data_1CG4
# 
_entry.id   1CG4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.291 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1CG4         
RCSB  RCSB000740   
WWPDB D_1000000740 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1CG4 
_pdbx_database_status.recvd_initial_deposition_date   1999-03-26 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Choe, J.Y.'   1 
'Poland, B.W.' 2 
'Fromm, H.'    3 
'Honzatko, R.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Mechanistic implications from crystalline complexes of wild-type and mutant adenylosuccinate synthetases from Escherichia coli.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            38 
_citation.page_first                6953 
_citation.page_last                 6961 
_citation.year                      1999 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10346917 
_citation.pdbx_database_id_DOI      10.1021/bi990159s 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Choe, J.Y.'     1 
primary 'Poland, B.W.'   2 
primary 'Fromm, H.J.'    3 
primary 'Honzatko, R.B.' 4 
# 
_cell.entry_id           1CG4 
_cell.length_a           80.210 
_cell.length_b           80.210 
_cell.length_c           157.870 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1CG4 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN (ADENYLOSUCCINATE SYNTHETASE)' 47225.559 1   6.3.4.4 R303L ? ? 
2 non-polymer syn 'MAGNESIUM ION'                         24.305    1   ?       ?     ? ? 
3 non-polymer syn '6-O-PHOSPHORYL INOSINE MONOPHOSPHATE'  428.186   1   ?       ?     ? ? 
4 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE"              443.201   1   ?       ?     ? ? 
5 water       nat water                                   18.015    166 ?       ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AMPSASE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILRENVTSIIGNGVVLSPAALM
KEMKELEDRGIPVRERLLLSEACPLILDYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEK
LKEVMEYHNFQLVNYYKAEAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVTS
SNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGLRRRTGWLDTVAVRRAVQ
LNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTTPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIK
RIEELTGVPIDIISTGPDRTETMILRDPFDA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILRENVTSIIGNGVVLSPAALM
KEMKELEDRGIPVRERLLLSEACPLILDYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEK
LKEVMEYHNFQLVNYYKAEAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVTS
SNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGLRRRTGWLDTVAVRRAVQ
LNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTTPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIK
RIEELTGVPIDIISTGPDRTETMILRDPFDA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ASN n 
1 3   ASN n 
1 4   VAL n 
1 5   VAL n 
1 6   VAL n 
1 7   LEU n 
1 8   GLY n 
1 9   THR n 
1 10  GLN n 
1 11  TRP n 
1 12  GLY n 
1 13  ASP n 
1 14  GLU n 
1 15  GLY n 
1 16  LYS n 
1 17  GLY n 
1 18  LYS n 
1 19  ILE n 
1 20  VAL n 
1 21  ASP n 
1 22  LEU n 
1 23  LEU n 
1 24  THR n 
1 25  GLU n 
1 26  ARG n 
1 27  ALA n 
1 28  LYS n 
1 29  TYR n 
1 30  VAL n 
1 31  VAL n 
1 32  ARG n 
1 33  TYR n 
1 34  GLN n 
1 35  GLY n 
1 36  GLY n 
1 37  HIS n 
1 38  ASN n 
1 39  ALA n 
1 40  GLY n 
1 41  HIS n 
1 42  THR n 
1 43  LEU n 
1 44  VAL n 
1 45  ILE n 
1 46  ASN n 
1 47  GLY n 
1 48  GLU n 
1 49  LYS n 
1 50  THR n 
1 51  VAL n 
1 52  LEU n 
1 53  HIS n 
1 54  LEU n 
1 55  ILE n 
1 56  PRO n 
1 57  SER n 
1 58  GLY n 
1 59  ILE n 
1 60  LEU n 
1 61  ARG n 
1 62  GLU n 
1 63  ASN n 
1 64  VAL n 
1 65  THR n 
1 66  SER n 
1 67  ILE n 
1 68  ILE n 
1 69  GLY n 
1 70  ASN n 
1 71  GLY n 
1 72  VAL n 
1 73  VAL n 
1 74  LEU n 
1 75  SER n 
1 76  PRO n 
1 77  ALA n 
1 78  ALA n 
1 79  LEU n 
1 80  MET n 
1 81  LYS n 
1 82  GLU n 
1 83  MET n 
1 84  LYS n 
1 85  GLU n 
1 86  LEU n 
1 87  GLU n 
1 88  ASP n 
1 89  ARG n 
1 90  GLY n 
1 91  ILE n 
1 92  PRO n 
1 93  VAL n 
1 94  ARG n 
1 95  GLU n 
1 96  ARG n 
1 97  LEU n 
1 98  LEU n 
1 99  LEU n 
1 100 SER n 
1 101 GLU n 
1 102 ALA n 
1 103 CYS n 
1 104 PRO n 
1 105 LEU n 
1 106 ILE n 
1 107 LEU n 
1 108 ASP n 
1 109 TYR n 
1 110 HIS n 
1 111 VAL n 
1 112 ALA n 
1 113 LEU n 
1 114 ASP n 
1 115 ASN n 
1 116 ALA n 
1 117 ARG n 
1 118 GLU n 
1 119 LYS n 
1 120 ALA n 
1 121 ARG n 
1 122 GLY n 
1 123 ALA n 
1 124 LYS n 
1 125 ALA n 
1 126 ILE n 
1 127 GLY n 
1 128 THR n 
1 129 THR n 
1 130 GLY n 
1 131 ARG n 
1 132 GLY n 
1 133 ILE n 
1 134 GLY n 
1 135 PRO n 
1 136 ALA n 
1 137 TYR n 
1 138 GLU n 
1 139 ASP n 
1 140 LYS n 
1 141 VAL n 
1 142 ALA n 
1 143 ARG n 
1 144 ARG n 
1 145 GLY n 
1 146 LEU n 
1 147 ARG n 
1 148 VAL n 
1 149 GLY n 
1 150 ASP n 
1 151 LEU n 
1 152 PHE n 
1 153 ASP n 
1 154 LYS n 
1 155 GLU n 
1 156 THR n 
1 157 PHE n 
1 158 ALA n 
1 159 GLU n 
1 160 LYS n 
1 161 LEU n 
1 162 LYS n 
1 163 GLU n 
1 164 VAL n 
1 165 MET n 
1 166 GLU n 
1 167 TYR n 
1 168 HIS n 
1 169 ASN n 
1 170 PHE n 
1 171 GLN n 
1 172 LEU n 
1 173 VAL n 
1 174 ASN n 
1 175 TYR n 
1 176 TYR n 
1 177 LYS n 
1 178 ALA n 
1 179 GLU n 
1 180 ALA n 
1 181 VAL n 
1 182 ASP n 
1 183 TYR n 
1 184 GLN n 
1 185 LYS n 
1 186 VAL n 
1 187 LEU n 
1 188 ASP n 
1 189 ASP n 
1 190 THR n 
1 191 MET n 
1 192 ALA n 
1 193 VAL n 
1 194 ALA n 
1 195 ASP n 
1 196 ILE n 
1 197 LEU n 
1 198 THR n 
1 199 SER n 
1 200 MET n 
1 201 VAL n 
1 202 VAL n 
1 203 ASP n 
1 204 VAL n 
1 205 SER n 
1 206 ASP n 
1 207 LEU n 
1 208 LEU n 
1 209 ASP n 
1 210 GLN n 
1 211 ALA n 
1 212 ARG n 
1 213 GLN n 
1 214 ARG n 
1 215 GLY n 
1 216 ASP n 
1 217 PHE n 
1 218 VAL n 
1 219 MET n 
1 220 PHE n 
1 221 GLU n 
1 222 GLY n 
1 223 ALA n 
1 224 GLN n 
1 225 GLY n 
1 226 THR n 
1 227 LEU n 
1 228 LEU n 
1 229 ASP n 
1 230 ILE n 
1 231 ASP n 
1 232 HIS n 
1 233 GLY n 
1 234 THR n 
1 235 TYR n 
1 236 PRO n 
1 237 TYR n 
1 238 VAL n 
1 239 THR n 
1 240 SER n 
1 241 SER n 
1 242 ASN n 
1 243 THR n 
1 244 THR n 
1 245 ALA n 
1 246 GLY n 
1 247 GLY n 
1 248 VAL n 
1 249 ALA n 
1 250 THR n 
1 251 GLY n 
1 252 SER n 
1 253 GLY n 
1 254 LEU n 
1 255 GLY n 
1 256 PRO n 
1 257 ARG n 
1 258 TYR n 
1 259 VAL n 
1 260 ASP n 
1 261 TYR n 
1 262 VAL n 
1 263 LEU n 
1 264 GLY n 
1 265 ILE n 
1 266 LEU n 
1 267 LYS n 
1 268 ALA n 
1 269 TYR n 
1 270 SER n 
1 271 THR n 
1 272 ARG n 
1 273 VAL n 
1 274 GLY n 
1 275 ALA n 
1 276 GLY n 
1 277 PRO n 
1 278 PHE n 
1 279 PRO n 
1 280 THR n 
1 281 GLU n 
1 282 LEU n 
1 283 PHE n 
1 284 ASP n 
1 285 GLU n 
1 286 THR n 
1 287 GLY n 
1 288 GLU n 
1 289 PHE n 
1 290 LEU n 
1 291 CYS n 
1 292 LYS n 
1 293 GLN n 
1 294 GLY n 
1 295 ASN n 
1 296 GLU n 
1 297 PHE n 
1 298 GLY n 
1 299 ALA n 
1 300 THR n 
1 301 THR n 
1 302 GLY n 
1 303 LEU n 
1 304 ARG n 
1 305 ARG n 
1 306 ARG n 
1 307 THR n 
1 308 GLY n 
1 309 TRP n 
1 310 LEU n 
1 311 ASP n 
1 312 THR n 
1 313 VAL n 
1 314 ALA n 
1 315 VAL n 
1 316 ARG n 
1 317 ARG n 
1 318 ALA n 
1 319 VAL n 
1 320 GLN n 
1 321 LEU n 
1 322 ASN n 
1 323 SER n 
1 324 LEU n 
1 325 SER n 
1 326 GLY n 
1 327 PHE n 
1 328 CYS n 
1 329 LEU n 
1 330 THR n 
1 331 LYS n 
1 332 LEU n 
1 333 ASP n 
1 334 VAL n 
1 335 LEU n 
1 336 ASP n 
1 337 GLY n 
1 338 LEU n 
1 339 LYS n 
1 340 GLU n 
1 341 VAL n 
1 342 LYS n 
1 343 LEU n 
1 344 CYS n 
1 345 VAL n 
1 346 ALA n 
1 347 TYR n 
1 348 ARG n 
1 349 MET n 
1 350 PRO n 
1 351 ASP n 
1 352 GLY n 
1 353 ARG n 
1 354 GLU n 
1 355 VAL n 
1 356 THR n 
1 357 THR n 
1 358 THR n 
1 359 PRO n 
1 360 LEU n 
1 361 ALA n 
1 362 ALA n 
1 363 ASP n 
1 364 ASP n 
1 365 TRP n 
1 366 LYS n 
1 367 GLY n 
1 368 VAL n 
1 369 GLU n 
1 370 PRO n 
1 371 ILE n 
1 372 TYR n 
1 373 GLU n 
1 374 THR n 
1 375 MET n 
1 376 PRO n 
1 377 GLY n 
1 378 TRP n 
1 379 SER n 
1 380 GLU n 
1 381 SER n 
1 382 THR n 
1 383 PHE n 
1 384 GLY n 
1 385 VAL n 
1 386 LYS n 
1 387 ASP n 
1 388 ARG n 
1 389 SER n 
1 390 GLY n 
1 391 LEU n 
1 392 PRO n 
1 393 GLN n 
1 394 ALA n 
1 395 ALA n 
1 396 LEU n 
1 397 ASN n 
1 398 TYR n 
1 399 ILE n 
1 400 LYS n 
1 401 ARG n 
1 402 ILE n 
1 403 GLU n 
1 404 GLU n 
1 405 LEU n 
1 406 THR n 
1 407 GLY n 
1 408 VAL n 
1 409 PRO n 
1 410 ILE n 
1 411 ASP n 
1 412 ILE n 
1 413 ILE n 
1 414 SER n 
1 415 THR n 
1 416 GLY n 
1 417 PRO n 
1 418 ASP n 
1 419 ARG n 
1 420 THR n 
1 421 GLU n 
1 422 THR n 
1 423 MET n 
1 424 ILE n 
1 425 LEU n 
1 426 ARG n 
1 427 ASP n 
1 428 PRO n 
1 429 PHE n 
1 430 ASP n 
1 431 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   'Escherichia coli' 
_entity_src_gen.gene_src_strain                    K-12 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli K12' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     83333 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'PUR A- STRAIN H1238' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTrc99A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PURA_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P0A7D4 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1CG4 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 431 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P0A7D4 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  431 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       431 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1CG4 
