLU A . n 
C 3 41  HIS 41  41  41  HIS HIS A . n 
C 3 42  GLU 42  42  42  GLU GLU A . n 
C 3 43  SER 43  43  43  SER SER A . n 
C 3 44  TYR 44  44  44  TYR TYR A . n 
C 3 45  GLU 45  45  45  GLU GLU A . n 
C 3 46  MET 46  46  46  MET MET A . n 
C 3 47  GLY 47  47  47  GLY GLY A . n 
C 3 48  GLU 48  48  48  GLU GLU A . n 
C 3 49  ALA 49  49  49  ALA ALA A . n 
C 3 50  ARG 50  50  50  ARG ARG A . n 
C 3 51  PHE 51  51  51  PHE PHE A . n 
C 3 52  ARG 52  52  52  ARG ARG A . n 
C 3 53  LYS 53  53  53  LYS LYS A . n 
C 3 54  MET 54  54  54  MET MET A . n 
C 3 55  PHE 55  55  55  PHE PHE A . n 
C 3 56  GLU 56  56  ?   ?   ?   A . n 
C 3 57  ARG 57  57  ?   ?   ?   A . n 
C 3 58  GLN 58  58  ?   ?   ?   A . n 
C 3 59  LEU 59  59  ?   ?   ?   A . n 
C 3 60  LYS 60  60  ?   ?   ?   A . n 
C 3 61  ALA 61  61  ?   ?   ?   A . n 
C 3 62  GLY 62  62  ?   ?   ?   A . n 
C 3 63  GLU 63  63  ?   ?   ?   A . n 
C 3 64  VAL 64  64  ?   ?   ?   A . n 
C 3 65  ALA 65  65  ?   ?   ?   A . n 
C 3 66  ASP 66  66  ?   ?   ?   A . n 
C 3 67  ASN 67  67  ?   ?   ?   A . n 
C 3 68  ALA 68  68  ?   ?   ?   A . n 
C 3 69  ALA 69  69  ?   ?   ?   A . n 
C 3 70  ALA 70  70  ?   ?   ?   A . n 
C 3 71  LYS 71  71  ?   ?   ?   A . n 
C 3 72  PRO 72  72  72  PRO PRO A . n 
C 3 73  LEU 73  73  73  LEU LEU A . n 
C 3 74  ILE 74  74  74  ILE ILE A . n 
C 3 75  THR 75  75  75  THR THR A . n 
C 3 76  THR 76  76  76  THR THR A . n 
C 3 77  LEU 77  77  77  LEU LEU A . n 
C 3 78  LEU 78  78  78  LEU LEU A . n 
C 3 79  PRO 79  79  79  PRO PRO A . n 
C 3 80  LYS 80  80  80  LYS LYS A . n 
C 3 81  MET 81  81  81  MET MET A . n 
C 3 82  ILE 82  82  82  ILE ILE A . n 
C 3 83  ALA 83  83  83  ALA ALA A . n 
C 3 84  ARG 84  84  84  ARG ARG A . n 
C 3 85  ILE 85  85  85  ILE ILE A . n 
C 3 86  ASN 86  86  86  ASN ASN A . n 
C 3 87  ASP 87  87  87  ASP ASP A . n 
C 3 88  TRP 88  88  88  TRP TRP A . n 
C 3 89  PHE 89  89  89  PHE PHE A . n 
C 3 90  GLU 90  90  90  GLU GLU A . n 
C 3 91  GLU 91  91  91  GLU GLU A . n 
C 3 92  VAL 92  92  92  VAL VAL A . n 
C 3 93  LYS 93  93  93  LYS LYS A . n 
C 3 94  ALA 94  94  94  ALA ALA A . n 
C 3 95  LYS 95  95  95  LYS LYS A . n 
C 3 96  ARG 96  96  96  ARG ARG A . n 
C 3 97  GLY 97  97  97  GLY GLY A . n 
C 3 98  LYS 98  98  98  LYS LYS A . n 
C 3 99  ARG 99  99  99  ARG ARG A . n 
C 3 100 PRO 100 100 100 PRO PRO A . n 
C 3 101 THR 101 101 101 THR THR A . n 
C 3 102 ALA 102 102 102 ALA ALA A . n 
C 3 103 PHE 103 103 103 PHE PHE A . n 
C 3 104 GLN 104 104 104 GLN GLN A . n 
C 3 105 PHE 105 105 105 PHE PHE A . n 
C 3 106 LEU 106 106 106 LEU LEU A . n 
C 3 107 GLN 107 107 107 GLN GLN A . n 
C 3 108 GLU 108 108 108 GLU GLU A . n 
C 3 109 ILE 109 109 109 ILE ILE A . n 
C 3 110 LYS 110 110 110 LYS LYS A . n 
C 3 111 PRO 111 111 111 PRO PRO A . n 
C 3 112 GLU 112 112 112 GLU GLU A . n 
C 3 113 ALA 113 113 113 ALA ALA A . n 
C 3 114 VAL 114 114 114 VAL VAL A . n 
C 3 115 ALA 115 115 115 ALA ALA A . n 
C 3 116 TYR 116 116 116 TYR TYR A . n 
C 3 117 ILE 117 117 117 ILE ILE A . n 
C 3 118 THR 118 118 118 THR THR A . n 
C 3 119 ILE 119 119 119 ILE ILE A . n 
C 3 120 LYS 120 120 120 LYS LYS A . n 
C 3 121 THR 121 121 121 THR THR A . n 
C 3 122 THR 122 122 122 THR THR A . n 
C 3 123 LEU 123 123 123 LEU LEU A . n 
C 3 124 ALA 124 124 124 ALA ALA A . n 
C 3 125 CYS 125 125 125 CYS CYS A . n 
C 3 126 LEU 126 126 126 LEU LEU A . n 
C 3 127 THR 127 127 127 THR THR A . n 
C 3 128 SER 128 128 128 SER SER A . n 
C 3 129 ALA 129 129 129 ALA ALA A . n 
C 3 130 ASP 130 130 130 ASP ASP A . n 
C 3 131 ASN 131 131 131 ASN ASN A . n 
C 3 132 THR 132 132 132 THR THR A . n 
C 3 133 THR 133 133 133 THR THR A . n 
C 3 134 VAL 134 134 134 VAL VAL A . n 
C 3 135 GLN 135 135 135 GLN GLN A . n 
C 3 136 ALA 136 136 136 ALA ALA A . n 
C 3 137 VAL 137 137 137 VAL VAL A . n 
C 3 138 ALA 138 138 138 ALA ALA A . n 
C 3 139 SER 139 139 139 SER SER A . n 
C 3 140 ALA 140 140 140 ALA ALA A . n 
C 3 141 ILE 141 141 141 ILE ILE A . n 
C 3 142 GLY 142 142 142 GLY GLY A . n 
C 3 143 ARG 143 143 143 ARG ARG A . n 
C 3 144 ALA 144 144 144 ALA ALA A . n 
C 3 145 ILE 145 145 145 ILE ILE A . n 
C 3 146 GLU 146 146 146 GLU GLU A . n 
C 3 147 ASP 147 147 147 ASP ASP A . n 
C 3 148 GLU 148 148 148 GLU GLU A . n 
C 3 149 ALA 149 149 149 ALA ALA A . n 
C 3 150 ARG 150 150 150 ARG ARG A . n 
C 3 151 PHE 151 151 151 PHE PHE A . n 
C 3 152 GLY 152 152 152 GLY GLY A . n 
C 3 153 ARG 153 153 153 ARG ARG A . n 
C 3 154 ILE 154 154 154 ILE ILE A . n 
C 3 155 ARG 155 155 155 ARG ARG A . n 
C 3 156 ASP 156 156 156 ASP ASP A . n 
C 3 157 LEU 157 157 157 LEU LEU A . n 
C 3 158 GLU 158 158 158 GLU GLU A . n 
C 3 159 ALA 159 159 159 ALA ALA A . n 
C 3 160 LYS 160 160 160 LYS LYS A . n 
C 3 161 HIS 161 161 161 HIS HIS A . n 
C 3 162 PHE 162 162 162 PHE PHE A . n 
C 3 163 LYS 163 163 163 LYS LYS A . n 
C 3 164 LYS 164 164 164 LYS LYS A . n 
C 3 165 ASN 165 165 165 ASN ASN A . n 
C 3 166 VAL 166 166 166 VAL VAL A . n 
C 3 167 GLU 167 167 167 GLU GLU A . n 
C 3 168 GLU 168 168 168 GLU GLU A . n 
C 3 169 GLN 169 169 169 GLN GLN A . n 
C 3 170 LEU 170 170 170 LEU LEU A . n 
C 3 171 ASN 171 171 171 ASN ASN A . n 
C 3 172 LYS 172 172 172 LYS LYS A . n 
C 3 173 ARG 173 173 173 ARG ARG A . n 
C 3 174 VAL 174 174 174 VAL VAL A . n 
C 3 175 GLY 175 175 175 GLY GLY A . n 
C 3 176 HIS 176 176 176 HIS HIS A . n 
C 3 177 VAL 177 177 177 VAL VAL A . n 
C 3 178 TYR 178 178 178 TYR TYR A . n 
C 3 179 LYS 179 179 179 LYS LYS A . n 
C 3 180 LYS 180 180 180 LYS LYS A . n 
C 3 181 ALA 181 181 181 ALA ALA A . n 
C 3 182 PHE 182 182 182 PHE PHE A . n 
C 3 183 MET 183 183 183 MET MET A . n 
C 3 184 GLN 184 184 184 GLN GLN A . n 
C 3 185 VAL 185 185 185 VAL VAL A . n 
C 3 186 VAL 186 186 186 VAL VAL A . n 
C 3 187 GLU 187 187 187 GLU GLU A . n 
C 3 188 ALA 188 188 188 ALA ALA A . n 
C 3 189 ASP 189 189 189 ASP ASP A . n 
C 3 190 MET 190 190 190 MET MET A . n 
C 3 191 LEU 191 191 191 LEU LEU A . n 
C 3 192 SER 192 192 192 SER SER A . n 
C 3 193 LYS 193 193 193 LYS LYS A . n 
C 3 194 GLY 194 194 194 GLY GLY A . n 
C 3 195 LEU 195 195 195 LEU LEU A . n 
C 3 196 LEU 196 196 196 LEU LEU A . n 
C 3 197 GLY 197 197 197 GLY GLY A . n 
C 3 198 GLY 198 198 198 GLY GLY A . n 
C 3 199 GLU 199 199 199 GLU GLU A . n 
C 3 200 ALA 200 200 200 ALA ALA A . n 
C 3 201 TRP 201 201 201 TRP TRP A . n 
C 3 202 SER 202 202 202 SER SER A . n 
C 3 203 SER 203 203 203 SER SER A . n 
C 3 204 TRP 204 204 204 TRP TRP A . n 
C 3 205 HIS 205 205 205 HIS HIS A . n 
C 3 206 LYS 206 206 206 LYS LYS A . n 
C 3 207 GLU 207 207 207 GLU GLU A . n 
C 3 208 ASP 208 208 208 ASP ASP A . n 
C 3 209 SER 209 209 209 SER SER A . n 
C 3 210 ILE 210 210 210 ILE ILE A . n 
C 3 211 HIS 211 211 211 HIS HIS A . n 
C 3 212 VAL 212 212 212 VAL VAL A . n 
C 3 213 GLY 213 213 213 GLY GLY A . n 
C 3 214 VAL 214 214 214 VAL VAL A . n 
C 3 215 ARG 215 215 215 ARG ARG A . n 
C 3 216 CYS 216 216 216 CYS CYS A . n 
C 3 217 ILE 217 217 217 ILE ILE A . n 
C 3 218 GLU 218 218 218 GLU GLU A . n 
C 3 219 MET 219 219 219 MET MET A . n 
C 3 220 LEU 220 220 220 LEU LEU A . n 
C 3 221 ILE 221 221 221 ILE ILE A . n 
C 3 222 GLU 222 222 222 GLU GLU A . n 
C 3 223 SER 223 223 223 SER SER A . n 
C 3 224 THR 224 224 224 THR THR A . n 
C 3 225 GLY 225 225 225 GLY GLY A . n 
C 3 226 MET 226 226 226 MET MET A . n 
C 3 227 VAL 227 227 227 VAL VAL A . n 
C 3 228 SER 228 228 228 SER SER A . n 
C 3 229 LEU 229 229 229 LEU LEU A . n 
C 3 230 HIS 230 230 230 HIS HIS A . n 
C 3 231 ARG 231 231 231 ARG ARG A . n 
C 3 232 GLN 232 232 232 GLN GLN A . n 
C 3 233 ASN 233 233 233 ASN ASN A . n 
C 3 234 ALA 234 234 234 ALA ALA A . n 
C 3 235 GLY 235 235 235 GLY GLY A . n 
C 3 236 VAL 236 236 236 VAL VAL A . n 
C 3 237 VAL 237 237 237 VAL VAL A . n 
C 3 238 GLY 238 238 238 GLY GLY A . n 
C 3 239 GLN 239 239 239 GLN GLN A . n 
C 3 240 ASP 240 240 240 ASP ASP A . n 
C 3 241 SER 241 241 241 SER SER A . n 
C 3 242 GLU 242 242 242 GLU GLU A . n 
C 3 243 THR 243 243 243 THR THR A . n 
C 3 244 ILE 244 244 244 ILE ILE A . n 
C 3 245 GLU 245 245 245 GLU GLU A . n 
C 3 246 LEU 246 246 246 LEU LEU A . n 
C 3 247 ALA 247 247 247 ALA ALA A . n 
C 3 248 PRO 248 248 248 PRO PRO A . n 
C 3 249 GLU 249 249 249 GLU GLU A . n 
C 3 250 TYR 250 250 250 TYR TYR A . n 
