data_1CG1
# 
_entry.id   1CG1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.291 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1CG1         
RCSB  RCSB000738   
WWPDB D_1000000738 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1CG1 
_pdbx_database_status.recvd_initial_deposition_date   1999-03-26 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Choe, J.Y.'   1 
'Poland, B.W.' 2 
'Fromm, H.'    3 
'Honzatko, R.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Mechanistic implications from crystalline complexes of wild-type and mutant adenylosuccinate synthetases from Escherichia coli.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            38 
_citation.page_first                6953 
_citation.page_last                 6961 
_citation.year                      1999 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10346917 
_citation.pdbx_database_id_DOI      10.1021/bi990159s 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Choe, J.Y.'     1 
primary 'Poland, B.W.'   2 
primary 'Fromm, H.J.'    3 
primary 'Honzatko, R.B.' 4 
# 
_cell.entry_id           1CG1 
_cell.length_a           80.370 
_cell.length_b           80.370 
_cell.length_c           158.520 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1CG1 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN (ADENYLOSUCCINATE SYNTHETASE)' 47268.547 1   6.3.4.4 K16Q ? ? 
2 non-polymer syn 'MAGNESIUM ION'                         24.305    1   ?       ?    ? ? 
3 non-polymer syn HADACIDIN                               119.076   1   ?       ?    ? ? 
4 non-polymer syn '6-O-PHOSPHORYL INOSINE MONOPHOSPHATE'  428.186   1   ?       ?    ? ? 
5 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE"              443.201   1   ?       ?    ? ? 
6 water       nat water                                   18.015    238 ?       ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AMPSASE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GNNVVVLGTQWGDEGQGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILRENVTSIIGNGVVLSPAALM
KEMKELEDRGIPVRERLLLSEACPLILDYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEK
LKEVMEYHNFQLVNYYKAEAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVTS
SNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQ
LNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTTPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIK
RIEELTGVPIDIISTGPDRTETMILRDPFDA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GNNVVVLGTQWGDEGQGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILRENVTSIIGNGVVLSPAALM
KEMKELEDRGIPVRERLLLSEACPLILDYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEK
LKEVMEYHNFQLVNYYKAEAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVTS
SNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQ
LNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTTPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIK
RIEELTGVPIDIISTGPDRTETMILRDPFDA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ASN n 
1 3   ASN n 
1 4   VAL n 
1 5   VAL n 
1 6   VAL n 
1 7   LEU n 
1 8   GLY n 
1 9   THR n 
1 10  GLN n 
1 11  TRP n 
1 12  GLY n 
1 13  ASP n 
1 14  GLU n 
1 15  GLY n 
1 16  GLN n 
1 17  GLY n 
1 18  LYS n 
1 19  ILE n 
1 20  VAL n 
1 21  ASP n 
1 22  LEU n 
1 23  LEU n 
1 24  THR n 
1 25  GLU n 
1 26  ARG n 
1 27  ALA n 
1 28  LYS n 
1 29  TYR n 
1 30  VAL n 
1 31  VAL n 
1 32  ARG n 
1 33  TYR n 
1 34  GLN n 
1 35  GLY n 
1 36  GLY n 
1 37  HIS n 
1 38  ASN n 
1 39  ALA n 
1 40  GLY n 
1 41  HIS n 
1 42  THR n 
1 43  LEU n 
1 44  VAL n 
1 45  ILE n 
1 46  ASN n 
1 47  GLY n 
1 48  GLU n 
1 49  LYS n 
1 50  THR n 
1 51  VAL n 
1 52  LEU n 
1 53  HIS n 
1 54  LEU n 
1 55  ILE n 
1 56  PRO n 
1 57  SER n 
1 58  GLY n 
1 59  ILE n 
1 60  LEU n 
1 61  ARG n 
1 62  GLU n 
1 63  ASN n 
1 64  VAL n 
1 65  THR n 
1 66  SER n 
1 67  ILE n 
1 68  ILE n 
1 69  GLY n 
1 70  ASN n 
1 71  GLY n 
1 72  VAL n 
1 73  VAL n 
1 74  LEU n 
1 75  SER n 
1 76  PRO n 
1 77  ALA n 
1 78  ALA n 
1 79  LEU n 
1 80  MET n 
1 81  LYS n 
1 82  GLU n 
1 83  MET n 
1 84  LYS n 
1 85  GLU n 
1 86  LEU n 
1 87  GLU n 
1 88  ASP n 
1 89  ARG n 
1 90  GLY n 
1 91  ILE n 
1 92  PRO n 
1 93  VAL n 
1 94  ARG n 
1 95  GLU n 
1 96  ARG n 
1 97  LEU n 
1 98  LEU n 
1 99  LEU n 
1 100 SER n 
1 101 GLU n 
1 102 ALA n 
1 103 CYS n 
1 104 PRO n 
1 105 LEU n 
1 106 ILE n 
1 107 LEU n 
1 108 ASP n 
1 109 TYR n 
1 110 HIS n 
1 111 VAL n 
1 112 ALA n 
1 113 LEU n 
1 114 ASP n 
1 115 ASN n 
1 116 ALA n 
1 117 ARG n 
1 118 GLU n 
1 119 LYS n 
1 120 ALA n 
1 121 ARG n 
1 122 GLY n 
1 123 ALA n 
1 124 LYS n 
1 125 ALA n 
1 126 ILE n 
1 127 GLY n 
1 128 THR n 
1 129 THR n 
1 130 GLY n 
1 131 ARG n 
1 132 GLY n 
1 133 ILE n 
1 134 GLY n 
1 135 PRO n 
1 136 ALA n 
1 137 TYR n 
1 138 GLU n 
1 139 ASP n 
1 140 LYS n 
1 141 VAL n 
1 142 ALA n 
1 143 ARG n 
1 144 ARG n 
1 145 GLY n 
1 146 LEU n 
1 147 ARG n 
1 148 VAL n 
1 149 GLY n 
1 150 ASP n 
1 151 LEU n 
1 152 PHE n 
1 153 ASP n 
1 154 LYS n 
1 155 GLU n 
1 156 THR n 
1 157 PHE n 
1 158 ALA n 
1 159 GLU n 
1 160 LYS n 
1 161 LEU n 
1 162 LYS n 
1 163 GLU n 
1 164 VAL n 
1 165 MET n 
1 166 GLU n 
1 167 TYR n 
1 168 HIS n 
1 169 ASN n 
1 170 PHE n 
1 171 GLN n 
1 172 LEU n 
1 173 VAL n 
1 174 ASN n 
1 175 TYR n 
1 176 TYR n 
1 177 LYS n 
1 178 ALA n 
1 179 GLU n 
1 180 ALA n 
1 181 VAL n 
1 182 ASP n 
1 183 TYR n 
1 184 GLN n 
1 185 LYS n 
1 186 VAL n 
1 187 LEU n 
1 188 ASP n 
1 189 ASP n 
1 190 THR n 
1 191 MET n 
1 192 ALA n 
1 193 VAL n 
1 194 ALA n 
1 195 ASP n 
1 196 ILE n 
1 197 LEU n 
1 198 THR n 
1 199 SER n 
1 200 MET n 
1 201 VAL n 
1 202 VAL n 
1 203 ASP n 
1 204 VAL n 
1 205 SER n 
1 206 ASP n 
1 207 LEU n 
1 208 LEU n 
1 209 ASP n 
1 210 GLN n 
1 211 ALA n 
1 212 ARG n 
1 213 GLN n 
1 214 ARG n 
1 215 GLY n 
1 216 ASP n 
1 217 PHE n 
1 218 VAL n 
1 219 MET n 
1 220 PHE n 
1 221 GLU n 
1 222 GLY n 
1 223 ALA n 
1 224 GLN n 
1 225 GLY n 
1 226 THR n 
1 227 LEU n 
1 228 LEU n 
1 229 ASP n 
1 230 ILE n 
1 231 ASP n 
1 232 HIS n 
1 233 GLY n 
1 234 THR n 
1 235 TYR n 
1 236 PRO n 
1 237 TYR n 
1 238 VAL n 
1 239 THR n 
1 240 SER n 
1 241 SER n 
1 242 ASN n 
1 243 THR n 
1 244 THR n 
1 245 ALA n 
1 246 GLY n 
1 247 GLY n 
1 248 VAL n 
1 249 ALA n 
1 250 THR n 
1 251 GLY n 
1 252 SER n 
1 253 GLY n 
1 254 LEU n 
1 255 GLY n 
1 256 PRO n 
1 257 ARG n 
1 258 TYR n 
1 259 VAL n 
1 260 ASP n 
1 261 TYR n 
1 262 VAL n 
1 263 LEU n 
1 264 GLY n 
1 265 ILE n 
1 266 LEU n 
1 267 LYS n 
1 268 ALA n 
1 269 TYR n 
1 270 SER n 
1 271 THR n 
1 272 ARG n 
1 273 VAL n 
1 274 GLY n 
1 275 ALA n 
1 276 GLY n 
1 277 PRO n 
1 278 PHE n 
1 279 PRO n 
1 280 THR n 
1 281 GLU n 
1 282 LEU n 
1 283 PHE n 
1 284 ASP n 
1 285 GLU n 
1 286 THR n 
1 287 GLY n 
1 288 GLU n 
1 289 PHE n 
1 290 LEU n 
1 291 CYS n 
1 292 LYS n 
1 293 GLN n 
1 294 GLY n 
1 295 ASN n 
1 296 GLU n 
1 297 PHE n 
1 298 GLY n 
1 299 ALA n 
1 300 THR n 
1 301 THR n 
1 302 GLY n 
1 303 ARG n 
1 304 ARG n 
1 305 ARG n 
1 306 ARG n 
1 307 THR n 
1 308 GLY n 
1 309 TRP n 
1 310 LEU n 
1 311 ASP n 
1 312 THR n 
1 313 VAL n 
1 314 ALA n 
1 315 VAL n 
1 316 ARG n 
1 317 ARG n 
1 318 ALA n 
1 319 VAL n 
1 320 GLN n 
1 321 LEU n 
1 322 ASN n 
1 323 SER n 
1 324 LEU n 
1 325 SER n 
1 326 GLY n 
1 327 PHE n 
1 328 CYS n 
1 329 LEU n 
1 330 THR n 
1 331 LYS n 
1 332 LEU n 
1 333 ASP n 
1 334 VAL n 
1 335 LEU n 
1 336 ASP n 
1 337 GLY n 
1 338 LEU n 
1 339 LYS n 
1 340 GLU n 
1 341 VAL n 
1 342 LYS n 
1 343 LEU n 
1 344 CYS n 
1 345 VAL n 
1 346 ALA n 
1 347 TYR n 
1 348 ARG n 
1 349 MET n 
1 350 PRO n 
1 351 ASP n 
1 352 GLY n 
1 353 ARG n 
1 354 GLU n 
1 355 VAL n 
1 356 THR n 
1 357 THR n 
1 358 THR n 
1 359 PRO n 
1 360 LEU n 
1 361 ALA n 
1 362 ALA n 
1 363 ASP n 
1 364 ASP n 
1 365 TRP n 
1 366 LYS n 
1 367 GLY n 
1 368 VAL n 
1 369 GLU n 
1 370 PRO n 
1 371 ILE n 
1 372 TYR n 
1 373 GLU n 
1 374 THR n 
1 375 MET n 
1 376 PRO n 
1 377 GLY n 
1 378 TRP n 
1 379 SER n 
1 380 GLU n 
1 381 SER n 
1 382 THR n 
1 383 PHE n 
1 384 GLY n 
1 385 VAL n 
1 386 LYS n 
1 387 ASP n 
1 388 ARG n 
1 389 SER n 
1 390 GLY n 
1 391 LEU n 
1 392 PRO n 
1 393 GLN n 
1 394 ALA n 
1 395 ALA n 
1 396 LEU n 
1 397 ASN n 
1 398 TYR n 
1 399 ILE n 
1 400 LYS n 
1 401 ARG n 
1 402 ILE n 
1 403 GLU n 
1 404 GLU n 
1 405 LEU n 
1 406 THR n 
1 407 GLY n 
1 408 VAL n 
1 409 PRO n 
1 410 ILE n 
1 411 ASP n 
1 412 ILE n 
1 413 ILE n 
1 414 SER n 
1 415 THR n 
1 416 GLY n 
1 417 PRO n 
1 418 ASP n 
1 419 ARG n 
1 420 THR n 
1 421 GLU n 
1 422 THR n 
1 423 MET n 
1 424 ILE n 
1 425 LEU n 
1 426 ARG n 
1 427 ASP n 
1 428 PRO n 
1 429 PHE n 
1 430 ASP n 
1 431 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   'Escherichia coli' 
_entity_src_gen.gene_src_strain                    K-12 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli K12' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     83333 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'PUR A- STRAIN H1238' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PTRC99A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PURA_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P0A7D4 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1CG1 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 431 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P0A7D4 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  431 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       431 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1CG1 
_struct_ref_seq_dif.mon_id                       GLN 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      16 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P0A7D4 
_struct_ref_seq_dif.db_mon_id                    LYS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          16 
_struct_ref_seq_dif.details                      'ENGINEERED MUTATION' 
_struct_ref_seq_dif.pdbx_auth_seq_num            16 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                               ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                               ? 'C3 H7 N O2 S'      121.158 
GDP 'RNA linking'       n "GUANOSINE-5'-DIPHOSPHATE"             ? 'C10 H15 N5 O11 P2' 443.201 
GLN 'L-peptide linking' y GLUTAMINE                              ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                ? 'C2 H5 N O2'        75.067  
HDA non-polymer         . HADACIDIN                              ? 'C3 H5 N O4'        119.076 
HIS 'L-peptide linking' y HISTIDINE                              ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                  ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ? 'C6 H13 N O2'       131.173 
IMO non-polymer         . '6-O-PHOSPHORYL INOSINE MONOPHOSPHATE' ? 'C10 H14 N4 O11 P2' 428.186 
LEU 'L-peptide linking' y LEUCINE                                ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                 ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                             ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                        ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                          ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                 ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                              ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                               ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                 ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1CG1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.13 
_exptl_crystal.density_percent_sol   60.65 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    '13% PEG 8000, 100MM NA-CACODYLATE(PH 6.5)' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           120 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   SIEMENS 
_diffrn_detector.pdbx_collection_date   1997-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        SIEMENS 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1CG1 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.5 
_reflns.number_obs                   27094 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99 
_reflns.pdbx_Rmerge_I_obs            0.0743000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.5 
_reflns.R_free_details               ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.5 
_reflns_shell.d_res_low              2.7 
_reflns_shell.percent_possible_all   99 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1CG1 
_refine.ls_number_reflns_obs                     17691 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                0 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             5.0 
_refine.ls_d_res_high                            2.5 
_refine.ls_percent_reflns_obs                    65.3 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1690000 
_refine.ls_R_factor_R_free                       0.2490000 
_refine.ls_R_factor_R_free_error                 0.0056 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10 
_refine.ls_number_reflns_R_free                  1770 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               18 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1GIM 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3321 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         64 
_refine_hist.number_atoms_solvent             238 
_refine_hist.number_atoms_total               3623 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        5.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.013 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.97  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARNAH1E.DNA TOPH19.PEP   'X-RAY DIFFRACTION' 
3 PARAM19.SOL  ?            'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1CG1 
_struct.title                     
;STRUCTURE OF THE MUTANT (K16Q) OF ADENYLOSUCCINATE SYNTHETASE FROM E. COLI COMPLEXED WITH HADACIDIN, GDP, 6-PHOSPHORYL-IMP, AND MG2+
;
_struct.pdbx_descriptor           'ADENYLOSUCCINATE SYNTHETASE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1CG1 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            'LIGASE, GTP-HYDROLYSING ENZYMES, PURINE 2 NUCLEOTIDE BIOSYNTHESIS, 6-PHOSPORYL-IMP' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLN A 16  ? ARG A 26  ? GLN A 16  ARG A 26  1 ? 11 
HELX_P HELX_P2  2  PRO A 76  ? ARG A 89  ? PRO A 76  ARG A 89  1 ? 14 
HELX_P HELX_P3  3  VAL A 93  ? ARG A 96  ? VAL A 93  ARG A 96  1 ? 4  
HELX_P HELX_P4  4  ASP A 108 ? ALA A 120 ? ASP A 108 ALA A 120 1 ? 13 
HELX_P HELX_P5  5  GLY A 122 ? LYS A 124 ? GLY A 122 LYS A 124 5 ? 3  
HELX_P HELX_P6  6  ILE A 133 ? ALA A 142 ? ILE A 133 ALA A 142 1 ? 10 
HELX_P HELX_P7  7  VAL A 148 ? PHE A 152 ? VAL A 148 PHE A 152 5 ? 5  
HELX_P HELX_P8  8  LYS A 154 ? ASN A 174 ? LYS A 154 ASN A 174 1 ? 21 
HELX_P HELX_P9  9  TYR A 183 ? MET A 200 ? TYR A 183 MET A 200 1 ? 18 
HELX_P HELX_P10 10 VAL A 204 ? GLN A 213 ? VAL A 204 GLN A 213 1 ? 10 
HELX_P HELX_P11 11 THR A 226 ? LEU A 228 ? THR A 226 LEU A 228 5 ? 3  
HELX_P HELX_P12 12 ALA A 245 ? THR A 250 ? ALA A 245 THR A 250 5 ? 6  
HELX_P HELX_P13 13 PRO A 256 ? TYR A 258 ? PRO A 256 TYR A 258 5 ? 3  
HELX_P HELX_P14 14 GLU A 285 ? GLN A 293 ? GLU A 285 GLN A 293 1 ? 9  
HELX_P HELX_P15 15 THR A 312 ? ASN A 322 ? THR A 312 ASN A 322 1 ? 11 
HELX_P HELX_P16 16 LEU A 332 ? LEU A 335 ? LEU A 332 LEU A 335 5 ? 4  
HELX_P HELX_P17 17 ALA A 362 ? TRP A 365 ? ALA A 362 TRP A 365 5 ? 4  
HELX_P HELX_P18 18 ARG A 388 ? GLY A 390 ? ARG A 388 GLY A 390 5 ? 3  
HELX_P HELX_P19 19 GLN A 393 ? THR A 406 ? GLN A 393 THR A 406 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B MG . MG ? ? ? 1_555 A ASP 13 OD1 ? ? A MG 435 A ASP 13  1_555 ? ? ? ? ? ? ? 2.378 ? 
metalc2 metalc ? ? B MG . MG ? ? ? 1_555 A GLY 40 O   ? ? A MG 435 A GLY 40  1_555 ? ? ? ? ? ? ? 2.119 ? 
metalc3 metalc ? ? B MG . MG ? ? ? 1_555 C HDA .  O   ? ? A MG 435 A HDA 437 1_555 ? ? ? ? ? ? ? 2.158 ? 
metalc4 metalc ? ? B MG . MG ? ? ? 1_555 D IMO .  O1  ? ? A MG 435 A IMO 440 1_555 ? ? ? ? ? ? ? 2.103 ? 
metalc5 metalc ? ? B MG . MG ? ? ? 1_555 E GDP .  O2B ? ? A MG 435 A GDP 432 1_555 ? ? ? ? ? ? ? 2.332 ? 
metalc6 metalc ? ? B MG . MG ? ? ? 1_555 E GDP .  O2A ? ? A MG 435 A GDP 432 1_555 ? ? ? ? ? ? ? 2.096 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TYR 
_struct_mon_prot_cis.label_seq_id           235 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TYR 
_struct_mon_prot_cis.auth_seq_id            235 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    236 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     236 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.12 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? parallel      
A 8 9 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 422 ? ILE A 424 ? THR A 422 ILE A 424 
A 2 ILE A 410 ? SER A 414 ? ILE A 410 SER A 414 
A 3 GLY A 326 ? LEU A 329 ? GLY A 326 LEU A 329 
A 4 TYR A 261 ? LEU A 266 ? TYR A 261 LEU A 266 
A 5 ASN A 3   ? GLY A 8   ? ASN A 3   GLY A 8   
A 6 VAL A 218 ? GLU A 221 ? VAL A 218 GLU A 221 
A 7 TYR A 29  ? ARG A 32  ? TYR A 29  ARG A 32  
A 8 THR A 65  ? ILE A 68  ? THR A 65  ILE A 68  
A 9 LEU A 97  ? LEU A 99  ? LEU A 97  LEU A 99  
B 1 HIS A 41  ? ILE A 45  ? HIS A 41  ILE A 45  
B 2 GLU A 48  ? LEU A 52  ? GLU A 48  LEU A 52  
C 1 SER A 270 ? ARG A 272 ? SER A 270 ARG A 272 
C 2 ARG A 306 ? GLY A 308 ? ARG A 306 GLY A 308 
D 1 GLU A 340 ? ARG A 348 ? GLU A 340 ARG A 348 
D 2 GLU A 369 ? PRO A 376 ? GLU A 369 PRO A 376 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O MET A 423 ? O MET A 423 N ILE A 413 ? N ILE A 413 
A 2 3 O ASP A 411 ? O ASP A 411 N PHE A 327 ? N PHE A 327 
A 3 4 O GLY A 326 ? O GLY A 326 N GLY A 264 ? N GLY A 264 
A 4 5 O TYR A 261 ? O TYR A 261 N VAL A 5   ? N VAL A 5   
A 5 6 O VAL A 4   ? O VAL A 4   N VAL A 218 ? N VAL A 218 
A 6 7 O MET A 219 ? O MET A 219 N TYR A 29  ? N TYR A 29  
A 7 8 O VAL A 30  ? O VAL A 30  N THR A 65  ? N THR A 65  
A 8 9 O SER A 66  ? O SER A 66  N LEU A 98  ? N LEU A 98  
B 1 2 O HIS A 41  ? O HIS A 41  N LEU A 52  ? N LEU A 52  
C 1 2 O SER A 270 ? O SER A 270 N GLY A 308 ? N GLY A 308 
D 1 2 O VAL A 341 ? O VAL A 341 N MET A 375 ? N MET A 375 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 435'  
AC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE HDA A 437' 
AC3 Software ? ? ? ? 28 'BINDING SITE FOR RESIDUE IMO A 440' 
AC4 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE GDP A 432' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  ASP A 13  ? ASP A 13  . ? 1_555 ? 
2  AC1 5  GLY A 40  ? GLY A 40  . ? 1_555 ? 
3  AC1 5  GDP E .   ? GDP A 432 . ? 1_555 ? 
4  AC1 5  HDA C .   ? HDA A 437 . ? 1_555 ? 
5  AC1 5  IMO D .   ? IMO A 440 . ? 1_555 ? 
6  AC2 14 ASP A 13  ? ASP A 13  . ? 1_555 ? 
7  AC2 14 ASN A 38  ? ASN A 38  . ? 1_555 ? 
8  AC2 14 GLY A 40  ? GLY A 40  . ? 1_555 ? 
9  AC2 14 THR A 129 ? THR A 129 . ? 1_555 ? 
10 AC2 14 VAL A 273 ? VAL A 273 . ? 1_555 ? 
11 AC2 14 GLY A 298 ? GLY A 298 . ? 1_555 ? 
12 AC2 14 ALA A 299 ? ALA A 299 . ? 1_555 ? 
13 AC2 14 THR A 300 ? THR A 300 . ? 1_555 ? 
14 AC2 14 THR A 301 ? THR A 301 . ? 1_555 ? 
15 AC2 14 ARG A 303 ? ARG A 303 . ? 1_555 ? 
16 AC2 14 ARG A 305 ? ARG A 305 . ? 1_555 ? 
17 AC2 14 GDP E .   ? GDP A 432 . ? 1_555 ? 
18 AC2 14 MG  B .   ? MG  A 435 . ? 1_555 ? 
19 AC2 14 IMO D .   ? IMO A 440 . ? 1_555 ? 
20 AC3 28 TRP A 11  ? TRP A 11  . ? 1_555 ? 
21 AC3 28 GLY A 12  ? GLY A 12  . ? 1_555 ? 
22 AC3 28 ASP A 13  ? ASP A 13  . ? 1_555 ? 
23 AC3 28 GLN A 16  ? GLN A 16  . ? 1_555 ? 
24 AC3 28 ASN A 38  ? ASN A 38  . ? 1_555 ? 
25 AC3 28 ALA A 39  ? ALA A 39  . ? 1_555 ? 
26 AC3 28 GLY A 40  ? GLY A 40  . ? 1_555 ? 
27 AC3 28 HIS A 41  ? HIS A 41  . ? 1_555 ? 
28 AC3 28 GLY A 127 ? GLY A 127 . ? 1_555 ? 
29 AC3 28 THR A 128 ? THR A 128 . ? 1_555 ? 
30 AC3 28 THR A 129 ? THR A 129 . ? 1_555 ? 
31 AC3 28 ARG A 143 ? ARG A 143 . ? 6_555 ? 
32 AC3 28 ALA A 223 ? ALA A 223 . ? 1_555 ? 
33 AC3 28 GLN A 224 ? GLN A 224 . ? 1_555 ? 
34 AC3 28 VAL A 238 ? VAL A 238 . ? 1_555 ? 
35 AC3 28 THR A 239 ? THR A 239 . ? 1_555 ? 
36 AC3 28 VAL A 273 ? VAL A 273 . ? 1_555 ? 
37 AC3 28 GLY A 274 ? GLY A 274 . ? 1_555 ? 
38 AC3 28 ARG A 303 ? ARG A 303 . ? 1_555 ? 
39 AC3 28 GDP E .   ? GDP A 432 . ? 1_555 ? 
40 AC3 28 MG  B .   ? MG  A 435 . ? 1_555 ? 
41 AC3 28 HDA C .   ? HDA A 437 . ? 1_555 ? 
42 AC3 28 HOH F .   ? HOH A 532 . ? 1_555 ? 
43 AC3 28 HOH F .   ? HOH A 575 . ? 1_555 ? 
44 AC3 28 HOH F .   ? HOH A 632 . ? 1_555 ? 
45 AC3 28 HOH F .   ? HOH A 647 . ? 6_555 ? 
46 AC3 28 HOH F .   ? HOH A 651 . ? 6_555 ? 
47 AC3 28 HOH F .   ? HOH A 678 . ? 1_555 ? 
48 AC4 22 ASP A 13  ? ASP A 13  . ? 1_555 ? 
49 AC4 22 GLU A 14  ? GLU A 14  . ? 1_555 ? 
50 AC4 22 GLY A 15  ? GLY A 15  . ? 1_555 ? 
51 AC4 22 GLN A 16  ? GLN A 16  . ? 1_555 ? 
52 AC4 22 GLY A 17  ? GLY A 17  . ? 1_555 ? 
53 AC4 22 LYS A 18  ? LYS A 18  . ? 1_555 ? 
54 AC4 22 GLY A 40  ? GLY A 40  . ? 1_555 ? 
55 AC4 22 HIS A 41  ? HIS A 41  . ? 1_555 ? 
56 AC4 22 THR A 42  ? THR A 42  . ? 1_555 ? 
57 AC4 22 ARG A 305 ? ARG A 305 . ? 1_555 ? 
58 AC4 22 LYS A 331 ? LYS A 331 . ? 1_555 ? 
59 AC4 22 ASP A 333 ? ASP A 333 . ? 1_555 ? 
60 AC4 22 SER A 414 ? SER A 414 . ? 1_555 ? 
61 AC4 22 THR A 415 ? THR A 415 . ? 1_555 ? 
62 AC4 22 GLY A 416 ? GLY A 416 . ? 1_555 ? 
63 AC4 22 PRO A 417 ? PRO A 417 . ? 1_555 ? 
64 AC4 22 MG  B .   ? MG  A 435 . ? 1_555 ? 
65 AC4 22 HDA C .   ? HDA A 437 . ? 1_555 ? 
66 AC4 22 IMO D .   ? IMO A 440 . ? 1_555 ? 
67 AC4 22 HOH F .   ? HOH A 503 . ? 1_555 ? 
68 AC4 22 HOH F .   ? HOH A 689 . ? 1_555 ? 
69 AC4 22 HOH F .   ? HOH A 693 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1CG1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1CG1 
_atom_sites.fract_transf_matrix[1][1]   0.012520 
_atom_sites.fract_transf_matrix[1][2]   0.007230 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014460 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006310 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? -4.885  24.515 45.306 1.00 21.21 ? 1   GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? -6.361  24.436 45.184 1.00 20.64 ? 1   GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? -6.865  25.048 43.901 1.00 20.58 ? 1   GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? -6.200  25.914 43.313 1.00 20.92 ? 1   GLY A O     1 
ATOM   5    N  N     . ASN A 1 2   ? -8.058  24.623 43.483 1.00 19.90 ? 2   ASN A N     1 
ATOM   6    C  CA    . ASN A 1 2   ? -8.699  25.104 42.243 1.00 18.07 ? 2   ASN A CA    1 
ATOM   7    C  C     . ASN A 1 2   ? -9.254  26.519 42.394 1.00 16.48 ? 2   ASN A C     1 
ATOM   8    O  O     . ASN A 1 2   ? -9.108  27.350 41.500 1.00 14.96 ? 2   ASN A O     1 
ATOM   9    C  CB    . ASN A 1 2   ? -9.855  24.176 41.855 1.00 18.90 ? 2   ASN A CB    1 
ATOM   10   C  CG    . ASN A 1 2   ? -9.383  22.854 41.269 1.00 19.68 ? 2   ASN A CG    1 
ATOM   11   O  OD1   . ASN A 1 2   ? -8.296  22.761 40.686 1.00 20.34 ? 2   ASN A OD1   1 
ATOM   12   N  ND2   . ASN A 1 2   ? -10.202 21.822 41.417 1.00 20.33 ? 2   ASN A ND2   1 
ATOM   13   N  N     . ASN A 1 3   ? -9.943  26.760 43.509 1.00 14.60 ? 3   ASN A N     1 
ATOM   14   C  CA    . ASN A 1 3   ? -10.535 28.049 43.798 1.00 13.35 ? 3   ASN A CA    1 
ATOM   15   C  C     . ASN A 1 3   ? -9.710  28.811 44.790 1.00 12.60 ? 3   ASN A C     1 
ATOM   16   O  O     . ASN A 1 3   ? -9.695  28.479 45.974 1.00 14.17 ? 3   ASN A O     1 
ATOM   17   C  CB    . ASN A 1 3   ? -11.967 27.872 44.275 1.00 13.78 ? 3   ASN A CB    1 
ATOM   18   C  CG    . ASN A 1 3   ? -12.836 27.247 43.209 1.00 16.01 ? 3   ASN A CG    1 
ATOM   19   O  OD1   . ASN A 1 3   ? -13.742 26.469 43.499 1.00 18.25 ? 3   ASN A OD1   1 
ATOM   20   N  ND2   . ASN A 1 3   ? -12.517 27.531 41.938 1.00 17.35 ? 3   ASN A ND2   1 
ATOM   21   N  N     . VAL A 1 4   ? -8.992  29.812 44.298 1.00 11.00 ? 4   VAL A N     1 
ATOM   22   C  CA    . VAL A 1 4   ? -8.126  30.621 45.124 1.00 9.33  ? 4   VAL A CA    1 
ATOM   23   C  C     . VAL A 1 4   ? -8.700  32.023 45.265 1.00 9.60  ? 4   VAL A C     1 
ATOM   24   O  O     . VAL A 1 4   ? -9.220  32.631 44.309 1.00 8.42  ? 4   VAL A O     1 
ATOM   25   C  CB    . VAL A 1 4   ? -6.680  30.703 44.530 1.00 9.43  ? 4   VAL A CB    1 
ATOM   26   C  CG1   . VAL A 1 4   ? -5.774  31.574 45.425 1.00 8.65  ? 4   VAL A CG1   1 
ATOM   27   C  CG2   . VAL A 1 4   ? -6.087  29.301 44.396 1.00 6.89  ? 4   VAL A CG2   1 
ATOM   28   N  N     . VAL A 1 5   ? -8.615  32.517 46.494 1.00 10.07 ? 5   VAL A N     1 
ATOM   29   C  CA    . VAL A 1 5   ? -9.099  33.827 46.863 1.00 8.40  ? 5   VAL A CA    1 
ATOM   30   C  C     . VAL A 1 5   ? -7.902  34.699 47.210 1.00 10.38 ? 5   VAL A C     1 
ATOM   31   O  O     . VAL A 1 5   ? -7.037  34.310 48.018 1.00 9.74  ? 5   VAL A O     1 
ATOM   32   C  CB    . VAL A 1 5   ? -10.044 33.739 48.109 1.00 7.52  ? 5   VAL A CB    1 
ATOM   33   C  CG1   . VAL A 1 5   ? -10.528 35.135 48.518 1.00 4.53  ? 5   VAL A CG1   1 
ATOM   34   C  CG2   . VAL A 1 5   ? -11.241 32.819 47.819 1.00 3.23  ? 5   VAL A CG2   1 
ATOM   35   N  N     . VAL A 1 6   ? -7.854  35.868 46.573 1.00 11.09 ? 6   VAL A N     1 
ATOM   36   C  CA    . VAL A 1 6   ? -6.834  36.876 46.826 1.00 11.65 ? 6   VAL A CA    1 
ATOM   37   C  C     . VAL A 1 6   ? -7.519  38.125 47.413 1.00 11.84 ? 6   VAL A C     1 
ATOM   38   O  O     . VAL A 1 6   ? -8.393  38.715 46.759 1.00 12.27 ? 6   VAL A O     1 
ATOM   39   C  CB    . VAL A 1 6   ? -6.141  37.263 45.535 1.00 12.04 ? 6   VAL A CB    1 
ATOM   40   C  CG1   . VAL A 1 6   ? -5.273  38.507 45.759 1.00 10.62 ? 6   VAL A CG1   1 
ATOM   41   C  CG2   . VAL A 1 6   ? -5.343  36.064 45.020 1.00 12.14 ? 6   VAL A CG2   1 
ATOM   42   N  N     . LEU A 1 7   ? -7.161  38.500 48.642 1.00 11.34 ? 7   LEU A N     1 
ATOM   43   C  CA    . LEU A 1 7   ? -7.752  39.687 49.290 1.00 11.42 ? 7   LEU A CA    1 
ATOM   44   C  C     . LEU A 1 7   ? -6.752  40.513 50.135 1.00 11.00 ? 7   LEU A C     1 
ATOM   45   O  O     . LEU A 1 7   ? -5.679  40.014 50.492 1.00 9.62  ? 7   LEU A O     1 
ATOM   46   C  CB    . LEU A 1 7   ? -9.030  39.333 50.104 1.00 10.69 ? 7   LEU A CB    1 
ATOM   47   C  CG    . LEU A 1 7   ? -9.025  38.323 51.250 1.00 10.01 ? 7   LEU A CG    1 
ATOM   48   C  CD1   . LEU A 1 7   ? -8.904  37.004 50.654 1.00 13.01 ? 7   LEU A CD1   1 
ATOM   49   C  CD2   . LEU A 1 7   ? -7.884  38.497 52.244 1.00 11.87 ? 7   LEU A CD2   1 
ATOM   50   N  N     . GLY A 1 8   ? -7.086  41.786 50.395 1.00 11.09 ? 8   GLY A N     1 
ATOM   51   C  CA    . GLY A 1 8   ? -6.219  42.656 51.176 1.00 9.81  ? 8   GLY A CA    1 
ATOM   52   C  C     . GLY A 1 8   ? -6.442  42.435 52.651 1.00 9.86  ? 8   GLY A C     1 
ATOM   53   O  O     . GLY A 1 8   ? -7.557  42.612 53.149 1.00 11.11 ? 8   GLY A O     1 
ATOM   54   N  N     . THR A 1 9   ? -5.399  42.053 53.371 1.00 9.70  ? 9   THR A N     1 
ATOM   55   C  CA    . THR A 1 9   ? -5.530  41.791 54.803 1.00 9.99  ? 9   THR A CA    1 
ATOM   56   C  C     . THR A 1 9   ? -5.513  43.030 55.687 1.00 10.69 ? 9   THR A C     1 
ATOM   57   O  O     . THR A 1 9   ? -5.605  42.902 56.912 1.00 11.51 ? 9   THR A O     1 
ATOM   58   C  CB    . THR A 1 9   ? -4.396  40.922 55.328 1.00 9.43  ? 9   THR A CB    1 
ATOM   59   O  OG1   . THR A 1 9   ? -3.152  41.610 55.129 1.00 9.06  ? 9   THR A OG1   1 
ATOM   60   C  CG2   . THR A 1 9   ? -4.385  39.572 54.644 1.00 8.87  ? 9   THR A CG2   1 
ATOM   61   N  N     . GLN A 1 10  ? -5.427  44.223 55.106 1.00 10.46 ? 10  GLN A N     1 
ATOM   62   C  CA    . GLN A 1 10  ? -5.339  45.412 55.934 1.00 9.77  ? 10  GLN A CA    1 
ATOM   63   C  C     . GLN A 1 10  ? -6.458  46.381 55.703 1.00 10.01 ? 10  GLN A C     1 
ATOM   64   O  O     . GLN A 1 10  ? -7.620  46.071 56.015 1.00 10.72 ? 10  GLN A O     1 
ATOM   65   C  CB    . GLN A 1 10  ? -3.937  46.007 55.763 1.00 9.86  ? 10  GLN A CB    1 
ATOM   66   C  CG    . GLN A 1 10  ? -2.891  44.966 56.207 1.00 10.60 ? 10  GLN A CG    1 
ATOM   67   C  CD    . GLN A 1 10  ? -1.547  45.139 55.591 1.00 11.54 ? 10  GLN A CD    1 
ATOM   68   O  OE1   . GLN A 1 10  ? -1.435  45.221 54.377 1.00 14.54 ? 10  GLN A OE1   1 
ATOM   69   N  NE2   . GLN A 1 10  ? -0.498  45.160 56.414 1.00 11.84 ? 10  GLN A NE2   1 
ATOM   70   N  N     . TRP A 1 11  ? -6.139  47.551 55.179 1.00 10.07 ? 11  TRP A N     1 
ATOM   71   C  CA    . TRP A 1 11  ? -7.146  48.549 54.893 1.00 9.64  ? 11  TRP A CA    1 
ATOM   72   C  C     . TRP A 1 11  ? -7.046  48.903 53.394 1.00 10.71 ? 11  TRP A C     1 
ATOM   73   O  O     . TRP A 1 11  ? -7.030  50.098 53.015 1.00 8.93  ? 11  TRP A O     1 
ATOM   74   C  CB    . TRP A 1 11  ? -6.913  49.808 55.722 1.00 7.63  ? 11  TRP A CB    1 
ATOM   75   C  CG    . TRP A 1 11  ? -6.889  49.617 57.176 1.00 7.82  ? 11  TRP A CG    1 
ATOM   76   C  CD1   . TRP A 1 11  ? -7.935  49.808 58.058 1.00 7.76  ? 11  TRP A CD1   1 
ATOM   77   C  CD2   . TRP A 1 11  ? -5.730  49.417 57.978 1.00 7.55  ? 11  TRP A CD2   1 
ATOM   78   N  NE1   . TRP A 1 11  ? -7.483  49.773 59.352 1.00 5.94  ? 11  TRP A NE1   1 
ATOM   79   C  CE2   . TRP A 1 11  ? -6.131  49.542 59.335 1.00 7.10  ? 11  TRP A CE2   1 
ATOM   80   C  CE3   . TRP A 1 11  ? -4.380  49.165 57.682 1.00 8.16  ? 11  TRP A CE3   1 
ATOM   81   C  CZ2   . TRP A 1 11  ? -5.233  49.432 60.394 1.00 8.67  ? 11  TRP A CZ2   1 
ATOM   82   C  CZ3   . TRP A 1 11  ? -3.483  49.047 58.723 1.00 10.11 ? 11  TRP A CZ3   1 
ATOM   83   C  CH2   . TRP A 1 11  ? -3.918  49.187 60.083 1.00 11.49 ? 11  TRP A CH2   1 
ATOM   84   N  N     . GLY A 1 12  ? -6.940  47.871 52.559 1.00 10.86 ? 12  GLY A N     1 
ATOM   85   C  CA    . GLY A 1 12  ? -6.852  48.092 51.126 1.00 13.01 ? 12  GLY A CA    1 
ATOM   86   C  C     . GLY A 1 12  ? -5.444  48.440 50.646 1.00 13.61 ? 12  GLY A C     1 
ATOM   87   O  O     . GLY A 1 12  ? -4.492  48.486 51.434 1.00 13.12 ? 12  GLY A O     1 
ATOM   88   N  N     . ASP A 1 13  ? -5.310  48.628 49.335 1.00 14.11 ? 13  ASP A N     1 
ATOM   89   C  CA    . ASP A 1 13  ? -4.049  49.028 48.709 1.00 14.47 ? 13  ASP A CA    1 
ATOM   90   C  C     . ASP A 1 13  ? -2.800  48.253 49.062 1.00 14.35 ? 13  ASP A C     1 
ATOM   91   O  O     . ASP A 1 13  ? -1.713  48.788 48.945 1.00 15.39 ? 13  ASP A O     1 
ATOM   92   C  CB    . ASP A 1 13  ? -3.820  50.519 48.975 1.00 15.58 ? 13  ASP A CB    1 
ATOM   93   C  CG    . ASP A 1 13  ? -5.022  51.382 48.546 1.00 17.47 ? 13  ASP A CG    1 
ATOM   94   O  OD1   . ASP A 1 13  ? -5.691  50.989 47.570 1.00 18.74 ? 13  ASP A OD1   1 
ATOM   95   O  OD2   . ASP A 1 13  ? -5.325  52.430 49.181 1.00 17.70 ? 13  ASP A OD2   1 
ATOM   96   N  N     . GLU A 1 14  ? -2.945  46.980 49.430 1.00 15.12 ? 14  GLU A N     1 
ATOM   97   C  CA    . GLU A 1 14  ? -1.831  46.101 49.823 1.00 13.84 ? 14  GLU A CA    1 
ATOM   98   C  C     . GLU A 1 14  ? -1.074  45.605 48.612 1.00 14.45 ? 14  GLU A C     1 
ATOM   99   O  O     . GLU A 1 14  ? 0.058   45.121 48.753 1.00 13.60 ? 14  GLU A O     1 
ATOM   100  C  CB    . GLU A 1 14  ? -2.342  44.859 50.588 1.00 14.15 ? 14  GLU A CB    1 
ATOM   101  C  CG    . GLU A 1 14  ? -3.306  45.114 51.760 1.00 14.22 ? 14  GLU A CG    1 
ATOM   102  C  CD    . GLU A 1 14  ? -4.754  45.449 51.325 1.00 14.89 ? 14  GLU A CD    1 
ATOM   103  O  OE1   . GLU A 1 14  ? -5.029  45.570 50.116 1.00 15.85 ? 14  GLU A OE1   1 
ATOM   104  O  OE2   . GLU A 1 14  ? -5.633  45.601 52.200 1.00 15.79 ? 14  GLU A OE2   1 
ATOM   105  N  N     . GLY A 1 15  ? -1.751  45.633 47.450 1.00 14.87 ? 15  GLY A N     1 
ATOM   106  C  CA    . GLY A 1 15  ? -1.181  45.191 46.176 1.00 14.26 ? 15  GLY A CA    1 
ATOM   107  C  C     . GLY A 1 15  ? -1.873  43.981 45.554 1.00 14.26 ? 15  GLY A C     1 
ATOM   108  O  O     . GLY A 1 15  ? -1.227  43.124 44.938 1.00 14.17 ? 15  GLY A O     1 
ATOM   109  N  N     . GLN A 1 16  ? -3.195  43.921 45.675 1.00 14.17 ? 16  GLN A N     1 
ATOM   110  C  CA    . GLN A 1 16  ? -3.955  42.802 45.136 1.00 14.75 ? 16  GLN A CA    1 
ATOM   111  C  C     . GLN A 1 16  ? -3.890  42.723 43.590 1.00 15.14 ? 16  GLN A C     1 
ATOM   112  O  O     . GLN A 1 16  ? -3.704  41.623 43.028 1.00 15.55 ? 16  GLN A O     1 
ATOM   113  C  CB    . GLN A 1 16  ? -5.416  42.844 45.630 1.00 15.75 ? 16  GLN A CB    1 
ATOM   114  C  CG    . GLN A 1 16  ? -5.608  42.991 47.155 1.00 17.84 ? 16  GLN A CG    1 
ATOM   115  C  CD    . GLN A 1 16  ? -6.943  43.674 47.517 1.00 21.15 ? 16  GLN A CD    1 
ATOM   116  O  OE1   . GLN A 1 16  ? -8.005  43.037 47.464 1.00 23.50 ? 16  GLN A OE1   1 
ATOM   117  N  NE2   . GLN A 1 16  ? -6.896  44.982 47.870 1.00 20.68 ? 16  GLN A NE2   1 
ATOM   118  N  N     . GLY A 1 17  ? -3.991  43.876 42.916 1.00 14.39 ? 17  GLY A N     1 
ATOM   119  C  CA    . GLY A 1 17  ? -3.940  43.911 41.455 1.00 14.85 ? 17  GLY A CA    1 
ATOM   120  C  C     . GLY A 1 17  ? -2.745  43.156 40.881 1.00 14.83 ? 17  GLY A C     1 
ATOM   121  O  O     . GLY A 1 17  ? -2.881  42.169 40.112 1.00 14.43 ? 17  GLY A O     1 
ATOM   122  N  N     . LYS A 1 18  ? -1.560  43.596 41.285 1.00 14.03 ? 18  LYS A N     1 
ATOM   123  C  CA    . LYS A 1 18  ? -0.361  42.942 40.842 1.00 13.42 ? 18  LYS A CA    1 
ATOM   124  C  C     . LYS A 1 18  ? -0.498  41.431 41.105 1.00 14.03 ? 18  LYS A C     1 
ATOM   125  O  O     . LYS A 1 18  ? -0.323  40.595 40.191 1.00 14.89 ? 18  LYS A O     1 
ATOM   126  C  CB    . LYS A 1 18  ? 0.883   43.509 41.550 1.00 11.40 ? 18  LYS A CB    1 
ATOM   127  C  CG    . LYS A 1 18  ? 2.092   42.616 41.270 1.00 11.72 ? 18  LYS A CG    1 
ATOM   128  C  CD    . LYS A 1 18  ? 3.424   43.036 41.893 1.00 10.07 ? 18  LYS A CD    1 
ATOM   129  C  CE    . LYS A 1 18  ? 4.449   41.917 41.631 1.00 6.72  ? 18  LYS A CE    1 
ATOM   130  N  NZ    . LYS A 1 18  ? 5.815   42.207 42.117 1.00 6.18  ? 18  LYS A NZ    1 
ATOM   131  N  N     . ILE A 1 19  ? -0.878  41.058 42.319 1.00 13.61 ? 19  ILE A N     1 
ATOM   132  C  CA    . ILE A 1 19  ? -0.952  39.628 42.602 1.00 13.73 ? 19  ILE A CA    1 
ATOM   133  C  C     . ILE A 1 19  ? -1.999  38.899 41.777 1.00 14.27 ? 19  ILE A C     1 
ATOM   134  O  O     . ILE A 1 19  ? -1.794  37.726 41.413 1.00 14.44 ? 19  ILE A O     1 
ATOM   135  C  CB    . ILE A 1 19  ? -1.035  39.288 44.163 1.00 13.08 ? 19  ILE A CB    1 
ATOM   136  C  CG1   . ILE A 1 19  ? 0.216   39.823 44.890 1.00 10.29 ? 19  ILE A CG1   1 
ATOM   137  C  CG2   . ILE A 1 19  ? -1.073  37.775 44.392 1.00 9.91  ? 19  ILE A CG2   1 
ATOM   138  C  CD1   . ILE A 1 19  ? 1.500   39.289 44.320 1.00 8.68  ? 19  ILE A CD1   1 
ATOM   139  N  N     . VAL A 1 20  ? -3.110  39.557 41.450 1.00 14.51 ? 20  VAL A N     1 
ATOM   140  C  CA    . VAL A 1 20  ? -4.090  38.837 40.639 1.00 14.18 ? 20  VAL A CA    1 
ATOM   141  C  C     . VAL A 1 20  ? -3.572  38.666 39.224 1.00 15.66 ? 20  VAL A C     1 
ATOM   142  O  O     . VAL A 1 20  ? -3.605  37.547 38.680 1.00 15.41 ? 20  VAL A O     1 
ATOM   143  C  CB    . VAL A 1 20  ? -5.472  39.472 40.612 1.00 12.84 ? 20  VAL A CB    1 
ATOM   144  C  CG1   . VAL A 1 20  ? -6.384  38.612 39.759 1.00 10.69 ? 20  VAL A CG1   1 
ATOM   145  C  CG2   . VAL A 1 20  ? -6.020  39.577 42.040 1.00 12.75 ? 20  VAL A CG2   1 
ATOM   146  N  N     . ASP A 1 21  ? -3.043  39.745 38.635 1.00 16.56 ? 21  ASP A N     1 
ATOM   147  C  CA    . ASP A 1 21  ? -2.515  39.640 37.279 1.00 17.36 ? 21  ASP A CA    1 
ATOM   148  C  C     . ASP A 1 21  ? -1.449  38.546 37.160 1.00 17.88 ? 21  ASP A C     1 
ATOM   149  O  O     . ASP A 1 21  ? -1.382  37.830 36.168 1.00 18.46 ? 21  ASP A O     1 
ATOM   150  C  CB    . ASP A 1 21  ? -1.913  40.943 36.812 1.00 18.66 ? 21  ASP A CB    1 
ATOM   151  C  CG    . ASP A 1 21  ? -1.108  40.764 35.537 1.00 20.05 ? 21  ASP A CG    1 
ATOM   152  O  OD1   . ASP A 1 21  ? -1.726  40.651 34.448 1.00 20.02 ? 21  ASP A OD1   1 
ATOM   153  O  OD2   . ASP A 1 21  ? 0.141   40.694 35.628 1.00 19.32 ? 21  ASP A OD2   1 
ATOM   154  N  N     . LEU A 1 22  ? -0.615  38.433 38.178 1.00 17.70 ? 22  LEU A N     1 
ATOM   155  C  CA    . LEU A 1 22  ? 0.426   37.442 38.201 1.00 17.71 ? 22  LEU A CA    1 
ATOM   156  C  C     . LEU A 1 22  ? -0.100  36.020 38.282 1.00 18.75 ? 22  LEU A C     1 
ATOM   157  O  O     . LEU A 1 22  ? 0.242   35.195 37.460 1.00 19.72 ? 22  LEU A O     1 
ATOM   158  C  CB    . LEU A 1 22  ? 1.349   37.712 39.396 1.00 17.84 ? 22  LEU A CB    1 
ATOM   159  C  CG    . LEU A 1 22  ? 2.537   36.808 39.749 1.00 17.04 ? 22  LEU A CG    1 
ATOM   160  C  CD1   . LEU A 1 22  ? 3.646   36.922 38.717 1.00 16.47 ? 22  LEU A CD1   1 
ATOM   161  C  CD2   . LEU A 1 22  ? 3.075   37.243 41.091 1.00 17.53 ? 22  LEU A CD2   1 
ATOM   162  N  N     . LEU A 1 23  ? -0.947  35.707 39.255 1.00 19.74 ? 23  LEU A N     1 
ATOM   163  C  CA    . LEU A 1 23  ? -1.392  34.324 39.394 1.00 19.79 ? 23  LEU A CA    1 
ATOM   164  C  C     . LEU A 1 23  ? -2.412  33.836 38.398 1.00 20.55 ? 23  LEU A C     1 
ATOM   165  O  O     . LEU A 1 23  ? -2.623  32.634 38.261 1.00 19.90 ? 23  LEU A O     1 
ATOM   166  C  CB    . LEU A 1 23  ? -1.874  34.043 40.818 1.00 19.66 ? 23  LEU A CB    1 
ATOM   167  C  CG    . LEU A 1 23  ? -0.833  34.241 41.930 1.00 20.63 ? 23  LEU A CG    1 
ATOM   168  C  CD1   . LEU A 1 23  ? -1.498  34.033 43.315 1.00 20.12 ? 23  LEU A CD1   1 
ATOM   169  C  CD2   . LEU A 1 23  ? 0.357   33.299 41.730 1.00 19.01 ? 23  LEU A CD2   1 
ATOM   170  N  N     . THR A 1 24  ? -3.057  34.765 37.711 1.00 21.85 ? 24  THR A N     1 
ATOM   171  C  CA    . THR A 1 24  ? -4.080  34.409 36.744 1.00 22.73 ? 24  THR A CA    1 
ATOM   172  C  C     . THR A 1 24  ? -3.564  33.677 35.516 1.00 23.68 ? 24  THR A C     1 
ATOM   173  O  O     . THR A 1 24  ? -4.330  33.073 34.761 1.00 23.86 ? 24  THR A O     1 
ATOM   174  C  CB    . THR A 1 24  ? -4.897  35.619 36.372 1.00 23.20 ? 24  THR A CB    1 
ATOM   175  O  OG1   . THR A 1 24  ? -4.020  36.747 36.152 1.00 23.50 ? 24  THR A OG1   1 
ATOM   176  C  CG2   . THR A 1 24  ? -5.886  35.913 37.528 1.00 21.85 ? 24  THR A CG2   1 
ATOM   177  N  N     . GLU A 1 25  ? -2.244  33.655 35.384 1.00 23.99 ? 25  GLU A N     1 
ATOM   178  C  CA    . GLU A 1 25  ? -1.593  32.977 34.292 1.00 23.50 ? 25  GLU A CA    1 
ATOM   179  C  C     . GLU A 1 25  ? -2.057  31.543 34.107 1.00 22.78 ? 25  GLU A C     1 
ATOM   180  O  O     . GLU A 1 25  ? -2.021  31.014 32.999 1.00 24.23 ? 25  GLU A O     1 
ATOM   181  C  CB    . GLU A 1 25  ? -0.102  32.998 34.519 1.00 24.93 ? 25  GLU A CB    1 
ATOM   182  C  CG    . GLU A 1 25  ? 0.654   32.261 33.473 1.00 27.72 ? 25  GLU A CG    1 
ATOM   183  C  CD    . GLU A 1 25  ? 2.119   32.462 33.628 1.00 29.81 ? 25  GLU A CD    1 
ATOM   184  O  OE1   . GLU A 1 25  ? 2.837   31.442 33.643 1.00 30.05 ? 25  GLU A OE1   1 
ATOM   185  O  OE2   . GLU A 1 25  ? 2.537   33.649 33.755 1.00 31.38 ? 25  GLU A OE2   1 
ATOM   186  N  N     . ARG A 1 26  ? -2.476  30.888 35.170 1.00 21.61 ? 26  ARG A N     1 
ATOM   187  C  CA    . ARG A 1 26  ? -2.937  29.515 35.025 1.00 21.28 ? 26  ARG A CA    1 
ATOM   188  C  C     . ARG A 1 26  ? -4.468  29.418 35.197 1.00 21.39 ? 26  ARG A C     1 
ATOM   189  O  O     . ARG A 1 26  ? -5.049  28.348 35.032 1.00 22.06 ? 26  ARG A O     1 
ATOM   190  C  CB    . ARG A 1 26  ? -2.251  28.636 36.078 1.00 21.19 ? 26  ARG A CB    1 
ATOM   191  C  CG    . ARG A 1 26  ? -0.708  28.603 36.015 1.00 21.04 ? 26  ARG A CG    1 
ATOM   192  C  CD    . ARG A 1 26  ? -0.056  28.056 37.327 1.00 18.99 ? 26  ARG A CD    1 
ATOM   193  N  NE    . ARG A 1 26  ? -0.390  26.657 37.554 1.00 15.73 ? 26  ARG A NE    1 
ATOM   194  C  CZ    . ARG A 1 26  ? -0.146  26.051 38.706 1.00 16.18 ? 26  ARG A CZ    1 
ATOM   195  N  NH1   . ARG A 1 26  ? 0.414   26.707 39.719 1.00 16.14 ? 26  ARG A NH1   1 
ATOM   196  N  NH2   . ARG A 1 26  ? -0.473  24.762 38.840 1.00 16.79 ? 26  ARG A NH2   1 
ATOM   197  N  N     . ALA A 1 27  ? -5.125  30.538 35.477 1.00 20.69 ? 27  ALA A N     1 
ATOM   198  C  CA    . ALA A 1 27  ? -6.563  30.534 35.724 1.00 20.03 ? 27  ALA A CA    1 
ATOM   199  C  C     . ALA A 1 27  ? -7.482  30.629 34.502 1.00 19.76 ? 27  ALA A C     1 
ATOM   200  O  O     . ALA A 1 27  ? -7.126  31.254 33.496 1.00 20.36 ? 27  ALA A O     1 
ATOM   201  C  CB    . ALA A 1 27  ? -6.907  31.661 36.701 1.00 19.76 ? 27  ALA A CB    1 
ATOM   202  N  N     . LYS A 1 28  ? -8.670  30.023 34.614 1.00 18.14 ? 28  LYS A N     1 
ATOM   203  C  CA    . LYS A 1 28  ? -9.681  30.098 33.572 1.00 17.17 ? 28  LYS A CA    1 
ATOM   204  C  C     . LYS A 1 28  ? -10.473 31.374 33.856 1.00 16.37 ? 28  LYS A C     1 
ATOM   205  O  O     . LYS A 1 28  ? -10.721 32.164 32.958 1.00 16.03 ? 28  LYS A O     1 
ATOM   206  C  CB    . LYS A 1 28  ? -10.654 28.917 33.649 1.00 19.18 ? 28  LYS A CB    1 
ATOM   207  C  CG    . LYS A 1 28  ? -10.045 27.558 33.380 1.00 22.85 ? 28  LYS A CG    1 
ATOM   208  C  CD    . LYS A 1 28  ? -9.528  27.440 31.929 1.00 24.85 ? 28  LYS A CD    1 
ATOM   209  C  CE    . LYS A 1 28  ? -8.764  26.137 31.689 1.00 24.21 ? 28  LYS A CE    1 
ATOM   210  N  NZ    . LYS A 1 28  ? -9.636  24.955 31.896 1.00 23.92 ? 28  LYS A NZ    1 
ATOM   211  N  N     . TYR A 1 29  ? -10.847 31.589 35.122 1.00 15.66 ? 29  TYR A N     1 
ATOM   212  C  CA    . TYR A 1 29  ? -11.650 32.763 35.501 1.00 14.59 ? 29  TYR A CA    1 
ATOM   213  C  C     . TYR A 1 29  ? -11.034 33.613 36.586 1.00 13.59 ? 29  TYR A C     1 
ATOM   214  O  O     . TYR A 1 29  ? -10.202 33.135 37.359 1.00 13.32 ? 29  TYR A O     1 
ATOM   215  C  CB    . TYR A 1 29  ? -13.030 32.328 36.028 1.00 13.97 ? 29  TYR A CB    1 
ATOM   216  C  CG    . TYR A 1 29  ? -13.824 31.437 35.103 1.00 13.83 ? 29  TYR A CG    1 
ATOM   217  C  CD1   . TYR A 1 29  ? -14.614 31.980 34.096 1.00 14.32 ? 29  TYR A CD1   1 
ATOM   218  C  CD2   . TYR A 1 29  ? -13.752 30.051 35.207 1.00 13.37 ? 29  TYR A CD2   1 
ATOM   219  C  CE1   . TYR A 1 29  ? -15.290 31.162 33.220 1.00 14.47 ? 29  TYR A CE1   1 
ATOM   220  C  CE2   . TYR A 1 29  ? -14.431 29.231 34.339 1.00 11.89 ? 29  TYR A CE2   1 
ATOM   221  C  CZ    . TYR A 1 29  ? -15.186 29.786 33.351 1.00 12.79 ? 29  TYR A CZ    1 
ATOM   222  O  OH    . TYR A 1 29  ? -15.791 28.970 32.428 1.00 14.53 ? 29  TYR A OH    1 
ATOM   223  N  N     . VAL A 1 30  ? -11.522 34.853 36.664 1.00 12.60 ? 30  VAL A N     1 
ATOM   224  C  CA    . VAL A 1 30  ? -11.138 35.845 37.679 1.00 12.65 ? 30  VAL A CA    1 
ATOM   225  C  C     . VAL A 1 30  ? -12.452 36.510 38.038 1.00 11.80 ? 30  VAL A C     1 
ATOM   226  O  O     . VAL A 1 30  ? -13.147 37.027 37.162 1.00 12.91 ? 30  VAL A O     1 
ATOM   227  C  CB    . VAL A 1 30  ? -10.165 36.957 37.152 1.00 13.24 ? 30  VAL A CB    1 
ATOM   228  C  CG1   . VAL A 1 30  ? -9.923  38.008 38.192 1.00 12.23 ? 30  VAL A CG1   1 
ATOM   229  C  CG2   . VAL A 1 30  ? -8.848  36.361 36.875 1.00 15.99 ? 30  VAL A CG2   1 
ATOM   230  N  N     . VAL A 1 31  ? -12.788 36.517 39.319 1.00 10.78 ? 31  VAL A N     1 
ATOM   231  C  CA    . VAL A 1 31  ? -14.048 37.105 39.762 1.00 9.44  ? 31  VAL A CA    1 
ATOM   232  C  C     . VAL A 1 31  ? -13.905 38.165 40.869 1.00 8.94  ? 31  VAL A C     1 
ATOM   233  O  O     . VAL A 1 31  ? -13.251 37.910 41.879 1.00 9.06  ? 31  VAL A O     1 
ATOM   234  C  CB    . VAL A 1 31  ? -15.012 35.985 40.305 1.00 8.96  ? 31  VAL A CB    1 
ATOM   235  C  CG1   . VAL A 1 31  ? -16.433 36.527 40.488 1.00 8.57  ? 31  VAL A CG1   1 
ATOM   236  C  CG2   . VAL A 1 31  ? -14.977 34.712 39.402 1.00 7.34  ? 31  VAL A CG2   1 
ATOM   237  N  N     . ARG A 1 32  ? -14.472 39.352 40.627 1.00 8.56  ? 32  ARG A N     1 
ATOM   238  C  CA    . ARG A 1 32  ? -14.556 40.443 41.595 1.00 7.94  ? 32  ARG A CA    1 
ATOM   239  C  C     . ARG A 1 32  ? -15.883 40.080 42.256 1.00 8.68  ? 32  ARG A C     1 
ATOM   240  O  O     . ARG A 1 32  ? -16.848 39.695 41.567 1.00 8.15  ? 32  ARG A O     1 
ATOM   241  C  CB    . ARG A 1 32  ? -14.733 41.813 40.940 1.00 7.54  ? 32  ARG A CB    1 
ATOM   242  C  CG    . ARG A 1 32  ? -13.456 42.512 40.476 1.00 9.16  ? 32  ARG A CG    1 
ATOM   243  C  CD    . ARG A 1 32  ? -12.690 43.145 41.595 1.00 8.68  ? 32  ARG A CD    1 
ATOM   244  N  NE    . ARG A 1 32  ? -13.570 44.023 42.352 1.00 11.80 ? 32  ARG A NE    1 
ATOM   245  C  CZ    . ARG A 1 32  ? -13.717 45.304 42.020 1.00 12.30 ? 32  ARG A CZ    1 
ATOM   246  N  NH1   . ARG A 1 32  ? -13.047 45.787 40.970 1.00 12.19 ? 32  ARG A NH1   1 
ATOM   247  N  NH2   . ARG A 1 32  ? -14.474 46.105 42.784 1.00 9.35  ? 32  ARG A NH2   1 
ATOM   248  N  N     . TYR A 1 33  ? -15.938 40.183 43.582 1.00 9.64  ? 33  TYR A N     1 
ATOM   249  C  CA    . TYR A 1 33  ? -17.137 39.812 44.306 1.00 9.33  ? 33  TYR A CA    1 
ATOM   250  C  C     . TYR A 1 33  ? -17.684 40.866 45.210 1.00 8.71  ? 33  TYR A C     1 
ATOM   251  O  O     . TYR A 1 33  ? -18.730 40.666 45.809 1.00 10.26 ? 33  TYR A O     1 
ATOM   252  C  CB    . TYR A 1 33  ? -16.899 38.533 45.092 1.00 9.72  ? 33  TYR A CB    1 
ATOM   253  C  CG    . TYR A 1 33  ? -15.696 38.630 46.007 1.00 10.71 ? 33  TYR A CG    1 
ATOM   254  C  CD1   . TYR A 1 33  ? -15.837 39.076 47.336 1.00 11.02 ? 33  TYR A CD1   1 
ATOM   255  C  CD2   . TYR A 1 33  ? -14.430 38.258 45.558 1.00 9.30  ? 33  TYR A CD2   1 
ATOM   256  C  CE1   . TYR A 1 33  ? -14.742 39.146 48.190 1.00 11.85 ? 33  TYR A CE1   1 
ATOM   257  C  CE2   . TYR A 1 33  ? -13.345 38.311 46.392 1.00 11.34 ? 33  TYR A CE2   1 
ATOM   258  C  CZ    . TYR A 1 33  ? -13.503 38.752 47.717 1.00 12.27 ? 33  TYR A CZ    1 
ATOM   259  O  OH    . TYR A 1 33  ? -12.444 38.720 48.580 1.00 13.13 ? 33  TYR A OH    1 
ATOM   260  N  N     . GLN A 1 34  ? -16.996 41.986 45.329 1.00 9.24  ? 34  GLN A N     1 
ATOM   261  C  CA    . GLN A 1 34  ? -17.494 43.084 46.178 1.00 10.27 ? 34  GLN A CA    1 
ATOM   262  C  C     . GLN A 1 34  ? -16.842 44.397 45.799 1.00 10.04 ? 34  GLN A C     1 
ATOM   263  O  O     . GLN A 1 34  ? -15.823 44.426 45.067 1.00 9.98  ? 34  GLN A O     1 
ATOM   264  C  CB    . GLN A 1 34  ? -17.346 42.813 47.699 1.00 11.03 ? 34  GLN A CB    1 
ATOM   265  C  CG    . GLN A 1 34  ? -16.012 42.186 48.179 1.00 11.08 ? 34  GLN A CG    1 
ATOM   266  C  CD    . GLN A 1 34  ? -14.824 43.146 48.163 1.00 12.72 ? 34  GLN A CD    1 
ATOM   267  O  OE1   . GLN A 1 34  ? -14.920 44.325 48.557 1.00 14.94 ? 34  GLN A OE1   1 
ATOM   268  N  NE2   . GLN A 1 34  ? -13.700 42.648 47.748 1.00 10.78 ? 34  GLN A NE2   1 
ATOM   269  N  N     . GLY A 1 35  ? -17.476 45.470 46.255 1.00 9.11  ? 35  GLY A N     1 
ATOM   270  C  CA    . GLY A 1 35  ? -16.981 46.791 45.990 1.00 8.19  ? 35  GLY A CA    1 
ATOM   271  C  C     . GLY A 1 35  ? -17.488 47.272 44.652 1.00 8.93  ? 35  GLY A C     1 
ATOM   272  O  O     . GLY A 1 35  ? -18.454 46.711 44.066 1.00 7.87  ? 35  GLY A O     1 
ATOM   273  N  N     . GLY A 1 36  ? -16.869 48.357 44.194 1.00 8.78  ? 36  GLY A N     1 
ATOM   274  C  CA    . GLY A 1 36  ? -17.225 48.936 42.924 1.00 9.65  ? 36  GLY A CA    1 
ATOM   275  C  C     . GLY A 1 36  ? -15.976 49.573 42.366 1.00 10.63 ? 36  GLY A C     1 
ATOM   276  O  O     . GLY A 1 36  ? -14.904 48.978 42.426 1.00 11.23 ? 36  GLY A O     1 
ATOM   277  N  N     . HIS A 1 37  ? -16.099 50.800 41.868 1.00 11.39 ? 37  HIS A N     1 
ATOM   278  C  CA    . HIS A 1 37  ? -14.951 51.484 41.289 1.00 11.11 ? 37  HIS A CA    1 