_struct_ref_seq_dif.mon_id                       LEU 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      303 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P0A7D4 
_struct_ref_seq_dif.db_mon_id                    ARG 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          303 
_struct_ref_seq_dif.details                      'ENGINEERED MUTATION' 
_struct_ref_seq_dif.pdbx_auth_seq_num            303 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                               ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                               ? 'C3 H7 N O2 S'      121.158 
GDP 'RNA linking'       n "GUANOSINE-5'-DIPHOSPHATE"             ? 'C10 H15 N5 O11 P2' 443.201 
GLN 'L-peptide linking' y GLUTAMINE                              ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                              ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                  ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ? 'C6 H13 N O2'       131.173 
IMO non-polymer         . '6-O-PHOSPHORYL INOSINE MONOPHOSPHATE' ? 'C10 H14 N4 O11 P2' 428.186 
LEU 'L-peptide linking' y LEUCINE                                ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                 ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                             ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                        ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                          ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                 ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                              ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                               ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                 ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1CG4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.10 
_exptl_crystal.density_percent_sol   60.36 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    '13% PEG 8000, 100MM NA-CACODYLATE(PH 6.5)' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           120 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   SIEMENS 
_diffrn_detector.pdbx_collection_date   1997-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        SIEMENS 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1CG4 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.5 
_reflns.number_obs                   26203 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99 
_reflns.pdbx_Rmerge_I_obs            0.1070000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.5 
_reflns.R_free_details               ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.5 
_reflns_shell.d_res_low              2.7 
_reflns_shell.percent_possible_all   99 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1CG4 
_refine.ls_number_reflns_obs                     17525 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                0 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             5.0 
_refine.ls_d_res_high                            2.5 
_refine.ls_percent_reflns_obs                    66.9 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1790000 
_refine.ls_R_factor_R_free                       0.2520000 
_refine.ls_R_factor_R_free_error                 0.0056 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10 
_refine.ls_number_reflns_R_free                  1753 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               35 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1GIM 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3318 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         56 
_refine_hist.number_atoms_solvent             166 
_refine_hist.number_atoms_total               3540 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        5.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.76  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARNAH1E.DNA TOPH19.PEP   'X-RAY DIFFRACTION' 
3 PARAM19.SOL  ?            'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1CG4 
_struct.title                     
'STRUCTURE OF THE MUTANT (R303L) OF ADENYLOSUCCINATE SYNTHETASE FROM E. COLI COMPLEXED WITH, GDP, 6-PHOSPHORYL-IMP, AND MG2+' 
_struct.pdbx_descriptor           'ADENYLOSUCCINATE SYNTHETASE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1CG4 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            'LIGASE, GTP-HYDROLYSING ENZYMES, PURINE 2 NUCLEOTIDE BIOSYNTHESIS, 6-PHOSPORYL-IMP' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 16  ? ARG A 26  ? LYS A 16  ARG A 26  1 ? 11 
HELX_P HELX_P2  2  PRO A 76  ? ASP A 88  ? PRO A 76  ASP A 88  1 ? 13 
HELX_P HELX_P3  3  VAL A 93  ? ARG A 96  ? VAL A 93  ARG A 96  1 ? 4  
HELX_P HELX_P4  4  ASP A 108 ? LYS A 124 ? ASP A 108 LYS A 124 1 ? 17 
HELX_P HELX_P5  5  ILE A 133 ? VAL A 141 ? ILE A 133 VAL A 141 1 ? 9  
HELX_P HELX_P6  6  VAL A 148 ? PHE A 152 ? VAL A 148 PHE A 152 5 ? 5  
HELX_P HELX_P7  7  LYS A 154 ? ASN A 174 ? LYS A 154 ASN A 174 1 ? 21 
HELX_P HELX_P8  8  TYR A 183 ? MET A 200 ? TYR A 183 MET A 200 1 ? 18 
HELX_P HELX_P9  9  VAL A 204 ? ARG A 214 ? VAL A 204 ARG A 214 1 ? 11 
HELX_P HELX_P10 10 THR A 226 ? LEU A 228 ? THR A 226 LEU A 228 5 ? 3  
HELX_P HELX_P11 11 ALA A 245 ? SER A 252 ? ALA A 245 SER A 252 5 ? 8  
HELX_P HELX_P12 12 PRO A 256 ? TYR A 258 ? PRO A 256 TYR A 258 5 ? 3  
HELX_P HELX_P13 13 GLU A 285 ? GLY A 294 ? GLU A 285 GLY A 294 1 ? 10 
HELX_P HELX_P14 14 THR A 312 ? ASN A 322 ? THR A 312 ASN A 322 1 ? 11 
HELX_P HELX_P15 15 LEU A 332 ? VAL A 334 ? LEU A 332 VAL A 334 5 ? 3  
HELX_P HELX_P16 16 ALA A 362 ? TRP A 365 ? ALA A 362 TRP A 365 5 ? 4  
HELX_P HELX_P17 17 ARG A 388 ? GLY A 390 ? ARG A 388 GLY A 390 5 ? 3  
HELX_P HELX_P18 18 GLN A 393 ? THR A 406 ? GLN A 393 THR A 406 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? D GDP . O2B ? ? ? 1_555 B MG  .  MG  ? ? A GDP 432 A MG  435 1_555 ? ? ? ? ? ? ? 1.999 ? 
metalc2 metalc ? ? B MG  . MG  ? ? ? 1_555 C IMO .  O1  ? ? A MG  435 A IMO 440 1_555 ? ? ? ? ? ? ? 2.077 ? 
metalc3 metalc ? ? B MG  . MG  ? ? ? 1_555 E HOH .  O   ? ? A MG  435 A HOH 490 1_555 ? ? ? ? ? ? ? 2.177 ? 
metalc4 metalc ? ? B MG  . MG  ? ? ? 1_555 A ASP 13 OD1 ? ? A MG  435 A ASP 13  1_555 ? ? ? ? ? ? ? 2.604 ? 
metalc5 metalc ? ? B MG  . MG  ? ? ? 1_555 D GDP .  O2A ? ? A MG  435 A GDP 432 1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc6 metalc ? ? B MG  . MG  ? ? ? 1_555 A GLY 40 O   ? ? A MG  435 A GLY 40  1_555 ? ? ? ? ? ? ? 1.942 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TYR 
_struct_mon_prot_cis.label_seq_id           235 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TYR 
_struct_mon_prot_cis.auth_seq_id            235 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    236 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     236 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       1.79 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? parallel      
A 8 9 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 422 ? ILE A 424 ? THR A 422 ILE A 424 
A 2 ILE A 410 ? SER A 414 ? ILE A 410 SER A 414 
A 3 GLY A 326 ? LEU A 329 ? GLY A 326 LEU A 329 
A 4 TYR A 261 ? LEU A 266 ? TYR A 261 LEU A 266 
A 5 ASN A 3   ? GLY A 8   ? ASN A 3   GLY A 8   
A 6 VAL A 218 ? GLU A 221 ? VAL A 218 GLU A 221 
A 7 TYR A 29  ? ARG A 32  ? TYR A 29  ARG A 32  
A 8 THR A 65  ? ILE A 68  ? THR A 65  ILE A 68  
A 9 LEU A 97  ? LEU A 99  ? LEU A 97  LEU A 99  
B 1 HIS A 41  ? ILE A 45  ? HIS A 41  ILE A 45  
B 2 GLU A 48  ? LEU A 52  ? GLU A 48  LEU A 52  
C 1 TYR A 269 ? ARG A 272 ? TYR A 269 ARG A 272 
C 2 ARG A 306 ? TRP A 309 ? ARG A 306 TRP A 309 
D 1 GLU A 340 ? ARG A 348 ? GLU A 340 ARG A 348 
D 2 GLU A 369 ? PRO A 376 ? GLU A 369 PRO A 376 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O MET A 423 ? O MET A 423 N ILE A 413 ? N ILE A 413 
A 2 3 O ASP A 411 ? O ASP A 411 N PHE A 327 ? N PHE A 327 
A 3 4 O GLY A 326 ? O GLY A 326 N GLY A 264 ? N GLY A 264 
A 4 5 O TYR A 261 ? O TYR A 261 N VAL A 5   ? N VAL A 5   
A 5 6 O VAL A 4   ? O VAL A 4   N VAL A 218 ? N VAL A 218 
A 6 7 O MET A 219 ? O MET A 219 N TYR A 29  ? N TYR A 29  
A 7 8 O VAL A 30  ? O VAL A 30  N THR A 65  ? N THR A 65  
A 8 9 O SER A 66  ? O SER A 66  N LEU A 98  ? N LEU A 98  
B 1 2 O HIS A 41  ? O HIS A 41  N LEU A 52  ? N LEU A 52  
C 1 2 O SER A 270 ? O SER A 270 N GLY A 308 ? N GLY A 308 
D 1 2 O VAL A 341 ? O VAL A 341 N MET A 375 ? N MET A 375 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 435'  
AC2 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE IMO A 440' 
AC3 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE GDP A 432' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  ASP A 13  ? ASP A 13  . ? 1_555 ? 