C 3 251 ALA 251 251 251 ALA ALA A . n 
C 3 252 GLU 252 252 252 GLU GLU A . n 
C 3 253 ALA 253 253 253 ALA ALA A . n 
C 3 254 ILE 254 254 254 ILE ILE A . n 
C 3 255 ALA 255 255 255 ALA ALA A . n 
C 3 256 THR 256 256 256 THR THR A . n 
C 3 257 ARG 257 257 257 ARG ARG A . n 
C 3 258 ALA 258 258 258 ALA ALA A . n 
C 3 259 GLY 259 259 259 GLY GLY A . n 
C 3 260 ALA 260 260 260 ALA ALA A . n 
C 3 261 LEU 261 261 261 LEU LEU A . n 
C 3 262 ALA 262 262 262 ALA ALA A . n 
C 3 263 GLY 263 263 263 GLY GLY A . n 
C 3 264 ILE 264 264 264 ILE ILE A . n 
C 3 265 SER 265 265 265 SER SER A . n 
C 3 266 PRO 266 266 266 PRO PRO A . n 
C 3 267 MET 267 267 267 MET MET A . n 
C 3 268 PHE 268 268 268 PHE PHE A . n 
C 3 269 GLN 269 269 269 GLN GLN A . n 
C 3 270 PRO 270 270 270 PRO PRO A . n 
C 3 271 CYS 271 271 271 CYS CYS A . n 
C 3 272 VAL 272 272 272 VAL VAL A . n 
C 3 273 VAL 273 273 273 VAL VAL A . n 
C 3 274 PRO 274 274 274 PRO PRO A . n 
C 3 275 PRO 275 275 275 PRO PRO A . n 
C 3 276 LYS 276 276 276 LYS LYS A . n 
C 3 277 PRO 277 277 277 PRO PRO A . n 
C 3 278 TRP 278 278 278 TRP TRP A . n 
C 3 279 THR 279 279 279 THR THR A . n 
C 3 280 GLY 280 280 280 GLY GLY A . n 
C 3 281 ILE 281 281 281 ILE ILE A . n 
C 3 282 THR 282 282 282 THR THR A . n 
C 3 283 GLY 283 283 283 GLY GLY A . n 
C 3 284 GLY 284 284 284 GLY GLY A . n 
C 3 285 GLY 285 285 285 GLY GLY A . n 
C 3 286 TYR 286 286 286 TYR TYR A . n 
C 3 287 TRP 287 287 287 TRP TRP A . n 
C 3 288 ALA 288 288 288 ALA ALA A . n 
C 3 289 ASN 289 289 289 ASN ASN A . n 
C 3 290 GLY 290 290 290 GLY GLY A . n 
C 3 291 ARG 291 291 291 ARG ARG A . n 
C 3 292 ARG 292 292 292 ARG ARG A . n 
C 3 293 PRO 293 293 293 PRO PRO A . n 
C 3 294 LEU 294 294 294 LEU LEU A . n 
C 3 295 ALA 295 295 295 ALA ALA A . n 
C 3 296 LEU 296 296 296 LEU LEU A . n 
C 3 297 VAL 297 297 297 VAL VAL A . n 
C 3 298 ARG 298 298 298 ARG ARG A . n 
C 3 299 THR 299 299 299 THR THR A . n 
C 3 300 HIS 300 300 300 HIS HIS A . n 
C 3 301 SER 301 301 301 SER SER A . n 
C 3 302 LYS 302 302 302 LYS LYS A . n 
C 3 303 LYS 303 303 303 LYS LYS A . n 
C 3 304 ALA 304 304 304 ALA ALA A . n 
C 3 305 LEU 305 305 305 LEU LEU A . n 
C 3 306 MET 306 306 306 MET MET A . n 
C 3 307 ARG 307 307 307 ARG ARG A . n 
C 3 308 TYR 308 308 308 TYR TYR A . n 
C 3 309 GLU 309 309 309 GLU GLU A . n 
C 3 310 ASP 310 310 310 ASP ASP A . n 
C 3 311 VAL 311 311 311 VAL VAL A . n 
C 3 312 TYR 312 312 312 TYR TYR A . n 
C 3 313 MET 313 313 313 MET MET A . n 
C 3 314 PRO 314 314 314 PRO PRO A . n 
C 3 315 GLU 315 315 315 GLU GLU A . n 
C 3 316 VAL 316 316 316 VAL VAL A . n 
C 3 317 TYR 317 317 317 TYR TYR A . n 
C 3 318 LYS 318 318 318 LYS LYS A . n 
C 3 319 ALA 319 319 319 ALA ALA A . n 
C 3 320 ILE 320 320 320 ILE ILE A . n 
C 3 321 ASN 321 321 321 ASN ASN A . n 
C 3 322 ILE 322 322 322 ILE ILE A . n 
C 3 323 ALA 323 323 323 ALA ALA A . n 
C 3 324 GLN 324 324 324 GLN GLN A . n 
C 3 325 ASN 325 325 325 ASN ASN A . n 
C 3 326 THR 326 326 326 THR THR A . n 
C 3 327 ALA 327 327 327 ALA ALA A . n 
C 3 328 TRP 328 328 328 TRP TRP A . n 
C 3 329 LYS 329 329 329 LYS LYS A . n 
C 3 330 ILE 330 330 330 ILE ILE A . n 
C 3 331 ASN 331 331 331 ASN ASN A . n 
C 3 332 LYS 332 332 332 LYS LYS A . n 
C 3 333 LYS 333 333 333 LYS LYS A . n 
C 3 334 VAL 334 334 334 VAL VAL A . n 
C 3 335 LEU 335 335 335 LEU LEU A . n 
C 3 336 ALA 336 336 336 ALA ALA A . n 
C 3 337 VAL 337 337 337 VAL VAL A . n 
C 3 338 ALA 338 338 338 ALA ALA A . n 
C 3 339 ASN 339 339 339 ASN ASN A . n 
C 3 340 VAL 340 340 340 VAL VAL A . n 
C 3 341 ILE 341 341 341 ILE ILE A . n 
C 3 342 THR 342 342 342 THR THR A . n 
C 3 343 LYS 343 343 343 LYS LYS A . n 
C 3 344 TRP 344 344 344 TRP TRP A . n 
C 3 345 LYS 345 345 345 LYS LYS A . n 
C 3 346 HIS 346 346 346 HIS HIS A . n 
C 3 347 CYS 347 347 347 CYS CYS A . n 
C 3 348 PRO 348 348 348 PRO PRO A . n 
C 3 349 VAL 349 349 349 VAL VAL A . n 
C 3 350 GLU 350 350 350 GLU GLU A . n 
C 3 351 ASP 351 351 351 ASP ASP A . n 
C 3 352 ILE 352 352 352 ILE ILE A . n 
C 3 353 PRO 353 353 353 PRO PRO A . n 
C 3 354 ALA 354 354 354 ALA ALA A . n 
C 3 355 ILE 355 355 355 ILE ILE A . n 
C 3 356 GLU 356 356 356 GLU GLU A . n 
C 3 357 ARG 357 357 357 ARG ARG A . n 
C 3 358 GLU 358 358 358 GLU GLU A . n 
C 3 359 GLU 359 359 359 GLU GLU A . n 
C 3 360 LEU 360 360 360 LEU LEU A . n 
C 3 361 PRO 361 361 361 PRO PRO A . n 
C 3 362 MET 362 362 362 MET MET A . n 
C 3 363 LYS 363 363 363 LYS LYS A . n 
C 3 364 PRO 364 364 364 PRO PRO A . n 
C 3 365 GLU 365 365 365 GLU GLU A . n 
C 3 366 ASP 366 366 366 ASP ASP A . n 
C 3 367 ILE 367 367 367 ILE ILE A . n 
C 3 368 ASP 368 368 368 ASP ASP A . n 
C 3 369 MET 369 369 369 MET MET A . n 
C 3 370 ASN 370 370 370 ASN ASN A . n 
C 3 371 PRO 371 371 371 PRO PRO A . n 
C 3 372 GLU 372 372 372 GLU GLU A . n 
C 3 373 ALA 373 373 373 ALA ALA A . n 
C 3 374 LEU 374 374 374 LEU LEU A . n 
C 3 375 THR 375 375 375 THR THR A . n 
C 3 376 ALA 376 376 376 ALA ALA A . n 
C 3 377 TRP 377 377 377 TRP TRP A . n 
C 3 378 LYS 378 378 378 LYS LYS A . n 
C 3 379 ARG 379 379 379 ARG ARG A . n 
C 3 380 ALA 380 380 380 ALA ALA A . n 
C 3 381 ALA 381 381 381 ALA ALA A . n 
C 3 382 ALA 382 382 382 ALA ALA A . n 
C 3 383 ALA 383 383 383 ALA ALA A . n 
C 3 384 VAL 384 384 384 VAL VAL A . n 
C 3 385 TYR 385 385 385 TYR TYR A . n 
C 3 386 ARG 386 386 386 ARG ARG A . n 
C 3 387 LYS 387 387 387 LYS LYS A . n 
C 3 388 ASP 388 388 388 ASP ASP A . n 
C 3 389 LYS 389 389 389 LYS LYS A . n 
C 3 390 ALA 390 390 390 ALA ALA A . n 
C 3 391 ARG 391 391 391 ARG ARG A . n 
C 3 392 LYS 392 392 392 LYS LYS A . n 
C 3 393 SER 393 393 393 SER SER A . n 
C 3 394 ARG 394 394 394 ARG ARG A . n 
C 3 395 ARG 395 395 395 ARG ARG A . n 
C 3 396 ILE 396 396 396 ILE ILE A . n 
C 3 397 SER 397 397 397 SER SER A . n 
C 3 398 LEU 398 398 398 LEU LEU A . n 
C 3 399 GLU 399 399 399 GLU GLU A . n 
C 3 400 PHE 400 400 400 PHE PHE A . n 
C 3 401 MET 401 401 401 MET MET A . n 
C 3 402 LEU 402 402 402 LEU LEU A . n 
C 3 403 GLU 403 403 403 GLU GLU A . n 
C 3 404 GLN 404 404 404 GLN GLN A . n 
C 3 405 ALA 405 405 405 ALA ALA A . n 
C 3 406 ASN 406 406 406 ASN ASN A . n 
C 3 407 LYS 407 407 407 LYS LYS A . n 
C 3 408 PHE 408 408 408 PHE PHE A . n 
C 3 409 ALA 409 409 409 ALA ALA A . n 
C 3 410 ASN 410 410 410 ASN ASN A . n 
C 3 411 HIS 411 411 411 HIS HIS A . n 
C 3 412 LYS 412 412 412 LYS LYS A . n 
C 3 413 ALA 413 413 413 ALA ALA A . n 
C 3 414 ILE 414 414 414 ILE ILE A . n 
C 3 415 TRP 415 415 415 TRP TRP A . n 
C 3 416 PHE 416 416 416 PHE PHE A . n 
C 3 417 PRO 417 417 417 PRO PRO A . n 
C 3 418 TYR 418 418 418 TYR TYR A . n 
C 3 419 ASN 419 419 419 ASN ASN A . n 
C 3 420 MET 420 420 420 MET MET A . n 
C 3 421 ASP 421 421 421 ASP ASP A . n 
C 3 422 TRP 422 422 422 TRP TRP A . n 
C 3 423 ARG 423 423 423 ARG ARG A . n 
C 3 424 GLY 424 424 424 GLY GLY A . n 
C 3 425 ARG 425 425 425 ARG ARG A . n 
C 3 426 VAL 426 426 426 VAL VAL A . n 
C 3 427 TYR 427 427 427 TYR TYR A . n 
C 3 428 ALA 428 428 428 ALA ALA A . n 
C 3 429 VAL 429 429 429 VAL VAL A . n 
C 3 430 SER 430 430 430 SER SER A . n 
C 3 431 MET 431 431 431 MET MET A . n 
C 3 432 PHE 432 432 432 PHE PHE A . n 
C 3 433 ASN 433 433 433 ASN ASN A . n 
C 3 434 PRO 434 434 434 PRO PRO A . n 
C 3 435 GLN 435 435 435 GLN GLN A . n 
C 3 436 GLY 436 436 436 GLY GLY A . n 
C 3 437 ASN 437 437 437 ASN ASN A . n 
C 3 438 ASP 438 438 438 ASP ASP A . n 
C 3 439 MET 439 439 439 MET MET A . n 
C 3 440 THR 440 440 440 THR THR A . n 
C 3 441 LYS 441 441 441 LYS LYS A . n 
C 3 442 GLY 442 442 442 GLY GLY A . n 
C 3 443 LEU 443 443 443 LEU LEU A . n 
C 3 444 LEU 444 444 444 LEU LEU A . n 
C 3 445 THR 445 445 445 THR THR A . n 
C 3 446 LEU 446 446 446 LEU LEU A . n 
C 3 447 ALA 447 447 447 ALA ALA A . n 
C 3 448 LYS 448 448 448 LYS LYS A . n 
C 3 449 GLY 449 449 449 GLY GLY A . n 
C 3 450 LYS 450 450 450 LYS LYS A . n 
C 3 451 PRO 451 451 451 PRO PRO A . n 
C 3 452 ILE 452 452 452 ILE ILE A . n 
C 3 453 GLY 453 453 453 GLY GLY A . n 
C 3 454 LYS 454 454 454 LYS LYS A . n 
C 3 455 GLU 455 455 455 GLU GLU A . n 
C 3 456 GLY 456 456 456 GLY GLY A . n 
C 3 457 TYR 457 457 457 TYR TYR A . n 
C 3 458 TYR 458 458 458 TYR TYR A . n 
C 3 459 TRP 459 459 459 TRP TRP A . n 
C 3 460 LEU 460 460 460 LEU LEU A . n 