ATOM   279  C  C     . HIS A 1 37  ? -14.218 52.373 42.267 1.00 11.09 ? 37  HIS A C     1 
ATOM   280  O  O     . HIS A 1 37  ? -13.529 53.328 41.857 1.00 8.58  ? 37  HIS A O     1 
ATOM   281  C  CB    . HIS A 1 37  ? -15.313 52.235 39.999 1.00 9.77  ? 37  HIS A CB    1 
ATOM   282  C  CG    . HIS A 1 37  ? -16.411 53.231 40.157 1.00 7.81  ? 37  HIS A CG    1 
ATOM   283  N  ND1   . HIS A 1 37  ? -17.688 52.913 40.571 1.00 5.88  ? 37  HIS A ND1   1 
ATOM   284  C  CD2   . HIS A 1 37  ? -16.450 54.539 39.801 1.00 4.95  ? 37  HIS A CD2   1 
ATOM   285  C  CE1   . HIS A 1 37  ? -18.452 54.005 40.421 1.00 4.46  ? 37  HIS A CE1   1 
ATOM   286  N  NE2   . HIS A 1 37  ? -17.739 55.012 39.962 1.00 5.00  ? 37  HIS A NE2   1 
ATOM   287  N  N     . ASN A 1 38  ? -14.401 52.056 43.558 1.00 11.71 ? 38  ASN A N     1 
ATOM   288  C  CA    . ASN A 1 38  ? -13.683 52.742 44.645 1.00 12.27 ? 38  ASN A CA    1 
ATOM   289  C  C     . ASN A 1 38  ? -12.265 52.119 44.683 1.00 12.39 ? 38  ASN A C     1 
ATOM   290  O  O     . ASN A 1 38  ? -11.279 52.767 44.992 1.00 12.66 ? 38  ASN A O     1 
ATOM   291  C  CB    . ASN A 1 38  ? -14.420 52.587 45.995 1.00 12.53 ? 38  ASN A CB    1 
ATOM   292  C  CG    . ASN A 1 38  ? -15.024 51.157 46.227 1.00 13.14 ? 38  ASN A CG    1 
ATOM   293  O  OD1   . ASN A 1 38  ? -15.051 50.301 45.331 1.00 13.69 ? 38  ASN A OD1   1 
ATOM   294  N  ND2   . ASN A 1 38  ? -15.534 50.932 47.429 1.00 11.45 ? 38  ASN A ND2   1 
ATOM   295  N  N     . ALA A 1 39  ? -12.164 50.856 44.312 1.00 13.64 ? 39  ALA A N     1 
ATOM   296  C  CA    . ALA A 1 39  ? -10.882 50.179 44.289 1.00 15.91 ? 39  ALA A CA    1 
ATOM   297  C  C     . ALA A 1 39  ? -10.029 50.840 43.214 1.00 17.26 ? 39  ALA A C     1 
ATOM   298  O  O     . ALA A 1 39  ? -10.545 51.586 42.392 1.00 17.95 ? 39  ALA A O     1 
ATOM   299  C  CB    . ALA A 1 39  ? -11.087 48.698 43.945 1.00 15.34 ? 39  ALA A CB    1 
ATOM   300  N  N     . GLY A 1 40  ? -8.728  50.563 43.229 1.00 18.62 ? 40  GLY A N     1 
ATOM   301  C  CA    . GLY A 1 40  ? -7.808  51.105 42.234 1.00 19.51 ? 40  GLY A CA    1 
ATOM   302  C  C     . GLY A 1 40  ? -6.606  50.183 42.304 1.00 19.83 ? 40  GLY A C     1 
ATOM   303  O  O     . GLY A 1 40  ? -5.741  50.341 43.167 1.00 20.97 ? 40  GLY A O     1 
ATOM   304  N  N     . HIS A 1 41  ? -6.560  49.208 41.409 1.00 19.59 ? 41  HIS A N     1 
ATOM   305  C  CA    . HIS A 1 41  ? -5.494  48.216 41.408 1.00 20.40 ? 41  HIS A CA    1 
ATOM   306  C  C     . HIS A 1 41  ? -4.545  48.427 40.221 1.00 21.05 ? 41  HIS A C     1 
ATOM   307  O  O     . HIS A 1 41  ? -4.980  48.413 39.036 1.00 21.75 ? 41  HIS A O     1 
ATOM   308  C  CB    . HIS A 1 41  ? -6.099  46.816 41.342 1.00 20.27 ? 41  HIS A CB    1 
ATOM   309  C  CG    . HIS A 1 41  ? -7.206  46.579 42.328 1.00 21.88 ? 41  HIS A CG    1 
ATOM   310  N  ND1   . HIS A 1 41  ? -7.981  45.434 42.315 1.00 21.69 ? 41  HIS A ND1   1 
ATOM   311  C  CD2   . HIS A 1 41  ? -7.620  47.297 43.403 1.00 21.64 ? 41  HIS A CD2   1 
ATOM   312  C  CE1   . HIS A 1 41  ? -8.810  45.452 43.343 1.00 21.73 ? 41  HIS A CE1   1 
ATOM   313  N  NE2   . HIS A 1 41  ? -8.611  46.572 44.018 1.00 21.19 ? 41  HIS A NE2   1 
ATOM   314  N  N     . THR A 1 42  ? -3.260  48.588 40.555 1.00 20.02 ? 42  THR A N     1 
ATOM   315  C  CA    . THR A 1 42  ? -2.174  48.832 39.600 1.00 18.04 ? 42  THR A CA    1 
ATOM   316  C  C     . THR A 1 42  ? -1.411  47.614 39.073 1.00 16.96 ? 42  THR A C     1 
ATOM   317  O  O     . THR A 1 42  ? -0.752  46.892 39.825 1.00 15.70 ? 42  THR A O     1 
ATOM   318  C  CB    . THR A 1 42  ? -1.163  49.802 40.209 1.00 17.42 ? 42  THR A CB    1 
ATOM   319  O  OG1   . THR A 1 42  ? -1.873  50.840 40.896 1.00 19.73 ? 42  THR A OG1   1 
ATOM   320  C  CG2   . THR A 1 42  ? -0.306  50.428 39.131 1.00 17.76 ? 42  THR A CG2   1 
ATOM   321  N  N     . LEU A 1 43  ? -1.507  47.386 37.771 1.00 16.13 ? 43  LEU A N     1 
ATOM   322  C  CA    . LEU A 1 43  ? -0.791  46.277 37.153 1.00 16.07 ? 43  LEU A CA    1 
ATOM   323  C  C     . LEU A 1 43  ? 0.342   46.977 36.458 1.00 15.97 ? 43  LEU A C     1 
ATOM   324  O  O     . LEU A 1 43  ? 0.169   48.102 35.989 1.00 17.81 ? 43  LEU A O     1 
ATOM   325  C  CB    . LEU A 1 43  ? -1.656  45.517 36.119 1.00 15.38 ? 43  LEU A CB    1 
ATOM   326  C  CG    . LEU A 1 43  ? -2.655  44.446 36.593 1.00 12.29 ? 43  LEU A CG    1 
ATOM   327  C  CD1   . LEU A 1 43  ? -3.406  44.966 37.786 1.00 12.46 ? 43  LEU A CD1   1 
ATOM   328  C  CD2   . LEU A 1 43  ? -3.598  44.063 35.471 1.00 9.80  ? 43  LEU A CD2   1 
ATOM   329  N  N     . VAL A 1 44  ? 1.507   46.353 36.445 1.00 15.35 ? 44  VAL A N     1 
ATOM   330  C  CA    . VAL A 1 44  ? 2.660   46.932 35.794 1.00 15.34 ? 44  VAL A CA    1 
ATOM   331  C  C     . VAL A 1 44  ? 3.368   45.785 35.084 1.00 15.54 ? 44  VAL A C     1 
ATOM   332  O  O     . VAL A 1 44  ? 3.862   44.861 35.730 1.00 15.63 ? 44  VAL A O     1 
ATOM   333  C  CB    . VAL A 1 44  ? 3.585   47.629 36.810 1.00 16.40 ? 44  VAL A CB    1 
ATOM   334  C  CG1   . VAL A 1 44  ? 4.969   47.827 36.199 1.00 16.55 ? 44  VAL A CG1   1 
ATOM   335  C  CG2   . VAL A 1 44  ? 2.985   48.978 37.228 1.00 14.23 ? 44  VAL A CG2   1 
ATOM   336  N  N     . ILE A 1 45  ? 3.327   45.797 33.754 1.00 15.75 ? 45  ILE A N     1 
ATOM   337  C  CA    . ILE A 1 45  ? 3.961   44.733 32.978 1.00 17.30 ? 45  ILE A CA    1 
ATOM   338  C  C     . ILE A 1 45  ? 5.043   45.313 32.123 1.00 17.07 ? 45  ILE A C     1 
ATOM   339  O  O     . ILE A 1 45  ? 4.783   46.164 31.279 1.00 16.56 ? 45  ILE A O     1 
ATOM   340  C  CB    . ILE A 1 45  ? 2.974   43.929 32.077 1.00 18.67 ? 45  ILE A CB    1 
ATOM   341  C  CG1   . ILE A 1 45  ? 1.945   43.148 32.936 1.00 19.59 ? 45  ILE A CG1   1 
ATOM   342  C  CG2   . ILE A 1 45  ? 3.773   42.915 31.231 1.00 18.75 ? 45  ILE A CG2   1 
ATOM   343  C  CD1   . ILE A 1 45  ? 0.906   44.000 33.653 1.00 19.94 ? 45  ILE A CD1   1 
ATOM   344  N  N     . ASN A 1 46  ? 6.267   44.878 32.388 1.00 17.81 ? 46  ASN A N     1 
ATOM   345  C  CA    . ASN A 1 46  ? 7.445   45.353 31.682 1.00 18.01 ? 46  ASN A CA    1 
ATOM   346  C  C     . ASN A 1 46  ? 7.468   46.879 31.642 1.00 16.84 ? 46  ASN A C     1 
ATOM   347  O  O     . ASN A 1 46  ? 7.833   47.482 30.654 1.00 16.75 ? 46  ASN A O     1 
ATOM   348  C  CB    . ASN A 1 46  ? 7.517   44.749 30.277 1.00 20.99 ? 46  ASN A CB    1 
ATOM   349  C  CG    . ASN A 1 46  ? 7.612   43.225 30.299 1.00 25.37 ? 46  ASN A CG    1 
ATOM   350  O  OD1   . ASN A 1 46  ? 7.249   42.557 31.296 1.00 28.71 ? 46  ASN A OD1   1 
ATOM   351  N  ND2   . ASN A 1 46  ? 8.074   42.654 29.194 1.00 26.54 ? 46  ASN A ND2   1 
ATOM   352  N  N     . GLY A 1 47  ? 7.093   47.508 32.742 1.00 16.36 ? 47  GLY A N     1 
ATOM   353  C  CA    . GLY A 1 47  ? 7.098   48.955 32.786 1.00 15.31 ? 47  GLY A CA    1 
ATOM   354  C  C     . GLY A 1 47  ? 5.807   49.598 32.367 1.00 15.03 ? 47  GLY A C     1 
ATOM   355  O  O     . GLY A 1 47  ? 5.576   50.755 32.676 1.00 15.02 ? 47  GLY A O     1 
ATOM   356  N  N     . GLU A 1 48  ? 4.937   48.853 31.706 1.00 15.79 ? 48  GLU A N     1 
ATOM   357  C  CA    . GLU A 1 48  ? 3.673   49.416 31.242 1.00 16.22 ? 48  GLU A CA    1 
ATOM   358  C  C     . GLU A 1 48  ? 2.641   49.265 32.344 1.00 17.70 ? 48  GLU A C     1 
ATOM   359  O  O     . GLU A 1 48  ? 2.298   48.141 32.758 1.00 17.64 ? 48  GLU A O     1 
ATOM   360  C  CB    . GLU A 1 48  ? 3.208   48.704 29.976 1.00 15.33 ? 48  GLU A CB    1 
ATOM   361  C  CG    . GLU A 1 48  ? 2.115   49.436 29.223 1.00 14.72 ? 48  GLU A CG    1 
ATOM   362  C  CD    . GLU A 1 48  ? 1.374   48.545 28.255 1.00 13.71 ? 48  GLU A CD    1 
ATOM   363  O  OE1   . GLU A 1 48  ? 1.683   47.335 28.134 1.00 13.95 ? 48  GLU A OE1   1 
ATOM   364  O  OE2   . GLU A 1 48  ? 0.432   49.047 27.640 1.00 12.91 ? 48  GLU A OE2   1 
ATOM   365  N  N     . LYS A 1 49  ? 2.167   50.406 32.824 1.00 19.03 ? 49  LYS A N     1 
ATOM   366  C  CA    . LYS A 1 49  ? 1.202   50.477 33.910 1.00 20.31 ? 49  LYS A CA    1 
ATOM   367  C  C     . LYS A 1 49  ? -0.284  50.476 33.498 1.00 20.67 ? 49  LYS A C     1 
ATOM   368  O  O     . LYS A 1 49  ? -0.686  51.137 32.520 1.00 21.25 ? 49  LYS A O     1 
ATOM   369  C  CB    . LYS A 1 49  ? 1.517   51.730 34.746 1.00 20.57 ? 49  LYS A CB    1 
ATOM   370  C  CG    . LYS A 1 49  ? 0.543   51.997 35.889 1.00 23.22 ? 49  LYS A CG    1 
ATOM   371  C  CD    . LYS A 1 49  ? 1.204   52.764 37.041 1.00 25.79 ? 49  LYS A CD    1 
ATOM   372  C  CE    . LYS A 1 49  ? 0.706   54.199 37.139 1.00 27.62 ? 49  LYS A CE    1 
ATOM   373  N  NZ    . LYS A 1 49  ? -0.794  54.279 36.983 1.00 29.76 ? 49  LYS A NZ    1 
ATOM   374  N  N     . THR A 1 50  ? -1.091  49.722 34.236 1.00 20.04 ? 50  THR A N     1 
ATOM   375  C  CA    . THR A 1 50  ? -2.544  49.693 34.025 1.00 20.39 ? 50  THR A CA    1 
ATOM   376  C  C     . THR A 1 50  ? -3.173  49.824 35.432 1.00 20.26 ? 50  THR A C     1 
ATOM   377  O  O     . THR A 1 50  ? -2.719  49.173 36.397 1.00 19.74 ? 50  THR A O     1 
ATOM   378  C  CB    . THR A 1 50  ? -3.056  48.354 33.357 1.00 20.72 ? 50  THR A CB    1 
ATOM   379  O  OG1   . THR A 1 50  ? -2.536  48.236 32.023 1.00 21.43 ? 50  THR A OG1   1 
ATOM   380  C  CG2   . THR A 1 50  ? -4.601  48.319 33.292 1.00 18.85 ? 50  THR A CG2   1 
ATOM   381  N  N     . VAL A 1 51  ? -4.178  50.684 35.558 1.00 18.78 ? 51  VAL A N     1 
ATOM   382  C  CA    . VAL A 1 51  ? -4.860  50.863 36.845 1.00 17.37 ? 51  VAL A CA    1 
ATOM   383  C  C     . VAL A 1 51  ? -6.295  50.444 36.602 1.00 16.05 ? 51  VAL A C     1 
ATOM   384  O  O     . VAL A 1 51  ? -6.972  51.056 35.777 1.00 14.60 ? 51  VAL A O     1 
ATOM   385  C  CB    . VAL A 1 51  ? -4.837  52.364 37.339 1.00 17.50 ? 51  VAL A CB    1 
ATOM   386  C  CG1   . VAL A 1 51  ? -5.761  52.556 38.546 1.00 17.38 ? 51  VAL A CG1   1 
ATOM   387  C  CG2   . VAL A 1 51  ? -3.414  52.799 37.718 1.00 16.99 ? 51  VAL A CG2   1 
ATOM   388  N  N     . LEU A 1 52  ? -6.744  49.379 37.263 1.00 15.43 ? 52  LEU A N     1 
ATOM   389  C  CA    . LEU A 1 52  ? -8.123  48.944 37.084 1.00 14.96 ? 52  LEU A CA    1 
ATOM   390  C  C     . LEU A 1 52  ? -8.979  49.397 38.269 1.00 15.10 ? 52  LEU A C     1 
ATOM   391  O  O     . LEU A 1 52  ? -8.483  49.575 39.381 1.00 16.58 ? 52  LEU A O     1 
ATOM   392  C  CB    . LEU A 1 52  ? -8.202  47.427 36.885 1.00 14.12 ? 52  LEU A CB    1 
ATOM   393  C  CG    . LEU A 1 52  ? -7.415  46.773 35.712 1.00 14.86 ? 52  LEU A CG    1 
ATOM   394  C  CD1   . LEU A 1 52  ? -7.557  45.279 35.830 1.00 15.02 ? 52  LEU A CD1   1 
ATOM   395  C  CD2   . LEU A 1 52  ? -7.879  47.190 34.314 1.00 12.74 ? 52  LEU A CD2   1 
ATOM   396  N  N     . HIS A 1 53  ? -10.252 49.659 38.036 1.00 15.17 ? 53  HIS A N     1 
ATOM   397  C  CA    . HIS A 1 53  ? -11.122 50.057 39.134 1.00 15.49 ? 53  HIS A CA    1 
ATOM   398  C  C     . HIS A 1 53  ? -12.215 49.011 39.289 1.00 15.62 ? 53  HIS A C     1 
ATOM   399  O  O     . HIS A 1 53  ? -12.220 48.242 40.260 1.00 15.88 ? 53  HIS A O     1 
ATOM   400  C  CB    . HIS A 1 53  ? -11.685 51.464 38.920 1.00 14.98 ? 53  HIS A CB    1 
ATOM   401  C  CG    . HIS A 1 53  ? -10.631 52.526 38.955 1.00 15.74 ? 53  HIS A CG    1 
ATOM   402  N  ND1   . HIS A 1 53  ? -10.052 53.042 37.816 1.00 17.11 ? 53  HIS A ND1   1 
ATOM   403  C  CD2   . HIS A 1 53  ? -10.005 53.120 39.991 1.00 16.58 ? 53  HIS A CD2   1 
ATOM   404  C  CE1   . HIS A 1 53  ? -9.115  53.908 38.152 1.00 15.85 ? 53  HIS A CE1   1 
ATOM   405  N  NE2   . HIS A 1 53  ? -9.066  53.974 39.464 1.00 16.03 ? 53  HIS A NE2   1 
ATOM   406  N  N     . LEU A 1 54  ? -13.085 48.933 38.291 1.00 14.61 ? 54  LEU A N     1 
ATOM   407  C  CA    . LEU A 1 54  ? -14.173 47.981 38.275 1.00 13.90 ? 54  LEU A CA    1 
ATOM   408  C  C     . LEU A 1 54  ? -13.831 46.710 37.487 1.00 14.19 ? 54  LEU A C     1 
ATOM   409  O  O     . LEU A 1 54  ? -14.340 45.633 37.802 1.00 13.82 ? 54  LEU A O     1 
ATOM   410  C  CB    . LEU A 1 54  ? -15.382 48.658 37.645 1.00 13.79 ? 54  LEU A CB    1 
ATOM   411  C  CG    . LEU A 1 54  ? -16.594 47.802 37.337 1.00 14.05 ? 54  LEU A CG    1 
ATOM   412  C  CD1   . LEU A 1 54  ? -17.230 47.374 38.642 1.00 13.35 ? 54  LEU A CD1   1 
ATOM   413  C  CD2   . LEU A 1 54  ? -17.560 48.586 36.462 1.00 13.71 ? 54  LEU A CD2   1 
ATOM   414  N  N     . ILE A 1 55  ? -12.982 46.825 36.461 1.00 14.10 ? 55  ILE A N     1 
ATOM   415  C  CA    . ILE A 1 55  ? -12.638 45.663 35.614 1.00 13.45 ? 55  ILE A CA    1 
ATOM   416  C  C     . ILE A 1 55  ? -11.684 44.664 36.296 1.00 11.84 ? 55  ILE A C     1 
ATOM   417  O  O     . ILE A 1 55  ? -10.600 45.026 36.770 1.00 12.79 ? 55  ILE A O     1 
ATOM   418  C  CB    . ILE A 1 55  ? -12.182 46.168 34.220 1.00 14.49 ? 55  ILE A CB    1 
ATOM   419  C  CG1   . ILE A 1 55  ? -13.408 46.803 33.518 1.00 14.46 ? 55  ILE A CG1   1 
ATOM   420  C  CG2   . ILE A 1 55  ? -11.569 45.025 33.366 1.00 15.26 ? 55  ILE A CG2   1 
ATOM   421  C  CD1   . ILE A 1 55  ? -13.170 47.266 32.092 1.00 14.66 ? 55  ILE A CD1   1 
ATOM   422  N  N     . PRO A 1 56  ? -12.063 43.387 36.350 1.00 10.25 ? 56  PRO A N     1 
ATOM   423  C  CA    . PRO A 1 56  ? -11.116 42.507 37.039 1.00 9.30  ? 56  PRO A CA    1 
ATOM   424  C  C     . PRO A 1 56  ? -9.682  42.478 36.520 1.00 9.78  ? 56  PRO A C     1 
ATOM   425  O  O     . PRO A 1 56  ? -9.405  42.661 35.332 1.00 10.11 ? 56  PRO A O     1 
ATOM   426  C  CB    . PRO A 1 56  ? -11.817 41.150 37.028 1.00 8.32  ? 56  PRO A CB    1 
ATOM   427  C  CG    . PRO A 1 56  ? -13.257 41.500 36.898 1.00 8.41  ? 56  PRO A CG    1 
ATOM   428  C  CD    . PRO A 1 56  ? -13.264 42.653 35.930 1.00 9.00  ? 56  PRO A CD    1 
ATOM   429  N  N     . SER A 1 57  ? -8.774  42.187 37.433 1.00 9.58  ? 57  SER A N     1 
ATOM   430  C  CA    . SER A 1 57  ? -7.370  42.160 37.142 1.00 10.46 ? 57  SER A CA    1 
ATOM   431  C  C     . SER A 1 57  ? -6.812  41.099 36.168 1.00 11.42 ? 57  SER A C     1 
ATOM   432  O  O     . SER A 1 57  ? -5.626  41.134 35.833 1.00 11.96 ? 57  SER A O     1 
ATOM   433  C  CB    . SER A 1 57  ? -6.604  42.189 38.465 1.00 9.63  ? 57  SER A CB    1 
ATOM   434  O  OG    . SER A 1 57  ? -6.718  43.476 39.042 1.00 8.43  ? 57  SER A OG    1 
ATOM   435  N  N     . GLY A 1 58  ? -7.632  40.168 35.708 1.00 11.83 ? 58  GLY A N     1 
ATOM   436  C  CA    . GLY A 1 58  ? -7.138  39.170 34.766 1.00 13.41 ? 58  GLY A CA    1 
ATOM   437  C  C     . GLY A 1 58  ? -7.377  39.664 33.339 1.00 14.24 ? 58  GLY A C     1 
ATOM   438  O  O     . GLY A 1 58  ? -7.039  39.010 32.349 1.00 14.35 ? 58  GLY A O     1 
ATOM   439  N  N     . ILE A 1 59  ? -7.925  40.869 33.249 1.00 14.73 ? 59  ILE A N     1 
ATOM   440  C  CA    . ILE A 1 59  ? -8.285  41.476 31.987 1.00 14.51 ? 59  ILE A CA    1 
ATOM   441  C  C     . ILE A 1 59  ? -7.201  41.554 30.938 1.00 14.74 ? 59  ILE A C     1 
ATOM   442  O  O     . ILE A 1 59  ? -7.519  41.689 29.771 1.00 16.39 ? 59  ILE A O     1 
ATOM   443  C  CB    . ILE A 1 59  ? -8.933  42.880 32.211 1.00 13.94 ? 59  ILE A CB    1 
ATOM   444  C  CG1   . ILE A 1 59  ? -9.904  43.195 31.069 1.00 14.03 ? 59  ILE A CG1   1 
ATOM   445  C  CG2   . ILE A 1 59  ? -7.866  43.950 32.382 1.00 13.12 ? 59  ILE A CG2   1 
ATOM   446  C  CD1   . ILE A 1 59  ? -11.054 42.143 30.933 1.00 12.80 ? 59  ILE A CD1   1 
ATOM   447  N  N     . LEU A 1 60  ? -5.935  41.478 31.325 1.00 14.50 ? 60  LEU A N     1 
ATOM   448  C  CA    . LEU A 1 60  ? -4.850  41.549 30.344 1.00 14.58 ? 60  LEU A CA    1 
ATOM   449  C  C     . LEU A 1 60  ? -4.413  40.175 29.830 1.00 14.77 ? 60  LEU A C     1 
ATOM   450  O  O     . LEU A 1 60  ? -3.607  40.090 28.916 1.00 14.83 ? 60  LEU A O     1 
ATOM   451  C  CB    . LEU A 1 60  ? -3.635  42.313 30.906 1.00 13.99 ? 60  LEU A CB    1 
ATOM   452  C  CG    . LEU A 1 60  ? -3.895  43.647 31.640 1.00 12.92 ? 60  LEU A CG    1 
ATOM   453  C  CD1   . LEU A 1 60  ? -2.591  44.275 32.053 1.00 13.04 ? 60  LEU A CD1   1 
ATOM   454  C  CD2   . LEU A 1 60  ? -4.666  44.632 30.777 1.00 13.58 ? 60  LEU A CD2   1 
ATOM   455  N  N     . ARG A 1 61  ? -4.963  39.096 30.372 1.00 16.04 ? 61  ARG A N     1 
ATOM   456  C  CA    . ARG A 1 61  ? -4.557  37.756 29.919 1.00 17.78 ? 61  ARG A CA    1 
ATOM   457  C  C     . ARG A 1 61  ? -5.697  37.209 29.044 1.00 18.40 ? 61  ARG A C     1 
ATOM   458  O  O     . ARG A 1 61  ? -6.800  36.948 29.538 1.00 18.65 ? 61  ARG A O     1 
ATOM   459  C  CB    . ARG A 1 61  ? -4.234  36.841 31.128 1.00 16.64 ? 61  ARG A CB    1 
ATOM   460  C  CG    . ARG A 1 61  ? -3.666  37.641 32.352 1.00 19.81 ? 61  ARG A CG    1 
ATOM   461  C  CD    . ARG A 1 61  ? -2.799  36.852 33.368 1.00 18.85 ? 61  ARG A CD    1 
ATOM   462  N  NE    . ARG A 1 61  ? -1.722  36.195 32.654 1.00 20.06 ? 61  ARG A NE    1 
ATOM   463  C  CZ    . ARG A 1 61  ? -0.463  36.168 33.073 1.00 18.66 ? 61  ARG A CZ    1 
ATOM   464  N  NH1   . ARG A 1 61  ? -0.112  36.746 34.210 1.00 16.58 ? 61  ARG A NH1   1 
ATOM   465  N  NH2   . ARG A 1 61  ? 0.445   35.563 32.299 1.00 17.40 ? 61  ARG A NH2   1 
ATOM   466  N  N     . GLU A 1 62  ? -5.453  37.041 27.744 1.00 18.70 ? 62  GLU A N     1 
ATOM   467  C  CA    . GLU A 1 62  ? -6.533  36.556 26.892 1.00 19.90 ? 62  GLU A CA    1 
ATOM   468  C  C     . GLU A 1 62  ? -7.035  35.149 27.221 1.00 18.77 ? 62  GLU A C     1 
ATOM   469  O  O     . GLU A 1 62  ? -8.131  34.779 26.858 1.00 19.51 ? 62  GLU A O     1 
ATOM   470  C  CB    . GLU A 1 62  ? -6.216  36.762 25.409 1.00 21.88 ? 62  GLU A CB    1 
ATOM   471  C  CG    . GLU A 1 62  ? -5.347  35.742 24.780 1.00 24.96 ? 62  GLU A CG    1 
ATOM   472  C  CD    . GLU A 1 62  ? -6.146  34.642 24.144 1.00 27.11 ? 62  GLU A CD    1 
ATOM   473  O  OE1   . GLU A 1 62  ? -5.638  33.501 24.102 1.00 28.55 ? 62  GLU A OE1   1 
ATOM   474  O  OE2   . GLU A 1 62  ? -7.274  34.919 23.683 1.00 27.40 ? 62  GLU A OE2   1 
ATOM   475  N  N     . ASN A 1 63  ? -6.266  34.399 27.986 1.00 18.24 ? 63  ASN A N     1 
ATOM   476  C  CA    . ASN A 1 63  ? -6.664  33.052 28.394 1.00 18.30 ? 63  ASN A CA    1 
ATOM   477  C  C     . ASN A 1 63  ? -7.679  33.042 29.577 1.00 17.45 ? 63  ASN A C     1 
ATOM   478  O  O     . ASN A 1 63  ? -8.273  32.002 29.906 1.00 17.87 ? 63  ASN A O     1 
ATOM   479  C  CB    . ASN A 1 63  ? -5.403  32.251 28.789 1.00 19.81 ? 63  ASN A CB    1 
ATOM   480  C  CG    . ASN A 1 63  ? -4.833  32.664 30.163 1.00 22.14 ? 63  ASN A CG    1 
ATOM   481  O  OD1   . ASN A 1 63  ? -5.033  31.966 31.148 1.00 23.67 ? 63  ASN A OD1   1 
ATOM   482  N  ND2   . ASN A 1 63  ? -4.108  33.790 30.217 1.00 22.77 ? 63  ASN A ND2   1 
ATOM   483  N  N     . VAL A 1 64  ? -7.902  34.197 30.189 1.00 15.78 ? 64  VAL A N     1 
ATOM   484  C  CA    . VAL A 1 64  ? -8.783  34.280 31.344 1.00 14.28 ? 64  VAL A CA    1 
ATOM   485  C  C     . VAL A 1 64  ? -10.061 35.001 31.006 1.00 13.38 ? 64  VAL A C     1 
ATOM   486  O  O     . VAL A 1 64  ? -10.046 35.980 30.260 1.00 12.96 ? 64  VAL A O     1 
ATOM   487  C  CB    . VAL A 1 64  ? -8.075  35.061 32.541 1.00 15.37 ? 64  VAL A CB    1 
ATOM   488  C  CG1   . VAL A 1 64  ? -9.031  35.311 33.685 1.00 13.67 ? 64  VAL A CG1   1 
ATOM   489  C  CG2   . VAL A 1 64  ? -6.867  34.288 33.051 1.00 14.51 ? 64  VAL A CG2   1 
ATOM   490  N  N     . THR A 1 65  ? -11.165 34.503 31.550 1.00 12.31 ? 65  THR A N     1 
ATOM   491  C  CA    . THR A 1 65  ? -12.458 35.126 31.371 1.00 12.09 ? 65  THR A CA    1 
ATOM   492  C  C     . THR A 1 65  ? -12.700 35.942 32.637 1.00 12.27 ? 65  THR A C     1 
ATOM   493  O  O     . THR A 1 65  ? -12.733 35.385 33.739 1.00 12.65 ? 65  THR A O     1 
ATOM   494  C  CB    . THR A 1 65  ? -13.571 34.100 31.245 1.00 11.72 ? 65  THR A CB    1 
ATOM   495  O  OG1   . THR A 1 65  ? -13.384 33.351 30.048 1.00 11.51 ? 65  THR A OG1   1 
ATOM   496  C  CG2   . THR A 1 65  ? -14.922 34.807 31.171 1.00 11.79 ? 65  THR A CG2   1 
ATOM   497  N  N     . SER A 1 66  ? -12.866 37.251 32.484 1.00 12.27 ? 66  SER A N     1 
ATOM   498  C  CA    . SER A 1 66  ? -13.072 38.125 33.629 1.00 11.81 ? 66  SER A CA    1 
ATOM   499  C  C     . SER A 1 66  ? -14.528 38.242 33.966 1.00 11.68 ? 66  SER A C     1 
ATOM   500  O  O     . SER A 1 66  ? -15.337 38.496 33.096 1.00 10.90 ? 66  SER A O     1 
ATOM   501  C  CB    . SER A 1 66  ? -12.501 39.512 33.366 1.00 10.60 ? 66  SER A CB    1 
ATOM   502  O  OG    . SER A 1 66  ? -11.088 39.476 33.384 1.00 10.47 ? 66  SER A OG    1 
ATOM   503  N  N     . ILE A 1 67  ? -14.858 38.068 35.241 1.00 12.35 ? 67  ILE A N     1 
ATOM   504  C  CA    . ILE A 1 67  ? -16.238 38.177 35.664 1.00 12.44 ? 67  ILE A CA    1 
ATOM   505  C  C     . ILE A 1 67  ? -16.482 39.175 36.789 1.00 11.62 ? 67  ILE A C     1 
ATOM   506  O  O     . ILE A 1 67  ? -15.783 39.173 37.820 1.00 11.92 ? 67  ILE A O     1 
ATOM   507  C  CB    . ILE A 1 67  ? -16.784 36.827 36.128 1.00 13.55 ? 67  ILE A CB    1 
ATOM   508  C  CG1   . ILE A 1 67  ? -16.463 35.735 35.088 1.00 13.82 ? 67  ILE A CG1   1 
ATOM   509  C  CG2   . ILE A 1 67  ? -18.285 36.971 36.357 1.00 14.39 ? 67  ILE A CG2   1 
ATOM   510  C  CD1   . ILE A 1 67  ? -16.701 34.280 35.562 1.00 13.17 ? 67  ILE A CD1   1 
ATOM   511  N  N     . ILE A 1 68  ? -17.460 40.049 36.565 1.00 10.18 ? 68  ILE A N     1 
ATOM   512  C  CA    . ILE A 1 68  ? -17.896 41.039 37.562 1.00 8.69  ? 68  ILE A CA    1 
ATOM   513  C  C     . ILE A 1 68  ? -19.099 40.356 38.255 1.00 8.08  ? 68  ILE A C     1 
ATOM   514  O  O     . ILE A 1 68  ? -20.184 40.210 37.657 1.00 7.46  ? 68  ILE A O     1 
ATOM   515  C  CB    . ILE A 1 68  ? -18.313 42.346 36.865 1.00 7.44  ? 68  ILE A CB    1 
ATOM   516  C  CG1   . ILE A 1 68  ? -17.061 43.041 36.314 1.00 5.97  ? 68  ILE A CG1   1 
ATOM   517  C  CG2   . ILE A 1 68  ? -19.137 43.229 37.806 1.00 5.95  ? 68  ILE A CG2   1 
ATOM   518  C  CD1   . ILE A 1 68  ? -17.350 44.280 35.526 1.00 2.27  ? 68  ILE A CD1   1 
ATOM   519  N  N     . GLY A 1 69  ? -18.869 39.845 39.463 1.00 8.15  ? 69  GLY A N     1 
ATOM   520  C  CA    . GLY A 1 69  ? -19.916 39.130 40.191 1.00 7.12  ? 69  GLY A CA    1 
ATOM   521  C  C     . GLY A 1 69  ? -20.988 39.990 40.823 1.00 7.13  ? 69  GLY A C     1 
ATOM   522  O  O     . GLY A 1 69  ? -20.774 41.185 41.041 1.00 6.27  ? 69  GLY A O     1 
ATOM   523  N  N     . ASN A 1 70  ? -22.110 39.353 41.168 1.00 6.94  ? 70  ASN A N     1 
ATOM   524  C  CA    . ASN A 1 70  ? -23.268 40.005 41.805 1.00 7.82  ? 70  ASN A CA    1 
ATOM   525  C  C     . ASN A 1 70  ? -22.999 40.842 43.060 1.00 7.32  ? 70  ASN A C     1 
ATOM   526  O  O     . ASN A 1 70  ? -23.844 41.645 43.461 1.00 8.51  ? 70  ASN A O     1 
ATOM   527  C  CB    . ASN A 1 70  ? -24.338 38.958 42.182 1.00 9.12  ? 70  ASN A CB    1 
ATOM   528  C  CG    . ASN A 1 70  ? -23.911 38.067 43.356 1.00 8.97  ? 70  ASN A CG    1 
ATOM   529  O  OD1   . ASN A 1 70  ? -23.392 36.981 43.145 1.00 8.71  ? 70  ASN A OD1   1 
ATOM   530  N  ND2   . ASN A 1 70  ? -24.124 38.535 44.585 1.00 8.18  ? 70  ASN A ND2   1 
ATOM   531  N  N     . GLY A 1 71  ? -21.873 40.619 43.724 1.00 7.11  ? 71  GLY A N     1 
ATOM   532  C  CA    . GLY A 1 71  ? -21.590 41.384 44.918 1.00 6.74  ? 71  GLY A CA    1 
ATOM   533  C  C     . GLY A 1 71  ? -21.128 42.768 44.562 1.00 6.92  ? 71  GLY A C     1 
ATOM   534  O  O     . GLY A 1 71  ? -21.182 43.692 45.373 1.00 7.62  ? 71  GLY A O     1 
ATOM   535  N  N     . VAL A 1 72  ? -20.677 42.922 43.329 1.00 7.53  ? 72  VAL A N     1 
ATOM   536  C  CA    . VAL A 1 72  ? -20.162 44.191 42.868 1.00 7.50  ? 72  VAL A CA    1 
ATOM   537  C  C     . VAL A 1 72  ? -21.228 45.215 42.536 1.00 8.41  ? 72  VAL A C     1 
ATOM   538  O  O     . VAL A 1 72  ? -22.221 44.875 41.887 1.00 8.15  ? 72  VAL A O     1 
ATOM   539  C  CB    . VAL A 1 72  ? -19.267 43.962 41.647 1.00 7.21  ? 72  VAL A CB    1 
ATOM   540  C  CG1   . VAL A 1 72  ? -18.753 45.307 41.007 1.00 4.35  ? 72  VAL A CG1   1 
ATOM   541  C  CG2   . VAL A 1 72  ? -18.138 43.081 42.075 1.00 6.84  ? 72  VAL A CG2   1 
ATOM   542  N  N     . VAL A 1 73  ? -21.028 46.455 43.018 1.00 8.59  ? 73  VAL A N     1 
ATOM   543  C  CA    . VAL A 1 73  ? -21.931 47.559 42.686 1.00 9.24  ? 73  VAL A CA    1 
ATOM   544  C  C     . VAL A 1 73  ? -21.343 48.196 41.396 1.00 11.08 ? 73  VAL A C     1 
ATOM   545  O  O     . VAL A 1 73  ? -20.215 48.778 41.391 1.00 10.93 ? 73  VAL A O     1 
ATOM   546  C  CB    . VAL A 1 73  ? -22.085 48.565 43.826 1.00 8.38  ? 73  VAL A CB    1 
ATOM   547  C  CG1   . VAL A 1 73  ? -22.925 47.938 44.917 1.00 6.95  ? 73  VAL A CG1   1 
ATOM   548  C  CG2   . VAL A 1 73  ? -20.723 49.027 44.323 1.00 7.92  ? 73  VAL A CG2   1 
ATOM   549  N  N     . LEU A 1 74  ? -22.111 48.064 40.306 1.00 11.10 ? 74  LEU A N     1 
ATOM   550  C  CA    . LEU A 1 74  ? -21.670 48.481 38.971 1.00 10.40 ? 74  LEU A CA    1 
ATOM   551  C  C     . LEU A 1 74  ? -22.165 49.767 38.330 1.00 10.12 ? 74  LEU A C     1 
ATOM   552  O  O     . LEU A 1 74  ? -23.376 49.964 38.085 1.00 8.57  ? 74  LEU A O     1 
ATOM   553  C  CB    . LEU A 1 74  ? -21.810 47.261 38.024 1.00 10.24 ? 74  LEU A CB    1 
ATOM   554  C  CG    . LEU A 1 74  ? -21.974 47.084 36.498 1.00 11.29 ? 74  LEU A CG    1 
ATOM   555  C  CD1   . LEU A 1 74  ? -21.247 48.075 35.610 1.00 10.51 ? 74  LEU A CD1   1 
ATOM   556  C  CD2   . LEU A 1 74  ? -21.576 45.646 36.179 1.00 9.84  ? 74  LEU A CD2   1 
ATOM   557  N  N     . SER A 1 75  ? -21.196 50.656 38.092 1.00 10.27 ? 75  SER A N     1 
ATOM   558  C  CA    . SER A 1 75  ? -21.436 51.934 37.427 1.00 9.58  ? 75  SER A CA    1 
ATOM   559  C  C     . SER A 1 75  ? -21.246 51.791 35.898 1.00 10.00 ? 75  SER A C     1 
ATOM   560  O  O     . SER A 1 75  ? -20.125 51.617 35.407 1.00 8.35  ? 75  SER A O     1 
ATOM   561  C  CB    . SER A 1 75  ? -20.482 52.996 37.955 1.00 9.60  ? 75  SER A CB    1 
ATOM   562  O  OG    . SER A 1 75  ? -20.530 54.155 37.136 1.00 9.53  ? 75  SER A OG    1 
ATOM   563  N  N     . PRO A 1 76  ? -22.346 51.890 35.123 1.00 10.94 ? 76  PRO A N     1 
ATOM   564  C  CA    . PRO A 1 76  ? -22.288 51.773 33.657 1.00 10.30 ? 76  PRO A CA    1 
ATOM   565  C  C     . PRO A 1 76  ? -21.302 52.775 33.052 1.00 11.91 ? 76  PRO A C     1 
ATOM   566  O  O     . PRO A 1 76  ? -20.528 52.445 32.153 1.00 12.32 ? 76  PRO A O     1 
ATOM   567  C  CB    . PRO A 1 76  ? -23.715 52.079 33.243 1.00 10.80 ? 76  PRO A CB    1 
ATOM   568  C  CG    . PRO A 1 76  ? -24.542 51.600 34.465 1.00 9.72  ? 76  PRO A CG    1 
ATOM   569  C  CD    . PRO A 1 76  ? -23.719 52.176 35.585 1.00 9.65  ? 76  PRO A CD    1 
ATOM   570  N  N     . ALA A 1 77  ? -21.332 54.003 33.563 1.00 13.05 ? 77  ALA A N     1 
ATOM   571  C  CA    . ALA A 1 77  ? -20.454 55.061 33.115 1.00 12.96 ? 77  ALA A CA    1 
ATOM   572  C  C     . ALA A 1 77  ? -19.033 54.620 33.370 1.00 14.27 ? 77  ALA A C     1 
ATOM   573  O  O     . ALA A 1 77  ? -18.177 54.689 32.483 1.00 15.38 ? 77  ALA A O     1 
ATOM   574  C  CB    . ALA A 1 77  ? -20.733 56.315 33.907 1.00 11.42 ? 77  ALA A CB    1 
ATOM   575  N  N     . ALA A 1 78  ? -18.770 54.169 34.598 1.00 15.18 ? 78  ALA A N     1 
ATOM   576  C  CA    . ALA A 1 78  ? -17.430 53.729 34.975 1.00 14.05 ? 78  ALA A CA    1 
ATOM   577  C  C     . ALA A 1 78  ? -16.942 52.616 34.081 1.00 13.92 ? 78  ALA A C     1 
ATOM   578  O  O     . ALA A 1 78  ? -15.820 52.645 33.610 1.00 15.60 ? 78  ALA A O     1 
ATOM   579  C  CB    . ALA A 1 78  ? -17.414 53.292 36.415 1.00 14.01 ? 78  ALA A CB    1 
ATOM   580  N  N     . LEU A 1 79  ? -17.787 51.638 33.830 1.00 13.69 ? 79  LEU A N     1 
ATOM   581  C  CA    . LEU A 1 79  ? -17.407 50.515 32.990 1.00 15.33 ? 79  LEU A CA    1 
ATOM   582  C  C     . LEU A 1 79  ? -16.985 50.988 31.601 1.00 16.58 ? 79  LEU A C     1 
ATOM   583  O  O     . LEU A 1 79  ? -15.916 50.621 31.102 1.00 15.61 ? 79  LEU A O     1 
ATOM   584  C  CB    . LEU A 1 79  ? -18.578 49.521 32.875 1.00 14.74 ? 79  LEU A CB    1 
ATOM   585  C  CG    . LEU A 1 79  ? -18.332 48.178 32.160 1.00 16.30 ? 79  LEU A CG    1 
ATOM   586  C  CD1   . LEU A 1 79  ? -17.091 47.417 32.702 1.00 15.65 ? 79  LEU A CD1   1 
ATOM   587  C  CD2   . LEU A 1 79  ? -19.563 47.318 32.281 1.00 15.45 ? 79  LEU A CD2   1 
ATOM   588  N  N     . MET A 1 80  ? -17.835 51.816 30.989 1.00 18.70 ? 80  MET A N     1 
ATOM   589  C  CA    . MET A 1 80  ? -17.609 52.341 29.638 1.00 19.39 ? 80  MET A CA    1 
ATOM   590  C  C     . MET A 1 80  ? -16.296 53.104 29.516 1.00 19.74 ? 80  MET A C     1 
ATOM   591  O  O     . MET A 1 80  ? -15.587 52.948 28.526 1.00 18.17 ? 80  MET A O     1 
ATOM   592  C  CB    . MET A 1 80  ? -18.775 53.226 29.224 1.00 20.91 ? 80  MET A CB    1 
ATOM   593  C  CG    . MET A 1 80  ? -20.090 52.505 29.085 1.00 22.84 ? 80  MET A CG    1 
ATOM   594  S  SD    . MET A 1 80  ? -19.929 51.072 28.001 1.00 27.62 ? 80  MET A SD    1 
ATOM   595  C  CE    . MET A 1 80  ? -20.649 49.833 29.077 1.00 26.95 ? 80  MET A CE    1 
ATOM   596  N  N     . LYS A 1 81  ? -15.986 53.934 30.513 1.00 19.84 ? 81  LYS A N     1 
ATOM   597  C  CA    . LYS A 1 81  ? -14.737 54.688 30.532 1.00 20.45 ? 81  LYS A CA    1 
ATOM   598  C  C     . LYS A 1 81  ? -13.513 53.771 30.571 1.00 21.26 ? 81  LYS A C     1 
ATOM   599  O  O     . LYS A 1 81  ? -12.538 54.028 29.888 1.00 22.12 ? 81  LYS A O     1 
ATOM   600  C  CB    . LYS A 1 81  ? -14.704 55.633 31.734 1.00 20.76 ? 81  LYS A CB    1 
ATOM   601  C  CG    . LYS A 1 81  ? -13.353 56.324 31.969 1.00 21.03 ? 81  LYS A CG    1 
ATOM   602  C  CD    . LYS A 1 81  ? -13.423 57.321 33.126 1.00 22.36 ? 81  LYS A CD    1 
ATOM   603  C  CE    . LYS A 1 81  ? -12.092 58.062 33.315 1.00 22.35 ? 81  LYS A CE    1 
ATOM   604  N  NZ    . LYS A 1 81  ? -10.960 57.083 33.461 1.00 24.11 ? 81  LYS A NZ    1 
ATOM   605  N  N     . GLU A 1 82  ? -13.540 52.729 31.395 1.00 22.16 ? 82  GLU A N     1 
ATOM   606  C  CA    . GLU A 1 82  ? -12.410 51.808 31.480 1.00 23.53 ? 82  GLU A CA    1 
ATOM   607  C  C     . GLU A 1 82  ? -12.294 50.941 30.243 1.00 24.06 ? 82  GLU A C     1 
ATOM   608  O  O     . GLU A 1 82  ? -11.174 50.618 29.819 1.00 24.28 ? 82  GLU A O     1 
ATOM   609  C  CB    . GLU A 1 82  ? -12.511 50.903 32.709 1.00 24.85 ? 82  GLU A CB    1 
ATOM   610  C  CG    . GLU A 1 82  ? -12.351 51.637 34.056 1.00 26.55 ? 82  GLU A CG    1 
ATOM   611  C  CD    . GLU A 1 82  ? -12.413 50.683 35.243 1.00 25.95 ? 82  GLU A CD    1 
ATOM   612  O  OE1   . GLU A 1 82  ? -11.459 49.880 35.430 1.00 23.96 ? 82  GLU A OE1   1 
ATOM   613  O  OE2   . GLU A 1 82  ? -13.427 50.744 35.979 1.00 25.67 ? 82  GLU A OE2   1 
ATOM   614  N  N     . MET A 1 83  ? -13.438 50.526 29.689 1.00 24.67 ? 83  MET A N     1 
ATOM   615  C  CA    . MET A 1 83  ? -13.471 49.703 28.463 1.00 25.32 ? 83  MET A CA    1 
ATOM   616  C  C     . MET A 1 83  ? -12.795 50.403 27.275 1.00 24.71 ? 83  MET A C     1 
ATOM   617  O  O     . MET A 1 83  ? -11.886 49.854 26.636 1.00 24.51 ? 83  MET A O     1 
ATOM   618  C  CB    . MET A 1 83  ? -14.909 49.351 28.083 1.00 26.35 ? 83  MET A CB    1 
ATOM   619  C  CG    . MET A 1 83  ? -15.561 48.333 29.016 1.00 29.60 ? 83  MET A CG    1 
ATOM   620  S  SD    . MET A 1 83  ? -17.170 47.681 28.408 1.00 32.52 ? 83  MET A SD    1 
ATOM   621  C  CE    . MET A 1 83  ? -16.741 47.504 26.652 1.00 30.62 ? 83  MET A CE    1 
ATOM   622  N  N     . LYS A 1 84  ? -13.227 51.632 27.018 1.00 24.28 ? 84  LYS A N     1 
ATOM   623  C  CA    . LYS A 1 84  ? -12.714 52.451 25.937 1.00 24.13 ? 84  LYS A CA    1 
ATOM   624  C  C     . LYS A 1 84  ? -11.218 52.597 26.129 1.00 23.54 ? 84  LYS A C     1 
ATOM   625  O  O     . LYS A 1 84  ? -10.457 52.424 25.176 1.00 23.62 ? 84  LYS A O     1 
ATOM   626  C  CB    . LYS A 1 84  ? -13.395 53.827 25.964 1.00 25.97 ? 84  LYS A CB    1 
ATOM   627  C  CG    . LYS A 1 84  ? -13.457 54.543 24.636 1.00 28.93 ? 84  LYS A CG    1 
ATOM   628  C  CD    . LYS A 1 84  ? -12.057 54.819 24.090 1.00 32.11 ? 84  LYS A CD    1 
ATOM   629  C  CE    . LYS A 1 84  ? -12.054 55.626 22.763 1.00 34.02 ? 84  LYS A CE    1 
ATOM   630  N  NZ    . LYS A 1 84  ? -12.369 54.805 21.542 1.00 33.90 ? 84  LYS A NZ    1 
ATOM   631  N  N     . GLU A 1 85  ? -10.800 52.893 27.364 1.00 22.70 ? 85  GLU A N     1 
ATOM   632  C  CA    . GLU A 1 85  ? -9.383  53.064 27.710 1.00 20.89 ? 85  GLU A CA    1 
ATOM   633  C  C     . GLU A 1 85  ? -8.537  51.800 27.471 1.00 20.55 ? 85  GLU A C     1 
ATOM   634  O  O     . GLU A 1 85  ? -7.396  51.869 26.989 1.00 19.98 ? 85  GLU A O     1 
ATOM   635  C  CB    . GLU A 1 85  ? -9.256  53.479 29.166 1.00 21.51 ? 85  GLU A CB    1 
ATOM   636  C  CG    . GLU A 1 85  ? -9.757  54.888 29.476 1.00 22.76 ? 85  GLU A CG    1 
ATOM   637  C  CD    . GLU A 1 85  ? -9.622  55.276 30.948 1.00 24.44 ? 85  GLU A CD    1 
ATOM   638  O  OE1   . GLU A 1 85  ? -9.403  54.390 31.826 1.00 24.65 ? 85  GLU A OE1   1 
ATOM   639  O  OE2   . GLU A 1 85  ? -9.767  56.484 31.241 1.00 25.50 ? 85  GLU A OE2   1 
ATOM   640  N  N     . LEU A 1 86  ? -9.080  50.641 27.823 1.00 19.03 ? 86  LEU A N     1 
ATOM   641  C  CA    . LEU A 1 86  ? -8.343  49.419 27.627 1.00 17.85 ? 86  LEU A CA    1 
ATOM   642  C  C     . LEU A 1 86  ? -8.391  48.979 26.167 1.00 18.69 ? 86  LEU A C     1 
ATOM   643  O  O     . LEU A 1 86  ? -7.395  48.457 25.646 1.00 19.53 ? 86  LEU A O     1 
ATOM   644  C  CB    . LEU A 1 86  ? -8.865  48.325 28.552 1.00 17.02 ? 86  LEU A CB    1 
ATOM   645  C  CG    . LEU A 1 86  ? -8.926  48.578 30.069 1.00 17.42 ? 86  LEU A CG    1 
ATOM   646  C  CD1   . LEU A 1 86  ? -9.466  47.338 30.743 1.00 15.74 ? 86  LEU A CD1   1 
ATOM   647  C  CD2   . LEU A 1 86  ? -7.535  48.954 30.664 1.00 17.22 ? 86  LEU A CD2   1 
ATOM   648  N  N     . GLU A 1 87  ? -9.541  49.149 25.507 1.00 18.33 ? 87  GLU A N     1 
ATOM   649  C  CA    . GLU A 1 87  ? -9.664  48.777 24.087 1.00 18.43 ? 87  GLU A CA    1 
ATOM   650  C  C     . GLU A 1 87  ? -8.677  49.579 23.223 1.00 17.63 ? 87  GLU A C     1 
ATOM   651  O  O     . GLU A 1 87  ? -8.005  49.012 22.356 1.00 16.82 ? 87  GLU A O     1 
ATOM   652  C  CB    . GLU A 1 87  ? -11.103 48.950 23.596 1.00 18.31 ? 87  GLU A CB    1 
ATOM   653  C  CG    . GLU A 1 87  ? -12.013 47.861 24.125 1.00 19.77 ? 87  GLU A CG    1 
ATOM   654  C  CD    . GLU A 1 87  ? -13.474 48.156 23.955 1.00 19.62 ? 87  GLU A CD    1 
ATOM   655  O  OE1   . GLU A 1 87  ? -13.804 49.306 23.602 1.00 21.31 ? 87  GLU A OE1   1 
ATOM   656  O  OE2   . GLU A 1 87  ? -14.296 47.231 24.163 1.00 20.84 ? 87  GLU A OE2   1 
ATOM   657  N  N     . ASP A 1 88  ? -8.580  50.883 23.491 1.00 16.43 ? 88  ASP A N     1 
ATOM   658  C  CA    . ASP A 1 88  ? -7.641  51.743 22.794 1.00 16.36 ? 88  ASP A CA    1 
ATOM   659  C  C     . ASP A 1 88  ? -6.224  51.196 22.915 1.00 16.73 ? 88  ASP A C     1 
ATOM   660  O  O     . ASP A 1 88  ? -5.370  51.506 22.093 1.00 17.01 ? 88  ASP A O     1 
ATOM   661  C  CB    . ASP A 1 88  ? -7.656  53.145 23.397 1.00 15.14 ? 88  ASP A CB    1 
ATOM   662  C  CG    . ASP A 1 88  ? -8.828  53.970 22.925 1.00 15.64 ? 88  ASP A CG    1 
ATOM   663  O  OD1   . ASP A 1 88  ? -9.098  55.027 23.542 1.00 15.58 ? 88  ASP A OD1   1 
ATOM   664  O  OD2   . ASP A 1 88  ? -9.496  53.571 21.946 1.00 15.72 ? 88  ASP A OD2   1 
ATOM   665  N  N     . ARG A 1 89  ? -5.971  50.419 23.969 1.00 17.33 ? 89  ARG A N     1 
ATOM   666  C  CA    . ARG A 1 89  ? -4.658  49.830 24.243 1.00 16.62 ? 89  ARG A CA    1 
ATOM   667  C  C     . ARG A 1 89  ? -4.568  48.378 23.770 1.00 16.53 ? 89  ARG A C     1 
ATOM   668  O  O     . ARG A 1 89  ? -3.690  47.629 24.210 1.00 15.41 ? 89  ARG A O     1 
ATOM   669  C  CB    . ARG A 1 89  ? -4.335  49.937 25.738 1.00 16.50 ? 89  ARG A CB    1 
ATOM   670  C  CG    . ARG A 1 89  ? -4.362  51.389 26.258 1.00 18.02 ? 89  ARG A CG    1 
ATOM   671  C  CD    . ARG A 1 89  ? -4.124  51.519 27.771 1.00 16.90 ? 89  ARG A CD    1 
ATOM   672  N  NE    . ARG A 1 89  ? -2.827  50.968 28.147 1.00 17.34 ? 89  ARG A NE    1 
ATOM   673  C  CZ    . ARG A 1 89  ? -2.683  50.225 29.242 1.00 17.87 ? 89  ARG A CZ    1 
ATOM   674  N  NH1   . ARG A 1 89  ? -3.717  49.970 30.029 1.00 17.04 ? 89  ARG A NH1   1 
ATOM   675  N  NH2   . ARG A 1 89  ? -1.497  49.733 29.553 1.00 17.58 ? 89  ARG A NH2   1 
ATOM   676  N  N     . GLY A 1 90  ? -5.495  47.987 22.898 1.00 16.19 ? 90  GLY A N     1 
ATOM   677  C  CA    . GLY A 1 90  ? -5.480  46.656 22.341 1.00 16.54 ? 90  GLY A CA    1 
ATOM   678  C  C     . GLY A 1 90  ? -6.133  45.546 23.129 1.00 17.84 ? 90  GLY A C     1 
ATOM   679  O  O     . GLY A 1 90  ? -6.063  44.371 22.732 1.00 16.35 ? 90  GLY A O     1 
ATOM   680  N  N     . ILE A 1 91  ? -6.736  45.894 24.264 1.00 19.28 ? 91  ILE A N     1 
ATOM   681  C  CA    . ILE A 1 91  ? -7.387  44.894 25.089 1.00 19.56 ? 91  ILE A CA    1 
ATOM   682  C  C     . ILE A 1 91  ? -8.851  44.823 24.720 1.00 19.66 ? 91  ILE A C     1 
ATOM   683  O  O     . ILE A 1 91  ? -9.628  45.711 25.090 1.00 20.44 ? 91  ILE A O     1 
ATOM   684  C  CB    . ILE A 1 91  ? -7.253  45.209 26.587 1.00 21.10 ? 91  ILE A CB    1 
ATOM   685  C  CG1   . ILE A 1 91  ? -5.821  44.872 27.068 1.00 21.44 ? 91  ILE A CG1   1 
ATOM   686  C  CG2   . ILE A 1 91  ? -8.332  44.401 27.395 1.00 21.60 ? 91  ILE A CG2   1 
ATOM   687  C  CD1   . ILE A 1 91  ? -4.852  46.029 27.085 1.00 21.11 ? 91  ILE A CD1   1 
ATOM   688  N  N     . PRO A 1 92  ? -9.254  43.753 24.012 1.00 18.78 ? 92  PRO A N     1 
ATOM   689  C  CA    . PRO A 1 92  ? -10.620 43.516 23.563 1.00 18.88 ? 92  PRO A CA    1 
ATOM   690  C  C     . PRO A 1 92  ? -11.529 43.177 24.749 1.00 19.39 ? 92  PRO A C     1 
ATOM   691  O  O     . PRO A 1 92  ? -12.055 42.061 24.860 1.00 19.23 ? 92  PRO A O     1 
ATOM   692  C  CB    . PRO A 1 92  ? -10.440 42.332 22.617 1.00 19.37 ? 92  PRO A CB    1 
ATOM   693  C  CG    . PRO A 1 92  ? -9.411  41.535 23.273 1.00 18.27 ? 92  PRO A CG    1 
ATOM   694  C  CD    . PRO A 1 92  ? -8.409  42.579 23.725 1.00 19.08 ? 92  PRO A CD    1 
ATOM   695  N  N     . VAL A 1 93  ? -11.700 44.149 25.638 1.00 19.74 ? 93  VAL A N     1 
ATOM   696  C  CA    . VAL A 1 93  ? -12.506 43.987 26.856 1.00 19.82 ? 93  VAL A CA    1 
ATOM   697  C  C     . VAL A 1 93  ? -13.787 43.162 26.709 1.00 20.68 ? 93  VAL A C     1 
ATOM   698  O  O     . VAL A 1 93  ? -13.991 42.199 27.464 1.00 21.67 ? 93  VAL A O     1 
ATOM   699  C  CB    . VAL A 1 93  ? -12.867 45.370 27.510 1.00 18.42 ? 93  VAL A CB    1 
ATOM   700  C  CG1   . VAL A 1 93  ? -13.632 45.154 28.777 1.00 17.30 ? 93  VAL A CG1   1 
ATOM   701  C  CG2   . VAL A 1 93  ? -11.630 46.193 27.759 1.00 14.52 ? 93  VAL A CG2   1 
ATOM   702  N  N     . ARG A 1 94  ? -14.631 43.509 25.735 1.00 22.07 ? 94  ARG A N     1 
ATOM   703  C  CA    . ARG A 1 94  ? -15.909 42.805 25.508 1.00 22.48 ? 94  ARG A CA    1 
ATOM   704  C  C     . ARG A 1 94  ? -15.836 41.317 25.244 1.00 21.82 ? 94  ARG A C     1 
ATOM   705  O  O     . ARG A 1 94  ? -16.851 40.634 25.333 1.00 22.11 ? 94  ARG A O     1 
ATOM   706  C  CB    . ARG A 1 94  ? -16.713 43.441 24.384 1.00 24.72 ? 94  ARG A CB    1 
ATOM   707  C  CG    . ARG A 1 94  ? -17.029 44.883 24.607 1.00 29.75 ? 94  ARG A CG    1 
ATOM   708  C  CD    . ARG A 1 94  ? -17.881 45.440 23.479 1.00 33.78 ? 94  ARG A CD    1 
ATOM   709  N  NE    . ARG A 1 94  ? -17.565 46.846 23.210 1.00 37.62 ? 94  ARG A NE    1 
ATOM   710  C  CZ    . ARG A 1 94  ? -18.357 47.591 22.438 1.00 39.12 ? 94  ARG A CZ    1 
ATOM   711  N  NH1   . ARG A 1 94  ? -19.468 47.070 21.902 1.00 39.44 ? 94  ARG A NH1   1 
ATOM   712  N  NH2   . ARG A 1 94  ? -18.020 48.852 22.174 1.00 39.94 ? 94  ARG A NH2   1 
ATOM   713  N  N     . GLU A 1 95  ? -14.667 40.808 24.892 1.00 21.13 ? 95  GLU A N     1 
ATOM   714  C  CA    . GLU A 1 95  ? -14.537 39.388 24.642 1.00 21.43 ? 95  GLU A CA    1 
ATOM   715  C  C     . GLU A 1 95  ? -14.124 38.654 25.884 1.00 20.65 ? 95  GLU A C     1 
ATOM   716  O  O     . GLU A 1 95  ? -14.432 37.470 26.025 1.00 20.99 ? 95  GLU A O     1 
ATOM   717  C  CB    . GLU A 1 95  ? -13.487 39.105 23.574 1.00 23.76 ? 95  GLU A CB    1 
ATOM   718  C  CG    . GLU A 1 95  ? -13.784 39.752 22.233 1.00 28.68 ? 95  GLU A CG    1 
ATOM   719  C  CD    . GLU A 1 95  ? -12.636 39.619 21.247 1.00 31.60 ? 95  GLU A CD    1 
ATOM   720  O  OE1   . GLU A 1 95  ? -12.813 40.093 20.096 1.00 33.87 ? 95  GLU A OE1   1 
ATOM   721  O  OE2   . GLU A 1 95  ? -11.565 39.049 21.611 1.00 32.13 ? 95  GLU A OE2   1 
ATOM   722  N  N     . ARG A 1 96  ? -13.418 39.342 26.780 1.00 19.22 ? 96  ARG A N     1 
ATOM   723  C  CA    . ARG A 1 96  ? -12.906 38.711 27.999 1.00 17.80 ? 96  ARG A CA    1 
ATOM   724  C  C     . ARG A 1 96  ? -13.776 38.917 29.233 1.00 16.54 ? 96  ARG A C     1 
ATOM   725  O  O     . ARG A 1 96  ? -13.656 38.176 30.206 1.00 16.27 ? 96  ARG A O     1 
ATOM   726  C  CB    . ARG A 1 96  ? -11.490 39.231 28.302 1.00 18.45 ? 96  ARG A CB    1 
ATOM   727  C  CG    . ARG A 1 96  ? -10.506 39.156 27.119 1.00 19.91 ? 96  ARG A CG    1 
ATOM   728  C  CD    . ARG A 1 96  ? -9.197  39.961 27.344 1.00 19.64 ? 96  ARG A CD    1 
ATOM   729  N  NE    . ARG A 1 96  ? -8.211  39.659 26.303 1.00 18.69 ? 96  ARG A NE    1 
ATOM   730  C  CZ    . ARG A 1 96  ? -6.962  40.125 26.345 1.00 19.60 ? 96  ARG A CZ    1 
ATOM   731  N  NH1   . ARG A 1 96  ? -6.522  40.883 27.331 1.00 18.41 ? 96  ARG A NH1   1 
ATOM   732  N  NH2   . ARG A 1 96  ? -6.151  39.891 25.330 1.00 21.81 ? 96  ARG A NH2   1 
ATOM   733  N  N     . LEU A 1 97  ? -14.642 39.926 29.202 1.00 15.50 ? 97  LEU A N     1 
ATOM   734  C  CA    . LEU A 1 97  ? -15.484 40.244 30.359 1.00 13.74 ? 97  LEU A CA    1 
ATOM   735  C  C     . LEU A 1 97  ? -16.948 39.815 30.293 1.00 13.21 ? 97  LEU A C     1 
ATOM   736  O  O     . LEU A 1 97  ? -17.613 39.917 29.260 1.00 13.45 ? 97  LEU A O     1 
ATOM   737  C  CB    . LEU A 1 97  ? -15.391 41.745 30.666 1.00 12.96 ? 97  LEU A CB    1 
ATOM   738  C  CG    . LEU A 1 97  ? -16.221 42.381 31.786 1.00 12.27 ? 97  LEU A CG    1 
ATOM   739  C  CD1   . LEU A 1 97  ? -15.573 42.152 33.100 1.00 10.50 ? 97  LEU A CD1   1 
ATOM   740  C  CD2   . LEU A 1 97  ? -16.345 43.875 31.541 1.00 12.19 ? 97  LEU A CD2   1 
ATOM   741  N  N     . LEU A 1 98  ? -17.412 39.309 31.422 1.00 12.50 ? 98  LEU A N     1 
ATOM   742  C  CA    . LEU A 1 98  ? -18.777 38.855 31.646 1.00 11.92 ? 98  LEU A CA    1 
ATOM   743  C  C     . LEU A 1 98  ? -19.261 39.520 32.952 1.00 11.16 ? 98  LEU A C     1 
ATOM   744  O  O     . LEU A 1 98  ? -18.462 39.938 33.782 1.00 10.59 ? 98  LEU A O     1 
ATOM   745  C  CB    . LEU A 1 98  ? -18.795 37.321 31.816 1.00 11.30 ? 98  LEU A CB    1 
ATOM   746  C  CG    . LEU A 1 98  ? -18.523 36.494 30.557 1.00 12.76 ? 98  LEU A CG    1 
ATOM   747  C  CD1   . LEU A 1 98  ? -18.468 34.978 30.855 1.00 11.65 ? 98  LEU A CD1   1 
ATOM   748  C  CD2   . LEU A 1 98  ? -19.621 36.804 29.537 1.00 10.98 ? 98  LEU A CD2   1 
ATOM   749  N  N     . LEU A 1 99  ? -20.560 39.630 33.147 1.00 11.01 ? 99  LEU A N     1 
ATOM   750  C  CA    . LEU A 1 99  ? -21.037 40.231 34.382 1.00 11.31 ? 99  LEU A CA    1 
ATOM   751  C  C     . LEU A 1 99  ? -22.348 39.618 34.908 1.00 11.40 ? 99  LEU A C     1 
ATOM   752  O  O     . LEU A 1 99  ? -22.951 38.760 34.249 1.00 10.96 ? 99  LEU A O     1 
ATOM   753  C  CB    . LEU A 1 99  ? -21.070 41.773 34.258 1.00 9.77  ? 99  LEU A CB    1 
ATOM   754  C  CG    . LEU A 1 99  ? -21.732 42.467 33.069 1.00 10.29 ? 99  LEU A CG    1 
ATOM   755  C  CD1   . LEU A 1 99  ? -23.194 42.768 33.385 1.00 10.56 ? 99  LEU A CD1   1 
ATOM   756  C  CD2   . LEU A 1 99  ? -21.021 43.764 32.735 1.00 9.71  ? 99  LEU A CD2   1 
ATOM   757  N  N     . SER A 1 100 ? -22.734 39.980 36.131 1.00 11.91 ? 100 SER A N     1 
ATOM   758  C  CA    . SER A 1 100 ? -23.962 39.443 36.707 1.00 11.50 ? 100 SER A CA    1 
ATOM   759  C  C     . SER A 1 100 ? -25.171 40.363 36.555 1.00 12.00 ? 100 SER A C     1 
ATOM   760  O  O     . SER A 1 100 ? -25.095 41.568 36.857 1.00 11.49 ? 100 SER A O     1 
ATOM   761  C  CB    . SER A 1 100 ? -23.775 39.118 38.188 1.00 10.89 ? 100 SER A CB    1 
ATOM   762  O  OG    . SER A 1 100 ? -24.943 38.485 38.732 1.00 10.27 ? 100 SER A OG    1 
ATOM   763  N  N     . GLU A 1 101 ? -26.298 39.789 36.128 1.00 10.80 ? 101 GLU A N     1 
ATOM   764  C  CA    . GLU A 1 101 ? -27.526 40.573 35.995 1.00 10.43 ? 101 GLU A CA    1 
ATOM   765  C  C     . GLU A 1 101 ? -27.997 41.012 37.377 1.00 10.16 ? 101 GLU A C     1 
ATOM   766  O  O     . GLU A 1 101 ? -28.887 41.857 37.494 1.00 9.81  ? 101 GLU A O     1 
ATOM   767  C  CB    . GLU A 1 101 ? -28.632 39.754 35.297 1.00 10.23 ? 101 GLU A CB    1 
ATOM   768  C  CG    . GLU A 1 101 ? -28.966 38.470 35.971 1.00 9.15  ? 101 GLU A CG    1 
ATOM   769  C  CD    . GLU A 1 101 ? -29.753 37.536 35.098 1.00 11.12 ? 101 GLU A CD    1 
ATOM   770  O  OE1   . GLU A 1 101 ? -31.003 37.632 35.037 1.00 11.98 ? 101 GLU A OE1   1 
ATOM   771  O  OE2   . GLU A 1 101 ? -29.127 36.654 34.490 1.00 12.46 ? 101 GLU A OE2   1 
ATOM   772  N  N     . ALA A 1 102 ? -27.415 40.418 38.422 1.00 10.56 ? 102 ALA A N     1 
ATOM   773  C  CA    . ALA A 1 102 ? -27.777 40.741 39.798 1.00 10.33 ? 102 ALA A CA    1 
ATOM   774  C  C     . ALA A 1 102 ? -26.974 41.902 40.366 1.00 10.95 ? 102 ALA A C     1 
ATOM   775  O  O     . ALA A 1 102 ? -27.243 42.334 41.488 1.00 12.81 ? 102 ALA A O     1 
ATOM   776  C  CB    . ALA A 1 102 ? -27.634 39.521 40.678 1.00 9.46  ? 102 ALA A CB    1 
ATOM   777  N  N     . CYS A 1 103 ? -26.000 42.416 39.613 1.00 10.04 ? 103 CYS A N     1 
ATOM   778  C  CA    . CYS A 1 103 ? -25.194 43.548 40.091 1.00 9.78  ? 103 CYS A CA    1 
ATOM   779  C  C     . CYS A 1 103 ? -26.025 44.812 40.201 1.00 10.22 ? 103 CYS A C     1 
ATOM   780  O  O     . CYS A 1 103 ? -26.746 45.145 39.266 1.00 11.18 ? 103 CYS A O     1 
ATOM   781  C  CB    . CYS A 1 103 ? -24.053 43.876 39.126 1.00 7.36  ? 103 CYS A CB    1 
ATOM   782  S  SG    . CYS A 1 103 ? -22.784 42.663 39.021 1.00 9.92  ? 103 CYS A SG    1 
ATOM   783  N  N     . PRO A 1 104 ? -26.001 45.492 41.362 1.00 11.07 ? 104 PRO A N     1 
ATOM   784  C  CA    . PRO A 1 104 ? -26.795 46.727 41.424 1.00 10.96 ? 104 PRO A CA    1 
ATOM   785  C  C     . PRO A 1 104 ? -26.087 47.748 40.514 1.00 11.59 ? 104 PRO A C     1 
ATOM   786  O  O     . PRO A 1 104 ? -24.900 47.574 40.201 1.00 11.89 ? 104 PRO A O     1 
ATOM   787  C  CB    . PRO A 1 104 ? -26.653 47.160 42.892 1.00 9.82  ? 104 PRO A CB    1 
ATOM   788  C  CG    . PRO A 1 104 ? -26.419 45.892 43.633 1.00 9.21  ? 104 PRO A CG    1 
ATOM   789  C  CD    . PRO A 1 104 ? -25.553 45.070 42.710 1.00 10.40 ? 104 PRO A CD    1 
ATOM   790  N  N     . LEU A 1 105 ? -26.802 48.798 40.113 1.00 11.68 ? 105 LEU A N     1 
ATOM   791  C  CA    . LEU A 1 105 ? -26.227 49.858 39.290 1.00 12.49 ? 105 LEU A CA    1 
ATOM   792  C  C     . LEU A 1 105 ? -25.997 51.130 40.131 1.00 13.01 ? 105 LEU A C     1 
ATOM   793  O  O     . LEU A 1 105 ? -26.838 51.506 40.957 1.00 12.68 ? 105 LEU A O     1 
ATOM   794  C  CB    . LEU A 1 105 ? -27.148 50.225 38.109 1.00 11.37 ? 105 LEU A CB    1 
ATOM   795  C  CG    . LEU A 1 105 ? -27.489 49.132 37.087 1.00 12.26 ? 105 LEU A CG    1 
ATOM   796  C  CD1   . LEU A 1 105 ? -28.665 49.580 36.246 1.00 11.51 ? 105 LEU A CD1   1 
ATOM   797  C  CD2   . LEU A 1 105 ? -26.273 48.777 36.239 1.00 9.92  ? 105 LEU A CD2   1 
ATOM   798  N  N     . ILE A 1 106 ? -24.854 51.782 39.895 1.00 13.10 ? 106 ILE A N     1 