2  AC1 5  GLY A 40  ? GLY A 40  . ? 1_555 ? 
3  AC1 5  GDP D .   ? GDP A 432 . ? 1_555 ? 
4  AC1 5  IMO C .   ? IMO A 440 . ? 1_555 ? 
5  AC1 5  HOH E .   ? HOH A 490 . ? 1_555 ? 
6  AC2 25 TRP A 11  ? TRP A 11  . ? 1_555 ? 
7  AC2 25 GLY A 12  ? GLY A 12  . ? 1_555 ? 
8  AC2 25 ASP A 13  ? ASP A 13  . ? 1_555 ? 
9  AC2 25 LYS A 16  ? LYS A 16  . ? 1_555 ? 
10 AC2 25 ASN A 38  ? ASN A 38  . ? 1_555 ? 
11 AC2 25 ALA A 39  ? ALA A 39  . ? 1_555 ? 
12 AC2 25 GLY A 40  ? GLY A 40  . ? 1_555 ? 
13 AC2 25 GLY A 127 ? GLY A 127 . ? 1_555 ? 
14 AC2 25 THR A 128 ? THR A 128 . ? 1_555 ? 
15 AC2 25 THR A 129 ? THR A 129 . ? 1_555 ? 
16 AC2 25 ARG A 143 ? ARG A 143 . ? 6_555 ? 
17 AC2 25 ALA A 223 ? ALA A 223 . ? 1_555 ? 
18 AC2 25 GLN A 224 ? GLN A 224 . ? 1_555 ? 
19 AC2 25 VAL A 238 ? VAL A 238 . ? 1_555 ? 
20 AC2 25 THR A 239 ? THR A 239 . ? 1_555 ? 
21 AC2 25 VAL A 273 ? VAL A 273 . ? 1_555 ? 
22 AC2 25 GLY A 274 ? GLY A 274 . ? 1_555 ? 
23 AC2 25 GDP D .   ? GDP A 432 . ? 1_555 ? 
24 AC2 25 MG  B .   ? MG  A 435 . ? 1_555 ? 
25 AC2 25 HOH E .   ? HOH A 495 . ? 1_555 ? 
26 AC2 25 HOH E .   ? HOH A 522 . ? 1_555 ? 
27 AC2 25 HOH E .   ? HOH A 527 . ? 1_555 ? 
28 AC2 25 HOH E .   ? HOH A 543 . ? 1_555 ? 
29 AC2 25 HOH E .   ? HOH A 596 . ? 1_555 ? 
30 AC2 25 HOH E .   ? HOH A 604 . ? 1_555 ? 
31 AC3 19 ASP A 13  ? ASP A 13  . ? 1_555 ? 
32 AC3 19 GLU A 14  ? GLU A 14  . ? 1_555 ? 
33 AC3 19 GLY A 15  ? GLY A 15  . ? 1_555 ? 
34 AC3 19 LYS A 16  ? LYS A 16  . ? 1_555 ? 
35 AC3 19 GLY A 17  ? GLY A 17  . ? 1_555 ? 
36 AC3 19 GLY A 40  ? GLY A 40  . ? 1_555 ? 
37 AC3 19 HIS A 41  ? HIS A 41  . ? 1_555 ? 
38 AC3 19 THR A 42  ? THR A 42  . ? 1_555 ? 
39 AC3 19 LYS A 331 ? LYS A 331 . ? 1_555 ? 
40 AC3 19 ASP A 333 ? ASP A 333 . ? 1_555 ? 
41 AC3 19 SER A 414 ? SER A 414 . ? 1_555 ? 
42 AC3 19 THR A 415 ? THR A 415 . ? 1_555 ? 
43 AC3 19 GLY A 416 ? GLY A 416 . ? 1_555 ? 
44 AC3 19 PRO A 417 ? PRO A 417 . ? 1_555 ? 
45 AC3 19 MG  B .   ? MG  A 435 . ? 1_555 ? 
46 AC3 19 IMO C .   ? IMO A 440 . ? 1_555 ? 
47 AC3 19 HOH E .   ? HOH A 442 . ? 1_555 ? 
48 AC3 19 HOH E .   ? HOH A 499 . ? 1_555 ? 
49 AC3 19 HOH E .   ? HOH A 550 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1CG4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1CG4 
_atom_sites.fract_transf_matrix[1][1]   0.012520 
_atom_sites.fract_transf_matrix[1][2]   0.007230 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014460 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006310 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? -5.049  24.619 45.116 1.00 33.04 ? 1   GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? -6.563  24.579 45.116 1.00 34.39 ? 1   GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? -7.149  25.209 43.867 1.00 33.98 ? 1   GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? -6.577  26.174 43.357 1.00 35.50 ? 1   GLY A O     1 
ATOM   5    N  N     . ASN A 1 2   ? -8.289  24.689 43.391 1.00 33.00 ? 2   ASN A N     1 
ATOM   6    C  CA    . ASN A 1 2   ? -8.959  25.152 42.165 1.00 29.20 ? 2   ASN A CA    1 
ATOM   7    C  C     . ASN A 1 2   ? -9.540  26.555 42.257 1.00 29.08 ? 2   ASN A C     1 
ATOM   8    O  O     . ASN A 1 2   ? -9.398  27.356 41.342 1.00 31.40 ? 2   ASN A O     1 
ATOM   9    C  CB    . ASN A 1 2   ? -10.094 24.185 41.795 1.00 33.44 ? 2   ASN A CB    1 
ATOM   10   C  CG    . ASN A 1 2   ? -9.595  22.911 41.128 1.00 32.51 ? 2   ASN A CG    1 
ATOM   11   O  OD1   . ASN A 1 2   ? -8.474  22.866 40.621 1.00 34.08 ? 2   ASN A OD1   1 
ATOM   12   N  ND2   . ASN A 1 2   ? -10.431 21.888 41.101 1.00 22.88 ? 2   ASN A ND2   1 
ATOM   13   N  N     . ASN A 1 3   ? -10.256 26.851 43.330 1.00 25.66 ? 3   ASN A N     1 
ATOM   14   C  CA    . ASN A 1 3   ? -10.841 28.166 43.500 1.00 20.23 ? 3   ASN A CA    1 
ATOM   15   C  C     . ASN A 1 3   ? -10.004 28.963 44.486 1.00 22.78 ? 3   ASN A C     1 
ATOM   16   O  O     . ASN A 1 3   ? -10.022 28.697 45.686 1.00 20.49 ? 3   ASN A O     1 
ATOM   17   C  CB    . ASN A 1 3   ? -12.274 28.033 43.965 1.00 22.29 ? 3   ASN A CB    1 
ATOM   18   C  CG    . ASN A 1 3   ? -13.172 27.469 42.897 1.00 25.94 ? 3   ASN A CG    1 
ATOM   19   O  OD1   . ASN A 1 3   ? -14.026 26.647 43.162 1.00 25.41 ? 3   ASN A OD1   1 
ATOM   20   N  ND2   . ASN A 1 3   ? -12.983 27.920 41.667 1.00 29.16 ? 3   ASN A ND2   1 
ATOM   21   N  N     . VAL A 1 4   ? -9.256  29.930 43.968 1.00 22.61 ? 4   VAL A N     1 
ATOM   22   C  CA    . VAL A 1 4   ? -8.365  30.722 44.790 1.00 23.99 ? 4   VAL A CA    1 
ATOM   23   C  C     . VAL A 1 4   ? -8.932  32.115 44.955 1.00 27.10 ? 4   VAL A C     1 
ATOM   24   O  O     . VAL A 1 4   ? -9.482  32.701 43.983 1.00 25.05 ? 4   VAL A O     1 
ATOM   25   C  CB    . VAL A 1 4   ? -6.956  30.787 44.149 1.00 27.56 ? 4   VAL A CB    1 
ATOM   26   C  CG1   . VAL A 1 4   ? -6.045  31.775 44.913 1.00 27.31 ? 4   VAL A CG1   1 
ATOM   27   C  CG2   . VAL A 1 4   ? -6.334  29.378 44.106 1.00 23.64 ? 4   VAL A CG2   1 
ATOM   28   N  N     . VAL A 1 5   ? -8.844  32.638 46.178 1.00 23.03 ? 5   VAL A N     1 
ATOM   29   C  CA    . VAL A 1 5   ? -9.384  33.961 46.475 1.00 23.76 ? 5   VAL A CA    1 
ATOM   30   C  C     . VAL A 1 5   ? -8.215  34.876 46.818 1.00 25.83 ? 5   VAL A C     1 
ATOM   31   O  O     . VAL A 1 5   ? -7.359  34.494 47.628 1.00 26.11 ? 5   VAL A O     1 
ATOM   32   C  CB    . VAL A 1 5   ? -10.361 33.926 47.702 1.00 22.51 ? 5   VAL A CB    1 
ATOM   33   C  CG1   . VAL A 1 5   ? -10.885 35.295 47.994 1.00 23.20 ? 5   VAL A CG1   1 
ATOM   34   C  CG2   . VAL A 1 5   ? -11.504 32.949 47.486 1.00 15.31 ? 5   VAL A CG2   1 
ATOM   35   N  N     . VAL A 1 6   ? -8.152  36.043 46.160 1.00 23.21 ? 6   VAL A N     1 
ATOM   36   C  CA    . VAL A 1 6   ? -7.105  37.038 46.423 1.00 24.32 ? 6   VAL A CA    1 
ATOM   37   C  C     . VAL A 1 6   ? -7.740  38.305 47.009 1.00 24.37 ? 6   VAL A C     1 
ATOM   38   O  O     . VAL A 1 6   ? -8.595  38.943 46.377 1.00 26.78 ? 6   VAL A O     1 
ATOM   39   C  CB    . VAL A 1 6   ? -6.284  37.362 45.161 1.00 24.12 ? 6   VAL A CB    1 
ATOM   40   C  CG1   . VAL A 1 6   ? -5.327  38.540 45.408 1.00 18.52 ? 6   VAL A CG1   1 
ATOM   41   C  CG2   . VAL A 1 6   ? -5.505  36.121 44.775 1.00 27.23 ? 6   VAL A CG2   1 
ATOM   42   N  N     . LEU A 1 7   ? -7.352  38.645 48.235 1.00 21.40 ? 7   LEU A N     1 
ATOM   43   C  CA    . LEU A 1 7   ? -7.918  39.808 48.882 1.00 21.67 ? 7   LEU A CA    1 
ATOM   44   C  C     . LEU A 1 7   ? -6.967  40.633 49.732 1.00 20.17 ? 7   LEU A C     1 
ATOM   45   O  O     . LEU A 1 7   ? -5.891  40.173 50.066 1.00 23.74 ? 7   LEU A O     1 
ATOM   46   C  CB    . LEU A 1 7   ? -9.183  39.388 49.639 1.00 24.46 ? 7   LEU A CB    1 
ATOM   47   C  CG    . LEU A 1 7   ? -9.391  38.771 51.020 1.00 24.43 ? 7   LEU A CG    1 
ATOM   48   C  CD1   . LEU A 1 7   ? -10.481 37.702 50.879 1.00 21.96 ? 7   LEU A CD1   1 
ATOM   49   C  CD2   . LEU A 1 7   ? -8.149  38.240 51.620 1.00 25.98 ? 7   LEU A CD2   1 
ATOM   50   N  N     . GLY A 1 8   ? -7.327  41.879 50.000 1.00 21.00 ? 8   GLY A N     1 