C 3 461 LYS 461 461 461 LYS LYS A . n 
C 3 462 ILE 462 462 462 ILE ILE A . n 
C 3 463 HIS 463 463 463 HIS HIS A . n 
C 3 464 GLY 464 464 464 GLY GLY A . n 
C 3 465 ALA 465 465 465 ALA ALA A . n 
C 3 466 ASN 466 466 466 ASN ASN A . n 
C 3 467 CYS 467 467 467 CYS CYS A . n 
C 3 468 ALA 468 468 468 ALA ALA A . n 
C 3 469 GLY 469 469 469 GLY GLY A . n 
C 3 470 VAL 470 470 470 VAL VAL A . n 
C 3 471 ASP 471 471 471 ASP ASP A . n 
C 3 472 LYS 472 472 472 LYS LYS A . n 
C 3 473 VAL 473 473 473 VAL VAL A . n 
C 3 474 PRO 474 474 474 PRO PRO A . n 
C 3 475 PHE 475 475 475 PHE PHE A . n 
C 3 476 PRO 476 476 476 PRO PRO A . n 
C 3 477 GLU 477 477 477 GLU GLU A . n 
C 3 478 ARG 478 478 478 ARG ARG A . n 
C 3 479 ILE 479 479 479 ILE ILE A . n 
C 3 480 LYS 480 480 480 LYS LYS A . n 
C 3 481 PHE 481 481 481 PHE PHE A . n 
C 3 482 ILE 482 482 482 ILE ILE A . n 
C 3 483 GLU 483 483 483 GLU GLU A . n 
C 3 484 GLU 484 484 484 GLU GLU A . n 
C 3 485 ASN 485 485 485 ASN ASN A . n 
C 3 486 HIS 486 486 486 HIS HIS A . n 
C 3 487 GLU 487 487 487 GLU GLU A . n 
C 3 488 ASN 488 488 488 ASN ASN A . n 
C 3 489 ILE 489 489 489 ILE ILE A . n 
C 3 490 MET 490 490 490 MET MET A . n 
C 3 491 ALA 491 491 491 ALA ALA A . n 
C 3 492 CYS 492 492 492 CYS CYS A . n 
C 3 493 ALA 493 493 493 ALA ALA A . n 
C 3 494 LYS 494 494 494 LYS LYS A . n 
C 3 495 SER 495 495 495 SER SER A . n 
C 3 496 PRO 496 496 496 PRO PRO A . n 
C 3 497 LEU 497 497 497 LEU LEU A . n 
C 3 498 GLU 498 498 498 GLU GLU A . n 
C 3 499 ASN 499 499 499 ASN ASN A . n 
C 3 500 THR 500 500 500 THR THR A . n 
C 3 501 TRP 501 501 501 TRP TRP A . n 
C 3 502 TRP 502 502 502 TRP TRP A . n 
C 3 503 ALA 503 503 503 ALA ALA A . n 
C 3 504 GLU 504 504 504 GLU GLU A . n 
C 3 505 GLN 505 505 505 GLN GLN A . n 
C 3 506 ASP 506 506 506 ASP ASP A . n 
C 3 507 SER 507 507 507 SER SER A . n 
C 3 508 PRO 508 508 508 PRO PRO A . n 
C 3 509 PHE 509 509 509 PHE PHE A . n 
C 3 510 CYS 510 510 510 CYS CYS A . n 
C 3 511 PHE 511 511 511 PHE PHE A . n 
C 3 512 LEU 512 512 512 LEU LEU A . n 
C 3 513 ALA 513 513 513 ALA ALA A . n 
C 3 514 PHE 514 514 514 PHE PHE A . n 
C 3 515 CYS 515 515 515 CYS CYS A . n 
C 3 516 PHE 516 516 516 PHE PHE A . n 
C 3 517 GLU 517 517 517 GLU GLU A . n 
C 3 518 TYR 518 518 518 TYR TYR A . n 
C 3 519 ALA 519 519 519 ALA ALA A . n 
C 3 520 GLY 520 520 520 GLY GLY A . n 
C 3 521 VAL 521 521 521 VAL VAL A . n 
C 3 522 GLN 522 522 522 GLN GLN A . n 
C 3 523 HIS 523 523 523 HIS HIS A . n 
C 3 524 HIS 524 524 524 HIS HIS A . n 
C 3 525 GLY 525 525 525 GLY GLY A . n 
C 3 526 LEU 526 526 526 LEU LEU A . n 
C 3 527 SER 527 527 527 SER SER A . n 
C 3 528 TYR 528 528 528 TYR TYR A . n 
C 3 529 ASN 529 529 529 ASN ASN A . n 
C 3 530 CYS 530 530 530 CYS CYS A . n 
C 3 531 SER 531 531 531 SER SER A . n 
C 3 532 LEU 532 532 532 LEU LEU A . n 
C 3 533 PRO 533 533 533 PRO PRO A . n 
C 3 534 LEU 534 534 534 LEU LEU A . n 
C 3 535 ALA 535 535 535 ALA ALA A . n 
C 3 536 PHE 536 536 536 PHE PHE A . n 
C 3 537 ASP 537 537 537 ASP ASP A . n 
C 3 538 GLY 538 538 538 GLY GLY A . n 
C 3 539 SER 539 539 539 SER SER A . n 
C 3 540 CYS 540 540 540 CYS CYS A . n 
C 3 541 SER 541 541 541 SER SER A . n 
C 3 542 GLY 542 542 542 GLY GLY A . n 
C 3 543 ILE 543 543 543 ILE ILE A . n 
C 3 544 GLN 544 544 544 GLN GLN A . n 
C 3 545 HIS 545 545 545 HIS HIS A . n 
C 3 546 PHE 546 546 546 PHE PHE A . n 
C 3 547 SER 547 547 547 SER SER A . n 
C 3 548 ALA 548 548 548 ALA ALA A . n 
C 3 549 MET 549 549 549 MET MET A . n 
C 3 550 LEU 550 550 550 LEU LEU A . n 
C 3 551 ARG 551 551 551 ARG ARG A . n 
C 3 552 ASP 552 552 552 ASP ASP A . n 
C 3 553 GLU 553 553 553 GLU GLU A . n 
C 3 554 VAL 554 554 554 VAL VAL A . n 
C 3 555 GLY 555 555 555 GLY GLY A . n 
C 3 556 GLY 556 556 556 GLY GLY A . n 
C 3 557 ARG 557 557 557 ARG ARG A . n 
C 3 558 ALA 558 558 558 ALA ALA A . n 
C 3 559 VAL 559 559 559 VAL VAL A . n 
C 3 560 ASN 560 560 560 ASN ASN A . n 
C 3 561 LEU 561 561 561 LEU LEU A . n 
C 3 562 LEU 562 562 562 LEU LEU A . n 
C 3 563 PRO 563 563 563 PRO PRO A . n 
C 3 564 SER 564 564 564 SER SER A . n 
C 3 565 GLU 565 565 565 GLU GLU A . n 
C 3 566 THR 566 566 566 THR THR A . n 
C 3 567 VAL 567 567 567 VAL VAL A . n 
C 3 568 GLN 568 568 568 GLN GLN A . n 
C 3 569 ASP 569 569 569 ASP ASP A . n 
C 3 570 ILE 570 570 570 ILE ILE A . n 
C 3 571 TYR 571 571 571 TYR TYR A . n 
C 3 572 GLY 572 572 572 GLY GLY A . n 
C 3 573 ILE 573 573 573 ILE ILE A . n 
C 3 574 VAL 574 574 574 VAL VAL A . n 
C 3 575 ALA 575 575 575 ALA ALA A . n 
C 3 576 LYS 576 576 576 LYS LYS A . n 
C 3 577 LYS 577 577 577 LYS LYS A . n 
C 3 578 VAL 578 578 578 VAL VAL A . n 
C 3 579 ASN 579 579 579 ASN ASN A . n 
C 3 580 GLU 580 580 580 GLU GLU A . n 
C 3 581 ILE 581 581 581 ILE ILE A . n 
C 3 582 LEU 582 582 582 LEU LEU A . n 
C 3 583 GLN 583 583 583 GLN GLN A . n 
C 3 584 ALA 584 584 584 ALA ALA A . n 
C 3 585 ASP 585 585 585 ASP ASP A . n 
C 3 586 ALA 586 586 586 ALA ALA A . n 
C 3 587 ILE 587 587 587 ILE ILE A . n 
C 3 588 ASN 588 588 588 ASN ASN A . n 
C 3 589 GLY 589 589 589 GLY GLY A . n 
C 3 590 THR 590 590 590 THR THR A . n 
C 3 591 ASP 591 591 591 ASP ASP A . n 
C 3 592 ASN 592 592 592 ASN ASN A . n 
C 3 593 GLU 593 593 593 GLU GLU A . n 
C 3 594 VAL 594 594 594 VAL VAL A . n 
C 3 595 VAL 595 595 595 VAL VAL A . n 
C 3 596 THR 596 596 596 THR THR A . n 
C 3 597 VAL 597 597 597 VAL VAL A . n 
C 3 598 THR 598 598 598 THR THR A . n 
C 3 599 ASP 599 599 599 ASP ASP A . n 
C 3 600 GLU 600 600 600 GLU GLU A . n 
C 3 601 ASN 601 601 601 ASN ASN A . n 
C 3 602 THR 602 602 602 THR THR A . n 
C 3 603 GLY 603 603 603 GLY GLY A . n 
C 3 604 GLU 604 604 604 GLU GLU A . n 
C 3 605 ILE 605 605 605 ILE ILE A . n 
C 3 606 SER 606 606 606 SER SER A . n 
C 3 607 GLU 607 607 607 GLU GLU A . n 
C 3 608 LYS 608 608 608 LYS LYS A . n 
C 3 609 VAL 609 609 609 VAL VAL A . n 
C 3 610 LYS 610 610 610 LYS LYS A . n 
C 3 611 LEU 611 611 611 LEU LEU A . n 
C 3 612 GLY 612 612 612 GLY GLY A . n 
C 3 613 THR 613 613 613 THR THR A . n 
C 3 614 LYS 614 614 614 LYS LYS A . n 
C 3 615 ALA 615 615 615 ALA ALA A . n 
C 3 616 LEU 616 616 616 LEU LEU A . n 
C 3 617 ALA 617 617 617 ALA ALA A . n 
C 3 618 GLY 618 618 618 GLY GLY A . n 
C 3 619 GLN 619 619 619 GLN GLN A . n 
C 3 620 TRP 620 620 620 TRP TRP A . n 
C 3 621 LEU 621 621 621 LEU LEU A . n 
C 3 622 ALA 622 622 622 ALA ALA A . n 
C 3 623 TYR 623 623 623 TYR TYR A . n 
C 3 624 GLY 624 624 624 GLY GLY A . n 
C 3 625 VAL 625 625 625 VAL VAL A . n 
C 3 626 THR 626 626 626 THR THR A . n 
C 3 627 ARG 627 627 627 ARG ARG A . n 
C 3 628 SER 628 628 628 SER SER A . n 
C 3 629 VAL 629 629 629 VAL VAL A . n 
C 3 630 THR 630 630 630 THR THR A . n 
C 3 631 LYS 631 631 631 LYS LYS A . n 
C 3 632 ARG 632 632 632 ARG ARG A . n 
C 3 633 SER 633 633 633 SER SER A . n 
C 3 634 VAL 634 634 634 VAL VAL A . n 
C 3 635 MET 635 635 635 MET MET A . n 
C 3 636 THR 636 636 636 THR THR A . n 
C 3 637 LEU 637 637 637 LEU LEU A . n 
C 3 638 ALA 638 638 638 ALA ALA A . n 
C 3 639 TYR 639 639 639 TYR TYR A . n 
C 3 640 GLY 640 640 640 GLY GLY A . n 
C 3 641 SER 641 641 641 SER SER A . n 
C 3 642 LYS 642 642 642 LYS LYS A . n 
C 3 643 GLU 643 643 643 GLU GLU A . n 
C 3 644 PHE 644 644 644 PHE PHE A . n 
C 3 645 GLY 645 645 645 GLY GLY A . n 
C 3 646 PHE 646 646 646 PHE PHE A . n 
C 3 647 ARG 647 647 647 ARG ARG A . n 
C 3 648 GLN 648 648 648 GLN GLN A . n 
C 3 649 GLN 649 649 649 GLN GLN A . n 
C 3 650 VAL 650 650 650 VAL VAL A . n 
C 3 651 LEU 651 651 651 LEU LEU A . n 
C 3 652 GLU 652 652 652 GLU GLU A . n 
C 3 653 ASP 653 653 653 ASP ASP A . n 
C 3 654 THR 654 654 654 THR THR A . n 
C 3 655 ILE 655 655 655 ILE ILE A . n 
C 3 656 GLN 656 656 656 GLN GLN A . n 
C 3 657 PRO 657 657 657 PRO PRO A . n 
C 3 658 ALA 658 658 658 ALA ALA A . n 
C 3 659 ILE 659 659 659 ILE ILE A . n 
C 3 660 ASP 660 660 660 ASP ASP A . n 
C 3 661 SER 661 661 661 SER SER A . n 
C 3 662 GLY 662 662 662 GLY GLY A . n 
C 3 663 LYS 663 663 663 LYS LYS A . n 
C 3 664 GLY 664 664 664 GLY GLY A . n 
C 3 665 LEU 665 665 665 LEU LEU A . n 
C 3 666 MET 666 666 666 MET MET A . n 
C 3 667 PHE 667 667 667 PHE PHE A . n 
C 3 668 THR 668 668 668 THR THR A . n 
C 3 669 GLN 669 669 669 GLN GLN A . n 
C 3 670 PRO 670 670 670 PRO PRO A . n 