ATOM   799  C  CA    . ILE A 1 106 ? -24.489 53.029 40.558 1.00 12.37 ? 106 ILE A CA    1 
ATOM   800  C  C     . ILE A 1 106 ? -24.781 54.071 39.492 1.00 12.97 ? 106 ILE A C     1 
ATOM   801  O  O     . ILE A 1 106 ? -24.183 54.042 38.411 1.00 13.07 ? 106 ILE A O     1 
ATOM   802  C  CB    . ILE A 1 106 ? -22.974 53.107 40.884 1.00 10.71 ? 106 ILE A CB    1 
ATOM   803  C  CG1   . ILE A 1 106 ? -22.543 51.935 41.773 1.00 11.26 ? 106 ILE A CG1   1 
ATOM   804  C  CG2   . ILE A 1 106 ? -22.662 54.393 41.571 1.00 8.59  ? 106 ILE A CG2   1 
ATOM   805  C  CD1   . ILE A 1 106 ? -21.129 52.032 42.295 1.00 8.15  ? 106 ILE A CD1   1 
ATOM   806  N  N     . LEU A 1 107 ? -25.728 54.959 39.782 1.00 13.89 ? 107 LEU A N     1 
ATOM   807  C  CA    . LEU A 1 107 ? -26.113 56.029 38.856 1.00 14.03 ? 107 LEU A CA    1 
ATOM   808  C  C     . LEU A 1 107 ? -25.716 57.391 39.445 1.00 15.31 ? 107 LEU A C     1 
ATOM   809  O  O     . LEU A 1 107 ? -25.292 57.467 40.611 1.00 14.20 ? 107 LEU A O     1 
ATOM   810  C  CB    . LEU A 1 107 ? -27.597 55.935 38.506 1.00 11.58 ? 107 LEU A CB    1 
ATOM   811  C  CG    . LEU A 1 107 ? -28.018 54.563 37.939 1.00 11.22 ? 107 LEU A CG    1 
ATOM   812  C  CD1   . LEU A 1 107 ? -29.489 54.497 37.887 1.00 9.58  ? 107 LEU A CD1   1 
ATOM   813  C  CD2   . LEU A 1 107 ? -27.431 54.219 36.543 1.00 10.28 ? 107 LEU A CD2   1 
ATOM   814  N  N     . ASP A 1 108 ? -25.798 58.455 38.639 1.00 17.24 ? 108 ASP A N     1 
ATOM   815  C  CA    . ASP A 1 108 ? -25.377 59.770 39.123 1.00 18.63 ? 108 ASP A CA    1 
ATOM   816  C  C     . ASP A 1 108 ? -25.981 60.173 40.464 1.00 17.27 ? 108 ASP A C     1 
ATOM   817  O  O     . ASP A 1 108 ? -25.295 60.820 41.260 1.00 16.54 ? 108 ASP A O     1 
ATOM   818  C  CB    . ASP A 1 108 ? -25.599 60.879 38.082 1.00 23.07 ? 108 ASP A CB    1 
ATOM   819  C  CG    . ASP A 1 108 ? -24.682 60.751 36.851 1.00 27.99 ? 108 ASP A CG    1 
ATOM   820  O  OD1   . ASP A 1 108 ? -23.897 59.766 36.738 1.00 30.76 ? 108 ASP A OD1   1 
ATOM   821  O  OD2   . ASP A 1 108 ? -24.768 61.641 35.963 1.00 29.76 ? 108 ASP A OD2   1 
ATOM   822  N  N     . TYR A 1 109 ? -27.243 59.810 40.739 1.00 15.44 ? 109 TYR A N     1 
ATOM   823  C  CA    . TYR A 1 109 ? -27.822 60.195 42.044 1.00 14.55 ? 109 TYR A CA    1 
ATOM   824  C  C     . TYR A 1 109 ? -27.073 59.595 43.262 1.00 13.78 ? 109 TYR A C     1 
ATOM   825  O  O     . TYR A 1 109 ? -26.985 60.235 44.300 1.00 14.89 ? 109 TYR A O     1 
ATOM   826  C  CB    . TYR A 1 109 ? -29.341 59.948 42.127 1.00 13.89 ? 109 TYR A CB    1 
ATOM   827  C  CG    . TYR A 1 109 ? -29.828 58.580 41.672 1.00 13.76 ? 109 TYR A CG    1 
ATOM   828  C  CD1   . TYR A 1 109 ? -30.046 57.539 42.591 1.00 12.34 ? 109 TYR A CD1   1 
ATOM   829  C  CD2   . TYR A 1 109 ? -30.061 58.324 40.316 1.00 13.57 ? 109 TYR A CD2   1 
ATOM   830  C  CE1   . TYR A 1 109 ? -30.475 56.288 42.165 1.00 11.67 ? 109 TYR A CE1   1 
ATOM   831  C  CE2   . TYR A 1 109 ? -30.490 57.062 39.879 1.00 12.93 ? 109 TYR A CE2   1 
ATOM   832  C  CZ    . TYR A 1 109 ? -30.689 56.055 40.804 1.00 12.04 ? 109 TYR A CZ    1 
ATOM   833  O  OH    . TYR A 1 109 ? -31.079 54.823 40.336 1.00 12.32 ? 109 TYR A OH    1 
ATOM   834  N  N     . HIS A 1 110 ? -26.494 58.406 43.116 1.00 12.63 ? 110 HIS A N     1 
ATOM   835  C  CA    . HIS A 1 110 ? -25.750 57.782 44.195 1.00 13.41 ? 110 HIS A CA    1 
ATOM   836  C  C     . HIS A 1 110 ? -24.545 58.635 44.500 1.00 14.43 ? 110 HIS A C     1 
ATOM   837  O  O     . HIS A 1 110 ? -24.161 58.767 45.659 1.00 14.54 ? 110 HIS A O     1 
ATOM   838  C  CB    . HIS A 1 110 ? -25.333 56.357 43.837 1.00 11.80 ? 110 HIS A CB    1 
ATOM   839  C  CG    . HIS A 1 110 ? -26.489 55.416 43.723 1.00 12.75 ? 110 HIS A CG    1 
ATOM   840  N  ND1   . HIS A 1 110 ? -26.639 54.574 42.639 1.00 13.03 ? 110 HIS A ND1   1 
ATOM   841  C  CD2   . HIS A 1 110 ? -27.539 55.252 44.573 1.00 12.24 ? 110 HIS A CD2   1 
ATOM   842  C  CE1   . HIS A 1 110 ? -27.768 53.916 42.848 1.00 13.29 ? 110 HIS A CE1   1 
ATOM   843  N  NE2   . HIS A 1 110 ? -28.351 54.296 44.009 1.00 13.42 ? 110 HIS A NE2   1 
ATOM   844  N  N     . VAL A 1 111 ? -23.947 59.230 43.467 1.00 16.19 ? 111 VAL A N     1 
ATOM   845  C  CA    . VAL A 1 111 ? -22.787 60.102 43.674 1.00 17.10 ? 111 VAL A CA    1 
ATOM   846  C  C     . VAL A 1 111 ? -23.235 61.385 44.399 1.00 18.10 ? 111 VAL A C     1 
ATOM   847  O  O     . VAL A 1 111 ? -22.572 61.842 45.351 1.00 18.67 ? 111 VAL A O     1 
ATOM   848  C  CB    . VAL A 1 111 ? -22.076 60.470 42.363 1.00 17.36 ? 111 VAL A CB    1 
ATOM   849  C  CG1   . VAL A 1 111 ? -20.916 61.415 42.685 1.00 18.56 ? 111 VAL A CG1   1 
ATOM   850  C  CG2   . VAL A 1 111 ? -21.529 59.208 41.682 1.00 16.31 ? 111 VAL A CG2   1 
ATOM   851  N  N     . ALA A 1 112 ? -24.370 61.938 43.969 1.00 16.76 ? 112 ALA A N     1 
ATOM   852  C  CA    . ALA A 1 112 ? -24.921 63.118 44.605 1.00 16.46 ? 112 ALA A CA    1 
ATOM   853  C  C     . ALA A 1 112 ? -25.225 62.828 46.102 1.00 17.40 ? 112 ALA A C     1 
ATOM   854  O  O     . ALA A 1 112 ? -24.994 63.693 46.978 1.00 17.43 ? 112 ALA A O     1 
ATOM   855  C  CB    . ALA A 1 112 ? -26.184 63.535 43.882 1.00 16.48 ? 112 ALA A CB    1 
ATOM   856  N  N     . LEU A 1 113 ? -25.745 61.627 46.404 1.00 16.76 ? 113 LEU A N     1 
ATOM   857  C  CA    . LEU A 1 113 ? -26.054 61.260 47.797 1.00 16.64 ? 113 LEU A CA    1 
ATOM   858  C  C     . LEU A 1 113 ? -24.788 61.069 48.598 1.00 16.65 ? 113 LEU A C     1 
ATOM   859  O  O     . LEU A 1 113 ? -24.683 61.560 49.707 1.00 16.99 ? 113 LEU A O     1 
ATOM   860  C  CB    . LEU A 1 113 ? -26.855 59.965 47.887 1.00 16.37 ? 113 LEU A CB    1 
ATOM   861  C  CG    . LEU A 1 113 ? -28.247 60.022 47.284 1.00 17.96 ? 113 LEU A CG    1 
ATOM   862  C  CD1   . LEU A 1 113 ? -28.704 58.636 46.923 1.00 17.74 ? 113 LEU A CD1   1 
ATOM   863  C  CD2   . LEU A 1 113 ? -29.217 60.752 48.233 1.00 17.94 ? 113 LEU A CD2   1 
ATOM   864  N  N     . ASP A 1 114 ? -23.826 60.354 48.036 1.00 15.82 ? 114 ASP A N     1 
ATOM   865  C  CA    . ASP A 1 114 ? -22.590 60.103 48.750 1.00 15.93 ? 114 ASP A CA    1 
ATOM   866  C  C     . ASP A 1 114 ? -21.961 61.446 49.160 1.00 15.07 ? 114 ASP A C     1 
ATOM   867  O  O     . ASP A 1 114 ? -21.542 61.608 50.288 1.00 14.96 ? 114 ASP A O     1 
ATOM   868  C  CB    . ASP A 1 114 ? -21.631 59.240 47.877 1.00 16.44 ? 114 ASP A CB    1 
ATOM   869  C  CG    . ASP A 1 114 ? -20.422 58.718 48.658 1.00 17.07 ? 114 ASP A CG    1 
ATOM   870  O  OD1   . ASP A 1 114 ? -19.572 58.012 48.090 1.00 17.14 ? 114 ASP A OD1   1 
ATOM   871  O  OD2   . ASP A 1 114 ? -20.288 59.006 49.856 1.00 17.89 ? 114 ASP A OD2   1 
ATOM   872  N  N     . ASN A 1 115 ? -21.942 62.411 48.246 1.00 15.22 ? 115 ASN A N     1 
ATOM   873  C  CA    . ASN A 1 115 ? -21.375 63.736 48.492 1.00 14.25 ? 115 ASN A CA    1 
ATOM   874  C  C     . ASN A 1 115 ? -22.166 64.472 49.539 1.00 13.38 ? 115 ASN A C     1 
ATOM   875  O  O     . ASN A 1 115 ? -21.584 65.107 50.415 1.00 10.99 ? 115 ASN A O     1 
ATOM   876  C  CB    . ASN A 1 115 ? -21.357 64.574 47.210 1.00 15.61 ? 115 ASN A CB    1 
ATOM   877  C  CG    . ASN A 1 115 ? -20.473 63.994 46.139 1.00 15.43 ? 115 ASN A CG    1 
ATOM   878  O  OD1   . ASN A 1 115 ? -20.697 64.244 44.949 1.00 18.00 ? 115 ASN A OD1   1 
ATOM   879  N  ND2   . ASN A 1 115 ? -19.459 63.235 46.536 1.00 14.19 ? 115 ASN A ND2   1 
ATOM   880  N  N     . ALA A 1 116 ? -23.491 64.440 49.405 1.00 13.76 ? 116 ALA A N     1 
ATOM   881  C  CA    . ALA A 1 116 ? -24.358 65.066 50.396 1.00 15.25 ? 116 ALA A CA    1 
ATOM   882  C  C     . ALA A 1 116 ? -24.080 64.467 51.778 1.00 16.89 ? 116 ALA A C     1 
ATOM   883  O  O     . ALA A 1 116 ? -23.663 65.183 52.698 1.00 17.80 ? 116 ALA A O     1 
ATOM   884  C  CB    . ALA A 1 116 ? -25.826 64.864 50.043 1.00 14.98 ? 116 ALA A CB    1 
ATOM   885  N  N     . ARG A 1 117 ? -24.259 63.155 51.926 1.00 16.92 ? 117 ARG A N     1 
ATOM   886  C  CA    . ARG A 1 117 ? -24.041 62.539 53.225 1.00 18.20 ? 117 ARG A CA    1 
ATOM   887  C  C     . ARG A 1 117 ? -22.666 62.936 53.745 1.00 18.79 ? 117 ARG A C     1 
ATOM   888  O  O     . ARG A 1 117 ? -22.516 63.408 54.875 1.00 20.45 ? 117 ARG A O     1 
ATOM   889  C  CB    . ARG A 1 117 ? -24.149 61.005 53.174 1.00 17.21 ? 117 ARG A CB    1 
ATOM   890  C  CG    . ARG A 1 117 ? -25.182 60.460 52.236 1.00 18.00 ? 117 ARG A CG    1 
ATOM   891  C  CD    . ARG A 1 117 ? -26.430 59.929 52.873 1.00 17.48 ? 117 ARG A CD    1 
ATOM   892  N  NE    . ARG A 1 117 ? -26.794 58.692 52.158 1.00 17.96 ? 117 ARG A NE    1 
ATOM   893  C  CZ    . ARG A 1 117 ? -28.034 58.431 51.752 1.00 16.72 ? 117 ARG A CZ    1 
ATOM   894  N  NH1   . ARG A 1 117 ? -29.021 59.302 51.995 1.00 16.07 ? 117 ARG A NH1   1 
ATOM   895  N  NH2   . ARG A 1 117 ? -28.265 57.304 51.083 1.00 13.73 ? 117 ARG A NH2   1 
ATOM   896  N  N     . GLU A 1 118 ? -21.658 62.779 52.913 1.00 19.03 ? 118 GLU A N     1 
ATOM   897  C  CA    . GLU A 1 118 ? -20.310 63.111 53.325 1.00 20.09 ? 118 GLU A CA    1 
ATOM   898  C  C     . GLU A 1 118 ? -20.238 64.567 53.854 1.00 21.99 ? 118 GLU A C     1 
ATOM   899  O  O     . GLU A 1 118 ? -19.692 64.838 54.949 1.00 21.40 ? 118 GLU A O     1 
ATOM   900  C  CB    . GLU A 1 118 ? -19.367 62.808 52.174 1.00 18.28 ? 118 GLU A CB    1 
ATOM   901  C  CG    . GLU A 1 118 ? -17.964 62.570 52.582 1.00 20.60 ? 118 GLU A CG    1 
ATOM   902  C  CD    . GLU A 1 118 ? -17.725 61.340 53.458 1.00 19.78 ? 118 GLU A CD    1 
ATOM   903  O  OE1   . GLU A 1 118 ? -16.597 60.809 53.366 1.00 19.70 ? 118 GLU A OE1   1 
ATOM   904  O  OE2   . GLU A 1 118 ? -18.592 60.929 54.259 1.00 18.23 ? 118 GLU A OE2   1 
ATOM   905  N  N     . LYS A 1 119 ? -20.850 65.487 53.106 1.00 23.34 ? 119 LYS A N     1 
ATOM   906  C  CA    . LYS A 1 119 ? -20.933 66.884 53.505 1.00 24.13 ? 119 LYS A CA    1 
ATOM   907  C  C     . LYS A 1 119 ? -21.635 66.907 54.890 1.00 24.84 ? 119 LYS A C     1 
ATOM   908  O  O     . LYS A 1 119 ? -21.066 67.364 55.889 1.00 26.02 ? 119 LYS A O     1 
ATOM   909  C  CB    . LYS A 1 119 ? -21.772 67.643 52.464 1.00 25.22 ? 119 LYS A CB    1 
ATOM   910  C  CG    . LYS A 1 119 ? -22.058 69.126 52.727 1.00 26.67 ? 119 LYS A CG    1 
ATOM   911  C  CD    . LYS A 1 119 ? -21.128 70.088 51.919 1.00 29.00 ? 119 LYS A CD    1 
ATOM   912  C  CE    . LYS A 1 119 ? -21.446 70.254 50.397 1.00 29.70 ? 119 LYS A CE    1 
ATOM   913  N  NZ    . LYS A 1 119 ? -21.220 69.049 49.463 1.00 30.86 ? 119 LYS A NZ    1 
ATOM   914  N  N     . ALA A 1 120 ? -22.837 66.350 54.975 1.00 24.37 ? 120 ALA A N     1 
ATOM   915  C  CA    . ALA A 1 120 ? -23.578 66.378 56.234 1.00 24.17 ? 120 ALA A CA    1 
ATOM   916  C  C     . ALA A 1 120 ? -22.755 65.964 57.445 1.00 25.25 ? 120 ALA A C     1 
ATOM   917  O  O     . ALA A 1 120 ? -22.897 66.571 58.499 1.00 25.77 ? 120 ALA A O     1 
ATOM   918  C  CB    . ALA A 1 120 ? -24.845 65.566 56.143 1.00 22.42 ? 120 ALA A CB    1 
ATOM   919  N  N     . ARG A 1 121 ? -21.888 64.956 57.301 1.00 26.26 ? 121 ARG A N     1 
ATOM   920  C  CA    . ARG A 1 121 ? -21.033 64.491 58.412 1.00 26.18 ? 121 ARG A CA    1 
ATOM   921  C  C     . ARG A 1 121 ? -20.004 65.521 58.913 1.00 26.48 ? 121 ARG A C     1 
ATOM   922  O  O     . ARG A 1 121 ? -19.377 65.337 59.954 1.00 25.99 ? 121 ARG A O     1 
ATOM   923  C  CB    . ARG A 1 121 ? -20.319 63.179 58.046 1.00 26.12 ? 121 ARG A CB    1 
ATOM   924  C  CG    . ARG A 1 121 ? -21.259 61.982 57.861 1.00 25.39 ? 121 ARG A CG    1 
ATOM   925  C  CD    . ARG A 1 121 ? -20.504 60.658 57.809 1.00 25.90 ? 121 ARG A CD    1 
ATOM   926  N  NE    . ARG A 1 121 ? -19.660 60.477 58.999 1.00 28.03 ? 121 ARG A NE    1 
ATOM   927  C  CZ    . ARG A 1 121 ? -19.904 59.524 59.904 1.00 28.04 ? 121 ARG A CZ    1 
ATOM   928  N  NH1   . ARG A 1 121 ? -20.933 58.689 59.737 1.00 29.15 ? 121 ARG A NH1   1 
ATOM   929  N  NH2   . ARG A 1 121 ? -19.131 59.424 60.987 1.00 27.38 ? 121 ARG A NH2   1 
ATOM   930  N  N     . GLY A 1 122 ? -19.813 66.604 58.180 1.00 27.26 ? 122 GLY A N     1 
ATOM   931  C  CA    . GLY A 1 122 ? -18.867 67.605 58.633 1.00 28.36 ? 122 GLY A CA    1 
ATOM   932  C  C     . GLY A 1 122 ? -17.535 67.046 59.082 1.00 28.95 ? 122 GLY A C     1 
ATOM   933  O  O     . GLY A 1 122 ? -16.890 66.292 58.365 1.00 29.58 ? 122 GLY A O     1 
ATOM   934  N  N     . ALA A 1 123 ? -17.105 67.420 60.274 1.00 29.65 ? 123 ALA A N     1 
ATOM   935  C  CA    . ALA A 1 123 ? -15.825 66.942 60.800 1.00 29.99 ? 123 ALA A CA    1 
ATOM   936  C  C     . ALA A 1 123 ? -15.736 65.414 60.788 1.00 29.55 ? 123 ALA A C     1 
ATOM   937  O  O     . ALA A 1 123 ? -14.690 64.839 60.524 1.00 29.40 ? 123 ALA A O     1 
ATOM   938  C  CB    . ALA A 1 123 ? -15.620 67.461 62.244 1.00 29.67 ? 123 ALA A CB    1 
ATOM   939  N  N     . LYS A 1 124 ? -16.851 64.754 61.050 1.00 29.66 ? 124 LYS A N     1 
ATOM   940  C  CA    . LYS A 1 124 ? -16.845 63.309 61.113 1.00 29.47 ? 124 LYS A CA    1 
ATOM   941  C  C     . LYS A 1 124 ? -17.026 62.643 59.751 1.00 28.04 ? 124 LYS A C     1 
ATOM   942  O  O     . LYS A 1 124 ? -17.635 61.574 59.671 1.00 28.00 ? 124 LYS A O     1 
ATOM   943  C  CB    . LYS A 1 124 ? -17.915 62.837 62.109 1.00 31.57 ? 124 LYS A CB    1 
ATOM   944  C  CG    . LYS A 1 124 ? -19.348 62.881 61.558 1.00 35.54 ? 124 LYS A CG    1 
ATOM   945  C  CD    . LYS A 1 124 ? -20.386 62.369 62.539 1.00 37.78 ? 124 LYS A CD    1 
ATOM   946  C  CE    . LYS A 1 124 ? -21.780 62.441 61.953 1.00 38.42 ? 124 LYS A CE    1 
ATOM   947  N  NZ    . LYS A 1 124 ? -22.712 62.037 63.045 1.00 41.11 ? 124 LYS A NZ    1 
ATOM   948  N  N     . ALA A 1 125 ? -16.506 63.253 58.681 1.00 26.47 ? 125 ALA A N     1 
ATOM   949  C  CA    . ALA A 1 125 ? -16.631 62.666 57.331 1.00 24.07 ? 125 ALA A CA    1 
ATOM   950  C  C     . ALA A 1 125 ? -15.874 61.337 57.206 1.00 22.70 ? 125 ALA A C     1 
ATOM   951  O  O     . ALA A 1 125 ? -14.698 61.248 57.566 1.00 22.99 ? 125 ALA A O     1 
ATOM   952  C  CB    . ALA A 1 125 ? -16.141 63.619 56.286 1.00 23.07 ? 125 ALA A CB    1 
ATOM   953  N  N     . ILE A 1 126 ? -16.546 60.308 56.698 1.00 20.41 ? 126 ILE A N     1 
ATOM   954  C  CA    . ILE A 1 126 ? -15.920 59.007 56.532 1.00 17.78 ? 126 ILE A CA    1 
ATOM   955  C  C     . ILE A 1 126 ? -14.646 59.089 55.683 1.00 17.52 ? 126 ILE A C     1 
ATOM   956  O  O     . ILE A 1 126 ? -13.643 58.396 55.949 1.00 18.27 ? 126 ILE A O     1 
ATOM   957  C  CB    . ILE A 1 126 ? -16.905 58.035 55.878 1.00 16.28 ? 126 ILE A CB    1 
ATOM   958  C  CG1   . ILE A 1 126 ? -17.990 57.658 56.885 1.00 16.09 ? 126 ILE A CG1   1 
ATOM   959  C  CG2   . ILE A 1 126 ? -16.192 56.810 55.367 1.00 14.75 ? 126 ILE A CG2   1 
ATOM   960  C  CD1   . ILE A 1 126 ? -19.129 56.852 56.311 1.00 14.41 ? 126 ILE A CD1   1 
ATOM   961  N  N     . GLY A 1 127 ? -14.675 59.963 54.682 1.00 16.08 ? 127 GLY A N     1 
ATOM   962  C  CA    . GLY A 1 127 ? -13.560 60.099 53.780 1.00 14.66 ? 127 GLY A CA    1 
ATOM   963  C  C     . GLY A 1 127 ? -13.748 59.122 52.632 1.00 14.18 ? 127 GLY A C     1 
ATOM   964  O  O     . GLY A 1 127 ? -12.778 58.523 52.190 1.00 14.69 ? 127 GLY A O     1 
ATOM   965  N  N     . THR A 1 128 ? -14.976 58.967 52.135 1.00 14.28 ? 128 THR A N     1 
ATOM   966  C  CA    . THR A 1 128 ? -15.249 58.046 51.026 1.00 14.83 ? 128 THR A CA    1 
ATOM   967  C  C     . THR A 1 128 ? -14.642 58.463 49.686 1.00 15.44 ? 128 THR A C     1 
ATOM   968  O  O     . THR A 1 128 ? -14.331 59.643 49.467 1.00 15.77 ? 128 THR A O     1 
ATOM   969  C  CB    . THR A 1 128 ? -16.740 57.869 50.764 1.00 15.09 ? 128 THR A CB    1 
ATOM   970  O  OG1   . THR A 1 128 ? -17.228 59.001 50.014 1.00 13.83 ? 128 THR A OG1   1 
ATOM   971  C  CG2   . THR A 1 128 ? -17.506 57.668 52.084 1.00 12.95 ? 128 THR A CG2   1 
ATOM   972  N  N     . THR A 1 129 ? -14.545 57.500 48.766 1.00 16.71 ? 129 THR A N     1 
ATOM   973  C  CA    . THR A 1 129 ? -13.954 57.742 47.438 1.00 17.69 ? 129 THR A CA    1 
ATOM   974  C  C     . THR A 1 129 ? -14.787 58.611 46.471 1.00 17.66 ? 129 THR A C     1 
ATOM   975  O  O     . THR A 1 129 ? -14.385 58.813 45.322 1.00 17.94 ? 129 THR A O     1 
ATOM   976  C  CB    . THR A 1 129 ? -13.548 56.406 46.705 1.00 17.82 ? 129 THR A CB    1 
ATOM   977  O  OG1   . THR A 1 129 ? -14.717 55.632 46.418 1.00 18.38 ? 129 THR A OG1   1 
ATOM   978  C  CG2   . THR A 1 129 ? -12.572 55.565 47.561 1.00 16.93 ? 129 THR A CG2   1 
ATOM   979  N  N     . GLY A 1 130 ? -15.932 59.116 46.929 1.00 17.43 ? 130 GLY A N     1 
ATOM   980  C  CA    . GLY A 1 130 ? -16.749 59.953 46.083 1.00 17.83 ? 130 GLY A CA    1 
ATOM   981  C  C     . GLY A 1 130 ? -17.442 59.272 44.921 1.00 18.49 ? 130 GLY A C     1 
ATOM   982  O  O     . GLY A 1 130 ? -17.794 59.922 43.924 1.00 18.74 ? 130 GLY A O     1 
ATOM   983  N  N     . ARG A 1 131 ? -17.559 57.954 44.996 1.00 18.75 ? 131 ARG A N     1 
ATOM   984  C  CA    . ARG A 1 131 ? -18.273 57.171 43.993 1.00 18.95 ? 131 ARG A CA    1 
ATOM   985  C  C     . ARG A 1 131 ? -19.544 56.885 44.758 1.00 19.76 ? 131 ARG A C     1 
ATOM   986  O  O     . ARG A 1 131 ? -19.568 57.060 45.973 1.00 21.72 ? 131 ARG A O     1 
ATOM   987  C  CB    . ARG A 1 131 ? -17.524 55.897 43.686 1.00 19.21 ? 131 ARG A CB    1 
ATOM   988  C  CG    . ARG A 1 131 ? -16.287 56.151 42.866 1.00 20.70 ? 131 ARG A CG    1 
ATOM   989  C  CD    . ARG A 1 131 ? -15.131 56.562 43.684 1.00 23.58 ? 131 ARG A CD    1 
ATOM   990  N  NE    . ARG A 1 131 ? -14.450 57.743 43.143 1.00 28.60 ? 131 ARG A NE    1 
ATOM   991  C  CZ    . ARG A 1 131 ? -13.924 57.748 41.918 1.00 29.15 ? 131 ARG A CZ    1 
ATOM   992  N  NH1   . ARG A 1 131 ? -14.024 56.666 41.146 1.00 29.37 ? 131 ARG A NH1   1 
ATOM   993  N  NH2   . ARG A 1 131 ? -13.212 58.796 41.504 1.00 28.59 ? 131 ARG A NH2   1 
ATOM   994  N  N     . GLY A 1 132 ? -20.619 56.439 44.146 1.00 19.12 ? 132 GLY A N     1 
ATOM   995  C  CA    . GLY A 1 132 ? -21.796 56.253 45.012 1.00 16.77 ? 132 GLY A CA    1 
ATOM   996  C  C     . GLY A 1 132 ? -21.868 54.895 45.675 1.00 14.92 ? 132 GLY A C     1 
ATOM   997  O  O     . GLY A 1 132 ? -22.957 54.351 45.813 1.00 15.74 ? 132 GLY A O     1 
ATOM   998  N  N     . ILE A 1 133 ? -20.740 54.368 46.141 1.00 13.34 ? 133 ILE A N     1 
ATOM   999  C  CA    . ILE A 1 133 ? -20.723 53.022 46.713 1.00 12.07 ? 133 ILE A CA    1 
ATOM   1000 C  C     . ILE A 1 133 ? -21.772 52.697 47.759 1.00 11.40 ? 133 ILE A C     1 
ATOM   1001 O  O     . ILE A 1 133 ? -22.658 51.887 47.531 1.00 10.25 ? 133 ILE A O     1 
ATOM   1002 C  CB    . ILE A 1 133 ? -19.336 52.642 47.247 1.00 11.68 ? 133 ILE A CB    1 
ATOM   1003 C  CG1   . ILE A 1 133 ? -18.247 53.032 46.227 1.00 12.00 ? 133 ILE A CG1   1 
ATOM   1004 C  CG2   . ILE A 1 133 ? -19.297 51.131 47.513 1.00 11.67 ? 133 ILE A CG2   1 
ATOM   1005 C  CD1   . ILE A 1 133 ? -18.381 52.364 44.813 1.00 10.01 ? 133 ILE A CD1   1 
ATOM   1006 N  N     . GLY A 1 134 ? -21.680 53.366 48.901 1.00 12.69 ? 134 GLY A N     1 
ATOM   1007 C  CA    . GLY A 1 134 ? -22.601 53.128 49.994 1.00 12.25 ? 134 GLY A CA    1 
ATOM   1008 C  C     . GLY A 1 134 ? -24.027 53.274 49.569 1.00 11.90 ? 134 GLY A C     1 
ATOM   1009 O  O     . GLY A 1 134 ? -24.838 52.387 49.829 1.00 12.59 ? 134 GLY A O     1 
ATOM   1010 N  N     . PRO A 1 135 ? -24.377 54.411 48.959 1.00 12.28 ? 135 PRO A N     1 
ATOM   1011 C  CA    . PRO A 1 135 ? -25.754 54.647 48.498 1.00 12.86 ? 135 PRO A CA    1 
ATOM   1012 C  C     . PRO A 1 135 ? -26.262 53.538 47.584 1.00 12.60 ? 135 PRO A C     1 
ATOM   1013 O  O     . PRO A 1 135 ? -27.424 53.131 47.675 1.00 12.53 ? 135 PRO A O     1 
ATOM   1014 C  CB    . PRO A 1 135 ? -25.648 55.990 47.776 1.00 11.95 ? 135 PRO A CB    1 
ATOM   1015 C  CG    . PRO A 1 135 ? -24.645 56.721 48.626 1.00 10.70 ? 135 PRO A CG    1 
ATOM   1016 C  CD    . PRO A 1 135 ? -23.582 55.655 48.897 1.00 11.69 ? 135 PRO A CD    1 
ATOM   1017 N  N     . ALA A 1 136 ? -25.406 53.052 46.692 1.00 12.73 ? 136 ALA A N     1 
ATOM   1018 C  CA    . ALA A 1 136 ? -25.839 51.964 45.815 1.00 13.17 ? 136 ALA A CA    1 
ATOM   1019 C  C     . ALA A 1 136 ? -26.137 50.725 46.674 1.00 13.04 ? 136 ALA A C     1 
ATOM   1020 O  O     . ALA A 1 136 ? -27.100 50.006 46.380 1.00 13.84 ? 136 ALA A O     1 
ATOM   1021 C  CB    . ALA A 1 136 ? -24.796 51.668 44.732 1.00 11.26 ? 136 ALA A CB    1 
ATOM   1022 N  N     . TYR A 1 137 ? -25.341 50.490 47.734 1.00 12.53 ? 137 TYR A N     1 
ATOM   1023 C  CA    . TYR A 1 137 ? -25.553 49.351 48.653 1.00 12.25 ? 137 TYR A CA    1 
ATOM   1024 C  C     . TYR A 1 137 ? -26.801 49.547 49.510 1.00 13.17 ? 137 TYR A C     1 
ATOM   1025 O  O     . TYR A 1 137 ? -27.496 48.568 49.834 1.00 13.55 ? 137 TYR A O     1 
ATOM   1026 C  CB    . TYR A 1 137 ? -24.331 49.071 49.535 1.00 10.96 ? 137 TYR A CB    1 
ATOM   1027 C  CG    . TYR A 1 137 ? -23.272 48.192 48.852 1.00 10.30 ? 137 TYR A CG    1 
ATOM   1028 C  CD1   . TYR A 1 137 ? -21.996 48.704 48.525 1.00 8.13  ? 137 TYR A CD1   1 
ATOM   1029 C  CD2   . TYR A 1 137 ? -23.546 46.856 48.540 1.00 7.10  ? 137 TYR A CD2   1 
ATOM   1030 C  CE1   . TYR A 1 137 ? -21.041 47.914 47.915 1.00 7.72  ? 137 TYR A CE1   1 
ATOM   1031 C  CE2   . TYR A 1 137 ? -22.598 46.054 47.934 1.00 7.26  ? 137 TYR A CE2   1 
ATOM   1032 C  CZ    . TYR A 1 137 ? -21.345 46.580 47.621 1.00 8.93  ? 137 TYR A CZ    1 
ATOM   1033 O  OH    . TYR A 1 137 ? -20.391 45.772 47.032 1.00 9.40  ? 137 TYR A OH    1 
ATOM   1034 N  N     . GLU A 1 138 ? -27.103 50.801 49.859 1.00 13.10 ? 138 GLU A N     1 
ATOM   1035 C  CA    . GLU A 1 138 ? -28.316 51.095 50.627 1.00 13.38 ? 138 GLU A CA    1 
ATOM   1036 C  C     . GLU A 1 138 ? -29.520 50.709 49.790 1.00 12.23 ? 138 GLU A C     1 
ATOM   1037 O  O     . GLU A 1 138 ? -30.417 49.975 50.244 1.00 12.49 ? 138 GLU A O     1 
ATOM   1038 C  CB    . GLU A 1 138 ? -28.440 52.582 50.972 1.00 15.75 ? 138 GLU A CB    1 
ATOM   1039 C  CG    . GLU A 1 138 ? -27.209 53.254 51.666 1.00 19.20 ? 138 GLU A CG    1 
ATOM   1040 C  CD    . GLU A 1 138 ? -27.445 54.749 51.980 1.00 20.20 ? 138 GLU A CD    1 
ATOM   1041 O  OE1   . GLU A 1 138 ? -28.518 55.081 52.546 1.00 22.72 ? 138 GLU A OE1   1 
ATOM   1042 O  OE2   . GLU A 1 138 ? -26.582 55.596 51.671 1.00 19.37 ? 138 GLU A OE2   1 
ATOM   1043 N  N     . ASP A 1 139 ? -29.523 51.168 48.549 1.00 11.12 ? 139 ASP A N     1 
ATOM   1044 C  CA    . ASP A 1 139 ? -30.636 50.907 47.650 1.00 11.61 ? 139 ASP A CA    1 
ATOM   1045 C  C     . ASP A 1 139 ? -30.851 49.411 47.455 1.00 11.83 ? 139 ASP A C     1 
ATOM   1046 O  O     . ASP A 1 139 ? -32.003 48.930 47.411 1.00 11.80 ? 139 ASP A O     1 
ATOM   1047 C  CB    . ASP A 1 139 ? -30.427 51.629 46.293 1.00 13.27 ? 139 ASP A CB    1 
ATOM   1048 C  CG    . ASP A 1 139 ? -30.787 53.138 46.326 1.00 14.09 ? 139 ASP A CG    1 
ATOM   1049 O  OD1   . ASP A 1 139 ? -30.805 53.745 45.228 1.00 15.49 ? 139 ASP A OD1   1 
ATOM   1050 O  OD2   . ASP A 1 139 ? -31.029 53.746 47.401 1.00 15.29 ? 139 ASP A OD2   1 
ATOM   1051 N  N     . LYS A 1 140 ? -29.748 48.676 47.304 1.00 11.95 ? 140 LYS A N     1 
ATOM   1052 C  CA    . LYS A 1 140 ? -29.812 47.222 47.135 1.00 12.18 ? 140 LYS A CA    1 
ATOM   1053 C  C     . LYS A 1 140 ? -30.545 46.630 48.318 1.00 13.16 ? 140 LYS A C     1 
ATOM   1054 O  O     . LYS A 1 140 ? -31.571 45.982 48.174 1.00 14.86 ? 140 LYS A O     1 
ATOM   1055 C  CB    . LYS A 1 140 ? -28.405 46.620 47.109 1.00 11.06 ? 140 LYS A CB    1 
ATOM   1056 C  CG    . LYS A 1 140 ? -28.352 45.128 47.459 1.00 8.21  ? 140 LYS A CG    1 
ATOM   1057 C  CD    . LYS A 1 140 ? -26.900 44.627 47.523 1.00 5.63  ? 140 LYS A CD    1 
ATOM   1058 C  CE    . LYS A 1 140 ? -26.860 43.121 47.753 1.00 3.87  ? 140 LYS A CE    1 
ATOM   1059 N  NZ    . LYS A 1 140 ? -25.498 42.560 47.669 1.00 1.38  ? 140 LYS A NZ    1 
ATOM   1060 N  N     . VAL A 1 141 ? -30.001 46.880 49.496 1.00 13.56 ? 141 VAL A N     1 
ATOM   1061 C  CA    . VAL A 1 141 ? -30.550 46.372 50.748 1.00 14.56 ? 141 VAL A CA    1 
ATOM   1062 C  C     . VAL A 1 141 ? -32.000 46.829 51.043 1.00 14.90 ? 141 VAL A C     1 
ATOM   1063 O  O     . VAL A 1 141 ? -32.810 46.056 51.605 1.00 14.44 ? 141 VAL A O     1 
ATOM   1064 C  CB    . VAL A 1 141 ? -29.538 46.643 51.861 1.00 14.85 ? 141 VAL A CB    1 
ATOM   1065 C  CG1   . VAL A 1 141 ? -30.111 47.523 52.912 1.00 13.35 ? 141 VAL A CG1   1 
ATOM   1066 C  CG2   . VAL A 1 141 ? -28.987 45.301 52.356 1.00 15.40 ? 141 VAL A CG2   1 
ATOM   1067 N  N     . ALA A 1 142 ? -32.335 48.050 50.617 1.00 14.02 ? 142 ALA A N     1 
ATOM   1068 C  CA    . ALA A 1 142 ? -33.706 48.534 50.741 1.00 13.93 ? 142 ALA A CA    1 
ATOM   1069 C  C     . ALA A 1 142 ? -34.619 47.848 49.695 1.00 14.01 ? 142 ALA A C     1 
ATOM   1070 O  O     . ALA A 1 142 ? -35.829 47.868 49.826 1.00 14.05 ? 142 ALA A O     1 
ATOM   1071 C  CB    . ALA A 1 142 ? -33.753 50.057 50.531 1.00 13.04 ? 142 ALA A CB    1 
ATOM   1072 N  N     . ARG A 1 143 ? -34.039 47.241 48.662 1.00 14.11 ? 143 ARG A N     1 
ATOM   1073 C  CA    . ARG A 1 143 ? -34.787 46.593 47.573 1.00 14.34 ? 143 ARG A CA    1 
ATOM   1074 C  C     . ARG A 1 143 ? -35.459 47.575 46.616 1.00 14.58 ? 143 ARG A C     1 
ATOM   1075 O  O     . ARG A 1 143 ? -36.479 47.241 46.005 1.00 16.74 ? 143 ARG A O     1 
ATOM   1076 C  CB    . ARG A 1 143 ? -35.851 45.622 48.057 1.00 13.79 ? 143 ARG A CB    1 
ATOM   1077 C  CG    . ARG A 1 143 ? -35.361 44.574 48.959 1.00 15.34 ? 143 ARG A CG    1 
ATOM   1078 C  CD    . ARG A 1 143 ? -35.866 44.883 50.328 1.00 15.45 ? 143 ARG A CD    1 
ATOM   1079 N  NE    . ARG A 1 143 ? -36.632 43.766 50.829 1.00 15.29 ? 143 ARG A NE    1 
ATOM   1080 C  CZ    . ARG A 1 143 ? -37.305 43.871 51.962 1.00 15.31 ? 143 ARG A CZ    1 
ATOM   1081 N  NH1   . ARG A 1 143 ? -37.313 45.016 52.643 1.00 12.60 ? 143 ARG A NH1   1 
ATOM   1082 N  NH2   . ARG A 1 143 ? -37.839 42.772 52.468 1.00 16.04 ? 143 ARG A NH2   1 
ATOM   1083 N  N     . ARG A 1 144 ? -34.917 48.777 46.491 1.00 13.99 ? 144 ARG A N     1 
ATOM   1084 C  CA    . ARG A 1 144 ? -35.477 49.765 45.573 1.00 13.48 ? 144 ARG A CA    1 
ATOM   1085 C  C     . ARG A 1 144 ? -34.486 49.999 44.425 1.00 14.01 ? 144 ARG A C     1 
ATOM   1086 O  O     . ARG A 1 144 ? -34.833 50.553 43.372 1.00 13.87 ? 144 ARG A O     1 
ATOM   1087 C  CB    . ARG A 1 144 ? -35.722 51.085 46.301 1.00 13.33 ? 144 ARG A CB    1 
ATOM   1088 C  CG    . ARG A 1 144 ? -34.464 51.903 46.666 1.00 14.18 ? 144 ARG A CG    1 
ATOM   1089 C  CD    . ARG A 1 144 ? -34.858 53.235 47.409 1.00 17.45 ? 144 ARG A CD    1 
ATOM   1090 N  NE    . ARG A 1 144 ? -34.088 53.440 48.637 1.00 18.01 ? 144 ARG A NE    1 
ATOM   1091 C  CZ    . ARG A 1 144 ? -34.648 53.268 49.828 1.00 18.78 ? 144 ARG A CZ    1 
ATOM   1092 N  NH1   . ARG A 1 144 ? -35.923 52.939 49.909 1.00 20.84 ? 144 ARG A NH1   1 
ATOM   1093 N  NH2   . ARG A 1 144 ? -33.904 53.303 50.934 1.00 21.04 ? 144 ARG A NH2   1 
ATOM   1094 N  N     . GLY A 1 145 ? -33.241 49.583 44.638 1.00 13.34 ? 145 GLY A N     1 
ATOM   1095 C  CA    . GLY A 1 145 ? -32.234 49.797 43.639 1.00 13.39 ? 145 GLY A CA    1 
ATOM   1096 C  C     . GLY A 1 145 ? -32.452 49.021 42.362 1.00 14.49 ? 145 GLY A C     1 
ATOM   1097 O  O     . GLY A 1 145 ? -33.107 47.955 42.352 1.00 13.72 ? 145 GLY A O     1 
ATOM   1098 N  N     . LEU A 1 146 ? -31.907 49.586 41.279 1.00 14.93 ? 146 LEU A N     1 
ATOM   1099 C  CA    . LEU A 1 146 ? -31.960 48.988 39.969 1.00 15.30 ? 146 LEU A CA    1 
ATOM   1100 C  C     . LEU A 1 146 ? -30.754 48.067 39.860 1.00 15.33 ? 146 LEU A C     1 
ATOM   1101 O  O     . LEU A 1 146 ? -29.739 48.294 40.508 1.00 15.51 ? 146 LEU A O     1 
ATOM   1102 C  CB    . LEU A 1 146 ? -31.850 50.060 38.887 1.00 16.02 ? 146 LEU A CB    1 
ATOM   1103 C  CG    . LEU A 1 146 ? -32.999 51.017 38.538 1.00 16.01 ? 146 LEU A CG    1 
ATOM   1104 C  CD1   . LEU A 1 146 ? -34.259 50.253 38.330 1.00 15.40 ? 146 LEU A CD1   1 
ATOM   1105 C  CD2   . LEU A 1 146 ? -33.162 52.085 39.576 1.00 17.24 ? 146 LEU A CD2   1 
ATOM   1106 N  N     . ARG A 1 147 ? -30.869 47.023 39.042 1.00 16.10 ? 147 ARG A N     1 
ATOM   1107 C  CA    . ARG A 1 147 ? -29.774 46.078 38.822 1.00 14.88 ? 147 ARG A CA    1 
ATOM   1108 C  C     . ARG A 1 147 ? -29.667 45.876 37.315 1.00 15.67 ? 147 ARG A C     1 
ATOM   1109 O  O     . ARG A 1 147 ? -30.560 46.252 36.559 1.00 15.56 ? 147 ARG A O     1 
ATOM   1110 C  CB    . ARG A 1 147 ? -30.023 44.713 39.497 1.00 13.19 ? 147 ARG A CB    1 
ATOM   1111 C  CG    . ARG A 1 147 ? -30.496 44.787 40.950 1.00 11.15 ? 147 ARG A CG    1 
ATOM   1112 C  CD    . ARG A 1 147 ? -30.361 43.475 41.717 1.00 7.60  ? 147 ARG A CD    1 
ATOM   1113 N  NE    . ARG A 1 147 ? -31.007 42.350 41.071 1.00 4.09  ? 147 ARG A NE    1 
ATOM   1114 C  CZ    . ARG A 1 147 ? -31.023 41.149 41.628 1.00 3.17  ? 147 ARG A CZ    1 
ATOM   1115 N  NH1   . ARG A 1 147 ? -30.469 40.966 42.813 1.00 3.47  ? 147 ARG A NH1   1 
ATOM   1116 N  NH2   . ARG A 1 147 ? -31.497 40.105 40.949 1.00 3.25  ? 147 ARG A NH2   1 
ATOM   1117 N  N     . VAL A 1 148 ? -28.556 45.280 36.893 1.00 16.21 ? 148 VAL A N     1 
ATOM   1118 C  CA    . VAL A 1 148 ? -28.294 45.001 35.502 1.00 15.70 ? 148 VAL A CA    1 
ATOM   1119 C  C     . VAL A 1 148 ? -29.495 44.299 34.833 1.00 16.95 ? 148 VAL A C     1 
ATOM   1120 O  O     . VAL A 1 148 ? -29.854 44.596 33.660 1.00 17.18 ? 148 VAL A O     1 
ATOM   1121 C  CB    . VAL A 1 148 ? -27.031 44.150 35.382 1.00 14.16 ? 148 VAL A CB    1 
ATOM   1122 C  CG1   . VAL A 1 148 ? -26.915 43.606 34.015 1.00 14.39 ? 148 VAL A CG1   1 
ATOM   1123 C  CG2   . VAL A 1 148 ? -25.813 44.971 35.699 1.00 11.91 ? 148 VAL A CG2   1 
ATOM   1124 N  N     . GLY A 1 149 ? -30.113 43.367 35.561 1.00 17.18 ? 149 GLY A N     1 
ATOM   1125 C  CA    . GLY A 1 149 ? -31.249 42.646 35.016 1.00 16.82 ? 149 GLY A CA    1 
ATOM   1126 C  C     . GLY A 1 149 ? -32.404 43.582 34.659 1.00 17.80 ? 149 GLY A C     1 
ATOM   1127 O  O     . GLY A 1 149 ? -33.164 43.328 33.720 1.00 17.95 ? 149 GLY A O     1 
ATOM   1128 N  N     . ASP A 1 150 ? -32.525 44.709 35.336 1.00 17.35 ? 150 ASP A N     1 
ATOM   1129 C  CA    . ASP A 1 150 ? -33.637 45.565 35.003 1.00 19.72 ? 150 ASP A CA    1 
ATOM   1130 C  C     . ASP A 1 150 ? -33.578 46.126 33.601 1.00 21.40 ? 150 ASP A C     1 
ATOM   1131 O  O     . ASP A 1 150 ? -34.615 46.465 33.037 1.00 23.31 ? 150 ASP A O     1 
ATOM   1132 C  CB    . ASP A 1 150 ? -33.839 46.667 36.052 1.00 19.54 ? 150 ASP A CB    1 
ATOM   1133 C  CG    . ASP A 1 150 ? -34.263 46.102 37.396 1.00 18.79 ? 150 ASP A CG    1 
ATOM   1134 O  OD1   . ASP A 1 150 ? -35.362 45.501 37.468 1.00 18.38 ? 150 ASP A OD1   1 
ATOM   1135 O  OD2   . ASP A 1 150 ? -33.487 46.213 38.364 1.00 18.42 ? 150 ASP A OD2   1 
ATOM   1136 N  N     . LEU A 1 151 ? -32.382 46.180 33.016 1.00 22.72 ? 151 LEU A N     1 
ATOM   1137 C  CA    . LEU A 1 151 ? -32.200 46.718 31.664 1.00 23.38 ? 151 LEU A CA    1 
ATOM   1138 C  C     . LEU A 1 151 ? -32.798 45.787 30.596 1.00 25.69 ? 151 LEU A C     1 
ATOM   1139 O  O     . LEU A 1 151 ? -32.862 46.119 29.399 1.00 26.01 ? 151 LEU A O     1 
ATOM   1140 C  CB    . LEU A 1 151 ? -30.713 46.960 31.388 1.00 21.02 ? 151 LEU A CB    1 
ATOM   1141 C  CG    . LEU A 1 151 ? -30.034 48.074 32.184 1.00 19.24 ? 151 LEU A CG    1 
ATOM   1142 C  CD1   . LEU A 1 151 ? -28.538 47.930 32.176 1.00 19.05 ? 151 LEU A CD1   1 
ATOM   1143 C  CD2   . LEU A 1 151 ? -30.438 49.410 31.627 1.00 19.36 ? 151 LEU A CD2   1 
ATOM   1144 N  N     . PHE A 1 152 ? -33.278 44.634 31.026 1.00 27.19 ? 152 PHE A N     1 
ATOM   1145 C  CA    . PHE A 1 152 ? -33.828 43.711 30.076 1.00 29.15 ? 152 PHE A CA    1 
ATOM   1146 C  C     . PHE A 1 152 ? -35.224 44.070 29.584 1.00 29.09 ? 152 PHE A C     1 
ATOM   1147 O  O     . PHE A 1 152 ? -35.866 43.322 28.843 1.00 29.74 ? 152 PHE A O     1 
ATOM   1148 C  CB    . PHE A 1 152 ? -33.700 42.300 30.636 1.00 31.82 ? 152 PHE A CB    1 
ATOM   1149 C  CG    . PHE A 1 152 ? -32.307 41.735 30.479 1.00 33.91 ? 152 PHE A CG    1 
ATOM   1150 C  CD1   . PHE A 1 152 ? -31.628 41.194 31.565 1.00 34.12 ? 152 PHE A CD1   1 
ATOM   1151 C  CD2   . PHE A 1 152 ? -31.690 41.741 29.212 1.00 35.20 ? 152 PHE A CD2   1 
ATOM   1152 C  CE1   . PHE A 1 152 ? -30.356 40.665 31.412 1.00 35.01 ? 152 PHE A CE1   1 
ATOM   1153 C  CE2   . PHE A 1 152 ? -30.422 41.214 29.034 1.00 36.41 ? 152 PHE A CE2   1 
ATOM   1154 C  CZ    . PHE A 1 152 ? -29.746 40.670 30.145 1.00 37.01 ? 152 PHE A CZ    1 
ATOM   1155 N  N     . ASP A 1 153 ? -35.668 45.254 29.966 1.00 28.43 ? 153 ASP A N     1 
ATOM   1156 C  CA    . ASP A 1 153 ? -36.966 45.763 29.566 1.00 27.37 ? 153 ASP A CA    1 
ATOM   1157 C  C     . ASP A 1 153 ? -36.893 47.252 29.838 1.00 26.18 ? 153 ASP A C     1 
ATOM   1158 O  O     . ASP A 1 153 ? -37.191 47.725 30.934 1.00 26.00 ? 153 ASP A O     1 
ATOM   1159 C  CB    . ASP A 1 153 ? -38.055 45.124 30.390 1.00 27.99 ? 153 ASP A CB    1 
ATOM   1160 C  CG    . ASP A 1 153 ? -39.418 45.607 29.999 1.00 29.54 ? 153 ASP A CG    1 
ATOM   1161 O  OD1   . ASP A 1 153 ? -40.276 44.756 29.677 1.00 31.75 ? 153 ASP A OD1   1 
ATOM   1162 O  OD2   . ASP A 1 153 ? -39.638 46.833 30.020 1.00 29.49 ? 153 ASP A OD2   1 
ATOM   1163 N  N     . LYS A 1 154 ? -36.445 47.981 28.830 1.00 25.51 ? 154 LYS A N     1 
ATOM   1164 C  CA    . LYS A 1 154 ? -36.252 49.420 28.929 1.00 25.44 ? 154 LYS A CA    1 
ATOM   1165 C  C     . LYS A 1 154 ? -37.430 50.299 29.355 1.00 25.48 ? 154 LYS A C     1 
ATOM   1166 O  O     . LYS A 1 154 ? -37.233 51.287 30.059 1.00 24.40 ? 154 LYS A O     1 
ATOM   1167 C  CB    . LYS A 1 154 ? -35.579 49.911 27.657 1.00 25.11 ? 154 LYS A CB    1 
ATOM   1168 C  CG    . LYS A 1 154 ? -34.204 49.259 27.425 1.00 24.56 ? 154 LYS A CG    1 
ATOM   1169 C  CD    . LYS A 1 154 ? -33.716 49.430 25.978 1.00 23.81 ? 154 LYS A CD    1 
ATOM   1170 C  CE    . LYS A 1 154 ? -32.264 49.018 25.829 1.00 23.74 ? 154 LYS A CE    1 
ATOM   1171 N  NZ    . LYS A 1 154 ? -31.790 48.883 24.418 1.00 22.44 ? 154 LYS A NZ    1 
ATOM   1172 N  N     . GLU A 1 155 ? -38.649 49.929 28.969 1.00 26.80 ? 155 GLU A N     1 
ATOM   1173 C  CA    . GLU A 1 155 ? -39.847 50.695 29.349 1.00 28.41 ? 155 GLU A CA    1 
ATOM   1174 C  C     . GLU A 1 155 ? -40.048 50.601 30.851 1.00 27.41 ? 155 GLU A C     1 
ATOM   1175 O  O     . GLU A 1 155 ? -40.173 51.597 31.563 1.00 27.96 ? 155 GLU A O     1 
ATOM   1176 C  CB    . GLU A 1 155 ? -41.090 50.118 28.689 1.00 31.08 ? 155 GLU A CB    1 
ATOM   1177 C  CG    . GLU A 1 155 ? -41.155 50.223 27.191 1.00 36.14 ? 155 GLU A CG    1 
ATOM   1178 C  CD    . GLU A 1 155 ? -42.509 49.751 26.664 1.00 39.78 ? 155 GLU A CD    1 
ATOM   1179 O  OE1   . GLU A 1 155 ? -42.567 49.284 25.497 1.00 41.85 ? 155 GLU A OE1   1 
ATOM   1180 O  OE2   . GLU A 1 155 ? -43.517 49.848 27.421 1.00 41.29 ? 155 GLU A OE2   1 
ATOM   1181 N  N     . THR A 1 156 ? -40.108 49.371 31.325 1.00 26.89 ? 156 THR A N     1 
ATOM   1182 C  CA    . THR A 1 156 ? -40.262 49.099 32.732 1.00 25.25 ? 156 THR A CA    1 
ATOM   1183 C  C     . THR A 1 156 ? -39.097 49.694 33.521 1.00 23.83 ? 156 THR A C     1 
ATOM   1184 O  O     . THR A 1 156 ? -39.297 50.163 34.637 1.00 23.61 ? 156 THR A O     1 
ATOM   1185 C  CB    . THR A 1 156 ? -40.392 47.602 32.915 1.00 26.12 ? 156 THR A CB    1 
ATOM   1186 O  OG1   . THR A 1 156 ? -41.785 47.264 32.932 1.00 29.30 ? 156 THR A OG1   1 
ATOM   1187 C  CG2   . THR A 1 156 ? -39.721 47.128 34.135 1.00 26.56 ? 156 THR A CG2   1 
ATOM   1188 N  N     . PHE A 1 157 ? -37.892 49.708 32.940 1.00 22.13 ? 157 PHE A N     1 
ATOM   1189 C  CA    . PHE A 1 157 ? -36.722 50.285 33.619 1.00 21.44 ? 157 PHE A CA    1 
ATOM   1190 C  C     . PHE A 1 157 ? -36.922 51.785 33.840 1.00 20.74 ? 157 PHE A C     1 
ATOM   1191 O  O     . PHE A 1 157 ? -36.638 52.330 34.912 1.00 19.51 ? 157 PHE A O     1 
ATOM   1192 C  CB    . PHE A 1 157 ? -35.434 50.033 32.806 1.00 21.75 ? 157 PHE A CB    1 
ATOM   1193 C  CG    . PHE A 1 157 ? -34.191 50.650 33.421 1.00 20.95 ? 157 PHE A CG    1 
ATOM   1194 C  CD1   . PHE A 1 157 ? -33.408 49.931 34.314 1.00 21.33 ? 157 PHE A CD1   1 
ATOM   1195 C  CD2   . PHE A 1 157 ? -33.840 51.968 33.150 1.00 19.75 ? 157 PHE A CD2   1 
ATOM   1196 C  CE1   . PHE A 1 157 ? -32.300 50.537 34.927 1.00 20.93 ? 157 PHE A CE1   1 
ATOM   1197 C  CE2   . PHE A 1 157 ? -32.743 52.571 33.756 1.00 19.06 ? 157 PHE A CE2   1 
ATOM   1198 C  CZ    . PHE A 1 157 ? -31.979 51.861 34.641 1.00 20.09 ? 157 PHE A CZ    1 
ATOM   1199 N  N     . ALA A 1 158 ? -37.387 52.432 32.779 1.00 21.36 ? 158 ALA A N     1 
ATOM   1200 C  CA    . ALA A 1 158 ? -37.682 53.855 32.739 1.00 22.17 ? 158 ALA A CA    1 
ATOM   1201 C  C     . ALA A 1 158 ? -38.672 54.204 33.834 1.00 22.56 ? 158 ALA A C     1 
ATOM   1202 O  O     . ALA A 1 158 ? -38.568 55.269 34.447 1.00 22.83 ? 158 ALA A O     1 
ATOM   1203 C  CB    . ALA A 1 158 ? -38.279 54.215 31.371 1.00 21.95 ? 158 ALA A CB    1 
ATOM   1204 N  N     . GLU A 1 159 ? -39.668 53.339 34.018 1.00 22.74 ? 159 GLU A N     1 
ATOM   1205 C  CA    . GLU A 1 159 ? -40.674 53.516 35.051 1.00 23.51 ? 159 GLU A CA    1 
ATOM   1206 C  C     . GLU A 1 159 ? -39.993 53.419 36.413 1.00 23.02 ? 159 GLU A C     1 
ATOM   1207 O  O     . GLU A 1 159 ? -40.089 54.330 37.223 1.00 23.12 ? 159 GLU A O     1 
ATOM   1208 C  CB    . GLU A 1 159 ? -41.738 52.432 34.923 1.00 26.42 ? 159 GLU A CB    1 
ATOM   1209 C  CG    . GLU A 1 159 ? -42.509 52.442 33.608 1.00 31.49 ? 159 GLU A CG    1 
ATOM   1210 C  CD    . GLU A 1 159 ? -43.419 51.220 33.446 1.00 35.29 ? 159 GLU A CD    1 
ATOM   1211 O  OE1   . GLU A 1 159 ? -44.492 51.336 32.806 1.00 37.11 ? 159 GLU A OE1   1 
ATOM   1212 O  OE2   . GLU A 1 159 ? -43.059 50.126 33.948 1.00 38.28 ? 159 GLU A OE2   1 
ATOM   1213 N  N     . LYS A 1 160 ? -39.265 52.322 36.639 1.00 23.30 ? 160 LYS A N     1 
ATOM   1214 C  CA    . LYS A 1 160 ? -38.538 52.084 37.895 1.00 22.35 ? 160 LYS A CA    1 
ATOM   1215 C  C     . LYS A 1 160 ? -37.569 53.223 38.247 1.00 22.44 ? 160 LYS A C     1 
ATOM   1216 O  O     . LYS A 1 160 ? -37.513 53.687 39.397 1.00 22.14 ? 160 LYS A O     1 
ATOM   1217 C  CB    . LYS A 1 160 ? -37.764 50.751 37.833 1.00 21.11 ? 160 LYS A CB    1 
ATOM   1218 C  CG    . LYS A 1 160 ? -38.643 49.488 37.754 1.00 19.41 ? 160 LYS A CG    1 
ATOM   1219 C  CD    . LYS A 1 160 ? -37.826 48.207 37.516 1.00 17.38 ? 160 LYS A CD    1 
ATOM   1220 C  CE    . LYS A 1 160 ? -38.710 46.988 37.649 1.00 16.68 ? 160 LYS A CE    1 
ATOM   1221 N  NZ    . LYS A 1 160 ? -38.100 45.764 37.090 1.00 16.07 ? 160 LYS A NZ    1 
ATOM   1222 N  N     . LEU A 1 161 ? -36.801 53.680 37.269 1.00 22.23 ? 161 LEU A N     1 
ATOM   1223 C  CA    . LEU A 1 161 ? -35.851 54.732 37.558 1.00 23.21 ? 161 LEU A CA    1 
ATOM   1224 C  C     . LEU A 1 161 ? -36.540 56.032 37.977 1.00 23.82 ? 161 LEU A C     1 
ATOM   1225 O  O     . LEU A 1 161 ? -36.038 56.763 38.839 1.00 23.32 ? 161 LEU A O     1 
ATOM   1226 C  CB    . LEU A 1 161 ? -34.919 54.959 36.365 1.00 23.48 ? 161 LEU A CB    1 
ATOM   1227 C  CG    . LEU A 1 161 ? -33.790 55.971 36.592 1.00 23.11 ? 161 LEU A CG    1 
ATOM   1228 C  CD1   . LEU A 1 161 ? -32.771 55.345 37.497 1.00 22.22 ? 161 LEU A CD1   1 
ATOM   1229 C  CD2   . LEU A 1 161 ? -33.153 56.391 35.256 1.00 23.71 ? 161 LEU A CD2   1 
ATOM   1230 N  N     . LYS A 1 162 ? -37.684 56.316 37.366 1.00 24.59 ? 162 LYS A N     1 
ATOM   1231 C  CA    . LYS A 1 162 ? -38.459 57.518 37.673 1.00 25.67 ? 162 LYS A CA    1 
ATOM   1232 C  C     . LYS A 1 162 ? -38.823 57.536 39.167 1.00 25.05 ? 162 LYS A C     1 
ATOM   1233 O  O     . LYS A 1 162 ? -38.529 58.499 39.890 1.00 24.49 ? 162 LYS A O     1 
ATOM   1234 C  CB    . LYS A 1 162 ? -39.733 57.540 36.811 1.00 28.33 ? 162 LYS A CB    1 
ATOM   1235 C  CG    . LYS A 1 162 ? -40.235 58.939 36.494 1.00 29.40 ? 162 LYS A CG    1 
ATOM   1236 C  CD    . LYS A 1 162 ? -41.670 58.956 36.047 1.00 30.15 ? 162 LYS A CD    1 
ATOM   1237 C  CE    . LYS A 1 162 ? -42.024 60.365 35.656 1.00 32.85 ? 162 LYS A CE    1 
ATOM   1238 N  NZ    . LYS A 1 162 ? -41.500 61.365 36.678 1.00 36.19 ? 162 LYS A NZ    1 
ATOM   1239 N  N     . GLU A 1 163 ? -39.471 56.463 39.612 1.00 24.74 ? 163 GLU A N     1 
ATOM   1240 C  CA    . GLU A 1 163 ? -39.843 56.300 41.007 1.00 24.64 ? 163 GLU A CA    1 
ATOM   1241 C  C     . GLU A 1 163 ? -38.630 56.510 41.938 1.00 25.38 ? 163 GLU A C     1 
ATOM   1242 O  O     . GLU A 1 163 ? -38.663 57.312 42.895 1.00 25.63 ? 163 GLU A O     1 
ATOM   1243 C  CB    . GLU A 1 163 ? -40.329 54.883 41.244 1.00 24.69 ? 163 GLU A CB    1 
ATOM   1244 C  CG    . GLU A 1 163 ? -41.628 54.489 40.631 1.00 25.88 ? 163 GLU A CG    1 
ATOM   1245 C  CD    . GLU A 1 163 ? -42.135 53.193 41.217 1.00 27.59 ? 163 GLU A CD    1 
ATOM   1246 O  OE1   . GLU A 1 163 ? -41.973 53.000 42.439 1.00 28.29 ? 163 GLU A OE1   1 
ATOM   1247 O  OE2   . GLU A 1 163 ? -42.683 52.341 40.482 1.00 29.20 ? 163 GLU A OE2   1 
ATOM   1248 N  N     . VAL A 1 164 ? -37.544 55.787 41.672 1.00 25.25 ? 164 VAL A N     1 
ATOM   1249 C  CA    . VAL A 1 164 ? -36.376 55.902 42.548 1.00 24.81 ? 164 VAL A CA    1 
ATOM   1250 C  C     . VAL A 1 164 ? -35.786 57.305 42.616 1.00 23.76 ? 164 VAL A C     1 
ATOM   1251 O  O     . VAL A 1 164 ? -35.521 57.831 43.715 1.00 23.30 ? 164 VAL A O     1 
ATOM   1252 C  CB    . VAL A 1 164 ? -35.287 54.812 42.241 1.00 24.78 ? 164 VAL A CB    1 
ATOM   1253 C  CG1   . VAL A 1 164 ? -34.581 55.072 40.918 1.00 25.63 ? 164 VAL A CG1   1 
ATOM   1254 C  CG2   . VAL A 1 164 ? -34.295 54.766 43.357 1.00 25.05 ? 164 VAL A CG2   1 
ATOM   1255 N  N     . MET A 1 165 ? -35.589 57.911 41.450 1.00 22.93 ? 165 MET A N     1 
ATOM   1256 C  CA    . MET A 1 165 ? -35.030 59.252 41.385 1.00 22.59 ? 165 MET A CA    1 
ATOM   1257 C  C     . MET A 1 165 ? -35.924 60.315 42.001 1.00 23.00 ? 165 MET A C     1 
ATOM   1258 O  O     . MET A 1 165 ? -35.410 61.248 42.628 1.00 22.97 ? 165 MET A O     1 
ATOM   1259 C  CB    . MET A 1 165 ? -34.640 59.635 39.957 1.00 21.36 ? 165 MET A CB    1 
ATOM   1260 C  CG    . MET A 1 165 ? -33.323 59.048 39.536 1.00 21.27 ? 165 MET A CG    1 
ATOM   1261 S  SD    . MET A 1 165 ? -32.819 59.549 37.939 1.00 19.35 ? 165 MET A SD    1 
ATOM   1262 C  CE    . MET A 1 165 ? -32.129 61.127 38.298 1.00 19.58 ? 165 MET A CE    1 
ATOM   1263 N  N     . GLU A 1 166 ? -37.239 60.199 41.812 1.00 23.16 ? 166 GLU A N     1 
ATOM   1264 C  CA    . GLU A 1 166 ? -38.157 61.143 42.418 1.00 24.80 ? 166 GLU A CA    1 
ATOM   1265 C  C     . GLU A 1 166 ? -37.896 61.073 43.925 1.00 24.63 ? 166 GLU A C     1 
ATOM   1266 O  O     . GLU A 1 166 ? -37.651 62.114 44.565 1.00 25.05 ? 166 GLU A O     1 
ATOM   1267 C  CB    . GLU A 1 166 ? -39.618 60.786 42.066 1.00 28.21 ? 166 GLU A CB    1 
ATOM   1268 C  CG    . GLU A 1 166 ? -40.112 61.420 40.730 1.00 32.30 ? 166 GLU A CG    1 
ATOM   1269 C  CD    . GLU A 1 166 ? -41.363 60.769 40.149 1.00 34.34 ? 166 GLU A CD    1 
ATOM   1270 O  OE1   . GLU A 1 166 ? -41.974 61.352 39.208 1.00 35.22 ? 166 GLU A OE1   1 
ATOM   1271 O  OE2   . GLU A 1 166 ? -41.707 59.650 40.591 1.00 35.65 ? 166 GLU A OE2   1 
ATOM   1272 N  N     . TYR A 1 167 ? -37.892 59.841 44.463 1.00 23.92 ? 167 TYR A N     1 
ATOM   1273 C  CA    . TYR A 1 167 ? -37.617 59.546 45.884 1.00 22.50 ? 167 TYR A CA    1 
ATOM   1274 C  C     . TYR A 1 167 ? -36.339 60.210 46.368 1.00 21.25 ? 167 TYR A C     1 
ATOM   1275 O  O     . TYR A 1 167 ? -36.337 60.945 47.359 1.00 20.67 ? 167 TYR A O     1 
ATOM   1276 C  CB    . TYR A 1 167 ? -37.476 58.020 46.095 1.00 24.21 ? 167 TYR A CB    1 
ATOM   1277 C  CG    . TYR A 1 167 ? -37.010 57.584 47.488 1.00 24.10 ? 167 TYR A CG    1 
ATOM   1278 C  CD1   . TYR A 1 167 ? -37.851 57.692 48.586 1.00 24.01 ? 167 TYR A CD1   1 
ATOM   1279 C  CD2   . TYR A 1 167 ? -35.703 57.120 47.702 1.00 23.37 ? 167 TYR A CD2   1 
ATOM   1280 C  CE1   . TYR A 1 167 ? -37.416 57.366 49.863 1.00 24.15 ? 167 TYR A CE1   1 
ATOM   1281 C  CE2   . TYR A 1 167 ? -35.264 56.790 48.962 1.00 23.23 ? 167 TYR A CE2   1 
ATOM   1282 C  CZ    . TYR A 1 167 ? -36.125 56.912 50.053 1.00 24.01 ? 167 TYR A CZ    1 
ATOM   1283 O  OH    . TYR A 1 167 ? -35.719 56.554 51.339 1.00 23.25 ? 167 TYR A OH    1 
ATOM   1284 N  N     . HIS A 1 168 ? -35.238 59.916 45.689 1.00 20.79 ? 168 HIS A N     1 
ATOM   1285 C  CA    . HIS A 1 168 ? -33.946 60.500 46.063 1.00 20.18 ? 168 HIS A CA    1 
ATOM   1286 C  C     . HIS A 1 168 ? -33.860 61.992 45.800 1.00 20.20 ? 168 HIS A C     1 
ATOM   1287 O  O     . HIS A 1 168 ? -33.218 62.710 46.574 1.00 20.18 ? 168 HIS A O     1 
ATOM   1288 C  CB    . HIS A 1 168 ? -32.769 59.774 45.376 1.00 20.28 ? 168 HIS A CB    1 
ATOM   1289 C  CG    . HIS A 1 168 ? -32.556 58.357 45.841 1.00 20.34 ? 168 HIS A CG    1 
ATOM   1290 N  ND1   . HIS A 1 168 ? -32.350 57.311 44.968 1.00 20.30 ? 168 HIS A ND1   1 
ATOM   1291 C  CD2   . HIS A 1 168 ? -32.480 57.820 47.086 1.00 20.19 ? 168 HIS A CD2   1 
ATOM   1292 C  CE1   . HIS A 1 168 ? -32.147 56.197 45.647 1.00 19.61 ? 168 HIS A CE1   1 
ATOM   1293 N  NE2   . HIS A 1 168 ? -32.221 56.477 46.934 1.00 20.43 ? 168 HIS A NE2   1 
ATOM   1294 N  N     . ASN A 1 169 ? -34.465 62.475 44.712 1.00 20.53 ? 169 ASN A N     1 
ATOM   1295 C  CA    . ASN A 1 169 ? -34.415 63.920 44.418 1.00 21.18 ? 169 ASN A CA    1 
ATOM   1296 C  C     . ASN A 1 169 ? -35.126 64.669 45.531 1.00 22.07 ? 169 ASN A C     1 
ATOM   1297 O  O     . ASN A 1 169 ? -34.667 65.732 45.967 1.00 22.41 ? 169 ASN A O     1 
ATOM   1298 C  CB    . ASN A 1 169 ? -35.043 64.271 43.065 1.00 19.89 ? 169 ASN A CB    1 
ATOM   1299 C  CG    . ASN A 1 169 ? -34.045 64.181 41.882 1.00 19.88 ? 169 ASN A CG    1 
ATOM   1300 O  OD1   . ASN A 1 169 ? -32.863 64.535 42.006 1.00 16.69 ? 169 ASN A OD1   1 
ATOM   1301 N  ND2   . ASN A 1 169 ? -34.541 63.720 40.726 1.00 17.08 ? 169 ASN A ND2   1 
ATOM   1302 N  N     . PHE A 1 170 ? -36.231 64.107 46.018 1.00 22.61 ? 170 PHE A N     1 
ATOM   1303 C  CA    . PHE A 1 170 ? -36.948 64.746 47.107 1.00 23.82 ? 170 PHE A CA    1 
ATOM   1304 C  C     . PHE A 1 170 ? -35.998 65.033 48.293 1.00 25.08 ? 170 PHE A C     1 
ATOM   1305 O  O     . PHE A 1 170 ? -35.990 66.130 48.872 1.00 24.93 ? 170 PHE A O     1 
ATOM   1306 C  CB    . PHE A 1 170 ? -38.104 63.861 47.581 1.00 24.12 ? 170 PHE A CB    1 
ATOM   1307 C  CG    . PHE A 1 170 ? -38.920 64.496 48.662 1.00 24.42 ? 170 PHE A CG    1 
ATOM   1308 C  CD1   . PHE A 1 170 ? -40.179 65.010 48.381 1.00 25.12 ? 170 PHE A CD1   1 
ATOM   1309 C  CD2   . PHE A 1 170 ? -38.387 64.678 49.928 1.00 24.37 ? 170 PHE A CD2   1 
ATOM   1310 C  CE1   . PHE A 1 170 ? -40.887 65.702 49.340 1.00 25.42 ? 170 PHE A CE1   1 
ATOM   1311 C  CE2   . PHE A 1 170 ? -39.091 65.374 50.905 1.00 24.80 ? 170 PHE A CE2   1 
ATOM   1312 C  CZ    . PHE A 1 170 ? -40.333 65.885 50.615 1.00 25.36 ? 170 PHE A CZ    1 
ATOM   1313 N  N     . GLN A 1 171 ? -35.223 64.014 48.658 1.00 25.81 ? 171 GLN A N     1 
ATOM   1314 C  CA    . GLN A 1 171 ? -34.273 64.083 49.756 1.00 26.08 ? 171 GLN A CA    1 
ATOM   1315 C  C     . GLN A 1 171 ? -33.150 65.053 49.418 1.00 25.59 ? 171 GLN A C     1 
ATOM   1316 O  O     . GLN A 1 171 ? -32.773 65.868 50.246 1.00 24.94 ? 171 GLN A O     1 
ATOM   1317 C  CB    . GLN A 1 171 ? -33.734 62.669 50.054 1.00 27.15 ? 171 GLN A CB    1 