ATOM   51   C  CA    . GLY A 1 8   ? -6.477  42.757 50.791 1.00 22.04 ? 8   GLY A CA    1 
ATOM   52   C  C     . GLY A 1 8   ? -6.701  42.500 52.242 1.00 25.19 ? 8   GLY A C     1 
ATOM   53   O  O     . GLY A 1 8   ? -7.846  42.404 52.673 1.00 30.12 ? 8   GLY A O     1 
ATOM   54   N  N     . THR A 1 9   ? -5.627  42.371 53.007 1.00 25.60 ? 9   THR A N     1 
ATOM   55   C  CA    . THR A 1 9   ? -5.710  42.085 54.427 1.00 23.22 ? 9   THR A CA    1 
ATOM   56   C  C     . THR A 1 9   ? -5.687  43.342 55.308 1.00 24.77 ? 9   THR A C     1 
ATOM   57   O  O     . THR A 1 9   ? -5.789  43.271 56.535 1.00 24.86 ? 9   THR A O     1 
ATOM   58   C  CB    . THR A 1 9   ? -4.515  41.257 54.818 1.00 24.12 ? 9   THR A CB    1 
ATOM   59   O  OG1   . THR A 1 9   ? -3.320  41.981 54.493 1.00 20.60 ? 9   THR A OG1   1 
ATOM   60   C  CG2   . THR A 1 9   ? -4.535  39.903 54.110 1.00 26.41 ? 9   THR A CG2   1 
ATOM   61   N  N     . GLN A 1 10  ? -5.527  44.502 54.689 1.00 22.32 ? 10  GLN A N     1 
ATOM   62   C  CA    . GLN A 1 10  ? -5.438  45.717 55.456 1.00 19.18 ? 10  GLN A CA    1 
ATOM   63   C  C     . GLN A 1 10  ? -6.537  46.705 55.082 1.00 21.69 ? 10  GLN A C     1 
ATOM   64   O  O     . GLN A 1 10  ? -7.722  46.408 55.314 1.00 20.81 ? 10  GLN A O     1 
ATOM   65   C  CB    . GLN A 1 10  ? -3.996  46.264 55.338 1.00 17.11 ? 10  GLN A CB    1 
ATOM   66   C  CG    . GLN A 1 10  ? -2.980  45.133 55.573 1.00 14.89 ? 10  GLN A CG    1 
ATOM   67   C  CD    . GLN A 1 10  ? -1.623  45.340 54.931 1.00 25.09 ? 10  GLN A CD    1 
ATOM   68   O  OE1   . GLN A 1 10  ? -1.461  45.182 53.719 1.00 29.41 ? 10  GLN A OE1   1 
ATOM   69   N  NE2   . GLN A 1 10  ? -0.620  45.641 55.752 1.00 23.99 ? 10  GLN A NE2   1 
ATOM   70   N  N     . TRP A 1 11  ? -6.181  47.836 54.479 1.00 26.58 ? 11  TRP A N     1 
ATOM   71   C  CA    . TRP A 1 11  ? -7.147  48.862 54.121 1.00 26.09 ? 11  TRP A CA    1 
ATOM   72   C  C     . TRP A 1 11  ? -7.129  49.191 52.626 1.00 31.36 ? 11  TRP A C     1 
ATOM   73   O  O     . TRP A 1 11  ? -7.230  50.383 52.215 1.00 29.69 ? 11  TRP A O     1 
ATOM   74   C  CB    . TRP A 1 11  ? -6.870  50.129 54.930 1.00 24.05 ? 11  TRP A CB    1 
ATOM   75   C  CG    . TRP A 1 11  ? -7.031  49.966 56.397 1.00 30.91 ? 11  TRP A CG    1 
ATOM   76   C  CD1   . TRP A 1 11  ? -8.183  50.044 57.098 1.00 30.45 ? 11  TRP A CD1   1 
ATOM   77   C  CD2   . TRP A 1 11  ? -5.971  49.834 57.370 1.00 34.17 ? 11  TRP A CD2   1 
ATOM   78   N  NE1   . TRP A 1 11  ? -7.918  50.002 58.452 1.00 32.11 ? 11  TRP A NE1   1 
ATOM   79   C  CE2   . TRP A 1 11  ? -6.587  49.872 58.641 1.00 31.28 ? 11  TRP A CE2   1 
ATOM   80   C  CE3   . TRP A 1 11  ? -4.581  49.694 57.278 1.00 38.75 ? 11  TRP A CE3   1 
ATOM   81   C  CZ2   . TRP A 1 11  ? -5.841  49.788 59.820 1.00 37.84 ? 11  TRP A CZ2   1 
ATOM   82   C  CZ3   . TRP A 1 11  ? -3.840  49.607 58.453 1.00 39.44 ? 11  TRP A CZ3   1 
ATOM   83   C  CH2   . TRP A 1 11  ? -4.480  49.654 59.712 1.00 39.59 ? 11  TRP A CH2   1 
ATOM   84   N  N     . GLY A 1 12  ? -7.051  48.137 51.818 1.00 28.22 ? 12  GLY A N     1 
ATOM   85   C  CA    . GLY A 1 12  ? -7.032  48.359 50.390 1.00 26.85 ? 12  GLY A CA    1 
ATOM   86   C  C     . GLY A 1 12  ? -5.604  48.677 49.896 1.00 30.33 ? 12  GLY A C     1 
ATOM   87   O  O     . GLY A 1 12  ? -4.685  48.890 50.674 1.00 33.71 ? 12  GLY A O     1 
ATOM   88   N  N     . ASP A 1 13  ? -5.506  48.792 48.574 1.00 32.62 ? 13  ASP A N     1 
ATOM   89   C  CA    . ASP A 1 13  ? -4.228  49.073 47.957 1.00 28.66 ? 13  ASP A CA    1 
ATOM   90   C  C     . ASP A 1 13  ? -3.016  48.175 48.391 1.00 26.11 ? 13  ASP A C     1 
ATOM   91   O  O     . ASP A 1 13  ? -1.876  48.692 48.325 1.00 25.80 ? 13  ASP A O     1 
ATOM   92   C  CB    . ASP A 1 13  ? -3.881  50.528 48.211 1.00 30.24 ? 13  ASP A CB    1 
ATOM   93   C  CG    . ASP A 1 13  ? -5.014  51.488 47.907 1.00 30.66 ? 13  ASP A CG    1 
ATOM   94   O  OD1   . ASP A 1 13  ? -5.954  51.135 47.167 1.00 31.97 ? 13  ASP A OD1   1 
ATOM   95   O  OD2   . ASP A 1 13  ? -5.001  52.637 48.350 1.00 40.66 ? 13  ASP A OD2   1 
ATOM   96   N  N     . GLU A 1 14  ? -3.258  46.938 48.814 1.00 25.91 ? 14  GLU A N     1 
ATOM   97   C  CA    . GLU A 1 14  ? -2.075  46.147 49.183 1.00 25.37 ? 14  GLU A CA    1 
ATOM   98   C  C     . GLU A 1 14  ? -1.311  45.696 47.937 1.00 25.41 ? 14  GLU A C     1 
ATOM   99   O  O     . GLU A 1 14  ? -0.114  45.393 47.999 1.00 25.90 ? 14  GLU A O     1 
ATOM   100  C  CB    . GLU A 1 14  ? -2.479  44.926 49.988 1.00 18.33 ? 14  GLU A CB    1 
ATOM   101  C  CG    . GLU A 1 14  ? -3.386  45.203 51.185 1.00 21.86 ? 14  GLU A CG    1 
ATOM   102  C  CD    . GLU A 1 14  ? -4.830  45.470 50.817 1.00 20.56 ? 14  GLU A CD    1 
ATOM   103  O  OE1   . GLU A 1 14  ? -5.139  45.446 49.599 1.00 22.06 ? 14  GLU A OE1   1 
ATOM   104  O  OE2   . GLU A 1 14  ? -5.647  45.720 51.740 1.00 17.08 ? 14  GLU A OE2   1 
ATOM   105  N  N     . GLY A 1 15  ? -2.023  45.646 46.802 1.00 26.69 ? 15  GLY A N     1 
ATOM   106  C  CA    . GLY A 1 15  ? -1.449  45.188 45.538 1.00 28.03 ? 15  GLY A CA    1 
ATOM   107  C  C     . GLY A 1 15  ? -2.178  43.989 44.931 1.00 28.21 ? 15  GLY A C     1 
ATOM   108  O  O     . GLY A 1 15  ? -1.548  43.085 44.381 1.00 26.68 ? 15  GLY A O     1 
ATOM   109  N  N     . LYS A 1 16  ? -3.506  43.949 45.046 1.00 30.76 ? 16  LYS A N     1 
ATOM   110  C  CA    . LYS A 1 16  ? -4.285  42.841 44.491 1.00 27.97 ? 16  LYS A CA    1 
ATOM   111  C  C     . LYS A 1 16  ? -4.209  42.834 42.976 1.00 27.43 ? 16  LYS A C     1 
ATOM   112  O  O     . LYS A 1 16  ? -4.064  41.775 42.365 1.00 22.65 ? 16  LYS A O     1 
ATOM   113  C  CB    . LYS A 1 16  ? -5.757  42.909 44.902 1.00 26.42 ? 16  LYS A CB    1 
ATOM   114  C  CG    . LYS A 1 16  ? -6.065  42.415 46.309 1.00 30.60 ? 16  LYS A CG    1 
ATOM   115  C  CD    . LYS A 1 16  ? -6.291  43.544 47.308 1.00 24.59 ? 16  LYS A CD    1 
ATOM   116  C  CE    . LYS A 1 16  ? -7.556  44.341 47.026 1.00 19.01 ? 16  LYS A CE    1 
ATOM   117  N  NZ    . LYS A 1 16  ? -7.251  45.849 46.990 1.00 16.14 ? 16  LYS A NZ    1 
ATOM   118  N  N     . GLY A 1 17  ? -4.371  44.005 42.362 1.00 25.58 ? 17  GLY A N     1 
ATOM   119  C  CA    . GLY A 1 17  ? -4.300  44.061 40.915 1.00 25.72 ? 17  GLY A CA    1 
ATOM   120  C  C     . GLY A 1 17  ? -3.089  43.329 40.350 1.00 25.71 ? 17  GLY A C     1 
ATOM   121  O  O     . GLY A 1 17  ? -3.252  42.347 39.645 1.00 28.02 ? 17  GLY A O     1 
ATOM   122  N  N     . LYS A 1 18  ? -1.869  43.777 40.671 1.00 25.95 ? 18  LYS A N     1 
ATOM   123  C  CA    . LYS A 1 18  ? -0.693  43.081 40.138 1.00 23.83 ? 18  LYS A CA    1 
ATOM   124  C  C     . LYS A 1 18  ? -0.778  41.577 40.381 1.00 25.82 ? 18  LYS A C     1 
ATOM   125  O  O     . LYS A 1 18  ? -0.741  40.793 39.426 1.00 24.75 ? 18  LYS A O     1 
ATOM   126  C  CB    . LYS A 1 18  ? 0.610   43.594 40.737 1.00 21.04 ? 18  LYS A CB    1 
ATOM   127  C  CG    . LYS A 1 18  ? 1.764   42.592 40.536 1.00 20.02 ? 18  LYS A CG    1 