C 3 671 ASN 671 671 671 ASN ASN A . n 
C 3 672 GLN 672 672 672 GLN GLN A . n 
C 3 673 ALA 673 673 673 ALA ALA A . n 
C 3 674 ALA 674 674 674 ALA ALA A . n 
C 3 675 GLY 675 675 675 GLY GLY A . n 
C 3 676 TYR 676 676 676 TYR TYR A . n 
C 3 677 MET 677 677 677 MET MET A . n 
C 3 678 ALA 678 678 678 ALA ALA A . n 
C 3 679 LYS 679 679 679 LYS LYS A . n 
C 3 680 LEU 680 680 680 LEU LEU A . n 
C 3 681 ILE 681 681 681 ILE ILE A . n 
C 3 682 TRP 682 682 682 TRP TRP A . n 
C 3 683 GLU 683 683 683 GLU GLU A . n 
C 3 684 SER 684 684 684 SER SER A . n 
C 3 685 VAL 685 685 685 VAL VAL A . n 
C 3 686 SER 686 686 686 SER SER A . n 
C 3 687 VAL 687 687 687 VAL VAL A . n 
C 3 688 THR 688 688 688 THR THR A . n 
C 3 689 VAL 689 689 689 VAL VAL A . n 
C 3 690 VAL 690 690 690 VAL VAL A . n 
C 3 691 ALA 691 691 691 ALA ALA A . n 
C 3 692 ALA 692 692 692 ALA ALA A . n 
C 3 693 VAL 693 693 693 VAL VAL A . n 
C 3 694 GLU 694 694 694 GLU GLU A . n 
C 3 695 ALA 695 695 695 ALA ALA A . n 
C 3 696 MET 696 696 696 MET MET A . n 
C 3 697 ASN 697 697 697 ASN ASN A . n 
C 3 698 TRP 698 698 698 TRP TRP A . n 
C 3 699 LEU 699 699 699 LEU LEU A . n 
C 3 700 LYS 700 700 700 LYS LYS A . n 
C 3 701 SER 701 701 701 SER SER A . n 
C 3 702 ALA 702 702 702 ALA ALA A . n 
C 3 703 ALA 703 703 703 ALA ALA A . n 
C 3 704 LYS 704 704 704 LYS LYS A . n 
C 3 705 LEU 705 705 705 LEU LEU A . n 
C 3 706 LEU 706 706 706 LEU LEU A . n 
C 3 707 ALA 707 707 707 ALA ALA A . n 
C 3 708 ALA 708 708 708 ALA ALA A . n 
C 3 709 GLU 709 709 709 GLU GLU A . n 
C 3 710 VAL 710 710 710 VAL VAL A . n 
C 3 711 LYS 711 711 711 LYS LYS A . n 
C 3 712 ASP 712 712 712 ASP ASP A . n 
C 3 713 LYS 713 713 713 LYS LYS A . n 
C 3 714 LYS 714 714 714 LYS LYS A . n 
C 3 715 THR 715 715 715 THR THR A . n 
C 3 716 GLY 716 716 716 GLY GLY A . n 
C 3 717 GLU 717 717 717 GLU GLU A . n 
C 3 718 ILE 718 718 718 ILE ILE A . n 
C 3 719 LEU 719 719 719 LEU LEU A . n 
C 3 720 ARG 720 720 720 ARG ARG A . n 
C 3 721 LYS 721 721 721 LYS LYS A . n 
C 3 722 ARG 722 722 722 ARG ARG A . n 
C 3 723 CYS 723 723 723 CYS CYS A . n 
C 3 724 ALA 724 724 724 ALA ALA A . n 
C 3 725 VAL 725 725 725 VAL VAL A . n 
C 3 726 HIS 726 726 726 HIS HIS A . n 
C 3 727 TRP 727 727 727 TRP TRP A . n 
C 3 728 VAL 728 728 728 VAL VAL A . n 
C 3 729 THR 729 729 729 THR THR A . n 
C 3 730 PRO 730 730 730 PRO PRO A . n 
C 3 731 ASP 731 731 731 ASP ASP A . n 
C 3 732 GLY 732 732 732 GLY GLY A . n 
C 3 733 PHE 733 733 733 PHE PHE A . n 
C 3 734 PRO 734 734 734 PRO PRO A . n 
C 3 735 VAL 735 735 735 VAL VAL A . n 
C 3 736 TRP 736 736 736 TRP TRP A . n 
C 3 737 GLN 737 737 737 GLN GLN A . n 
C 3 738 GLU 738 738 738 GLU GLU A . n 
C 3 739 TYR 739 739 739 TYR TYR A . n 
C 3 740 LYS 740 740 740 LYS LYS A . n 
C 3 741 LYS 741 741 741 LYS LYS A . n 
C 3 742 PRO 742 742 742 PRO PRO A . n 
C 3 743 ILE 743 743 743 ILE ILE A . n 
C 3 744 GLN 744 744 744 GLN GLN A . n 
C 3 745 THR 745 745 745 THR THR A . n 
C 3 746 ARG 746 746 746 ARG ARG A . n 
C 3 747 LEU 747 747 747 LEU LEU A . n 
C 3 748 ASN 748 748 748 ASN ASN A . n 
C 3 749 LEU 749 749 749 LEU LEU A . n 
C 3 750 MET 750 750 750 MET MET A . n 
C 3 751 PHE 751 751 751 PHE PHE A . n 
C 3 752 LEU 752 752 752 LEU LEU A . n 
C 3 753 GLY 753 753 753 GLY GLY A . n 
C 3 754 GLN 754 754 754 GLN GLN A . n 
C 3 755 PHE 755 755 755 PHE PHE A . n 
C 3 756 ARG 756 756 756 ARG ARG A . n 
C 3 757 LEU 757 757 757 LEU LEU A . n 
C 3 758 GLN 758 758 758 GLN GLN A . n 
C 3 759 PRO 759 759 759 PRO PRO A . n 
C 3 760 THR 760 760 760 THR THR A . n 
C 3 761 ILE 761 761 761 ILE ILE A . n 
C 3 762 ASN 762 762 762 ASN ASN A . n 
C 3 763 THR 763 763 763 THR THR A . n 
C 3 764 ASN 764 764 764 ASN ASN A . n 
C 3 765 LYS 765 765 765 LYS LYS A . n 
C 3 766 ASP 766 766 766 ASP ASP A . n 
C 3 767 SER 767 767 767 SER SER A . n 
C 3 768 GLU 768 768 768 GLU GLU A . n 
C 3 769 ILE 769 769 769 ILE ILE A . n 
C 3 770 ASP 770 770 770 ASP ASP A . n 
C 3 771 ALA 771 771 771 ALA ALA A . n 
C 3 772 HIS 772 772 772 HIS HIS A . n 
C 3 773 LYS 773 773 773 LYS LYS A . n 
C 3 774 GLN 774 774 774 GLN GLN A . n 
C 3 775 GLU 775 775 775 GLU GLU A . n 
C 3 776 SER 776 776 776 SER SER A . n 
C 3 777 GLY 777 777 777 GLY GLY A . n 
C 3 778 ILE 778 778 778 ILE ILE A . n 
C 3 779 ALA 779 779 779 ALA ALA A . n 
C 3 780 PRO 780 780 780 PRO PRO A . n 
C 3 781 ASN 781 781 781 ASN ASN A . n 
C 3 782 PHE 782 782 782 PHE PHE A . n 
C 3 783 VAL 783 783 783 VAL VAL A . n 
C 3 784 HIS 784 784 784 HIS HIS A . n 
C 3 785 SER 785 785 785 SER SER A . n 
C 3 786 GLN 786 786 786 GLN GLN A . n 
C 3 787 ASP 787 787 787 ASP ASP A . n 
C 3 788 GLY 788 788 788 GLY GLY A . n 
C 3 789 SER 789 789 789 SER SER A . n 
C 3 790 HIS 790 790 790 HIS HIS A . n 
C 3 791 LEU 791 791 791 LEU LEU A . n 
C 3 792 ARG 792 792 792 ARG ARG A . n 
C 3 793 LYS 793 793 793 LYS LYS A . n 
C 3 794 THR 794 794 794 THR THR A . n 
C 3 795 VAL 795 795 795 VAL VAL A . n 
C 3 796 VAL 796 796 796 VAL VAL A . n 
C 3 797 TRP 797 797 797 TRP TRP A . n 
C 3 798 ALA 798 798 798 ALA ALA A . n 
C 3 799 HIS 799 799 799 HIS HIS A . n 
C 3 800 GLU 800 800 800 GLU GLU A . n 
C 3 801 LYS 801 801 801 LYS LYS A . n 
C 3 802 TYR 802 802 802 TYR TYR A . n 
C 3 803 GLY 803 803 803 GLY GLY A . n 
C 3 804 ILE 804 804 804 ILE ILE A . n 
C 3 805 GLU 805 805 805 GLU GLU A . n 
C 3 806 SER 806 806 806 SER SER A . n 
C 3 807 PHE 807 807 807 PHE PHE A . n 
C 3 808 ALA 808 808 808 ALA ALA A . n 
C 3 809 LEU 809 809 809 LEU LEU A . n 
C 3 810 ILE 810 810 810 ILE ILE A . n 
C 3 811 HIS 811 811 811 HIS HIS A . n 
C 3 812 ASP 812 812 812 ASP ASP A . n 
C 3 813 SER 813 813 813 SER SER A . n 
C 3 814 PHE 814 814 814 PHE PHE A . n 
C 3 815 GLY 815 815 815 GLY GLY A . n 
C 3 816 THR 816 816 816 THR THR A . n 
C 3 817 ILE 817 817 817 ILE ILE A . n 
C 3 818 PRO 818 818 818 PRO PRO A . n 
C 3 819 ALA 819 819 819 ALA ALA A . n 
C 3 820 ASP 820 820 820 ASP ASP A . n 
C 3 821 ALA 821 821 821 ALA ALA A . n 
C 3 822 ALA 822 822 822 ALA ALA A . n 
C 3 823 ASN 823 823 823 ASN ASN A . n 
C 3 824 LEU 824 824 824 LEU LEU A . n 
C 3 825 PHE 825 825 825 PHE PHE A . n 
C 3 826 LYS 826 826 826 LYS LYS A . n 
C 3 827 ALA 827 827 827 ALA ALA A . n 
C 3 828 VAL 828 828 828 VAL VAL A . n 
C 3 829 ARG 829 829 829 ARG ARG A . n 
C 3 830 GLU 830 830 830 GLU GLU A . n 
C 3 831 THR 831 831 831 THR THR A . n 
C 3 832 MET 832 832 832 MET MET A . n 
C 3 833 VAL 833 833 833 VAL VAL A . n 
C 3 834 ASP 834 834 834 ASP ASP A . n 
C 3 835 THR 835 835 835 THR THR A . n 
C 3 836 TYR 836 836 836 TYR TYR A . n 
C 3 837 GLU 837 837 837 GLU GLU A . n 
C 3 838 SER 838 838 838 SER SER A . n 
C 3 839 CYS 839 839 839 CYS CYS A . n 
C 3 840 ASP 840 840 840 ASP ASP A . n 
C 3 841 VAL 841 841 841 VAL VAL A . n 
C 3 842 LEU 842 842 842 LEU LEU A . n 
C 3 843 ALA 843 843 843 ALA ALA A . n 
C 3 844 ASP 844 844 844 ASP ASP A . n 
C 3 845 PHE 845 845 845 PHE PHE A . n 
C 3 846 TYR 846 846 846 TYR TYR A . n 
C 3 847 ASP 847 847 847 ASP ASP A . n 
C 3 848 GLN 848 848 848 GLN GLN A . n 
C 3 849 PHE 849 849 849 PHE PHE A . n 
C 3 850 ALA 850 850 850 ALA ALA A . n 
C 3 851 ASP 851 851 851 ASP ASP A . n 
C 3 852 GLN 852 852 852 GLN GLN A . n 
C 3 853 LEU 853 853 853 LEU LEU A . n 
C 3 854 HIS 854 854 854 HIS HIS A . n 
C 3 855 GLU 855 855 855 GLU GLU A . n 
C 3 856 SER 856 856 856 SER SER A . n 
C 3 857 GLN 857 857 857 GLN GLN A . n 
C 3 858 LEU 858 858 858 LEU LEU A . n 
C 3 859 ASP 859 859 859 ASP ASP A . n 
C 3 860 LYS 860 860 860 LYS LYS A . n 
C 3 861 MET 861 861 861 MET MET A . n 
C 3 862 PRO 862 862 862 PRO PRO A . n 
C 3 863 ALA 863 863 863 ALA ALA A . n 
C 3 864 LEU 864 864 864 LEU LEU A . n 
C 3 865 PRO 865 865 865 PRO PRO A . n 
C 3 866 ALA 866 866 866 ALA ALA A . n 
C 3 867 LYS 867 867 867 LYS LYS A . n 
C 3 868 GLY 868 868 868 GLY GLY A . n 
C 3 869 ASN 869 869 869 ASN ASN A . n 
C 3 870 LEU 870 870 870 LEU LEU A . n 
C 3 871 ASN 871 871 871 ASN ASN A . n 
C 3 872 LEU 872 872 872 LEU LEU A . n 
C 3 873 ARG 873 873 873 ARG ARG A . n 
C 3 874 ASP 874 874 874 ASP ASP A . n 
C 3 875 ILE 875 875 875 ILE ILE A . n 
C 3 876 LEU 876 876 876 LEU LEU A . n 
C 3 877 GLU 877 877 877 GLU GLU A . n 
C 3 878 SER 878 878 878 SER SER A . n 
C 3 879 ASP 879 879 879 ASP ASP A . n 
C 3 880 PHE 880 880 880 PHE PHE A . n 