ATOM   1318 C  CG    . GLN A 1 171 ? -32.485 62.607 50.917 1.00 30.69 ? 171 GLN A CG    1 
ATOM   1319 C  CD    . GLN A 1 171 ? -31.925 61.182 51.102 1.00 33.88 ? 171 GLN A CD    1 
ATOM   1320 O  OE1   . GLN A 1 171 ? -32.183 60.251 50.302 1.00 34.92 ? 171 GLN A OE1   1 
ATOM   1321 N  NE2   . GLN A 1 171 ? -31.139 61.009 52.165 1.00 35.58 ? 171 GLN A NE2   1 
ATOM   1322 N  N     . LEU A 1 172 ? -32.618 64.958 48.202 1.00 25.85 ? 172 LEU A N     1 
ATOM   1323 C  CA    . LEU A 1 172 ? -31.527 65.824 47.763 1.00 25.82 ? 172 LEU A CA    1 
ATOM   1324 C  C     . LEU A 1 172 ? -31.827 67.331 47.847 1.00 26.67 ? 172 LEU A C     1 
ATOM   1325 O  O     . LEU A 1 172 ? -30.997 68.106 48.359 1.00 26.46 ? 172 LEU A O     1 
ATOM   1326 C  CB    . LEU A 1 172 ? -31.058 65.436 46.344 1.00 25.48 ? 172 LEU A CB    1 
ATOM   1327 C  CG    . LEU A 1 172 ? -30.045 64.271 46.285 1.00 25.19 ? 172 LEU A CG    1 
ATOM   1328 C  CD1   . LEU A 1 172 ? -29.743 63.850 44.851 1.00 22.89 ? 172 LEU A CD1   1 
ATOM   1329 C  CD2   . LEU A 1 172 ? -28.759 64.655 47.024 1.00 24.70 ? 172 LEU A CD2   1 
ATOM   1330 N  N     . VAL A 1 173 ? -32.998 67.758 47.365 1.00 26.81 ? 173 VAL A N     1 
ATOM   1331 C  CA    . VAL A 1 173 ? -33.307 69.181 47.428 1.00 26.70 ? 173 VAL A CA    1 
ATOM   1332 C  C     . VAL A 1 173 ? -33.907 69.657 48.765 1.00 26.54 ? 173 VAL A C     1 
ATOM   1333 O  O     . VAL A 1 173 ? -33.323 70.532 49.418 1.00 27.10 ? 173 VAL A O     1 
ATOM   1334 C  CB    . VAL A 1 173 ? -34.127 69.695 46.186 1.00 27.34 ? 173 VAL A CB    1 
ATOM   1335 C  CG1   . VAL A 1 173 ? -33.955 68.761 44.979 1.00 25.46 ? 173 VAL A CG1   1 
ATOM   1336 C  CG2   . VAL A 1 173 ? -35.594 69.954 46.539 1.00 27.24 ? 173 VAL A CG2   1 
ATOM   1337 N  N     . ASN A 1 174 ? -34.992 69.028 49.223 1.00 25.40 ? 174 ASN A N     1 
ATOM   1338 C  CA    . ASN A 1 174 ? -35.652 69.427 50.472 1.00 24.34 ? 174 ASN A CA    1 
ATOM   1339 C  C     . ASN A 1 174 ? -34.873 69.276 51.773 1.00 24.74 ? 174 ASN A C     1 
ATOM   1340 O  O     . ASN A 1 174 ? -35.009 70.098 52.689 1.00 24.93 ? 174 ASN A O     1 
ATOM   1341 C  CB    . ASN A 1 174 ? -36.960 68.670 50.642 1.00 24.00 ? 174 ASN A CB    1 
ATOM   1342 C  CG    . ASN A 1 174 ? -37.949 68.979 49.565 1.00 24.38 ? 174 ASN A CG    1 
ATOM   1343 O  OD1   . ASN A 1 174 ? -38.199 70.135 49.246 1.00 25.22 ? 174 ASN A OD1   1 
ATOM   1344 N  ND2   . ASN A 1 174 ? -38.510 67.949 48.975 1.00 26.11 ? 174 ASN A ND2   1 
ATOM   1345 N  N     . TYR A 1 175 ? -34.096 68.202 51.888 1.00 24.69 ? 175 TYR A N     1 
ATOM   1346 C  CA    . TYR A 1 175 ? -33.348 67.918 53.106 1.00 23.96 ? 175 TYR A CA    1 
ATOM   1347 C  C     . TYR A 1 175 ? -31.882 68.339 53.047 1.00 24.59 ? 175 TYR A C     1 
ATOM   1348 O  O     . TYR A 1 175 ? -31.416 69.124 53.878 1.00 25.60 ? 175 TYR A O     1 
ATOM   1349 C  CB    . TYR A 1 175 ? -33.485 66.436 53.463 1.00 21.91 ? 175 TYR A CB    1 
ATOM   1350 C  CG    . TYR A 1 175 ? -32.742 66.045 54.714 1.00 20.85 ? 175 TYR A CG    1 
ATOM   1351 C  CD1   . TYR A 1 175 ? -31.435 65.517 54.647 1.00 20.33 ? 175 TYR A CD1   1 
ATOM   1352 C  CD2   . TYR A 1 175 ? -33.336 66.169 55.963 1.00 19.20 ? 175 TYR A CD2   1 
ATOM   1353 C  CE1   . TYR A 1 175 ? -30.743 65.128 55.798 1.00 18.28 ? 175 TYR A CE1   1 
ATOM   1354 C  CE2   . TYR A 1 175 ? -32.649 65.766 57.120 1.00 19.12 ? 175 TYR A CE2   1 
ATOM   1355 C  CZ    . TYR A 1 175 ? -31.362 65.257 57.026 1.00 19.04 ? 175 TYR A CZ    1 
ATOM   1356 O  OH    . TYR A 1 175 ? -30.689 64.913 58.177 1.00 21.36 ? 175 TYR A OH    1 
ATOM   1357 N  N     . TYR A 1 176 ? -31.138 67.813 52.089 1.00 24.99 ? 176 TYR A N     1 
ATOM   1358 C  CA    . TYR A 1 176 ? -29.741 68.216 51.975 1.00 25.88 ? 176 TYR A CA    1 
ATOM   1359 C  C     . TYR A 1 176 ? -29.603 69.588 51.323 1.00 26.18 ? 176 TYR A C     1 
ATOM   1360 O  O     . TYR A 1 176 ? -28.565 70.225 51.443 1.00 26.75 ? 176 TYR A O     1 
ATOM   1361 C  CB    . TYR A 1 176 ? -28.943 67.191 51.183 1.00 25.18 ? 176 TYR A CB    1 
ATOM   1362 C  CG    . TYR A 1 176 ? -28.756 65.898 51.917 1.00 24.02 ? 176 TYR A CG    1 
ATOM   1363 C  CD1   . TYR A 1 176 ? -29.415 64.751 51.500 1.00 23.84 ? 176 TYR A CD1   1 
ATOM   1364 C  CD2   . TYR A 1 176 ? -27.925 65.828 53.038 1.00 23.28 ? 176 TYR A CD2   1 
ATOM   1365 C  CE1   . TYR A 1 176 ? -29.261 63.559 52.174 1.00 24.82 ? 176 TYR A CE1   1 
ATOM   1366 C  CE2   . TYR A 1 176 ? -27.753 64.638 53.735 1.00 24.14 ? 176 TYR A CE2   1 
ATOM   1367 C  CZ    . TYR A 1 176 ? -28.432 63.502 53.295 1.00 25.52 ? 176 TYR A CZ    1 
ATOM   1368 O  OH    . TYR A 1 176 ? -28.314 62.319 53.984 1.00 26.62 ? 176 TYR A OH    1 
ATOM   1369 N  N     . LYS A 1 177 ? -30.652 70.047 50.648 1.00 27.28 ? 177 LYS A N     1 
ATOM   1370 C  CA    . LYS A 1 177 ? -30.617 71.347 49.983 1.00 28.54 ? 177 LYS A CA    1 
ATOM   1371 C  C     . LYS A 1 177 ? -29.539 71.345 48.917 1.00 28.35 ? 177 LYS A C     1 
ATOM   1372 O  O     . LYS A 1 177 ? -28.769 72.307 48.762 1.00 28.13 ? 177 LYS A O     1 
ATOM   1373 C  CB    . LYS A 1 177 ? -30.392 72.486 50.987 1.00 29.21 ? 177 LYS A CB    1 
ATOM   1374 C  CG    . LYS A 1 177 ? -31.678 72.944 51.618 1.00 29.97 ? 177 LYS A CG    1 
ATOM   1375 C  CD    . LYS A 1 177 ? -31.566 72.983 53.104 1.00 30.61 ? 177 LYS A CD    1 
ATOM   1376 C  CE    . LYS A 1 177 ? -32.939 73.195 53.681 1.00 32.47 ? 177 LYS A CE    1 
ATOM   1377 N  NZ    . LYS A 1 177 ? -33.841 72.075 53.292 1.00 34.12 ? 177 LYS A NZ    1 
ATOM   1378 N  N     . ALA A 1 178 ? -29.487 70.225 48.206 1.00 28.44 ? 178 ALA A N     1 
ATOM   1379 C  CA    . ALA A 1 178 ? -28.538 70.029 47.137 1.00 28.48 ? 178 ALA A CA    1 
ATOM   1380 C  C     . ALA A 1 178 ? -29.344 70.023 45.850 1.00 28.83 ? 178 ALA A C     1 
ATOM   1381 O  O     . ALA A 1 178 ? -30.573 69.908 45.862 1.00 27.92 ? 178 ALA A O     1 
ATOM   1382 C  CB    . ALA A 1 178 ? -27.829 68.696 47.310 1.00 28.07 ? 178 ALA A CB    1 
ATOM   1383 N  N     . GLU A 1 179 ? -28.641 70.174 44.744 1.00 29.24 ? 179 GLU A N     1 
ATOM   1384 C  CA    . GLU A 1 179 ? -29.263 70.149 43.443 1.00 30.45 ? 179 GLU A CA    1 
ATOM   1385 C  C     . GLU A 1 179 ? -29.847 68.764 43.135 1.00 29.72 ? 179 GLU A C     1 
ATOM   1386 O  O     . GLU A 1 179 ? -29.330 67.739 43.588 1.00 29.25 ? 179 GLU A O     1 
ATOM   1387 C  CB    . GLU A 1 179 ? -28.223 70.530 42.396 1.00 33.16 ? 179 GLU A CB    1 
ATOM   1388 C  CG    . GLU A 1 179 ? -26.898 69.858 42.646 1.00 36.97 ? 179 GLU A CG    1 
ATOM   1389 C  CD    . GLU A 1 179 ? -25.791 70.354 41.750 1.00 40.31 ? 179 GLU A CD    1 
ATOM   1390 O  OE1   . GLU A 1 179 ? -25.821 71.549 41.357 1.00 41.04 ? 179 GLU A OE1   1 
ATOM   1391 O  OE2   . GLU A 1 179 ? -24.878 69.537 41.453 1.00 41.64 ? 179 GLU A OE2   1 
ATOM   1392 N  N     . ALA A 1 180 ? -30.942 68.748 42.382 1.00 29.12 ? 180 ALA A N     1 
ATOM   1393 C  CA    . ALA A 1 180 ? -31.588 67.508 41.985 1.00 28.54 ? 180 ALA A CA    1 
ATOM   1394 C  C     . ALA A 1 180 ? -30.791 66.908 40.832 1.00 28.47 ? 180 ALA A C     1 
ATOM   1395 O  O     . ALA A 1 180 ? -30.094 67.627 40.122 1.00 29.14 ? 180 ALA A O     1 
ATOM   1396 C  CB    . ALA A 1 180 ? -33.012 67.776 41.531 1.00 27.52 ? 180 ALA A CB    1 
ATOM   1397 N  N     . VAL A 1 181 ? -30.878 65.596 40.656 1.00 27.68 ? 181 VAL A N     1 
ATOM   1398 C  CA    . VAL A 1 181 ? -30.183 64.935 39.568 1.00 26.96 ? 181 VAL A CA    1 
ATOM   1399 C  C     . VAL A 1 181 ? -31.285 64.769 38.537 1.00 26.90 ? 181 VAL A C     1 
ATOM   1400 O  O     . VAL A 1 181 ? -32.394 64.380 38.899 1.00 26.75 ? 181 VAL A O     1 
ATOM   1401 C  CB    . VAL A 1 181 ? -29.618 63.565 40.035 1.00 26.26 ? 181 VAL A CB    1 
ATOM   1402 C  CG1   . VAL A 1 181 ? -28.910 62.833 38.889 1.00 24.42 ? 181 VAL A CG1   1 
ATOM   1403 C  CG2   . VAL A 1 181 ? -28.646 63.807 41.170 1.00 25.68 ? 181 VAL A CG2   1 
ATOM   1404 N  N     . ASP A 1 182 ? -31.007 65.069 37.271 1.00 26.93 ? 182 ASP A N     1 
ATOM   1405 C  CA    . ASP A 1 182 ? -32.034 64.965 36.243 1.00 27.47 ? 182 ASP A CA    1 
ATOM   1406 C  C     . ASP A 1 182 ? -32.454 63.583 35.778 1.00 27.90 ? 182 ASP A C     1 
ATOM   1407 O  O     . ASP A 1 182 ? -31.646 62.830 35.221 1.00 29.66 ? 182 ASP A O     1 
ATOM   1408 C  CB    . ASP A 1 182 ? -31.676 65.791 35.019 1.00 28.15 ? 182 ASP A CB    1 
ATOM   1409 C  CG    . ASP A 1 182 ? -32.820 65.857 34.041 1.00 29.90 ? 182 ASP A CG    1 
ATOM   1410 O  OD1   . ASP A 1 182 ? -32.708 65.229 32.966 1.00 32.03 ? 182 ASP A OD1   1 
ATOM   1411 O  OD2   . ASP A 1 182 ? -33.872 66.456 34.388 1.00 29.88 ? 182 ASP A OD2   1 
ATOM   1412 N  N     . TYR A 1 183 ? -33.732 63.263 35.924 1.00 26.88 ? 183 TYR A N     1 
ATOM   1413 C  CA    . TYR A 1 183 ? -34.194 61.955 35.490 1.00 26.63 ? 183 TYR A CA    1 
ATOM   1414 C  C     . TYR A 1 183 ? -33.797 61.601 34.058 1.00 27.02 ? 183 TYR A C     1 
ATOM   1415 O  O     . TYR A 1 183 ? -33.047 60.633 33.833 1.00 27.80 ? 183 TYR A O     1 
ATOM   1416 C  CB    . TYR A 1 183 ? -35.708 61.822 35.634 1.00 25.55 ? 183 TYR A CB    1 
ATOM   1417 C  CG    . TYR A 1 183 ? -36.296 60.627 34.913 1.00 25.25 ? 183 TYR A CG    1 
ATOM   1418 C  CD1   . TYR A 1 183 ? -36.189 59.341 35.448 1.00 25.58 ? 183 TYR A CD1   1 
ATOM   1419 C  CD2   . TYR A 1 183 ? -37.000 60.784 33.712 1.00 25.76 ? 183 TYR A CD2   1 
ATOM   1420 C  CE1   . TYR A 1 183 ? -36.772 58.242 34.819 1.00 25.13 ? 183 TYR A CE1   1 
ATOM   1421 C  CE2   . TYR A 1 183 ? -37.589 59.687 33.067 1.00 25.40 ? 183 TYR A CE2   1 
ATOM   1422 C  CZ    . TYR A 1 183 ? -37.474 58.420 33.635 1.00 25.96 ? 183 TYR A CZ    1 
ATOM   1423 O  OH    . TYR A 1 183 ? -38.108 57.346 33.050 1.00 26.28 ? 183 TYR A OH    1 
ATOM   1424 N  N     . GLN A 1 184 ? -34.320 62.370 33.099 1.00 27.58 ? 184 GLN A N     1 
ATOM   1425 C  CA    . GLN A 1 184 ? -34.087 62.150 31.663 1.00 26.58 ? 184 GLN A CA    1 
ATOM   1426 C  C     . GLN A 1 184 ? -32.622 61.994 31.341 1.00 25.57 ? 184 GLN A C     1 
ATOM   1427 O  O     . GLN A 1 184 ? -32.249 61.124 30.548 1.00 25.06 ? 184 GLN A O     1 
ATOM   1428 C  CB    . GLN A 1 184 ? -34.637 63.312 30.846 1.00 27.52 ? 184 GLN A CB    1 
ATOM   1429 C  CG    . GLN A 1 184 ? -34.650 63.024 29.376 1.00 27.85 ? 184 GLN A CG    1 
ATOM   1430 C  CD    . GLN A 1 184 ? -35.527 61.832 29.054 1.00 29.44 ? 184 GLN A CD    1 
ATOM   1431 O  OE1   . GLN A 1 184 ? -36.653 61.748 29.549 1.00 30.81 ? 184 GLN A OE1   1 
ATOM   1432 N  NE2   . GLN A 1 184 ? -35.018 60.888 28.244 1.00 28.88 ? 184 GLN A NE2   1 
ATOM   1433 N  N     . LYS A 1 185 ? -31.799 62.835 31.971 1.00 24.26 ? 185 LYS A N     1 
ATOM   1434 C  CA    . LYS A 1 185 ? -30.359 62.805 31.782 1.00 23.85 ? 185 LYS A CA    1 
ATOM   1435 C  C     . LYS A 1 185 ? -29.779 61.441 32.134 1.00 24.16 ? 185 LYS A C     1 
ATOM   1436 O  O     . LYS A 1 185 ? -29.004 60.863 31.363 1.00 24.82 ? 185 LYS A O     1 
ATOM   1437 C  CB    . LYS A 1 185 ? -29.708 63.866 32.634 1.00 22.68 ? 185 LYS A CB    1 
ATOM   1438 C  CG    . LYS A 1 185 ? -28.428 64.417 32.062 1.00 22.85 ? 185 LYS A CG    1 
ATOM   1439 C  CD    . LYS A 1 185 ? -27.352 63.393 31.869 1.00 22.30 ? 185 LYS A CD    1 
ATOM   1440 C  CE    . LYS A 1 185 ? -25.979 64.085 31.936 1.00 23.81 ? 185 LYS A CE    1 
ATOM   1441 N  NZ    . LYS A 1 185 ? -24.922 63.299 31.233 1.00 24.77 ? 185 LYS A NZ    1 
ATOM   1442 N  N     . VAL A 1 186 ? -30.149 60.926 33.298 1.00 23.40 ? 186 VAL A N     1 
ATOM   1443 C  CA    . VAL A 1 186 ? -29.662 59.620 33.726 1.00 23.43 ? 186 VAL A CA    1 
ATOM   1444 C  C     . VAL A 1 186 ? -30.226 58.517 32.825 1.00 23.04 ? 186 VAL A C     1 
ATOM   1445 O  O     . VAL A 1 186 ? -29.526 57.547 32.470 1.00 21.88 ? 186 VAL A O     1 
ATOM   1446 C  CB    . VAL A 1 186 ? -30.061 59.347 35.198 1.00 23.53 ? 186 VAL A CB    1 
ATOM   1447 C  CG1   . VAL A 1 186 ? -29.719 57.922 35.595 1.00 22.82 ? 186 VAL A CG1   1 
ATOM   1448 C  CG2   . VAL A 1 186 ? -29.360 60.347 36.108 1.00 23.91 ? 186 VAL A CG2   1 
ATOM   1449 N  N     . LEU A 1 187 ? -31.506 58.651 32.490 1.00 23.14 ? 187 LEU A N     1 
ATOM   1450 C  CA    . LEU A 1 187 ? -32.173 57.671 31.654 1.00 23.39 ? 187 LEU A CA    1 
ATOM   1451 C  C     . LEU A 1 187 ? -31.458 57.542 30.328 1.00 23.71 ? 187 LEU A C     1 
ATOM   1452 O  O     . LEU A 1 187 ? -31.106 56.436 29.920 1.00 23.96 ? 187 LEU A O     1 
ATOM   1453 C  CB    . LEU A 1 187 ? -33.628 58.070 31.436 1.00 24.36 ? 187 LEU A CB    1 
ATOM   1454 C  CG    . LEU A 1 187 ? -34.549 57.103 30.673 1.00 25.14 ? 187 LEU A CG    1 
ATOM   1455 C  CD1   . LEU A 1 187 ? -34.659 55.718 31.351 1.00 25.11 ? 187 LEU A CD1   1 
ATOM   1456 C  CD2   . LEU A 1 187 ? -35.908 57.756 30.599 1.00 24.96 ? 187 LEU A CD2   1 
ATOM   1457 N  N     . ASP A 1 188 ? -31.227 58.677 29.671 1.00 23.43 ? 188 ASP A N     1 
ATOM   1458 C  CA    . ASP A 1 188 ? -30.552 58.693 28.390 1.00 23.77 ? 188 ASP A CA    1 
ATOM   1459 C  C     . ASP A 1 188 ? -29.155 58.086 28.460 1.00 23.63 ? 188 ASP A C     1 
ATOM   1460 O  O     . ASP A 1 188 ? -28.837 57.160 27.707 1.00 24.89 ? 188 ASP A O     1 
ATOM   1461 C  CB    . ASP A 1 188 ? -30.461 60.119 27.860 1.00 25.05 ? 188 ASP A CB    1 
ATOM   1462 C  CG    . ASP A 1 188 ? -31.823 60.723 27.539 1.00 26.41 ? 188 ASP A CG    1 
ATOM   1463 O  OD1   . ASP A 1 188 ? -31.908 61.965 27.645 1.00 28.77 ? 188 ASP A OD1   1 
ATOM   1464 O  OD2   . ASP A 1 188 ? -32.787 60.003 27.173 1.00 23.45 ? 188 ASP A OD2   1 
ATOM   1465 N  N     . ASP A 1 189 ? -28.310 58.617 29.335 1.00 23.28 ? 189 ASP A N     1 
ATOM   1466 C  CA    . ASP A 1 189 ? -26.952 58.102 29.512 1.00 22.85 ? 189 ASP A CA    1 
ATOM   1467 C  C     . ASP A 1 189 ? -26.922 56.587 29.683 1.00 22.72 ? 189 ASP A C     1 
ATOM   1468 O  O     . ASP A 1 189 ? -26.163 55.895 29.012 1.00 23.10 ? 189 ASP A O     1 
ATOM   1469 C  CB    . ASP A 1 189 ? -26.311 58.751 30.728 1.00 22.93 ? 189 ASP A CB    1 
ATOM   1470 C  CG    . ASP A 1 189 ? -25.886 60.168 30.470 1.00 23.87 ? 189 ASP A CG    1 
ATOM   1471 O  OD1   . ASP A 1 189 ? -25.332 60.769 31.416 1.00 25.61 ? 189 ASP A OD1   1 
ATOM   1472 O  OD2   . ASP A 1 189 ? -26.060 60.684 29.335 1.00 23.65 ? 189 ASP A OD2   1 
ATOM   1473 N  N     . THR A 1 190 ? -27.752 56.080 30.587 1.00 22.43 ? 190 THR A N     1 
ATOM   1474 C  CA    . THR A 1 190 ? -27.853 54.647 30.850 1.00 22.53 ? 190 THR A CA    1 
ATOM   1475 C  C     . THR A 1 190 ? -28.314 53.844 29.625 1.00 22.16 ? 190 THR A C     1 
ATOM   1476 O  O     . THR A 1 190 ? -27.783 52.771 29.344 1.00 21.69 ? 190 THR A O     1 
ATOM   1477 C  CB    . THR A 1 190 ? -28.857 54.356 32.025 1.00 23.48 ? 190 THR A CB    1 
ATOM   1478 O  OG1   . THR A 1 190 ? -28.492 55.107 33.208 1.00 21.12 ? 190 THR A OG1   1 
ATOM   1479 C  CG2   . THR A 1 190 ? -28.899 52.857 32.322 1.00 22.97 ? 190 THR A CG2   1 
ATOM   1480 N  N     . MET A 1 191 ? -29.324 54.327 28.908 1.00 22.65 ? 191 MET A N     1 
ATOM   1481 C  CA    . MET A 1 191 ? -29.812 53.597 27.719 1.00 22.32 ? 191 MET A CA    1 
ATOM   1482 C  C     . MET A 1 191 ? -28.780 53.519 26.597 1.00 21.91 ? 191 MET A C     1 
ATOM   1483 O  O     . MET A 1 191 ? -28.717 52.538 25.852 1.00 22.53 ? 191 MET A O     1 
ATOM   1484 C  CB    . MET A 1 191 ? -31.104 54.197 27.192 1.00 21.61 ? 191 MET A CB    1 
ATOM   1485 C  CG    . MET A 1 191 ? -32.306 53.961 28.048 1.00 22.60 ? 191 MET A CG    1 
ATOM   1486 S  SD    . MET A 1 191 ? -32.669 52.212 28.418 1.00 25.14 ? 191 MET A SD    1 
ATOM   1487 C  CE    . MET A 1 191 ? -32.681 52.369 30.191 1.00 23.69 ? 191 MET A CE    1 
ATOM   1488 N  N     . ALA A 1 192 ? -27.969 54.549 26.466 1.00 21.86 ? 192 ALA A N     1 
ATOM   1489 C  CA    . ALA A 1 192 ? -26.939 54.544 25.443 1.00 22.64 ? 192 ALA A CA    1 
ATOM   1490 C  C     . ALA A 1 192 ? -26.038 53.309 25.559 1.00 23.41 ? 192 ALA A C     1 
ATOM   1491 O  O     . ALA A 1 192 ? -25.592 52.762 24.557 1.00 25.09 ? 192 ALA A O     1 
ATOM   1492 C  CB    . ALA A 1 192 ? -26.113 55.818 25.539 1.00 21.81 ? 192 ALA A CB    1 
ATOM   1493 N  N     . VAL A 1 193 ? -25.765 52.862 26.779 1.00 24.50 ? 193 VAL A N     1 
ATOM   1494 C  CA    . VAL A 1 193 ? -24.888 51.693 26.987 1.00 23.74 ? 193 VAL A CA    1 
ATOM   1495 C  C     . VAL A 1 193 ? -25.580 50.364 27.282 1.00 22.97 ? 193 VAL A C     1 
ATOM   1496 O  O     . VAL A 1 193 ? -24.996 49.299 27.112 1.00 22.84 ? 193 VAL A O     1 
ATOM   1497 C  CB    . VAL A 1 193 ? -23.829 51.986 28.084 1.00 24.19 ? 193 VAL A CB    1 
ATOM   1498 C  CG1   . VAL A 1 193 ? -23.028 53.222 27.697 1.00 22.88 ? 193 VAL A CG1   1 
ATOM   1499 C  CG2   . VAL A 1 193 ? -24.500 52.207 29.436 1.00 23.94 ? 193 VAL A CG2   1 
ATOM   1500 N  N     . ALA A 1 194 ? -26.825 50.428 27.731 1.00 23.00 ? 194 ALA A N     1 
ATOM   1501 C  CA    . ALA A 1 194 ? -27.599 49.236 28.052 1.00 22.01 ? 194 ALA A CA    1 
ATOM   1502 C  C     . ALA A 1 194 ? -27.224 47.967 27.273 1.00 21.84 ? 194 ALA A C     1 
ATOM   1503 O  O     . ALA A 1 194 ? -26.826 46.957 27.866 1.00 22.38 ? 194 ALA A O     1 
ATOM   1504 C  CB    . ALA A 1 194 ? -29.088 49.531 27.894 1.00 21.64 ? 194 ALA A CB    1 
ATOM   1505 N  N     . ASP A 1 195 ? -27.381 48.007 25.955 1.00 21.22 ? 195 ASP A N     1 
ATOM   1506 C  CA    . ASP A 1 195 ? -27.102 46.855 25.094 1.00 20.64 ? 195 ASP A CA    1 
ATOM   1507 C  C     . ASP A 1 195 ? -25.699 46.295 25.217 1.00 20.44 ? 195 ASP A C     1 
ATOM   1508 O  O     . ASP A 1 195 ? -25.483 45.103 25.019 1.00 20.65 ? 195 ASP A O     1 
ATOM   1509 C  CB    . ASP A 1 195 ? -27.422 47.183 23.647 1.00 19.61 ? 195 ASP A CB    1 
ATOM   1510 C  CG    . ASP A 1 195 ? -28.863 47.554 23.442 1.00 19.21 ? 195 ASP A CG    1 
ATOM   1511 O  OD1   . ASP A 1 195 ? -29.186 47.968 22.333 1.00 20.48 ? 195 ASP A OD1   1 
ATOM   1512 O  OD2   . ASP A 1 195 ? -29.692 47.459 24.370 1.00 19.54 ? 195 ASP A OD2   1 
ATOM   1513 N  N     . ILE A 1 196 ? -24.739 47.152 25.536 1.00 21.18 ? 196 ILE A N     1 
ATOM   1514 C  CA    . ILE A 1 196 ? -23.376 46.688 25.724 1.00 21.59 ? 196 ILE A CA    1 
ATOM   1515 C  C     . ILE A 1 196 ? -23.355 45.903 27.051 1.00 20.67 ? 196 ILE A C     1 
ATOM   1516 O  O     . ILE A 1 196 ? -22.983 44.729 27.062 1.00 20.09 ? 196 ILE A O     1 
ATOM   1517 C  CB    . ILE A 1 196 ? -22.368 47.856 25.740 1.00 21.51 ? 196 ILE A CB    1 
ATOM   1518 C  CG1   . ILE A 1 196 ? -22.200 48.406 24.337 1.00 20.58 ? 196 ILE A CG1   1 
ATOM   1519 C  CG2   . ILE A 1 196 ? -20.996 47.394 26.279 1.00 22.49 ? 196 ILE A CG2   1 
ATOM   1520 C  CD1   . ILE A 1 196 ? -21.427 49.710 24.306 1.00 20.50 ? 196 ILE A CD1   1 
ATOM   1521 N  N     . LEU A 1 197 ? -23.793 46.539 28.139 1.00 21.21 ? 197 LEU A N     1 
ATOM   1522 C  CA    . LEU A 1 197 ? -23.849 45.901 29.476 1.00 21.46 ? 197 LEU A CA    1 
ATOM   1523 C  C     . LEU A 1 197 ? -24.487 44.527 29.362 1.00 20.77 ? 197 LEU A C     1 
ATOM   1524 O  O     . LEU A 1 197 ? -23.869 43.506 29.630 1.00 21.57 ? 197 LEU A O     1 
ATOM   1525 C  CB    . LEU A 1 197 ? -24.731 46.704 30.436 1.00 22.34 ? 197 LEU A CB    1 
ATOM   1526 C  CG    . LEU A 1 197 ? -24.080 47.531 31.520 1.00 24.03 ? 197 LEU A CG    1 
ATOM   1527 C  CD1   . LEU A 1 197 ? -22.844 46.791 31.960 1.00 25.55 ? 197 LEU A CD1   1 
ATOM   1528 C  CD2   . LEU A 1 197 ? -23.706 48.892 30.978 1.00 25.09 ? 197 LEU A CD2   1 
ATOM   1529 N  N     . THR A 1 198 ? -25.740 44.557 28.937 1.00 20.14 ? 198 THR A N     1 
ATOM   1530 C  CA    . THR A 1 198 ? -26.606 43.413 28.723 1.00 19.10 ? 198 THR A CA    1 
ATOM   1531 C  C     . THR A 1 198 ? -25.952 42.323 27.858 1.00 17.09 ? 198 THR A C     1 
ATOM   1532 O  O     . THR A 1 198 ? -26.221 41.136 28.007 1.00 16.18 ? 198 THR A O     1 
ATOM   1533 C  CB    . THR A 1 198 ? -27.910 43.955 28.045 1.00 19.83 ? 198 THR A CB    1 
ATOM   1534 O  OG1   . THR A 1 198 ? -28.951 44.116 29.027 1.00 23.02 ? 198 THR A OG1   1 
ATOM   1535 C  CG2   . THR A 1 198 ? -28.367 43.093 26.907 1.00 21.27 ? 198 THR A CG2   1 
ATOM   1536 N  N     . SER A 1 199 ? -25.082 42.731 26.951 1.00 16.43 ? 199 SER A N     1 
ATOM   1537 C  CA    . SER A 1 199 ? -24.443 41.776 26.055 1.00 15.99 ? 199 SER A CA    1 
ATOM   1538 C  C     . SER A 1 199 ? -23.425 40.907 26.804 1.00 14.54 ? 199 SER A C     1 
ATOM   1539 O  O     . SER A 1 199 ? -23.078 39.859 26.331 1.00 13.88 ? 199 SER A O     1 
ATOM   1540 C  CB    . SER A 1 199 ? -23.765 42.521 24.889 1.00 14.97 ? 199 SER A CB    1 
ATOM   1541 O  OG    . SER A 1 199 ? -22.518 43.077 25.308 1.00 16.43 ? 199 SER A OG    1 
ATOM   1542 N  N     . MET A 1 200 ? -22.954 41.358 27.962 1.00 13.32 ? 200 MET A N     1 
ATOM   1543 C  CA    . MET A 1 200 ? -21.974 40.617 28.737 1.00 12.94 ? 200 MET A CA    1 
ATOM   1544 C  C     . MET A 1 200 ? -22.520 39.794 29.911 1.00 13.08 ? 200 MET A C     1 
ATOM   1545 O  O     . MET A 1 200 ? -21.754 39.213 30.684 1.00 13.26 ? 200 MET A O     1 
ATOM   1546 C  CB    . MET A 1 200 ? -20.915 41.595 29.249 1.00 13.56 ? 200 MET A CB    1 
ATOM   1547 C  CG    . MET A 1 200 ? -19.984 42.061 28.149 1.00 13.83 ? 200 MET A CG    1 
ATOM   1548 S  SD    . MET A 1 200 ? -18.801 43.260 28.704 1.00 15.77 ? 200 MET A SD    1 
ATOM   1549 C  CE    . MET A 1 200 ? -19.831 44.763 28.917 1.00 13.14 ? 200 MET A CE    1 
ATOM   1550 N  N     . VAL A 1 201 ? -23.839 39.745 30.052 1.00 12.46 ? 201 VAL A N     1 
ATOM   1551 C  CA    . VAL A 1 201 ? -24.481 39.016 31.140 1.00 10.44 ? 201 VAL A CA    1 
ATOM   1552 C  C     . VAL A 1 201 ? -24.302 37.495 30.987 1.00 10.77 ? 201 VAL A C     1 
ATOM   1553 O  O     . VAL A 1 201 ? -24.476 36.947 29.897 1.00 10.06 ? 201 VAL A O     1 
ATOM   1554 C  CB    . VAL A 1 201 ? -26.027 39.324 31.174 1.00 9.37  ? 201 VAL A CB    1 
ATOM   1555 C  CG1   . VAL A 1 201 ? -26.738 38.407 32.145 1.00 11.13 ? 201 VAL A CG1   1 
ATOM   1556 C  CG2   . VAL A 1 201 ? -26.314 40.756 31.558 1.00 8.30  ? 201 VAL A CG2   1 
ATOM   1557 N  N     . VAL A 1 202 ? -23.893 36.825 32.065 1.00 11.10 ? 202 VAL A N     1 
ATOM   1558 C  CA    . VAL A 1 202 ? -23.823 35.347 32.091 1.00 10.45 ? 202 VAL A CA    1 
ATOM   1559 C  C     . VAL A 1 202 ? -24.447 35.058 33.463 1.00 11.34 ? 202 VAL A C     1 
ATOM   1560 O  O     . VAL A 1 202 ? -24.528 35.977 34.294 1.00 12.49 ? 202 VAL A O     1 
ATOM   1561 C  CB    . VAL A 1 202 ? -22.353 34.767 32.030 1.00 9.32  ? 202 VAL A CB    1 
ATOM   1562 C  CG1   . VAL A 1 202 ? -21.581 35.026 33.316 1.00 8.03  ? 202 VAL A CG1   1 
ATOM   1563 C  CG2   . VAL A 1 202 ? -22.369 33.259 31.744 1.00 7.09  ? 202 VAL A CG2   1 
ATOM   1564 N  N     . ASP A 1 203 ? -24.941 33.844 33.676 1.00 10.07 ? 203 ASP A N     1 
ATOM   1565 C  CA    . ASP A 1 203 ? -25.479 33.413 34.973 1.00 9.61  ? 203 ASP A CA    1 
ATOM   1566 C  C     . ASP A 1 203 ? -24.200 32.992 35.760 1.00 10.49 ? 203 ASP A C     1 
ATOM   1567 O  O     . ASP A 1 203 ? -23.769 31.817 35.714 1.00 10.54 ? 203 ASP A O     1 
ATOM   1568 C  CB    . ASP A 1 203 ? -26.353 32.192 34.731 1.00 8.94  ? 203 ASP A CB    1 
ATOM   1569 C  CG    . ASP A 1 203 ? -26.987 31.638 35.973 1.00 9.11  ? 203 ASP A CG    1 
ATOM   1570 O  OD1   . ASP A 1 203 ? -27.991 30.910 35.811 1.00 8.69  ? 203 ASP A OD1   1 
ATOM   1571 O  OD2   . ASP A 1 203 ? -26.492 31.859 37.097 1.00 10.75 ? 203 ASP A OD2   1 
ATOM   1572 N  N     . VAL A 1 204 ? -23.584 33.942 36.463 1.00 10.36 ? 204 VAL A N     1 
ATOM   1573 C  CA    . VAL A 1 204 ? -22.342 33.682 37.201 1.00 11.60 ? 204 VAL A CA    1 
ATOM   1574 C  C     . VAL A 1 204 ? -22.312 32.481 38.202 1.00 12.40 ? 204 VAL A C     1 
ATOM   1575 O  O     . VAL A 1 204 ? -21.326 31.704 38.232 1.00 12.34 ? 204 VAL A O     1 
ATOM   1576 C  CB    . VAL A 1 204 ? -21.841 35.003 37.907 1.00 12.34 ? 204 VAL A CB    1 
ATOM   1577 C  CG1   . VAL A 1 204 ? -20.582 34.756 38.748 1.00 11.67 ? 204 VAL A CG1   1 
ATOM   1578 C  CG2   . VAL A 1 204 ? -21.560 36.077 36.876 1.00 12.11 ? 204 VAL A CG2   1 
ATOM   1579 N  N     . SER A 1 205 ? -23.362 32.309 39.008 1.00 11.70 ? 205 SER A N     1 
ATOM   1580 C  CA    . SER A 1 205 ? -23.366 31.221 39.997 1.00 12.56 ? 205 SER A CA    1 
ATOM   1581 C  C     . SER A 1 205 ? -23.362 29.849 39.352 1.00 13.02 ? 205 SER A C     1 
ATOM   1582 O  O     . SER A 1 205 ? -22.634 28.950 39.774 1.00 12.06 ? 205 SER A O     1 
ATOM   1583 C  CB    . SER A 1 205 ? -24.529 31.348 40.986 1.00 11.92 ? 205 SER A CB    1 
ATOM   1584 O  OG    . SER A 1 205 ? -25.757 30.991 40.402 1.00 14.21 ? 205 SER A OG    1 
ATOM   1585 N  N     . ASP A 1 206 ? -24.169 29.708 38.305 1.00 14.71 ? 206 ASP A N     1 
ATOM   1586 C  CA    . ASP A 1 206 ? -24.253 28.465 37.553 1.00 15.19 ? 206 ASP A CA    1 
ATOM   1587 C  C     . ASP A 1 206 ? -22.923 28.250 36.781 1.00 14.67 ? 206 ASP A C     1 
ATOM   1588 O  O     . ASP A 1 206 ? -22.356 27.132 36.748 1.00 13.97 ? 206 ASP A O     1 
ATOM   1589 C  CB    . ASP A 1 206 ? -25.449 28.542 36.616 1.00 17.94 ? 206 ASP A CB    1 
ATOM   1590 C  CG    . ASP A 1 206 ? -25.741 27.243 35.983 1.00 19.03 ? 206 ASP A CG    1 
ATOM   1591 O  OD1   . ASP A 1 206 ? -25.265 27.036 34.860 1.00 21.96 ? 206 ASP A OD1   1 
ATOM   1592 O  OD2   . ASP A 1 206 ? -26.426 26.424 36.616 1.00 21.14 ? 206 ASP A OD2   1 
ATOM   1593 N  N     . LEU A 1 207 ? -22.400 29.339 36.222 1.00 13.37 ? 207 LEU A N     1 
ATOM   1594 C  CA    . LEU A 1 207 ? -21.133 29.280 35.521 1.00 14.43 ? 207 LEU A CA    1 
ATOM   1595 C  C     . LEU A 1 207 ? -20.044 28.732 36.469 1.00 14.21 ? 207 LEU A C     1 
ATOM   1596 O  O     . LEU A 1 207 ? -19.365 27.735 36.153 1.00 14.10 ? 207 LEU A O     1 
ATOM   1597 C  CB    . LEU A 1 207 ? -20.768 30.669 34.979 1.00 14.99 ? 207 LEU A CB    1 
ATOM   1598 C  CG    . LEU A 1 207 ? -19.397 30.850 34.311 1.00 15.89 ? 207 LEU A CG    1 
ATOM   1599 C  CD1   . LEU A 1 207 ? -19.435 32.045 33.383 1.00 16.87 ? 207 LEU A CD1   1 
ATOM   1600 C  CD2   . LEU A 1 207 ? -18.344 31.092 35.373 1.00 17.01 ? 207 LEU A CD2   1 
ATOM   1601 N  N     . LEU A 1 208 ? -19.903 29.349 37.647 1.00 13.98 ? 208 LEU A N     1 
ATOM   1602 C  CA    . LEU A 1 208 ? -18.900 28.901 38.627 1.00 12.89 ? 208 LEU A CA    1 
ATOM   1603 C  C     . LEU A 1 208 ? -19.174 27.476 39.144 1.00 11.74 ? 208 LEU A C     1 
ATOM   1604 O  O     . LEU A 1 208 ? -18.260 26.750 39.490 1.00 10.29 ? 208 LEU A O     1 
ATOM   1605 C  CB    . LEU A 1 208 ? -18.773 29.917 39.789 1.00 13.52 ? 208 LEU A CB    1 
ATOM   1606 C  CG    . LEU A 1 208 ? -18.287 31.334 39.420 1.00 12.52 ? 208 LEU A CG    1 
ATOM   1607 C  CD1   . LEU A 1 208 ? -18.649 32.302 40.518 1.00 13.10 ? 208 LEU A CD1   1 
ATOM   1608 C  CD2   . LEU A 1 208 ? -16.799 31.357 39.126 1.00 10.98 ? 208 LEU A CD2   1 
ATOM   1609 N  N     . ASP A 1 209 ? -20.430 27.076 39.242 1.00 13.09 ? 209 ASP A N     1 
ATOM   1610 C  CA    . ASP A 1 209 ? -20.699 25.702 39.668 1.00 14.29 ? 209 ASP A CA    1 
ATOM   1611 C  C     . ASP A 1 209 ? -20.165 24.754 38.581 1.00 14.18 ? 209 ASP A C     1 
ATOM   1612 O  O     . ASP A 1 209 ? -19.648 23.668 38.869 1.00 13.87 ? 209 ASP A O     1 
ATOM   1613 C  CB    . ASP A 1 209 ? -22.198 25.456 39.886 1.00 15.56 ? 209 ASP A CB    1 
ATOM   1614 C  CG    . ASP A 1 209 ? -22.492 24.035 40.375 1.00 16.39 ? 209 ASP A CG    1 
ATOM   1615 O  OD1   . ASP A 1 209 ? -23.382 23.392 39.813 1.00 17.72 ? 209 ASP A OD1   1 
ATOM   1616 O  OD2   . ASP A 1 209 ? -21.853 23.559 41.335 1.00 18.17 ? 209 ASP A OD2   1 
ATOM   1617 N  N     . GLN A 1 210 ? -20.277 25.171 37.325 1.00 14.44 ? 210 GLN A N     1 
ATOM   1618 C  CA    . GLN A 1 210 ? -19.766 24.342 36.231 1.00 15.53 ? 210 GLN A CA    1 
ATOM   1619 C  C     . GLN A 1 210 ? -18.235 24.317 36.202 1.00 14.74 ? 210 GLN A C     1 
ATOM   1620 O  O     . GLN A 1 210 ? -17.614 23.280 35.999 1.00 14.56 ? 210 GLN A O     1 
ATOM   1621 C  CB    . GLN A 1 210 ? -20.347 24.804 34.893 1.00 16.35 ? 210 GLN A CB    1 
ATOM   1622 C  CG    . GLN A 1 210 ? -21.829 24.612 34.849 1.00 17.91 ? 210 GLN A CG    1 
ATOM   1623 C  CD    . GLN A 1 210 ? -22.458 25.188 33.622 1.00 20.11 ? 210 GLN A CD    1 
ATOM   1624 O  OE1   . GLN A 1 210 ? -22.104 26.278 33.169 1.00 22.17 ? 210 GLN A OE1   1 
ATOM   1625 N  NE2   . GLN A 1 210 ? -23.419 24.470 33.076 1.00 22.03 ? 210 GLN A NE2   1 
ATOM   1626 N  N     . ALA A 1 211 ? -17.621 25.472 36.370 1.00 13.68 ? 211 ALA A N     1 
ATOM   1627 C  CA    . ALA A 1 211 ? -16.176 25.512 36.406 1.00 13.01 ? 211 ALA A CA    1 
ATOM   1628 C  C     . ALA A 1 211 ? -15.683 24.581 37.530 1.00 13.37 ? 211 ALA A C     1 
ATOM   1629 O  O     . ALA A 1 211 ? -14.769 23.781 37.347 1.00 14.58 ? 211 ALA A O     1 
ATOM   1630 C  CB    . ALA A 1 211 ? -15.708 26.953 36.665 1.00 10.54 ? 211 ALA A CB    1 
ATOM   1631 N  N     . ARG A 1 212 ? -16.295 24.696 38.700 1.00 13.94 ? 212 ARG A N     1 
ATOM   1632 C  CA    . ARG A 1 212 ? -15.900 23.946 39.880 1.00 13.42 ? 212 ARG A CA    1 
ATOM   1633 C  C     . ARG A 1 212 ? -15.928 22.476 39.601 1.00 13.63 ? 212 ARG A C     1 
ATOM   1634 O  O     . ARG A 1 212 ? -15.034 21.751 40.003 1.00 13.20 ? 212 ARG A O     1 
ATOM   1635 C  CB    . ARG A 1 212 ? -16.855 24.296 41.044 1.00 12.55 ? 212 ARG A CB    1 
ATOM   1636 C  CG    . ARG A 1 212 ? -16.424 23.875 42.449 1.00 9.73  ? 212 ARG A CG    1 
ATOM   1637 C  CD    . ARG A 1 212 ? -16.863 22.465 42.818 1.00 8.33  ? 212 ARG A CD    1 
ATOM   1638 N  NE    . ARG A 1 212 ? -18.310 22.323 42.741 1.00 8.88  ? 212 ARG A NE    1 
ATOM   1639 C  CZ    . ARG A 1 212 ? -18.870 21.126 42.788 1.00 9.22  ? 212 ARG A CZ    1 
ATOM   1640 N  NH1   . ARG A 1 212 ? -18.094 20.067 42.913 1.00 11.50 ? 212 ARG A NH1   1 
ATOM   1641 N  NH2   . ARG A 1 212 ? -20.175 20.980 42.596 1.00 7.45  ? 212 ARG A NH2   1 
ATOM   1642 N  N     . GLN A 1 213 ? -16.967 22.033 38.901 1.00 14.74 ? 213 GLN A N     1 
ATOM   1643 C  CA    . GLN A 1 213 ? -17.119 20.609 38.610 1.00 14.67 ? 213 GLN A CA    1 
ATOM   1644 C  C     . GLN A 1 213 ? -16.098 20.087 37.632 1.00 15.04 ? 213 GLN A C     1 
ATOM   1645 O  O     . GLN A 1 213 ? -15.756 18.911 37.684 1.00 15.47 ? 213 GLN A O     1 
ATOM   1646 C  CB    . GLN A 1 213 ? -18.559 20.286 38.203 1.00 13.64 ? 213 GLN A CB    1 
ATOM   1647 C  CG    . GLN A 1 213 ? -19.500 20.470 39.372 1.00 17.15 ? 213 GLN A CG    1 
ATOM   1648 C  CD    . GLN A 1 213 ? -20.973 20.191 39.069 1.00 19.40 ? 213 GLN A CD    1 
ATOM   1649 O  OE1   . GLN A 1 213 ? -21.866 20.866 39.600 1.00 19.60 ? 213 GLN A OE1   1 
ATOM   1650 N  NE2   . GLN A 1 213 ? -21.234 19.147 38.301 1.00 19.56 ? 213 GLN A NE2   1 
ATOM   1651 N  N     . ARG A 1 214 ? -15.614 20.971 36.762 1.00 15.73 ? 214 ARG A N     1 
ATOM   1652 C  CA    . ARG A 1 214 ? -14.599 20.673 35.749 1.00 17.34 ? 214 ARG A CA    1 
ATOM   1653 C  C     . ARG A 1 214 ? -13.205 20.814 36.364 1.00 17.81 ? 214 ARG A C     1 
ATOM   1654 O  O     . ARG A 1 214 ? -12.191 20.595 35.696 1.00 19.07 ? 214 ARG A O     1 
ATOM   1655 C  CB    . ARG A 1 214 ? -14.707 21.668 34.572 1.00 17.42 ? 214 ARG A CB    1 
ATOM   1656 C  CG    . ARG A 1 214 ? -16.090 21.695 33.931 1.00 20.97 ? 214 ARG A CG    1 
ATOM   1657 C  CD    . ARG A 1 214 ? -16.165 22.458 32.609 1.00 23.13 ? 214 ARG A CD    1 
ATOM   1658 N  NE    . ARG A 1 214 ? -15.820 23.876 32.777 1.00 25.24 ? 214 ARG A NE    1 
ATOM   1659 C  CZ    . ARG A 1 214 ? -16.654 24.856 32.430 1.00 24.26 ? 214 ARG A CZ    1 
ATOM   1660 N  NH1   . ARG A 1 214 ? -17.848 24.573 31.928 1.00 24.81 ? 214 ARG A NH1   1 
ATOM   1661 N  NH2   . ARG A 1 214 ? -16.262 26.121 32.544 1.00 23.72 ? 214 ARG A NH2   1 
ATOM   1662 N  N     . GLY A 1 215 ? -13.144 21.196 37.630 1.00 17.28 ? 215 GLY A N     1 
ATOM   1663 C  CA    . GLY A 1 215 ? -11.856 21.394 38.258 1.00 17.04 ? 215 GLY A CA    1 
ATOM   1664 C  C     . GLY A 1 215 ? -11.141 22.583 37.657 1.00 17.19 ? 215 GLY A C     1 
ATOM   1665 O  O     . GLY A 1 215 ? -9.933  22.634 37.720 1.00 19.97 ? 215 GLY A O     1 
ATOM   1666 N  N     . ASP A 1 216 ? -11.850 23.544 37.079 1.00 16.89 ? 216 ASP A N     1 
ATOM   1667 C  CA    . ASP A 1 216 ? -11.200 24.720 36.490 1.00 16.26 ? 216 ASP A CA    1 
ATOM   1668 C  C     . ASP A 1 216 ? -10.580 25.599 37.580 1.00 16.52 ? 216 ASP A C     1 
ATOM   1669 O  O     . ASP A 1 216 ? -11.115 25.685 38.705 1.00 15.48 ? 216 ASP A O     1 
ATOM   1670 C  CB    . ASP A 1 216 ? -12.211 25.568 35.714 1.00 18.28 ? 216 ASP A CB    1 
ATOM   1671 C  CG    . ASP A 1 216 ? -12.545 24.999 34.317 1.00 19.70 ? 216 ASP A CG    1 
ATOM   1672 O  OD1   . ASP A 1 216 ? -11.665 24.386 33.666 1.00 20.09 ? 216 ASP A OD1   1 
ATOM   1673 O  OD2   . ASP A 1 216 ? -13.692 25.207 33.853 1.00 20.12 ? 216 ASP A OD2   1 
ATOM   1674 N  N     . PHE A 1 217 ? -9.460  26.250 37.248 1.00 15.59 ? 217 PHE A N     1 
ATOM   1675 C  CA    . PHE A 1 217 ? -8.761  27.144 38.184 1.00 14.83 ? 217 PHE A CA    1 
ATOM   1676 C  C     . PHE A 1 217 ? -9.496  28.481 38.178 1.00 14.61 ? 217 PHE A C     1 
ATOM   1677 O  O     . PHE A 1 217 ? -9.677  29.099 37.116 1.00 15.43 ? 217 PHE A O     1 
ATOM   1678 C  CB    . PHE A 1 217 ? -7.292  27.349 37.784 1.00 13.71 ? 217 PHE A CB    1 
ATOM   1679 C  CG    . PHE A 1 217 ? -6.388  26.192 38.135 1.00 12.74 ? 217 PHE A CG    1 
ATOM   1680 C  CD1   . PHE A 1 217 ? -6.915  24.932 38.469 1.00 13.56 ? 217 PHE A CD1   1 
ATOM   1681 C  CD2   . PHE A 1 217 ? -5.008  26.357 38.121 1.00 12.39 ? 217 PHE A CD2   1 
ATOM   1682 C  CE1   . PHE A 1 217 ? -6.067  23.848 38.785 1.00 12.52 ? 217 PHE A CE1   1 
ATOM   1683 C  CE2   . PHE A 1 217 ? -4.152  25.289 38.431 1.00 13.00 ? 217 PHE A CE2   1 
ATOM   1684 C  CZ    . PHE A 1 217 ? -4.686  24.026 38.765 1.00 11.63 ? 217 PHE A CZ    1 
ATOM   1685 N  N     . VAL A 1 218 ? -9.939  28.911 39.354 1.00 12.97 ? 218 VAL A N     1 
ATOM   1686 C  CA    . VAL A 1 218 ? -10.684 30.146 39.472 1.00 11.22 ? 218 VAL A CA    1 
ATOM   1687 C  C     . VAL A 1 218 ? -10.016 31.086 40.468 1.00 10.98 ? 218 VAL A C     1 
ATOM   1688 O  O     . VAL A 1 218 ? -9.466  30.659 41.476 1.00 10.70 ? 218 VAL A O     1 
ATOM   1689 C  CB    . VAL A 1 218 ? -12.128 29.858 39.908 1.00 10.23 ? 218 VAL A CB    1 
ATOM   1690 C  CG1   . VAL A 1 218 ? -12.963 31.130 39.914 1.00 9.19  ? 218 VAL A CG1   1 
ATOM   1691 C  CG2   . VAL A 1 218 ? -12.741 28.833 39.006 1.00 9.53  ? 218 VAL A CG2   1 
ATOM   1692 N  N     . MET A 1 219 ? -9.981  32.364 40.149 1.00 11.13 ? 219 MET A N     1 
ATOM   1693 C  CA    . MET A 1 219 ? -9.395  33.291 41.090 1.00 12.01 ? 219 MET A CA    1 
ATOM   1694 C  C     . MET A 1 219 ? -10.416 34.343 41.479 1.00 12.11 ? 219 MET A C     1 
ATOM   1695 O  O     . MET A 1 219 ? -11.152 34.862 40.640 1.00 13.00 ? 219 MET A O     1 
ATOM   1696 C  CB    . MET A 1 219 ? -8.093  33.918 40.556 1.00 12.29 ? 219 MET A CB    1 
ATOM   1697 C  CG    . MET A 1 219 ? -7.500  34.989 41.472 1.00 13.68 ? 219 MET A CG    1 
ATOM   1698 S  SD    . MET A 1 219 ? -5.702  34.998 41.519 1.00 17.15 ? 219 MET A SD    1 
ATOM   1699 C  CE    . MET A 1 219 ? -5.425  33.294 42.006 1.00 14.31 ? 219 MET A CE    1 
ATOM   1700 N  N     . PHE A 1 220 ? -10.512 34.593 42.775 1.00 11.71 ? 220 PHE A N     1 
ATOM   1701 C  CA    . PHE A 1 220 ? -11.431 35.587 43.281 1.00 11.83 ? 220 PHE A CA    1 
ATOM   1702 C  C     . PHE A 1 220 ? -10.595 36.786 43.726 1.00 12.78 ? 220 PHE A C     1 
ATOM   1703 O  O     . PHE A 1 220 ? -9.706  36.670 44.587 1.00 13.41 ? 220 PHE A O     1 
ATOM   1704 C  CB    . PHE A 1 220 ? -12.288 34.991 44.420 1.00 10.08 ? 220 PHE A CB    1 
ATOM   1705 C  CG    . PHE A 1 220 ? -13.195 33.845 43.964 1.00 7.88  ? 220 PHE A CG    1 
ATOM   1706 C  CD1   . PHE A 1 220 ? -12.719 32.522 43.925 1.00 5.59  ? 220 PHE A CD1   1 
ATOM   1707 C  CD2   . PHE A 1 220 ? -14.519 34.098 43.557 1.00 5.88  ? 220 PHE A CD2   1 
ATOM   1708 C  CE1   . PHE A 1 220 ? -13.543 31.481 43.492 1.00 5.14  ? 220 PHE A CE1   1 
ATOM   1709 C  CE2   . PHE A 1 220 ? -15.359 33.054 43.118 1.00 4.53  ? 220 PHE A CE2   1 
ATOM   1710 C  CZ    . PHE A 1 220 ? -14.883 31.757 43.084 1.00 5.35  ? 220 PHE A CZ    1 
ATOM   1711 N  N     . GLU A 1 221 ? -10.887 37.935 43.124 1.00 13.15 ? 221 GLU A N     1 
ATOM   1712 C  CA    . GLU A 1 221 ? -10.179 39.173 43.398 1.00 13.06 ? 221 GLU A CA    1 
ATOM   1713 C  C     . GLU A 1 221 ? -10.844 40.046 44.463 1.00 12.87 ? 221 GLU A C     1 
ATOM   1714 O  O     . GLU A 1 221 ? -11.978 40.494 44.292 1.00 13.55 ? 221 GLU A O     1 
ATOM   1715 C  CB    . GLU A 1 221 ? -10.064 39.957 42.111 1.00 13.65 ? 221 GLU A CB    1 
ATOM   1716 C  CG    . GLU A 1 221 ? -9.199  41.195 42.201 1.00 16.22 ? 221 GLU A CG    1 
ATOM   1717 C  CD    . GLU A 1 221 ? -9.155  41.973 40.895 1.00 17.12 ? 221 GLU A CD    1 
ATOM   1718 O  OE1   . GLU A 1 221 ? -8.625  43.096 40.920 1.00 19.11 ? 221 GLU A OE1   1 
ATOM   1719 O  OE2   . GLU A 1 221 ? -9.654  41.481 39.848 1.00 17.84 ? 221 GLU A OE2   1 
ATOM   1720 N  N     . GLY A 1 222 ? -10.165 40.263 45.578 1.00 11.68 ? 222 GLY A N     1 
ATOM   1721 C  CA    . GLY A 1 222 ? -10.735 41.120 46.591 1.00 12.70 ? 222 GLY A CA    1 
ATOM   1722 C  C     . GLY A 1 222 ? -10.632 42.600 46.236 1.00 13.42 ? 222 GLY A C     1 
ATOM   1723 O  O     . GLY A 1 222 ? -9.927  42.986 45.323 1.00 16.29 ? 222 GLY A O     1 
ATOM   1724 N  N     . ALA A 1 223 ? -11.327 43.433 46.981 1.00 13.29 ? 223 ALA A N     1 
ATOM   1725 C  CA    . ALA A 1 223 ? -11.332 44.874 46.794 1.00 13.79 ? 223 ALA A CA    1 
ATOM   1726 C  C     . ALA A 1 223 ? -11.276 45.374 48.234 1.00 14.00 ? 223 ALA A C     1 
ATOM   1727 O  O     . ALA A 1 223 ? -11.787 44.696 49.136 1.00 15.71 ? 223 ALA A O     1 
ATOM   1728 C  CB    . ALA A 1 223 ? -12.611 45.331 46.113 1.00 13.50 ? 223 ALA A CB    1 
ATOM   1729 N  N     . GLN A 1 224 ? -10.684 46.540 48.460 1.00 12.90 ? 224 GLN A N     1 
ATOM   1730 C  CA    . GLN A 1 224 ? -10.531 47.055 49.824 1.00 13.30 ? 224 GLN A CA    1 
ATOM   1731 C  C     . GLN A 1 224 ? -9.777  46.049 50.736 1.00 13.01 ? 224 GLN A C     1 
ATOM   1732 O  O     . GLN A 1 224 ? -9.154  45.118 50.248 1.00 14.26 ? 224 GLN A O     1 
ATOM   1733 C  CB    . GLN A 1 224 ? -11.874 47.467 50.427 1.00 11.72 ? 224 GLN A CB    1 
ATOM   1734 C  CG    . GLN A 1 224 ? -12.459 48.686 49.758 1.00 11.74 ? 224 GLN A CG    1 
ATOM   1735 C  CD    . GLN A 1 224 ? -13.039 48.385 48.393 1.00 12.03 ? 224 GLN A CD    1 
ATOM   1736 O  OE1   . GLN A 1 224 ? -13.902 47.508 48.252 1.00 12.99 ? 224 GLN A OE1   1 
ATOM   1737 N  NE2   . GLN A 1 224 ? -12.624 49.150 47.387 1.00 10.20 ? 224 GLN A NE2   1 
ATOM   1738 N  N     . GLY A 1 225 ? -9.790  46.250 52.047 1.00 13.31 ? 225 GLY A N     1 
ATOM   1739 C  CA    . GLY A 1 225 ? -9.082  45.322 52.916 1.00 11.20 ? 225 GLY A CA    1 
ATOM   1740 C  C     . GLY A 1 225 ? -9.989  44.873 54.036 1.00 10.82 ? 225 GLY A C     1 
ATOM   1741 O  O     . GLY A 1 225 ? -11.095 45.429 54.197 1.00 8.66  ? 225 GLY A O     1 
ATOM   1742 N  N     . THR A 1 226 ? -9.526  43.876 54.798 1.00 10.40 ? 226 THR A N     1 
ATOM   1743 C  CA    . THR A 1 226 ? -10.290 43.306 55.915 1.00 9.71  ? 226 THR A CA    1 
ATOM   1744 C  C     . THR A 1 226 ? -10.861 44.326 56.919 1.00 10.47 ? 226 THR A C     1 
ATOM   1745 O  O     . THR A 1 226 ? -12.065 44.298 57.206 1.00 10.41 ? 226 THR A O     1 
ATOM   1746 C  CB    . THR A 1 226 ? -9.470  42.236 56.658 1.00 8.32  ? 226 THR A CB    1 
ATOM   1747 O  OG1   . THR A 1 226 ? -9.366  41.053 55.849 1.00 8.00  ? 226 THR A OG1   1 
ATOM   1748 C  CG2   . THR A 1 226 ? -10.131 41.874 57.940 1.00 7.45  ? 226 THR A CG2   1 
ATOM   1749 N  N     . LEU A 1 227 ? -10.036 45.271 57.381 1.00 10.99 ? 227 LEU A N     1 
ATOM   1750 C  CA    . LEU A 1 227 ? -10.492 46.267 58.358 1.00 10.13 ? 227 LEU A CA    1 
ATOM   1751 C  C     . LEU A 1 227 ? -11.461 47.317 57.815 1.00 9.05  ? 227 LEU A C     1 
ATOM   1752 O  O     . LEU A 1 227 ? -11.909 48.211 58.544 1.00 7.66  ? 227 LEU A O     1 
ATOM   1753 C  CB    . LEU A 1 227 ? -9.305  46.909 59.099 1.00 10.77 ? 227 LEU A CB    1 
ATOM   1754 C  CG    . LEU A 1 227 ? -8.546  45.978 60.060 1.00 12.56 ? 227 LEU A CG    1 
ATOM   1755 C  CD1   . LEU A 1 227 ? -7.585  46.779 60.854 1.00 12.76 ? 227 LEU A CD1   1 
ATOM   1756 C  CD2   . LEU A 1 227 ? -9.504  45.197 61.016 1.00 12.10 ? 227 LEU A CD2   1 
ATOM   1757 N  N     . LEU A 1 228 ? -11.805 47.194 56.542 1.00 8.66  ? 228 LEU A N     1 
ATOM   1758 C  CA    . LEU A 1 228 ? -12.769 48.105 55.920 1.00 8.99  ? 228 LEU A CA    1 
ATOM   1759 C  C     . LEU A 1 228 ? -14.097 47.355 55.735 1.00 8.49  ? 228 LEU A C     1 
ATOM   1760 O  O     . LEU A 1 228 ? -15.080 47.902 55.189 1.00 7.80  ? 228 LEU A O     1 
ATOM   1761 C  CB    . LEU A 1 228 ? -12.248 48.673 54.572 1.00 9.15  ? 228 LEU A CB    1 
ATOM   1762 C  CG    . LEU A 1 228 ? -11.094 49.700 54.554 1.00 10.05 ? 228 LEU A CG    1 
ATOM   1763 C  CD1   . LEU A 1 228 ? -10.754 50.170 53.137 1.00 9.04  ? 228 LEU A CD1   1 
ATOM   1764 C  CD2   . LEU A 1 228 ? -11.486 50.907 55.396 1.00 12.47 ? 228 LEU A CD2   1 
ATOM   1765 N  N     . ASP A 1 229 ? -14.132 46.121 56.232 1.00 8.03  ? 229 ASP A N     1 
ATOM   1766 C  CA    . ASP A 1 229 ? -15.325 45.282 56.135 1.00 8.79  ? 229 ASP A CA    1 
ATOM   1767 C  C     . ASP A 1 229 ? -16.532 45.902 56.860 1.00 8.42  ? 229 ASP A C     1 
ATOM   1768 O  O     . ASP A 1 229 ? -16.427 46.241 58.038 1.00 9.49  ? 229 ASP A O     1 
ATOM   1769 C  CB    . ASP A 1 229 ? -15.017 43.869 56.686 1.00 8.72  ? 229 ASP A CB    1 
ATOM   1770 C  CG    . ASP A 1 229 ? -16.194 42.896 56.515 1.00 9.28  ? 229 ASP A CG    1 
ATOM   1771 O  OD1   . ASP A 1 229 ? -16.145 42.063 55.579 1.00 8.46  ? 229 ASP A OD1   1 
ATOM   1772 O  OD2   . ASP A 1 229 ? -17.164 42.977 57.303 1.00 7.11  ? 229 ASP A OD2   1 
ATOM   1773 N  N     . ILE A 1 230 ? -17.662 46.061 56.169 1.00 8.00  ? 230 ILE A N     1 
ATOM   1774 C  CA    . ILE A 1 230 ? -18.874 46.636 56.779 1.00 7.97  ? 230 ILE A CA    1 
ATOM   1775 C  C     . ILE A 1 230 ? -19.260 46.046 58.185 1.00 9.65  ? 230 ILE A C     1 
ATOM   1776 O  O     . ILE A 1 230 ? -19.655 46.779 59.128 1.00 8.91  ? 230 ILE A O     1 
ATOM   1777 C  CB    . ILE A 1 230 ? -20.083 46.549 55.786 1.00 7.63  ? 230 ILE A CB    1 
ATOM   1778 C  CG1   . ILE A 1 230 ? -21.278 47.427 56.263 1.00 7.39  ? 230 ILE A CG1   1 
ATOM   1779 C  CG2   . ILE A 1 230 ? -20.504 45.065 55.546 1.00 5.36  ? 230 ILE A CG2   1 
ATOM   1780 C  CD1   . ILE A 1 230 ? -20.970 48.892 56.514 1.00 4.19  ? 230 ILE A CD1   1 
ATOM   1781 N  N     . ASP A 1 231 ? -19.094 44.733 58.342 1.00 10.60 ? 231 ASP A N     1 
ATOM   1782 C  CA    . ASP A 1 231 ? -19.420 44.049 59.596 1.00 10.49 ? 231 ASP A CA    1 
ATOM   1783 C  C     . ASP A 1 231 ? -18.275 44.004 60.605 1.00 10.39 ? 231 ASP A C     1 
ATOM   1784 O  O     . ASP A 1 231 ? -18.427 44.371 61.775 1.00 10.26 ? 231 ASP A O     1 
ATOM   1785 C  CB    . ASP A 1 231 ? -19.863 42.604 59.309 1.00 10.40 ? 231 ASP A CB    1 
ATOM   1786 C  CG    . ASP A 1 231 ? -21.313 42.508 58.835 1.00 11.75 ? 231 ASP A CG    1 
ATOM   1787 O  OD1   . ASP A 1 231 ? -22.213 42.617 59.705 1.00 13.13 ? 231 ASP A OD1   1 
ATOM   1788 O  OD2   . ASP A 1 231 ? -21.573 42.297 57.619 1.00 9.77  ? 231 ASP A OD2   1 
ATOM   1789 N  N     . HIS A 1 232 ? -17.107 43.587 60.141 1.00 10.46 ? 232 HIS A N     1 
ATOM   1790 C  CA    . HIS A 1 232 ? -15.979 43.404 61.031 1.00 8.92  ? 232 HIS A CA    1 
ATOM   1791 C  C     . HIS A 1 232 ? -14.939 44.518 61.083 1.00 9.19  ? 232 HIS A C     1 
ATOM   1792 O  O     . HIS A 1 232 ? -13.978 44.455 61.874 1.00 7.81  ? 232 HIS A O     1 
ATOM   1793 C  CB    . HIS A 1 232 ? -15.339 42.055 60.710 1.00 8.59  ? 232 HIS A CB    1 
ATOM   1794 C  CG    . HIS A 1 232 ? -16.318 40.918 60.660 1.00 8.89  ? 232 HIS A CG    1 
ATOM   1795 N  ND1   . HIS A 1 232 ? -16.809 40.339 61.802 1.00 9.63  ? 232 HIS A ND1   1 
ATOM   1796 C  CD2   . HIS A 1 232 ? -16.905 40.334 59.577 1.00 8.94  ? 232 HIS A CD2   1 
ATOM   1797 C  CE1   . HIS A 1 232 ? -17.680 39.426 61.400 1.00 9.44  ? 232 HIS A CE1   1 
ATOM   1798 N  NE2   . HIS A 1 232 ? -17.772 39.385 60.063 1.00 9.12  ? 232 HIS A NE2   1 
ATOM   1799 N  N     . GLY A 1 233 ? -15.124 45.547 60.263 1.00 8.74  ? 233 GLY A N     1 
ATOM   1800 C  CA    . GLY A 1 233 ? -14.182 46.653 60.268 1.00 8.81  ? 233 GLY A CA    1 
ATOM   1801 C  C     . GLY A 1 233 ? -14.407 47.718 61.347 1.00 9.35  ? 233 GLY A C     1 
ATOM   1802 O  O     . GLY A 1 233 ? -15.322 47.626 62.196 1.00 7.96  ? 233 GLY A O     1 
ATOM   1803 N  N     . THR A 1 234 ? -13.559 48.746 61.295 1.00 9.37  ? 234 THR A N     1 
ATOM   1804 C  CA    . THR A 1 234 ? -13.581 49.860 62.232 1.00 9.14  ? 234 THR A CA    1 
ATOM   1805 C  C     . THR A 1 234 ? -14.783 50.762 61.912 1.00 9.53  ? 234 THR A C     1 
ATOM   1806 O  O     . THR A 1 234 ? -14.652 51.934 61.523 1.00 9.01  ? 234 THR A O     1 
ATOM   1807 C  CB    . THR A 1 234 ? -12.234 50.633 62.156 1.00 9.25  ? 234 THR A CB    1 
ATOM   1808 O  OG1   . THR A 1 234 ? -12.071 51.192 60.846 1.00 12.34 ? 234 THR A OG1   1 
ATOM   1809 C  CG2   . THR A 1 234 ? -11.072 49.700 62.385 1.00 7.26  ? 234 THR A CG2   1 
ATOM   1810 N  N     . TYR A 1 235 ? -15.967 50.192 62.095 1.00 10.00 ? 235 TYR A N     1 
ATOM   1811 C  CA    . TYR A 1 235 ? -17.227 50.862 61.810 1.00 10.53 ? 235 TYR A CA    1 
ATOM   1812 C  C     . TYR A 1 235 ? -17.353 52.191 62.547 1.00 12.01 ? 235 TYR A C     1 
ATOM   1813 O  O     . TYR A 1 235 ? -16.940 52.290 63.702 1.00 14.22 ? 235 TYR A O     1 
ATOM   1814 C  CB    . TYR A 1 235 ? -18.372 49.926 62.201 1.00 8.84  ? 235 TYR A CB    1 
ATOM   1815 C  CG    . TYR A 1 235 ? -19.744 50.427 61.831 1.00 8.31  ? 235 TYR A CG    1 
ATOM   1816 C  CD1   . TYR A 1 235 ? -20.539 51.098 62.766 1.00 7.90  ? 235 TYR A CD1   1 
ATOM   1817 C  CD2   . TYR A 1 235 ? -20.272 50.202 60.553 1.00 7.71  ? 235 TYR A CD2   1 
ATOM   1818 C  CE1   . TYR A 1 235 ? -21.840 51.527 62.433 1.00 7.00  ? 235 TYR A CE1   1 
ATOM   1819 C  CE2   . TYR A 1 235 ? -21.561 50.632 60.213 1.00 6.50  ? 235 TYR A CE2   1 
ATOM   1820 C  CZ    . TYR A 1 235 ? -22.333 51.293 61.163 1.00 6.81  ? 235 TYR A CZ    1 
ATOM   1821 O  OH    . TYR A 1 235 ? -23.576 51.742 60.833 1.00 6.14  ? 235 TYR A OH    1 
ATOM   1822 N  N     . PRO A 1 236 ? -17.935 53.232 61.907 1.00 12.95 ? 236 PRO A N     1 
ATOM   1823 C  CA    . PRO A 1 236 ? -18.498 53.316 60.549 1.00 12.80 ? 236 PRO A CA    1 
ATOM   1824 C  C     . PRO A 1 236 ? -17.413 53.733 59.500 1.00 13.68 ? 236 PRO A C     1 
ATOM   1825 O  O     . PRO A 1 236 ? -17.726 54.011 58.327 1.00 13.28 ? 236 PRO A O     1 
ATOM   1826 C  CB    . PRO A 1 236 ? -19.546 54.407 60.720 1.00 12.23 ? 236 PRO A CB    1 
ATOM   1827 C  CG    . PRO A 1 236 ? -18.778 55.398 61.567 1.00 11.45 ? 236 PRO A CG    1 
ATOM   1828 C  CD    . PRO A 1 236 ? -18.189 54.497 62.638 1.00 11.85 ? 236 PRO A CD    1 
ATOM   1829 N  N     . TYR A 1 237 ? -16.150 53.793 59.925 1.00 12.94 ? 237 TYR A N     1 
ATOM   1830 C  CA    . TYR A 1 237 ? -15.096 54.176 59.010 1.00 13.94 ? 237 TYR A CA    1 
ATOM   1831 C  C     . TYR A 1 237 ? -14.782 52.961 58.158 1.00 13.25 ? 237 TYR A C     1 
ATOM   1832 O  O     . TYR A 1 237 ? -13.711 52.334 58.290 1.00 12.86 ? 237 TYR A O     1 
ATOM   1833 C  CB    . TYR A 1 237 ? -13.879 54.687 59.789 1.00 15.45 ? 237 TYR A CB    1 
ATOM   1834 C  CG    . TYR A 1 237 ? -14.237 55.938 60.533 1.00 17.85 ? 237 TYR A CG    1 
ATOM   1835 C  CD1   . TYR A 1 237 ? -14.522 57.121 59.845 1.00 19.33 ? 237 TYR A CD1   1 
ATOM   1836 C  CD2   . TYR A 1 237 ? -14.447 55.911 61.916 1.00 19.09 ? 237 TYR A CD2   1 