ATOM   128  C  CD    . LYS A 1 18  ? 3.067   43.025 41.198 1.00 20.78 ? 18  LYS A CD    1 
ATOM   129  C  CE    . LYS A 1 18  ? 4.068   41.889 41.094 1.00 20.27 ? 18  LYS A CE    1 
ATOM   130  N  NZ    . LYS A 1 18  ? 5.399   42.131 41.736 1.00 14.49 ? 18  LYS A NZ    1 
ATOM   131  N  N     . ILE A 1 19  ? -0.900  41.175 41.648 1.00 24.80 ? 19  ILE A N     1 
ATOM   132  C  CA    . ILE A 1 19  ? -0.954  39.751 41.982 1.00 26.01 ? 19  ILE A CA    1 
ATOM   133  C  C     . ILE A 1 19  ? -2.041  38.987 41.227 1.00 26.36 ? 19  ILE A C     1 
ATOM   134  O  O     . ILE A 1 19  ? -1.797  37.855 40.783 1.00 25.52 ? 19  ILE A O     1 
ATOM   135  C  CB    . ILE A 1 19  ? -1.112  39.504 43.506 1.00 24.60 ? 19  ILE A CB    1 
ATOM   136  C  CG1   . ILE A 1 19  ? -0.052  40.274 44.277 1.00 27.98 ? 19  ILE A CG1   1 
ATOM   137  C  CG2   . ILE A 1 19  ? -0.907  38.034 43.810 1.00 21.12 ? 19  ILE A CG2   1 
ATOM   138  C  CD1   . ILE A 1 19  ? 1.334   39.877 43.841 1.00 25.76 ? 19  ILE A CD1   1 
ATOM   139  N  N     . VAL A 1 20  ? -3.235  39.568 41.097 1.00 26.89 ? 20  VAL A N     1 
ATOM   140  C  CA    . VAL A 1 20  ? -4.308  38.883 40.390 1.00 27.38 ? 20  VAL A CA    1 
ATOM   141  C  C     . VAL A 1 20  ? -3.872  38.724 38.957 1.00 28.70 ? 20  VAL A C     1 
ATOM   142  O  O     . VAL A 1 20  ? -4.009  37.641 38.400 1.00 27.99 ? 20  VAL A O     1 
ATOM   143  C  CB    . VAL A 1 20  ? -5.650  39.637 40.397 1.00 28.55 ? 20  VAL A CB    1 
ATOM   144  C  CG1   . VAL A 1 20  ? -6.653  38.920 39.483 1.00 25.03 ? 20  VAL A CG1   1 
ATOM   145  C  CG2   . VAL A 1 20  ? -6.199  39.724 41.813 1.00 27.44 ? 20  VAL A CG2   1 
ATOM   146  N  N     . ASP A 1 21  ? -3.344  39.786 38.357 1.00 28.82 ? 21  ASP A N     1 
ATOM   147  C  CA    . ASP A 1 21  ? -2.912  39.695 36.973 1.00 32.16 ? 21  ASP A CA    1 
ATOM   148  C  C     . ASP A 1 21  ? -1.887  38.580 36.839 1.00 33.17 ? 21  ASP A C     1 
ATOM   149  O  O     . ASP A 1 21  ? -1.997  37.704 35.985 1.00 37.15 ? 21  ASP A O     1 
ATOM   150  C  CB    . ASP A 1 21  ? -2.308  41.016 36.512 1.00 33.86 ? 21  ASP A CB    1 
ATOM   151  C  CG    . ASP A 1 21  ? -1.642  40.903 35.160 1.00 35.39 ? 21  ASP A CG    1 
ATOM   152  O  OD1   . ASP A 1 21  ? -2.350  40.994 34.140 1.00 32.40 ? 21  ASP A OD1   1 
ATOM   153  O  OD2   . ASP A 1 21  ? -0.412  40.685 35.122 1.00 34.65 ? 21  ASP A OD2   1 
ATOM   154  N  N     . LEU A 1 22  ? -0.905  38.602 37.723 1.00 33.12 ? 22  LEU A N     1 
ATOM   155  C  CA    . LEU A 1 22  ? 0.150   37.615 37.729 1.00 32.57 ? 22  LEU A CA    1 
ATOM   156  C  C     . LEU A 1 22  ? -0.418  36.220 37.835 1.00 32.29 ? 22  LEU A C     1 
ATOM   157  O  O     . LEU A 1 22  ? -0.221  35.401 36.944 1.00 36.47 ? 22  LEU A O     1 
ATOM   158  C  CB    . LEU A 1 22  ? 1.115   37.882 38.893 1.00 33.84 ? 22  LEU A CB    1 
ATOM   159  C  CG    . LEU A 1 22  ? 2.171   36.840 39.297 1.00 36.19 ? 22  LEU A CG    1 
ATOM   160  C  CD1   . LEU A 1 22  ? 3.412   37.007 38.486 1.00 33.24 ? 22  LEU A CD1   1 
ATOM   161  C  CD2   . LEU A 1 22  ? 2.530   37.020 40.780 1.00 39.98 ? 22  LEU A CD2   1 
ATOM   162  N  N     . LEU A 1 23  ? -1.142  35.946 38.910 1.00 30.69 ? 23  LEU A N     1 
ATOM   163  C  CA    . LEU A 1 23  ? -1.679  34.611 39.129 1.00 28.42 ? 23  LEU A CA    1 
ATOM   164  C  C     . LEU A 1 23  ? -2.692  34.076 38.100 1.00 33.16 ? 23  LEU A C     1 
ATOM   165  O  O     . LEU A 1 23  ? -2.899  32.858 38.001 1.00 32.51 ? 23  LEU A O     1 
ATOM   166  C  CB    . LEU A 1 23  ? -2.227  34.493 40.550 1.00 26.39 ? 23  LEU A CB    1 
ATOM   167  C  CG    . LEU A 1 23  ? -1.163  34.713 41.648 1.00 33.91 ? 23  LEU A CG    1 
ATOM   168  C  CD1   . LEU A 1 23  ? -1.760  34.694 43.043 1.00 26.83 ? 23  LEU A CD1   1 
ATOM   169  C  CD2   . LEU A 1 23  ? -0.027  33.659 41.550 1.00 31.11 ? 23  LEU A CD2   1 
ATOM   170  N  N     . THR A 1 24  ? -3.302  34.951 37.300 1.00 33.38 ? 24  THR A N     1 
ATOM   171  C  CA    . THR A 1 24  ? -4.308  34.476 36.363 1.00 36.38 ? 24  THR A CA    1 
ATOM   172  C  C     . THR A 1 24  ? -3.776  33.732 35.167 1.00 38.33 ? 24  THR A C     1 
ATOM   173  O  O     . THR A 1 24  ? -4.548  33.203 34.374 1.00 41.16 ? 24  THR A O     1 
ATOM   174  C  CB    . THR A 1 24  ? -5.258  35.586 35.889 1.00 36.90 ? 24  THR A CB    1 
ATOM   175  O  OG1   . THR A 1 24  ? -4.518  36.797 35.696 1.00 39.31 ? 24  THR A OG1   1 
ATOM   176  C  CG2   . THR A 1 24  ? -6.376  35.795 36.896 1.00 33.26 ? 24  THR A CG2   1 
ATOM   177  N  N     . GLU A 1 25  ? -2.463  33.658 35.045 1.00 37.39 ? 25  GLU A N     1 
ATOM   178  C  CA    . GLU A 1 25  ? -1.854  32.963 33.928 1.00 33.73 ? 25  GLU A CA    1 
ATOM   179  C  C     . GLU A 1 25  ? -2.438  31.580 33.775 1.00 34.01 ? 25  GLU A C     1 
ATOM   180  O  O     . GLU A 1 25  ? -2.683  31.107 32.678 1.00 38.82 ? 25  GLU A O     1 
ATOM   181  C  CB    . GLU A 1 25  ? -0.366  32.830 34.156 1.00 34.30 ? 25  GLU A CB    1 
ATOM   182  C  CG    . GLU A 1 25  ? 0.369   32.177 33.032 1.00 41.03 ? 25  GLU A CG    1 
ATOM   183  C  CD    . GLU A 1 25  ? 1.854   32.315 33.205 1.00 47.39 ? 25  GLU A CD    1 
ATOM   184  O  OE1   . GLU A 1 25  ? 2.559   31.322 32.949 1.00 54.67 ? 25  GLU A OE1   1 
ATOM   185  O  OE2   . GLU A 1 25  ? 2.316   33.426 33.585 1.00 50.38 ? 25  GLU A OE2   1 
ATOM   186  N  N     . ARG A 1 26  ? -2.638  30.913 34.888 1.00 31.71 ? 26  ARG A N     1 
ATOM   187  C  CA    . ARG A 1 26  ? -3.178  29.575 34.837 1.00 29.84 ? 26  ARG A CA    1 
ATOM   188  C  C     . ARG A 1 26  ? -4.700  29.548 35.034 1.00 30.18 ? 26  ARG A C     1 
ATOM   189  O  O     . ARG A 1 26  ? -5.272  28.463 35.078 1.00 30.51 ? 26  ARG A O     1 
ATOM   190  C  CB    . ARG A 1 26  ? -2.495  28.732 35.936 1.00 32.33 ? 26  ARG A CB    1 
ATOM   191  C  CG    . ARG A 1 26  ? -0.945  28.793 35.912 1.00 30.37 ? 26  ARG A CG    1 
ATOM   192  C  CD    . ARG A 1 26  ? -0.303  27.899 36.972 1.00 22.20 ? 26  ARG A CD    1 
ATOM   193  N  NE    . ARG A 1 26  ? -0.901  26.568 37.012 1.00 27.67 ? 26  ARG A NE    1 
ATOM   194  C  CZ    . ARG A 1 26  ? -0.832  25.835 38.121 1.00 31.58 ? 26  ARG A CZ    1 
ATOM   195  N  NH1   . ARG A 1 26  ? -0.229  26.309 39.205 1.00 29.14 ? 26  ARG A NH1   1 
ATOM   196  N  NH2   . ARG A 1 26  ? -1.335  24.602 38.123 1.00 32.29 ? 26  ARG A NH2   1 
ATOM   197  N  N     . ALA A 1 27  ? -5.358  30.704 35.163 1.00 25.01 ? 27  ALA A N     1 
ATOM   198  C  CA    . ALA A 1 27  ? -6.797  30.711 35.408 1.00 27.12 ? 27  ALA A CA    1 
ATOM   199  C  C     . ALA A 1 27  ? -7.724  30.784 34.207 1.00 29.92 ? 27  ALA A C     1 
ATOM   200  O  O     . ALA A 1 27  ? -7.437  31.479 33.230 1.00 32.41 ? 27  ALA A O     1 
ATOM   201  C  CB    . ALA A 1 27  ? -7.141  31.800 36.343 1.00 25.23 ? 27  ALA A CB    1 
ATOM   202  N  N     . LYS A 1 28  ? -8.872  30.116 34.328 1.00 31.48 ? 28  LYS A N     1 
ATOM   203  C  CA    . LYS A 1 28  ? -9.913  30.098 33.297 1.00 30.45 ? 28  LYS A CA    1 
ATOM   204  C  C     . LYS A 1 28  ? -10.786 31.344 33.532 1.00 30.52 ? 28  LYS A C     1 
ATOM   205  O  O     . LYS A 1 28  ? -11.111 32.095 32.591 1.00 27.29 ? 28  LYS A O     1 