C 3 881 ALA 881 881 881 ALA ALA A . n 
C 3 882 PHE 882 882 882 PHE PHE A . n 
C 3 883 ALA 883 883 883 ALA ALA A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-05-21 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MLPHARE phasing          .         ? 1 
CNS     refinement       0.5       ? 2 
MOSFLM  'data reduction' .         ? 3 
CCP4    'data scaling'   '(SCALA)' ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A ASP 147 ? ? O A ARG 150 ? ? 2.05 
2 1 O A LEU 24  ? ? O A HIS 27  ? ? 2.05 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 C4 N DT  114 ? ? C5  N DT  114 ? ? 1.503 1.445 0.058 0.009 N 
2 1 CD A GLU 805 ? ? OE2 A GLU 805 ? ? 1.334 1.252 0.082 0.011 N 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             "O4'" 
_pdbx_validate_rmsd_angle.auth_asym_id_1             N 
_pdbx_validate_rmsd_angle.auth_comp_id_1             DC 
_pdbx_validate_rmsd_angle.auth_seq_id_1              106 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             "C1'" 
_pdbx_validate_rmsd_angle.auth_asym_id_2             N 
_pdbx_validate_rmsd_angle.auth_comp_id_2             DC 
_pdbx_validate_rmsd_angle.auth_seq_id_2              106 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             N1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             N 
_pdbx_validate_rmsd_angle.auth_comp_id_3             DC 
_pdbx_validate_rmsd_angle.auth_seq_id_3              106 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                110.83 
_pdbx_validate_rmsd_angle.angle_target_value         108.30 
_pdbx_validate_rmsd_angle.angle_deviation            2.53 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 9   ? ? 88.20   -59.31  
2  1 ASP A 10  ? ? -39.14  -26.95  
3  1 TYR A 28  ? ? 73.22   -29.65  
4  1 ASP A 130 ? ? -100.99 -81.62  
5  1 PHE A 151 ? ? 69.54   -25.88  
6  1 GLU A 168 ? ? 33.78   -159.59 
7  1 GLN A 169 ? ? 35.11   91.12   
8  1 HIS A 176 ? ? -45.09  -70.91  
9  1 VAL A 177 ? ? 55.17   95.62   
10 1 TYR A 178 ? ? -48.82  67.96   
11 1 LYS A 180 ? ? -54.17  79.23   
12 1 ALA A 181 ? ? 179.21  141.52  
13 1 GLU A 199 ? ? 79.43   86.37   
14 1 ALA A 262 ? ? -22.16  -68.76  
15 1 TYR A 312 ? ? 76.03   100.33  
16 1 MET A 313 ? ? -154.22 74.01   
17 1 PRO A 361 ? ? -59.13  109.59  
18 1 MET A 362 ? ? -39.61  130.08  
19 1 PRO A 364 ? ? -62.87  7.19    
20 1 GLU A 365 ? ? 62.49   -16.81  
21 1 PRO A 371 ? ? -67.74  -171.19 
22 1 GLU A 372 ? ? -68.07  22.54   
23 1 ALA A 447 ? ? -72.36  -79.31  
24 1 LEU A 526 ? ? -57.69  -6.89   
25 1 SER A 539 ? ? -53.42  -103.07 
26 1 VAL A 559 ? ? -84.20  -159.11 
27 1 ASN A 588 ? ? -108.23 -136.31 
28 1 THR A 590 ? ? -43.76  152.59  
29 1 ASN A 592 ? ? -63.62  95.78   
30 1 VAL A 594 ? ? -51.51  -172.87 
31 1 VAL A 595 ? ? -45.64  159.25  
32 1 VAL A 597 ? ? -22.12  89.24   
33 1 THR A 598 ? ? -171.99 21.73   
34 1 ASP A 599 ? ? -152.31 28.87   
35 1 GLU A 600 ? ? -171.64 -115.39 
36 1 ASN A 601 ? ? 177.01  124.13  
37 1 THR A 602 ? ? 77.58   -171.53 
38 1 GLU A 604 ? ? -43.83  69.53   
39 1 SER A 606 ? ? -50.94  -178.50 
40 1 LYS A 608 ? ? -63.93  63.43   
41 1 VAL A 609 ? ? 162.13  133.89  
42 1 LEU A 611 ? ? 39.90   104.19  
43 1 VAL A 625 ? ? 69.74   80.82   
44 1 ALA A 638 ? ? 61.05   -99.73  
45 1 PHE A 644 ? ? 44.29   100.34  
46 1 GLN A 648 ? ? -63.47  4.36    
47 1 THR A 654 ? ? -122.90 -62.96  
48 1 LYS A 663 ? ? -69.56  -163.53 
49 1 GLN A 669 ? ? -119.02 75.19   
50 1 LYS A 711 ? ? -102.39 -144.10 
51 1 ASP A 712 ? ? 147.22  166.46  
52 1 LYS A 714 ? ? 4.31    101.79  
53 1 THR A 715 ? ? 137.32  46.19   
54 1 SER A 767 ? ? -100.51 -62.25  
55 1 HIS A 811 ? ? 53.07   -23.70  
56 1 ASP A 812 ? ? -172.60 26.51   
57 1 THR A 816 ? ? -170.18 -179.29 
58 1 ASP A 840 ? ? -111.48 79.74   
59 1 LEU A 853 ? ? -67.87  -153.69 
60 1 HIS A 854 ? ? -4.58   126.79  
61 1 GLU A 855 ? ? -74.35  -96.69  
62 1 SER A 856 ? ? -91.11  -74.99  
63 1 GLN A 857 ? ? -19.44  -93.03  
64 1 LYS A 860 ? ? 70.79   -28.14  
65 1 PRO A 862 ? ? -33.35  -165.39 
66 1 ALA A 863 ? ? 84.98   77.07   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DG T 5   ? ? 0.062 'SIDE CHAIN' 
2 1 DT T 6   ? ? 0.061 'SIDE CHAIN' 
3 1 DC N 106 ? ? 0.058 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A ILE 6   ? CG1 ? C ILE 6   CG1 
2   1 Y 1 A ILE 6   ? CG2 ? C ILE 6   CG2 
3   1 Y 1 A ILE 6   ? CD1 ? C ILE 6   CD1 
4   1 Y 1 A LYS 8   ? CG  ? C LYS 8   CG  
5   1 Y 1 A LYS 8   ? CD  ? C LYS 8   CD  
6   1 Y 1 A LYS 8   ? CE  ? C LYS 8   CE  
7   1 Y 1 A LYS 8   ? NZ  ? C LYS 8   NZ  
8   1 Y 1 A ASN 9   ? CG  ? C ASN 9   CG  
9   1 Y 1 A ASN 9   ? OD1 ? C ASN 9   OD1 
10  1 Y 1 A ASN 9   ? ND2 ? C ASN 9   ND2 
11  1 Y 1 A ASP 10  ? CG  ? C ASP 10  CG  
12  1 Y 1 A ASP 10  ? OD1 ? C ASP 10  OD1 
13  1 Y 1 A ASP 10  ? OD2 ? C ASP 10  OD2 
14  1 Y 1 A LYS 163 ? CG  ? C LYS 163 CG  
15  1 Y 1 A LYS 163 ? CD  ? C LYS 163 CD  
16  1 Y 1 A LYS 163 ? CE  ? C LYS 163 CE  
17  1 Y 1 A LYS 163 ? NZ  ? C LYS 163 NZ  
18  1 Y 1 A LYS 164 ? CG  ? C LYS 164 CG  
19  1 Y 1 A LYS 164 ? CD  ? C LYS 164 CD  
20  1 Y 1 A LYS 164 ? CE  ? C LYS 164 CE  
21  1 Y 1 A LYS 164 ? NZ  ? C LYS 164 NZ  
22  1 Y 1 A GLU 356 ? CG  ? C GLU 356 CG  
23  1 Y 1 A GLU 356 ? CD  ? C GLU 356 CD  
24  1 Y 1 A GLU 356 ? OE1 ? C GLU 356 OE1 
25  1 Y 1 A GLU 356 ? OE2 ? C GLU 356 OE2 
26  1 Y 1 A GLU 358 ? CG  ? C GLU 358 CG  
27  1 Y 1 A GLU 358 ? CD  ? C GLU 358 CD  
28  1 Y 1 A GLU 358 ? OE1 ? C GLU 358 OE1 
29  1 Y 1 A GLU 358 ? OE2 ? C GLU 358 OE2 
30  1 Y 1 A GLU 359 ? CG  ? C GLU 359 CG  
31  1 Y 1 A GLU 359 ? CD  ? C GLU 359 CD  
32  1 Y 1 A GLU 359 ? OE1 ? C GLU 359 OE1 
33  1 Y 1 A GLU 359 ? OE2 ? C GLU 359 OE2 
34  1 Y 1 A LYS 363 ? CG  ? C LYS 363 CG  
35  1 Y 1 A LYS 363 ? CD  ? C LYS 363 CD  
36  1 Y 1 A LYS 363 ? CE  ? C LYS 363 CE  
37  1 Y 1 A LYS 363 ? NZ  ? C LYS 363 NZ  
38  1 Y 1 A GLU 365 ? CG  ? C GLU 365 CG  
39  1 Y 1 A GLU 365 ? CD  ? C GLU 365 CD  
40  1 Y 1 A GLU 365 ? OE1 ? C GLU 365 OE1 
41  1 Y 1 A GLU 365 ? OE2 ? C GLU 365 OE2 
42  1 Y 1 A ASP 366 ? CG  ? C ASP 366 CG  
43  1 Y 1 A ASP 366 ? OD1 ? C ASP 366 OD1 
44  1 Y 1 A ASP 366 ? OD2 ? C ASP 366 OD2 
45  1 Y 1 A ILE 367 ? CG1 ? C ILE 367 CG1 
46  1 Y 1 A ILE 367 ? CG2 ? C ILE 367 CG2 
47  1 Y 1 A ILE 367 ? CD1 ? C ILE 367 CD1 
48  1 Y 1 A ASP 368 ? CG  ? C ASP 368 CG  
49  1 Y 1 A ASP 368 ? OD1 ? C ASP 368 OD1 
50  1 Y 1 A ASP 368 ? OD2 ? C ASP 368 OD2 
51  1 Y 1 A MET 369 ? CG  ? C MET 369 CG  
52  1 Y 1 A MET 369 ? SD  ? C MET 369 SD  
53  1 Y 1 A MET 369 ? CE  ? C MET 369 CE  
54  1 Y 1 A LYS 378 ? CG  ? C LYS 378 CG  
55  1 Y 1 A LYS 378 ? CD  ? C LYS 378 CD  
56  1 Y 1 A LYS 378 ? CE  ? C LYS 378 CE  
57  1 Y 1 A LYS 378 ? NZ  ? C LYS 378 NZ  
58  1 Y 1 A VAL 594 ? CG1 ? C VAL 594 CG1 
59  1 Y 1 A VAL 594 ? CG2 ? C VAL 594 CG2 
60  1 Y 1 A VAL 595 ? CG1 ? C VAL 595 CG1 
61  1 Y 1 A VAL 595 ? CG2 ? C VAL 595 CG2 
62  1 Y 1 A THR 596 ? OG1 ? C THR 596 OG1 
63  1 Y 1 A THR 596 ? CG2 ? C THR 596 CG2 
64  1 Y 1 A VAL 597 ? CG1 ? C VAL 597 CG1 
65  1 Y 1 A VAL 597 ? CG2 ? C VAL 597 CG2 
66  1 Y 1 A THR 598 ? OG1 ? C THR 598 OG1 
67  1 Y 1 A THR 598 ? CG2 ? C THR 598 CG2 
68  1 Y 1 A ASP 599 ? CG  ? C ASP 599 CG  
69  1 Y 1 A ASP 599 ? OD1 ? C ASP 599 OD1 
70  1 Y 1 A ASP 599 ? OD2 ? C ASP 599 OD2 
71  1 Y 1 A GLU 600 ? CB  ? C GLU 600 CB  
72  1 Y 1 A GLU 600 ? CG  ? C GLU 600 CG  
73  1 Y 1 A GLU 600 ? CD  ? C GLU 600 CD  
74  1 Y 1 A GLU 600 ? OE1 ? C GLU 600 OE1 
75  1 Y 1 A GLU 600 ? OE2 ? C GLU 600 OE2 
76  1 Y 1 A ASN 601 ? CG  ? C ASN 601 CG  
77  1 Y 1 A ASN 601 ? OD1 ? C ASN 601 OD1 
78  1 Y 1 A ASN 601 ? ND2 ? C ASN 601 ND2 
79  1 Y 1 A THR 602 ? OG1 ? C THR 602 OG1 
80  1 Y 1 A THR 602 ? CG2 ? C THR 602 CG2 
81  1 Y 1 A GLU 604 ? CG  ? C GLU 604 CG  
82  1 Y 1 A GLU 604 ? CD  ? C GLU 604 CD  
83  1 Y 1 A GLU 604 ? OE1 ? C GLU 604 OE1 
84  1 Y 1 A GLU 604 ? OE2 ? C GLU 604 OE2 
85  1 Y 1 A ILE 605 ? CG1 ? C ILE 605 CG1 
86  1 Y 1 A ILE 605 ? CG2 ? C ILE 605 CG2 
87  1 Y 1 A ILE 605 ? CD1 ? C ILE 605 CD1 
88  1 Y 1 A SER 606 ? OG  ? C SER 606 OG  
89  1 Y 1 A GLU 607 ? CG  ? C GLU 607 CG  
90  1 Y 1 A GLU 607 ? CD  ? C GLU 607 CD  
91  1 Y 1 A GLU 607 ? OE1 ? C GLU 607 OE1 
92  1 Y 1 A GLU 607 ? OE2 ? C GLU 607 OE2 