ATOM   1837 C  CE1   . TYR A 1 237 ? -15.026 58.243 60.525 1.00 20.73 ? 237 TYR A CE1   1 
ATOM   1838 C  CE2   . TYR A 1 237 ? -14.941 57.013 62.597 1.00 19.85 ? 237 TYR A CE2   1 
ATOM   1839 C  CZ    . TYR A 1 237 ? -15.231 58.169 61.904 1.00 20.71 ? 237 TYR A CZ    1 
ATOM   1840 O  OH    . TYR A 1 237 ? -15.742 59.246 62.600 1.00 23.96 ? 237 TYR A OH    1 
ATOM   1841 N  N     . VAL A 1 238 ? -15.733 52.618 57.293 1.00 11.29 ? 238 VAL A N     1 
ATOM   1842 C  CA    . VAL A 1 238 ? -15.581 51.427 56.454 1.00 10.25 ? 238 VAL A CA    1 
ATOM   1843 C  C     . VAL A 1 238 ? -16.188 51.561 55.023 1.00 10.15 ? 238 VAL A C     1 
ATOM   1844 O  O     . VAL A 1 238 ? -16.737 52.622 54.617 1.00 8.60  ? 238 VAL A O     1 
ATOM   1845 C  CB    . VAL A 1 238 ? -16.300 50.165 57.154 1.00 9.38  ? 238 VAL A CB    1 
ATOM   1846 C  CG1   . VAL A 1 238 ? -15.564 49.706 58.468 1.00 7.10  ? 238 VAL A CG1   1 
ATOM   1847 C  CG2   . VAL A 1 238 ? -17.770 50.489 57.443 1.00 5.65  ? 238 VAL A CG2   1 
ATOM   1848 N  N     . THR A 1 239 ? -16.095 50.462 54.274 1.00 8.82  ? 239 THR A N     1 
ATOM   1849 C  CA    . THR A 1 239 ? -16.716 50.417 52.984 1.00 8.64  ? 239 THR A CA    1 
ATOM   1850 C  C     . THR A 1 239 ? -18.011 49.663 53.275 1.00 7.96  ? 239 THR A C     1 
ATOM   1851 O  O     . THR A 1 239 ? -18.115 48.999 54.305 1.00 9.31  ? 239 THR A O     1 
ATOM   1852 C  CB    . THR A 1 239 ? -15.831 49.729 51.909 1.00 9.56  ? 239 THR A CB    1 
ATOM   1853 O  OG1   . THR A 1 239 ? -16.332 50.077 50.595 1.00 9.75  ? 239 THR A OG1   1 
ATOM   1854 C  CG2   . THR A 1 239 ? -15.796 48.201 52.095 1.00 9.11  ? 239 THR A CG2   1 
ATOM   1855 N  N     . SER A 1 240 ? -18.988 49.753 52.384 1.00 7.48  ? 240 SER A N     1 
ATOM   1856 C  CA    . SER A 1 240 ? -20.284 49.116 52.573 1.00 6.06  ? 240 SER A CA    1 
ATOM   1857 C  C     . SER A 1 240 ? -20.432 47.666 52.149 1.00 5.62  ? 240 SER A C     1 
ATOM   1858 O  O     . SER A 1 240 ? -21.549 47.163 52.052 1.00 5.54  ? 240 SER A O     1 
ATOM   1859 C  CB    . SER A 1 240 ? -21.369 49.945 51.888 1.00 6.48  ? 240 SER A CB    1 
ATOM   1860 O  OG    . SER A 1 240 ? -21.240 51.301 52.255 1.00 6.07  ? 240 SER A OG    1 
ATOM   1861 N  N     . SER A 1 241 ? -19.342 46.974 51.868 1.00 6.01  ? 241 SER A N     1 
ATOM   1862 C  CA    . SER A 1 241 ? -19.495 45.571 51.470 1.00 5.74  ? 241 SER A CA    1 
ATOM   1863 C  C     . SER A 1 241 ? -18.646 44.743 52.382 1.00 5.60  ? 241 SER A C     1 
ATOM   1864 O  O     . SER A 1 241 ? -17.846 45.280 53.134 1.00 6.14  ? 241 SER A O     1 
ATOM   1865 C  CB    . SER A 1 241 ? -19.019 45.364 50.026 1.00 5.64  ? 241 SER A CB    1 
ATOM   1866 O  OG    . SER A 1 241 ? -17.670 45.781 49.852 1.00 7.45  ? 241 SER A OG    1 
ATOM   1867 N  N     . ASN A 1 242 ? -18.843 43.443 52.368 1.00 5.90  ? 242 ASN A N     1 
ATOM   1868 C  CA    . ASN A 1 242 ? -17.971 42.585 53.158 1.00 6.14  ? 242 ASN A CA    1 
ATOM   1869 C  C     . ASN A 1 242 ? -16.681 42.339 52.350 1.00 6.17  ? 242 ASN A C     1 
ATOM   1870 O  O     . ASN A 1 242 ? -16.716 41.738 51.287 1.00 5.30  ? 242 ASN A O     1 
ATOM   1871 C  CB    . ASN A 1 242 ? -18.665 41.262 53.493 1.00 4.27  ? 242 ASN A CB    1 
ATOM   1872 C  CG    . ASN A 1 242 ? -19.874 41.460 54.387 1.00 2.84  ? 242 ASN A CG    1 
ATOM   1873 O  OD1   . ASN A 1 242 ? -20.994 41.374 53.927 1.00 1.76  ? 242 ASN A OD1   1 
ATOM   1874 N  ND2   . ASN A 1 242 ? -19.646 41.743 55.666 1.00 2.68  ? 242 ASN A ND2   1 
ATOM   1875 N  N     . THR A 1 243 ? -15.560 42.845 52.844 1.00 7.22  ? 243 THR A N     1 
ATOM   1876 C  CA    . THR A 1 243 ? -14.259 42.661 52.189 1.00 7.60  ? 243 THR A CA    1 
ATOM   1877 C  C     . THR A 1 243 ? -13.593 41.337 52.648 1.00 8.74  ? 243 THR A C     1 
ATOM   1878 O  O     . THR A 1 243 ? -12.623 40.847 52.050 1.00 8.11  ? 243 THR A O     1 
ATOM   1879 C  CB    . THR A 1 243 ? -13.347 43.833 52.518 1.00 8.10  ? 243 THR A CB    1 
ATOM   1880 O  OG1   . THR A 1 243 ? -13.044 43.816 53.919 1.00 8.34  ? 243 THR A OG1   1 
ATOM   1881 C  CG2   . THR A 1 243 ? -14.037 45.159 52.172 1.00 7.29  ? 243 THR A CG2   1 
ATOM   1882 N  N     . THR A 1 244 ? -14.113 40.770 53.736 1.00 9.42  ? 244 THR A N     1 
ATOM   1883 C  CA    . THR A 1 244 ? -13.618 39.500 54.265 1.00 9.03  ? 244 THR A CA    1 
ATOM   1884 C  C     . THR A 1 244 ? -14.049 38.332 53.342 1.00 9.46  ? 244 THR A C     1 
ATOM   1885 O  O     . THR A 1 244 ? -15.004 38.458 52.559 1.00 10.76 ? 244 THR A O     1 
ATOM   1886 C  CB    . THR A 1 244 ? -14.145 39.256 55.716 1.00 7.46  ? 244 THR A CB    1 
ATOM   1887 O  OG1   . THR A 1 244 ? -15.552 39.512 55.771 1.00 5.29  ? 244 THR A OG1   1 
ATOM   1888 C  CG2   . THR A 1 244 ? -13.435 40.164 56.713 1.00 6.70  ? 244 THR A CG2   1 
ATOM   1889 N  N     . ALA A 1 245 ? -13.374 37.195 53.475 1.00 8.72  ? 245 ALA A N     1 
ATOM   1890 C  CA    . ALA A 1 245 ? -13.628 36.021 52.658 1.00 8.64  ? 245 ALA A CA    1 
ATOM   1891 C  C     . ALA A 1 245 ? -15.073 35.490 52.491 1.00 8.85  ? 245 ALA A C     1 
ATOM   1892 O  O     . ALA A 1 245 ? -15.381 34.875 51.467 1.00 9.49  ? 245 ALA A O     1 
ATOM   1893 C  CB    . ALA A 1 245 ? -12.670 34.911 53.064 1.00 9.50  ? 245 ALA A CB    1 
ATOM   1894 N  N     . GLY A 1 246 ? -15.962 35.709 53.463 1.00 8.21  ? 246 GLY A N     1 
ATOM   1895 C  CA    . GLY A 1 246 ? -17.339 35.259 53.293 1.00 7.05  ? 246 GLY A CA    1 
ATOM   1896 C  C     . GLY A 1 246 ? -18.010 35.965 52.112 1.00 7.11  ? 246 GLY A C     1 
ATOM   1897 O  O     . GLY A 1 246 ? -18.951 35.430 51.487 1.00 6.63  ? 246 GLY A O     1 
ATOM   1898 N  N     . GLY A 1 247 ? -17.531 37.176 51.804 1.00 6.37  ? 247 GLY A N     1 
ATOM   1899 C  CA    . GLY A 1 247 ? -18.079 37.920 50.692 1.00 6.51  ? 247 GLY A CA    1 
ATOM   1900 C  C     . GLY A 1 247 ? -17.884 37.204 49.356 1.00 7.21  ? 247 GLY A C     1 
ATOM   1901 O  O     . GLY A 1 247 ? -18.595 37.465 48.420 1.00 7.44  ? 247 GLY A O     1 
ATOM   1902 N  N     . VAL A 1 248 ? -16.930 36.282 49.283 1.00 7.54  ? 248 VAL A N     1 
ATOM   1903 C  CA    . VAL A 1 248 ? -16.644 35.542 48.077 1.00 6.76  ? 248 VAL A CA    1 
ATOM   1904 C  C     . VAL A 1 248 ? -17.908 34.798 47.622 1.00 9.24  ? 248 VAL A C     1 
ATOM   1905 O  O     . VAL A 1 248 ? -18.311 34.872 46.463 1.00 10.33 ? 248 VAL A O     1 
ATOM   1906 C  CB    . VAL A 1 248 ? -15.471 34.579 48.338 1.00 4.71  ? 248 VAL A CB    1 
ATOM   1907 C  CG1   . VAL A 1 248 ? -15.294 33.606 47.197 1.00 3.82  ? 248 VAL A CG1   1 
ATOM   1908 C  CG2   . VAL A 1 248 ? -14.213 35.372 48.524 1.00 2.81  ? 248 VAL A CG2   1 
ATOM   1909 N  N     . ALA A 1 249 ? -18.567 34.109 48.543 1.00 10.99 ? 249 ALA A N     1 
ATOM   1910 C  CA    . ALA A 1 249 ? -19.770 33.379 48.191 1.00 10.51 ? 249 ALA A CA    1 
ATOM   1911 C  C     . ALA A 1 249 ? -20.972 34.307 48.087 1.00 11.08 ? 249 ALA A C     1 
ATOM   1912 O  O     . ALA A 1 249 ? -21.732 34.210 47.143 1.00 12.09 ? 249 ALA A O     1 
ATOM   1913 C  CB    . ALA A 1 249 ? -20.032 32.264 49.189 1.00 11.14 ? 249 ALA A CB    1 
ATOM   1914 N  N     . THR A 1 250 ? -21.146 35.255 48.995 1.00 10.78 ? 250 THR A N     1 
ATOM   1915 C  CA    . THR A 1 250 ? -22.338 36.070 48.840 1.00 10.85 ? 250 THR A CA    1 
ATOM   1916 C  C     . THR A 1 250 ? -22.312 36.802 47.501 1.00 11.02 ? 250 THR A C     1 
ATOM   1917 O  O     . THR A 1 250 ? -23.312 36.843 46.799 1.00 11.63 ? 250 THR A O     1 
ATOM   1918 C  CB    . THR A 1 250 ? -22.572 37.070 50.006 1.00 10.64 ? 250 THR A CB    1 
ATOM   1919 O  OG1   . THR A 1 250 ? -21.484 37.987 50.084 1.00 12.51 ? 250 THR A OG1   1 
ATOM   1920 C  CG2   . THR A 1 250 ? -22.744 36.346 51.336 1.00 8.83  ? 250 THR A CG2   1 
ATOM   1921 N  N     . GLY A 1 251 ? -21.148 37.330 47.126 1.00 10.60 ? 251 GLY A N     1 
ATOM   1922 C  CA    . GLY A 1 251 ? -21.022 38.064 45.884 1.00 9.19  ? 251 GLY A CA    1 
ATOM   1923 C  C     . GLY A 1 251 ? -20.696 37.345 44.582 1.00 9.33  ? 251 GLY A C     1 
ATOM   1924 O  O     . GLY A 1 251 ? -20.426 38.034 43.608 1.00 9.18  ? 251 GLY A O     1 
ATOM   1925 N  N     . SER A 1 252 ? -20.680 36.014 44.537 1.00 8.47  ? 252 SER A N     1 
ATOM   1926 C  CA    . SER A 1 252 ? -20.405 35.340 43.289 1.00 9.36  ? 252 SER A CA    1 
ATOM   1927 C  C     . SER A 1 252 ? -21.380 34.184 43.032 1.00 10.91 ? 252 SER A C     1 
ATOM   1928 O  O     . SER A 1 252 ? -21.589 33.760 41.865 1.00 11.64 ? 252 SER A O     1 
ATOM   1929 C  CB    . SER A 1 252 ? -18.958 34.837 43.252 1.00 9.24  ? 252 SER A CB    1 
ATOM   1930 O  OG    . SER A 1 252 ? -18.761 33.814 44.222 1.00 10.94 ? 252 SER A OG    1 
ATOM   1931 N  N     . GLY A 1 253 ? -21.977 33.672 44.111 1.00 11.56 ? 253 GLY A N     1 
ATOM   1932 C  CA    . GLY A 1 253 ? -22.917 32.568 44.014 1.00 10.80 ? 253 GLY A CA    1 
ATOM   1933 C  C     . GLY A 1 253 ? -22.256 31.217 44.197 1.00 11.68 ? 253 GLY A C     1 
ATOM   1934 O  O     . GLY A 1 253 ? -22.942 30.204 44.194 1.00 12.92 ? 253 GLY A O     1 
ATOM   1935 N  N     . LEU A 1 254 ? -20.933 31.172 44.313 1.00 11.77 ? 254 LEU A N     1 
ATOM   1936 C  CA    . LEU A 1 254 ? -20.245 29.893 44.527 1.00 12.68 ? 254 LEU A CA    1 
ATOM   1937 C  C     . LEU A 1 254 ? -20.422 29.447 45.995 1.00 12.77 ? 254 LEU A C     1 
ATOM   1938 O  O     . LEU A 1 254 ? -20.321 30.276 46.923 1.00 12.44 ? 254 LEU A O     1 
ATOM   1939 C  CB    . LEU A 1 254 ? -18.739 30.002 44.184 1.00 12.43 ? 254 LEU A CB    1 
ATOM   1940 C  CG    . LEU A 1 254 ? -17.771 28.845 44.548 1.00 12.10 ? 254 LEU A CG    1 
ATOM   1941 C  CD1   . LEU A 1 254 ? -17.610 27.825 43.438 1.00 10.74 ? 254 LEU A CD1   1 
ATOM   1942 C  CD2   . LEU A 1 254 ? -16.419 29.414 44.907 1.00 11.29 ? 254 LEU A CD2   1 
ATOM   1943 N  N     . GLY A 1 255 ? -20.657 28.149 46.188 1.00 11.56 ? 255 GLY A N     1 
ATOM   1944 C  CA    . GLY A 1 255 ? -20.851 27.614 47.515 1.00 12.38 ? 255 GLY A CA    1 
ATOM   1945 C  C     . GLY A 1 255 ? -19.634 27.850 48.363 1.00 13.56 ? 255 GLY A C     1 
ATOM   1946 O  O     . GLY A 1 255 ? -18.512 27.609 47.880 1.00 14.48 ? 255 GLY A O     1 
ATOM   1947 N  N     . PRO A 1 256 ? -19.800 28.266 49.641 1.00 13.73 ? 256 PRO A N     1 
ATOM   1948 C  CA    . PRO A 1 256 ? -18.645 28.522 50.529 1.00 13.41 ? 256 PRO A CA    1 
ATOM   1949 C  C     . PRO A 1 256 ? -17.690 27.333 50.754 1.00 12.59 ? 256 PRO A C     1 
ATOM   1950 O  O     . PRO A 1 256 ? -16.507 27.526 51.024 1.00 13.16 ? 256 PRO A O     1 
ATOM   1951 C  CB    . PRO A 1 256 ? -19.298 29.016 51.842 1.00 12.85 ? 256 PRO A CB    1 
ATOM   1952 C  CG    . PRO A 1 256 ? -20.661 28.413 51.828 1.00 12.13 ? 256 PRO A CG    1 
ATOM   1953 C  CD    . PRO A 1 256 ? -21.075 28.480 50.354 1.00 13.56 ? 256 PRO A CD    1 
ATOM   1954 N  N     . ARG A 1 257 ? -18.189 26.108 50.634 1.00 12.28 ? 257 ARG A N     1 
ATOM   1955 C  CA    . ARG A 1 257 ? -17.324 24.959 50.825 1.00 11.47 ? 257 ARG A CA    1 
ATOM   1956 C  C     . ARG A 1 257 ? -16.362 24.749 49.653 1.00 12.02 ? 257 ARG A C     1 
ATOM   1957 O  O     . ARG A 1 257 ? -15.506 23.846 49.713 1.00 12.53 ? 257 ARG A O     1 
ATOM   1958 C  CB    . ARG A 1 257 ? -18.127 23.688 51.103 1.00 10.39 ? 257 ARG A CB    1 
ATOM   1959 C  CG    . ARG A 1 257 ? -18.664 23.554 52.523 1.00 10.48 ? 257 ARG A CG    1 
ATOM   1960 C  CD    . ARG A 1 257 ? -19.074 22.098 52.804 1.00 12.01 ? 257 ARG A CD    1 
ATOM   1961 N  NE    . ARG A 1 257 ? -19.997 21.602 51.775 1.00 15.82 ? 257 ARG A NE    1 
ATOM   1962 C  CZ    . ARG A 1 257 ? -19.677 20.627 50.910 1.00 15.82 ? 257 ARG A CZ    1 
ATOM   1963 N  NH1   . ARG A 1 257 ? -18.487 20.047 50.957 1.00 17.24 ? 257 ARG A NH1   1 
ATOM   1964 N  NH2   . ARG A 1 257 ? -20.553 20.241 49.975 1.00 15.68 ? 257 ARG A NH2   1 
ATOM   1965 N  N     . TYR A 1 258 ? -16.484 25.555 48.591 1.00 11.48 ? 258 TYR A N     1 
ATOM   1966 C  CA    . TYR A 1 258 ? -15.583 25.401 47.446 1.00 11.52 ? 258 TYR A CA    1 
ATOM   1967 C  C     . TYR A 1 258 ? -14.366 26.349 47.415 1.00 12.20 ? 258 TYR A C     1 
ATOM   1968 O  O     . TYR A 1 258 ? -13.651 26.429 46.437 1.00 11.75 ? 258 TYR A O     1 
ATOM   1969 C  CB    . TYR A 1 258 ? -16.377 25.404 46.131 1.00 11.57 ? 258 TYR A CB    1 
ATOM   1970 C  CG    . TYR A 1 258 ? -17.483 24.363 46.131 1.00 9.82  ? 258 TYR A CG    1 
ATOM   1971 C  CD1   . TYR A 1 258 ? -17.220 23.042 46.493 1.00 9.95  ? 258 TYR A CD1   1 
ATOM   1972 C  CD2   . TYR A 1 258 ? -18.796 24.711 45.869 1.00 10.32 ? 258 TYR A CD2   1 
ATOM   1973 C  CE1   . TYR A 1 258 ? -18.233 22.090 46.603 1.00 9.39  ? 258 TYR A CE1   1 
ATOM   1974 C  CE2   . TYR A 1 258 ? -19.841 23.748 45.977 1.00 10.41 ? 258 TYR A CE2   1 
ATOM   1975 C  CZ    . TYR A 1 258 ? -19.529 22.445 46.346 1.00 9.22  ? 258 TYR A CZ    1 
ATOM   1976 O  OH    . TYR A 1 258 ? -20.503 21.494 46.462 1.00 10.86 ? 258 TYR A OH    1 
ATOM   1977 N  N     . VAL A 1 259 ? -14.128 27.082 48.492 1.00 13.08 ? 259 VAL A N     1 
ATOM   1978 C  CA    . VAL A 1 259 ? -12.951 27.926 48.526 1.00 14.16 ? 259 VAL A CA    1 
ATOM   1979 C  C     . VAL A 1 259 ? -11.791 27.001 48.920 1.00 14.54 ? 259 VAL A C     1 
ATOM   1980 O  O     . VAL A 1 259 ? -11.838 26.381 49.975 1.00 15.83 ? 259 VAL A O     1 
ATOM   1981 C  CB    . VAL A 1 259 ? -13.103 29.042 49.555 1.00 14.00 ? 259 VAL A CB    1 
ATOM   1982 C  CG1   . VAL A 1 259 ? -11.874 29.875 49.564 1.00 15.58 ? 259 VAL A CG1   1 
ATOM   1983 C  CG2   . VAL A 1 259 ? -14.287 29.920 49.208 1.00 15.02 ? 259 VAL A CG2   1 
ATOM   1984 N  N     . ASP A 1 260 ? -10.764 26.871 48.091 1.00 14.56 ? 260 ASP A N     1 
ATOM   1985 C  CA    . ASP A 1 260 ? -9.662  25.969 48.455 1.00 14.28 ? 260 ASP A CA    1 
ATOM   1986 C  C     . ASP A 1 260 ? -8.505  26.692 49.135 1.00 14.12 ? 260 ASP A C     1 
ATOM   1987 O  O     . ASP A 1 260 ? -7.957  26.218 50.124 1.00 15.49 ? 260 ASP A O     1 
ATOM   1988 C  CB    . ASP A 1 260 ? -9.132  25.224 47.233 1.00 14.58 ? 260 ASP A CB    1 
ATOM   1989 C  CG    . ASP A 1 260 ? -10.245 24.664 46.361 1.00 16.23 ? 260 ASP A CG    1 
ATOM   1990 O  OD1   . ASP A 1 260 ? -11.238 24.123 46.879 1.00 13.62 ? 260 ASP A OD1   1 
ATOM   1991 O  OD2   . ASP A 1 260 ? -10.120 24.775 45.126 1.00 18.17 ? 260 ASP A OD2   1 
ATOM   1992 N  N     . TYR A 1 261 ? -8.134  27.852 48.634 1.00 12.12 ? 261 TYR A N     1 
ATOM   1993 C  CA    . TYR A 1 261 ? -7.036  28.538 49.240 1.00 11.02 ? 261 TYR A CA    1 
ATOM   1994 C  C     . TYR A 1 261 ? -7.360  30.032 49.302 1.00 11.99 ? 261 TYR A C     1 
ATOM   1995 O  O     . TYR A 1 261 ? -7.864  30.582 48.316 1.00 12.46 ? 261 TYR A O     1 
ATOM   1996 C  CB    . TYR A 1 261 ? -5.782  28.252 48.418 1.00 8.36  ? 261 TYR A CB    1 
ATOM   1997 C  CG    . TYR A 1 261 ? -4.501  28.845 48.969 1.00 6.86  ? 261 TYR A CG    1 
ATOM   1998 C  CD1   . TYR A 1 261 ? -4.316  30.218 48.998 1.00 6.87  ? 261 TYR A CD1   1 
ATOM   1999 C  CD2   . TYR A 1 261 ? -3.452  28.030 49.403 1.00 6.26  ? 261 TYR A CD2   1 
ATOM   2000 C  CE1   . TYR A 1 261 ? -3.144  30.775 49.426 1.00 5.78  ? 261 TYR A CE1   1 
ATOM   2001 C  CE2   . TYR A 1 261 ? -2.249  28.583 49.845 1.00 5.88  ? 261 TYR A CE2   1 
ATOM   2002 C  CZ    . TYR A 1 261 ? -2.111  29.964 49.846 1.00 6.59  ? 261 TYR A CZ    1 
ATOM   2003 O  OH    . TYR A 1 261 ? -0.939  30.586 50.235 1.00 8.10  ? 261 TYR A OH    1 
ATOM   2004 N  N     . VAL A 1 262 ? -7.139  30.653 50.476 1.00 11.70 ? 262 VAL A N     1 
ATOM   2005 C  CA    . VAL A 1 262 ? -7.363  32.088 50.682 1.00 11.15 ? 262 VAL A CA    1 
ATOM   2006 C  C     . VAL A 1 262 ? -5.989  32.745 50.835 1.00 12.67 ? 262 VAL A C     1 
ATOM   2007 O  O     . VAL A 1 262 ? -5.289  32.510 51.817 1.00 13.01 ? 262 VAL A O     1 
ATOM   2008 C  CB    . VAL A 1 262 ? -8.183  32.403 51.948 1.00 9.39  ? 262 VAL A CB    1 
ATOM   2009 C  CG1   . VAL A 1 262 ? -8.542  33.867 51.978 1.00 8.05  ? 262 VAL A CG1   1 
ATOM   2010 C  CG2   . VAL A 1 262 ? -9.423  31.566 52.025 1.00 7.84  ? 262 VAL A CG2   1 
ATOM   2011 N  N     . LEU A 1 263 ? -5.592  33.532 49.839 1.00 13.94 ? 263 LEU A N     1 
ATOM   2012 C  CA    . LEU A 1 263 ? -4.305  34.202 49.841 1.00 14.27 ? 263 LEU A CA    1 
ATOM   2013 C  C     . LEU A 1 263 ? -4.545  35.643 50.306 1.00 14.75 ? 263 LEU A C     1 
ATOM   2014 O  O     . LEU A 1 263 ? -5.275  36.402 49.636 1.00 14.98 ? 263 LEU A O     1 
ATOM   2015 C  CB    . LEU A 1 263 ? -3.707  34.163 48.421 1.00 13.79 ? 263 LEU A CB    1 
ATOM   2016 C  CG    . LEU A 1 263 ? -2.197  34.333 48.127 1.00 14.87 ? 263 LEU A CG    1 
ATOM   2017 C  CD1   . LEU A 1 263 ? -1.918  35.695 47.593 1.00 14.05 ? 263 LEU A CD1   1 
ATOM   2018 C  CD2   . LEU A 1 263 ? -1.265  33.988 49.323 1.00 13.55 ? 263 LEU A CD2   1 
ATOM   2019 N  N     . GLY A 1 264 ? -3.949  36.000 51.454 1.00 13.56 ? 264 GLY A N     1 
ATOM   2020 C  CA    . GLY A 1 264 ? -4.083  37.340 52.007 1.00 12.25 ? 264 GLY A CA    1 
ATOM   2021 C  C     . GLY A 1 264 ? -2.878  38.210 51.665 1.00 12.64 ? 264 GLY A C     1 
ATOM   2022 O  O     . GLY A 1 264 ? -1.724  37.903 52.009 1.00 11.57 ? 264 GLY A O     1 
ATOM   2023 N  N     . ILE A 1 265 ? -3.152  39.290 50.943 1.00 12.21 ? 265 ILE A N     1 
ATOM   2024 C  CA    . ILE A 1 265 ? -2.133  40.225 50.512 1.00 11.38 ? 265 ILE A CA    1 
ATOM   2025 C  C     . ILE A 1 265 ? -1.794  41.076 51.726 1.00 11.88 ? 265 ILE A C     1 
ATOM   2026 O  O     . ILE A 1 265 ? -2.681  41.680 52.331 1.00 11.58 ? 265 ILE A O     1 
ATOM   2027 C  CB    . ILE A 1 265 ? -2.633  41.074 49.293 1.00 10.80 ? 265 ILE A CB    1 
ATOM   2028 C  CG1   . ILE A 1 265 ? -3.197  40.150 48.206 1.00 9.84  ? 265 ILE A CG1   1 
ATOM   2029 C  CG2   . ILE A 1 265 ? -1.501  41.846 48.657 1.00 10.47 ? 265 ILE A CG2   1 
ATOM   2030 C  CD1   . ILE A 1 265 ? -2.243  38.973 47.804 1.00 8.23  ? 265 ILE A CD1   1 
ATOM   2031 N  N     . LEU A 1 266 ? -0.502  41.067 52.079 1.00 12.54 ? 266 LEU A N     1 
ATOM   2032 C  CA    . LEU A 1 266 ? 0.085   41.761 53.227 1.00 11.69 ? 266 LEU A CA    1 
ATOM   2033 C  C     . LEU A 1 266 ? 1.219   42.701 52.799 1.00 11.02 ? 266 LEU A C     1 
ATOM   2034 O  O     . LEU A 1 266 ? 2.298   42.244 52.453 1.00 10.99 ? 266 LEU A O     1 
ATOM   2035 C  CB    . LEU A 1 266 ? 0.653   40.686 54.179 1.00 12.28 ? 266 LEU A CB    1 
ATOM   2036 C  CG    . LEU A 1 266 ? 1.328   41.069 55.504 1.00 11.16 ? 266 LEU A CG    1 
ATOM   2037 C  CD1   . LEU A 1 266 ? 0.290   41.716 56.403 1.00 9.86  ? 266 LEU A CD1   1 
ATOM   2038 C  CD2   . LEU A 1 266 ? 1.945   39.811 56.157 1.00 10.77 ? 266 LEU A CD2   1 
ATOM   2039 N  N     . LYS A 1 267 ? 1.005   44.004 52.929 1.00 11.48 ? 267 LYS A N     1 
ATOM   2040 C  CA    . LYS A 1 267 ? 1.977   45.032 52.533 1.00 12.53 ? 267 LYS A CA    1 
ATOM   2041 C  C     . LYS A 1 267 ? 3.395   45.213 53.123 1.00 15.27 ? 267 LYS A C     1 
ATOM   2042 O  O     . LYS A 1 267 ? 4.217   45.877 52.487 1.00 19.13 ? 267 LYS A O     1 
ATOM   2043 C  CB    . LYS A 1 267 ? 1.288   46.395 52.541 1.00 10.62 ? 267 LYS A CB    1 
ATOM   2044 C  CG    . LYS A 1 267 ? 2.162   47.566 52.107 1.00 10.20 ? 267 LYS A CG    1 
ATOM   2045 C  CD    . LYS A 1 267 ? 1.388   48.906 52.156 1.00 11.68 ? 267 LYS A CD    1 
ATOM   2046 C  CE    . LYS A 1 267 ? 0.280   48.958 51.132 1.00 9.44  ? 267 LYS A CE    1 
ATOM   2047 N  NZ    . LYS A 1 267 ? -0.538  50.230 51.093 1.00 10.29 ? 267 LYS A NZ    1 
ATOM   2048 N  N     . ALA A 1 268 ? 3.714   44.715 54.309 1.00 15.34 ? 268 ALA A N     1 
ATOM   2049 C  CA    . ALA A 1 268 ? 5.075   44.929 54.901 1.00 15.28 ? 268 ALA A CA    1 
ATOM   2050 C  C     . ALA A 1 268 ? 5.211   46.146 55.829 1.00 14.20 ? 268 ALA A C     1 
ATOM   2051 O  O     . ALA A 1 268 ? 6.152   46.238 56.626 1.00 14.22 ? 268 ALA A O     1 
ATOM   2052 C  CB    . ALA A 1 268 ? 6.197   44.916 53.857 1.00 16.16 ? 268 ALA A CB    1 
ATOM   2053 N  N     . TYR A 1 269 ? 4.295   47.086 55.675 1.00 13.31 ? 269 TYR A N     1 
ATOM   2054 C  CA    . TYR A 1 269 ? 4.150   48.258 56.539 1.00 13.78 ? 269 TYR A CA    1 
ATOM   2055 C  C     . TYR A 1 269 ? 2.660   48.567 56.274 1.00 14.15 ? 269 TYR A C     1 
ATOM   2056 O  O     . TYR A 1 269 ? 2.076   47.970 55.368 1.00 14.14 ? 269 TYR A O     1 
ATOM   2057 C  CB    . TYR A 1 269 ? 5.091   49.424 56.171 1.00 13.64 ? 269 TYR A CB    1 
ATOM   2058 C  CG    . TYR A 1 269 ? 4.956   49.942 54.745 1.00 14.02 ? 269 TYR A CG    1 
ATOM   2059 C  CD1   . TYR A 1 269 ? 4.205   51.085 54.464 1.00 12.67 ? 269 TYR A CD1   1 
ATOM   2060 C  CD2   . TYR A 1 269 ? 5.575   49.275 53.676 1.00 13.44 ? 269 TYR A CD2   1 
ATOM   2061 C  CE1   . TYR A 1 269 ? 4.076   51.542 53.157 1.00 13.58 ? 269 TYR A CE1   1 
ATOM   2062 C  CE2   . TYR A 1 269 ? 5.448   49.728 52.369 1.00 12.23 ? 269 TYR A CE2   1 
ATOM   2063 C  CZ    . TYR A 1 269 ? 4.703   50.854 52.111 1.00 11.75 ? 269 TYR A CZ    1 
ATOM   2064 O  OH    . TYR A 1 269 ? 4.575   51.296 50.822 1.00 10.23 ? 269 TYR A OH    1 
ATOM   2065 N  N     . SER A 1 270 ? 2.035   49.469 57.021 1.00 14.16 ? 270 SER A N     1 
ATOM   2066 C  CA    . SER A 1 270 ? 0.611   49.725 56.805 1.00 13.51 ? 270 SER A CA    1 
ATOM   2067 C  C     . SER A 1 270 ? 0.313   51.066 56.171 1.00 13.73 ? 270 SER A C     1 
ATOM   2068 O  O     . SER A 1 270 ? 1.111   52.022 56.304 1.00 13.67 ? 270 SER A O     1 
ATOM   2069 C  CB    . SER A 1 270 ? -0.165  49.635 58.137 1.00 12.87 ? 270 SER A CB    1 
ATOM   2070 O  OG    . SER A 1 270 ? 0.217   48.502 58.897 1.00 11.30 ? 270 SER A OG    1 
ATOM   2071 N  N     . THR A 1 271 ? -0.831  51.126 55.475 1.00 13.11 ? 271 THR A N     1 
ATOM   2072 C  CA    . THR A 1 271 ? -1.328  52.364 54.880 1.00 13.21 ? 271 THR A CA    1 
ATOM   2073 C  C     . THR A 1 271 ? -2.840  52.349 55.060 1.00 13.82 ? 271 THR A C     1 
ATOM   2074 O  O     . THR A 1 271 ? -3.463  51.281 55.068 1.00 13.79 ? 271 THR A O     1 
ATOM   2075 C  CB    . THR A 1 271 ? -1.076  52.534 53.328 1.00 13.56 ? 271 THR A CB    1 
ATOM   2076 O  OG1   . THR A 1 271 ? -1.807  51.545 52.591 1.00 13.46 ? 271 THR A OG1   1 
ATOM   2077 C  CG2   . THR A 1 271 ? 0.423   52.463 52.966 1.00 14.23 ? 271 THR A CG2   1 
ATOM   2078 N  N     . ARG A 1 272 ? -3.428  53.534 55.172 1.00 13.59 ? 272 ARG A N     1 
ATOM   2079 C  CA    . ARG A 1 272 ? -4.855  53.667 55.281 1.00 12.57 ? 272 ARG A CA    1 
ATOM   2080 C  C     . ARG A 1 272 ? -5.201  54.996 54.567 1.00 13.38 ? 272 ARG A C     1 
ATOM   2081 O  O     . ARG A 1 272 ? -4.429  55.939 54.672 1.00 15.31 ? 272 ARG A O     1 
ATOM   2082 C  CB    . ARG A 1 272 ? -5.270  53.682 56.774 1.00 10.90 ? 272 ARG A CB    1 
ATOM   2083 C  CG    . ARG A 1 272 ? -6.770  53.853 56.950 1.00 11.02 ? 272 ARG A CG    1 
ATOM   2084 C  CD    . ARG A 1 272 ? -7.406  53.669 58.353 1.00 10.42 ? 272 ARG A CD    1 
ATOM   2085 N  NE    . ARG A 1 272 ? -8.848  53.634 58.101 1.00 11.15 ? 272 ARG A NE    1 
ATOM   2086 C  CZ    . ARG A 1 272 ? -9.727  52.974 58.842 1.00 13.23 ? 272 ARG A CZ    1 
ATOM   2087 N  NH1   . ARG A 1 272 ? -9.363  52.318 59.951 1.00 14.59 ? 272 ARG A NH1   1 
ATOM   2088 N  NH2   . ARG A 1 272 ? -10.929 52.745 58.316 1.00 13.67 ? 272 ARG A NH2   1 
ATOM   2089 N  N     . VAL A 1 273 ? -6.260  55.049 53.753 1.00 12.68 ? 273 VAL A N     1 
ATOM   2090 C  CA    . VAL A 1 273 ? -6.700  56.314 53.147 1.00 12.06 ? 273 VAL A CA    1 
ATOM   2091 C  C     . VAL A 1 273 ? -8.147  56.399 53.608 1.00 11.49 ? 273 VAL A C     1 
ATOM   2092 O  O     . VAL A 1 273 ? -8.930  55.477 53.383 1.00 11.51 ? 273 VAL A O     1 
ATOM   2093 C  CB    . VAL A 1 273 ? -6.788  56.384 51.574 1.00 12.36 ? 273 VAL A CB    1 
ATOM   2094 C  CG1   . VAL A 1 273 ? -6.187  57.692 51.095 1.00 10.57 ? 273 VAL A CG1   1 
ATOM   2095 C  CG2   . VAL A 1 273 ? -6.219  55.165 50.878 1.00 13.50 ? 273 VAL A CG2   1 
ATOM   2096 N  N     . GLY A 1 274 ? -8.523  57.553 54.127 1.00 11.15 ? 274 GLY A N     1 
ATOM   2097 C  CA    . GLY A 1 274 ? -9.850  57.747 54.665 1.00 11.11 ? 274 GLY A CA    1 
ATOM   2098 C  C     . GLY A 1 274 ? -9.649  57.868 56.181 1.00 12.15 ? 274 GLY A C     1 
ATOM   2099 O  O     . GLY A 1 274 ? -8.569  57.522 56.732 1.00 11.26 ? 274 GLY A O     1 
ATOM   2100 N  N     . ALA A 1 275 ? -10.677 58.355 56.869 1.00 12.44 ? 275 ALA A N     1 
ATOM   2101 C  CA    . ALA A 1 275 ? -10.601 58.527 58.313 1.00 12.85 ? 275 ALA A CA    1 
ATOM   2102 C  C     . ALA A 1 275 ? -10.680 57.143 58.983 1.00 13.07 ? 275 ALA A C     1 
ATOM   2103 O  O     . ALA A 1 275 ? -11.064 56.171 58.342 1.00 12.63 ? 275 ALA A O     1 
ATOM   2104 C  CB    . ALA A 1 275 ? -11.746 59.437 58.774 1.00 11.75 ? 275 ALA A CB    1 
ATOM   2105 N  N     . GLY A 1 276 ? -10.302 57.051 60.253 1.00 14.08 ? 276 GLY A N     1 
ATOM   2106 C  CA    . GLY A 1 276 ? -10.364 55.771 60.957 1.00 15.38 ? 276 GLY A CA    1 
ATOM   2107 C  C     . GLY A 1 276 ? -9.205  55.428 61.898 1.00 14.27 ? 276 GLY A C     1 
ATOM   2108 O  O     . GLY A 1 276 ? -8.093  55.904 61.713 1.00 14.95 ? 276 GLY A O     1 
ATOM   2109 N  N     . PRO A 1 277 ? -9.421  54.542 62.873 1.00 13.92 ? 277 PRO A N     1 
ATOM   2110 C  CA    . PRO A 1 277 ? -8.329  54.201 63.786 1.00 12.48 ? 277 PRO A CA    1 
ATOM   2111 C  C     . PRO A 1 277 ? -7.209  53.694 62.968 1.00 12.11 ? 277 PRO A C     1 
ATOM   2112 O  O     . PRO A 1 277 ? -7.451  53.113 61.929 1.00 12.79 ? 277 PRO A O     1 
ATOM   2113 C  CB    . PRO A 1 277 ? -8.915  53.065 64.617 1.00 12.26 ? 277 PRO A CB    1 
ATOM   2114 C  CG    . PRO A 1 277 ? -10.381 53.345 64.580 1.00 13.49 ? 277 PRO A CG    1 
ATOM   2115 C  CD    . PRO A 1 277 ? -10.610 53.711 63.144 1.00 13.47 ? 277 PRO A CD    1 
ATOM   2116 N  N     . PHE A 1 278 ? -5.988  53.896 63.443 1.00 13.74 ? 278 PHE A N     1 
ATOM   2117 C  CA    . PHE A 1 278 ? -4.770  53.439 62.773 1.00 13.83 ? 278 PHE A CA    1 
ATOM   2118 C  C     . PHE A 1 278 ? -3.666  53.463 63.853 1.00 15.26 ? 278 PHE A C     1 
ATOM   2119 O  O     . PHE A 1 278 ? -2.746  54.305 63.815 1.00 15.99 ? 278 PHE A O     1 
ATOM   2120 C  CB    . PHE A 1 278 ? -4.428  54.383 61.606 1.00 14.03 ? 278 PHE A CB    1 
ATOM   2121 C  CG    . PHE A 1 278 ? -3.310  53.885 60.698 1.00 12.61 ? 278 PHE A CG    1 
ATOM   2122 C  CD1   . PHE A 1 278 ? -2.760  52.619 60.853 1.00 11.83 ? 278 PHE A CD1   1 
ATOM   2123 C  CD2   . PHE A 1 278 ? -2.820  54.698 59.694 1.00 11.36 ? 278 PHE A CD2   1 
ATOM   2124 C  CE1   . PHE A 1 278 ? -1.735  52.161 60.022 1.00 12.52 ? 278 PHE A CE1   1 
ATOM   2125 C  CE2   . PHE A 1 278 ? -1.801  54.251 58.858 1.00 13.85 ? 278 PHE A CE2   1 
ATOM   2126 C  CZ    . PHE A 1 278 ? -1.251  52.966 59.027 1.00 13.66 ? 278 PHE A CZ    1 
ATOM   2127 N  N     . PRO A 1 279 ? -3.703  52.486 64.787 1.00 15.02 ? 279 PRO A N     1 
ATOM   2128 C  CA    . PRO A 1 279 ? -2.724  52.400 65.879 1.00 15.72 ? 279 PRO A CA    1 
ATOM   2129 C  C     . PRO A 1 279 ? -1.244  52.620 65.540 1.00 16.45 ? 279 PRO A C     1 
ATOM   2130 O  O     . PRO A 1 279 ? -0.576  53.450 66.177 1.00 16.87 ? 279 PRO A O     1 
ATOM   2131 C  CB    . PRO A 1 279 ? -2.972  51.001 66.467 1.00 15.07 ? 279 PRO A CB    1 
ATOM   2132 C  CG    . PRO A 1 279 ? -4.386  50.732 66.115 1.00 14.76 ? 279 PRO A CG    1 
ATOM   2133 C  CD    . PRO A 1 279 ? -4.521  51.265 64.724 1.00 13.71 ? 279 PRO A CD    1 
ATOM   2134 N  N     . THR A 1 280 ? -0.721  51.900 64.553 1.00 16.66 ? 280 THR A N     1 
ATOM   2135 C  CA    . THR A 1 280 ? 0.699   52.037 64.234 1.00 16.47 ? 280 THR A CA    1 
ATOM   2136 C  C     . THR A 1 280 ? 1.049   53.180 63.323 1.00 16.07 ? 280 THR A C     1 
ATOM   2137 O  O     . THR A 1 280 ? 2.141   53.153 62.733 1.00 15.75 ? 280 THR A O     1 
ATOM   2138 C  CB    . THR A 1 280 ? 1.272   50.763 63.560 1.00 17.58 ? 280 THR A CB    1 
ATOM   2139 O  OG1   . THR A 1 280 ? 0.481   50.432 62.411 1.00 17.82 ? 280 THR A OG1   1 
ATOM   2140 C  CG2   . THR A 1 280 ? 1.318   49.579 64.543 1.00 16.68 ? 280 THR A CG2   1 
ATOM   2141 N  N     . GLU A 1 281 ? 0.136   54.143 63.169 1.00 15.78 ? 281 GLU A N     1 
ATOM   2142 C  CA    . GLU A 1 281 ? 0.373   55.265 62.284 1.00 17.25 ? 281 GLU A CA    1 
ATOM   2143 C  C     . GLU A 1 281 ? 1.588   56.110 62.657 1.00 18.41 ? 281 GLU A C     1 
ATOM   2144 O  O     . GLU A 1 281 ? 1.804   56.442 63.838 1.00 19.45 ? 281 GLU A O     1 
ATOM   2145 C  CB    . GLU A 1 281 ? -0.863  56.146 62.188 1.00 17.93 ? 281 GLU A CB    1 
ATOM   2146 C  CG    . GLU A 1 281 ? -0.749  57.271 61.135 1.00 18.32 ? 281 GLU A CG    1 
ATOM   2147 C  CD    . GLU A 1 281 ? -2.052  58.041 60.966 1.00 19.94 ? 281 GLU A CD    1 
ATOM   2148 O  OE1   . GLU A 1 281 ? -2.119  58.990 60.170 1.00 20.26 ? 281 GLU A OE1   1 
ATOM   2149 O  OE2   . GLU A 1 281 ? -3.048  57.701 61.622 1.00 22.17 ? 281 GLU A OE2   1 
ATOM   2150 N  N     . LEU A 1 282 ? 2.371   56.472 61.641 1.00 18.72 ? 282 LEU A N     1 
ATOM   2151 C  CA    . LEU A 1 282 ? 3.568   57.270 61.834 1.00 18.73 ? 282 LEU A CA    1 
ATOM   2152 C  C     . LEU A 1 282 ? 3.399   58.671 61.268 1.00 20.27 ? 282 LEU A C     1 
ATOM   2153 O  O     . LEU A 1 282 ? 3.037   58.844 60.108 1.00 21.17 ? 282 LEU A O     1 
ATOM   2154 C  CB    . LEU A 1 282 ? 4.756   56.591 61.171 1.00 17.85 ? 282 LEU A CB    1 
ATOM   2155 C  CG    . LEU A 1 282 ? 5.296   55.283 61.753 1.00 17.99 ? 282 LEU A CG    1 
ATOM   2156 C  CD1   . LEU A 1 282 ? 6.292   54.614 60.794 1.00 19.07 ? 282 LEU A CD1   1 
ATOM   2157 C  CD2   . LEU A 1 282 ? 5.965   55.555 63.040 1.00 17.40 ? 282 LEU A CD2   1 
ATOM   2158 N  N     . PHE A 1 283 ? 3.656   59.678 62.093 1.00 21.65 ? 283 PHE A N     1 
ATOM   2159 C  CA    . PHE A 1 283 ? 3.564   61.065 61.657 1.00 22.20 ? 283 PHE A CA    1 
ATOM   2160 C  C     . PHE A 1 283 ? 4.977   61.673 61.625 1.00 23.55 ? 283 PHE A C     1 
ATOM   2161 O  O     . PHE A 1 283 ? 5.158   62.892 61.565 1.00 25.50 ? 283 PHE A O     1 
ATOM   2162 C  CB    . PHE A 1 283 ? 2.671   61.855 62.606 1.00 20.29 ? 283 PHE A CB    1 
ATOM   2163 C  CG    . PHE A 1 283 ? 1.335   61.210 62.865 1.00 21.25 ? 283 PHE A CG    1 
ATOM   2164 C  CD1   . PHE A 1 283 ? 0.206   61.601 62.158 1.00 21.58 ? 283 PHE A CD1   1 
ATOM   2165 C  CD2   . PHE A 1 283 ? 1.186   60.250 63.864 1.00 20.55 ? 283 PHE A CD2   1 
ATOM   2166 C  CE1   . PHE A 1 283 ? -1.062  61.043 62.450 1.00 21.49 ? 283 PHE A CE1   1 
ATOM   2167 C  CE2   . PHE A 1 283 ? -0.057  59.703 64.149 1.00 19.46 ? 283 PHE A CE2   1 
ATOM   2168 C  CZ    . PHE A 1 283 ? -1.184  60.100 63.443 1.00 19.54 ? 283 PHE A CZ    1 
ATOM   2169 N  N     . ASP A 1 284 ? 5.990   60.829 61.636 1.00 24.57 ? 284 ASP A N     1 
ATOM   2170 C  CA    . ASP A 1 284 ? 7.353   61.336 61.659 1.00 26.57 ? 284 ASP A CA    1 
ATOM   2171 C  C     . ASP A 1 284 ? 8.069   61.171 60.304 1.00 27.58 ? 284 ASP A C     1 
ATOM   2172 O  O     . ASP A 1 284 ? 7.432   60.919 59.286 1.00 28.39 ? 284 ASP A O     1 
ATOM   2173 C  CB    . ASP A 1 284 ? 8.120   60.622 62.768 1.00 24.13 ? 284 ASP A CB    1 
ATOM   2174 C  CG    . ASP A 1 284 ? 8.208   59.159 62.528 1.00 24.84 ? 284 ASP A CG    1 
ATOM   2175 O  OD1   . ASP A 1 284 ? 8.701   58.461 63.439 1.00 24.78 ? 284 ASP A OD1   1 
ATOM   2176 O  OD2   . ASP A 1 284 ? 7.773   58.703 61.425 1.00 22.88 ? 284 ASP A OD2   1 
ATOM   2177 N  N     . GLU A 1 285 ? 9.394   61.269 60.301 1.00 28.93 ? 285 GLU A N     1 
ATOM   2178 C  CA    . GLU A 1 285 ? 10.165  61.160 59.064 1.00 29.43 ? 285 GLU A CA    1 
ATOM   2179 C  C     . GLU A 1 285 ? 10.014  59.775 58.453 1.00 28.85 ? 285 GLU A C     1 
ATOM   2180 O  O     . GLU A 1 285 ? 9.886   59.633 57.230 1.00 28.77 ? 285 GLU A O     1 
ATOM   2181 C  CB    . GLU A 1 285 ? 11.648  61.467 59.325 1.00 31.08 ? 285 GLU A CB    1 
ATOM   2182 C  CG    . GLU A 1 285 ? 11.876  62.641 60.288 1.00 34.79 ? 285 GLU A CG    1 
ATOM   2183 C  CD    . GLU A 1 285 ? 13.160  63.422 60.015 1.00 37.58 ? 285 GLU A CD    1 
ATOM   2184 O  OE1   . GLU A 1 285 ? 13.209  64.618 60.417 1.00 39.54 ? 285 GLU A OE1   1 
ATOM   2185 O  OE2   . GLU A 1 285 ? 14.112  62.858 59.402 1.00 38.61 ? 285 GLU A OE2   1 
ATOM   2186 N  N     . THR A 1 286 ? 10.005  58.741 59.290 1.00 28.27 ? 286 THR A N     1 
ATOM   2187 C  CA    . THR A 1 286 ? 9.880   57.386 58.748 1.00 27.54 ? 286 THR A CA    1 
ATOM   2188 C  C     . THR A 1 286 ? 8.523   57.181 58.083 1.00 26.79 ? 286 THR A C     1 
ATOM   2189 O  O     . THR A 1 286 ? 8.415   56.485 57.077 1.00 26.04 ? 286 THR A O     1 
ATOM   2190 C  CB    . THR A 1 286 ? 10.248  56.284 59.764 1.00 27.33 ? 286 THR A CB    1 
ATOM   2191 O  OG1   . THR A 1 286 ? 9.345   55.176 59.655 1.00 28.22 ? 286 THR A OG1   1 
ATOM   2192 C  CG2   . THR A 1 286 ? 10.272  56.814 61.169 1.00 28.44 ? 286 THR A CG2   1 
ATOM   2193 N  N     . GLY A 1 287 ? 7.503   57.836 58.618 1.00 26.69 ? 287 GLY A N     1 
ATOM   2194 C  CA    . GLY A 1 287 ? 6.191   57.749 58.018 1.00 26.53 ? 287 GLY A CA    1 
ATOM   2195 C  C     . GLY A 1 287 ? 6.296   58.365 56.644 1.00 26.67 ? 287 GLY A C     1 
ATOM   2196 O  O     . GLY A 1 287 ? 5.812   57.765 55.667 1.00 26.49 ? 287 GLY A O     1 
ATOM   2197 N  N     . GLU A 1 288 ? 6.933   59.548 56.575 1.00 27.17 ? 288 GLU A N     1 
ATOM   2198 C  CA    . GLU A 1 288 ? 7.162   60.306 55.323 1.00 26.93 ? 288 GLU A CA    1 
ATOM   2199 C  C     . GLU A 1 288 ? 7.995   59.487 54.347 1.00 25.29 ? 288 GLU A C     1 
ATOM   2200 O  O     . GLU A 1 288 ? 7.734   59.489 53.146 1.00 25.31 ? 288 GLU A O     1 
ATOM   2201 C  CB    . GLU A 1 288 ? 7.854   61.643 55.595 1.00 29.45 ? 288 GLU A CB    1 
ATOM   2202 C  CG    . GLU A 1 288 ? 8.381   62.368 54.343 1.00 34.54 ? 288 GLU A CG    1 
ATOM   2203 C  CD    . GLU A 1 288 ? 9.539   63.348 54.643 1.00 38.78 ? 288 GLU A CD    1 
ATOM   2204 O  OE1   . GLU A 1 288 ? 10.388  63.590 53.734 1.00 40.35 ? 288 GLU A OE1   1 
ATOM   2205 O  OE2   . GLU A 1 288 ? 9.619   63.875 55.786 1.00 41.02 ? 288 GLU A OE2   1 
ATOM   2206 N  N     . PHE A 1 289 ? 9.002   58.796 54.854 1.00 23.56 ? 289 PHE A N     1 
ATOM   2207 C  CA    . PHE A 1 289 ? 9.829   57.945 54.007 1.00 22.99 ? 289 PHE A CA    1 
ATOM   2208 C  C     . PHE A 1 289 ? 8.951   56.854 53.375 1.00 23.05 ? 289 PHE A C     1 
ATOM   2209 O  O     . PHE A 1 289 ? 9.051   56.567 52.166 1.00 22.87 ? 289 PHE A O     1 
ATOM   2210 C  CB    . PHE A 1 289 ? 10.927  57.308 54.852 1.00 22.53 ? 289 PHE A CB    1 
ATOM   2211 C  CG    . PHE A 1 289 ? 11.749  56.288 54.130 1.00 21.49 ? 289 PHE A CG    1 
ATOM   2212 C  CD1   . PHE A 1 289 ? 12.848  56.675 53.376 1.00 22.63 ? 289 PHE A CD1   1 
ATOM   2213 C  CD2   . PHE A 1 289 ? 11.477  54.935 54.278 1.00 21.86 ? 289 PHE A CD2   1 
ATOM   2214 C  CE1   . PHE A 1 289 ? 13.679  55.725 52.779 1.00 23.90 ? 289 PHE A CE1   1 
ATOM   2215 C  CE2   . PHE A 1 289 ? 12.291  53.960 53.690 1.00 22.35 ? 289 PHE A CE2   1 
ATOM   2216 C  CZ    . PHE A 1 289 ? 13.396  54.348 52.942 1.00 23.73 ? 289 PHE A CZ    1 
ATOM   2217 N  N     . LEU A 1 290 ? 8.093   56.253 54.204 1.00 22.02 ? 290 LEU A N     1 
ATOM   2218 C  CA    . LEU A 1 290 ? 7.194   55.199 53.761 1.00 20.85 ? 290 LEU A CA    1 
ATOM   2219 C  C     . LEU A 1 290 ? 6.313   55.680 52.606 1.00 20.27 ? 290 LEU A C     1 
ATOM   2220 O  O     . LEU A 1 290 ? 6.306   55.090 51.522 1.00 19.29 ? 290 LEU A O     1 
ATOM   2221 C  CB    . LEU A 1 290 ? 6.366   54.685 54.944 1.00 20.77 ? 290 LEU A CB    1 
ATOM   2222 C  CG    . LEU A 1 290 ? 7.160   53.887 55.995 1.00 20.88 ? 290 LEU A CG    1 
ATOM   2223 C  CD1   . LEU A 1 290 ? 6.227   53.382 57.059 1.00 21.43 ? 290 LEU A CD1   1 
ATOM   2224 C  CD2   . LEU A 1 290 ? 7.885   52.716 55.371 1.00 21.01 ? 290 LEU A CD2   1 
ATOM   2225 N  N     . CYS A 1 291 ? 5.571   56.752 52.836 1.00 19.86 ? 291 CYS A N     1 
ATOM   2226 C  CA    . CYS A 1 291 ? 4.731   57.315 51.792 1.00 20.17 ? 291 CYS A CA    1 
ATOM   2227 C  C     . CYS A 1 291 ? 5.551   57.448 50.460 1.00 21.39 ? 291 CYS A C     1 
ATOM   2228 O  O     . CYS A 1 291 ? 5.192   56.871 49.407 1.00 20.41 ? 291 CYS A O     1 
ATOM   2229 C  CB    . CYS A 1 291 ? 4.239   58.689 52.266 1.00 18.81 ? 291 CYS A CB    1 
ATOM   2230 S  SG    . CYS A 1 291 ? 3.077   59.533 51.186 1.00 21.56 ? 291 CYS A SG    1 
ATOM   2231 N  N     . LYS A 1 292 ? 6.666   58.185 50.553 1.00 21.65 ? 292 LYS A N     1 
ATOM   2232 C  CA    . LYS A 1 292 ? 7.579   58.498 49.468 1.00 21.05 ? 292 LYS A CA    1 
ATOM   2233 C  C     . LYS A 1 292 ? 8.125   57.325 48.669 1.00 20.71 ? 292 LYS A C     1 
ATOM   2234 O  O     . LYS A 1 292 ? 7.949   57.250 47.462 1.00 20.20 ? 292 LYS A O     1 
ATOM   2235 C  CB    . LYS A 1 292 ? 8.771   59.238 50.046 1.00 23.37 ? 292 LYS A CB    1 
ATOM   2236 C  CG    . LYS A 1 292 ? 8.939   60.649 49.583 1.00 26.08 ? 292 LYS A CG    1 
ATOM   2237 C  CD    . LYS A 1 292 ? 10.407  61.046 49.690 1.00 28.60 ? 292 LYS A CD    1 
ATOM   2238 C  CE    . LYS A 1 292 ? 10.975  60.906 51.122 1.00 30.56 ? 292 LYS A CE    1 
ATOM   2239 N  NZ    . LYS A 1 292 ? 10.410  61.852 52.146 1.00 30.85 ? 292 LYS A NZ    1 
ATOM   2240 N  N     . GLN A 1 293 ? 8.856   56.446 49.335 1.00 20.70 ? 293 GLN A N     1 
ATOM   2241 C  CA    . GLN A 1 293 ? 9.461   55.308 48.671 1.00 21.38 ? 293 GLN A CA    1 
ATOM   2242 C  C     . GLN A 1 293 ? 8.441   54.347 48.097 1.00 22.01 ? 293 GLN A C     1 
ATOM   2243 O  O     . GLN A 1 293 ? 8.707   53.679 47.086 1.00 22.45 ? 293 GLN A O     1 
ATOM   2244 C  CB    . GLN A 1 293 ? 10.354  54.574 49.648 1.00 21.75 ? 293 GLN A CB    1 
ATOM   2245 C  CG    . GLN A 1 293 ? 11.514  55.413 50.095 1.00 24.54 ? 293 GLN A CG    1 
ATOM   2246 C  CD    . GLN A 1 293 ? 12.411  55.756 48.934 1.00 24.93 ? 293 GLN A CD    1 
ATOM   2247 O  OE1   . GLN A 1 293 ? 12.952  54.854 48.285 1.00 25.20 ? 293 GLN A OE1   1 
ATOM   2248 N  NE2   . GLN A 1 293 ? 12.529  57.057 48.616 1.00 25.08 ? 293 GLN A NE2   1 
ATOM   2249 N  N     . GLY A 1 294 ? 7.286   54.262 48.763 1.00 21.40 ? 294 GLY A N     1 
ATOM   2250 C  CA    . GLY A 1 294 ? 6.227   53.370 48.341 1.00 20.11 ? 294 GLY A CA    1 
ATOM   2251 C  C     . GLY A 1 294 ? 5.174   54.053 47.507 1.00 19.62 ? 294 GLY A C     1 
ATOM   2252 O  O     . GLY A 1 294 ? 4.132   53.451 47.266 1.00 19.57 ? 294 GLY A O     1 
ATOM   2253 N  N     . ASN A 1 295 ? 5.443   55.284 47.064 1.00 18.76 ? 295 ASN A N     1 
ATOM   2254 C  CA    . ASN A 1 295 ? 4.520   56.057 46.239 1.00 17.94 ? 295 ASN A CA    1 
ATOM   2255 C  C     . ASN A 1 295 ? 3.068   55.881 46.721 1.00 17.83 ? 295 ASN A C     1 
ATOM   2256 O  O     . ASN A 1 295 ? 2.156   55.638 45.936 1.00 18.64 ? 295 ASN A O     1 
ATOM   2257 C  CB    . ASN A 1 295 ? 4.684   55.631 44.784 1.00 17.50 ? 295 ASN A CB    1 
ATOM   2258 C  CG    . ASN A 1 295 ? 3.842   56.452 43.821 1.00 18.83 ? 295 ASN A CG    1 
ATOM   2259 O  OD1   . ASN A 1 295 ? 3.215   55.890 42.930 1.00 20.96 ? 295 ASN A OD1   1 
ATOM   2260 N  ND2   . ASN A 1 295 ? 3.836   57.777 43.971 1.00 19.11 ? 295 ASN A ND2   1 
ATOM   2261 N  N     . GLU A 1 296 ? 2.851   56.044 48.019 1.00 16.85 ? 296 GLU A N     1 
ATOM   2262 C  CA    . GLU A 1 296 ? 1.528   55.853 48.594 1.00 15.65 ? 296 GLU A CA    1 
ATOM   2263 C  C     . GLU A 1 296 ? 0.503   56.950 48.364 1.00 16.09 ? 296 GLU A C     1 
ATOM   2264 O  O     . GLU A 1 296 ? 0.281   57.819 49.223 1.00 15.33 ? 296 GLU A O     1 
ATOM   2265 C  CB    . GLU A 1 296 ? 1.615   55.522 50.084 1.00 14.26 ? 296 GLU A CB    1 
ATOM   2266 C  CG    . GLU A 1 296 ? 2.402   54.269 50.400 1.00 13.97 ? 296 GLU A CG    1 
ATOM   2267 C  CD    . GLU A 1 296 ? 1.799   52.999 49.804 1.00 14.80 ? 296 GLU A CD    1 
ATOM   2268 O  OE1   . GLU A 1 296 ? 2.476   51.951 49.851 1.00 12.25 ? 296 GLU A OE1   1 
ATOM   2269 O  OE2   . GLU A 1 296 ? 0.666   53.030 49.273 1.00 15.33 ? 296 GLU A OE2   1 
ATOM   2270 N  N     . PHE A 1 297 ? -0.153  56.888 47.207 1.00 15.98 ? 297 PHE A N     1 
ATOM   2271 C  CA    . PHE A 1 297 ? -1.198  57.841 46.878 1.00 15.34 ? 297 PHE A CA    1 
ATOM   2272 C  C     . PHE A 1 297 ? -2.310  56.994 46.337 1.00 16.79 ? 297 PHE A C     1 
ATOM   2273 O  O     . PHE A 1 297 ? -2.048  56.083 45.547 1.00 19.18 ? 297 PHE A O     1 
ATOM   2274 C  CB    . PHE A 1 297 ? -0.683  58.868 45.873 1.00 13.09 ? 297 PHE A CB    1 
ATOM   2275 C  CG    . PHE A 1 297 ? 0.261   59.861 46.490 1.00 11.44 ? 297 PHE A CG    1 
ATOM   2276 C  CD1   . PHE A 1 297 ? -0.229  60.994 47.117 1.00 10.20 ? 297 PHE A CD1   1 
ATOM   2277 C  CD2   . PHE A 1 297 ? 1.625   59.603 46.558 1.00 11.02 ? 297 PHE A CD2   1 
ATOM   2278 C  CE1   . PHE A 1 297 ? 0.624   61.849 47.812 1.00 10.87 ? 297 PHE A CE1   1 
ATOM   2279 C  CE2   . PHE A 1 297 ? 2.485   60.464 47.262 1.00 11.21 ? 297 PHE A CE2   1 
ATOM   2280 C  CZ    . PHE A 1 297 ? 1.978   61.581 47.887 1.00 10.51 ? 297 PHE A CZ    1 
ATOM   2281 N  N     . GLY A 1 298 ? -3.538  57.225 46.793 1.00 16.99 ? 298 GLY A N     1 
ATOM   2282 C  CA    . GLY A 1 298 ? -4.661  56.418 46.319 1.00 16.62 ? 298 GLY A CA    1 
ATOM   2283 C  C     . GLY A 1 298 ? -4.810  56.332 44.795 1.00 15.84 ? 298 GLY A C     1 
ATOM   2284 O  O     . GLY A 1 298 ? -5.052  57.350 44.105 1.00 15.04 ? 298 GLY A O     1 
ATOM   2285 N  N     . ALA A 1 299 ? -4.739  55.113 44.271 1.00 14.45 ? 299 ALA A N     1 
ATOM   2286 C  CA    . ALA A 1 299 ? -4.845  54.911 42.832 1.00 14.93 ? 299 ALA A CA    1 
ATOM   2287 C  C     . ALA A 1 299 ? -6.223  55.289 42.285 1.00 15.82 ? 299 ALA A C     1 
ATOM   2288 O  O     . ALA A 1 299 ? -6.484  55.107 41.088 1.00 17.34 ? 299 ALA A O     1 
ATOM   2289 C  CB    . ALA A 1 299 ? -4.486  53.473 42.447 1.00 13.41 ? 299 ALA A CB    1 
ATOM   2290 N  N     . THR A 1 300 ? -7.112  55.794 43.144 1.00 15.01 ? 300 THR A N     1 
ATOM   2291 C  CA    . THR A 1 300 ? -8.416  56.207 42.698 1.00 12.92 ? 300 THR A CA    1 
ATOM   2292 C  C     . THR A 1 300 ? -8.690  57.657 43.023 1.00 15.24 ? 300 THR A C     1 
ATOM   2293 O  O     . THR A 1 300 ? -9.224  58.381 42.176 1.00 16.45 ? 300 THR A O     1 
ATOM   2294 C  CB    . THR A 1 300 ? -9.496  55.345 43.287 1.00 10.49 ? 300 THR A CB    1 
ATOM   2295 O  OG1   . THR A 1 300 ? -9.445  54.078 42.649 1.00 8.79  ? 300 THR A OG1   1 
ATOM   2296 C  CG2   . THR A 1 300 ? -10.875 55.957 43.072 1.00 7.47  ? 300 THR A CG2   1 
ATOM   2297 N  N     . THR A 1 301 ? -8.372  58.110 44.234 1.00 16.16 ? 301 THR A N     1 
ATOM   2298 C  CA    . THR A 1 301 ? -8.659  59.521 44.553 1.00 16.09 ? 301 THR A CA    1 
ATOM   2299 C  C     . THR A 1 301 ? -7.404  60.373 44.484 1.00 16.26 ? 301 THR A C     1 
ATOM   2300 O  O     . THR A 1 301 ? -7.475  61.597 44.569 1.00 16.68 ? 301 THR A O     1 
ATOM   2301 C  CB    . THR A 1 301 ? -9.292  59.723 45.962 1.00 15.18 ? 301 THR A CB    1 
ATOM   2302 O  OG1   . THR A 1 301 ? -8.423  59.175 46.966 1.00 14.78 ? 301 THR A OG1   1 
ATOM   2303 C  CG2   . THR A 1 301 ? -10.689 59.110 46.037 1.00 12.32 ? 301 THR A CG2   1 
ATOM   2304 N  N     . GLY A 1 302 ? -6.252  59.728 44.346 1.00 16.21 ? 302 GLY A N     1 
ATOM   2305 C  CA    . GLY A 1 302 ? -5.027  60.493 44.302 1.00 16.38 ? 302 GLY A CA    1 
ATOM   2306 C  C     . GLY A 1 302 ? -4.666  61.044 45.670 1.00 16.57 ? 302 GLY A C     1 
ATOM   2307 O  O     . GLY A 1 302 ? -3.615  61.681 45.792 1.00 17.74 ? 302 GLY A O     1 
ATOM   2308 N  N     . ARG A 1 303 ? -5.516  60.794 46.675 1.00 15.70 ? 303 ARG A N     1 
ATOM   2309 C  CA    . ARG A 1 303 ? -5.297  61.240 48.034 1.00 15.98 ? 303 ARG A CA    1 
ATOM   2310 C  C     . ARG A 1 303 ? -4.068  60.532 48.574 1.00 17.14 ? 303 ARG A C     1 
ATOM   2311 O  O     . ARG A 1 303 ? -3.803  59.370 48.232 1.00 17.97 ? 303 ARG A O     1 
ATOM   2312 C  CB    . ARG A 1 303 ? -6.479  60.853 48.933 1.00 16.32 ? 303 ARG A CB    1 
ATOM   2313 C  CG    . ARG A 1 303 ? -7.742  61.731 48.877 1.00 15.32 ? 303 ARG A CG    1 
ATOM   2314 C  CD    . ARG A 1 303 ? -8.794  61.194 49.881 1.00 14.70 ? 303 ARG A CD    1 
ATOM   2315 N  NE    . ARG A 1 303 ? -9.111  59.782 49.606 1.00 13.65 ? 303 ARG A NE    1 
ATOM   2316 C  CZ    . ARG A 1 303 ? -9.999  59.096 50.321 1.00 11.32 ? 303 ARG A CZ    1 
ATOM   2317 N  NH1   . ARG A 1 303 ? -10.660 59.658 51.325 1.00 10.30 ? 303 ARG A NH1   1 
ATOM   2318 N  NH2   . ARG A 1 303 ? -10.219 57.833 50.021 1.00 11.04 ? 303 ARG A NH2   1 
ATOM   2319 N  N     . ARG A 1 304 ? -3.354  61.208 49.462 1.00 17.11 ? 304 ARG A N     1 
ATOM   2320 C  CA    . ARG A 1 304 ? -2.158  60.652 50.072 1.00 18.28 ? 304 ARG A CA    1 
ATOM   2321 C  C     . ARG A 1 304 ? -2.571  59.559 51.088 1.00 18.27 ? 304 ARG A C     1 
ATOM   2322 O  O     . ARG A 1 304 ? -3.583  59.688 51.786 1.00 18.58 ? 304 ARG A O     1 
ATOM   2323 C  CB    . ARG A 1 304 ? -1.374  61.783 50.765 1.00 18.71 ? 304 ARG A CB    1 
ATOM   2324 C  CG    . ARG A 1 304 ? -0.190  61.326 51.598 1.00 23.11 ? 304 ARG A CG    1 
ATOM   2325 C  CD    . ARG A 1 304 ? 0.527   62.477 52.276 1.00 24.34 ? 304 ARG A CD    1 
ATOM   2326 N  NE    . ARG A 1 304 ? 1.964   62.387 52.017 1.00 29.59 ? 304 ARG A NE    1 
ATOM   2327 C  CZ    . ARG A 1 304 ? 2.637   63.398 51.441 1.00 32.38 ? 304 ARG A CZ    1 
ATOM   2328 N  NH1   . ARG A 1 304 ? 2.002   64.535 51.098 1.00 32.87 ? 304 ARG A NH1   1 
ATOM   2329 N  NH2   . ARG A 1 304 ? 3.944   63.260 51.166 1.00 32.65 ? 304 ARG A NH2   1 
ATOM   2330 N  N     . ARG A 1 305 ? -1.810  58.481 51.153 1.00 17.34 ? 305 ARG A N     1 
ATOM   2331 C  CA    . ARG A 1 305 ? -2.103  57.412 52.098 1.00 16.75 ? 305 ARG A CA    1 
ATOM   2332 C  C     . ARG A 1 305 ? -1.326  57.533 53.410 1.00 17.28 ? 305 ARG A C     1 
ATOM   2333 O  O     . ARG A 1 305 ? -0.093  57.688 53.409 1.00 17.71 ? 305 ARG A O     1 
ATOM   2334 C  CB    . ARG A 1 305 ? -1.770  56.068 51.480 1.00 15.37 ? 305 ARG A CB    1 
ATOM   2335 C  CG    . ARG A 1 305 ? -2.755  55.664 50.398 1.00 15.74 ? 305 ARG A CG    1 
ATOM   2336 C  CD    . ARG A 1 305 ? -2.262  54.472 49.607 1.00 13.28 ? 305 ARG A CD    1 
ATOM   2337 N  NE    . ARG A 1 305 ? -3.144  54.201 48.487 1.00 13.30 ? 305 ARG A NE    1 
ATOM   2338 C  CZ    . ARG A 1 305 ? -2.699  53.577 47.405 1.00 11.33 ? 305 ARG A CZ    1 
ATOM   2339 N  NH1   . ARG A 1 305 ? -1.431  53.213 47.329 1.00 8.55  ? 305 ARG A NH1   1 
ATOM   2340 N  NH2   . ARG A 1 305 ? -3.568  53.201 46.470 1.00 10.51 ? 305 ARG A NH2   1 
ATOM   2341 N  N     . ARG A 1 306 ? -2.040  57.427 54.531 1.00 16.36 ? 306 ARG A N     1 
ATOM   2342 C  CA    . ARG A 1 306 ? -1.409  57.474 55.855 1.00 14.63 ? 306 ARG A CA    1 
ATOM   2343 C  C     . ARG A 1 306 ? -0.617  56.170 55.888 1.00 14.04 ? 306 ARG A C     1 
ATOM   2344 O  O     . ARG A 1 306 ? -1.101  55.140 55.403 1.00 12.80 ? 306 ARG A O     1 
ATOM   2345 C  CB    . ARG A 1 306 ? -2.480  57.464 56.941 1.00 13.22 ? 306 ARG A CB    1 
ATOM   2346 C  CG    . ARG A 1 306 ? -3.562  58.506 56.690 1.00 13.13 ? 306 ARG A CG    1 
ATOM   2347 C  CD    . ARG A 1 306 ? -4.859  58.139 57.373 1.00 14.97 ? 306 ARG A CD    1 
ATOM   2348 N  NE    . ARG A 1 306 ? -4.722  58.034 58.830 1.00 16.04 ? 306 ARG A NE    1 
ATOM   2349 C  CZ    . ARG A 1 306 ? -5.731  57.611 59.582 1.00 15.55 ? 306 ARG A CZ    1 
ATOM   2350 N  NH1   . ARG A 1 306 ? -6.891  57.278 59.021 1.00 16.40 ? 306 ARG A NH1   1 
ATOM   2351 N  NH2   . ARG A 1 306 ? -5.565  57.474 60.890 1.00 14.82 ? 306 ARG A NH2   1 
ATOM   2352 N  N     . THR A 1 307 ? 0.599   56.224 56.423 1.00 13.94 ? 307 THR A N     1 
ATOM   2353 C  CA    . THR A 1 307 ? 1.475   55.059 56.515 1.00 14.44 ? 307 THR A CA    1 
ATOM   2354 C  C     . THR A 1 307 ? 1.836   54.788 57.971 1.00 14.00 ? 307 THR A C     1 
ATOM   2355 O  O     . THR A 1 307 ? 1.767   55.696 58.811 1.00 13.68 ? 307 THR A O     1 
ATOM   2356 C  CB    . THR A 1 307 ? 2.797   55.297 55.746 1.00 14.53 ? 307 THR A CB    1 