ATOM   206  C  CB    . LYS A 1 28  ? -10.769 28.828 33.435 1.00 32.91 ? 28  LYS A CB    1 
ATOM   207  C  CG    . LYS A 1 28  ? -10.002 27.515 33.240 1.00 38.75 ? 28  LYS A CG    1 
ATOM   208  C  CD    . LYS A 1 28  ? -9.678  27.328 31.747 1.00 43.84 ? 28  LYS A CD    1 
ATOM   209  C  CE    . LYS A 1 28  ? -8.711  26.202 31.416 1.00 39.44 ? 28  LYS A CE    1 
ATOM   210  N  NZ    . LYS A 1 28  ? -9.324  24.854 31.547 1.00 39.17 ? 28  LYS A NZ    1 
ATOM   211  N  N     . TYR A 1 29  ? -11.134 31.586 34.799 1.00 26.62 ? 29  TYR A N     1 
ATOM   212  C  CA    . TYR A 1 29  ? -11.963 32.748 35.115 1.00 24.15 ? 29  TYR A CA    1 
ATOM   213  C  C     . TYR A 1 29  ? -11.361 33.593 36.204 1.00 23.52 ? 29  TYR A C     1 
ATOM   214  O  O     . TYR A 1 29  ? -10.530 33.094 36.980 1.00 18.61 ? 29  TYR A O     1 
ATOM   215  C  CB    . TYR A 1 29  ? -13.342 32.335 35.610 1.00 21.07 ? 29  TYR A CB    1 
ATOM   216  C  CG    . TYR A 1 29  ? -14.112 31.409 34.703 1.00 22.71 ? 29  TYR A CG    1 
ATOM   217  C  CD1   . TYR A 1 29  ? -14.971 31.897 33.730 1.00 18.56 ? 29  TYR A CD1   1 
ATOM   218  C  CD2   . TYR A 1 29  ? -13.993 30.036 34.841 1.00 23.41 ? 29  TYR A CD2   1 
ATOM   219  C  CE1   . TYR A 1 29  ? -15.680 31.035 32.934 1.00 19.88 ? 29  TYR A CE1   1 
ATOM   220  C  CE2   . TYR A 1 29  ? -14.692 29.167 34.051 1.00 22.10 ? 29  TYR A CE2   1 
ATOM   221  C  CZ    . TYR A 1 29  ? -15.531 29.667 33.100 1.00 22.10 ? 29  TYR A CZ    1 
ATOM   222  O  OH    . TYR A 1 29  ? -16.205 28.762 32.309 1.00 27.11 ? 29  TYR A OH    1 
ATOM   223  N  N     . VAL A 1 30  ? -11.783 34.863 36.251 1.00 19.99 ? 30  VAL A N     1 
ATOM   224  C  CA    . VAL A 1 30  ? -11.368 35.788 37.303 1.00 25.20 ? 30  VAL A CA    1 
ATOM   225  C  C     . VAL A 1 30  ? -12.654 36.519 37.695 1.00 27.69 ? 30  VAL A C     1 
ATOM   226  O  O     . VAL A 1 30  ? -13.349 37.064 36.850 1.00 32.31 ? 30  VAL A O     1 
ATOM   227  C  CB    . VAL A 1 30  ? -10.247 36.787 36.878 1.00 26.93 ? 30  VAL A CB    1 
ATOM   228  C  CG1   . VAL A 1 30  ? -10.755 37.780 35.850 1.00 26.57 ? 30  VAL A CG1   1 
ATOM   229  C  CG2   . VAL A 1 30  ? -9.731  37.528 38.102 1.00 25.89 ? 30  VAL A CG2   1 
ATOM   230  N  N     . VAL A 1 31  ? -12.973 36.545 38.980 1.00 27.71 ? 31  VAL A N     1 
ATOM   231  C  CA    . VAL A 1 31  ? -14.214 37.168 39.413 1.00 27.23 ? 31  VAL A CA    1 
ATOM   232  C  C     . VAL A 1 31  ? -14.126 38.283 40.468 1.00 27.54 ? 31  VAL A C     1 
ATOM   233  O  O     . VAL A 1 31  ? -13.445 38.140 41.494 1.00 27.12 ? 31  VAL A O     1 
ATOM   234  C  CB    . VAL A 1 31  ? -15.145 36.070 39.967 1.00 26.40 ? 31  VAL A CB    1 
ATOM   235  C  CG1   . VAL A 1 31  ? -16.577 36.589 40.179 1.00 14.27 ? 31  VAL A CG1   1 
ATOM   236  C  CG2   . VAL A 1 31  ? -15.080 34.839 39.061 1.00 19.76 ? 31  VAL A CG2   1 
ATOM   237  N  N     . ARG A 1 32  ? -14.770 39.409 40.182 1.00 26.00 ? 32  ARG A N     1 
ATOM   238  C  CA    . ARG A 1 32  ? -14.864 40.509 41.125 1.00 23.38 ? 32  ARG A CA    1 
ATOM   239  C  C     . ARG A 1 32  ? -16.174 40.127 41.837 1.00 23.65 ? 32  ARG A C     1 
ATOM   240  O  O     . ARG A 1 32  ? -17.163 39.767 41.191 1.00 20.82 ? 32  ARG A O     1 
ATOM   241  C  CB    . ARG A 1 32  ? -15.026 41.849 40.391 1.00 16.76 ? 32  ARG A CB    1 
ATOM   242  C  CG    . ARG A 1 32  ? -13.740 42.619 40.129 1.00 20.44 ? 32  ARG A CG    1 
ATOM   243  C  CD    . ARG A 1 32  ? -13.046 43.149 41.400 1.00 22.55 ? 32  ARG A CD    1 
ATOM   244  N  NE    . ARG A 1 32  ? -13.862 44.081 42.193 1.00 26.14 ? 32  ARG A NE    1 
ATOM   245  C  CZ    . ARG A 1 32  ? -13.883 45.384 41.931 1.00 26.29 ? 32  ARG A CZ    1 
ATOM   246  N  NH1   . ARG A 1 32  ? -13.176 45.893 40.937 1.00 29.88 ? 32  ARG A NH1   1 
ATOM   247  N  NH2   . ARG A 1 32  ? -14.550 46.200 42.728 1.00 33.73 ? 32  ARG A NH2   1 
ATOM   248  N  N     . TYR A 1 33  ? -16.190 40.175 43.160 1.00 22.90 ? 33  TYR A N     1 
ATOM   249  C  CA    . TYR A 1 33  ? -17.388 39.800 43.894 1.00 23.41 ? 33  TYR A CA    1 
ATOM   250  C  C     . TYR A 1 33  ? -17.930 40.890 44.810 1.00 21.78 ? 33  TYR A C     1 
ATOM   251  O  O     . TYR A 1 33  ? -18.917 40.667 45.490 1.00 25.43 ? 33  TYR A O     1 
ATOM   252  C  CB    . TYR A 1 33  ? -17.116 38.554 44.712 1.00 27.35 ? 33  TYR A CB    1 
ATOM   253  C  CG    . TYR A 1 33  ? -15.856 38.678 45.537 1.00 31.80 ? 33  TYR A CG    1 
ATOM   254  C  CD1   . TYR A 1 33  ? -15.887 39.174 46.842 1.00 21.87 ? 33  TYR A CD1   1 
ATOM   255  C  CD2   . TYR A 1 33  ? -14.625 38.301 45.003 1.00 29.97 ? 33  TYR A CD2   1 
ATOM   256  C  CE1   . TYR A 1 33  ? -14.729 39.280 47.583 1.00 25.74 ? 33  TYR A CE1   1 
ATOM   257  C  CE2   . TYR A 1 33  ? -13.462 38.411 45.742 1.00 27.16 ? 33  TYR A CE2   1 
ATOM   258  C  CZ    . TYR A 1 33  ? -13.519 38.895 47.030 1.00 28.28 ? 33  TYR A CZ    1 
ATOM   259  O  OH    . TYR A 1 33  ? -12.364 38.953 47.780 1.00 29.64 ? 33  TYR A OH    1 
ATOM   260  N  N     . GLN A 1 34  ? -17.315 42.065 44.804 1.00 22.98 ? 34  GLN A N     1 
ATOM   261  C  CA    . GLN A 1 34  ? -17.760 43.189 45.630 1.00 23.09 ? 34  GLN A CA    1 
ATOM   262  C  C     . GLN A 1 34  ? -17.065 44.534 45.330 1.00 25.19 ? 34  GLN A C     1 
ATOM   263  O  O     . GLN A 1 34  ? -16.002 44.577 44.679 1.00 23.33 ? 34  GLN A O     1 
ATOM   264  C  CB    . GLN A 1 34  ? -17.712 42.855 47.121 1.00 21.46 ? 34  GLN A CB    1 
ATOM   265  C  CG    . GLN A 1 34  ? -16.381 42.291 47.653 1.00 18.49 ? 34  GLN A CG    1 
ATOM   266  C  CD    . GLN A 1 34  ? -15.365 43.354 47.944 1.00 22.80 ? 34  GLN A CD    1 
ATOM   267  O  OE1   . GLN A 1 34  ? -15.682 44.411 48.508 1.00 30.39 ? 34  GLN A OE1   1 
ATOM   268  N  NE2   . GLN A 1 34  ? -14.137 43.108 47.533 1.00 15.57 ? 34  GLN A NE2   1 
ATOM   269  N  N     . GLY A 1 35  ? -17.700 45.619 45.782 1.00 27.29 ? 35  GLY A N     1 
ATOM   270  C  CA    . GLY A 1 35  ? -17.225 46.969 45.553 1.00 28.59 ? 35  GLY A CA    1 
ATOM   271  C  C     . GLY A 1 35  ? -17.714 47.429 44.174 1.00 28.35 ? 35  GLY A C     1 
ATOM   272  O  O     . GLY A 1 35  ? -18.642 46.848 43.593 1.00 26.04 ? 35  GLY A O     1 
ATOM   273  N  N     . GLY A 1 36  ? -17.082 48.467 43.640 1.00 29.28 ? 36  GLY A N     1 
ATOM   274  C  CA    . GLY A 1 36  ? -17.451 48.968 42.330 1.00 23.54 ? 36  GLY A CA    1 
ATOM   275  C  C     . GLY A 1 36  ? -16.188 49.599 41.760 1.00 27.16 ? 36  GLY A C     1 
ATOM   276  O  O     . GLY A 1 36  ? -15.097 48.987 41.841 1.00 27.16 ? 36  GLY A O     1 
ATOM   277  N  N     . HIS A 1 37  ? -16.292 50.818 41.244 1.00 20.31 ? 37  HIS A N     1 
ATOM   278  C  CA    . HIS A 1 37  ? -15.120 51.460 40.701 1.00 25.10 ? 37  HIS A CA    1 
ATOM   279  C  C     . HIS A 1 37  ? -14.402 52.384 41.711 1.00 27.12 ? 37  HIS A C     1 
ATOM   280  O  O     . HIS A 1 37  ? -13.708 53.347 41.339 1.00 27.14 ? 37  HIS A O     1 
ATOM   281  C  CB    . HIS A 1 37  ? -15.462 52.192 39.406 1.00 27.28 ? 37  HIS A CB    1 
ATOM   282  C  CG    . HIS A 1 37  ? -16.510 53.240 39.563 1.00 24.77 ? 37  HIS A CG    1 