93  1 Y 1 A LYS 608 ? CG  ? C LYS 608 CG  
94  1 Y 1 A LYS 608 ? CD  ? C LYS 608 CD  
95  1 Y 1 A LYS 608 ? CE  ? C LYS 608 CE  
96  1 Y 1 A LYS 608 ? NZ  ? C LYS 608 NZ  
97  1 Y 1 A LYS 610 ? CG  ? C LYS 610 CG  
98  1 Y 1 A LYS 610 ? CD  ? C LYS 610 CD  
99  1 Y 1 A LYS 610 ? CE  ? C LYS 610 CE  
100 1 Y 1 A LYS 610 ? NZ  ? C LYS 610 NZ  
101 1 Y 1 A THR 636 ? OG1 ? C THR 636 OG1 
102 1 Y 1 A THR 636 ? CG2 ? C THR 636 CG2 
103 1 Y 1 A LEU 637 ? CG  ? C LEU 637 CG  
104 1 Y 1 A LEU 637 ? CD1 ? C LEU 637 CD1 
105 1 Y 1 A LEU 637 ? CD2 ? C LEU 637 CD2 
106 1 Y 1 A TYR 639 ? CG  ? C TYR 639 CG  
107 1 Y 1 A TYR 639 ? CD1 ? C TYR 639 CD1 
108 1 Y 1 A TYR 639 ? CD2 ? C TYR 639 CD2 
109 1 Y 1 A TYR 639 ? CE1 ? C TYR 639 CE1 
110 1 Y 1 A TYR 639 ? CE2 ? C TYR 639 CE2 
111 1 Y 1 A TYR 639 ? CZ  ? C TYR 639 CZ  
112 1 Y 1 A TYR 639 ? OH  ? C TYR 639 OH  
113 1 Y 1 A SER 641 ? OG  ? C SER 641 OG  
114 1 Y 1 A LYS 642 ? CG  ? C LYS 642 CG  
115 1 Y 1 A LYS 642 ? CD  ? C LYS 642 CD  
116 1 Y 1 A LYS 642 ? CE  ? C LYS 642 CE  
117 1 Y 1 A LYS 642 ? NZ  ? C LYS 642 NZ  
118 1 Y 1 A GLU 643 ? CG  ? C GLU 643 CG  
119 1 Y 1 A GLU 643 ? CD  ? C GLU 643 CD  
120 1 Y 1 A GLU 643 ? OE1 ? C GLU 643 OE1 
121 1 Y 1 A GLU 643 ? OE2 ? C GLU 643 OE2 
122 1 Y 1 A PHE 644 ? CG  ? C PHE 644 CG  
123 1 Y 1 A PHE 644 ? CD1 ? C PHE 644 CD1 
124 1 Y 1 A PHE 644 ? CD2 ? C PHE 644 CD2 
125 1 Y 1 A PHE 644 ? CE1 ? C PHE 644 CE1 
126 1 Y 1 A PHE 644 ? CE2 ? C PHE 644 CE2 
127 1 Y 1 A PHE 644 ? CZ  ? C PHE 644 CZ  
128 1 Y 1 A PHE 646 ? CG  ? C PHE 646 CG  
129 1 Y 1 A PHE 646 ? CD1 ? C PHE 646 CD1 
130 1 Y 1 A PHE 646 ? CD2 ? C PHE 646 CD2 
131 1 Y 1 A PHE 646 ? CE1 ? C PHE 646 CE1 
132 1 Y 1 A PHE 646 ? CE2 ? C PHE 646 CE2 
133 1 Y 1 A PHE 646 ? CZ  ? C PHE 646 CZ  
134 1 Y 1 A ASP 851 ? CG  ? C ASP 851 CG  
135 1 Y 1 A ASP 851 ? OD1 ? C ASP 851 OD1 
136 1 Y 1 A ASP 851 ? OD2 ? C ASP 851 OD2 
137 1 Y 1 A GLN 852 ? CG  ? C GLN 852 CG  
138 1 Y 1 A GLN 852 ? CD  ? C GLN 852 CD  
139 1 Y 1 A GLN 852 ? OE1 ? C GLN 852 OE1 
140 1 Y 1 A GLN 852 ? NE2 ? C GLN 852 NE2 
141 1 Y 1 A LEU 853 ? CG  ? C LEU 853 CG  
142 1 Y 1 A LEU 853 ? CD1 ? C LEU 853 CD1 
143 1 Y 1 A LEU 853 ? CD2 ? C LEU 853 CD2 
144 1 Y 1 A HIS 854 ? CG  ? C HIS 854 CG  
145 1 Y 1 A HIS 854 ? ND1 ? C HIS 854 ND1 
146 1 Y 1 A HIS 854 ? CD2 ? C HIS 854 CD2 
147 1 Y 1 A HIS 854 ? CE1 ? C HIS 854 CE1 
148 1 Y 1 A HIS 854 ? NE2 ? C HIS 854 NE2 
149 1 Y 1 A GLU 855 ? CG  ? C GLU 855 CG  
150 1 Y 1 A GLU 855 ? CD  ? C GLU 855 CD  
151 1 Y 1 A GLU 855 ? OE1 ? C GLU 855 OE1 
152 1 Y 1 A GLU 855 ? OE2 ? C GLU 855 OE2 
153 1 Y 1 A SER 856 ? OG  ? C SER 856 OG  
154 1 Y 1 A GLN 857 ? CG  ? C GLN 857 CG  
155 1 Y 1 A GLN 857 ? CD  ? C GLN 857 CD  
156 1 Y 1 A GLN 857 ? OE1 ? C GLN 857 OE1 
157 1 Y 1 A GLN 857 ? NE2 ? C GLN 857 NE2 
158 1 Y 1 A LEU 858 ? CG  ? C LEU 858 CG  
159 1 Y 1 A LEU 858 ? CD1 ? C LEU 858 CD1 
160 1 Y 1 A LEU 858 ? CD2 ? C LEU 858 CD2 
161 1 Y 1 A ASP 859 ? CG  ? C ASP 859 CG  
162 1 Y 1 A ASP 859 ? OD1 ? C ASP 859 OD1 
163 1 Y 1 A ASP 859 ? OD2 ? C ASP 859 OD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1  ? C MET 1  
2  1 Y 1 A ASN 2  ? C ASN 2  
3  1 Y 1 A THR 3  ? C THR 3  
4  1 Y 1 A ILE 4  ? C ILE 4  
5  1 Y 1 A ASN 5  ? C ASN 5  
6  1 Y 1 A GLU 56 ? C GLU 56 
7  1 Y 1 A ARG 57 ? C ARG 57 
8  1 Y 1 A GLN 58 ? C GLN 58 
9  1 Y 1 A LEU 59 ? C LEU 59 
10 1 Y 1 A LYS 60 ? C LYS 60 
11 1 Y 1 A ALA 61 ? C ALA 61 
12 1 Y 1 A GLY 62 ? C GLY 62 
13 1 Y 1 A GLU 63 ? C GLU 63 
14 1 Y 1 A VAL 64 ? C VAL 64 
15 1 Y 1 A ALA 65 ? C ALA 65 
16 1 Y 1 A ASP 66 ? C ASP 66 
17 1 Y 1 A ASN 67 ? C ASN 67 
18 1 Y 1 A ALA 68 ? C ALA 68 
19 1 Y 1 A ALA 69 ? C ALA 69 
20 1 Y 1 A ALA 70 ? C ALA 70 
21 1 Y 1 A LYS 71 ? C LYS 71 
# 
_ndb_struct_conf_na.entry_id   1CEZ 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 5  1_555 B DC 13 1_555 -0.130 -0.256 -0.759 -19.907 -9.720  0.710  1  T_DG5:DC113_N  T 5  ? N 113 ? 19 1 
1 A DT 6  1_555 B DA 12 1_555 -0.198 -0.009 0.085  -20.562 -2.857  -4.634 2  T_DT6:DA112_N  T 6  ? N 112 ? 20 1 
1 A DG 7  1_555 B DC 11 1_555 -0.225 0.037  -0.234 -0.337  6.278   -0.527 3  T_DG7:DC111_N  T 7  ? N 111 ? 19 1 
1 A DA 8  1_555 B DT 10 1_555 0.116  -0.073 -0.063 0.813   -3.340  0.813  4  T_DA8:DT110_N  T 8  ? N 110 ? 20 1 
1 A DG 9  1_555 B DC 9  1_555 -0.219 -0.133 -0.310 -8.555  -8.500  0.546  5  T_DG9:DC109_N  T 9  ? N 109 ? 19 1 
1 A DT 10 1_555 B DA 8  1_555 -0.078 0.083  -0.272 3.325   -12.677 0.429  6  T_DT10:DA108_N T 10 ? N 108 ? 20 1 
1 A DC 11 1_555 B DG 7  1_555 0.075  0.053  0.256  -6.241  -4.657  -1.571 7  T_DC11:DG107_N T 11 ? N 107 ? 19 1 
1 A DG 12 1_555 B DC 6  1_555 -0.162 -0.041 -0.100 -8.116  -2.463  -1.566 8  T_DG12:DC106_N T 12 ? N 106 ? 19 1 
1 A DT 13 1_555 B DA 5  1_555 -0.188 -0.073 0.014  5.742   1.038   0.651  9  T_DT13:DA105_N T 13 ? N 105 ? 20 1 
1 A DA 14 1_555 B DT 4  1_555 0.036  0.029  -0.253 7.537   -13.763 1.272  10 T_DA14:DT104_N T 14 ? N 104 ? 20 1 
1 A DT 15 1_555 B DA 3  1_555 -0.002 -0.166 -0.248 8.831   -18.138 11.206 11 T_DT15:DA103_N T 15 ? N 103 ? 20 1 
1 A DT 16 1_555 B DA 2  1_555 -0.137 -0.105 -0.210 2.923   0.586   0.942  12 T_DT16:DA102_N T 16 ? N 102 ? 20 1 
1 A DA 17 1_555 B DT 1  1_555 0.089  0.067  -0.027 12.621  -11.883 -2.948 13 T_DA17:DT101_N T 17 ? N 101 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 5  1_555 B DC 13 1_555 A DT 6  1_555 B DA 12 1_555 -0.822 -0.877 3.441 -7.343 1.655  34.356 -1.718 0.186  3.492 2.761  
12.250 35.147 1  TT_DG5DT6:DA112DC113_NN   T 5  ? N 113 ? T 6  ? N 112 ? 
1 A DT 6  1_555 B DA 12 1_555 A DG 7  1_555 B DC 11 1_555 -0.133 0.402  3.024 0.274  2.804  31.769 0.257  0.288  3.046 5.110  
-0.499 31.891 2  TT_DT6DG7:DC111DA112_NN   T 6  ? N 112 ? T 7  ? N 111 ? 
1 A DG 7  1_555 B DC 11 1_555 A DA 8  1_555 B DT 10 1_555 -0.305 -0.133 3.426 -1.088 5.185  35.300 -1.003 0.333  3.381 8.492  
1.782  35.683 3  TT_DG7DA8:DT110DC111_NN   T 7  ? N 111 ? T 8  ? N 110 ? 
1 A DA 8  1_555 B DT 10 1_555 A DG 9  1_555 B DC 9  1_555 -0.499 -0.339 3.486 -2.269 11.803 32.280 -2.519 0.470  3.197 20.369 
3.916  34.389 4  TT_DA8DG9:DC109DT110_NN   T 8  ? N 110 ? T 9  ? N 109 ? 
1 A DG 9  1_555 B DC 9  1_555 A DT 10 1_555 B DA 8  1_555 0.115  -0.816 2.980 0.349  7.851  25.844 -3.500 -0.168 2.623 17.058 
-0.759 26.993 5  TT_DG9DT10:DA108DC109_NN  T 9  ? N 109 ? T 10 ? N 108 ? 
1 A DT 10 1_555 B DA 8  1_555 A DC 11 1_555 B DG 7  1_555 0.016  -0.133 3.623 -2.898 8.251  34.028 -1.584 -0.505 3.484 13.818 
4.853  35.102 6  TT_DT10DC11:DG107DA108_NN T 10 ? N 108 ? T 11 ? N 107 ? 
1 A DC 11 1_555 B DG 7  1_555 A DG 12 1_555 B DC 6  1_555 0.642  0.452  3.413 4.913  2.371  38.927 0.374  -0.336 3.486 3.537  
-7.329 39.293 7  TT_DC11DG12:DC106DG107_NN T 11 ? N 107 ? T 12 ? N 106 ? 
1 A DG 12 1_555 B DC 6  1_555 A DT 13 1_555 B DA 5  1_555 -0.232 -0.494 3.004 0.401  5.713  24.894 -2.586 0.629  2.817 13.034 
-0.915 25.534 8  TT_DG12DT13:DA105DC106_NN T 12 ? N 106 ? T 13 ? N 105 ? 
1 A DT 13 1_555 B DA 5  1_555 A DA 14 1_555 B DT 4  1_555 -0.396 1.395  3.586 1.000  8.366  34.231 0.880  0.825  3.798 13.953 
-1.669 35.222 9  TT_DT13DA14:DT104DA105_NN T 13 ? N 105 ? T 14 ? N 104 ? 
1 A DA 14 1_555 B DT 4  1_555 A DT 15 1_555 B DA 3  1_555 0.728  -0.812 3.197 0.944  4.728  33.279 -2.149 -1.110 3.074 8.203  
-1.638 33.617 10 TT_DA14DT15:DA103DT104_NN T 14 ? N 104 ? T 15 ? N 103 ? 
1 A DT 15 1_555 B DA 3  1_555 A DT 16 1_555 B DA 2  1_555 0.314  0.868  3.475 1.319  4.558  37.343 0.706  -0.302 3.561 7.083  
-2.050 37.633 11 TT_DT15DT16:DA102DA103_NN T 15 ? N 103 ? T 16 ? N 102 ? 
1 A DT 16 1_555 B DA 2  1_555 A DA 17 1_555 B DT 1  1_555 -1.663 1.334  3.226 -1.847 7.734  35.604 1.014  2.392  3.508 12.458 
2.976  36.453 12 TT_DT16DA17:DT101DA102_NN T 16 ? N 102 ? T 17 ? N 101 ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 HOH 1   18   16  HOH HOH T . 
D 4 HOH 2   19   201 HOH HOH T . 
D 4 HOH 3   20   216 HOH HOH T . 
D 4 HOH 4   21   224 HOH HOH T . 
D 4 HOH 5   22   279 HOH HOH T . 
D 4 HOH 6   23   280 HOH HOH T . 
D 4 HOH 7   24   282 HOH HOH T . 
D 4 HOH 8   25   298 HOH HOH T . 
D 4 HOH 9   26   312 HOH HOH T . 
D 4 HOH 10  27   343 HOH HOH T . 
D 4 HOH 11  28   364 HOH HOH T . 
D 4 HOH 12  29   376 HOH HOH T . 