ATOM   2357 O  OG1   . THR A 1 307 ? 3.293   56.606 56.070 1.00 16.91 ? 307 THR A OG1   1 
ATOM   2358 C  CG2   . THR A 1 307 ? 2.582   55.195 54.259 1.00 12.55 ? 307 THR A CG2   1 
ATOM   2359 N  N     . GLY A 1 308 ? 2.216   53.542 58.257 1.00 12.87 ? 308 GLY A N     1 
ATOM   2360 C  CA    . GLY A 1 308 ? 2.620   53.170 59.597 1.00 12.24 ? 308 GLY A CA    1 
ATOM   2361 C  C     . GLY A 1 308 ? 3.333   51.838 59.541 1.00 12.84 ? 308 GLY A C     1 
ATOM   2362 O  O     . GLY A 1 308 ? 3.585   51.320 58.448 1.00 13.01 ? 308 GLY A O     1 
ATOM   2363 N  N     . TRP A 1 309 ? 3.632   51.262 60.700 1.00 12.84 ? 309 TRP A N     1 
ATOM   2364 C  CA    . TRP A 1 309 ? 4.331   49.980 60.756 1.00 13.45 ? 309 TRP A CA    1 
ATOM   2365 C  C     . TRP A 1 309 ? 3.346   48.837 60.658 1.00 13.81 ? 309 TRP A C     1 
ATOM   2366 O  O     . TRP A 1 309 ? 2.159   48.979 61.027 1.00 12.99 ? 309 TRP A O     1 
ATOM   2367 C  CB    . TRP A 1 309 ? 5.078   49.784 62.094 1.00 14.58 ? 309 TRP A CB    1 
ATOM   2368 C  CG    . TRP A 1 309 ? 6.172   50.760 62.420 1.00 16.91 ? 309 TRP A CG    1 
ATOM   2369 C  CD1   . TRP A 1 309 ? 6.159   51.701 63.422 1.00 18.45 ? 309 TRP A CD1   1 
ATOM   2370 C  CD2   . TRP A 1 309 ? 7.462   50.863 61.793 1.00 17.84 ? 309 TRP A CD2   1 
ATOM   2371 N  NE1   . TRP A 1 309 ? 7.355   52.377 63.451 1.00 18.98 ? 309 TRP A NE1   1 
ATOM   2372 C  CE2   . TRP A 1 309 ? 8.177   51.879 62.470 1.00 18.80 ? 309 TRP A CE2   1 
ATOM   2373 C  CE3   . TRP A 1 309 ? 8.087   50.194 60.734 1.00 17.59 ? 309 TRP A CE3   1 
ATOM   2374 C  CZ2   . TRP A 1 309 ? 9.488   52.234 62.119 1.00 17.69 ? 309 TRP A CZ2   1 
ATOM   2375 C  CZ3   . TRP A 1 309 ? 9.388   50.545 60.395 1.00 16.63 ? 309 TRP A CZ3   1 
ATOM   2376 C  CH2   . TRP A 1 309 ? 10.070  51.552 61.083 1.00 16.65 ? 309 TRP A CH2   1 
ATOM   2377 N  N     . LEU A 1 310 ? 3.851   47.688 60.204 1.00 13.56 ? 310 LEU A N     1 
ATOM   2378 C  CA    . LEU A 1 310 ? 3.032   46.493 60.118 1.00 13.47 ? 310 LEU A CA    1 
ATOM   2379 C  C     . LEU A 1 310 ? 2.500   46.224 61.542 1.00 14.53 ? 310 LEU A C     1 
ATOM   2380 O  O     . LEU A 1 310 ? 3.232   46.321 62.554 1.00 13.64 ? 310 LEU A O     1 
ATOM   2381 C  CB    . LEU A 1 310 ? 3.864   45.330 59.618 1.00 12.73 ? 310 LEU A CB    1 
ATOM   2382 C  CG    . LEU A 1 310 ? 3.275   43.937 59.433 1.00 11.66 ? 310 LEU A CG    1 
ATOM   2383 C  CD1   . LEU A 1 310 ? 1.860   44.006 59.002 1.00 11.02 ? 310 LEU A CD1   1 
ATOM   2384 C  CD2   . LEU A 1 310 ? 4.115   43.224 58.352 1.00 13.72 ? 310 LEU A CD2   1 
ATOM   2385 N  N     . ASP A 1 311 ? 1.207   45.918 61.598 1.00 14.59 ? 311 ASP A N     1 
ATOM   2386 C  CA    . ASP A 1 311 ? 0.500   45.662 62.835 1.00 14.29 ? 311 ASP A CA    1 
ATOM   2387 C  C     . ASP A 1 311 ? -0.003  44.227 62.813 1.00 14.72 ? 311 ASP A C     1 
ATOM   2388 O  O     . ASP A 1 311 ? -1.049  43.931 62.223 1.00 16.35 ? 311 ASP A O     1 
ATOM   2389 C  CB    . ASP A 1 311 ? -0.663  46.659 62.930 1.00 13.03 ? 311 ASP A CB    1 
ATOM   2390 C  CG    . ASP A 1 311 ? -1.503  46.475 64.154 1.00 12.07 ? 311 ASP A CG    1 
ATOM   2391 O  OD1   . ASP A 1 311 ? -1.351  45.492 64.885 1.00 11.67 ? 311 ASP A OD1   1 
ATOM   2392 O  OD2   . ASP A 1 311 ? -2.381  47.311 64.364 1.00 13.22 ? 311 ASP A OD2   1 
ATOM   2393 N  N     . THR A 1 312 ? 0.744   43.344 63.467 1.00 14.58 ? 312 THR A N     1 
ATOM   2394 C  CA    . THR A 1 312 ? 0.439   41.915 63.563 1.00 13.56 ? 312 THR A CA    1 
ATOM   2395 C  C     . THR A 1 312 ? -0.830  41.634 64.403 1.00 12.59 ? 312 THR A C     1 
ATOM   2396 O  O     . THR A 1 312 ? -1.412  40.525 64.378 1.00 11.13 ? 312 THR A O     1 
ATOM   2397 C  CB    . THR A 1 312 ? 1.669   41.168 64.179 1.00 14.43 ? 312 THR A CB    1 
ATOM   2398 O  OG1   . THR A 1 312 ? 2.812   41.331 63.325 1.00 14.07 ? 312 THR A OG1   1 
ATOM   2399 C  CG2   . THR A 1 312 ? 1.395   39.690 64.322 1.00 17.42 ? 312 THR A CG2   1 
ATOM   2400 N  N     . VAL A 1 313 ? -1.258  42.618 65.180 1.00 12.56 ? 313 VAL A N     1 
ATOM   2401 C  CA    . VAL A 1 313 ? -2.461  42.418 65.976 1.00 12.81 ? 313 VAL A CA    1 
ATOM   2402 C  C     . VAL A 1 313 ? -3.633  42.530 64.984 1.00 12.89 ? 313 VAL A C     1 
ATOM   2403 O  O     . VAL A 1 313 ? -4.446  41.607 64.858 1.00 12.34 ? 313 VAL A O     1 
ATOM   2404 C  CB    . VAL A 1 313 ? -2.522  43.426 67.141 1.00 12.76 ? 313 VAL A CB    1 
ATOM   2405 C  CG1   . VAL A 1 313 ? -3.781  43.235 68.001 1.00 12.75 ? 313 VAL A CG1   1 
ATOM   2406 C  CG2   . VAL A 1 313 ? -1.306  43.246 67.977 1.00 12.10 ? 313 VAL A CG2   1 
ATOM   2407 N  N     . ALA A 1 314 ? -3.679  43.620 64.225 1.00 12.62 ? 314 ALA A N     1 
ATOM   2408 C  CA    . ALA A 1 314 ? -4.732  43.752 63.218 1.00 13.04 ? 314 ALA A CA    1 
ATOM   2409 C  C     . ALA A 1 314 ? -4.665  42.577 62.196 1.00 13.46 ? 314 ALA A C     1 
ATOM   2410 O  O     . ALA A 1 314 ? -5.680  41.921 61.915 1.00 14.00 ? 314 ALA A O     1 
ATOM   2411 C  CB    . ALA A 1 314 ? -4.625  45.084 62.524 1.00 11.11 ? 314 ALA A CB    1 
ATOM   2412 N  N     . VAL A 1 315 ? -3.471  42.277 61.680 1.00 12.68 ? 315 VAL A N     1 
ATOM   2413 C  CA    . VAL A 1 315 ? -3.313  41.182 60.726 1.00 11.71 ? 315 VAL A CA    1 
ATOM   2414 C  C     . VAL A 1 315 ? -3.833  39.847 61.268 1.00 11.89 ? 315 VAL A C     1 
ATOM   2415 O  O     . VAL A 1 315 ? -4.318  39.002 60.508 1.00 12.72 ? 315 VAL A O     1 
ATOM   2416 C  CB    . VAL A 1 315 ? -1.837  41.066 60.264 1.00 12.01 ? 315 VAL A CB    1 
ATOM   2417 C  CG1   . VAL A 1 315 ? -1.592  39.776 59.450 1.00 8.97  ? 315 VAL A CG1   1 
ATOM   2418 C  CG2   . VAL A 1 315 ? -1.471  42.325 59.425 1.00 12.13 ? 315 VAL A CG2   1 
ATOM   2419 N  N     . ARG A 1 316 ? -3.749  39.643 62.580 1.00 11.70 ? 316 ARG A N     1 
ATOM   2420 C  CA    . ARG A 1 316 ? -4.234  38.395 63.168 1.00 10.24 ? 316 ARG A CA    1 
ATOM   2421 C  C     . ARG A 1 316 ? -5.723  38.301 63.209 1.00 8.64  ? 316 ARG A C     1 
ATOM   2422 O  O     . ARG A 1 316 ? -6.265  37.203 63.245 1.00 8.53  ? 316 ARG A O     1 
ATOM   2423 C  CB    . ARG A 1 316 ? -3.608  38.097 64.522 1.00 12.16 ? 316 ARG A CB    1 
ATOM   2424 C  CG    . ARG A 1 316 ? -2.312  37.300 64.401 1.00 15.41 ? 316 ARG A CG    1 
ATOM   2425 C  CD    . ARG A 1 316 ? -1.716  37.023 65.731 1.00 17.84 ? 316 ARG A CD    1 
ATOM   2426 N  NE    . ARG A 1 316 ? -0.971  38.178 66.201 1.00 23.28 ? 316 ARG A NE    1 
ATOM   2427 C  CZ    . ARG A 1 316 ? -0.886  38.467 67.507 1.00 25.66 ? 316 ARG A CZ    1 
ATOM   2428 N  NH1   . ARG A 1 316 ? -1.522  37.694 68.392 1.00 27.15 ? 316 ARG A NH1   1 
ATOM   2429 N  NH2   . ARG A 1 316 ? -0.092  39.467 67.932 1.00 24.18 ? 316 ARG A NH2   1 
ATOM   2430 N  N     . ARG A 1 317 ? -6.392  39.449 63.192 1.00 8.06  ? 317 ARG A N     1 
ATOM   2431 C  CA    . ARG A 1 317 ? -7.862  39.465 63.130 1.00 7.85  ? 317 ARG A CA    1 
ATOM   2432 C  C     . ARG A 1 317 ? -8.203  38.999 61.685 1.00 6.82  ? 317 ARG A C     1 
ATOM   2433 O  O     . ARG A 1 317 ? -9.124  38.216 61.456 1.00 6.29  ? 317 ARG A O     1 
ATOM   2434 C  CB    . ARG A 1 317 ? -8.404  40.883 63.405 1.00 6.58  ? 317 ARG A CB    1 
ATOM   2435 C  CG    . ARG A 1 317 ? -9.924  40.988 63.331 1.00 8.71  ? 317 ARG A CG    1 
ATOM   2436 C  CD    . ARG A 1 317 ? -10.644 40.173 64.422 1.00 8.96  ? 317 ARG A CD    1 
ATOM   2437 N  NE    . ARG A 1 317 ? -10.648 40.911 65.685 1.00 10.61 ? 317 ARG A NE    1 
ATOM   2438 C  CZ    . ARG A 1 317 ? -11.377 40.521 66.721 1.00 11.31 ? 317 ARG A CZ    1 
ATOM   2439 N  NH1   . ARG A 1 317 ? -12.126 39.422 66.640 1.00 14.36 ? 317 ARG A NH1   1 
ATOM   2440 N  NH2   . ARG A 1 317 ? -11.403 41.258 67.824 1.00 9.90  ? 317 ARG A NH2   1 
ATOM   2441 N  N     . ALA A 1 318 ? -7.433  39.485 60.717 1.00 7.13  ? 318 ALA A N     1 
ATOM   2442 C  CA    . ALA A 1 318 ? -7.611  39.096 59.312 1.00 7.58  ? 318 ALA A CA    1 
ATOM   2443 C  C     . ALA A 1 318 ? -7.333  37.603 59.125 1.00 7.72  ? 318 ALA A C     1 
ATOM   2444 O  O     . ALA A 1 318 ? -7.994  36.947 58.326 1.00 8.88  ? 318 ALA A O     1 
ATOM   2445 C  CB    . ALA A 1 318 ? -6.699  39.938 58.389 1.00 6.45  ? 318 ALA A CB    1 
ATOM   2446 N  N     . VAL A 1 319 ? -6.342  37.062 59.823 1.00 7.97  ? 319 VAL A N     1 
ATOM   2447 C  CA    . VAL A 1 319 ? -6.074  35.632 59.705 1.00 8.91  ? 319 VAL A CA    1 
ATOM   2448 C  C     . VAL A 1 319 ? -7.334  34.815 60.026 1.00 9.72  ? 319 VAL A C     1 
ATOM   2449 O  O     . VAL A 1 319 ? -7.832  34.021 59.193 1.00 8.64  ? 319 VAL A O     1 
ATOM   2450 C  CB    . VAL A 1 319 ? -4.891  35.167 60.606 1.00 8.72  ? 319 VAL A CB    1 
ATOM   2451 C  CG1   . VAL A 1 319 ? -4.735  33.685 60.506 1.00 6.77  ? 319 VAL A CG1   1 
ATOM   2452 C  CG2   . VAL A 1 319 ? -3.571  35.855 60.167 1.00 8.52  ? 319 VAL A CG2   1 
ATOM   2453 N  N     . GLN A 1 320 ? -7.888  35.053 61.210 1.00 11.35 ? 320 GLN A N     1 
ATOM   2454 C  CA    . GLN A 1 320 ? -9.079  34.323 61.595 1.00 12.92 ? 320 GLN A CA    1 
ATOM   2455 C  C     . GLN A 1 320 ? -10.333 34.658 60.780 1.00 12.78 ? 320 GLN A C     1 
ATOM   2456 O  O     . GLN A 1 320 ? -11.019 33.751 60.305 1.00 13.37 ? 320 GLN A O     1 
ATOM   2457 C  CB    . GLN A 1 320 ? -9.308  34.379 63.110 1.00 13.80 ? 320 GLN A CB    1 
ATOM   2458 C  CG    . GLN A 1 320 ? -9.530  35.715 63.671 1.00 15.52 ? 320 GLN A CG    1 
ATOM   2459 C  CD    . GLN A 1 320 ? -9.549  35.714 65.186 1.00 16.92 ? 320 GLN A CD    1 
ATOM   2460 O  OE1   . GLN A 1 320 ? -10.113 36.626 65.787 1.00 20.11 ? 320 GLN A OE1   1 
ATOM   2461 N  NE2   . GLN A 1 320 ? -8.936  34.712 65.811 1.00 16.36 ? 320 GLN A NE2   1 
ATOM   2462 N  N     . LEU A 1 321 ? -10.623 35.936 60.564 1.00 12.80 ? 321 LEU A N     1 
ATOM   2463 C  CA    . LEU A 1 321 ? -11.801 36.276 59.766 1.00 12.11 ? 321 LEU A CA    1 
ATOM   2464 C  C     . LEU A 1 321 ? -11.813 35.648 58.375 1.00 11.15 ? 321 LEU A C     1 
ATOM   2465 O  O     . LEU A 1 321 ? -12.879 35.251 57.881 1.00 9.89  ? 321 LEU A O     1 
ATOM   2466 C  CB    . LEU A 1 321 ? -11.965 37.795 59.621 1.00 12.77 ? 321 LEU A CB    1 
ATOM   2467 C  CG    . LEU A 1 321 ? -12.452 38.561 60.861 1.00 12.99 ? 321 LEU A CG    1 
ATOM   2468 C  CD1   . LEU A 1 321 ? -12.412 40.073 60.625 1.00 12.15 ? 321 LEU A CD1   1 
ATOM   2469 C  CD2   . LEU A 1 321 ? -13.871 38.101 61.214 1.00 12.21 ? 321 LEU A CD2   1 
ATOM   2470 N  N     . ASN A 1 322 ? -10.639 35.551 57.747 1.00 10.12 ? 322 ASN A N     1 
ATOM   2471 C  CA    . ASN A 1 322 ? -10.549 35.039 56.365 1.00 9.38  ? 322 ASN A CA    1 
ATOM   2472 C  C     . ASN A 1 322 ? -10.030 33.619 56.150 1.00 9.60  ? 322 ASN A C     1 
ATOM   2473 O  O     . ASN A 1 322 ? -9.939  33.164 54.996 1.00 8.94  ? 322 ASN A O     1 
ATOM   2474 C  CB    . ASN A 1 322 ? -9.658  35.970 55.529 1.00 7.86  ? 322 ASN A CB    1 
ATOM   2475 C  CG    . ASN A 1 322 ? -10.147 37.408 55.499 1.00 7.28  ? 322 ASN A CG    1 
ATOM   2476 O  OD1   . ASN A 1 322 ? -11.259 37.676 55.015 1.00 6.22  ? 322 ASN A OD1   1 
ATOM   2477 N  ND2   . ASN A 1 322 ? -9.303  38.355 55.976 1.00 4.99  ? 322 ASN A ND2   1 
ATOM   2478 N  N     . SER A 1 323 ? -9.738  32.910 57.239 1.00 9.75  ? 323 SER A N     1 
ATOM   2479 C  CA    . SER A 1 323 ? -9.141  31.574 57.158 1.00 10.92 ? 323 SER A CA    1 
ATOM   2480 C  C     . SER A 1 323 ? -7.965  31.594 56.170 1.00 10.71 ? 323 SER A C     1 
ATOM   2481 O  O     . SER A 1 323 ? -7.870  30.776 55.253 1.00 8.82  ? 323 SER A O     1 
ATOM   2482 C  CB    . SER A 1 323 ? -10.147 30.432 56.858 1.00 10.91 ? 323 SER A CB    1 
ATOM   2483 O  OG    . SER A 1 323 ? -11.159 30.758 55.935 1.00 13.08 ? 323 SER A OG    1 
ATOM   2484 N  N     . LEU A 1 324 ? -7.053  32.539 56.380 1.00 11.32 ? 324 LEU A N     1 
ATOM   2485 C  CA    . LEU A 1 324 ? -5.905  32.642 55.481 1.00 11.72 ? 324 LEU A CA    1 
ATOM   2486 C  C     . LEU A 1 324 ? -5.248  31.284 55.335 1.00 11.30 ? 324 LEU A C     1 
ATOM   2487 O  O     . LEU A 1 324 ? -5.303  30.458 56.243 1.00 11.26 ? 324 LEU A O     1 
ATOM   2488 C  CB    . LEU A 1 324 ? -4.884  33.690 55.973 1.00 10.75 ? 324 LEU A CB    1 
ATOM   2489 C  CG    . LEU A 1 324 ? -5.484  35.107 56.002 1.00 10.17 ? 324 LEU A CG    1 
ATOM   2490 C  CD1   . LEU A 1 324 ? -4.498  36.171 56.473 1.00 8.50  ? 324 LEU A CD1   1 
ATOM   2491 C  CD2   . LEU A 1 324 ? -5.977  35.416 54.624 1.00 10.38 ? 324 LEU A CD2   1 
ATOM   2492 N  N     . SER A 1 325 ? -4.721  31.016 54.152 1.00 11.01 ? 325 SER A N     1 
ATOM   2493 C  CA    . SER A 1 325 ? -4.010  29.777 53.918 1.00 10.18 ? 325 SER A CA    1 
ATOM   2494 C  C     . SER A 1 325 ? -2.575  30.202 53.845 1.00 10.31 ? 325 SER A C     1 
ATOM   2495 O  O     . SER A 1 325 ? -1.678  29.459 54.214 1.00 10.73 ? 325 SER A O     1 
ATOM   2496 C  CB    . SER A 1 325 ? -4.442  29.134 52.612 1.00 10.58 ? 325 SER A CB    1 
ATOM   2497 O  OG    . SER A 1 325 ? -5.791  28.718 52.689 1.00 11.54 ? 325 SER A OG    1 
ATOM   2498 N  N     . GLY A 1 326 ? -2.354  31.417 53.362 1.00 10.77 ? 326 GLY A N     1 
ATOM   2499 C  CA    . GLY A 1 326 ? -1.006  31.921 53.267 1.00 11.02 ? 326 GLY A CA    1 
ATOM   2500 C  C     . GLY A 1 326 ? -1.069  33.400 52.985 1.00 11.91 ? 326 GLY A C     1 
ATOM   2501 O  O     . GLY A 1 326 ? -2.142  33.947 52.738 1.00 12.20 ? 326 GLY A O     1 
ATOM   2502 N  N     . PHE A 1 327 ? 0.094   34.041 52.993 1.00 12.75 ? 327 PHE A N     1 
ATOM   2503 C  CA    . PHE A 1 327 ? 0.210   35.479 52.745 1.00 12.11 ? 327 PHE A CA    1 
ATOM   2504 C  C     . PHE A 1 327 ? 1.073   35.727 51.545 1.00 11.81 ? 327 PHE A C     1 
ATOM   2505 O  O     . PHE A 1 327 ? 1.874   34.892 51.141 1.00 12.68 ? 327 PHE A O     1 
ATOM   2506 C  CB    . PHE A 1 327 ? 0.996   36.173 53.864 1.00 11.31 ? 327 PHE A CB    1 
ATOM   2507 C  CG    . PHE A 1 327 ? 0.257   36.363 55.140 1.00 10.59 ? 327 PHE A CG    1 
ATOM   2508 C  CD1   . PHE A 1 327 ? 0.824   35.923 56.340 1.00 10.26 ? 327 PHE A CD1   1 
ATOM   2509 C  CD2   . PHE A 1 327 ? -0.918  37.113 55.179 1.00 9.07  ? 327 PHE A CD2   1 
ATOM   2510 C  CE1   . PHE A 1 327 ? 0.231   36.252 57.582 1.00 9.49  ? 327 PHE A CE1   1 
ATOM   2511 C  CE2   . PHE A 1 327 ? -1.506  37.433 56.387 1.00 9.20  ? 327 PHE A CE2   1 
ATOM   2512 C  CZ    . PHE A 1 327 ? -0.928  37.005 57.602 1.00 8.49  ? 327 PHE A CZ    1 
ATOM   2513 N  N     . CYS A 1 328 ? 0.962   36.940 51.045 1.00 12.27 ? 328 CYS A N     1 
ATOM   2514 C  CA    . CYS A 1 328 ? 1.792   37.405 49.965 1.00 11.42 ? 328 CYS A CA    1 
ATOM   2515 C  C     . CYS A 1 328 ? 2.351   38.665 50.586 1.00 11.94 ? 328 CYS A C     1 
ATOM   2516 O  O     . CYS A 1 328 ? 1.612   39.617 50.839 1.00 12.09 ? 328 CYS A O     1 
ATOM   2517 C  CB    . CYS A 1 328 ? 0.981   37.749 48.737 1.00 11.80 ? 328 CYS A CB    1 
ATOM   2518 S  SG    . CYS A 1 328 ? 1.980   38.527 47.491 1.00 10.68 ? 328 CYS A SG    1 
ATOM   2519 N  N     . LEU A 1 329 ? 3.627   38.627 50.952 1.00 12.33 ? 329 LEU A N     1 
ATOM   2520 C  CA    . LEU A 1 329 ? 4.253   39.786 51.558 1.00 11.56 ? 329 LEU A CA    1 
ATOM   2521 C  C     . LEU A 1 329 ? 4.654   40.687 50.382 1.00 12.22 ? 329 LEU A C     1 
ATOM   2522 O  O     . LEU A 1 329 ? 5.406   40.263 49.489 1.00 12.79 ? 329 LEU A O     1 
ATOM   2523 C  CB    . LEU A 1 329 ? 5.456   39.345 52.388 1.00 10.15 ? 329 LEU A CB    1 
ATOM   2524 C  CG    . LEU A 1 329 ? 6.200   40.446 53.136 1.00 9.27  ? 329 LEU A CG    1 
ATOM   2525 C  CD1   . LEU A 1 329 ? 5.323   40.939 54.263 1.00 10.23 ? 329 LEU A CD1   1 
ATOM   2526 C  CD2   . LEU A 1 329 ? 7.549   39.942 53.661 1.00 8.07  ? 329 LEU A CD2   1 
ATOM   2527 N  N     . THR A 1 330 ? 4.110   41.899 50.359 1.00 12.43 ? 330 THR A N     1 
ATOM   2528 C  CA    . THR A 1 330 ? 4.370   42.858 49.290 1.00 12.95 ? 330 THR A CA    1 
ATOM   2529 C  C     . THR A 1 330 ? 5.142   44.079 49.808 1.00 13.31 ? 330 THR A C     1 
ATOM   2530 O  O     . THR A 1 330 ? 5.212   44.307 51.008 1.00 13.15 ? 330 THR A O     1 
ATOM   2531 C  CB    . THR A 1 330 ? 3.027   43.388 48.651 1.00 13.64 ? 330 THR A CB    1 
ATOM   2532 O  OG1   . THR A 1 330 ? 2.303   44.146 49.627 1.00 14.25 ? 330 THR A OG1   1 
ATOM   2533 C  CG2   . THR A 1 330 ? 2.139   42.236 48.140 1.00 12.18 ? 330 THR A CG2   1 
ATOM   2534 N  N     . LYS A 1 331 ? 5.704   44.849 48.877 1.00 12.21 ? 331 LYS A N     1 
ATOM   2535 C  CA    . LYS A 1 331 ? 6.469   46.046 49.145 1.00 11.95 ? 331 LYS A CA    1 
ATOM   2536 C  C     . LYS A 1 331 ? 7.672   45.989 50.125 1.00 13.40 ? 331 LYS A C     1 
ATOM   2537 O  O     . LYS A 1 331 ? 8.087   47.005 50.694 1.00 13.96 ? 331 LYS A O     1 
ATOM   2538 C  CB    . LYS A 1 331 ? 5.513   47.201 49.414 1.00 11.09 ? 331 LYS A CB    1 
ATOM   2539 C  CG    . LYS A 1 331 ? 4.585   47.441 48.229 1.00 10.30 ? 331 LYS A CG    1 
ATOM   2540 C  CD    . LYS A 1 331 ? 3.628   48.570 48.408 1.00 8.26  ? 331 LYS A CD    1 
ATOM   2541 C  CE    . LYS A 1 331 ? 4.150   49.779 47.695 1.00 10.34 ? 331 LYS A CE    1 
ATOM   2542 N  NZ    . LYS A 1 331 ? 3.343   51.039 47.846 1.00 10.36 ? 331 LYS A NZ    1 
ATOM   2543 N  N     . LEU A 1 332 ? 8.272   44.813 50.271 1.00 14.64 ? 332 LEU A N     1 
ATOM   2544 C  CA    . LEU A 1 332 ? 9.448   44.650 51.123 1.00 16.76 ? 332 LEU A CA    1 
ATOM   2545 C  C     . LEU A 1 332 ? 10.528  45.672 50.682 1.00 17.89 ? 332 LEU A C     1 
ATOM   2546 O  O     . LEU A 1 332 ? 11.067  46.443 51.485 1.00 19.04 ? 332 LEU A O     1 
ATOM   2547 C  CB    . LEU A 1 332 ? 9.999   43.238 50.951 1.00 16.78 ? 332 LEU A CB    1 
ATOM   2548 C  CG    . LEU A 1 332 ? 11.130  42.800 51.875 1.00 18.44 ? 332 LEU A CG    1 
ATOM   2549 C  CD1   . LEU A 1 332 ? 10.526  42.710 53.272 1.00 19.88 ? 332 LEU A CD1   1 
ATOM   2550 C  CD2   . LEU A 1 332 ? 11.738  41.431 51.472 1.00 16.92 ? 332 LEU A CD2   1 
ATOM   2551 N  N     . ASP A 1 333 ? 10.809  45.697 49.389 1.00 18.22 ? 333 ASP A N     1 
ATOM   2552 C  CA    . ASP A 1 333 ? 11.804  46.599 48.826 1.00 18.72 ? 333 ASP A CA    1 
ATOM   2553 C  C     . ASP A 1 333 ? 11.683  47.990 49.357 1.00 19.26 ? 333 ASP A C     1 
ATOM   2554 O  O     . ASP A 1 333 ? 12.661  48.718 49.381 1.00 20.52 ? 333 ASP A O     1 
ATOM   2555 C  CB    . ASP A 1 333 ? 11.669  46.671 47.301 1.00 18.58 ? 333 ASP A CB    1 
ATOM   2556 C  CG    . ASP A 1 333 ? 10.261  47.015 46.859 1.00 17.25 ? 333 ASP A CG    1 
ATOM   2557 O  OD1   . ASP A 1 333 ? 9.330   46.223 47.104 1.00 16.00 ? 333 ASP A OD1   1 
ATOM   2558 O  OD2   . ASP A 1 333 ? 10.079  48.074 46.243 1.00 17.16 ? 333 ASP A OD2   1 
ATOM   2559 N  N     . VAL A 1 334 ? 10.481  48.380 49.755 1.00 19.48 ? 334 VAL A N     1 
ATOM   2560 C  CA    . VAL A 1 334 ? 10.269  49.719 50.255 1.00 19.34 ? 334 VAL A CA    1 
ATOM   2561 C  C     . VAL A 1 334 ? 10.955  49.925 51.603 1.00 21.44 ? 334 VAL A C     1 
ATOM   2562 O  O     . VAL A 1 334 ? 11.346  51.047 51.943 1.00 22.37 ? 334 VAL A O     1 
ATOM   2563 C  CB    . VAL A 1 334 ? 8.756   50.050 50.308 1.00 18.11 ? 334 VAL A CB    1 
ATOM   2564 C  CG1   . VAL A 1 334 ? 8.493   51.403 51.059 1.00 17.04 ? 334 VAL A CG1   1 
ATOM   2565 C  CG2   . VAL A 1 334 ? 8.209   50.094 48.872 1.00 16.24 ? 334 VAL A CG2   1 
ATOM   2566 N  N     . LEU A 1 335 ? 11.156  48.846 52.353 1.00 21.93 ? 335 LEU A N     1 
ATOM   2567 C  CA    . LEU A 1 335 ? 11.795  48.975 53.653 1.00 22.97 ? 335 LEU A CA    1 
ATOM   2568 C  C     . LEU A 1 335 ? 13.315  49.113 53.566 1.00 24.30 ? 335 LEU A C     1 
ATOM   2569 O  O     . LEU A 1 335 ? 13.963  49.341 54.586 1.00 25.05 ? 335 LEU A O     1 
ATOM   2570 C  CB    . LEU A 1 335 ? 11.441  47.787 54.557 1.00 20.97 ? 335 LEU A CB    1 
ATOM   2571 C  CG    . LEU A 1 335 ? 9.980   47.490 54.912 1.00 19.29 ? 335 LEU A CG    1 
ATOM   2572 C  CD1   . LEU A 1 335 ? 9.981   46.178 55.671 1.00 19.79 ? 335 LEU A CD1   1 
ATOM   2573 C  CD2   . LEU A 1 335 ? 9.324   48.579 55.753 1.00 17.50 ? 335 LEU A CD2   1 
ATOM   2574 N  N     . ASP A 1 336 ? 13.876  48.942 52.366 1.00 25.59 ? 336 ASP A N     1 
ATOM   2575 C  CA    . ASP A 1 336 ? 15.329  49.018 52.126 1.00 26.12 ? 336 ASP A CA    1 
ATOM   2576 C  C     . ASP A 1 336 ? 15.971  50.303 52.617 1.00 26.81 ? 336 ASP A C     1 
ATOM   2577 O  O     . ASP A 1 336 ? 15.507  51.389 52.287 1.00 28.62 ? 336 ASP A O     1 
ATOM   2578 C  CB    . ASP A 1 336 ? 15.607  48.917 50.643 1.00 25.06 ? 336 ASP A CB    1 
ATOM   2579 C  CG    . ASP A 1 336 ? 15.301  47.560 50.081 1.00 25.86 ? 336 ASP A CG    1 
ATOM   2580 O  OD1   . ASP A 1 336 ? 15.515  47.403 48.849 1.00 25.70 ? 336 ASP A OD1   1 
ATOM   2581 O  OD2   . ASP A 1 336 ? 14.876  46.645 50.842 1.00 24.29 ? 336 ASP A OD2   1 
ATOM   2582 N  N     . GLY A 1 337 ? 17.053  50.193 53.376 1.00 26.89 ? 337 GLY A N     1 
ATOM   2583 C  CA    . GLY A 1 337 ? 17.704  51.384 53.873 1.00 26.62 ? 337 GLY A CA    1 
ATOM   2584 C  C     . GLY A 1 337 ? 17.105  51.989 55.131 1.00 27.47 ? 337 GLY A C     1 
ATOM   2585 O  O     . GLY A 1 337 ? 17.072  53.213 55.251 1.00 27.64 ? 337 GLY A O     1 
ATOM   2586 N  N     . LEU A 1 338 ? 16.608  51.154 56.048 1.00 27.78 ? 338 LEU A N     1 
ATOM   2587 C  CA    . LEU A 1 338 ? 16.039  51.610 57.332 1.00 28.39 ? 338 LEU A CA    1 
ATOM   2588 C  C     . LEU A 1 338 ? 16.908  50.952 58.411 1.00 29.84 ? 338 LEU A C     1 
ATOM   2589 O  O     . LEU A 1 338 ? 17.189  49.751 58.344 1.00 30.53 ? 338 LEU A O     1 
ATOM   2590 C  CB    . LEU A 1 338 ? 14.567  51.190 57.518 1.00 26.41 ? 338 LEU A CB    1 
ATOM   2591 C  CG    . LEU A 1 338 ? 13.419  51.944 56.823 1.00 26.35 ? 338 LEU A CG    1 
ATOM   2592 C  CD1   . LEU A 1 338 ? 12.080  51.271 57.103 1.00 24.47 ? 338 LEU A CD1   1 
ATOM   2593 C  CD2   . LEU A 1 338 ? 13.358  53.414 57.261 1.00 25.30 ? 338 LEU A CD2   1 
ATOM   2594 N  N     . LYS A 1 339 ? 17.370  51.734 59.379 1.00 31.20 ? 339 LYS A N     1 
ATOM   2595 C  CA    . LYS A 1 339 ? 18.229  51.192 60.423 1.00 32.30 ? 339 LYS A CA    1 
ATOM   2596 C  C     . LYS A 1 339 ? 17.453  50.082 61.091 1.00 31.44 ? 339 LYS A C     1 
ATOM   2597 O  O     . LYS A 1 339 ? 17.959  48.975 61.266 1.00 31.60 ? 339 LYS A O     1 
ATOM   2598 C  CB    . LYS A 1 339 ? 18.606  52.274 61.441 1.00 35.17 ? 339 LYS A CB    1 
ATOM   2599 C  CG    . LYS A 1 339 ? 19.720  51.888 62.419 1.00 39.23 ? 339 LYS A CG    1 
ATOM   2600 C  CD    . LYS A 1 339 ? 21.124  51.985 61.775 1.00 41.82 ? 339 LYS A CD    1 
ATOM   2601 C  CE    . LYS A 1 339 ? 22.202  51.426 62.738 1.00 43.37 ? 339 LYS A CE    1 
ATOM   2602 N  NZ    . LYS A 1 339 ? 23.550  51.201 62.109 1.00 43.43 ? 339 LYS A NZ    1 
ATOM   2603 N  N     . GLU A 1 340 ? 16.199  50.362 61.416 1.00 30.75 ? 340 GLU A N     1 
ATOM   2604 C  CA    . GLU A 1 340 ? 15.359  49.362 62.055 1.00 29.71 ? 340 GLU A CA    1 
ATOM   2605 C  C     . GLU A 1 340 ? 13.943  49.455 61.537 1.00 28.74 ? 340 GLU A C     1 
ATOM   2606 O  O     . GLU A 1 340 ? 13.533  50.488 60.987 1.00 28.78 ? 340 GLU A O     1 
ATOM   2607 C  CB    . GLU A 1 340 ? 15.387  49.510 63.581 1.00 30.12 ? 340 GLU A CB    1 
ATOM   2608 C  CG    . GLU A 1 340 ? 15.108  50.922 64.073 1.00 30.43 ? 340 GLU A CG    1 
ATOM   2609 C  CD    . GLU A 1 340 ? 15.441  51.120 65.548 1.00 30.29 ? 340 GLU A CD    1 
ATOM   2610 O  OE1   . GLU A 1 340 ? 16.334  50.407 66.071 1.00 29.10 ? 340 GLU A OE1   1 
ATOM   2611 O  OE2   . GLU A 1 340 ? 14.796  51.998 66.172 1.00 29.90 ? 340 GLU A OE2   1 
ATOM   2612 N  N     . VAL A 1 341 ? 13.225  48.345 61.676 1.00 27.06 ? 341 VAL A N     1 
ATOM   2613 C  CA    . VAL A 1 341 ? 11.833  48.228 61.256 1.00 24.87 ? 341 VAL A CA    1 
ATOM   2614 C  C     . VAL A 1 341 ? 11.123  47.598 62.443 1.00 24.39 ? 341 VAL A C     1 
ATOM   2615 O  O     . VAL A 1 341 ? 11.669  46.711 63.097 1.00 25.55 ? 341 VAL A O     1 
ATOM   2616 C  CB    . VAL A 1 341 ? 11.664  47.279 60.027 1.00 23.61 ? 341 VAL A CB    1 
ATOM   2617 C  CG1   . VAL A 1 341 ? 12.047  47.974 58.749 1.00 21.41 ? 341 VAL A CG1   1 
ATOM   2618 C  CG2   . VAL A 1 341 ? 12.496  46.049 60.212 1.00 22.13 ? 341 VAL A CG2   1 
ATOM   2619 N  N     . LYS A 1 342 ? 9.927   48.055 62.760 1.00 22.93 ? 342 LYS A N     1 
ATOM   2620 C  CA    . LYS A 1 342 ? 9.241   47.444 63.870 1.00 21.97 ? 342 LYS A CA    1 
ATOM   2621 C  C     . LYS A 1 342 ? 7.866   46.928 63.492 1.00 21.02 ? 342 LYS A C     1 
ATOM   2622 O  O     . LYS A 1 342 ? 7.341   47.256 62.426 1.00 20.02 ? 342 LYS A O     1 
ATOM   2623 C  CB    . LYS A 1 342 ? 9.188   48.398 65.064 1.00 22.85 ? 342 LYS A CB    1 
ATOM   2624 C  CG    . LYS A 1 342 ? 8.491   49.671 64.838 1.00 23.14 ? 342 LYS A CG    1 
ATOM   2625 C  CD    . LYS A 1 342 ? 8.692   50.592 66.028 1.00 25.21 ? 342 LYS A CD    1 
ATOM   2626 C  CE    . LYS A 1 342 ? 10.089  51.172 66.110 1.00 25.56 ? 342 LYS A CE    1 
ATOM   2627 N  NZ    . LYS A 1 342 ? 10.099  52.413 66.974 1.00 25.13 ? 342 LYS A NZ    1 
ATOM   2628 N  N     . LEU A 1 343 ? 7.341   46.017 64.302 1.00 20.56 ? 343 LEU A N     1 
ATOM   2629 C  CA    . LEU A 1 343 ? 6.015   45.495 64.049 1.00 20.13 ? 343 LEU A CA    1 
ATOM   2630 C  C     . LEU A 1 343 ? 5.271   45.427 65.362 1.00 19.42 ? 343 LEU A C     1 
ATOM   2631 O  O     . LEU A 1 343 ? 5.884   45.241 66.424 1.00 20.00 ? 343 LEU A O     1 
ATOM   2632 C  CB    . LEU A 1 343 ? 6.051   44.179 63.267 1.00 20.95 ? 343 LEU A CB    1 
ATOM   2633 C  CG    . LEU A 1 343 ? 6.930   43.049 63.738 1.00 21.97 ? 343 LEU A CG    1 
ATOM   2634 C  CD1   . LEU A 1 343 ? 6.150   42.430 64.863 1.00 24.90 ? 343 LEU A CD1   1 
ATOM   2635 C  CD2   . LEU A 1 343 ? 7.181   42.027 62.652 1.00 20.20 ? 343 LEU A CD2   1 
ATOM   2636 N  N     . CYS A 1 344 ? 3.974   45.719 65.305 1.00 17.82 ? 344 CYS A N     1 
ATOM   2637 C  CA    . CYS A 1 344 ? 3.145   45.739 66.503 1.00 16.50 ? 344 CYS A CA    1 
ATOM   2638 C  C     . CYS A 1 344 ? 2.704   44.341 66.889 1.00 17.01 ? 344 CYS A C     1 
ATOM   2639 O  O     . CYS A 1 344 ? 2.029   43.645 66.098 1.00 16.44 ? 344 CYS A O     1 
ATOM   2640 C  CB    . CYS A 1 344 ? 1.946   46.648 66.290 1.00 15.31 ? 344 CYS A CB    1 
ATOM   2641 S  SG    . CYS A 1 344 ? 0.859   46.754 67.660 1.00 11.89 ? 344 CYS A SG    1 
ATOM   2642 N  N     . VAL A 1 345 ? 3.096   43.932 68.095 1.00 16.01 ? 345 VAL A N     1 
ATOM   2643 C  CA    . VAL A 1 345 ? 2.769   42.602 68.587 1.00 16.22 ? 345 VAL A CA    1 
ATOM   2644 C  C     . VAL A 1 345 ? 1.639   42.590 69.594 1.00 16.16 ? 345 VAL A C     1 
ATOM   2645 O  O     . VAL A 1 345 ? 1.068   41.523 69.869 1.00 15.32 ? 345 VAL A O     1 
ATOM   2646 C  CB    . VAL A 1 345 ? 3.991   41.884 69.196 1.00 16.47 ? 345 VAL A CB    1 
ATOM   2647 C  CG1   . VAL A 1 345 ? 5.117   41.764 68.131 1.00 15.74 ? 345 VAL A CG1   1 
ATOM   2648 C  CG2   . VAL A 1 345 ? 4.450   42.630 70.489 1.00 15.51 ? 345 VAL A CG2   1 
ATOM   2649 N  N     . ALA A 1 346 ? 1.309   43.759 70.141 1.00 15.82 ? 346 ALA A N     1 
ATOM   2650 C  CA    . ALA A 1 346 ? 0.226   43.845 71.103 1.00 14.71 ? 346 ALA A CA    1 
ATOM   2651 C  C     . ALA A 1 346 ? -0.252  45.264 71.180 1.00 14.86 ? 346 ALA A C     1 
ATOM   2652 O  O     . ALA A 1 346 ? 0.384   46.168 70.616 1.00 14.85 ? 346 ALA A O     1 
ATOM   2653 C  CB    . ALA A 1 346 ? 0.684   43.365 72.475 1.00 16.21 ? 346 ALA A CB    1 
ATOM   2654 N  N     . TYR A 1 347 ? -1.375  45.445 71.871 1.00 14.96 ? 347 TYR A N     1 
ATOM   2655 C  CA    . TYR A 1 347 ? -2.018  46.745 72.067 1.00 15.97 ? 347 TYR A CA    1 
ATOM   2656 C  C     . TYR A 1 347 ? -2.163  47.048 73.564 1.00 15.63 ? 347 TYR A C     1 
ATOM   2657 O  O     . TYR A 1 347 ? -2.564  46.185 74.357 1.00 13.93 ? 347 TYR A O     1 
ATOM   2658 C  CB    . TYR A 1 347 ? -3.457  46.739 71.518 1.00 17.02 ? 347 TYR A CB    1 
ATOM   2659 C  CG    . TYR A 1 347 ? -3.689  46.786 70.018 1.00 17.75 ? 347 TYR A CG    1 
ATOM   2660 C  CD1   . TYR A 1 347 ? -2.645  46.948 69.103 1.00 18.05 ? 347 TYR A CD1   1 
ATOM   2661 C  CD2   . TYR A 1 347 ? -4.994  46.724 69.526 1.00 17.80 ? 347 TYR A CD2   1 
ATOM   2662 C  CE1   . TYR A 1 347 ? -2.905  47.051 67.728 1.00 17.91 ? 347 TYR A CE1   1 
ATOM   2663 C  CE2   . TYR A 1 347 ? -5.267  46.833 68.171 1.00 18.27 ? 347 TYR A CE2   1 
ATOM   2664 C  CZ    . TYR A 1 347 ? -4.225  46.995 67.278 1.00 18.77 ? 347 TYR A CZ    1 
ATOM   2665 O  OH    . TYR A 1 347 ? -4.545  47.093 65.946 1.00 18.69 ? 347 TYR A OH    1 
ATOM   2666 N  N     . ARG A 1 348 ? -1.855  48.276 73.942 1.00 16.26 ? 348 ARG A N     1 
ATOM   2667 C  CA    . ARG A 1 348 ? -2.024  48.679 75.328 1.00 17.11 ? 348 ARG A CA    1 
ATOM   2668 C  C     . ARG A 1 348 ? -3.402  49.366 75.321 1.00 17.26 ? 348 ARG A C     1 
ATOM   2669 O  O     . ARG A 1 348 ? -3.638  50.333 74.576 1.00 15.43 ? 348 ARG A O     1 
ATOM   2670 C  CB    . ARG A 1 348 ? -0.902  49.639 75.776 1.00 17.87 ? 348 ARG A CB    1 
ATOM   2671 C  CG    . ARG A 1 348 ? -1.002  50.146 77.246 1.00 18.51 ? 348 ARG A CG    1 
ATOM   2672 C  CD    . ARG A 1 348 ? -0.865  49.030 78.295 1.00 18.78 ? 348 ARG A CD    1 
ATOM   2673 N  NE    . ARG A 1 348 ? 0.468   48.435 78.293 1.00 20.64 ? 348 ARG A NE    1 
ATOM   2674 C  CZ    . ARG A 1 348 ? 0.736   47.321 78.977 1.00 22.72 ? 348 ARG A CZ    1 
ATOM   2675 N  NH1   . ARG A 1 348 ? -0.207  46.726 79.717 1.00 23.22 ? 348 ARG A NH1   1 
ATOM   2676 N  NH2   . ARG A 1 348 ? 1.906   46.715 78.809 1.00 22.66 ? 348 ARG A NH2   1 
ATOM   2677 N  N     . MET A 1 349 ? -4.341  48.795 76.076 1.00 18.25 ? 349 MET A N     1 
ATOM   2678 C  CA    . MET A 1 349 ? -5.687  49.354 76.148 1.00 17.29 ? 349 MET A CA    1 
ATOM   2679 C  C     . MET A 1 349 ? -5.633  50.552 77.079 1.00 17.63 ? 349 MET A C     1 
ATOM   2680 O  O     . MET A 1 349 ? -4.808  50.605 78.017 1.00 17.33 ? 349 MET A O     1 
ATOM   2681 C  CB    . MET A 1 349 ? -6.684  48.312 76.671 1.00 16.64 ? 349 MET A CB    1 
ATOM   2682 C  CG    . MET A 1 349 ? -6.897  47.090 75.749 1.00 14.80 ? 349 MET A CG    1 
ATOM   2683 S  SD    . MET A 1 349 ? -7.220  47.597 74.031 1.00 13.47 ? 349 MET A SD    1 
ATOM   2684 C  CE    . MET A 1 349 ? -8.910  48.175 74.136 1.00 8.89  ? 349 MET A CE    1 
ATOM   2685 N  N     . PRO A 1 350 ? -6.491  51.545 76.823 1.00 17.72 ? 350 PRO A N     1 
ATOM   2686 C  CA    . PRO A 1 350 ? -6.562  52.760 77.630 1.00 17.55 ? 350 PRO A CA    1 
ATOM   2687 C  C     . PRO A 1 350 ? -6.754  52.474 79.103 1.00 17.24 ? 350 PRO A C     1 
ATOM   2688 O  O     . PRO A 1 350 ? -6.468  53.332 79.937 1.00 18.30 ? 350 PRO A O     1 
ATOM   2689 C  CB    . PRO A 1 350 ? -7.749  53.519 77.018 1.00 17.39 ? 350 PRO A CB    1 
ATOM   2690 C  CG    . PRO A 1 350 ? -8.491  52.498 76.274 1.00 17.16 ? 350 PRO A CG    1 
ATOM   2691 C  CD    . PRO A 1 350 ? -7.442  51.611 75.711 1.00 17.67 ? 350 PRO A CD    1 
ATOM   2692 N  N     . ASP A 1 351 ? -7.219  51.276 79.439 1.00 17.46 ? 351 ASP A N     1 
ATOM   2693 C  CA    . ASP A 1 351 ? -7.411  50.923 80.852 1.00 18.05 ? 351 ASP A CA    1 
ATOM   2694 C  C     . ASP A 1 351 ? -6.184  50.218 81.440 1.00 17.94 ? 351 ASP A C     1 
ATOM   2695 O  O     . ASP A 1 351 ? -6.216  49.726 82.568 1.00 17.38 ? 351 ASP A O     1 
ATOM   2696 C  CB    . ASP A 1 351 ? -8.692  50.104 81.062 1.00 17.04 ? 351 ASP A CB    1 
ATOM   2697 C  CG    . ASP A 1 351 ? -8.548  48.619 80.679 1.00 17.25 ? 351 ASP A CG    1 
ATOM   2698 O  OD1   . ASP A 1 351 ? -9.502  47.875 81.002 1.00 17.62 ? 351 ASP A OD1   1 
ATOM   2699 O  OD2   . ASP A 1 351 ? -7.535  48.181 80.075 1.00 15.06 ? 351 ASP A OD2   1 
ATOM   2700 N  N     . GLY A 1 352 ? -5.118  50.144 80.645 1.00 18.73 ? 352 GLY A N     1 
ATOM   2701 C  CA    . GLY A 1 352 ? -3.873  49.549 81.106 1.00 19.43 ? 352 GLY A CA    1 
ATOM   2702 C  C     . GLY A 1 352 ? -3.635  48.100 80.763 1.00 18.97 ? 352 GLY A C     1 
ATOM   2703 O  O     . GLY A 1 352 ? -2.498  47.637 80.796 1.00 17.63 ? 352 GLY A O     1 
ATOM   2704 N  N     . ARG A 1 353 ? -4.690  47.396 80.385 1.00 20.51 ? 353 ARG A N     1 
ATOM   2705 C  CA    . ARG A 1 353 ? -4.567  45.971 80.064 1.00 22.37 ? 353 ARG A CA    1 
ATOM   2706 C  C     . ARG A 1 353 ? -3.785  45.765 78.751 1.00 20.63 ? 353 ARG A C     1 
ATOM   2707 O  O     . ARG A 1 353 ? -3.831  46.607 77.850 1.00 20.02 ? 353 ARG A O     1 
ATOM   2708 C  CB    . ARG A 1 353 ? -5.988  45.343 80.023 1.00 25.08 ? 353 ARG A CB    1 
ATOM   2709 C  CG    . ARG A 1 353 ? -6.063  43.819 79.799 1.00 30.67 ? 353 ARG A CG    1 
ATOM   2710 C  CD    . ARG A 1 353 ? -7.540  43.258 79.679 1.00 34.05 ? 353 ARG A CD    1 
ATOM   2711 N  NE    . ARG A 1 353 ? -8.349  43.908 78.631 1.00 35.68 ? 353 ARG A NE    1 
ATOM   2712 C  CZ    . ARG A 1 353 ? -8.950  45.074 78.865 1.00 35.47 ? 353 ARG A CZ    1 
ATOM   2713 N  NH1   . ARG A 1 353 ? -8.828  45.644 80.063 1.00 35.86 ? 353 ARG A NH1   1 
ATOM   2714 N  NH2   . ARG A 1 353 ? -9.612  45.695 77.892 1.00 35.19 ? 353 ARG A NH2   1 
ATOM   2715 N  N     . GLU A 1 354 ? -2.969  44.723 78.704 1.00 19.80 ? 354 GLU A N     1 
ATOM   2716 C  CA    . GLU A 1 354 ? -2.238  44.407 77.487 1.00 20.27 ? 354 GLU A CA    1 
ATOM   2717 C  C     . GLU A 1 354 ? -3.097  43.401 76.757 1.00 19.52 ? 354 GLU A C     1 
ATOM   2718 O  O     . GLU A 1 354 ? -3.608  42.458 77.340 1.00 18.29 ? 354 GLU A O     1 
ATOM   2719 C  CB    . GLU A 1 354 ? -0.847  43.826 77.738 1.00 21.48 ? 354 GLU A CB    1 
ATOM   2720 C  CG    . GLU A 1 354 ? -0.080  43.563 76.453 1.00 22.57 ? 354 GLU A CG    1 
ATOM   2721 C  CD    . GLU A 1 354 ? 1.300   43.020 76.699 1.00 23.84 ? 354 GLU A CD    1 
ATOM   2722 O  OE1   . GLU A 1 354 ? 2.156   43.129 75.803 1.00 25.13 ? 354 GLU A OE1   1 
ATOM   2723 O  OE2   . GLU A 1 354 ? 1.550   42.486 77.794 1.00 26.26 ? 354 GLU A OE2   1 
ATOM   2724 N  N     . VAL A 1 355 ? -3.224  43.596 75.458 1.00 19.43 ? 355 VAL A N     1 
ATOM   2725 C  CA    . VAL A 1 355 ? -4.082  42.757 74.678 1.00 18.57 ? 355 VAL A CA    1 
ATOM   2726 C  C     . VAL A 1 355 ? -3.404  42.415 73.337 1.00 19.35 ? 355 VAL A C     1 
ATOM   2727 O  O     . VAL A 1 355 ? -2.507  43.134 72.891 1.00 20.48 ? 355 VAL A O     1 
ATOM   2728 C  CB    . VAL A 1 355 ? -5.385  43.550 74.522 1.00 17.66 ? 355 VAL A CB    1 
ATOM   2729 C  CG1   . VAL A 1 355 ? -5.784  43.649 73.133 1.00 18.90 ? 355 VAL A CG1   1 
ATOM   2730 C  CG2   . VAL A 1 355 ? -6.474  42.977 75.371 1.00 17.06 ? 355 VAL A CG2   1 
ATOM   2731 N  N     . THR A 1 356 ? -3.783  41.296 72.726 1.00 18.72 ? 356 THR A N     1 
ATOM   2732 C  CA    . THR A 1 356 ? -3.231  40.910 71.423 1.00 17.73 ? 356 THR A CA    1 
ATOM   2733 C  C     . THR A 1 356 ? -4.387  40.704 70.450 1.00 16.77 ? 356 THR A C     1 
ATOM   2734 O  O     . THR A 1 356 ? -4.234  40.083 69.400 1.00 17.43 ? 356 THR A O     1 
ATOM   2735 C  CB    . THR A 1 356 ? -2.425  39.603 71.484 1.00 17.82 ? 356 THR A CB    1 
ATOM   2736 O  OG1   . THR A 1 356 ? -3.096  38.663 72.343 1.00 19.95 ? 356 THR A OG1   1 
ATOM   2737 C  CG2   . THR A 1 356 ? -1.025  39.852 71.969 1.00 16.60 ? 356 THR A CG2   1 
ATOM   2738 N  N     . THR A 1 357 ? -5.535  41.249 70.815 1.00 15.27 ? 357 THR A N     1 
ATOM   2739 C  CA    . THR A 1 357 ? -6.742  41.148 70.037 1.00 14.24 ? 357 THR A CA    1 
ATOM   2740 C  C     . THR A 1 357 ? -7.188  42.587 69.725 1.00 13.55 ? 357 THR A C     1 
ATOM   2741 O  O     . THR A 1 357 ? -6.902  43.502 70.500 1.00 13.63 ? 357 THR A O     1 
ATOM   2742 C  CB    . THR A 1 357 ? -7.755  40.372 70.864 1.00 14.71 ? 357 THR A CB    1 
ATOM   2743 O  OG1   . THR A 1 357 ? -8.014  39.110 70.235 1.00 15.83 ? 357 THR A OG1   1 
ATOM   2744 C  CG2   . THR A 1 357 ? -8.990  41.157 71.115 1.00 15.91 ? 357 THR A CG2   1 
ATOM   2745 N  N     . THR A 1 358 ? -7.857  42.794 68.587 1.00 11.91 ? 358 THR A N     1 
ATOM   2746 C  CA    . THR A 1 358 ? -8.278  44.125 68.183 1.00 9.76  ? 358 THR A CA    1 
ATOM   2747 C  C     . THR A 1 358 ? -9.693  44.437 68.608 1.00 9.13  ? 358 THR A C     1 
ATOM   2748 O  O     . THR A 1 358 ? -10.482 43.521 68.795 1.00 8.50  ? 358 THR A O     1 
ATOM   2749 C  CB    . THR A 1 358 ? -8.263  44.283 66.628 1.00 10.96 ? 358 THR A CB    1 
ATOM   2750 O  OG1   . THR A 1 358 ? -9.223  43.380 66.049 1.00 8.46  ? 358 THR A OG1   1 
ATOM   2751 C  CG2   . THR A 1 358 ? -6.845  44.041 66.036 1.00 10.21 ? 358 THR A CG2   1 
ATOM   2752 N  N     . PRO A 1 359 ? -10.028 45.742 68.766 1.00 8.07  ? 359 PRO A N     1 
ATOM   2753 C  CA    . PRO A 1 359 ? -11.364 46.194 69.149 1.00 7.78  ? 359 PRO A CA    1 
ATOM   2754 C  C     . PRO A 1 359 ? -12.195 46.109 67.861 1.00 8.73  ? 359 PRO A C     1 
ATOM   2755 O  O     . PRO A 1 359 ? -11.641 45.912 66.797 1.00 9.43  ? 359 PRO A O     1 
ATOM   2756 C  CB    . PRO A 1 359 ? -11.139 47.661 69.525 1.00 7.11  ? 359 PRO A CB    1 
ATOM   2757 C  CG    . PRO A 1 359 ? -9.648  47.774 69.808 1.00 5.80  ? 359 PRO A CG    1 
ATOM   2758 C  CD    . PRO A 1 359 ? -9.083  46.882 68.756 1.00 8.15  ? 359 PRO A CD    1 
ATOM   2759 N  N     . LEU A 1 360 ? -13.508 46.282 67.934 1.00 8.54  ? 360 LEU A N     1 
ATOM   2760 C  CA    . LEU A 1 360 ? -14.310 46.212 66.750 1.00 7.56  ? 360 LEU A CA    1 
ATOM   2761 C  C     . LEU A 1 360 ? -14.591 47.608 66.175 1.00 8.97  ? 360 LEU A C     1 
ATOM   2762 O  O     . LEU A 1 360 ? -13.812 48.101 65.354 1.00 9.60  ? 360 LEU A O     1 
ATOM   2763 C  CB    . LEU A 1 360 ? -15.618 45.412 67.004 1.00 8.28  ? 360 LEU A CB    1 
ATOM   2764 C  CG    . LEU A 1 360 ? -15.609 43.906 67.457 1.00 8.51  ? 360 LEU A CG    1 
ATOM   2765 C  CD1   . LEU A 1 360 ? -16.702 43.082 66.718 1.00 6.44  ? 360 LEU A CD1   1 
ATOM   2766 C  CD2   . LEU A 1 360 ? -14.208 43.248 67.334 1.00 5.67  ? 360 LEU A CD2   1 
ATOM   2767 N  N     . ALA A 1 361 ? -15.675 48.259 66.612 1.00 9.38  ? 361 ALA A N     1 
ATOM   2768 C  CA    . ALA A 1 361 ? -16.075 49.570 66.069 1.00 8.48  ? 361 ALA A CA    1 
ATOM   2769 C  C     . ALA A 1 361 ? -15.000 50.593 66.312 1.00 8.69  ? 361 ALA A C     1 
ATOM   2770 O  O     . ALA A 1 361 ? -14.280 50.499 67.294 1.00 7.55  ? 361 ALA A O     1 
ATOM   2771 C  CB    . ALA A 1 361 ? -17.416 50.026 66.661 1.00 7.21  ? 361 ALA A CB    1 
ATOM   2772 N  N     . ALA A 1 362 ? -14.929 51.593 65.440 1.00 10.04 ? 362 ALA A N     1 
ATOM   2773 C  CA    . ALA A 1 362 ? -13.891 52.628 65.507 1.00 11.84 ? 362 ALA A CA    1 
ATOM   2774 C  C     . ALA A 1 362 ? -13.669 53.224 66.902 1.00 13.13 ? 362 ALA A C     1 
ATOM   2775 O  O     . ALA A 1 362 ? -12.519 53.313 67.359 1.00 12.03 ? 362 ALA A O     1 
ATOM   2776 C  CB    . ALA A 1 362 ? -14.182 53.740 64.479 1.00 12.00 ? 362 ALA A CB    1 
ATOM   2777 N  N     . ASP A 1 363 ? -14.769 53.602 67.571 1.00 14.27 ? 363 ASP A N     1 
ATOM   2778 C  CA    . ASP A 1 363 ? -14.731 54.192 68.925 1.00 15.47 ? 363 ASP A CA    1 
ATOM   2779 C  C     . ASP A 1 363 ? -14.011 53.324 69.953 1.00 15.56 ? 363 ASP A C     1 
ATOM   2780 O  O     . ASP A 1 363 ? -13.325 53.837 70.839 1.00 15.78 ? 363 ASP A O     1 
ATOM   2781 C  CB    . ASP A 1 363 ? -16.141 54.502 69.437 1.00 15.96 ? 363 ASP A CB    1 
ATOM   2782 C  CG    . ASP A 1 363 ? -16.764 55.728 68.772 1.00 16.38 ? 363 ASP A CG    1 
ATOM   2783 O  OD1   . ASP A 1 363 ? -16.106 56.423 67.963 1.00 14.75 ? 363 ASP A OD1   1 
ATOM   2784 O  OD2   . ASP A 1 363 ? -17.944 55.997 69.078 1.00 16.90 ? 363 ASP A OD2   1 
ATOM   2785 N  N     . ASP A 1 364 ? -14.132 52.012 69.827 1.00 15.34 ? 364 ASP A N     1 
ATOM   2786 C  CA    . ASP A 1 364 ? -13.437 51.149 70.753 1.00 15.25 ? 364 ASP A CA    1 
ATOM   2787 C  C     . ASP A 1 364 ? -11.911 51.125 70.552 1.00 15.66 ? 364 ASP A C     1 
ATOM   2788 O  O     . ASP A 1 364 ? -11.199 50.431 71.274 1.00 17.07 ? 364 ASP A O     1 
ATOM   2789 C  CB    . ASP A 1 364 ? -14.058 49.768 70.721 1.00 15.83 ? 364 ASP A CB    1 
ATOM   2790 C  CG    . ASP A 1 364 ? -15.558 49.826 70.926 1.00 16.67 ? 364 ASP A CG    1 
ATOM   2791 O  OD1   . ASP A 1 364 ? -16.304 49.034 70.318 1.00 20.81 ? 364 ASP A OD1   1 
ATOM   2792 O  OD2   . ASP A 1 364 ? -16.017 50.695 71.673 1.00 16.42 ? 364 ASP A OD2   1 
ATOM   2793 N  N     . TRP A 1 365 ? -11.387 51.886 69.590 1.00 15.99 ? 365 TRP A N     1 
ATOM   2794 C  CA    . TRP A 1 365 ? -9.923  51.958 69.369 1.00 15.34 ? 365 TRP A CA    1 
ATOM   2795 C  C     . TRP A 1 365 ? -9.340  53.264 69.960 1.00 15.15 ? 365 TRP A C     1 
ATOM   2796 O  O     . TRP A 1 365 ? -8.130  53.417 70.058 1.00 13.85 ? 365 TRP A O     1 
ATOM   2797 C  CB    . TRP A 1 365 ? -9.563  51.907 67.855 1.00 13.96 ? 365 TRP A CB    1 
ATOM   2798 C  CG    . TRP A 1 365 ? -9.930  50.648 67.075 1.00 12.92 ? 365 TRP A CG    1 
ATOM   2799 C  CD1   . TRP A 1 365 ? -11.197 50.180 66.819 1.00 13.07 ? 365 TRP A CD1   1 
ATOM   2800 C  CD2   . TRP A 1 365 ? -9.037  49.774 66.359 1.00 11.70 ? 365 TRP A CD2   1 
ATOM   2801 N  NE1   . TRP A 1 365 ? -11.143 49.083 65.981 1.00 11.39 ? 365 TRP A NE1   1 
ATOM   2802 C  CE2   . TRP A 1 365 ? -9.836  48.812 65.683 1.00 11.07 ? 365 TRP A CE2   1 
ATOM   2803 C  CE3   . TRP A 1 365 ? -7.640  49.712 66.217 1.00 13.38 ? 365 TRP A CE3   1 
ATOM   2804 C  CZ2   . TRP A 1 365 ? -9.291  47.799 64.873 1.00 11.17 ? 365 TRP A CZ2   1 
ATOM   2805 C  CZ3   . TRP A 1 365 ? -7.077  48.691 65.400 1.00 12.46 ? 365 TRP A CZ3   1 
ATOM   2806 C  CH2   . TRP A 1 365 ? -7.919  47.748 64.742 1.00 12.49 ? 365 TRP A CH2   1 
ATOM   2807 N  N     . LYS A 1 366 ? -10.210 54.147 70.431 1.00 16.95 ? 366 LYS A N     1 
ATOM   2808 C  CA    . LYS A 1 366 ? -9.827  55.449 70.939 1.00 20.45 ? 366 LYS A CA    1 
ATOM   2809 C  C     . LYS A 1 366 ? -8.539  55.728 71.691 1.00 22.16 ? 366 LYS A C     1 
ATOM   2810 O  O     . LYS A 1 366 ? -7.931  56.786 71.472 1.00 25.44 ? 366 LYS A O     1 
ATOM   2811 C  CB    . LYS A 1 366 ? -10.972 56.099 71.665 1.00 23.01 ? 366 LYS A CB    1 
ATOM   2812 C  CG    . LYS A 1 366 ? -10.950 57.609 71.627 1.00 26.36 ? 366 LYS A CG    1 
ATOM   2813 C  CD    . LYS A 1 366 ? -12.404 58.084 71.726 1.00 30.84 ? 366 LYS A CD    1 
ATOM   2814 C  CE    . LYS A 1 366 ? -13.331 57.315 70.719 1.00 32.24 ? 366 LYS A CE    1 
ATOM   2815 N  NZ    . LYS A 1 366 ? -14.829 57.438 70.988 1.00 33.22 ? 366 LYS A NZ    1 
ATOM   2816 N  N     . GLY A 1 367 ? -8.085  54.880 72.593 1.00 21.17 ? 367 GLY A N     1 
ATOM   2817 C  CA    . GLY A 1 367 ? -6.819  55.260 73.213 1.00 19.67 ? 367 GLY A CA    1 
ATOM   2818 C  C     . GLY A 1 367 ? -5.856  54.105 73.186 1.00 20.26 ? 367 GLY A C     1 
ATOM   2819 O  O     . GLY A 1 367 ? -4.988  53.989 74.057 1.00 19.51 ? 367 GLY A O     1 
ATOM   2820 N  N     . VAL A 1 368 ? -6.007  53.226 72.192 1.00 20.11 ? 368 VAL A N     1 
ATOM   2821 C  CA    . VAL A 1 368 ? -5.152  52.063 72.158 1.00 20.00 ? 368 VAL A CA    1 
ATOM   2822 C  C     . VAL A 1 368 ? -3.805  52.445 71.616 1.00 19.88 ? 368 VAL A C     1 
ATOM   2823 O  O     . VAL A 1 368 ? -3.687  53.223 70.687 1.00 21.27 ? 368 VAL A O     1 
ATOM   2824 C  CB    . VAL A 1 368 ? -5.764  50.841 71.407 1.00 19.62 ? 368 VAL A CB    1 
ATOM   2825 C  CG1   . VAL A 1 368 ? -7.271  50.786 71.572 1.00 17.73 ? 368 VAL A CG1   1 
ATOM   2826 C  CG2   . VAL A 1 368 ? -5.328  50.828 69.969 1.00 22.35 ? 368 VAL A CG2   1 
ATOM   2827 N  N     . GLU A 1 369 ? -2.785  51.903 72.241 1.00 19.98 ? 369 GLU A N     1 
ATOM   2828 C  CA    . GLU A 1 369 ? -1.422  52.178 71.870 1.00 19.10 ? 369 GLU A CA    1 
ATOM   2829 C  C     . GLU A 1 369 ? -0.830  50.896 71.371 1.00 18.22 ? 369 GLU A C     1 
ATOM   2830 O  O     . GLU A 1 369 ? -1.200  49.828 71.867 1.00 18.63 ? 369 GLU A O     1 
ATOM   2831 C  CB    . GLU A 1 369 ? -0.662  52.579 73.128 1.00 18.57 ? 369 GLU A CB    1 
ATOM   2832 C  CG    . GLU A 1 369 ? -0.995  53.938 73.550 1.00 18.44 ? 369 GLU A CG    1 
ATOM   2833 C  CD    . GLU A 1 369 ? -0.568  54.938 72.528 1.00 18.76 ? 369 GLU A CD    1 
ATOM   2834 O  OE1   . GLU A 1 369 ? -1.189  56.015 72.496 1.00 20.12 ? 369 GLU A OE1   1 
ATOM   2835 O  OE2   . GLU A 1 369 ? 0.394   54.661 71.761 1.00 19.55 ? 369 GLU A OE2   1 
ATOM   2836 N  N     . PRO A 1 370 ? 0.067   50.973 70.377 1.00 17.64 ? 370 PRO A N     1 
ATOM   2837 C  CA    . PRO A 1 370 ? 0.705   49.761 69.849 1.00 17.13 ? 370 PRO A CA    1 
ATOM   2838 C  C     . PRO A 1 370 ? 1.955   49.494 70.658 1.00 16.60 ? 370 PRO A C     1 
ATOM   2839 O  O     . PRO A 1 370 ? 2.635   50.459 71.042 1.00 15.45 ? 370 PRO A O     1 
ATOM   2840 C  CB    . PRO A 1 370 ? 1.095   50.163 68.426 1.00 17.90 ? 370 PRO A CB    1 
ATOM   2841 C  CG    . PRO A 1 370 ? 1.447   51.674 68.607 1.00 17.75 ? 370 PRO A CG    1 
ATOM   2842 C  CD    . PRO A 1 370 ? 0.313   52.147 69.506 1.00 17.56 ? 370 PRO A CD    1 
ATOM   2843 N  N     . ILE A 1 371 ? 2.227   48.212 70.933 1.00 15.90 ? 371 ILE A N     1 
ATOM   2844 C  CA    . ILE A 1 371 ? 3.449   47.770 71.643 1.00 17.43 ? 371 ILE A CA    1 
ATOM   2845 C  C     . ILE A 1 371 ? 4.295   47.076 70.563 1.00 17.91 ? 371 ILE A C     1 
ATOM   2846 O  O     . ILE A 1 371 ? 3.855   46.086 69.971 1.00 20.82 ? 371 ILE A O     1 
ATOM   2847 C  CB    . ILE A 1 371 ? 3.155   46.692 72.718 1.00 17.37 ? 371 ILE A CB    1 
ATOM   2848 C  CG1   . ILE A 1 371 ? 2.206   47.237 73.787 1.00 16.10 ? 371 ILE A CG1   1 
ATOM   2849 C  CG2   . ILE A 1 371 ? 4.479   46.093 73.249 1.00 14.61 ? 371 ILE A CG2   1 
ATOM   2850 C  CD1   . ILE A 1 371 ? 1.637   46.130 74.636 1.00 17.15 ? 371 ILE A CD1   1 
ATOM   2851 N  N     . TYR A 1 372 ? 5.524   47.513 70.357 1.00 17.45 ? 372 TYR A N     1 
ATOM   2852 C  CA    . TYR A 1 372 ? 6.339   46.958 69.293 1.00 16.02 ? 372 TYR A CA    1 
ATOM   2853 C  C     . TYR A 1 372 ? 7.459   46.001 69.653 1.00 16.95 ? 372 TYR A C     1 
ATOM   2854 O  O     . TYR A 1 372 ? 7.751   45.750 70.806 1.00 16.93 ? 372 TYR A O     1 
ATOM   2855 C  CB    . TYR A 1 372 ? 6.971   48.121 68.509 1.00 14.19 ? 372 TYR A CB    1 
ATOM   2856 C  CG    . TYR A 1 372 ? 6.007   49.137 67.922 1.00 12.76 ? 372 TYR A CG    1 
ATOM   2857 C  CD1   . TYR A 1 372 ? 5.287   48.862 66.753 1.00 11.96 ? 372 TYR A CD1   1 
ATOM   2858 C  CD2   . TYR A 1 372 ? 5.907   50.409 68.459 1.00 11.57 ? 372 TYR A CD2   1 
ATOM   2859 C  CE1   . TYR A 1 372 ? 4.512   49.843 66.135 1.00 11.32 ? 372 TYR A CE1   1 
ATOM   2860 C  CE2   . TYR A 1 372 ? 5.137   51.393 67.856 1.00 10.78 ? 372 TYR A CE2   1 
ATOM   2861 C  CZ    . TYR A 1 372 ? 4.439   51.117 66.683 1.00 11.18 ? 372 TYR A CZ    1 
ATOM   2862 O  OH    . TYR A 1 372 ? 3.732   52.137 66.040 1.00 8.60  ? 372 TYR A OH    1 
ATOM   2863 N  N     . GLU A 1 373 ? 8.051   45.456 68.597 1.00 18.04 ? 373 GLU A N     1 
ATOM   2864 C  CA    . GLU A 1 373 ? 9.226   44.605 68.615 1.00 18.00 ? 373 GLU A CA    1 
ATOM   2865 C  C     . GLU A 1 373 ? 10.000  45.349 67.530 1.00 18.99 ? 373 GLU A C     1 
ATOM   2866 O  O     . GLU A 1 373 ? 9.504   45.507 66.415 1.00 19.58 ? 373 GLU A O     1 
ATOM   2867 C  CB    . GLU A 1 373 ? 8.932   43.202 68.109 1.00 18.41 ? 373 GLU A CB    1 
ATOM   2868 C  CG    . GLU A 1 373 ? 8.631   42.212 69.191 1.00 18.45 ? 373 GLU A CG    1 
ATOM   2869 C  CD    . GLU A 1 373 ? 8.595   40.796 68.688 1.00 18.33 ? 373 GLU A CD    1 
ATOM   2870 O  OE1   . GLU A 1 373 ? 9.272   40.485 67.685 1.00 19.66 ? 373 GLU A OE1   1 
ATOM   2871 O  OE2   . GLU A 1 373 ? 7.893   39.973 69.299 1.00 19.07 ? 373 GLU A OE2   1 
ATOM   2872 N  N     . THR A 1 374 ? 11.191  45.823 67.860 1.00 19.61 ? 374 THR A N     1 
ATOM   2873 C  CA    . THR A 1 374 ? 12.016  46.573 66.939 1.00 19.58 ? 374 THR A CA    1 
ATOM   2874 C  C     . THR A 1 374 ? 13.092  45.641 66.421 1.00 20.13 ? 374 THR A C     1 
ATOM   2875 O  O     . THR A 1 374 ? 13.831  45.085 67.207 1.00 21.91 ? 374 THR A O     1 