ATOM   283  N  ND1   . HIS A 1 37  ? -17.804 52.993 39.992 1.00 23.48 ? 37  HIS A ND1   1 
ATOM   284  C  CD2   . HIS A 1 37  ? -16.482 54.559 39.247 1.00 12.56 ? 37  HIS A CD2   1 
ATOM   285  C  CE1   . HIS A 1 37  ? -18.486 54.133 39.897 1.00 19.62 ? 37  HIS A CE1   1 
ATOM   286  N  NE2   . HIS A 1 37  ? -17.717 55.105 39.450 1.00 17.77 ? 37  HIS A NE2   1 
ATOM   287  N  N     . ASN A 1 38  ? -14.623 52.119 42.995 1.00 26.72 ? 38  ASN A N     1 
ATOM   288  C  CA    . ASN A 1 38  ? -13.955 52.865 44.047 1.00 24.88 ? 38  ASN A CA    1 
ATOM   289  C  C     . ASN A 1 38  ? -12.577 52.212 44.095 1.00 23.49 ? 38  ASN A C     1 
ATOM   290  O  O     . ASN A 1 38  ? -11.571 52.829 44.454 1.00 16.44 ? 38  ASN A O     1 
ATOM   291  C  CB    . ASN A 1 38  ? -14.695 52.755 45.396 1.00 25.70 ? 38  ASN A CB    1 
ATOM   292  C  CG    . ASN A 1 38  ? -15.262 51.349 45.668 1.00 32.01 ? 38  ASN A CG    1 
ATOM   293  O  OD1   . ASN A 1 38  ? -15.186 50.438 44.825 1.00 31.73 ? 38  ASN A OD1   1 
ATOM   294  N  ND2   . ASN A 1 38  ? -15.832 51.171 46.859 1.00 28.18 ? 38  ASN A ND2   1 
ATOM   295  N  N     . ALA A 1 39  ? -12.529 50.952 43.680 1.00 28.03 ? 39  ALA A N     1 
ATOM   296  C  CA    . ALA A 1 39  ? -11.282 50.200 43.614 1.00 29.72 ? 39  ALA A CA    1 
ATOM   297  C  C     . ALA A 1 39  ? -10.341 50.796 42.536 1.00 32.36 ? 39  ALA A C     1 
ATOM   298  O  O     . ALA A 1 39  ? -10.796 51.384 41.531 1.00 25.56 ? 39  ALA A O     1 
ATOM   299  C  CB    . ALA A 1 39  ? -11.597 48.744 43.267 1.00 26.88 ? 39  ALA A CB    1 
ATOM   300  N  N     . GLY A 1 40  ? -9.034  50.635 42.756 1.00 34.27 ? 40  GLY A N     1 
ATOM   301  C  CA    . GLY A 1 40  ? -8.040  51.113 41.810 1.00 34.59 ? 40  GLY A CA    1 
ATOM   302  C  C     . GLY A 1 40  ? -6.903  50.125 41.799 1.00 35.24 ? 40  GLY A C     1 
ATOM   303  O  O     . GLY A 1 40  ? -6.182  49.990 42.778 1.00 35.95 ? 40  GLY A O     1 
ATOM   304  N  N     . HIS A 1 41  ? -6.774  49.403 40.699 1.00 38.94 ? 41  HIS A N     1 
ATOM   305  C  CA    . HIS A 1 41  ? -5.751  48.374 40.553 1.00 39.75 ? 41  HIS A CA    1 
ATOM   306  C  C     . HIS A 1 41  ? -4.762  48.727 39.436 1.00 42.21 ? 41  HIS A C     1 
ATOM   307  O  O     . HIS A 1 41  ? -5.170  48.952 38.294 1.00 46.91 ? 41  HIS A O     1 
ATOM   308  C  CB    . HIS A 1 41  ? -6.416  47.034 40.247 1.00 35.64 ? 41  HIS A CB    1 
ATOM   309  C  CG    . HIS A 1 41  ? -7.531  46.684 41.198 1.00 35.31 ? 41  HIS A CG    1 
ATOM   310  N  ND1   . HIS A 1 41  ? -7.337  45.854 42.275 1.00 39.23 ? 41  HIS A ND1   1 
ATOM   311  C  CD2   . HIS A 1 41  ? -8.830  47.011 41.206 1.00 36.38 ? 41  HIS A CD2   1 
ATOM   312  C  CE1   . HIS A 1 41  ? -8.488  45.676 42.922 1.00 31.37 ? 41  HIS A CE1   1 
ATOM   313  N  NE2   . HIS A 1 41  ? -9.411  46.389 42.268 1.00 39.18 ? 41  HIS A NE2   1 
ATOM   314  N  N     . THR A 1 42  ? -3.477  48.789 39.782 1.00 42.08 ? 42  THR A N     1 
ATOM   315  C  CA    . THR A 1 42  ? -2.426  49.113 38.823 1.00 38.44 ? 42  THR A CA    1 
ATOM   316  C  C     . THR A 1 42  ? -1.641  47.882 38.390 1.00 35.52 ? 42  THR A C     1 
ATOM   317  O  O     . THR A 1 42  ? -1.001  47.232 39.208 1.00 35.61 ? 42  THR A O     1 
ATOM   318  C  CB    . THR A 1 42  ? -1.452  50.115 39.420 1.00 41.99 ? 42  THR A CB    1 
ATOM   319  O  OG1   . THR A 1 42  ? -2.134  51.358 39.675 1.00 43.38 ? 42  THR A OG1   1 
ATOM   320  C  CG2   . THR A 1 42  ? -0.284  50.335 38.463 1.00 40.92 ? 42  THR A CG2   1 
ATOM   321  N  N     . LEU A 1 43  ? -1.745  47.542 37.110 1.00 31.52 ? 43  LEU A N     1 
ATOM   322  C  CA    . LEU A 1 43  ? -1.033  46.399 36.554 1.00 32.44 ? 43  LEU A CA    1 
ATOM   323  C  C     . LEU A 1 43  ? 0.101   46.992 35.761 1.00 32.88 ? 43  LEU A C     1 
ATOM   324  O  O     . LEU A 1 43  ? -0.099  47.987 35.067 1.00 29.24 ? 43  LEU A O     1 
ATOM   325  C  CB    . LEU A 1 43  ? -1.926  45.546 35.620 1.00 31.98 ? 43  LEU A CB    1 
ATOM   326  C  CG    . LEU A 1 43  ? -2.952  44.571 36.234 1.00 27.48 ? 43  LEU A CG    1 
ATOM   327  C  CD1   . LEU A 1 43  ? -3.891  45.292 37.204 1.00 28.50 ? 43  LEU A CD1   1 
ATOM   328  C  CD2   . LEU A 1 43  ? -3.736  43.888 35.098 1.00 24.59 ? 43  LEU A CD2   1 
ATOM   329  N  N     . VAL A 1 44  ? 1.292   46.407 35.904 1.00 35.53 ? 44  VAL A N     1 
ATOM   330  C  CA    . VAL A 1 44  ? 2.493   46.853 35.198 1.00 36.81 ? 44  VAL A CA    1 
ATOM   331  C  C     . VAL A 1 44  ? 3.154   45.647 34.520 1.00 36.77 ? 44  VAL A C     1 
ATOM   332  O  O     . VAL A 1 44  ? 3.587   44.724 35.198 1.00 38.05 ? 44  VAL A O     1 
ATOM   333  C  CB    . VAL A 1 44  ? 3.488   47.580 36.184 1.00 36.89 ? 44  VAL A CB    1 
ATOM   334  C  CG1   . VAL A 1 44  ? 4.800   47.916 35.486 1.00 32.60 ? 44  VAL A CG1   1 
ATOM   335  C  CG2   . VAL A 1 44  ? 2.869   48.887 36.706 1.00 30.08 ? 44  VAL A CG2   1 
ATOM   336  N  N     . ILE A 1 45  ? 3.150   45.610 33.191 1.00 37.01 ? 45  ILE A N     1 
ATOM   337  C  CA    . ILE A 1 45  ? 3.769   44.509 32.449 1.00 37.33 ? 45  ILE A CA    1 
ATOM   338  C  C     . ILE A 1 45  ? 4.849   45.110 31.557 1.00 38.55 ? 45  ILE A C     1 
ATOM   339  O  O     . ILE A 1 45  ? 4.558   45.946 30.701 1.00 36.35 ? 45  ILE A O     1 
ATOM   340  C  CB    . ILE A 1 45  ? 2.784   43.726 31.561 1.00 37.58 ? 45  ILE A CB    1 
ATOM   341  C  CG1   . ILE A 1 45  ? 1.697   43.028 32.396 1.00 37.71 ? 45  ILE A CG1   1 
ATOM   342  C  CG2   . ILE A 1 45  ? 3.549   42.637 30.817 1.00 35.32 ? 45  ILE A CG2   1 
ATOM   343  C  CD1   . ILE A 1 45  ? 0.535   43.885 32.765 1.00 42.82 ? 45  ILE A CD1   1 
ATOM   344  N  N     . ASN A 1 46  ? 6.096   44.687 31.777 1.00 41.71 ? 46  ASN A N     1 
ATOM   345  C  CA    . ASN A 1 46  ? 7.253   45.217 31.050 1.00 39.37 ? 46  ASN A CA    1 
ATOM   346  C  C     . ASN A 1 46  ? 7.142   46.739 30.970 1.00 37.53 ? 46  ASN A C     1 
ATOM   347  O  O     . ASN A 1 46  ? 7.210   47.321 29.906 1.00 36.80 ? 46  ASN A O     1 
ATOM   348  C  CB    . ASN A 1 46  ? 7.372   44.593 29.662 1.00 42.49 ? 46  ASN A CB    1 
ATOM   349  C  CG    . ASN A 1 46  ? 7.597   43.083 29.712 1.00 47.15 ? 46  ASN A CG    1 
ATOM   350  O  OD1   . ASN A 1 46  ? 7.373   42.421 30.731 1.00 47.82 ? 46  ASN A OD1   1 
ATOM   351  N  ND2   . ASN A 1 46  ? 8.002   42.526 28.590 1.00 50.27 ? 46  ASN A ND2   1 
ATOM   352  N  N     . GLY A 1 47  ? 6.923   47.376 32.114 1.00 35.65 ? 47  GLY A N     1 
ATOM   353  C  CA    . GLY A 1 47  ? 6.811   48.818 32.158 1.00 31.75 ? 47  GLY A CA    1 
ATOM   354  C  C     . GLY A 1 47  ? 5.502   49.484 31.779 1.00 33.19 ? 47  GLY A C     1 
ATOM   355  O  O     . GLY A 1 47  ? 5.344   50.662 32.172 1.00 29.76 ? 47  GLY A O     1 
ATOM   356  N  N     . GLU A 1 48  ? 4.581   48.785 31.069 1.00 30.03 ? 48  GLU A N     1 
ATOM   357  C  CA    . GLU A 1 48  ? 3.283   49.358 30.638 1.00 31.29 ? 48  GLU A CA    1 
ATOM   358  C  C     . GLU A 1 48  ? 2.150   49.363 31.690 1.00 34.75 ? 48  GLU A C     1 
ATOM   359  O  O     . GLU A 1 48  ? 1.511   48.345 31.957 1.00 38.02 ? 48  GLU A O     1 
ATOM   360  C  CB    . GLU A 1 48  ? 2.797   48.673 29.375 1.00 30.30 ? 48  GLU A CB    1 