D 4 HOH 13  30   399 HOH HOH T . 
D 4 HOH 14  31   434 HOH HOH T . 
E 4 HOH 1   61   61  HOH HOH N . 
E 4 HOH 2   132  132 HOH HOH N . 
E 4 HOH 3   134  134 HOH HOH N . 
E 4 HOH 4   150  150 HOH HOH N . 
E 4 HOH 5   202  202 HOH HOH N . 
E 4 HOH 6   210  210 HOH HOH N . 
E 4 HOH 7   225  225 HOH HOH N . 
E 4 HOH 8   273  273 HOH HOH N . 
E 4 HOH 9   278  278 HOH HOH N . 
E 4 HOH 10  290  290 HOH HOH N . 
E 4 HOH 11  319  319 HOH HOH N . 
E 4 HOH 12  321  321 HOH HOH N . 
E 4 HOH 13  332  332 HOH HOH N . 
E 4 HOH 14  338  338 HOH HOH N . 
E 4 HOH 15  341  341 HOH HOH N . 
E 4 HOH 16  352  352 HOH HOH N . 
E 4 HOH 17  428  428 HOH HOH N . 
E 4 HOH 18  468  468 HOH HOH N . 
F 4 HOH 1   884  1   HOH HOH A . 
F 4 HOH 2   885  2   HOH HOH A . 
F 4 HOH 3   886  3   HOH HOH A . 
F 4 HOH 4   887  4   HOH HOH A . 
F 4 HOH 5   888  5   HOH HOH A . 
F 4 HOH 6   889  6   HOH HOH A . 
F 4 HOH 7   890  7   HOH HOH A . 
F 4 HOH 8   891  8   HOH HOH A . 
F 4 HOH 9   892  9   HOH HOH A . 
F 4 HOH 10  893  10  HOH HOH A . 
F 4 HOH 11  894  11  HOH HOH A . 
F 4 HOH 12  895  12  HOH HOH A . 
F 4 HOH 13  896  13  HOH HOH A . 
F 4 HOH 14  897  14  HOH HOH A . 
F 4 HOH 15  898  15  HOH HOH A . 
F 4 HOH 16  899  17  HOH HOH A . 
F 4 HOH 17  900  18  HOH HOH A . 
F 4 HOH 18  901  19  HOH HOH A . 
F 4 HOH 19  902  20  HOH HOH A . 
F 4 HOH 20  903  21  HOH HOH A . 
F 4 HOH 21  904  22  HOH HOH A . 
F 4 HOH 22  905  23  HOH HOH A . 
F 4 HOH 23  906  24  HOH HOH A . 
F 4 HOH 24  907  25  HOH HOH A . 
F 4 HOH 25  908  26  HOH HOH A . 
F 4 HOH 26  909  27  HOH HOH A . 
F 4 HOH 27  910  28  HOH HOH A . 
F 4 HOH 28  911  29  HOH HOH A . 
F 4 HOH 29  912  30  HOH HOH A . 
F 4 HOH 30  913  31  HOH HOH A . 
F 4 HOH 31  914  32  HOH HOH A . 
F 4 HOH 32  915  33  HOH HOH A . 
F 4 HOH 33  916  34  HOH HOH A . 
F 4 HOH 34  917  35  HOH HOH A . 
F 4 HOH 35  918  36  HOH HOH A . 
F 4 HOH 36  919  37  HOH HOH A . 
F 4 HOH 37  920  38  HOH HOH A . 
F 4 HOH 38  921  39  HOH HOH A . 
F 4 HOH 39  922  40  HOH HOH A . 
F 4 HOH 40  923  41  HOH HOH A . 
F 4 HOH 41  924  42  HOH HOH A . 
F 4 HOH 42  925  43  HOH HOH A . 
F 4 HOH 43  926  44  HOH HOH A . 
F 4 HOH 44  927  45  HOH HOH A . 
F 4 HOH 45  928  46  HOH HOH A . 
F 4 HOH 46  929  47  HOH HOH A . 
F 4 HOH 47  930  48  HOH HOH A . 
F 4 HOH 48  931  49  HOH HOH A . 
F 4 HOH 49  932  50  HOH HOH A . 
F 4 HOH 50  933  51  HOH HOH A . 
F 4 HOH 51  934  52  HOH HOH A . 
F 4 HOH 52  935  53  HOH HOH A . 
F 4 HOH 53  936  54  HOH HOH A . 
F 4 HOH 54  937  55  HOH HOH A . 
F 4 HOH 55  938  56  HOH HOH A . 
F 4 HOH 56  939  57  HOH HOH A . 
F 4 HOH 57  940  58  HOH HOH A . 
F 4 HOH 58  941  59  HOH HOH A . 
F 4 HOH 59  942  60  HOH HOH A . 
F 4 HOH 60  943  62  HOH HOH A . 
F 4 HOH 61  944  63  HOH HOH A . 
F 4 HOH 62  945  64  HOH HOH A . 
F 4 HOH 63  946  65  HOH HOH A . 
F 4 HOH 64  947  66  HOH HOH A . 
F 4 HOH 65  948  67  HOH HOH A . 
F 4 HOH 66  949  68  HOH HOH A . 
F 4 HOH 67  950  69  HOH HOH A . 
F 4 HOH 68  951  70  HOH HOH A . 
F 4 HOH 69  952  71  HOH HOH A . 
F 4 HOH 70  953  72  HOH HOH A . 
F 4 HOH 71  954  73  HOH HOH A . 
F 4 HOH 72  955  74  HOH HOH A . 
F 4 HOH 73  956  75  HOH HOH A . 
F 4 HOH 74  957  76  HOH HOH A . 
F 4 HOH 75  958  77  HOH HOH A . 
F 4 HOH 76  959  78  HOH HOH A . 
F 4 HOH 77  960  79  HOH HOH A . 
F 4 HOH 78  961  80  HOH HOH A . 
F 4 HOH 79  962  81  HOH HOH A . 
F 4 HOH 80  963  82  HOH HOH A . 
F 4 HOH 81  964  83  HOH HOH A . 
F 4 HOH 82  965  84  HOH HOH A . 
F 4 HOH 83  966  85  HOH HOH A . 
F 4 HOH 84  967  86  HOH HOH A . 
F 4 HOH 85  968  87  HOH HOH A . 
F 4 HOH 86  969  88  HOH HOH A . 
F 4 HOH 87  970  89  HOH HOH A . 
F 4 HOH 88  971  90  HOH HOH A . 
F 4 HOH 89  972  91  HOH HOH A . 
F 4 HOH 90  973  92  HOH HOH A . 
F 4 HOH 91  974  93  HOH HOH A . 
F 4 HOH 92  975  94  HOH HOH A . 
F 4 HOH 93  976  95  HOH HOH A . 
F 4 HOH 94  977  96  HOH HOH A . 
F 4 HOH 95  978  97  HOH HOH A . 
F 4 HOH 96  979  98  HOH HOH A . 
F 4 HOH 97  980  99  HOH HOH A . 
F 4 HOH 98  981  100 HOH HOH A . 
F 4 HOH 99  982  101 HOH HOH A . 
F 4 HOH 100 983  102 HOH HOH A . 
F 4 HOH 101 984  103 HOH HOH A . 
F 4 HOH 102 985  104 HOH HOH A . 
F 4 HOH 103 986  105 HOH HOH A . 
F 4 HOH 104 987  106 HOH HOH A . 
F 4 HOH 105 988  107 HOH HOH A . 
F 4 HOH 106 989  108 HOH HOH A . 
F 4 HOH 107 990  109 HOH HOH A . 
F 4 HOH 108 991  110 HOH HOH A . 
F 4 HOH 109 992  111 HOH HOH A . 
F 4 HOH 110 993  112 HOH HOH A . 
F 4 HOH 111 994  113 HOH HOH A . 
F 4 HOH 112 995  114 HOH HOH A . 
F 4 HOH 113 996  115 HOH HOH A . 
F 4 HOH 114 997  116 HOH HOH A . 
F 4 HOH 115 998  117 HOH HOH A . 
F 4 HOH 116 999  118 HOH HOH A . 
F 4 HOH 117 1000 119 HOH HOH A . 
F 4 HOH 118 1001 120 HOH HOH A . 
F 4 HOH 119 1002 121 HOH HOH A . 
F 4 HOH 120 1003 122 HOH HOH A . 
F 4 HOH 121 1004 123 HOH HOH A . 
F 4 HOH 122 1005 124 HOH HOH A . 
F 4 HOH 123 1006 125 HOH HOH A . 
F 4 HOH 124 1007 126 HOH HOH A . 
F 4 HOH 125 1008 127 HOH HOH A . 
F 4 HOH 126 1009 128 HOH HOH A . 
F 4 HOH 127 1010 129 HOH HOH A . 
F 4 HOH 128 1011 130 HOH HOH A . 
F 4 HOH 129 1012 131 HOH HOH A . 
F 4 HOH 130 1013 133 HOH HOH A . 
F 4 HOH 131 1014 135 HOH HOH A . 
F 4 HOH 132 1015 136 HOH HOH A . 
F 4 HOH 133 1016 137 HOH HOH A . 
F 4 HOH 134 1017 138 HOH HOH A . 
F 4 HOH 135 1018 139 HOH HOH A . 
F 4 HOH 136 1019 140 HOH HOH A . 
F 4 HOH 137 1020 141 HOH HOH A . 
F 4 HOH 138 1021 142 HOH HOH A . 
F 4 HOH 139 1022 143 HOH HOH A . 
F 4 HOH 140 1023 144 HOH HOH A . 
F 4 HOH 141 1024 145 HOH HOH A . 
F 4 HOH 142 1025 146 HOH HOH A . 
F 4 HOH 143 1026 147 HOH HOH A . 
F 4 HOH 144 1027 148 HOH HOH A . 
F 4 HOH 145 1028 149 HOH HOH A . 
F 4 HOH 146 1029 151 HOH HOH A . 
F 4 HOH 147 1030 152 HOH HOH A . 
F 4 HOH 148 1031 153 HOH HOH A . 
F 4 HOH 149 1032 154 HOH HOH A . 
F 4 HOH 150 1033 155 HOH HOH A . 
F 4 HOH 151 1034 156 HOH HOH A . 
F 4 HOH 152 1035 157 HOH HOH A . 
F 4 HOH 153 1036 158 HOH HOH A . 
F 4 HOH 154 1037 159 HOH HOH A . 
F 4 HOH 155 1038 160 HOH HOH A . 
F 4 HOH 156 1039 161 HOH HOH A . 
F 4 HOH 157 1040 162 HOH HOH A . 
F 4 HOH 158 1041 163 HOH HOH A . 
F 4 HOH 159 1042 164 HOH HOH A . 
F 4 HOH 160 1043 165 HOH HOH A . 
F 4 HOH 161 1044 166 HOH HOH A . 
F 4 HOH 162 1045 167 HOH HOH A . 
F 4 HOH 163 1046 168 HOH HOH A . 
F 4 HOH 164 1047 169 HOH HOH A . 
F 4 HOH 165 1048 170 HOH HOH A . 
F 4 HOH 166 1049 171 HOH HOH A . 
F 4 HOH 167 1050 172 HOH HOH A . 
F 4 HOH 168 1051 173 HOH HOH A . 
F 4 HOH 169 1052 174 HOH HOH A . 
F 4 HOH 170 1053 175 HOH HOH A . 
F 4 HOH 171 1054 176 HOH HOH A . 
F 4 HOH 172 1055 177 HOH HOH A . 
F 4 HOH 173 1056 178 HOH HOH A . 
F 4 HOH 174 1057 179 HOH HOH A . 
F 4 HOH 175 1058 180 HOH HOH A . 
F 4 HOH 176 1059 181 HOH HOH A . 
F 4 HOH 177 1060 182 HOH HOH A . 
F 4 HOH 178 1061 183 HOH HOH A . 
F 4 HOH 179 1062 184 HOH HOH A . 
F 4 HOH 180 1063 185 HOH HOH A . 
F 4 HOH 181 1064 186 HOH HOH A . 
F 4 HOH 182 1065 187 HOH HOH A . 
F 4 HOH 183 1066 188 HOH HOH A . 
F 4 HOH 184 1067 189 HOH HOH A . 
F 4 HOH 185 1068 190 HOH HOH A . 
F 4 HOH 186 1069 191 HOH HOH A . 
F 4 HOH 187 1070 192 HOH HOH A . 
F 4 HOH 188 1071 193 HOH HOH A . 
F 4 HOH 189 1072 194 HOH HOH A . 
F 4 HOH 190 1073 195 HOH HOH A . 
F 4 HOH 191 1074 196 HOH HOH A . 
F 4 HOH 192 1075 197 HOH HOH A . 
F 4 HOH 193 1076 198 HOH HOH A . 
F 4 HOH 194 1077 199 HOH HOH A . 
F 4 HOH 195 1078 200 HOH HOH A . 
F 4 HOH 196 1079 203 HOH HOH A . 
F 4 HOH 197 1080 204 HOH HOH A . 
F 4 HOH 198 1081 205 HOH HOH A . 
F 4 HOH 199 1082 206 HOH HOH A . 
F 4 HOH 200 1083 207 HOH HOH A . 
F 4 HOH 201 1084 208 HOH HOH A . 
F 4 HOH 202 1085 209 HOH HOH A . 
F 4 HOH 203 1086 211 HOH HOH A . 
F 4 HOH 204 1087 212 HOH HOH A . 
F 4 HOH 205 1088 213 HOH HOH A . 
F 4 HOH 206 1089 214 HOH HOH A . 
F 4 HOH 207 1090 215 HOH HOH A . 
F 4 HOH 208 1091 217 HOH HOH A . 
F 4 HOH 209 1092 218 HOH HOH A . 
F 4 HOH 210 1093 219 HOH HOH A . 
F 4 HOH 211 1094 220 HOH HOH A . 
F 4 HOH 212 1095 221 HOH HOH A . 