ATOM   2876 C  CB    . THR A 1 374 ? 12.650  47.738 67.696 1.00 20.15 ? 374 THR A CB    1 
ATOM   2877 O  OG1   . THR A 1 374 ? 11.627  48.425 68.441 1.00 20.57 ? 374 THR A OG1   1 
ATOM   2878 C  CG2   . THR A 1 374 ? 13.273  48.728 66.733 1.00 22.01 ? 374 THR A CG2   1 
ATOM   2879 N  N     . MET A 1 375 ? 13.179  45.442 65.109 1.00 19.89 ? 375 MET A N     1 
ATOM   2880 C  CA    . MET A 1 375 ? 14.193  44.554 64.538 1.00 18.26 ? 375 MET A CA    1 
ATOM   2881 C  C     . MET A 1 375 ? 15.158  45.346 63.654 1.00 17.50 ? 375 MET A C     1 
ATOM   2882 O  O     . MET A 1 375 ? 14.876  46.481 63.239 1.00 17.02 ? 375 MET A O     1 
ATOM   2883 C  CB    . MET A 1 375 ? 13.538  43.487 63.665 1.00 19.83 ? 375 MET A CB    1 
ATOM   2884 C  CG    . MET A 1 375 ? 12.369  42.762 64.277 1.00 22.09 ? 375 MET A CG    1 
ATOM   2885 S  SD    . MET A 1 375 ? 12.113  41.230 63.395 1.00 24.20 ? 375 MET A SD    1 
ATOM   2886 C  CE    . MET A 1 375 ? 10.724  41.673 62.439 1.00 25.30 ? 375 MET A CE    1 
ATOM   2887 N  N     . PRO A 1 376 ? 16.317  44.762 63.355 1.00 16.62 ? 376 PRO A N     1 
ATOM   2888 C  CA    . PRO A 1 376 ? 17.278  45.465 62.503 1.00 16.99 ? 376 PRO A CA    1 
ATOM   2889 C  C     . PRO A 1 376 ? 16.729  45.613 61.073 1.00 18.76 ? 376 PRO A C     1 
ATOM   2890 O  O     . PRO A 1 376 ? 16.015  44.727 60.568 1.00 18.28 ? 376 PRO A O     1 
ATOM   2891 C  CB    . PRO A 1 376 ? 18.484  44.522 62.497 1.00 15.19 ? 376 PRO A CB    1 
ATOM   2892 C  CG    . PRO A 1 376 ? 18.345  43.752 63.778 1.00 15.34 ? 376 PRO A CG    1 
ATOM   2893 C  CD    . PRO A 1 376 ? 16.878  43.500 63.874 1.00 15.75 ? 376 PRO A CD    1 
ATOM   2894 N  N     . GLY A 1 377 ? 17.052  46.731 60.429 1.00 20.06 ? 377 GLY A N     1 
ATOM   2895 C  CA    . GLY A 1 377 ? 16.615  46.940 59.062 1.00 21.99 ? 377 GLY A CA    1 
ATOM   2896 C  C     . GLY A 1 377 ? 17.695  46.337 58.194 1.00 23.35 ? 377 GLY A C     1 
ATOM   2897 O  O     . GLY A 1 377 ? 18.471  45.519 58.710 1.00 23.44 ? 377 GLY A O     1 
ATOM   2898 N  N     . TRP A 1 378 ? 17.773  46.738 56.919 1.00 24.01 ? 378 TRP A N     1 
ATOM   2899 C  CA    . TRP A 1 378 ? 18.785  46.222 55.969 1.00 25.65 ? 378 TRP A CA    1 
ATOM   2900 C  C     . TRP A 1 378 ? 19.109  47.282 54.919 1.00 25.92 ? 378 TRP A C     1 
ATOM   2901 O  O     . TRP A 1 378 ? 18.207  47.973 54.422 1.00 25.78 ? 378 TRP A O     1 
ATOM   2902 C  CB    . TRP A 1 378 ? 18.312  44.929 55.292 1.00 26.85 ? 378 TRP A CB    1 
ATOM   2903 C  CG    . TRP A 1 378 ? 16.896  44.996 54.797 1.00 29.37 ? 378 TRP A CG    1 
ATOM   2904 C  CD1   . TRP A 1 378 ? 16.480  45.410 53.559 1.00 30.23 ? 378 TRP A CD1   1 
ATOM   2905 C  CD2   . TRP A 1 378 ? 15.701  44.634 55.522 1.00 29.69 ? 378 TRP A CD2   1 
ATOM   2906 N  NE1   . TRP A 1 378 ? 15.105  45.322 53.462 1.00 31.24 ? 378 TRP A NE1   1 
ATOM   2907 C  CE2   . TRP A 1 378 ? 14.600  44.849 54.644 1.00 30.33 ? 378 TRP A CE2   1 
ATOM   2908 C  CE3   . TRP A 1 378 ? 15.455  44.147 56.813 1.00 29.15 ? 378 TRP A CE3   1 
ATOM   2909 C  CZ2   . TRP A 1 378 ? 13.274  44.588 55.024 1.00 29.57 ? 378 TRP A CZ2   1 
ATOM   2910 C  CZ3   . TRP A 1 378 ? 14.132  43.886 57.189 1.00 29.02 ? 378 TRP A CZ3   1 
ATOM   2911 C  CH2   . TRP A 1 378 ? 13.062  44.109 56.297 1.00 28.95 ? 378 TRP A CH2   1 
ATOM   2912 N  N     . SER A 1 379 ? 20.395  47.456 54.621 1.00 26.01 ? 379 SER A N     1 
ATOM   2913 C  CA    . SER A 1 379 ? 20.797  48.470 53.656 1.00 25.58 ? 379 SER A CA    1 
ATOM   2914 C  C     . SER A 1 379 ? 20.814  47.956 52.222 1.00 25.68 ? 379 SER A C     1 
ATOM   2915 O  O     . SER A 1 379 ? 20.659  48.731 51.277 1.00 26.14 ? 379 SER A O     1 
ATOM   2916 C  CB    . SER A 1 379 ? 22.132  49.150 54.052 1.00 26.06 ? 379 SER A CB    1 
ATOM   2917 O  OG    . SER A 1 379 ? 23.192  48.236 54.316 1.00 24.99 ? 379 SER A OG    1 
ATOM   2918 N  N     . GLU A 1 380 ? 20.981  46.653 52.055 1.00 25.60 ? 380 GLU A N     1 
ATOM   2919 C  CA    . GLU A 1 380 ? 20.979  46.054 50.730 1.00 26.10 ? 380 GLU A CA    1 
ATOM   2920 C  C     . GLU A 1 380 ? 19.655  46.334 49.979 1.00 26.00 ? 380 GLU A C     1 
ATOM   2921 O  O     . GLU A 1 380 ? 18.571  46.403 50.558 1.00 25.04 ? 380 GLU A O     1 
ATOM   2922 C  CB    . GLU A 1 380 ? 21.193  44.528 50.824 1.00 27.62 ? 380 GLU A CB    1 
ATOM   2923 C  CG    . GLU A 1 380 ? 22.492  44.069 51.475 1.00 27.56 ? 380 GLU A CG    1 
ATOM   2924 C  CD    . GLU A 1 380 ? 22.414  44.023 52.992 1.00 29.45 ? 380 GLU A CD    1 
ATOM   2925 O  OE1   . GLU A 1 380 ? 23.110  43.153 53.584 1.00 29.67 ? 380 GLU A OE1   1 
ATOM   2926 O  OE2   . GLU A 1 380 ? 21.669  44.848 53.598 1.00 29.50 ? 380 GLU A OE2   1 
ATOM   2927 N  N     . SER A 1 381 ? 19.761  46.502 48.674 1.00 26.37 ? 381 SER A N     1 
ATOM   2928 C  CA    . SER A 1 381 ? 18.593  46.751 47.846 1.00 26.16 ? 381 SER A CA    1 
ATOM   2929 C  C     . SER A 1 381 ? 17.954  45.388 47.638 1.00 26.77 ? 381 SER A C     1 
ATOM   2930 O  O     . SER A 1 381 ? 18.643  44.453 47.216 1.00 27.53 ? 381 SER A O     1 
ATOM   2931 C  CB    . SER A 1 381 ? 19.040  47.300 46.503 1.00 24.85 ? 381 SER A CB    1 
ATOM   2932 O  OG    . SER A 1 381 ? 17.938  47.562 45.686 1.00 25.79 ? 381 SER A OG    1 
ATOM   2933 N  N     . THR A 1 382 ? 16.669  45.243 47.958 1.00 26.30 ? 382 THR A N     1 
ATOM   2934 C  CA    . THR A 1 382 ? 16.002  43.959 47.763 1.00 25.52 ? 382 THR A CA    1 
ATOM   2935 C  C     . THR A 1 382 ? 15.067  44.027 46.551 1.00 25.43 ? 382 THR A C     1 
ATOM   2936 O  O     . THR A 1 382 ? 14.452  43.026 46.134 1.00 24.36 ? 382 THR A O     1 
ATOM   2937 C  CB    . THR A 1 382 ? 15.251  43.537 49.029 1.00 25.94 ? 382 THR A CB    1 
ATOM   2938 O  OG1   . THR A 1 382 ? 14.251  44.507 49.347 1.00 26.69 ? 382 THR A OG1   1 
ATOM   2939 C  CG2   . THR A 1 382 ? 16.213  43.422 50.203 1.00 25.61 ? 382 THR A CG2   1 
ATOM   2940 N  N     . PHE A 1 383 ? 15.009  45.220 45.956 1.00 25.80 ? 383 PHE A N     1 
ATOM   2941 C  CA    . PHE A 1 383 ? 14.187  45.491 44.785 1.00 25.57 ? 383 PHE A CA    1 
ATOM   2942 C  C     . PHE A 1 383 ? 14.389  44.531 43.610 1.00 25.37 ? 383 PHE A C     1 
ATOM   2943 O  O     . PHE A 1 383 ? 15.517  44.322 43.154 1.00 26.33 ? 383 PHE A O     1 
ATOM   2944 C  CB    . PHE A 1 383 ? 14.451  46.894 44.293 1.00 26.13 ? 383 PHE A CB    1 
ATOM   2945 C  CG    . PHE A 1 383 ? 13.604  47.280 43.118 1.00 28.08 ? 383 PHE A CG    1 
ATOM   2946 C  CD1   . PHE A 1 383 ? 12.340  47.842 43.309 1.00 27.24 ? 383 PHE A CD1   1 
ATOM   2947 C  CD2   . PHE A 1 383 ? 14.062  47.075 41.816 1.00 28.00 ? 383 PHE A CD2   1 
ATOM   2948 C  CE1   . PHE A 1 383 ? 11.544  48.193 42.233 1.00 26.32 ? 383 PHE A CE1   1 
ATOM   2949 C  CE2   . PHE A 1 383 ? 13.267  47.426 40.733 1.00 28.04 ? 383 PHE A CE2   1 
ATOM   2950 C  CZ    . PHE A 1 383 ? 12.006  47.987 40.947 1.00 27.35 ? 383 PHE A CZ    1 
ATOM   2951 N  N     . GLY A 1 384 ? 13.287  43.987 43.095 1.00 24.98 ? 384 GLY A N     1 
ATOM   2952 C  CA    . GLY A 1 384 ? 13.351  43.075 41.971 1.00 23.05 ? 384 GLY A CA    1 
ATOM   2953 C  C     . GLY A 1 384 ? 13.965  41.722 42.247 1.00 22.06 ? 384 GLY A C     1 
ATOM   2954 O  O     . GLY A 1 384 ? 14.074  40.916 41.338 1.00 21.76 ? 384 GLY A O     1 
ATOM   2955 N  N     . VAL A 1 385 ? 14.376  41.458 43.479 1.00 22.38 ? 385 VAL A N     1 
ATOM   2956 C  CA    . VAL A 1 385 ? 14.965  40.151 43.815 1.00 22.31 ? 385 VAL A CA    1 
ATOM   2957 C  C     . VAL A 1 385 ? 13.883  39.093 43.603 1.00 23.19 ? 385 VAL A C     1 
ATOM   2958 O  O     . VAL A 1 385 ? 12.723  39.350 43.944 1.00 22.62 ? 385 VAL A O     1 
ATOM   2959 C  CB    . VAL A 1 385 ? 15.469  40.135 45.295 1.00 20.63 ? 385 VAL A CB    1 
ATOM   2960 C  CG1   . VAL A 1 385 ? 15.890  38.742 45.728 1.00 19.62 ? 385 VAL A CG1   1 
ATOM   2961 C  CG2   . VAL A 1 385 ? 16.634  41.076 45.444 1.00 19.21 ? 385 VAL A CG2   1 
ATOM   2962 N  N     . LYS A 1 386 ? 14.220  37.960 42.978 1.00 24.47 ? 386 LYS A N     1 
ATOM   2963 C  CA    . LYS A 1 386 ? 13.225  36.900 42.768 1.00 27.45 ? 386 LYS A CA    1 
ATOM   2964 C  C     . LYS A 1 386 ? 13.643  35.626 43.500 1.00 29.36 ? 386 LYS A C     1 
ATOM   2965 O  O     . LYS A 1 386 ? 13.066  34.561 43.309 1.00 29.63 ? 386 LYS A O     1 
ATOM   2966 C  CB    . LYS A 1 386 ? 12.999  36.523 41.282 1.00 27.79 ? 386 LYS A CB    1 
ATOM   2967 C  CG    . LYS A 1 386 ? 13.442  37.448 40.175 1.00 27.32 ? 386 LYS A CG    1 
ATOM   2968 C  CD    . LYS A 1 386 ? 12.639  38.703 40.078 1.00 28.18 ? 386 LYS A CD    1 
ATOM   2969 C  CE    . LYS A 1 386 ? 13.131  39.510 38.872 1.00 30.47 ? 386 LYS A CE    1 
ATOM   2970 N  NZ    . LYS A 1 386 ? 12.832  40.971 38.947 1.00 31.22 ? 386 LYS A NZ    1 
ATOM   2971 N  N     . ASP A 1 387 ? 14.632  35.727 44.363 1.00 32.34 ? 387 ASP A N     1 
ATOM   2972 C  CA    . ASP A 1 387 ? 15.110  34.547 45.065 1.00 34.75 ? 387 ASP A CA    1 
ATOM   2973 C  C     . ASP A 1 387 ? 15.328  34.943 46.518 1.00 35.16 ? 387 ASP A C     1 
ATOM   2974 O  O     . ASP A 1 387 ? 15.826  36.042 46.792 1.00 35.09 ? 387 ASP A O     1 
ATOM   2975 C  CB    . ASP A 1 387 ? 16.446  34.126 44.441 1.00 37.50 ? 387 ASP A CB    1 
ATOM   2976 C  CG    . ASP A 1 387 ? 16.677  32.640 44.499 1.00 40.63 ? 387 ASP A CG    1 
ATOM   2977 O  OD1   . ASP A 1 387 ? 15.762  31.877 44.121 1.00 42.05 ? 387 ASP A OD1   1 
ATOM   2978 O  OD2   . ASP A 1 387 ? 17.791  32.226 44.909 1.00 43.55 ? 387 ASP A OD2   1 
ATOM   2979 N  N     . ARG A 1 388 ? 14.937  34.079 47.449 1.00 35.01 ? 388 ARG A N     1 
ATOM   2980 C  CA    . ARG A 1 388 ? 15.137  34.376 48.851 1.00 34.58 ? 388 ARG A CA    1 
ATOM   2981 C  C     . ARG A 1 388 ? 16.648  34.558 49.012 1.00 34.14 ? 388 ARG A C     1 
ATOM   2982 O  O     . ARG A 1 388 ? 17.096  35.485 49.676 1.00 35.76 ? 388 ARG A O     1 
ATOM   2983 C  CB    . ARG A 1 388 ? 14.624  33.243 49.741 1.00 35.83 ? 388 ARG A CB    1 
ATOM   2984 C  CG    . ARG A 1 388 ? 13.134  33.004 49.680 1.00 38.34 ? 388 ARG A CG    1 
ATOM   2985 C  CD    . ARG A 1 388 ? 12.732  31.759 50.472 1.00 41.12 ? 388 ARG A CD    1 
ATOM   2986 N  NE    . ARG A 1 388 ? 12.519  32.067 51.882 1.00 46.06 ? 388 ARG A NE    1 
ATOM   2987 C  CZ    . ARG A 1 388 ? 11.415  31.668 52.526 1.00 48.84 ? 388 ARG A CZ    1 
ATOM   2988 N  NH1   . ARG A 1 388 ? 10.478  30.958 51.898 1.00 49.95 ? 388 ARG A NH1   1 
ATOM   2989 N  NH2   . ARG A 1 388 ? 11.217  32.018 53.796 1.00 49.47 ? 388 ARG A NH2   1 
ATOM   2990 N  N     . SER A 1 389 ? 17.442  33.706 48.380 1.00 32.78 ? 389 SER A N     1 
ATOM   2991 C  CA    . SER A 1 389 ? 18.889  33.842 48.464 1.00 31.80 ? 389 SER A CA    1 
ATOM   2992 C  C     . SER A 1 389 ? 19.315  35.292 48.328 1.00 30.71 ? 389 SER A C     1 
ATOM   2993 O  O     . SER A 1 389 ? 20.271  35.725 48.963 1.00 32.44 ? 389 SER A O     1 
ATOM   2994 C  CB    . SER A 1 389 ? 19.563  33.060 47.344 1.00 32.68 ? 389 SER A CB    1 
ATOM   2995 O  OG    . SER A 1 389 ? 19.259  31.679 47.427 1.00 35.66 ? 389 SER A OG    1 
ATOM   2996 N  N     . GLY A 1 390 ? 18.617  36.048 47.495 1.00 28.88 ? 390 GLY A N     1 
ATOM   2997 C  CA    . GLY A 1 390 ? 18.992  37.434 47.293 1.00 27.32 ? 390 GLY A CA    1 
ATOM   2998 C  C     . GLY A 1 390 ? 18.494  38.416 48.320 1.00 26.28 ? 390 GLY A C     1 
ATOM   2999 O  O     . GLY A 1 390 ? 18.596  39.625 48.137 1.00 26.08 ? 390 GLY A O     1 
ATOM   3000 N  N     . LEU A 1 391 ? 17.925  37.916 49.397 1.00 25.76 ? 391 LEU A N     1 
ATOM   3001 C  CA    . LEU A 1 391 ? 17.439  38.791 50.442 1.00 26.13 ? 391 LEU A CA    1 
ATOM   3002 C  C     . LEU A 1 391 ? 18.427  38.708 51.599 1.00 26.04 ? 391 LEU A C     1 
ATOM   3003 O  O     . LEU A 1 391 ? 19.004  37.649 51.840 1.00 26.66 ? 391 LEU A O     1 
ATOM   3004 C  CB    . LEU A 1 391 ? 16.076  38.302 50.917 1.00 25.69 ? 391 LEU A CB    1 
ATOM   3005 C  CG    . LEU A 1 391 ? 14.997  38.144 49.851 1.00 25.33 ? 391 LEU A CG    1 
ATOM   3006 C  CD1   . LEU A 1 391 ? 13.780  37.491 50.477 1.00 25.32 ? 391 LEU A CD1   1 
ATOM   3007 C  CD2   . LEU A 1 391 ? 14.647  39.486 49.253 1.00 23.78 ? 391 LEU A CD2   1 
ATOM   3008 N  N     . PRO A 1 392 ? 18.698  39.833 52.276 1.00 26.11 ? 392 PRO A N     1 
ATOM   3009 C  CA    . PRO A 1 392 ? 19.629  39.790 53.409 1.00 26.40 ? 392 PRO A CA    1 
ATOM   3010 C  C     . PRO A 1 392 ? 18.949  39.141 54.615 1.00 27.10 ? 392 PRO A C     1 
ATOM   3011 O  O     . PRO A 1 392 ? 17.728  39.135 54.717 1.00 28.09 ? 392 PRO A O     1 
ATOM   3012 C  CB    . PRO A 1 392 ? 19.942  41.271 53.655 1.00 26.46 ? 392 PRO A CB    1 
ATOM   3013 C  CG    . PRO A 1 392 ? 18.747  41.998 53.134 1.00 26.18 ? 392 PRO A CG    1 
ATOM   3014 C  CD    . PRO A 1 392 ? 18.433  41.225 51.863 1.00 26.39 ? 392 PRO A CD    1 
ATOM   3015 N  N     . GLN A 1 393 ? 19.735  38.604 55.537 1.00 28.28 ? 393 GLN A N     1 
ATOM   3016 C  CA    . GLN A 1 393 ? 19.212  37.933 56.738 1.00 28.68 ? 393 GLN A CA    1 
ATOM   3017 C  C     . GLN A 1 393 ? 18.241  38.778 57.583 1.00 28.94 ? 393 GLN A C     1 
ATOM   3018 O  O     . GLN A 1 393 ? 17.312  38.258 58.227 1.00 29.43 ? 393 GLN A O     1 
ATOM   3019 C  CB    . GLN A 1 393 ? 20.370  37.462 57.615 1.00 27.96 ? 393 GLN A CB    1 
ATOM   3020 C  CG    . GLN A 1 393 ? 19.971  36.430 58.638 1.00 29.03 ? 393 GLN A CG    1 
ATOM   3021 C  CD    . GLN A 1 393 ? 19.425  35.156 58.023 1.00 30.68 ? 393 GLN A CD    1 
ATOM   3022 O  OE1   . GLN A 1 393 ? 18.473  34.570 58.552 1.00 30.72 ? 393 GLN A OE1   1 
ATOM   3023 N  NE2   . GLN A 1 393 ? 20.026  34.705 56.904 1.00 30.83 ? 393 GLN A NE2   1 
ATOM   3024 N  N     . ALA A 1 394 ? 18.462  40.079 57.600 1.00 28.35 ? 394 ALA A N     1 
ATOM   3025 C  CA    . ALA A 1 394 ? 17.584  40.943 58.353 1.00 27.99 ? 394 ALA A CA    1 
ATOM   3026 C  C     . ALA A 1 394 ? 16.186  40.837 57.716 1.00 27.92 ? 394 ALA A C     1 
ATOM   3027 O  O     . ALA A 1 394 ? 15.179  40.724 58.427 1.00 28.34 ? 394 ALA A O     1 
ATOM   3028 C  CB    . ALA A 1 394 ? 18.103  42.371 58.325 1.00 27.70 ? 394 ALA A CB    1 
ATOM   3029 N  N     . ALA A 1 395 ? 16.141  40.826 56.380 1.00 27.07 ? 395 ALA A N     1 
ATOM   3030 C  CA    . ALA A 1 395 ? 14.884  40.716 55.623 1.00 25.90 ? 395 ALA A CA    1 
ATOM   3031 C  C     . ALA A 1 395 ? 14.215  39.350 55.850 1.00 25.01 ? 395 ALA A C     1 
ATOM   3032 O  O     . ALA A 1 395 ? 12.998  39.258 56.051 1.00 24.21 ? 395 ALA A O     1 
ATOM   3033 C  CB    . ALA A 1 395 ? 15.140  40.946 54.139 1.00 25.09 ? 395 ALA A CB    1 
ATOM   3034 N  N     . LEU A 1 396 ? 15.013  38.291 55.815 1.00 24.31 ? 396 LEU A N     1 
ATOM   3035 C  CA    . LEU A 1 396 ? 14.473  36.961 56.056 1.00 24.45 ? 396 LEU A CA    1 
ATOM   3036 C  C     . LEU A 1 396 ? 13.952  36.843 57.499 1.00 24.65 ? 396 LEU A C     1 
ATOM   3037 O  O     . LEU A 1 396 ? 12.919  36.189 57.748 1.00 24.72 ? 396 LEU A O     1 
ATOM   3038 C  CB    . LEU A 1 396 ? 15.537  35.889 55.807 1.00 23.19 ? 396 LEU A CB    1 
ATOM   3039 C  CG    . LEU A 1 396 ? 16.028  35.724 54.370 1.00 23.27 ? 396 LEU A CG    1 
ATOM   3040 C  CD1   . LEU A 1 396 ? 17.200  34.757 54.362 1.00 22.26 ? 396 LEU A CD1   1 
ATOM   3041 C  CD2   . LEU A 1 396 ? 14.901  35.213 53.453 1.00 23.21 ? 396 LEU A CD2   1 
ATOM   3042 N  N     . ASN A 1 397 ? 14.669  37.450 58.452 1.00 24.26 ? 397 ASN A N     1 
ATOM   3043 C  CA    . ASN A 1 397 ? 14.257  37.381 59.861 1.00 23.98 ? 397 ASN A CA    1 
ATOM   3044 C  C     . ASN A 1 397 ? 12.902  38.061 60.021 1.00 23.28 ? 397 ASN A C     1 
ATOM   3045 O  O     . ASN A 1 397 ? 11.954  37.498 60.584 1.00 23.40 ? 397 ASN A O     1 
ATOM   3046 C  CB    . ASN A 1 397 ? 15.305  38.021 60.796 1.00 24.64 ? 397 ASN A CB    1 
ATOM   3047 C  CG    . ASN A 1 397 ? 16.650  37.249 60.832 1.00 24.44 ? 397 ASN A CG    1 
ATOM   3048 O  OD1   . ASN A 1 397 ? 17.649  37.774 61.334 1.00 24.45 ? 397 ASN A OD1   1 
ATOM   3049 N  ND2   . ASN A 1 397 ? 16.664  36.015 60.346 1.00 23.20 ? 397 ASN A ND2   1 
ATOM   3050 N  N     . TYR A 1 398 ? 12.810  39.272 59.500 1.00 21.75 ? 398 TYR A N     1 
ATOM   3051 C  CA    . TYR A 1 398 ? 11.575  40.007 59.552 1.00 21.36 ? 398 TYR A CA    1 
ATOM   3052 C  C     . TYR A 1 398 ? 10.474  39.055 59.033 1.00 21.45 ? 398 TYR A C     1 
ATOM   3053 O  O     . TYR A 1 398 ? 9.395   38.927 59.634 1.00 20.58 ? 398 TYR A O     1 
ATOM   3054 C  CB    . TYR A 1 398 ? 11.737  41.244 58.669 1.00 20.78 ? 398 TYR A CB    1 
ATOM   3055 C  CG    . TYR A 1 398 ? 10.524  42.135 58.549 1.00 20.19 ? 398 TYR A CG    1 
ATOM   3056 C  CD1   . TYR A 1 398 ? 10.129  42.938 59.610 1.00 19.02 ? 398 TYR A CD1   1 
ATOM   3057 C  CD2   . TYR A 1 398 ? 9.798   42.212 57.341 1.00 19.06 ? 398 TYR A CD2   1 
ATOM   3058 C  CE1   . TYR A 1 398 ? 9.054   43.800 59.479 1.00 19.46 ? 398 TYR A CE1   1 
ATOM   3059 C  CE2   . TYR A 1 398 ? 8.717   43.069 57.207 1.00 17.89 ? 398 TYR A CE2   1 
ATOM   3060 C  CZ    . TYR A 1 398 ? 8.351   43.861 58.278 1.00 17.24 ? 398 TYR A CZ    1 
ATOM   3061 O  OH    . TYR A 1 398 ? 7.303   44.738 58.188 1.00 16.26 ? 398 TYR A OH    1 
ATOM   3062 N  N     . ILE A 1 399 ? 10.768  38.355 57.938 1.00 21.80 ? 399 ILE A N     1 
ATOM   3063 C  CA    . ILE A 1 399 ? 9.808   37.419 57.366 1.00 22.52 ? 399 ILE A CA    1 
ATOM   3064 C  C     . ILE A 1 399 ? 9.433   36.282 58.333 1.00 23.23 ? 399 ILE A C     1 
ATOM   3065 O  O     . ILE A 1 399 ? 8.232   36.080 58.593 1.00 24.16 ? 399 ILE A O     1 
ATOM   3066 C  CB    . ILE A 1 399 ? 10.291  36.852 56.010 1.00 22.55 ? 399 ILE A CB    1 
ATOM   3067 C  CG1   . ILE A 1 399 ? 10.317  37.963 54.950 1.00 21.82 ? 399 ILE A CG1   1 
ATOM   3068 C  CG2   . ILE A 1 399 ? 9.408   35.682 55.575 1.00 21.51 ? 399 ILE A CG2   1 
ATOM   3069 C  CD1   . ILE A 1 399 ? 11.084  37.568 53.685 1.00 22.06 ? 399 ILE A CD1   1 
ATOM   3070 N  N     . LYS A 1 400 ? 10.431  35.559 58.866 1.00 22.58 ? 400 LYS A N     1 
ATOM   3071 C  CA    . LYS A 1 400 ? 10.166  34.455 59.810 1.00 21.57 ? 400 LYS A CA    1 
ATOM   3072 C  C     . LYS A 1 400 ? 9.395   34.996 60.989 1.00 20.64 ? 400 LYS A C     1 
ATOM   3073 O  O     . LYS A 1 400 ? 8.431   34.389 61.431 1.00 20.43 ? 400 LYS A O     1 
ATOM   3074 C  CB    . LYS A 1 400 ? 11.474  33.792 60.308 1.00 21.49 ? 400 LYS A CB    1 
ATOM   3075 C  CG    . LYS A 1 400 ? 11.361  32.442 61.107 1.00 21.53 ? 400 LYS A CG    1 
ATOM   3076 C  CD    . LYS A 1 400 ? 9.962   31.760 61.131 1.00 23.28 ? 400 LYS A CD    1 
ATOM   3077 C  CE    . LYS A 1 400 ? 9.777   30.697 60.028 1.00 25.70 ? 400 LYS A CE    1 
ATOM   3078 N  NZ    . LYS A 1 400 ? 8.384   30.598 59.372 1.00 25.64 ? 400 LYS A NZ    1 
ATOM   3079 N  N     . ARG A 1 401 ? 9.802   36.158 61.480 1.00 20.71 ? 401 ARG A N     1 
ATOM   3080 C  CA    . ARG A 1 401 ? 9.123   36.759 62.624 1.00 21.17 ? 401 ARG A CA    1 
ATOM   3081 C  C     . ARG A 1 401 ? 7.621   36.884 62.363 1.00 20.95 ? 401 ARG A C     1 
ATOM   3082 O  O     . ARG A 1 401 ? 6.822   36.372 63.152 1.00 22.38 ? 401 ARG A O     1 
ATOM   3083 C  CB    . ARG A 1 401 ? 9.733   38.116 62.991 1.00 20.01 ? 401 ARG A CB    1 
ATOM   3084 C  CG    . ARG A 1 401 ? 9.291   38.615 64.334 1.00 20.92 ? 401 ARG A CG    1 
ATOM   3085 C  CD    . ARG A 1 401 ? 9.696   37.657 65.473 1.00 21.24 ? 401 ARG A CD    1 
ATOM   3086 N  NE    . ARG A 1 401 ? 9.041   38.028 66.731 1.00 19.10 ? 401 ARG A NE    1 
ATOM   3087 C  CZ    . ARG A 1 401 ? 8.402   37.117 67.458 1.00 18.37 ? 401 ARG A CZ    1 
ATOM   3088 N  NH1   . ARG A 1 401 ? 8.384   35.845 67.064 1.00 17.10 ? 401 ARG A NH1   1 
ATOM   3089 N  NH2   . ARG A 1 401 ? 7.667   37.500 68.502 1.00 17.09 ? 401 ARG A NH2   1 
ATOM   3090 N  N     . ILE A 1 402 ? 7.241   37.525 61.252 1.00 19.69 ? 402 ILE A N     1 
ATOM   3091 C  CA    . ILE A 1 402 ? 5.825   37.686 60.887 1.00 17.52 ? 402 ILE A CA    1 
ATOM   3092 C  C     . ILE A 1 402 ? 5.082   36.332 60.854 1.00 17.64 ? 402 ILE A C     1 
ATOM   3093 O  O     . ILE A 1 402 ? 3.938   36.198 61.345 1.00 16.82 ? 402 ILE A O     1 
ATOM   3094 C  CB    . ILE A 1 402 ? 5.706   38.389 59.512 1.00 16.79 ? 402 ILE A CB    1 
ATOM   3095 C  CG1   . ILE A 1 402 ? 6.331   39.794 59.601 1.00 12.90 ? 402 ILE A CG1   1 
ATOM   3096 C  CG2   . ILE A 1 402 ? 4.219   38.411 59.019 1.00 15.68 ? 402 ILE A CG2   1 
ATOM   3097 C  CD1   . ILE A 1 402 ? 6.567   40.439 58.300 1.00 11.86 ? 402 ILE A CD1   1 
ATOM   3098 N  N     . GLU A 1 403 ? 5.711   35.322 60.273 1.00 16.55 ? 403 GLU A N     1 
ATOM   3099 C  CA    . GLU A 1 403 ? 5.072   34.036 60.240 1.00 17.07 ? 403 GLU A CA    1 
ATOM   3100 C  C     . GLU A 1 403 ? 4.876   33.576 61.702 1.00 17.92 ? 403 GLU A C     1 
ATOM   3101 O  O     . GLU A 1 403 ? 3.774   33.161 62.116 1.00 17.63 ? 403 GLU A O     1 
ATOM   3102 C  CB    . GLU A 1 403 ? 5.918   33.069 59.431 1.00 17.64 ? 403 GLU A CB    1 
ATOM   3103 C  CG    . GLU A 1 403 ? 6.177   33.548 57.970 1.00 18.70 ? 403 GLU A CG    1 
ATOM   3104 C  CD    . GLU A 1 403 ? 7.113   32.620 57.189 1.00 18.93 ? 403 GLU A CD    1 
ATOM   3105 O  OE1   . GLU A 1 403 ? 8.208   32.310 57.714 1.00 19.63 ? 403 GLU A OE1   1 
ATOM   3106 O  OE2   . GLU A 1 403 ? 6.759   32.184 56.070 1.00 17.36 ? 403 GLU A OE2   1 
ATOM   3107 N  N     . GLU A 1 404 ? 5.932   33.689 62.498 1.00 18.70 ? 404 GLU A N     1 
ATOM   3108 C  CA    . GLU A 1 404 ? 5.867   33.307 63.907 1.00 19.03 ? 404 GLU A CA    1 
ATOM   3109 C  C     . GLU A 1 404 ? 4.682   33.973 64.597 1.00 18.53 ? 404 GLU A C     1 
ATOM   3110 O  O     . GLU A 1 404 ? 3.808   33.298 65.143 1.00 18.22 ? 404 GLU A O     1 
ATOM   3111 C  CB    . GLU A 1 404 ? 7.162   33.694 64.628 1.00 19.56 ? 404 GLU A CB    1 
ATOM   3112 C  CG    . GLU A 1 404 ? 8.335   32.838 64.200 1.00 20.90 ? 404 GLU A CG    1 
ATOM   3113 C  CD    . GLU A 1 404 ? 9.647   33.248 64.806 1.00 21.84 ? 404 GLU A CD    1 
ATOM   3114 O  OE1   . GLU A 1 404 ? 9.776   34.395 65.313 1.00 23.07 ? 404 GLU A OE1   1 
ATOM   3115 O  OE2   . GLU A 1 404 ? 10.561  32.407 64.759 1.00 23.24 ? 404 GLU A OE2   1 
ATOM   3116 N  N     . LEU A 1 405 ? 4.655   35.295 64.565 1.00 17.30 ? 405 LEU A N     1 
ATOM   3117 C  CA    . LEU A 1 405 ? 3.584   36.041 65.187 1.00 17.92 ? 405 LEU A CA    1 
ATOM   3118 C  C     . LEU A 1 405 ? 2.146   35.723 64.708 1.00 18.36 ? 405 LEU A C     1 
ATOM   3119 O  O     . LEU A 1 405 ? 1.174   35.827 65.486 1.00 18.64 ? 405 LEU A O     1 
ATOM   3120 C  CB    . LEU A 1 405 ? 3.859   37.526 65.015 1.00 17.70 ? 405 LEU A CB    1 
ATOM   3121 C  CG    . LEU A 1 405 ? 4.968   38.081 65.903 1.00 19.31 ? 405 LEU A CG    1 
ATOM   3122 C  CD1   . LEU A 1 405 ? 5.267   39.504 65.492 1.00 18.14 ? 405 LEU A CD1   1 
ATOM   3123 C  CD2   . LEU A 1 405 ? 4.537   38.038 67.367 1.00 19.08 ? 405 LEU A CD2   1 
ATOM   3124 N  N     . THR A 1 406 ? 2.007   35.356 63.438 1.00 18.30 ? 406 THR A N     1 
ATOM   3125 C  CA    . THR A 1 406 ? 0.694   35.086 62.858 1.00 17.87 ? 406 THR A CA    1 
ATOM   3126 C  C     . THR A 1 406 ? 0.309   33.629 62.763 1.00 17.47 ? 406 THR A C     1 
ATOM   3127 O  O     . THR A 1 406 ? -0.889  33.287 62.856 1.00 18.00 ? 406 THR A O     1 
ATOM   3128 C  CB    . THR A 1 406 ? 0.581   35.672 61.439 1.00 18.01 ? 406 THR A CB    1 
ATOM   3129 O  OG1   . THR A 1 406 ? 1.648   35.151 60.627 1.00 19.50 ? 406 THR A OG1   1 
ATOM   3130 C  CG2   . THR A 1 406 ? 0.644   37.198 61.485 1.00 16.76 ? 406 THR A CG2   1 
ATOM   3131 N  N     . GLY A 1 407 ? 1.296   32.770 62.547 1.00 15.79 ? 407 GLY A N     1 
ATOM   3132 C  CA    . GLY A 1 407 ? 0.985   31.360 62.428 1.00 15.17 ? 407 GLY A CA    1 
ATOM   3133 C  C     . GLY A 1 407 ? 0.558   31.053 61.005 1.00 14.66 ? 407 GLY A C     1 
ATOM   3134 O  O     . GLY A 1 407 ? -0.104  30.057 60.756 1.00 15.05 ? 407 GLY A O     1 
ATOM   3135 N  N     . VAL A 1 408 ? 0.925   31.918 60.065 1.00 14.26 ? 408 VAL A N     1 
ATOM   3136 C  CA    . VAL A 1 408 ? 0.576   31.721 58.670 1.00 13.54 ? 408 VAL A CA    1 
ATOM   3137 C  C     . VAL A 1 408 ? 1.850   31.906 57.833 1.00 13.62 ? 408 VAL A C     1 
ATOM   3138 O  O     . VAL A 1 408 ? 2.584   32.898 58.001 1.00 13.16 ? 408 VAL A O     1 
ATOM   3139 C  CB    . VAL A 1 408 ? -0.555  32.728 58.232 1.00 13.31 ? 408 VAL A CB    1 
ATOM   3140 C  CG1   . VAL A 1 408 ? -0.880  32.593 56.741 1.00 10.36 ? 408 VAL A CG1   1 
ATOM   3141 C  CG2   . VAL A 1 408 ? -1.808  32.491 59.063 1.00 11.73 ? 408 VAL A CG2   1 
ATOM   3142 N  N     . PRO A 1 409 ? 2.112   30.962 56.893 1.00 13.74 ? 409 PRO A N     1 
ATOM   3143 C  CA    . PRO A 1 409 ? 3.293   31.003 56.031 1.00 12.79 ? 409 PRO A CA    1 
ATOM   3144 C  C     . PRO A 1 409 ? 3.210   32.038 54.951 1.00 13.03 ? 409 PRO A C     1 
ATOM   3145 O  O     . PRO A 1 409 ? 2.144   32.254 54.358 1.00 12.91 ? 409 PRO A O     1 
ATOM   3146 C  CB    . PRO A 1 409 ? 3.312   29.610 55.426 1.00 12.05 ? 409 PRO A CB    1 
ATOM   3147 C  CG    . PRO A 1 409 ? 1.861   29.343 55.221 1.00 12.29 ? 409 PRO A CG    1 
ATOM   3148 C  CD    . PRO A 1 409 ? 1.254   29.809 56.531 1.00 13.25 ? 409 PRO A CD    1 
ATOM   3149 N  N     . ILE A 1 410 ? 4.336   32.692 54.689 1.00 13.42 ? 410 ILE A N     1 
ATOM   3150 C  CA    . ILE A 1 410 ? 4.372   33.684 53.627 1.00 13.76 ? 410 ILE A CA    1 
ATOM   3151 C  C     . ILE A 1 410 ? 4.769   32.928 52.347 1.00 15.56 ? 410 ILE A C     1 
ATOM   3152 O  O     . ILE A 1 410 ? 5.956   32.665 52.087 1.00 16.28 ? 410 ILE A O     1 
ATOM   3153 C  CB    . ILE A 1 410 ? 5.322   34.824 53.948 1.00 11.63 ? 410 ILE A CB    1 
ATOM   3154 C  CG1   . ILE A 1 410 ? 4.772   35.611 55.163 1.00 10.25 ? 410 ILE A CG1   1 
ATOM   3155 C  CG2   . ILE A 1 410 ? 5.504   35.702 52.690 1.00 11.93 ? 410 ILE A CG2   1 
ATOM   3156 C  CD1   . ILE A 1 410 ? 5.654   36.726 55.651 1.00 7.20  ? 410 ILE A CD1   1 
ATOM   3157 N  N     . ASP A 1 411 ? 3.752   32.590 51.558 1.00 15.64 ? 411 ASP A N     1 
ATOM   3158 C  CA    . ASP A 1 411 ? 3.924   31.823 50.339 1.00 15.25 ? 411 ASP A CA    1 
ATOM   3159 C  C     . ASP A 1 411 ? 4.435   32.588 49.133 1.00 14.88 ? 411 ASP A C     1 
ATOM   3160 O  O     . ASP A 1 411 ? 4.922   31.960 48.186 1.00 15.43 ? 411 ASP A O     1 
ATOM   3161 C  CB    . ASP A 1 411 ? 2.613   31.114 49.981 1.00 16.02 ? 411 ASP A CB    1 
ATOM   3162 C  CG    . ASP A 1 411 ? 2.298   29.951 50.905 1.00 15.18 ? 411 ASP A CG    1 
ATOM   3163 O  OD1   . ASP A 1 411 ? 1.180   29.412 50.849 1.00 15.93 ? 411 ASP A OD1   1 
ATOM   3164 O  OD2   . ASP A 1 411 ? 3.174   29.541 51.674 1.00 16.88 ? 411 ASP A OD2   1 
ATOM   3165 N  N     . ILE A 1 412 ? 4.303   33.915 49.130 1.00 13.12 ? 412 ILE A N     1 
ATOM   3166 C  CA    . ILE A 1 412 ? 4.778   34.703 48.004 1.00 12.62 ? 412 ILE A CA    1 
ATOM   3167 C  C     . ILE A 1 412 ? 5.362   36.016 48.500 1.00 13.50 ? 412 ILE A C     1 
ATOM   3168 O  O     . ILE A 1 412 ? 4.818   36.617 49.430 1.00 14.17 ? 412 ILE A O     1 
ATOM   3169 C  CB    . ILE A 1 412 ? 3.622   35.088 47.023 1.00 12.17 ? 412 ILE A CB    1 
ATOM   3170 C  CG1   . ILE A 1 412 ? 2.857   33.876 46.541 1.00 11.89 ? 412 ILE A CG1   1 
ATOM   3171 C  CG2   . ILE A 1 412 ? 4.173   35.807 45.781 1.00 11.70 ? 412 ILE A CG2   1 
ATOM   3172 C  CD1   . ILE A 1 412 ? 1.651   34.262 45.676 1.00 13.39 ? 412 ILE A CD1   1 
ATOM   3173 N  N     . ILE A 1 413 ? 6.454   36.475 47.893 1.00 14.13 ? 413 ILE A N     1 
ATOM   3174 C  CA    . ILE A 1 413 ? 7.032   37.764 48.284 1.00 15.11 ? 413 ILE A CA    1 
ATOM   3175 C  C     . ILE A 1 413 ? 7.207   38.638 47.041 1.00 15.40 ? 413 ILE A C     1 
ATOM   3176 O  O     . ILE A 1 413 ? 7.794   38.187 46.035 1.00 15.40 ? 413 ILE A O     1 
ATOM   3177 C  CB    . ILE A 1 413 ? 8.392   37.619 49.000 1.00 15.67 ? 413 ILE A CB    1 
ATOM   3178 C  CG1   . ILE A 1 413 ? 8.239   36.702 50.223 1.00 17.60 ? 413 ILE A CG1   1 
ATOM   3179 C  CG2   . ILE A 1 413 ? 8.873   38.995 49.469 1.00 15.16 ? 413 ILE A CG2   1 
ATOM   3180 C  CD1   . ILE A 1 413 ? 9.453   35.816 50.543 1.00 18.82 ? 413 ILE A CD1   1 
ATOM   3181 N  N     . SER A 1 414 ? 6.691   39.872 47.116 1.00 15.09 ? 414 SER A N     1 
ATOM   3182 C  CA    . SER A 1 414 ? 6.754   40.836 46.028 1.00 14.81 ? 414 SER A CA    1 
ATOM   3183 C  C     . SER A 1 414 ? 7.827   41.878 46.314 1.00 15.85 ? 414 SER A C     1 
ATOM   3184 O  O     . SER A 1 414 ? 7.888   42.430 47.403 1.00 15.38 ? 414 SER A O     1 
ATOM   3185 C  CB    . SER A 1 414 ? 5.385   41.489 45.839 1.00 14.72 ? 414 SER A CB    1 
ATOM   3186 O  OG    . SER A 1 414 ? 5.373   42.436 44.773 1.00 13.92 ? 414 SER A OG    1 
ATOM   3187 N  N     . THR A 1 415 ? 8.638   42.178 45.301 1.00 17.91 ? 415 THR A N     1 
ATOM   3188 C  CA    . THR A 1 415 ? 9.761   43.100 45.431 1.00 19.32 ? 415 THR A CA    1 
ATOM   3189 C  C     . THR A 1 415 ? 9.799   44.193 44.356 1.00 19.44 ? 415 THR A C     1 
ATOM   3190 O  O     . THR A 1 415 ? 10.863  44.551 43.828 1.00 20.04 ? 415 THR A O     1 
ATOM   3191 C  CB    . THR A 1 415 ? 11.084  42.304 45.351 1.00 20.59 ? 415 THR A CB    1 
ATOM   3192 O  OG1   . THR A 1 415 ? 11.162  41.667 44.063 1.00 23.23 ? 415 THR A OG1   1 
ATOM   3193 C  CG2   . THR A 1 415 ? 11.142  41.229 46.440 1.00 19.67 ? 415 THR A CG2   1 
ATOM   3194 N  N     . GLY A 1 416 ? 8.637   44.712 44.003 1.00 19.06 ? 416 GLY A N     1 
ATOM   3195 C  CA    . GLY A 1 416 ? 8.597   45.763 43.012 1.00 17.63 ? 416 GLY A CA    1 
ATOM   3196 C  C     . GLY A 1 416 ? 7.246   45.697 42.354 1.00 17.54 ? 416 GLY A C     1 
ATOM   3197 O  O     . GLY A 1 416 ? 6.558   44.685 42.482 1.00 16.06 ? 416 GLY A O     1 
ATOM   3198 N  N     . PRO A 1 417 ? 6.844   46.754 41.641 1.00 17.94 ? 417 PRO A N     1 
ATOM   3199 C  CA    . PRO A 1 417 ? 5.556   46.800 40.964 1.00 18.45 ? 417 PRO A CA    1 
ATOM   3200 C  C     . PRO A 1 417 ? 5.426   45.881 39.757 1.00 19.73 ? 417 PRO A C     1 
ATOM   3201 O  O     . PRO A 1 417 ? 4.323   45.377 39.489 1.00 21.77 ? 417 PRO A O     1 
ATOM   3202 C  CB    . PRO A 1 417 ? 5.383   48.295 40.628 1.00 18.57 ? 417 PRO A CB    1 
ATOM   3203 C  CG    . PRO A 1 417 ? 6.757   48.792 40.469 1.00 18.53 ? 417 PRO A CG    1 
ATOM   3204 C  CD    . PRO A 1 417 ? 7.539   48.054 41.565 1.00 19.05 ? 417 PRO A CD    1 
ATOM   3205 N  N     . ASP A 1 418 ? 6.525   45.539 39.094 1.00 19.57 ? 418 ASP A N     1 
ATOM   3206 C  CA    . ASP A 1 418 ? 6.385   44.694 37.912 1.00 19.27 ? 418 ASP A CA    1 
ATOM   3207 C  C     . ASP A 1 418 ? 5.924   43.288 38.200 1.00 19.28 ? 418 ASP A C     1 
ATOM   3208 O  O     . ASP A 1 418 ? 6.294   42.693 39.192 1.00 20.20 ? 418 ASP A O     1 
ATOM   3209 C  CB    . ASP A 1 418 ? 7.656   44.645 37.057 1.00 18.47 ? 418 ASP A CB    1 
ATOM   3210 C  CG    . ASP A 1 418 ? 7.339   44.492 35.551 1.00 17.49 ? 418 ASP A CG    1 
ATOM   3211 O  OD1   . ASP A 1 418 ? 7.286   45.518 34.854 1.00 13.67 ? 418 ASP A OD1   1 
ATOM   3212 O  OD2   . ASP A 1 418 ? 7.110   43.348 35.080 1.00 18.08 ? 418 ASP A OD2   1 
ATOM   3213 N  N     . ARG A 1 419 ? 5.090   42.764 37.318 1.00 19.67 ? 419 ARG A N     1 
ATOM   3214 C  CA    . ARG A 1 419 ? 4.567   41.409 37.447 1.00 19.49 ? 419 ARG A CA    1 
ATOM   3215 C  C     . ARG A 1 419 ? 5.650   40.404 37.859 1.00 19.84 ? 419 ARG A C     1 
ATOM   3216 O  O     . ARG A 1 419 ? 5.434   39.567 38.722 1.00 19.32 ? 419 ARG A O     1 
ATOM   3217 C  CB    . ARG A 1 419 ? 3.932   40.986 36.100 1.00 18.42 ? 419 ARG A CB    1 
ATOM   3218 C  CG    . ARG A 1 419 ? 3.579   39.510 35.954 1.00 17.81 ? 419 ARG A CG    1 
ATOM   3219 C  CD    . ARG A 1 419 ? 3.248   39.164 34.494 1.00 18.08 ? 419 ARG A CD    1 
ATOM   3220 N  NE    . ARG A 1 419 ? 1.936   39.637 34.066 1.00 18.85 ? 419 ARG A NE    1 
ATOM   3221 C  CZ    . ARG A 1 419 ? 1.523   39.541 32.799 1.00 19.35 ? 419 ARG A CZ    1 
ATOM   3222 N  NH1   . ARG A 1 419 ? 2.319   39.016 31.857 1.00 18.68 ? 419 ARG A NH1   1 
ATOM   3223 N  NH2   . ARG A 1 419 ? 0.282   39.924 32.478 1.00 17.26 ? 419 ARG A NH2   1 
ATOM   3224 N  N     . THR A 1 420 ? 6.844   40.529 37.293 1.00 21.71 ? 420 THR A N     1 
ATOM   3225 C  CA    . THR A 1 420 ? 7.901   39.546 37.558 1.00 22.29 ? 420 THR A CA    1 
ATOM   3226 C  C     . THR A 1 420 ? 8.874   39.730 38.717 1.00 21.99 ? 420 THR A C     1 
ATOM   3227 O  O     . THR A 1 420 ? 9.625   38.821 39.013 1.00 23.21 ? 420 THR A O     1 
ATOM   3228 C  CB    . THR A 1 420 ? 8.669   39.234 36.277 1.00 23.20 ? 420 THR A CB    1 
ATOM   3229 O  OG1   . THR A 1 420 ? 9.250   40.446 35.765 1.00 23.89 ? 420 THR A OG1   1 
ATOM   3230 C  CG2   . THR A 1 420 ? 7.705   38.650 35.233 1.00 23.33 ? 420 THR A CG2   1 
ATOM   3231 N  N     . GLU A 1 421 ? 8.858   40.885 39.365 1.00 21.51 ? 421 GLU A N     1 
ATOM   3232 C  CA    . GLU A 1 421 ? 9.705   41.170 40.527 1.00 21.05 ? 421 GLU A CA    1 
ATOM   3233 C  C     . GLU A 1 421 ? 8.981   40.565 41.750 1.00 19.91 ? 421 GLU A C     1 
ATOM   3234 O  O     . GLU A 1 421 ? 8.416   41.271 42.596 1.00 18.91 ? 421 GLU A O     1 
ATOM   3235 C  CB    . GLU A 1 421 ? 9.834   42.690 40.663 1.00 22.39 ? 421 GLU A CB    1 
ATOM   3236 C  CG    . GLU A 1 421 ? 10.576  43.309 39.493 1.00 24.61 ? 421 GLU A CG    1 
ATOM   3237 C  CD    . GLU A 1 421 ? 10.297  44.783 39.315 1.00 26.74 ? 421 GLU A CD    1 
ATOM   3238 O  OE1   . GLU A 1 421 ? 11.159  45.486 38.735 1.00 28.87 ? 421 GLU A OE1   1 
ATOM   3239 O  OE2   . GLU A 1 421 ? 9.215   45.242 39.724 1.00 27.20 ? 421 GLU A OE2   1 
ATOM   3240 N  N     . THR A 1 422 ? 9.004   39.242 41.822 1.00 19.11 ? 422 THR A N     1 
ATOM   3241 C  CA    . THR A 1 422 ? 8.304   38.507 42.859 1.00 18.65 ? 422 THR A CA    1 
ATOM   3242 C  C     . THR A 1 422 ? 8.952   37.126 42.968 1.00 18.00 ? 422 THR A C     1 
ATOM   3243 O  O     . THR A 1 422 ? 9.589   36.667 42.014 1.00 17.24 ? 422 THR A O     1 
ATOM   3244 C  CB    . THR A 1 422 ? 6.810   38.231 42.377 1.00 19.39 ? 422 THR A CB    1 
ATOM   3245 O  OG1   . THR A 1 422 ? 6.208   39.440 41.901 1.00 20.18 ? 422 THR A OG1   1 
ATOM   3246 C  CG2   . THR A 1 422 ? 5.949   37.630 43.484 1.00 17.39 ? 422 THR A CG2   1 
ATOM   3247 N  N     . MET A 1 423 ? 8.788   36.481 44.124 1.00 17.29 ? 423 MET A N     1 
ATOM   3248 C  CA    . MET A 1 423 ? 9.250   35.109 44.312 1.00 17.49 ? 423 MET A CA    1 
ATOM   3249 C  C     . MET A 1 423 ? 7.994   34.381 44.754 1.00 16.67 ? 423 MET A C     1 
ATOM   3250 O  O     . MET A 1 423 ? 7.356   34.788 45.731 1.00 16.31 ? 423 MET A O     1 
ATOM   3251 C  CB    . MET A 1 423 ? 10.250  34.930 45.467 1.00 18.76 ? 423 MET A CB    1 
ATOM   3252 C  CG    . MET A 1 423 ? 11.418  35.862 45.532 1.00 21.06 ? 423 MET A CG    1 
ATOM   3253 S  SD    . MET A 1 423 ? 12.008  36.012 47.232 1.00 22.89 ? 423 MET A SD    1 
ATOM   3254 C  CE    . MET A 1 423 ? 12.257  37.807 47.217 1.00 21.34 ? 423 MET A CE    1 
ATOM   3255 N  N     . ILE A 1 424 ? 7.635   33.318 44.052 1.00 16.69 ? 424 ILE A N     1 
ATOM   3256 C  CA    . ILE A 1 424 ? 6.482   32.511 44.442 1.00 16.79 ? 424 ILE A CA    1 
ATOM   3257 C  C     . ILE A 1 424 ? 7.134   31.339 45.179 1.00 16.83 ? 424 ILE A C     1 
ATOM   3258 O  O     . ILE A 1 424 ? 7.847   30.545 44.585 1.00 16.88 ? 424 ILE A O     1 
ATOM   3259 C  CB    . ILE A 1 424 ? 5.641   32.010 43.191 1.00 16.39 ? 424 ILE A CB    1 
ATOM   3260 C  CG1   . ILE A 1 424 ? 4.942   33.194 42.492 1.00 15.63 ? 424 ILE A CG1   1 
ATOM   3261 C  CG2   . ILE A 1 424 ? 4.576   30.991 43.623 1.00 16.90 ? 424 ILE A CG2   1 
ATOM   3262 C  CD1   . ILE A 1 424 ? 4.150   32.813 41.243 1.00 12.35 ? 424 ILE A CD1   1 
ATOM   3263 N  N     . LEU A 1 425 ? 6.973   31.275 46.488 1.00 16.84 ? 425 LEU A N     1 
ATOM   3264 C  CA    . LEU A 1 425 ? 7.575   30.176 47.230 1.00 16.45 ? 425 LEU A CA    1 
ATOM   3265 C  C     . LEU A 1 425 ? 6.588   29.024 47.147 1.00 17.68 ? 425 LEU A C     1 
ATOM   3266 O  O     . LEU A 1 425 ? 6.955   27.843 47.146 1.00 17.98 ? 425 LEU A O     1 
ATOM   3267 C  CB    . LEU A 1 425 ? 7.849   30.598 48.673 1.00 15.39 ? 425 LEU A CB    1 
ATOM   3268 C  CG    . LEU A 1 425 ? 8.804   31.797 48.726 1.00 16.48 ? 425 LEU A CG    1 
ATOM   3269 C  CD1   . LEU A 1 425 ? 8.718   32.589 50.006 1.00 16.44 ? 425 LEU A CD1   1 
ATOM   3270 C  CD2   . LEU A 1 425 ? 10.206  31.308 48.499 1.00 16.57 ? 425 LEU A CD2   1 
ATOM   3271 N  N     . ARG A 1 426 ? 5.312   29.357 47.056 1.00 18.89 ? 426 ARG A N     1 
ATOM   3272 C  CA    . ARG A 1 426 ? 4.320   28.313 46.944 1.00 19.78 ? 426 ARG A CA    1 
ATOM   3273 C  C     . ARG A 1 426 ? 3.112   28.906 46.247 1.00 19.40 ? 426 ARG A C     1 
ATOM   3274 O  O     . ARG A 1 426 ? 2.559   29.912 46.704 1.00 19.35 ? 426 ARG A O     1 
ATOM   3275 C  CB    . ARG A 1 426 ? 3.978   27.785 48.328 1.00 21.27 ? 426 ARG A CB    1 
ATOM   3276 C  CG    . ARG A 1 426 ? 3.028   26.642 48.365 1.00 25.17 ? 426 ARG A CG    1 
ATOM   3277 C  CD    . ARG A 1 426 ? 2.172   26.798 49.610 1.00 29.34 ? 426 ARG A CD    1 
ATOM   3278 N  NE    . ARG A 1 426 ? 1.581   25.548 50.075 1.00 32.46 ? 426 ARG A NE    1 
ATOM   3279 C  CZ    . ARG A 1 426 ? 0.825   25.532 51.171 1.00 35.51 ? 426 ARG A CZ    1 
ATOM   3280 N  NH1   . ARG A 1 426 ? 0.595   26.672 51.866 1.00 36.38 ? 426 ARG A NH1   1 
ATOM   3281 N  NH2   . ARG A 1 426 ? 0.272   24.379 51.554 1.00 35.96 ? 426 ARG A NH2   1 
ATOM   3282 N  N     . ASP A 1 427 ? 2.754   28.295 45.113 1.00 18.60 ? 427 ASP A N     1 
ATOM   3283 C  CA    . ASP A 1 427 ? 1.623   28.702 44.279 1.00 16.47 ? 427 ASP A CA    1 
ATOM   3284 C  C     . ASP A 1 427 ? 0.321   28.177 44.859 1.00 15.37 ? 427 ASP A C     1 
ATOM   3285 O  O     . ASP A 1 427 ? 0.104   26.965 44.966 1.00 14.94 ? 427 ASP A O     1 
ATOM   3286 C  CB    . ASP A 1 427 ? 1.787   28.156 42.850 1.00 17.33 ? 427 ASP A CB    1 
ATOM   3287 C  CG    . ASP A 1 427 ? 0.732   28.675 41.886 1.00 19.10 ? 427 ASP A CG    1 
ATOM   3288 O  OD1   . ASP A 1 427 ? 1.086   29.058 40.754 1.00 20.02 ? 427 ASP A OD1   1 
ATOM   3289 O  OD2   . ASP A 1 427 ? -0.464  28.702 42.236 1.00 20.15 ? 427 ASP A OD2   1 
ATOM   3290 N  N     . PRO A 1 428 ? -0.573  29.089 45.250 1.00 14.71 ? 428 PRO A N     1 
ATOM   3291 C  CA    . PRO A 1 428 ? -1.865  28.706 45.815 1.00 13.95 ? 428 PRO A CA    1 
ATOM   3292 C  C     . PRO A 1 428 ? -2.553  27.610 44.976 1.00 14.30 ? 428 PRO A C     1 
ATOM   3293 O  O     . PRO A 1 428 ? -3.165  26.684 45.523 1.00 12.82 ? 428 PRO A O     1 
ATOM   3294 C  CB    . PRO A 1 428 ? -2.637  30.017 45.754 1.00 14.07 ? 428 PRO A CB    1 
ATOM   3295 C  CG    . PRO A 1 428 ? -1.577  31.024 46.062 1.00 14.75 ? 428 PRO A CG    1 
ATOM   3296 C  CD    . PRO A 1 428 ? -0.372  30.551 45.295 1.00 13.76 ? 428 PRO A CD    1 
ATOM   3297 N  N     . PHE A 1 429 ? -2.438  27.710 43.650 1.00 14.99 ? 429 PHE A N     1 
ATOM   3298 C  CA    . PHE A 1 429 ? -3.076  26.746 42.760 1.00 16.57 ? 429 PHE A CA    1 
ATOM   3299 C  C     . PHE A 1 429 ? -2.549  25.336 42.906 1.00 18.81 ? 429 PHE A C     1 
ATOM   3300 O  O     . PHE A 1 429 ? -3.239  24.406 42.501 1.00 19.07 ? 429 PHE A O     1 
ATOM   3301 C  CB    . PHE A 1 429 ? -3.011  27.171 41.283 1.00 14.01 ? 429 PHE A CB    1 
ATOM   3302 C  CG    . PHE A 1 429 ? -4.032  28.212 40.900 1.00 13.18 ? 429 PHE A CG    1 
ATOM   3303 C  CD1   . PHE A 1 429 ? -3.658  29.363 40.204 1.00 13.09 ? 429 PHE A CD1   1 
ATOM   3304 C  CD2   . PHE A 1 429 ? -5.364  28.052 41.230 1.00 11.32 ? 429 PHE A CD2   1 
ATOM   3305 C  CE1   . PHE A 1 429 ? -4.607  30.332 39.849 1.00 13.18 ? 429 PHE A CE1   1 
ATOM   3306 C  CE2   . PHE A 1 429 ? -6.312  29.021 40.876 1.00 11.87 ? 429 PHE A CE2   1 
ATOM   3307 C  CZ    . PHE A 1 429 ? -5.933  30.158 40.188 1.00 11.45 ? 429 PHE A CZ    1 
ATOM   3308 N  N     . ASP A 1 430 ? -1.352  25.170 43.467 1.00 21.30 ? 430 ASP A N     1 
ATOM   3309 C  CA    . ASP A 1 430 ? -0.780  23.843 43.647 1.00 24.81 ? 430 ASP A CA    1 
ATOM   3310 C  C     . ASP A 1 430 ? -1.111  23.283 45.011 1.00 27.91 ? 430 ASP A C     1 
ATOM   3311 O  O     . ASP A 1 430 ? -1.152  22.068 45.186 1.00 30.27 ? 430 ASP A O     1 
ATOM   3312 C  CB    . ASP A 1 430 ? 0.736   23.867 43.523 1.00 25.32 ? 430 ASP A CB    1 
ATOM   3313 C  CG    . ASP A 1 430 ? 1.209   24.317 42.171 1.00 26.46 ? 430 ASP A CG    1 
ATOM   3314 O  OD1   . ASP A 1 430 ? 2.275   24.960 42.124 1.00 27.74 ? 430 ASP A OD1   1 
ATOM   3315 O  OD2   . ASP A 1 430 ? 0.527   24.042 41.160 1.00 26.92 ? 430 ASP A OD2   1 
ATOM   3316 N  N     . ALA A 1 431 ? -1.247  24.160 46.005 1.00 30.08 ? 431 ALA A N     1 
ATOM   3317 C  CA    . ALA A 1 431 ? -1.577  23.723 47.361 1.00 30.46 ? 431 ALA A CA    1 
ATOM   3318 C  C     . ALA A 1 431 ? -2.986  23.108 47.335 1.00 31.02 ? 431 ALA A C     1 
ATOM   3319 O  O     . ALA A 1 431 ? -3.989  23.854 47.446 1.00 31.89 ? 431 ALA A O     1 
ATOM   3320 C  CB    . ALA A 1 431 ? -1.504  24.906 48.337 1.00 29.54 ? 431 ALA A CB    1 
ATOM   3321 O  OXT   . ALA A 1 431 ? -3.074  21.883 47.129 1.00 31.13 ? 431 ALA A OXT   1 
HETATM 3322 MG MG    . MG  B 2 .   ? -5.732  50.328 45.286 1.00 13.69 ? 435 MG  A MG    1 
HETATM 3323 N  NA    . HDA C 3 .   ? -7.558  53.572 46.853 1.00 16.16 ? 437 HDA A NA    1 
HETATM 3324 C  C     . HDA C 3 .   ? -7.403  52.784 45.673 1.00 16.36 ? 437 HDA A C     1 
HETATM 3325 O  O     . HDA C 3 .   ? -6.312  52.406 45.315 1.00 16.39 ? 437 HDA A O     1 
HETATM 3326 O  OB    . HDA C 3 .   ? -6.384  54.047 47.478 1.00 17.69 ? 437 HDA A OB    1 
HETATM 3327 C  CB    . HDA C 3 .   ? -8.784  54.421 46.993 1.00 16.51 ? 437 HDA A CB    1 
HETATM 3328 C  CG    . HDA C 3 .   ? -8.517  55.926 46.804 1.00 18.04 ? 437 HDA A CG    1 
HETATM 3329 O  OD1   . HDA C 3 .   ? -7.681  56.335 45.965 1.00 19.45 ? 437 HDA A OD1   1 
HETATM 3330 O  OD2   . HDA C 3 .   ? -9.184  56.741 47.479 1.00 17.75 ? 437 HDA A OD2   1 
HETATM 3331 P  P     . IMO D 4 .   ? -8.502  48.990 46.673 1.00 27.10 ? 440 IMO A P     1 
HETATM 3332 O  O1    . IMO D 4 .   ? -7.685  49.614 45.603 1.00 23.29 ? 440 IMO A O1    1 
HETATM 3333 C  C2    . IMO D 4 .   ? -8.132  51.817 49.995 1.00 15.48 ? 440 IMO A C2    1 
HETATM 3334 C  "C1'" . IMO D 4 .   ? -11.910 53.505 51.813 1.00 10.70 ? 440 IMO A "C1'" 1 
HETATM 3335 C  "C2'" . IMO D 4 .   ? -12.369 54.918 51.679 1.00 10.84 ? 440 IMO A "C2'" 1 
HETATM 3336 C  "C3'" . IMO D 4 .   ? -12.943 55.228 53.056 1.00 10.23 ? 440 IMO A "C3'" 1 
HETATM 3337 C  "C4'" . IMO D 4 .   ? -13.800 53.976 53.108 1.00 10.13 ? 440 IMO A "C4'" 1 
HETATM 3338 C  "C5'" . IMO D 4 .   ? -15.181 54.090 52.607 1.00 10.56 ? 440 IMO A "C5'" 1 
HETATM 3339 O  O2    . IMO D 4 .   ? -7.630  48.487 47.762 1.00 25.62 ? 440 IMO A O2    1 
HETATM 3340 O  O3    . IMO D 4 .   ? -9.279  47.856 46.110 1.00 24.66 ? 440 IMO A O3    1 
HETATM 3341 P  PA    . IMO D 4 .   ? -16.213 54.018 49.979 1.00 9.55  ? 440 IMO A PA    1 
HETATM 3342 O  O1A   . IMO D 4 .   ? -15.708 52.717 49.496 1.00 8.42  ? 440 IMO A O1A   1 
HETATM 3343 O  O2A   . IMO D 4 .   ? -16.178 55.122 48.988 1.00 8.86  ? 440 IMO A O2A   1 
HETATM 3344 O  O3A   . IMO D 4 .   ? -17.593 53.974 50.512 1.00 10.41 ? 440 IMO A O3A   1 
HETATM 3345 O  "O5'" . IMO D 4 .   ? -15.245 54.507 51.181 1.00 11.85 ? 440 IMO A "O5'" 1 
HETATM 3346 O  "O4'" . IMO D 4 .   ? -13.110 52.967 52.349 1.00 9.60  ? 440 IMO A "O4'" 1 
HETATM 3347 N  N9    . IMO D 4 .   ? -11.560 52.963 50.581 1.00 13.93 ? 440 IMO A N9    1 
HETATM 3348 C  C4    . IMO D 4 .   ? -10.293 52.369 50.120 1.00 15.60 ? 440 IMO A C4    1 
HETATM 3349 N  N3    . IMO D 4 .   ? -9.075  52.463 50.672 1.00 14.96 ? 440 IMO A N3    1 
HETATM 3350 N  N1    . IMO D 4 .   ? -8.392  51.140 48.902 1.00 17.43 ? 440 IMO A N1    1 
HETATM 3351 C  C6    . IMO D 4 .   ? -9.554  50.973 48.290 1.00 17.22 ? 440 IMO A C6    1 
HETATM 3352 O  O6    . IMO D 4 .   ? -9.654  50.125 47.163 1.00 22.63 ? 440 IMO A O6    1 
HETATM 3353 C  C5    . IMO D 4 .   ? -10.570 51.659 48.960 1.00 16.60 ? 440 IMO A C5    1 
HETATM 3354 N  N7    . IMO D 4 .   ? -11.944 51.785 48.676 1.00 16.52 ? 440 IMO A N7    1 
HETATM 3355 C  C8    . IMO D 4 .   ? -12.463 52.528 49.614 1.00 14.37 ? 440 IMO A C8    1 
HETATM 3356 O  "O2'" . IMO D 4 .   ? -11.251 55.678 51.290 1.00 10.59 ? 440 IMO A "O2'" 1 
HETATM 3357 O  "O3'" . IMO D 4 .   ? -11.818 55.191 54.040 1.00 9.77  ? 440 IMO A "O3'" 1 
HETATM 3358 P  PB    . GDP E 5 .   ? -4.244  47.230 45.316 1.00 19.86 ? 432 GDP A PB    1 
HETATM 3359 O  O1B   . GDP E 5 .   ? -4.002  46.567 44.014 1.00 20.21 ? 432 GDP A O1B   1 
HETATM 3360 O  O2B   . GDP E 5 .   ? -5.505  48.007 45.293 1.00 18.26 ? 432 GDP A O2B   1 
HETATM 3361 O  O3B   . GDP E 5 .   ? -4.282  46.162 46.352 1.00 19.06 ? 432 GDP A O3B   1 
HETATM 3362 O  O3A   . GDP E 5 .   ? -3.063  48.273 45.558 1.00 20.64 ? 432 GDP A O3A   1 
HETATM 3363 P  PA    . GDP E 5 .   ? -2.806  49.635 44.745 1.00 22.20 ? 432 GDP A PA    1 
HETATM 3364 O  O1A   . GDP E 5 .   ? -2.525  49.374 43.294 1.00 21.72 ? 432 GDP A O1A   1 
HETATM 3365 O  O2A   . GDP E 5 .   ? -3.706  50.792 45.018 1.00 21.26 ? 432 GDP A O2A   1 
HETATM 3366 O  "O5'" . GDP E 5 .   ? -1.372  49.930 45.379 1.00 21.11 ? 432 GDP A "O5'" 1 
HETATM 3367 C  "C5'" . GDP E 5 .   ? -0.285  49.030 45.178 1.00 20.69 ? 432 GDP A "C5'" 1 
HETATM 3368 C  "C4'" . GDP E 5 .   ? 0.841   49.923 44.575 1.00 20.49 ? 432 GDP A "C4'" 1 
HETATM 3369 O  "O4'" . GDP E 5 .   ? 2.136   49.384 44.818 1.00 20.54 ? 432 GDP A "O4'" 1 
HETATM 3370 C  "C3'" . GDP E 5 .   ? 0.853   50.148 43.086 1.00 20.00 ? 432 GDP A "C3'" 1 
HETATM 3371 O  "O3'" . GDP E 5 .   ? 1.601   51.327 43.052 1.00 20.56 ? 432 GDP A "O3'" 1 
HETATM 3372 C  "C2'" . GDP E 5 .   ? 1.714   48.956 42.570 1.00 19.52 ? 432 GDP A "C2'" 1 
HETATM 3373 O  "O2'" . GDP E 5 .   ? 2.275   49.207 41.313 1.00 16.89 ? 432 GDP A "O2'" 1 
HETATM 3374 C  "C1'" . GDP E 5 .   ? 2.805   48.914 43.658 1.00 19.24 ? 432 GDP A "C1'" 1 
HETATM 3375 N  N9    . GDP E 5 .   ? 3.373   47.697 44.041 1.00 19.61 ? 432 GDP A N9    1 
HETATM 3376 C  C8    . GDP E 5 .   ? 2.827   46.455 44.136 1.00 18.87 ? 432 GDP A C8    1 
HETATM 3377 N  N7    . GDP E 5 .   ? 3.631   45.516 44.604 1.00 18.98 ? 432 GDP A N7    1 
HETATM 3378 C  C5    . GDP E 5 .   ? 4.802   46.193 44.847 1.00 18.39 ? 432 GDP A C5    1 
HETATM 3379 C  C6    . GDP E 5 .   ? 6.009   45.700 45.367 1.00 19.33 ? 432 GDP A C6    1 
HETATM 3380 O  O6    . GDP E 5 .   ? 6.265   44.561 45.780 1.00 17.21 ? 432 GDP A O6    1 
HETATM 3381 N  N1    . GDP E 5 .   ? 6.965   46.712 45.441 1.00 19.95 ? 432 GDP A N1    1 
HETATM 3382 C  C2    . GDP E 5 .   ? 6.734   48.022 45.064 1.00 21.44 ? 432 GDP A C2    1 
HETATM 3383 N  N2    . GDP E 5 .   ? 7.737   48.903 45.156 1.00 22.04 ? 432 GDP A N2    1 
HETATM 3384 N  N3    . GDP E 5 .   ? 5.538   48.471 44.583 1.00 19.72 ? 432 GDP A N3    1 
HETATM 3385 C  C4    . GDP E 5 .   ? 4.659   47.504 44.507 1.00 18.77 ? 432 GDP A C4    1 
HETATM 3386 O  O     . HOH F 6 .   ? -23.802 32.835 49.500 1.00 5.21  ? 501 HOH A O     1 
HETATM 3387 O  O     . HOH F 6 .   ? -6.332  40.266 66.640 1.00 21.24 ? 502 HOH A O     1 
HETATM 3388 O  O     . HOH F 6 .   ? -1.168  46.284 42.794 1.00 12.63 ? 503 HOH A O     1 
HETATM 3389 O  O     . HOH F 6 .   ? -31.248 41.191 38.116 1.00 13.44 ? 504 HOH A O     1 
HETATM 3390 O  O     . HOH F 6 .   ? -5.887  50.440 19.467 1.00 10.05 ? 505 HOH A O     1 
HETATM 3391 O  O     . HOH F 6 .   ? -5.447  33.852 64.641 1.00 38.56 ? 506 HOH A O     1 
HETATM 3392 O  O     . HOH F 6 .   ? -16.859 45.879 63.928 1.00 2.01  ? 507 HOH A O     1 
HETATM 3393 O  O     . HOH F 6 .   ? 3.021   53.259 31.849 1.00 33.31 ? 508 HOH A O     1 
HETATM 3394 O  O     . HOH F 6 .   ? -35.604 64.909 37.848 1.00 39.37 ? 509 HOH A O     1 
HETATM 3395 O  O     . HOH F 6 .   ? -23.328 56.411 52.745 1.00 13.91 ? 510 HOH A O     1 
HETATM 3396 O  O     . HOH F 6 .   ? -3.565  48.804 53.939 1.00 13.24 ? 511 HOH A O     1 
HETATM 3397 O  O     . HOH F 6 .   ? -17.333 38.598 26.935 1.00 20.21 ? 512 HOH A O     1 
HETATM 3398 O  O     . HOH F 6 .   ? -16.785 48.183 48.828 1.00 2.96  ? 513 HOH A O     1 
HETATM 3399 O  O     . HOH F 6 .   ? -22.342 28.090 42.620 1.00 16.76 ? 514 HOH A O     1 
HETATM 3400 O  O     . HOH F 6 .   ? -12.803 22.873 41.604 1.00 18.62 ? 515 HOH A O     1 
HETATM 3401 O  O     . HOH F 6 .   ? -14.154 57.230 65.889 1.00 22.58 ? 516 HOH A O     1 
HETATM 3402 O  O     . HOH F 6 .   ? -3.435  55.684 68.228 1.00 32.35 ? 517 HOH A O     1 
HETATM 3403 O  O     . HOH F 6 .   ? -5.891  53.001 68.089 1.00 19.90 ? 518 HOH A O     1 
HETATM 3404 O  O     . HOH F 6 .   ? -16.178 61.846 49.288 1.00 16.87 ? 519 HOH A O     1 
HETATM 3405 O  O     . HOH F 6 .   ? -28.212 65.991 36.828 1.00 27.91 ? 520 HOH A O     1 
HETATM 3406 O  O     . HOH F 6 .   ? -17.779 60.018 40.941 1.00 20.81 ? 521 HOH A O     1 
HETATM 3407 O  O     . HOH F 6 .   ? -7.865  25.554 34.539 1.00 21.59 ? 522 HOH A O     1 
HETATM 3408 O  O     . HOH F 6 .   ? -25.890 33.641 39.182 1.00 7.90  ? 523 HOH A O     1 
HETATM 3409 O  O     . HOH F 6 .   ? 10.597  31.969 56.563 1.00 28.13 ? 524 HOH A O     1 
HETATM 3410 O  O     . HOH F 6 .   ? -9.850  42.442 49.672 1.00 6.63  ? 525 HOH A O     1 
HETATM 3411 O  O     . HOH F 6 .   ? 1.934   44.275 38.478 1.00 13.96 ? 526 HOH A O     1 
HETATM 3412 O  O     . HOH F 6 .   ? 8.407   32.362 41.341 1.00 28.39 ? 527 HOH A O     1 
HETATM 3413 O  O     . HOH F 6 .   ? -10.391 45.012 39.693 1.00 19.52 ? 528 HOH A O     1 
HETATM 3414 O  O     . HOH F 6 .   ? -3.562  56.811 64.154 1.00 18.39 ? 529 HOH A O     1 
HETATM 3415 O  O     . HOH F 6 .   ? -27.270 33.429 41.603 1.00 2.39  ? 530 HOH A O     1 
HETATM 3416 O  O     . HOH F 6 .   ? -29.438 55.318 49.424 1.00 15.28 ? 531 HOH A O     1 
HETATM 3417 O  O     . HOH F 6 .   ? -7.870  52.602 53.522 1.00 11.22 ? 532 HOH A O     1 
HETATM 3418 O  O     . HOH F 6 .   ? -16.933 30.542 30.262 1.00 20.34 ? 533 HOH A O     1 
HETATM 3419 O  O     . HOH F 6 .   ? -25.246 55.564 33.680 1.00 14.33 ? 534 HOH A O     1 
HETATM 3420 O  O     . HOH F 6 .   ? -37.931 53.828 48.578 1.00 26.12 ? 535 HOH A O     1 
HETATM 3421 O  O     . HOH F 6 .   ? -20.962 59.736 54.112 1.00 23.07 ? 536 HOH A O     1 
HETATM 3422 O  O     . HOH F 6 .   ? 9.686   55.465 63.797 1.00 34.07 ? 537 HOH A O     1 
HETATM 3423 O  O     . HOH F 6 .   ? -27.101 42.172 44.169 1.00 7.54  ? 538 HOH A O     1 
HETATM 3424 O  O     . HOH F 6 .   ? -19.182 57.816 40.321 1.00 33.23 ? 539 HOH A O     1 
HETATM 3425 O  O     . HOH F 6 .   ? -10.994 51.530 20.778 1.00 26.05 ? 540 HOH A O     1 
HETATM 3426 O  O     . HOH F 6 .   ? -2.304  49.890 62.845 1.00 10.87 ? 541 HOH A O     1 
HETATM 3427 O  O     . HOH F 6 .   ? -9.462  49.946 77.917 1.00 19.08 ? 542 HOH A O     1 
HETATM 3428 O  O     . HOH F 6 .   ? -24.199 43.545 45.309 1.00 3.21  ? 543 HOH A O     1 
HETATM 3429 O  O     . HOH F 6 .   ? -18.149 56.715 30.550 1.00 31.46 ? 544 HOH A O     1 
HETATM 3430 O  O     . HOH F 6 .   ? 6.674   47.463 59.648 1.00 27.06 ? 545 HOH A O     1 
HETATM 3431 O  O     . HOH F 6 .   ? -10.095 38.454 23.490 1.00 34.90 ? 546 HOH A O     1 
HETATM 3432 O  O     . HOH F 6 .   ? -25.881 57.681 35.564 1.00 20.56 ? 547 HOH A O     1 
HETATM 3433 O  O     . HOH F 6 .   ? -28.612 49.717 44.357 1.00 2.26  ? 548 HOH A O     1 
HETATM 3434 O  O     . HOH F 6 .   ? -12.934 62.553 56.385 1.00 30.72 ? 549 HOH A O     1 
HETATM 3435 O  O     . HOH F 6 .   ? -19.703 18.924 47.010 1.00 45.35 ? 550 HOH A O     1 
HETATM 3436 O  O     . HOH F 6 .   ? -22.002 58.618 51.768 1.00 11.77 ? 551 HOH A O     1 
HETATM 3437 O  O     . HOH F 6 .   ? 4.584   44.941 76.839 1.00 17.08 ? 552 HOH A O     1 
HETATM 3438 O  O     . HOH F 6 .   ? -21.939 46.920 60.708 1.00 1.38  ? 553 HOH A O     1 
HETATM 3439 O  O     . HOH F 6 .   ? -32.750 35.705 34.929 1.00 6.32  ? 554 HOH A O     1 
HETATM 3440 O  O     . HOH F 6 .   ? -36.045 65.169 33.402 1.00 24.09 ? 555 HOH A O     1 
HETATM 3441 O  O     . HOH F 6 .   ? 7.657   44.299 73.028 1.00 27.59 ? 556 HOH A O     1 
HETATM 3442 O  O     . HOH F 6 .   ? 4.355   42.136 74.887 1.00 26.36 ? 557 HOH A O     1 
HETATM 3443 O  O     . HOH F 6 .   ? -6.132  26.158 52.611 1.00 22.06 ? 558 HOH A O     1 
HETATM 3444 O  O     . HOH F 6 .   ? -27.594 50.442 24.285 1.00 16.30 ? 559 HOH A O     1 
HETATM 3445 O  O     . HOH F 6 .   ? -4.408  52.182 51.721 1.00 28.00 ? 560 HOH A O     1 
HETATM 3446 O  O     . HOH F 6 .   ? 6.906   58.832 45.416 1.00 24.29 ? 561 HOH A O     1 
HETATM 3447 O  O     . HOH F 6 .   ? 14.746  31.776 53.679 1.00 37.09 ? 562 HOH A O     1 
HETATM 3448 O  O     . HOH F 6 .   ? -2.925  34.213 64.087 1.00 17.95 ? 563 HOH A O     1 
HETATM 3449 O  O     . HOH F 6 .   ? -22.858 39.944 48.387 1.00 13.07 ? 564 HOH A O     1 
HETATM 3450 O  O     . HOH F 6 .   ? -10.849 55.573 67.211 1.00 55.10 ? 565 HOH A O     1 
HETATM 3451 O  O     . HOH F 6 .   ? -16.648 54.959 26.023 1.00 42.68 ? 566 HOH A O     1 
HETATM 3452 O  O     . HOH F 6 .   ? -3.070  52.621 79.258 1.00 17.18 ? 567 HOH A O     1 
HETATM 3453 O  O     . HOH F 6 .   ? -4.275  40.517 33.630 1.00 5.73  ? 568 HOH A O     1 
HETATM 3454 O  O     . HOH F 6 .   ? 21.031  41.503 57.266 1.00 20.91 ? 569 HOH A O     1 
HETATM 3455 O  O     . HOH F 6 .   ? -31.189 52.849 42.671 1.00 20.14 ? 570 HOH A O     1 
HETATM 3456 O  O     . HOH F 6 .   ? -33.298 57.236 26.949 1.00 25.96 ? 571 HOH A O     1 
HETATM 3457 O  O     . HOH F 6 .   ? -12.444 46.256 63.399 1.00 9.57  ? 572 HOH A O     1 
HETATM 3458 O  O     . HOH F 6 .   ? -31.369 56.884 50.213 1.00 26.95 ? 573 HOH A O     1 
HETATM 3459 O  O     . HOH F 6 .   ? -7.777  31.115 60.385 1.00 22.00 ? 574 HOH A O     1 
HETATM 3460 O  O     . HOH F 6 .   ? -13.162 55.625 56.457 1.00 3.90  ? 575 HOH A O     1 
HETATM 3461 O  O     . HOH F 6 .   ? 17.362  40.312 62.260 1.00 38.35 ? 576 HOH A O     1 
HETATM 3462 O  O     . HOH F 6 .   ? 18.167  45.376 44.281 1.00 25.82 ? 577 HOH A O     1 
HETATM 3463 O  O     . HOH F 6 .   ? -15.610 35.570 58.213 1.00 9.01  ? 578 HOH A O     1 
HETATM 3464 O  O     . HOH F 6 .   ? -0.930  48.247 54.066 1.00 10.16 ? 579 HOH A O     1 
HETATM 3465 O  O     . HOH F 6 .   ? -1.166  53.342 41.101 1.00 12.92 ? 580 HOH A O     1 
HETATM 3466 O  O     . HOH F 6 .   ? -10.952 35.703 27.383 1.00 20.39 ? 581 HOH A O     1 
HETATM 3467 O  O     . HOH F 6 .   ? -8.206  56.081 25.863 1.00 17.93 ? 582 HOH A O     1 
HETATM 3468 O  O     . HOH F 6 .   ? -15.766 59.250 65.443 1.00 54.14 ? 583 HOH A O     1 
HETATM 3469 O  O     . HOH F 6 .   ? 3.818   45.602 28.688 1.00 13.46 ? 584 HOH A O     1 
HETATM 3470 O  O     . HOH F 6 .   ? -11.336 54.871 34.738 1.00 36.79 ? 585 HOH A O     1 
HETATM 3471 O  O     . HOH F 6 .   ? -15.305 35.870 23.350 1.00 49.77 ? 586 HOH A O     1 
HETATM 3472 O  O     . HOH F 6 .   ? 3.249   61.544 54.295 1.00 30.63 ? 587 HOH A O     1 
HETATM 3473 O  O     . HOH F 6 .   ? -6.112  57.211 64.526 1.00 29.51 ? 588 HOH A O     1 
HETATM 3474 O  O     . HOH F 6 .   ? 0.604   45.402 29.918 1.00 17.13 ? 589 HOH A O     1 
HETATM 3475 O  O     . HOH F 6 .   ? -27.596 68.033 39.117 1.00 46.13 ? 590 HOH A O     1 
HETATM 3476 O  O     . HOH F 6 .   ? -25.012 66.470 46.482 1.00 24.72 ? 591 HOH A O     1 
HETATM 3477 O  O     . HOH F 6 .   ? -23.496 22.122 42.775 1.00 19.52 ? 592 HOH A O     1 
HETATM 3478 O  O     . HOH F 6 .   ? -0.113  27.975 63.182 1.00 37.05 ? 593 HOH A O     1 
HETATM 3479 O  O     . HOH F 6 .   ? -11.636 56.986 64.614 1.00 23.77 ? 594 HOH A O     1 
HETATM 3480 O  O     . HOH F 6 .   ? -11.519 44.173 64.802 1.00 15.38 ? 595 HOH A O     1 
HETATM 3481 O  O     . HOH F 6 .   ? -30.281 45.527 44.352 1.00 25.04 ? 596 HOH A O     1 
HETATM 3482 O  O     . HOH F 6 .   ? -20.773 50.379 66.594 1.00 16.54 ? 597 HOH A O     1 
HETATM 3483 O  O     . HOH F 6 .   ? -14.693 20.622 50.087 1.00 38.36 ? 598 HOH A O     1 
HETATM 3484 O  O     . HOH F 6 .   ? -22.844 70.727 42.180 1.00 37.89 ? 599 HOH A O     1 
HETATM 3485 O  O     . HOH F 6 .   ? -1.388  34.680 30.089 1.00 9.73  ? 600 HOH A O     1 
HETATM 3486 O  O     . HOH F 6 .   ? 2.953   30.719 65.036 1.00 25.09 ? 602 HOH A O     1 
HETATM 3487 O  O     . HOH F 6 .   ? -6.362  54.464 26.676 1.00 20.94 ? 603 HOH A O     1 
HETATM 3488 O  O     . HOH F 6 .   ? -16.482 20.596 52.564 1.00 25.10 ? 604 HOH A O     1 
HETATM 3489 O  O     . HOH F 6 .   ? -6.071  31.269 21.532 1.00 38.40 ? 605 HOH A O     1 
HETATM 3490 O  O     . HOH F 6 .   ? -36.513 46.266 41.067 1.00 33.98 ? 606 HOH A O     1 
HETATM 3491 O  O     . HOH F 6 .   ? -36.888 62.662 39.610 1.00 9.68  ? 607 HOH A O     1 
HETATM 3492 O  O     . HOH F 6 .   ? -15.826 27.081 40.374 1.00 28.83 ? 608 HOH A O     1 
HETATM 3493 O  O     . HOH F 6 .   ? -23.426 55.777 35.899 1.00 18.48 ? 609 HOH A O     1 
HETATM 3494 O  O     . HOH F 6 .   ? -23.595 68.033 48.550 1.00 24.16 ? 610 HOH A O     1 
HETATM 3495 O  O     . HOH F 6 .   ? -20.408 42.217 50.306 1.00 42.07 ? 611 HOH A O     1 
HETATM 3496 O  O     . HOH F 6 .   ? 2.291   52.115 27.399 1.00 45.28 ? 612 HOH A O     1 
HETATM 3497 O  O     . HOH F 6 .   ? 7.338   34.886 39.866 1.00 18.59 ? 613 HOH A O     1 
HETATM 3498 O  O     . HOH F 6 .   ? -7.908  49.869 62.219 1.00 22.20 ? 614 HOH A O     1 
HETATM 3499 O  O     . HOH F 6 .   ? 15.512  42.132 61.198 1.00 21.06 ? 615 HOH A O     1 
HETATM 3500 O  O     . HOH F 6 .   ? 13.524  31.860 45.994 1.00 39.13 ? 616 HOH A O     1 
HETATM 3501 O  O     . HOH F 6 .   ? 8.762   32.464 53.552 1.00 30.08 ? 618 HOH A O     1 
HETATM 3502 O  O     . HOH F 6 .   ? 5.828   51.547 38.797 1.00 31.18 ? 619 HOH A O     1 
HETATM 3503 O  O     . HOH F 6 .   ? -2.828  52.741 23.135 1.00 19.81 ? 620 HOH A O     1 
HETATM 3504 O  O     . HOH F 6 .   ? -18.850 54.101 72.009 1.00 32.63 ? 621 HOH A O     1 
HETATM 3505 O  O     . HOH F 6 .   ? -22.949 41.846 55.079 1.00 16.12 ? 622 HOH A O     1 
HETATM 3506 O  O     . HOH F 6 .   ? -10.316 32.989 27.068 1.00 31.95 ? 623 HOH A O     1 
HETATM 3507 O  O     . HOH F 6 .   ? -40.444 54.643 49.016 1.00 25.67 ? 624 HOH A O     1 
HETATM 3508 O  O     . HOH F 6 .   ? -12.949 23.430 44.429 1.00 35.05 ? 625 HOH A O     1 
HETATM 3509 O  O     . HOH F 6 .   ? -38.794 44.419 39.312 1.00 29.50 ? 626 HOH A O     1 
HETATM 3510 O  O     . HOH F 6 .   ? -12.597 55.108 39.868 1.00 31.51 ? 627 HOH A O     1 
HETATM 3511 O  O     . HOH F 6 .   ? -23.608 55.903 31.472 1.00 26.66 ? 628 HOH A O     1 
HETATM 3512 O  O     . HOH F 6 .   ? -3.102  29.529 60.880 1.00 31.70 ? 629 HOH A O     1 
HETATM 3513 O  O     . HOH F 6 .   ? -5.746  52.060 30.490 1.00 10.62 ? 630 HOH A O     1 
HETATM 3514 O  O     . HOH F 6 .   ? -4.162  40.122 23.353 1.00 5.57  ? 631 HOH A O     1 
HETATM 3515 O  O     . HOH F 6 .   ? -17.958 55.868 47.308 1.00 5.89  ? 632 HOH A O     1 
HETATM 3516 O  O     . HOH F 6 .   ? -7.381  45.522 18.783 1.00 27.00 ? 633 HOH A O     1 
HETATM 3517 O  O     . HOH F 6 .   ? -37.588 41.932 39.066 1.00 7.19  ? 634 HOH A O     1 
HETATM 3518 O  O     . HOH F 6 .   ? -26.645 67.306 44.445 1.00 36.96 ? 635 HOH A O     1 
HETATM 3519 O  O     . HOH F 6 .   ? -3.347  32.479 22.889 1.00 32.85 ? 636 HOH A O     1 
HETATM 3520 O  O     . HOH F 6 .   ? -0.016  30.443 38.946 1.00 29.98 ? 637 HOH A O     1 
HETATM 3521 O  O     . HOH F 6 .   ? -17.709 51.840 25.348 1.00 30.55 ? 638 HOH A O     1 
HETATM 3522 O  O     . HOH F 6 .   ? 5.408   51.584 29.136 1.00 22.31 ? 640 HOH A O     1 
HETATM 3523 O  O     . HOH F 6 .   ? -33.835 34.203 33.055 1.00 25.99 ? 641 HOH A O     1 
HETATM 3524 O  O     . HOH F 6 .   ? -29.893 32.884 42.112 1.00 2.17  ? 642 HOH A O     1 
HETATM 3525 O  O     . HOH F 6 .   ? 14.966  47.475 56.314 1.00 17.85 ? 643 HOH A O     1 
HETATM 3526 O  O     . HOH F 6 .   ? -2.060  55.406 39.616 1.00 24.35 ? 644 HOH A O     1 
HETATM 3527 O  O     . HOH F 6 .   ? 6.448   29.397 56.173 1.00 56.46 ? 645 HOH A O     1 
HETATM 3528 O  O     . HOH F 6 .   ? -16.204 36.067 27.203 1.00 15.95 ? 646 HOH A O     1 
HETATM 3529 O  O     . HOH F 6 .   ? -38.172 45.073 55.943 1.00 15.65 ? 647 HOH A O     1 
HETATM 3530 O  O     . HOH F 6 .   ? -18.326 58.598 68.673 1.00 36.15 ? 648 HOH A O     1 
HETATM 3531 O  O     . HOH F 6 .   ? 5.971   39.711 71.738 1.00 25.41 ? 649 HOH A O     1 
HETATM 3532 O  O     . HOH F 6 .   ? -19.125 65.912 50.257 1.00 45.30 ? 650 HOH A O     1 
HETATM 3533 O  O     . HOH F 6 .   ? -35.405 42.740 54.897 1.00 2.75  ? 651 HOH A O     1 
HETATM 3534 O  O     . HOH F 6 .   ? -35.543 42.894 37.707 1.00 9.13  ? 652 HOH A O     1 
HETATM 3535 O  O     . HOH F 6 .   ? -37.033 46.685 34.831 1.00 17.45 ? 653 HOH A O     1 
HETATM 3536 O  O     . HOH F 6 .   ? -25.857 32.446 31.491 1.00 17.90 ? 654 HOH A O     1 
HETATM 3537 O  O     . HOH F 6 .   ? -33.101 44.840 27.118 1.00 45.71 ? 655 HOH A O     1 
HETATM 3538 O  O     . HOH F 6 .   ? -26.590 36.982 35.472 1.00 8.75  ? 656 HOH A O     1 
HETATM 3539 O  O     . HOH F 6 .   ? -25.135 35.913 38.124 1.00 6.86  ? 657 HOH A O     1 
HETATM 3540 O  O     . HOH F 6 .   ? -22.645 36.300 40.613 1.00 7.14  ? 658 HOH A O     1 
HETATM 3541 O  O     . HOH F 6 .   ? 11.755  40.528 67.044 1.00 42.46 ? 659 HOH A O     1 
HETATM 3542 O  O     . HOH F 6 .   ? -8.708  22.076 44.384 1.00 16.66 ? 660 HOH A O     1 
HETATM 3543 O  O     . HOH F 6 .   ? 7.817   52.095 44.965 1.00 47.10 ? 661 HOH A O     1 
HETATM 3544 O  O     . HOH F 6 .   ? -5.316  23.053 42.888 1.00 22.10 ? 662 HOH A O     1 
HETATM 3545 O  O     . HOH F 6 .   ? -5.057  25.150 34.277 1.00 23.26 ? 663 HOH A O     1 
HETATM 3546 O  O     . HOH F 6 .   ? -11.434 37.424 51.696 1.00 35.73 ? 664 HOH A O     1 
HETATM 3547 O  O     . HOH F 6 .   ? -19.966 50.214 20.884 1.00 26.63 ? 665 HOH A O     1 
HETATM 3548 O  O     . HOH F 6 .   ? -26.406 60.089 34.214 1.00 29.70 ? 666 HOH A O     1 
HETATM 3549 O  O     . HOH F 6 .   ? -14.241 42.070 44.754 1.00 10.16 ? 667 HOH A O     1 
HETATM 3550 O  O     . HOH F 6 .   ? -12.533 41.289 49.652 1.00 7.36  ? 668 HOH A O     1 
HETATM 3551 O  O     . HOH F 6 .   ? -16.859 52.836 73.508 1.00 19.33 ? 669 HOH A O     1 
HETATM 3552 O  O     . HOH F 6 .   ? -23.612 62.719 28.917 1.00 31.52 ? 670 HOH A O     1 
HETATM 3553 O  O     . HOH F 6 .   ? -9.601  38.563 30.861 1.00 10.64 ? 671 HOH A O     1 
HETATM 3554 O  O     . HOH F 6 .   ? -10.182 41.360 53.309 1.00 14.65 ? 672 HOH A O     1 
HETATM 3555 O  O     . HOH F 6 .   ? -25.254 69.976 45.087 1.00 26.22 ? 673 HOH A O     1 
HETATM 3556 O  O     . HOH F 6 .   ? 11.067  47.579 70.982 1.00 43.16 ? 674 HOH A O     1 
HETATM 3557 O  O     . HOH F 6 .   ? -18.833 61.875 39.234 1.00 24.91 ? 675 HOH A O     1 
HETATM 3558 O  O     . HOH F 6 .   ? -22.689 66.434 44.783 1.00 34.98 ? 676 HOH A O     1 
HETATM 3559 O  O     . HOH F 6 .   ? -5.477  43.863 59.313 1.00 10.33 ? 677 HOH A O     1 
HETATM 3560 O  O     . HOH F 6 .   ? -9.742  53.732 55.360 1.00 14.25 ? 678 HOH A O     1 
HETATM 3561 O  O     . HOH F 6 .   ? -7.288  48.150 19.414 1.00 22.29 ? 679 HOH A O     1 
HETATM 3562 O  O     . HOH F 6 .   ? 1.177   41.726 37.990 1.00 13.49 ? 680 HOH A O     1 
HETATM 3563 O  O     . HOH F 6 .   ? -9.207  59.742 61.025 1.00 6.63  ? 681 HOH A O     1 
HETATM 3564 O  O     . HOH F 6 .   ? -10.390 62.010 52.507 1.00 27.99 ? 682 HOH A O     1 
HETATM 3565 O  O     . HOH F 6 .   ? -0.711  46.127 59.402 1.00 4.02  ? 683 HOH A O     1 
HETATM 3566 O  O     . HOH F 6 .   ? -4.240  52.659 33.279 1.00 29.11 ? 684 HOH A O     1 
HETATM 3567 O  O     . HOH F 6 .   ? -5.542  54.628 29.316 1.00 17.25 ? 685 HOH A O     1 
HETATM 3568 O  O     . HOH F 6 .   ? -5.965  55.165 66.615 1.00 28.15 ? 686 HOH A O     1 
HETATM 3569 O  O     . HOH F 6 .   ? -0.060  47.040 32.165 1.00 11.27 ? 687 HOH A O     1 
HETATM 3570 O  O     . HOH F 6 .   ? -6.943  59.987 54.894 1.00 26.60 ? 688 HOH A O     1 
HETATM 3571 O  O     . HOH F 6 .   ? 1.871   46.408 40.471 1.00 7.39  ? 689 HOH A O     1 
HETATM 3572 O  O     . HOH F 6 .   ? -0.193  51.487 26.700 1.00 24.27 ? 690 HOH A O     1 
HETATM 3573 O  O     . HOH F 6 .   ? -2.879  62.177 55.210 1.00 36.40 ? 691 HOH A O     1 
HETATM 3574 O  O     . HOH F 6 .   ? -4.036  63.921 50.015 1.00 42.60 ? 692 HOH A O     1 
HETATM 3575 O  O     . HOH F 6 .   ? 3.727   51.202 40.448 1.00 28.97 ? 693 HOH A O     1 
HETATM 3576 O  O     . HOH F 6 .   ? 2.209   54.567 66.344 1.00 44.70 ? 694 HOH A O     1 
HETATM 3577 O  O     . HOH F 6 .   ? 1.531   58.749 57.331 1.00 19.84 ? 695 HOH A O     1 
HETATM 3578 O  O     . HOH F 6 .   ? 13.995  43.126 38.511 1.00 38.64 ? 696 HOH A O     1 
HETATM 3579 O  O     . HOH F 6 .   ? 8.390   54.035 65.688 1.00 19.09 ? 697 HOH A O     1 
HETATM 3580 O  O     . HOH F 6 .   ? 11.317  61.064 54.665 1.00 33.35 ? 698 HOH A O     1 
HETATM 3581 O  O     . HOH F 6 .   ? -41.353 58.541 44.051 1.00 45.65 ? 699 HOH A O     1 
HETATM 3582 O  O     . HOH F 6 .   ? 16.724  55.762 54.432 1.00 31.75 ? 700 HOH A O     1 
HETATM 3583 O  O     . HOH F 6 .   ? 5.060   39.072 31.714 1.00 32.71 ? 701 HOH A O     1 
HETATM 3584 O  O     . HOH F 6 .   ? 4.358   53.590 42.472 1.00 20.32 ? 702 HOH A O     1 
HETATM 3585 O  O     . HOH F 6 .   ? -28.161 34.019 31.523 1.00 34.60 ? 703 HOH A O     1 
HETATM 3586 O  O     . HOH F 6 .   ? -20.506 41.520 24.476 1.00 27.50 ? 704 HOH A O     1 
HETATM 3587 O  O     . HOH F 6 .   ? -13.076 25.407 40.125 1.00 7.91  ? 705 HOH A O     1 
HETATM 3588 O  O     . HOH F 6 .   ? -18.667 61.227 48.636 1.00 19.12 ? 706 HOH A O     1 
HETATM 3589 O  O     . HOH F 6 .   ? 12.837  53.125 61.730 1.00 44.91 ? 707 HOH A O     1 
HETATM 3590 O  O     . HOH F 6 .   ? 10.919  30.499 44.298 1.00 29.88 ? 708 HOH A O     1 
HETATM 3591 O  O     . HOH F 6 .   ? -4.341  60.734 60.245 1.00 33.50 ? 709 HOH A O     1 
HETATM 3592 O  O     . HOH F 6 .   ? -6.749  60.658 58.996 1.00 42.00 ? 710 HOH A O     1 
HETATM 3593 O  O     . HOH F 6 .   ? -8.280  61.379 56.786 1.00 20.68 ? 711 HOH A O     1 
HETATM 3594 O  O     . HOH F 6 .   ? -0.643  61.034 55.993 1.00 44.69 ? 712 HOH A O     1 
HETATM 3595 O  O     . HOH F 6 .   ? -22.278 57.073 37.816 1.00 35.28 ? 713 HOH A O     1 
HETATM 3596 O  O     . HOH F 6 .   ? -36.444 46.285 26.218 1.00 19.97 ? 714 HOH A O     1 
HETATM 3597 O  O     . HOH F 6 .   ? -29.282 51.089 42.096 1.00 19.66 ? 715 HOH A O     1 
HETATM 3598 O  O     . HOH F 6 .   ? -15.595 19.310 43.348 1.00 43.48 ? 716 HOH A O     1 
HETATM 3599 O  O     . HOH F 6 .   ? -13.407 62.312 59.759 1.00 16.96 ? 717 HOH A O     1 
HETATM 3600 O  O     . HOH F 6 .   ? -5.472  30.520 59.138 1.00 15.75 ? 718 HOH A O     1 
HETATM 3601 O  O     . HOH F 6 .   ? -11.419 46.719 20.402 1.00 34.29 ? 719 HOH A O     1 
HETATM 3602 O  O     . HOH F 6 .   ? -8.740  45.944 21.329 1.00 40.75 ? 720 HOH A O     1 
HETATM 3603 O  O     . HOH F 6 .   ? 1.222   59.643 54.820 1.00 26.81 ? 721 HOH A O     1 
HETATM 3604 O  O     . HOH F 6 .   ? 17.094  37.574 41.852 1.00 29.54 ? 722 HOH A O     1 
HETATM 3605 O  O     . HOH F 6 .   ? -43.463 57.950 39.935 1.00 36.66 ? 723 HOH A O     1 
HETATM 3606 O  O     . HOH F 6 .   ? -30.562 46.154 26.763 1.00 31.95 ? 724 HOH A O     1 
HETATM 3607 O  O     . HOH F 6 .   ? -23.166 44.908 51.818 1.00 26.22 ? 725 HOH A O     1 
HETATM 3608 O  O     . HOH F 6 .   ? -24.982 50.192 23.982 1.00 13.67 ? 726 HOH A O     1 
HETATM 3609 O  O     . HOH F 6 .   ? -26.737 63.060 29.029 1.00 33.02 ? 727 HOH A O     1 
HETATM 3610 O  O     . HOH F 6 .   ? 3.093   35.125 31.926 1.00 34.27 ? 728 HOH A O     1 
HETATM 3611 O  O     . HOH F 6 .   ? -17.164 49.417 24.498 1.00 26.53 ? 729 HOH A O     1 
HETATM 3612 O  O     . HOH F 6 .   ? 1.479   53.910 41.296 1.00 25.41 ? 730 HOH A O     1 
HETATM 3613 O  O     . HOH F 6 .   ? -6.068  36.598 67.020 1.00 30.56 ? 731 HOH A O     1 
HETATM 3614 O  O     . HOH F 6 .   ? -30.873 51.286 24.711 1.00 24.71 ? 732 HOH A O     1 
HETATM 3615 O  O     . HOH F 6 .   ? -20.195 31.293 29.915 1.00 35.59 ? 733 HOH A O     1 
HETATM 3616 O  O     . HOH F 6 .   ? -18.677 50.495 39.677 1.00 2.14  ? 734 HOH A O     1 
HETATM 3617 O  O     . HOH F 6 .   ? -17.858 62.687 43.964 1.00 25.21 ? 735 HOH A O     1 
HETATM 3618 O  O     . HOH F 6 .   ? -8.089  51.773 31.403 1.00 22.64 ? 736 HOH A O     1 
HETATM 3619 O  O     . HOH F 6 .   ? -16.378 32.423 50.473 1.00 42.47 ? 737 HOH A O     1 
HETATM 3620 O  O     . HOH F 6 .   ? -7.565  55.726 36.528 1.00 21.65 ? 738 HOH A O     1 
HETATM 3621 O  O     . HOH F 6 .   ? -10.662 61.642 55.421 1.00 17.63 ? 739 HOH A O     1 
HETATM 3622 O  O     . HOH F 6 .   ? -4.403  54.941 24.436 1.00 28.91 ? 740 HOH A O     1 
HETATM 3623 O  O     . HOH F 6 .   ? -0.263  59.888 58.782 1.00 21.52 ? 741 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   1   GLY GLY A . n 
A 1 2   ASN 2   2   2   ASN ASN A . n 
A 1 3   ASN 3   3   3   ASN ASN A . n 
A 1 4   VAL 4   4   4   VAL VAL A . n 
A 1 5   VAL 5   5   5   VAL VAL A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   GLY 8   8   8   GLY GLY A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  GLN 10  10  10  GLN GLN A . n 
A 1 11  TRP 11  11  11  TRP TRP A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  ASP 13  13  13  ASP ASP A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  TYR 29  29  29  TYR TYR A . n 
A 1 30  VAL 30  30  30  VAL VAL A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  ARG 32  32  32  ARG ARG A . n 
A 1 33  TYR 33  33  33  TYR TYR A . n 
A 1 34  GLN 34  34  34  GLN GLN A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  HIS 37  37  37  HIS HIS A . n 
A 1 38  ASN 38  38  38  ASN ASN A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  HIS 41  41  41  HIS HIS A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  ASN 46  46  46  ASN ASN A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  HIS 53  53  53  HIS HIS A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  ILE 55  55  55  ILE ILE A . n 
A 1 56  PRO 56  56  56  PRO PRO A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  ILE 59  59  59  ILE ILE A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ARG 61  61  61  ARG ARG A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  ASN 63  63  63  ASN ASN A . n 
A 1 64  VAL 64  64  64  VAL VAL A . n 
A 1 65  THR 65  65  65  THR THR A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  GLY 69  69  69  GLY GLY A . n 
A 1 70  ASN 70  70  70  ASN ASN A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  ALA 77  77  77  ALA ALA A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  MET 80  80  80  MET MET A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  GLU 85  85  85  GLU GLU A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  ASP 88  88  88  ASP ASP A . n 
A 1 89  ARG 89  89  89  ARG ARG A . n 
A 1 90  GLY 90  90  90  GLY GLY A . n 
A 1 91  ILE 91  91  91  ILE ILE A . n 
A 1 92  PRO 92  92  92  PRO PRO A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  ARG 94  94  94  ARG ARG A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  ARG 96  96  96  ARG ARG A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 SER 100 100 100 SER SER A . n 
A 1 101 GLU 101 101 101 GLU GLU A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 CYS 103 103 103 CYS CYS A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 ASP 108 108 108 ASP ASP A . n 
A 1 109 TYR 109 109 109 TYR TYR A . n 
A 1 110 HIS 110 110 110 HIS HIS A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 ASP 114 114 114 ASP ASP A . n 
A 1 115 ASN 115 115 115 ASN ASN A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 ARG 117 117 117 ARG ARG A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 ARG 121 121 121 ARG ARG A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 LYS 124 124 124 LYS LYS A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 ILE 126 126 126 ILE ILE A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 THR 128 128 128 THR THR A . n 
A 1 129 THR 129 129 129 THR THR A . n 
A 1 130 GLY 130 130 130 GLY GLY A . n 
A 1 131 ARG 131 131 131 ARG ARG A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 ILE 133 133 133 ILE ILE A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 PRO 135 135 135 PRO PRO A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 ASP 139 139 139 ASP ASP A . n 
A 1 140 LYS 140 140 140 LYS LYS A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 ALA 142 142 142 ALA ALA A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 ARG 144 144 144 ARG ARG A . n 
A 1 145 GLY 145 145 145 GLY GLY A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 ARG 147 147 147 ARG ARG A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 ASP 153 153 153 ASP ASP A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 PHE 157 157 157 PHE PHE A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 GLU 159 159 159 GLU GLU A . n 
A 1 160 LYS 160 160 160 LYS LYS A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 LYS 162 162 162 LYS LYS A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 MET 165 165 165 MET MET A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 TYR 167 167 167 TYR TYR A . n 
A 1 168 HIS 168 168 168 HIS HIS A . n 
A 1 169 ASN 169 169 169 ASN ASN A . n 
A 1 170 PHE 170 170 170 PHE PHE A . n 
A 1 171 GLN 171 171 171 GLN GLN A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 ASN 174 174 174 ASN ASN A . n 
A 1 175 TYR 175 175 175 TYR TYR A . n 
A 1 176 TYR 176 176 176 TYR TYR A . n 
A 1 177 LYS 177 177 177 LYS LYS A . n 
A 1 178 ALA 178 178 178 ALA ALA A . n 
A 1 179 GLU 179 179 179 GLU GLU A . n 
A 1 180 ALA 180 180 180 ALA ALA A . n 
A 1 181 VAL 181 181 181 VAL VAL A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 TYR 183 183 183 TYR TYR A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 LYS 185 185 185 LYS LYS A . n 
A 1 186 VAL 186 186 186 VAL VAL A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 ASP 188 188 188 ASP ASP A . n 
A 1 189 ASP 189 189 189 ASP ASP A . n 
A 1 190 THR 190 190 190 THR THR A . n 
A 1 191 MET 191 191 191 MET MET A . n 
A 1 192 ALA 192 192 192 ALA ALA A . n 
A 1 193 VAL 193 193 193 VAL VAL A . n 
A 1 194 ALA 194 194 194 ALA ALA A . n 
A 1 195 ASP 195 195 195 ASP ASP A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 SER 199 199 199 SER SER A . n 
A 1 200 MET 200 200 200 MET MET A . n 
A 1 201 VAL 201 201 201 VAL VAL A . n 
A 1 202 VAL 202 202 202 VAL VAL A . n 
A 1 203 ASP 203 203 203 ASP ASP A . n 
A 1 204 VAL 204 204 204 VAL VAL A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 ASP 206 206 206 ASP ASP A . n 
A 1 207 LEU 207 207 207 LEU LEU A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 ASP 209 209 209 ASP ASP A . n 
A 1 210 GLN 210 210 210 GLN GLN A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 ARG 212 212 212 ARG ARG A . n 
A 1 213 GLN 213 213 213 GLN GLN A . n 
A 1 214 ARG 214 214 214 ARG ARG A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 ASP 216 216 216 ASP ASP A . n 
A 1 217 PHE 217 217 217 PHE PHE A . n 
A 1 218 VAL 218 218 218 VAL VAL A . n 
A 1 219 MET 219 219 219 MET MET A . n 
A 1 220 PHE 220 220 220 PHE PHE A . n 
A 1 221 GLU 221 221 221 GLU GLU A . n 
A 1 222 GLY 222 222 222 GLY GLY A . n 
A 1 223 ALA 223 223 223 ALA ALA A . n 
A 1 224 GLN 224 224 224 GLN GLN A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 THR 226 226 226 THR THR A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 ASP 229 229 229 ASP ASP A . n 
A 1 230 ILE 230 230 230 ILE ILE A . n 
A 1 231 ASP 231 231 231 ASP ASP A . n 
A 1 232 HIS 232 232 232 HIS HIS A . n 
A 1 233 GLY 233 233 233 GLY GLY A . n 
A 1 234 THR 234 234 234 THR THR A . n 
A 1 235 TYR 235 235 235 TYR TYR A . n 
A 1 236 PRO 236 236 236 PRO PRO A . n 
A 1 237 TYR 237 237 237 TYR TYR A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 THR 239 239 239 THR THR A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 ASN 242 242 242 ASN ASN A . n 
A 1 243 THR 243 243 243 THR THR A . n 
A 1 244 THR 244 244 244 THR THR A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 GLY 246 246 246 GLY GLY A . n 
A 1 247 GLY 247 247 247 GLY GLY A . n 
A 1 248 VAL 248 248 248 VAL VAL A . n 
A 1 249 ALA 249 249 249 ALA ALA A . n 
A 1 250 THR 250 250 250 THR THR A . n 
A 1 251 GLY 251 251 251 GLY GLY A . n 
A 1 252 SER 252 252 252 SER SER A . n 
A 1 253 GLY 253 253 253 GLY GLY A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 GLY 255 255 255 GLY GLY A . n 
A 1 256 PRO 256 256 256 PRO PRO A . n 
A 1 257 ARG 257 257 257 ARG ARG A . n 
A 1 258 TYR 258 258 258 TYR TYR A . n 
A 1 259 VAL 259 259 259 VAL VAL A . n 
A 1 260 ASP 260 260 260 ASP ASP A . n 
A 1 261 TYR 261 261 261 TYR TYR A . n 
A 1 262 VAL 262 262 262 VAL VAL A . n 
A 1 263 LEU 263 263 263 LEU LEU A . n 
A 1 264 GLY 264 264 264 GLY GLY A . n 
A 1 265 ILE 265 265 265 ILE ILE A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 LYS 267 267 267 LYS LYS A . n 
A 1 268 ALA 268 268 268 ALA ALA A . n 
A 1 269 TYR 269 269 269 TYR TYR A . n 
A 1 270 SER 270 270 270 SER SER A . n 
A 1 271 THR 271 271 271 THR THR A . n 
A 1 272 ARG 272 272 272 ARG ARG A . n 
A 1 273 VAL 273 273 273 VAL VAL A . n 
A 1 274 GLY 274 274 274 GLY GLY A . n 
A 1 275 ALA 275 275 275 ALA ALA A . n 
A 1 276 GLY 276 276 276 GLY GLY A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 PHE 278 278 278 PHE PHE A . n 
A 1 279 PRO 279 279 279 PRO PRO A . n 
A 1 280 THR 280 280 280 THR THR A . n 
A 1 281 GLU 281 281 281 GLU GLU A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PHE 283 283 283 PHE PHE A . n 
A 1 284 ASP 284 284 284 ASP ASP A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 THR 286 286 286 THR THR A . n 
A 1 287 GLY 287 287 287 GLY GLY A . n 
A 1 288 GLU 288 288 288 GLU GLU A . n 
A 1 289 PHE 289 289 289 PHE PHE A . n 
A 1 290 LEU 290 290 290 LEU LEU A . n 
A 1 291 CYS 291 291 291 CYS CYS A . n 
A 1 292 LYS 292 292 292 LYS LYS A . n 
A 1 293 GLN 293 293 293 GLN GLN A . n 
A 1 294 GLY 294 294 294 GLY GLY A . n 
A 1 295 ASN 295 295 295 ASN ASN A . n 
A 1 296 GLU 296 296 296 GLU GLU A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 THR 300 300 300 THR THR A . n 
A 1 301 THR 301 301 301 THR THR A . n 
A 1 302 GLY 302 302 302 GLY GLY A . n 
A 1 303 ARG 303 303 303 ARG ARG A . n 
A 1 304 ARG 304 304 304 ARG ARG A . n 
A 1 305 ARG 305 305 305 ARG ARG A . n 
A 1 306 ARG 306 306 306 ARG ARG A . n 
A 1 307 THR 307 307 307 THR THR A . n 
A 1 308 GLY 308 308 308 GLY GLY A . n 
A 1 309 TRP 309 309 309 TRP TRP A . n 
A 1 310 LEU 310 310 310 LEU LEU A . n 
A 1 311 ASP 311 311 311 ASP ASP A . n 
A 1 312 THR 312 312 312 THR THR A . n 
A 1 313 VAL 313 313 313 VAL VAL A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 VAL 315 315 315 VAL VAL A . n 
A 1 316 ARG 316 316 316 ARG ARG A . n 
A 1 317 ARG 317 317 317 ARG ARG A . n 
A 1 318 ALA 318 318 318 ALA ALA A . n 
A 1 319 VAL 319 319 319 VAL VAL A . n 
A 1 320 GLN 320 320 320 GLN GLN A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 ASN 322 322 322 ASN ASN A . n 
A 1 323 SER 323 323 323 SER SER A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 SER 325 325 325 SER SER A . n 
A 1 326 GLY 326 326 326 GLY GLY A . n 
A 1 327 PHE 327 327 327 PHE PHE A . n 
A 1 328 CYS 328 328 328 CYS CYS A . n 
A 1 329 LEU 329 329 329 LEU LEU A . n 
A 1 330 THR 330 330 330 THR THR A . n 
A 1 331 LYS 331 331 331 LYS LYS A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 ASP 333 333 333 ASP ASP A . n 
A 1 334 VAL 334 334 334 VAL VAL A . n 
A 1 335 LEU 335 335 335 LEU LEU A . n 
A 1 336 ASP 336 336 336 ASP ASP A . n 
A 1 337 GLY 337 337 337 GLY GLY A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 LYS 339 339 339 LYS LYS A . n 
A 1 340 GLU 340 340 340 GLU GLU A . n 
A 1 341 VAL 341 341 341 VAL VAL A . n 
A 1 342 LYS 342 342 342 LYS LYS A . n 
A 1 343 LEU 343 343 343 LEU LEU A . n 
A 1 344 CYS 344 344 344 CYS CYS A . n 
A 1 345 VAL 345 345 345 VAL VAL A . n 
A 1 346 ALA 346 346 346 ALA ALA A . n 
A 1 347 TYR 347 347 347 TYR TYR A . n 
A 1 348 ARG 348 348 348 ARG ARG A . n 
A 1 349 MET 349 349 349 MET MET A . n 
A 1 350 PRO 350 350 350 PRO PRO A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 GLY 352 352 352 GLY GLY A . n 
A 1 353 ARG 353 353 353 ARG ARG A . n 
A 1 354 GLU 354 354 354 GLU GLU A . n 
A 1 355 VAL 355 355 355 VAL VAL A . n 
A 1 356 THR 356 356 356 THR THR A . n 
A 1 357 THR 357 357 357 THR THR A . n 
A 1 358 THR 358 358 358 THR THR A . n 
A 1 359 PRO 359 359 359 PRO PRO A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 ALA 362 362 362 ALA ALA A . n 
A 1 363 ASP 363 363 363 ASP ASP A . n 
A 1 364 ASP 364 364 364 ASP ASP A . n 
A 1 365 TRP 365 365 365 TRP TRP A . n 
A 1 366 LYS 366 366 366 LYS LYS A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 VAL 368 368 368 VAL VAL A . n 
A 1 369 GLU 369 369 369 GLU GLU A . n 
A 1 370 PRO 370 370 370 PRO PRO A . n 
A 1 371 ILE 371 371 371 ILE ILE A . n 
A 1 372 TYR 372 372 372 TYR TYR A . n 
A 1 373 GLU 373 373 373 GLU GLU A . n 
A 1 374 THR 374 374 374 THR THR A . n 
A 1 375 MET 375 375 375 MET MET A . n 
A 1 376 PRO 376 376 376 PRO PRO A . n 
A 1 377 GLY 377 377 377 GLY GLY A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 SER 379 379 379 SER SER A . n 
A 1 380 GLU 380 380 380 GLU GLU A . n 
A 1 381 SER 381 381 381 SER SER A . n 
A 1 382 THR 382 382 382 THR THR A . n 
A 1 383 PHE 383 383 383 PHE PHE A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 VAL 385 385 385 VAL VAL A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASP 387 387 387 ASP ASP A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 SER 389 389 389 SER SER A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 PRO 392 392 392 PRO PRO A . n 
A 1 393 GLN 393 393 393 GLN GLN A . n 
A 1 394 ALA 394 394 394 ALA ALA A . n 
A 1 395 ALA 395 395 395 ALA ALA A . n 
A 1 396 LEU 396 396 396 LEU LEU A . n 
A 1 397 ASN 397 397 397 ASN ASN A . n 
A 1 398 TYR 398 398 398 TYR TYR A . n 
A 1 399 ILE 399 399 399 ILE ILE A . n 
A 1 400 LYS 400 400 400 LYS LYS A . n 
A 1 401 ARG 401 401 401 ARG ARG A . n 
A 1 402 ILE 402 402 402 ILE ILE A . n 
A 1 403 GLU 403 403 403 GLU GLU A . n 
A 1 404 GLU 404 404 404 GLU GLU A . n 
A 1 405 LEU 405 405 405 LEU LEU A . n 
A 1 406 THR 406 406 406 THR THR A . n 
A 1 407 GLY 407 407 407 GLY GLY A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 PRO 409 409 409 PRO PRO A . n 
A 1 410 ILE 410 410 410 ILE ILE A . n 
A 1 411 ASP 411 411 411 ASP ASP A . n 
A 1 412 ILE 412 412 412 ILE ILE A . n 
A 1 413 ILE 413 413 413 ILE ILE A . n 
A 1 414 SER 414 414 414 SER SER A . n 
A 1 415 THR 415 415 415 THR THR A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 PRO 417 417 417 PRO PRO A . n 
A 1 418 ASP 418 418 418 ASP ASP A . n 
A 1 419 ARG 419 419 419 ARG ARG A . n 
A 1 420 THR 420 420 420 THR THR A . n 
A 1 421 GLU 421 421 421 GLU GLU A . n 
A 1 422 THR 422 422 422 THR THR A . n 
A 1 423 MET 423 423 423 MET MET A . n 
A 1 424 ILE 424 424 424 ILE ILE A . n 
A 1 425 LEU 425 425 425 LEU LEU A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ASP 427 427 427 ASP ASP A . n 
A 1 428 PRO 428 428 428 PRO PRO A . n 
A 1 429 PHE 429 429 429 PHE PHE A . n 
A 1 430 ASP 430 430 430 ASP ASP A . n 
A 1 431 ALA 431 431 431 ALA ALA A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   435 435 MG  MG  A . 
C 3 HDA 1   437 437 HDA HAD A . 
D 4 IMO 1   440 440 IMO IPP A . 
E 5 GDP 1   432 432 GDP GDP A . 
F 6 HOH 1   501 501 HOH HOH A . 
F 6 HOH 2   502 502 HOH HOH A . 
F 6 HOH 3   503 503 HOH HOH A . 
F 6 HOH 4   504 504 HOH HOH A . 
F 6 HOH 5   505 505 HOH HOH A . 
F 6 HOH 6   506 506 HOH HOH A . 
F 6 HOH 7   507 507 HOH HOH A . 
F 6 HOH 8   508 508 HOH HOH A . 
F 6 HOH 9   509 509 HOH HOH A . 
F 6 HOH 10  510 510 HOH HOH A . 
F 6 HOH 11  511 511 HOH HOH A . 
F 6 HOH 12  512 512 HOH HOH A . 
F 6 HOH 13  513 513 HOH HOH A . 
F 6 HOH 14  514 514 HOH HOH A . 
F 6 HOH 15  515 515 HOH HOH A . 
F 6 HOH 16  516 516 HOH HOH A . 
F 6 HOH 17  517 517 HOH HOH A . 
F 6 HOH 18  518 518 HOH HOH A . 
F 6 HOH 19  519 519 HOH HOH A . 
F 6 HOH 20  520 520 HOH HOH A . 
F 6 HOH 21  521 521 HOH HOH A . 
F 6 HOH 22  522 522 HOH HOH A . 
F 6 HOH 23  523 523 HOH HOH A . 
F 6 HOH 24  524 524 HOH HOH A . 
F 6 HOH 25  525 525 HOH HOH A . 
F 6 HOH 26  526 526 HOH HOH A . 
F 6 HOH 27  527 527 HOH HOH A . 
F 6 HOH 28  528 528 HOH HOH A . 
F 6 HOH 29  529 529 HOH HOH A . 
F 6 HOH 30  530 530 HOH HOH A . 
F 6 HOH 31  531 531 HOH HOH A . 
F 6 HOH 32  532 532 HOH HOH A . 
F 6 HOH 33  533 533 HOH HOH A . 
F 6 HOH 34  534 534 HOH HOH A . 
F 6 HOH 35  535 535 HOH HOH A . 
F 6 HOH 36  536 536 HOH HOH A . 
F 6 HOH 37  537 537 HOH HOH A . 
F 6 HOH 38  538 538 HOH HOH A . 
F 6 HOH 39  539 539 HOH HOH A . 
F 6 HOH 40  540 540 HOH HOH A . 
F 6 HOH 41  541 541 HOH HOH A . 
F 6 HOH 42  542 542 HOH HOH A . 
F 6 HOH 43  543 543 HOH HOH A . 
F 6 HOH 44  544 544 HOH HOH A . 
F 6 HOH 45  545 545 HOH HOH A . 
F 6 HOH 46  546 546 HOH HOH A . 
F 6 HOH 47  547 547 HOH HOH A . 
F 6 HOH 48  548 548 HOH HOH A . 
F 6 HOH 49  549 549 HOH HOH A . 
F 6 HOH 50  550 550 HOH HOH A . 
F 6 HOH 51  551 551 HOH HOH A . 
F 6 HOH 52  552 552 HOH HOH A . 
F 6 HOH 53  553 553 HOH HOH A . 
F 6 HOH 54  554 554 HOH HOH A . 
F 6 HOH 55  555 555 HOH HOH A . 
F 6 HOH 56  556 556 HOH HOH A . 
F 6 HOH 57  557 557 HOH HOH A . 
F 6 HOH 58  558 558 HOH HOH A . 
F 6 HOH 59  559 559 HOH HOH A . 
F 6 HOH 60  560 560 HOH HOH A . 
F 6 HOH 61  561 561 HOH HOH A . 
F 6 HOH 62  562 562 HOH HOH A . 
F 6 HOH 63  563 563 HOH HOH A . 
F 6 HOH 64  564 564 HOH HOH A . 
F 6 HOH 65  565 565 HOH HOH A . 
F 6 HOH 66  566 566 HOH HOH A . 
F 6 HOH 67  567 567 HOH HOH A . 
F 6 HOH 68  568 568 HOH HOH A . 
F 6 HOH 69  569 569 HOH HOH A . 
F 6 HOH 70  570 570 HOH HOH A . 
F 6 HOH 71  571 571 HOH HOH A . 
F 6 HOH 72  572 572 HOH HOH A . 
F 6 HOH 73  573 573 HOH HOH A . 
F 6 HOH 74  574 574 HOH HOH A . 
F 6 HOH 75  575 575 HOH HOH A . 
F 6 HOH 76  576 576 HOH HOH A . 
F 6 HOH 77  577 577 HOH HOH A . 
F 6 HOH 78  578 578 HOH HOH A . 
F 6 HOH 79  579 579 HOH HOH A . 
F 6 HOH 80  580 580 HOH HOH A . 
F 6 HOH 81  581 581 HOH HOH A . 
F 6 HOH 82  582 582 HOH HOH A . 
F 6 HOH 83  583 583 HOH HOH A . 
F 6 HOH 84  584 584 HOH HOH A . 
F 6 HOH 85  585 585 HOH HOH A . 
F 6 HOH 86  586 586 HOH HOH A . 
F 6 HOH 87  587 587 HOH HOH A . 
F 6 HOH 88  588 588 HOH HOH A . 
F 6 HOH 89  589 589 HOH HOH A . 
F 6 HOH 90  590 590 HOH HOH A . 
F 6 HOH 91  591 591 HOH HOH A . 
F 6 HOH 92  592 592 HOH HOH A . 
F 6 HOH 93  593 593 HOH HOH A . 
F 6 HOH 94  594 594 HOH HOH A . 
F 6 HOH 95  595 595 HOH HOH A . 
F 6 HOH 96  596 596 HOH HOH A . 
F 6 HOH 97  597 597 HOH HOH A . 
F 6 HOH 98  598 598 HOH HOH A . 
F 6 HOH 99  599 599 HOH HOH A . 
F 6 HOH 100 600 600 HOH HOH A . 
F 6 HOH 101 602 602 HOH HOH A . 
F 6 HOH 102 603 603 HOH HOH A . 
F 6 HOH 103 604 604 HOH HOH A . 
F 6 HOH 104 605 605 HOH HOH A . 
F 6 HOH 105 606 606 HOH HOH A . 
F 6 HOH 106 607 607 HOH HOH A . 
F 6 HOH 107 608 608 HOH HOH A . 
F 6 HOH 108 609 609 HOH HOH A . 
F 6 HOH 109 610 610 HOH HOH A . 
F 6 HOH 110 611 611 HOH HOH A . 
F 6 HOH 111 612 612 HOH HOH A . 
F 6 HOH 112 613 613 HOH HOH A . 
F 6 HOH 113 614 614 HOH HOH A . 
F 6 HOH 114 615 615 HOH HOH A . 
F 6 HOH 115 616 616 HOH HOH A . 
F 6 HOH 116 618 618 HOH HOH A . 
F 6 HOH 117 619 619 HOH HOH A . 
F 6 HOH 118 620 620 HOH HOH A . 
F 6 HOH 119 621 621 HOH HOH A . 
F 6 HOH 120 622 622 HOH HOH A . 
F 6 HOH 121 623 623 HOH HOH A . 
F 6 HOH 122 624 624 HOH HOH A . 
F 6 HOH 123 625 625 HOH HOH A . 
F 6 HOH 124 626 626 HOH HOH A . 
F 6 HOH 125 627 627 HOH HOH A . 
F 6 HOH 126 628 628 HOH HOH A . 
F 6 HOH 127 629 629 HOH HOH A . 
F 6 HOH 128 630 630 HOH HOH A . 
F 6 HOH 129 631 631 HOH HOH A . 
F 6 HOH 130 632 632 HOH HOH A . 
F 6 HOH 131 633 633 HOH HOH A . 
F 6 HOH 132 634 634 HOH HOH A . 
F 6 HOH 133 635 635 HOH HOH A . 
F 6 HOH 134 636 636 HOH HOH A . 
F 6 HOH 135 637 637 HOH HOH A . 
F 6 HOH 136 638 638 HOH HOH A . 
F 6 HOH 137 640 640 HOH HOH A . 
F 6 HOH 138 641 641 HOH HOH A . 
F 6 HOH 139 642 642 HOH HOH A . 
F 6 HOH 140 643 643 HOH HOH A . 
F 6 HOH 141 644 644 HOH HOH A . 
F 6 HOH 142 645 645 HOH HOH A . 
F 6 HOH 143 646 646 HOH HOH A . 
F 6 HOH 144 647 647 HOH HOH A . 
F 6 HOH 145 648 648 HOH HOH A . 
F 6 HOH 146 649 649 HOH HOH A . 
F 6 HOH 147 650 650 HOH HOH A . 
F 6 HOH 148 651 651 HOH HOH A . 
F 6 HOH 149 652 652 HOH HOH A . 
F 6 HOH 150 653 653 HOH HOH A . 
F 6 HOH 151 654 654 HOH HOH A . 
F 6 HOH 152 655 655 HOH HOH A . 
F 6 HOH 153 656 656 HOH HOH A . 
F 6 HOH 154 657 657 HOH HOH A . 
F 6 HOH 155 658 658 HOH HOH A . 
F 6 HOH 156 659 659 HOH HOH A . 
F 6 HOH 157 660 660 HOH HOH A . 
F 6 HOH 158 661 661 HOH HOH A . 
F 6 HOH 159 662 662 HOH HOH A . 
F 6 HOH 160 663 663 HOH HOH A . 
F 6 HOH 161 664 664 HOH HOH A . 
F 6 HOH 162 665 665 HOH HOH A . 
F 6 HOH 163 666 666 HOH HOH A . 
F 6 HOH 164 667 667 HOH HOH A . 
F 6 HOH 165 668 668 HOH HOH A . 
F 6 HOH 166 669 669 HOH HOH A . 
F 6 HOH 167 670 670 HOH HOH A . 
F 6 HOH 168 671 671 HOH HOH A . 
F 6 HOH 169 672 672 HOH HOH A . 
F 6 HOH 170 673 673 HOH HOH A . 
F 6 HOH 171 674 674 HOH HOH A . 
F 6 HOH 172 675 675 HOH HOH A . 
F 6 HOH 173 676 676 HOH HOH A . 
F 6 HOH 174 677 677 HOH HOH A . 
F 6 HOH 175 678 678 HOH HOH A . 
F 6 HOH 176 679 679 HOH HOH A . 
F 6 HOH 177 680 680 HOH HOH A . 
F 6 HOH 178 681 681 HOH HOH A . 
F 6 HOH 179 682 682 HOH HOH A . 
F 6 HOH 180 683 683 HOH HOH A . 
F 6 HOH 181 684 684 HOH HOH A . 
F 6 HOH 182 685 685 HOH HOH A . 
F 6 HOH 183 686 686 HOH HOH A . 
F 6 HOH 184 687 687 HOH HOH A . 
F 6 HOH 185 688 688 HOH HOH A . 
F 6 HOH 186 689 689 HOH HOH A . 
F 6 HOH 187 690 690 HOH HOH A . 
F 6 HOH 188 691 691 HOH HOH A . 
F 6 HOH 189 692 692 HOH HOH A . 
F 6 HOH 190 693 693 HOH HOH A . 
F 6 HOH 191 694 694 HOH HOH A . 
F 6 HOH 192 695 695 HOH HOH A . 
F 6 HOH 193 696 696 HOH HOH A . 
F 6 HOH 194 697 697 HOH HOH A . 
F 6 HOH 195 698 698 HOH HOH A . 
F 6 HOH 196 699 699 HOH HOH A . 
F 6 HOH 197 700 700 HOH HOH A . 
F 6 HOH 198 701 701 HOH HOH A . 
F 6 HOH 199 702 702 HOH HOH A . 
F 6 HOH 200 703 703 HOH HOH A . 
F 6 HOH 201 704 704 HOH HOH A . 
F 6 HOH 202 705 705 HOH HOH A . 
F 6 HOH 203 706 706 HOH HOH A . 
F 6 HOH 204 707 707 HOH HOH A . 
F 6 HOH 205 708 708 HOH HOH A . 
F 6 HOH 206 709 709 HOH HOH A . 
F 6 HOH 207 710 710 HOH HOH A . 
F 6 HOH 208 711 711 HOH HOH A . 
F 6 HOH 209 712 712 HOH HOH A . 
F 6 HOH 210 713 713 HOH HOH A . 
F 6 HOH 211 714 714 HOH HOH A . 
F 6 HOH 212 715 715 HOH HOH A . 
F 6 HOH 213 716 716 HOH HOH A . 
F 6 HOH 214 717 717 HOH HOH A . 
F 6 HOH 215 718 718 HOH HOH A . 
F 6 HOH 216 719 719 HOH HOH A . 
F 6 HOH 217 720 720 HOH HOH A . 
F 6 HOH 218 721 721 HOH HOH A . 
F 6 HOH 219 722 722 HOH HOH A . 
F 6 HOH 220 723 723 HOH HOH A . 
F 6 HOH 221 724 724 HOH HOH A . 
F 6 HOH 222 725 725 HOH HOH A . 
F 6 HOH 223 726 726 HOH HOH A . 
F 6 HOH 224 727 727 HOH HOH A . 
F 6 HOH 225 728 728 HOH HOH A . 
F 6 HOH 226 729 729 HOH HOH A . 
F 6 HOH 227 730 730 HOH HOH A . 
F 6 HOH 228 731 731 HOH HOH A . 
F 6 HOH 229 732 732 HOH HOH A . 
F 6 HOH 230 733 733 HOH HOH A . 
F 6 HOH 231 734 734 HOH HOH A . 
F 6 HOH 232 735 735 HOH HOH A . 
F 6 HOH 233 736 736 HOH HOH A . 
F 6 HOH 234 737 737 HOH HOH A . 
F 6 HOH 235 738 738 HOH HOH A . 
F 6 HOH 236 739 739 HOH HOH A . 
F 6 HOH 237 740 740 HOH HOH A . 
F 6 HOH 238 741 741 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 9760  ? 
1 MORE         -52   ? 
1 'SSA (A^2)'  27530 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z          1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  
1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 6_555 -x,-x+y,-z+2/3 -0.5000000000 -0.8662140575 0.0000000000 0.0000000000 -0.8658367911 
0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 105.6524035922 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 13 ? A ASP 13  ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O   ? A GLY 40 ? A GLY 40  ? 1_555 163.5 ? 
2  OD1 ? A ASP 13 ? A ASP 13  ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O   ? C HDA .  ? A HDA 437 ? 1_555 74.0  ? 
3  O   ? A GLY 40 ? A GLY 40  ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O   ? C HDA .  ? A HDA 437 ? 1_555 90.4  ? 
4  OD1 ? A ASP 13 ? A ASP 13  ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O1  ? D IMO .  ? A IMO 440 ? 1_555 88.0  ? 
5  O   ? A GLY 40 ? A GLY 40  ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O1  ? D IMO .  ? A IMO 440 ? 1_555 98.6  ? 
6  O   ? C HDA .  ? A HDA 437 ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O1  ? D IMO .  ? A IMO 440 ? 1_555 94.3  ? 
7  OD1 ? A ASP 13 ? A ASP 13  ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O2B ? E GDP .  ? A GDP 432 ? 1_555 105.8 ? 
8  O   ? A GLY 40 ? A GLY 40  ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O2B ? E GDP .  ? A GDP 432 ? 1_555 90.5  ? 
9  O   ? C HDA .  ? A HDA 437 ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O2B ? E GDP .  ? A GDP 432 ? 1_555 169.9 ? 
10 O1  ? D IMO .  ? A IMO 440 ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O2B ? E GDP .  ? A GDP 432 ? 1_555 75.6  ? 
11 OD1 ? A ASP 13 ? A ASP 13  ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O2A ? E GDP .  ? A GDP 432 ? 1_555 92.6  ? 
12 O   ? A GLY 40 ? A GLY 40  ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O2A ? E GDP .  ? A GDP 432 ? 1_555 82.8  ? 
13 O   ? C HDA .  ? A HDA 437 ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O2A ? E GDP .  ? A GDP 432 ? 1_555 92.8  ? 
14 O1  ? D IMO .  ? A IMO 440 ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O2A ? E GDP .  ? A GDP 432 ? 1_555 172.8 ? 
15 O2B ? E GDP .  ? A GDP 432 ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O2A ? E GDP .  ? A GDP 432 ? 1_555 97.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-06-17 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
5 'Structure model' 1 4 2018-03-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
5 5 'Structure model' 'Database references'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' software           
2 5 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.name'              
2 5 'Structure model' '_struct_ref_seq_dif.details' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' .     ? 1 
X-PLOR refinement       3.851 ? 2 
X-GEN  'data reduction' .     ? 3 
X-GEN  'data scaling'   .     ? 4 
X-PLOR phasing          .     ? 5 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              74 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              74 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              74 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                134.66 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            19.36 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 10  ? ? -120.41 -114.09 
2  1 ASP A 13  ? ? 49.74   27.64   
3  1 LYS A 124 ? ? -85.75  33.67   
4  1 ASP A 153 ? ? -162.97 89.63   
5  1 ALA A 194 ? ? -27.79  -62.13  
6  1 GLN A 224 ? ? 56.30   -166.97 
7  1 ALA A 268 ? ? 93.00   -20.91  
8  1 PHE A 278 ? ? -161.92 74.09   
9  1 ASP A 284 ? ? -106.47 -162.86 
10 1 ALA A 299 ? ? -65.32  2.75    
11 1 LEU A 360 ? ? -96.74  -89.15  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'                        MG  
3 HADACIDIN                              HDA 
4 '6-O-PHOSPHORYL INOSINE MONOPHOSPHATE' IMO 
5 "GUANOSINE-5'-DIPHOSPHATE"             GDP 
6 water                                  HOH 
#