F 4 HOH 213 1096 222 HOH HOH A . 
F 4 HOH 214 1097 223 HOH HOH A . 
F 4 HOH 215 1098 226 HOH HOH A . 
F 4 HOH 216 1099 227 HOH HOH A . 
F 4 HOH 217 1100 228 HOH HOH A . 
F 4 HOH 218 1101 229 HOH HOH A . 
F 4 HOH 219 1102 230 HOH HOH A . 
F 4 HOH 220 1103 231 HOH HOH A . 
F 4 HOH 221 1104 232 HOH HOH A . 
F 4 HOH 222 1105 233 HOH HOH A . 
F 4 HOH 223 1106 234 HOH HOH A . 
F 4 HOH 224 1107 235 HOH HOH A . 
F 4 HOH 225 1108 236 HOH HOH A . 
F 4 HOH 226 1109 237 HOH HOH A . 
F 4 HOH 227 1110 238 HOH HOH A . 
F 4 HOH 228 1111 239 HOH HOH A . 
F 4 HOH 229 1112 240 HOH HOH A . 
F 4 HOH 230 1113 241 HOH HOH A . 
F 4 HOH 231 1114 242 HOH HOH A . 
F 4 HOH 232 1115 243 HOH HOH A . 
F 4 HOH 233 1116 244 HOH HOH A . 
F 4 HOH 234 1117 245 HOH HOH A . 
F 4 HOH 235 1118 246 HOH HOH A . 
F 4 HOH 236 1119 247 HOH HOH A . 
F 4 HOH 237 1120 248 HOH HOH A . 
F 4 HOH 238 1121 249 HOH HOH A . 
F 4 HOH 239 1122 250 HOH HOH A . 
F 4 HOH 240 1123 251 HOH HOH A . 
F 4 HOH 241 1124 252 HOH HOH A . 
F 4 HOH 242 1125 253 HOH HOH A . 
F 4 HOH 243 1126 254 HOH HOH A . 
F 4 HOH 244 1127 255 HOH HOH A . 
F 4 HOH 245 1128 256 HOH HOH A . 
F 4 HOH 246 1129 257 HOH HOH A . 
F 4 HOH 247 1130 258 HOH HOH A . 
F 4 HOH 248 1131 259 HOH HOH A . 
F 4 HOH 249 1132 260 HOH HOH A . 
F 4 HOH 250 1133 261 HOH HOH A . 
F 4 HOH 251 1134 262 HOH HOH A . 
F 4 HOH 252 1135 263 HOH HOH A . 
F 4 HOH 253 1136 264 HOH HOH A . 
F 4 HOH 254 1137 265 HOH HOH A . 
F 4 HOH 255 1138 266 HOH HOH A . 
F 4 HOH 256 1139 267 HOH HOH A . 
F 4 HOH 257 1140 268 HOH HOH A . 
F 4 HOH 258 1141 269 HOH HOH A . 
F 4 HOH 259 1142 270 HOH HOH A . 
F 4 HOH 260 1143 271 HOH HOH A . 
F 4 HOH 261 1144 272 HOH HOH A . 
F 4 HOH 262 1145 274 HOH HOH A . 
F 4 HOH 263 1146 275 HOH HOH A . 
F 4 HOH 264 1147 276 HOH HOH A . 
F 4 HOH 265 1148 277 HOH HOH A . 
F 4 HOH 266 1149 281 HOH HOH A . 
F 4 HOH 267 1150 283 HOH HOH A . 
F 4 HOH 268 1151 284 HOH HOH A . 
F 4 HOH 269 1152 285 HOH HOH A . 
F 4 HOH 270 1153 286 HOH HOH A . 
F 4 HOH 271 1154 287 HOH HOH A . 
F 4 HOH 272 1155 288 HOH HOH A . 
F 4 HOH 273 1156 289 HOH HOH A . 
F 4 HOH 274 1157 291 HOH HOH A . 
F 4 HOH 275 1158 292 HOH HOH A . 
F 4 HOH 276 1159 293 HOH HOH A . 
F 4 HOH 277 1160 294 HOH HOH A . 
F 4 HOH 278 1161 295 HOH HOH A . 
F 4 HOH 279 1162 296 HOH HOH A . 
F 4 HOH 280 1163 297 HOH HOH A . 
F 4 HOH 281 1164 299 HOH HOH A . 
F 4 HOH 282 1165 300 HOH HOH A . 
F 4 HOH 283 1166 301 HOH HOH A . 
F 4 HOH 284 1167 302 HOH HOH A . 
F 4 HOH 285 1168 303 HOH HOH A . 
F 4 HOH 286 1169 304 HOH HOH A . 
F 4 HOH 287 1170 305 HOH HOH A . 
F 4 HOH 288 1171 306 HOH HOH A . 
F 4 HOH 289 1172 307 HOH HOH A . 
F 4 HOH 290 1173 308 HOH HOH A . 
F 4 HOH 291 1174 309 HOH HOH A . 
F 4 HOH 292 1175 310 HOH HOH A . 
F 4 HOH 293 1176 311 HOH HOH A . 
F 4 HOH 294 1177 313 HOH HOH A . 
F 4 HOH 295 1178 314 HOH HOH A . 
F 4 HOH 296 1179 315 HOH HOH A . 
F 4 HOH 297 1180 316 HOH HOH A . 
F 4 HOH 298 1181 317 HOH HOH A . 
F 4 HOH 299 1182 318 HOH HOH A . 
F 4 HOH 300 1183 320 HOH HOH A . 
F 4 HOH 301 1184 322 HOH HOH A . 
F 4 HOH 302 1185 323 HOH HOH A . 
F 4 HOH 303 1186 324 HOH HOH A . 
F 4 HOH 304 1187 325 HOH HOH A . 
F 4 HOH 305 1188 326 HOH HOH A . 
F 4 HOH 306 1189 327 HOH HOH A . 
F 4 HOH 307 1190 328 HOH HOH A . 
F 4 HOH 308 1191 329 HOH HOH A . 
F 4 HOH 309 1192 330 HOH HOH A . 
F 4 HOH 310 1193 331 HOH HOH A . 
F 4 HOH 311 1194 333 HOH HOH A . 
F 4 HOH 312 1195 334 HOH HOH A . 
F 4 HOH 313 1196 335 HOH HOH A . 
F 4 HOH 314 1197 336 HOH HOH A . 
F 4 HOH 315 1198 337 HOH HOH A . 
F 4 HOH 316 1199 339 HOH HOH A . 
F 4 HOH 317 1200 340 HOH HOH A . 
F 4 HOH 318 1201 342 HOH HOH A . 
F 4 HOH 319 1202 344 HOH HOH A . 
F 4 HOH 320 1203 345 HOH HOH A . 
F 4 HOH 321 1204 346 HOH HOH A . 
F 4 HOH 322 1205 347 HOH HOH A . 
F 4 HOH 323 1206 348 HOH HOH A . 
F 4 HOH 324 1207 349 HOH HOH A . 
F 4 HOH 325 1208 350 HOH HOH A . 
F 4 HOH 326 1209 351 HOH HOH A . 
F 4 HOH 327 1210 353 HOH HOH A . 
F 4 HOH 328 1211 354 HOH HOH A . 
F 4 HOH 329 1212 355 HOH HOH A . 
F 4 HOH 330 1213 356 HOH HOH A . 
F 4 HOH 331 1214 357 HOH HOH A . 
F 4 HOH 332 1215 358 HOH HOH A . 
F 4 HOH 333 1216 359 HOH HOH A . 
F 4 HOH 334 1217 360 HOH HOH A . 
F 4 HOH 335 1218 361 HOH HOH A . 
F 4 HOH 336 1219 362 HOH HOH A . 
F 4 HOH 337 1220 363 HOH HOH A . 
F 4 HOH 338 1221 365 HOH HOH A . 
F 4 HOH 339 1222 366 HOH HOH A . 
F 4 HOH 340 1223 367 HOH HOH A . 
F 4 HOH 341 1224 368 HOH HOH A . 
F 4 HOH 342 1225 369 HOH HOH A . 
F 4 HOH 343 1226 370 HOH HOH A . 
F 4 HOH 344 1227 371 HOH HOH A . 
F 4 HOH 345 1228 372 HOH HOH A . 
F 4 HOH 346 1229 373 HOH HOH A . 
F 4 HOH 347 1230 374 HOH HOH A . 
F 4 HOH 348 1231 375 HOH HOH A . 
F 4 HOH 349 1232 377 HOH HOH A . 
F 4 HOH 350 1233 378 HOH HOH A . 
F 4 HOH 351 1234 379 HOH HOH A . 
F 4 HOH 352 1235 380 HOH HOH A . 
F 4 HOH 353 1236 381 HOH HOH A . 
F 4 HOH 354 1237 382 HOH HOH A . 
F 4 HOH 355 1238 383 HOH HOH A . 
F 4 HOH 356 1239 384 HOH HOH A . 
F 4 HOH 357 1240 385 HOH HOH A . 
F 4 HOH 358 1241 386 HOH HOH A . 
F 4 HOH 359 1242 387 HOH HOH A . 
F 4 HOH 360 1243 388 HOH HOH A . 
F 4 HOH 361 1244 389 HOH HOH A . 
F 4 HOH 362 1245 390 HOH HOH A . 
F 4 HOH 363 1246 391 HOH HOH A . 
F 4 HOH 364 1247 392 HOH HOH A . 
F 4 HOH 365 1248 393 HOH HOH A . 
F 4 HOH 366 1249 394 HOH HOH A . 
F 4 HOH 367 1250 395 HOH HOH A . 
F 4 HOH 368 1251 396 HOH HOH A . 
F 4 HOH 369 1252 397 HOH HOH A . 
F 4 HOH 370 1253 398 HOH HOH A . 
F 4 HOH 371 1254 400 HOH HOH A . 
F 4 HOH 372 1255 401 HOH HOH A . 
F 4 HOH 373 1256 402 HOH HOH A . 
F 4 HOH 374 1257 403 HOH HOH A . 
F 4 HOH 375 1258 404 HOH HOH A . 
F 4 HOH 376 1259 405 HOH HOH A . 
F 4 HOH 377 1260 406 HOH HOH A . 
F 4 HOH 378 1261 407 HOH HOH A . 
F 4 HOH 379 1262 408 HOH HOH A . 
F 4 HOH 380 1263 409 HOH HOH A . 
F 4 HOH 381 1264 410 HOH HOH A . 
F 4 HOH 382 1265 411 HOH HOH A . 
F 4 HOH 383 1266 412 HOH HOH A . 
F 4 HOH 384 1267 413 HOH HOH A . 
F 4 HOH 385 1268 414 HOH HOH A . 
F 4 HOH 386 1269 415 HOH HOH A . 
F 4 HOH 387 1270 416 HOH HOH A . 
F 4 HOH 388 1271 417 HOH HOH A . 
F 4 HOH 389 1272 418 HOH HOH A . 
F 4 HOH 390 1273 419 HOH HOH A . 
F 4 HOH 391 1274 420 HOH HOH A . 
F 4 HOH 392 1275 421 HOH HOH A . 
F 4 HOH 393 1276 422 HOH HOH A . 
F 4 HOH 394 1277 423 HOH HOH A . 
F 4 HOH 395 1278 424 HOH HOH A . 
F 4 HOH 396 1279 425 HOH HOH A . 
F 4 HOH 397 1280 426 HOH HOH A . 
F 4 HOH 398 1281 427 HOH HOH A . 
F 4 HOH 399 1282 429 HOH HOH A . 
F 4 HOH 400 1283 430 HOH HOH A . 
F 4 HOH 401 1284 431 HOH HOH A . 
F 4 HOH 402 1285 432 HOH HOH A . 
F 4 HOH 403 1286 433 HOH HOH A . 
F 4 HOH 404 1287 435 HOH HOH A . 
F 4 HOH 405 1288 436 HOH HOH A . 
F 4 HOH 406 1289 437 HOH HOH A . 
F 4 HOH 407 1290 438 HOH HOH A . 
F 4 HOH 408 1291 439 HOH HOH A . 
F 4 HOH 409 1292 440 HOH HOH A . 
F 4 HOH 410 1293 441 HOH HOH A . 
F 4 HOH 411 1294 442 HOH HOH A . 
F 4 HOH 412 1295 443 HOH HOH A . 
F 4 HOH 413 1296 444 HOH HOH A . 
F 4 HOH 414 1297 445 HOH HOH A . 
F 4 HOH 415 1298 446 HOH HOH A . 
F 4 HOH 416 1299 447 HOH HOH A . 
F 4 HOH 417 1300 448 HOH HOH A . 
F 4 HOH 418 1301 449 HOH HOH A . 
F 4 HOH 419 1302 450 HOH HOH A . 
F 4 HOH 420 1303 451 HOH HOH A . 
F 4 HOH 421 1304 452 HOH HOH A . 
F 4 HOH 422 1305 453 HOH HOH A . 
F 4 HOH 423 1306 454 HOH HOH A . 
F 4 HOH 424 1307 455 HOH HOH A . 
F 4 HOH 425 1308 456 HOH HOH A . 
F 4 HOH 426 1309 457 HOH HOH A . 
F 4 HOH 427 1310 458 HOH HOH A . 
F 4 HOH 428 1311 459 HOH HOH A . 
F 4 HOH 429 1312 460 HOH HOH A . 
F 4 HOH 430 1313 461 HOH HOH A . 
F 4 HOH 431 1314 462 HOH HOH A . 
F 4 HOH 432 1315 463 HOH HOH A . 
F 4 HOH 433 1316 464 HOH HOH A . 
F 4 HOH 434 1317 465 HOH HOH A . 
F 4 HOH 435 1318 466 HOH HOH A . 
F 4 HOH 436 1319 467 HOH HOH A . 
F 4 HOH 437 1320 469 HOH HOH A . 
F 4 HOH 438 1321 470 HOH HOH A . 
F 4 HOH 439 1322 471 HOH HOH A . 
#