ATOM   361  C  CG    . GLU A 1 48  ? 1.553   49.307 28.745 1.00 30.81 ? 48  GLU A CG    1 
ATOM   362  C  CD    . GLU A 1 48  ? 0.873   48.381 27.741 1.00 30.84 ? 48  GLU A CD    1 
ATOM   363  O  OE1   . GLU A 1 48  ? 1.248   47.199 27.651 1.00 30.47 ? 48  GLU A OE1   1 
ATOM   364  O  OE2   . GLU A 1 48  ? -0.072  48.808 27.070 1.00 29.94 ? 48  GLU A OE2   1 
ATOM   365  N  N     . LYS A 1 49  ? 1.881   50.521 32.270 1.00 35.06 ? 49  LYS A N     1 
ATOM   366  C  CA    . LYS A 1 49  ? 0.869   50.621 33.303 1.00 39.85 ? 49  LYS A CA    1 
ATOM   367  C  C     . LYS A 1 49  ? -0.586  50.549 32.799 1.00 43.12 ? 49  LYS A C     1 
ATOM   368  O  O     . LYS A 1 49  ? -0.939  51.166 31.785 1.00 46.41 ? 49  LYS A O     1 
ATOM   369  C  CB    . LYS A 1 49  ? 1.109   51.900 34.113 1.00 38.33 ? 49  LYS A CB    1 
ATOM   370  C  CG    . LYS A 1 49  ? 0.388   51.962 35.446 1.00 42.41 ? 49  LYS A CG    1 
ATOM   371  C  CD    . LYS A 1 49  ? 0.933   53.099 36.303 1.00 46.87 ? 49  LYS A CD    1 
ATOM   372  C  CE    . LYS A 1 49  ? 0.220   54.425 36.059 1.00 53.97 ? 49  LYS A CE    1 
ATOM   373  N  NZ    . LYS A 1 49  ? -1.138  54.470 36.695 1.00 55.91 ? 49  LYS A NZ    1 
ATOM   374  N  N     . THR A 1 50  ? -1.416  49.775 33.499 1.00 43.72 ? 50  THR A N     1 
ATOM   375  C  CA    . THR A 1 50  ? -2.847  49.628 33.183 1.00 41.29 ? 50  THR A CA    1 
ATOM   376  C  C     . THR A 1 50  ? -3.604  49.802 34.493 1.00 40.86 ? 50  THR A C     1 
ATOM   377  O  O     . THR A 1 50  ? -3.341  49.074 35.445 1.00 40.29 ? 50  THR A O     1 
ATOM   378  C  CB    . THR A 1 50  ? -3.191  48.221 32.658 1.00 39.01 ? 50  THR A CB    1 
ATOM   379  O  OG1   . THR A 1 50  ? -2.410  47.924 31.482 1.00 41.42 ? 50  THR A OG1   1 
ATOM   380  C  CG2   . THR A 1 50  ? -4.668  48.142 32.346 1.00 35.49 ? 50  THR A CG2   1 
ATOM   381  N  N     . VAL A 1 51  ? -4.510  50.770 34.564 1.00 39.48 ? 51  VAL A N     1 
ATOM   382  C  CA    . VAL A 1 51  ? -5.256  50.984 35.796 1.00 39.21 ? 51  VAL A CA    1 
ATOM   383  C  C     . VAL A 1 51  ? -6.708  50.532 35.700 1.00 36.97 ? 51  VAL A C     1 
ATOM   384  O  O     . VAL A 1 51  ? -7.523  51.118 34.985 1.00 36.74 ? 51  VAL A O     1 
ATOM   385  C  CB    . VAL A 1 51  ? -5.196  52.447 36.269 1.00 41.76 ? 51  VAL A CB    1 
ATOM   386  C  CG1   . VAL A 1 51  ? -6.215  52.665 37.407 1.00 45.00 ? 51  VAL A CG1   1 
ATOM   387  C  CG2   . VAL A 1 51  ? -3.794  52.770 36.759 1.00 40.93 ? 51  VAL A CG2   1 
ATOM   388  N  N     . LEU A 1 52  ? -7.034  49.490 36.442 1.00 32.38 ? 52  LEU A N     1 
ATOM   389  C  CA    . LEU A 1 52  ? -8.378  48.968 36.430 1.00 32.93 ? 52  LEU A CA    1 
ATOM   390  C  C     . LEU A 1 52  ? -9.146  49.461 37.685 1.00 34.98 ? 52  LEU A C     1 
ATOM   391  O  O     . LEU A 1 52  ? -8.539  49.780 38.718 1.00 36.30 ? 52  LEU A O     1 
ATOM   392  C  CB    . LEU A 1 52  ? -8.322  47.437 36.350 1.00 29.15 ? 52  LEU A CB    1 
ATOM   393  C  CG    . LEU A 1 52  ? -7.577  46.867 35.124 1.00 26.57 ? 52  LEU A CG    1 
ATOM   394  C  CD1   . LEU A 1 52  ? -7.548  45.386 35.190 1.00 24.39 ? 52  LEU A CD1   1 
ATOM   395  C  CD2   . LEU A 1 52  ? -8.275  47.249 33.847 1.00 29.54 ? 52  LEU A CD2   1 
ATOM   396  N  N     . HIS A 1 53  ? -10.461 49.600 37.575 1.00 29.98 ? 53  HIS A N     1 
ATOM   397  C  CA    . HIS A 1 53  ? -11.262 50.025 38.717 1.00 32.08 ? 53  HIS A CA    1 
ATOM   398  C  C     . HIS A 1 53  ? -12.399 49.021 38.904 1.00 35.19 ? 53  HIS A C     1 
ATOM   399  O  O     . HIS A 1 53  ? -12.438 48.272 39.896 1.00 36.30 ? 53  HIS A O     1 
ATOM   400  C  CB    . HIS A 1 53  ? -11.825 51.416 38.482 1.00 33.75 ? 53  HIS A CB    1 
ATOM   401  C  CG    . HIS A 1 53  ? -10.773 52.480 38.415 1.00 35.08 ? 53  HIS A CG    1 
ATOM   402  N  ND1   . HIS A 1 53  ? -10.106 52.909 39.534 1.00 39.84 ? 53  HIS A ND1   1 
ATOM   403  C  CD2   . HIS A 1 53  ? -10.292 53.191 37.387 1.00 32.29 ? 53  HIS A CD2   1 
ATOM   404  C  CE1   . HIS A 1 53  ? -9.244  53.855 39.190 1.00 38.29 ? 53  HIS A CE1   1 
ATOM   405  N  NE2   . HIS A 1 53  ? -9.337  54.048 37.886 1.00 35.71 ? 53  HIS A NE2   1 
ATOM   406  N  N     . LEU A 1 54  ? -13.285 48.979 37.908 1.00 33.93 ? 54  LEU A N     1 
ATOM   407  C  CA    . LEU A 1 54  ? -14.437 48.091 37.893 1.00 33.07 ? 54  LEU A CA    1 
ATOM   408  C  C     . LEU A 1 54  ? -14.183 46.776 37.148 1.00 33.51 ? 54  LEU A C     1 
ATOM   409  O  O     . LEU A 1 54  ? -14.782 45.745 37.465 1.00 32.95 ? 54  LEU A O     1 
ATOM   410  C  CB    . LEU A 1 54  ? -15.615 48.816 37.232 1.00 28.61 ? 54  LEU A CB    1 
ATOM   411  C  CG    . LEU A 1 54  ? -16.836 47.945 36.989 1.00 24.89 ? 54  LEU A CG    1 
ATOM   412  C  CD1   . LEU A 1 54  ? -17.264 47.348 38.337 1.00 26.94 ? 54  LEU A CD1   1 
ATOM   413  C  CD2   . LEU A 1 54  ? -17.961 48.762 36.327 1.00 27.60 ? 54  LEU A CD2   1 
ATOM   414  N  N     . ILE A 1 55  ? -13.334 46.808 36.129 1.00 35.03 ? 55  ILE A N     1 
ATOM   415  C  CA    . ILE A 1 55  ? -13.062 45.595 35.356 1.00 35.20 ? 55  ILE A CA    1 
ATOM   416  C  C     . ILE A 1 55  ? -12.066 44.683 36.087 1.00 33.58 ? 55  ILE A C     1 
ATOM   417  O  O     . ILE A 1 55  ? -11.058 45.151 36.600 1.00 38.22 ? 55  ILE A O     1 
ATOM   418  C  CB    . ILE A 1 55  ? -12.607 45.943 33.902 1.00 30.82 ? 55  ILE A CB    1 
ATOM   419  C  CG1   . ILE A 1 55  ? -13.794 46.538 33.120 1.00 30.58 ? 55  ILE A CG1   1 
ATOM   420  C  CG2   . ILE A 1 55  ? -12.123 44.702 33.172 1.00 34.11 ? 55  ILE A CG2   1 
ATOM   421  C  CD1   . ILE A 1 55  ? -13.480 46.910 31.664 1.00 21.47 ? 55  ILE A CD1   1 
ATOM   422  N  N     . PRO A 1 56  ? -12.361 43.375 36.180 1.00 32.93 ? 56  PRO A N     1 
ATOM   423  C  CA    . PRO A 1 56  ? -11.442 42.460 36.873 1.00 31.14 ? 56  PRO A CA    1 
ATOM   424  C  C     . PRO A 1 56  ? -10.022 42.531 36.297 1.00 31.33 ? 56  PRO A C     1 
ATOM   425  O  O     . PRO A 1 56  ? -9.823  42.722 35.093 1.00 31.80 ? 56  PRO A O     1 
ATOM   426  C  CB    . PRO A 1 56  ? -12.080 41.092 36.650 1.00 27.22 ? 56  PRO A CB    1 
ATOM   427  C  CG    . PRO A 1 56  ? -13.532 41.404 36.496 1.00 31.18 ? 56  PRO A CG    1 
ATOM   428  C  CD    . PRO A 1 56  ? -13.520 42.643 35.634 1.00 32.61 ? 56  PRO A CD    1 
ATOM   429  N  N     . SER A 1 57  ? -9.029  42.331 37.148 1.00 31.65 ? 57  SER A N     1 
ATOM   430  C  CA    . SER A 1 57  ? -7.648  42.423 36.728 1.00 32.45 ? 57  SER A CA    1 
ATOM   431  C  C     . SER A 1 57  ? -7.146  41.293 35.834 1.00 33.32 ? 57  SER A C     1 
ATOM   432  O  O     . SER A 1 57  ? -5.974  41.255 35.476 1.00 36.77 ? 57  SER A O     1 
ATOM   433  C  CB    . SER A 1 57  ? -6.747  42.645 37.944 1.00 35.44 ? 57  SER A CB    1 
ATOM   434  O  OG    . SER A 1 57  ? -7.225  43.762 38.695 1.00 34.50 ? 57  SER A OG    1 
ATOM   435  N  N     . GLY A 1 58  ? -8.027  40.386 35.449 1.00 34.02 ? 58  GLY A N     1 
ATOM   436  C  CA    . GLY A 1 58  ? -7.621  39.311 34.548 1.00 32.69 ? 58  GLY A CA    1 
ATOM   437  C  C     . GLY A 1 58  ? -7.927  39.676 33.084 1.00 28.30 ? 58  GLY A C     1 
ATOM   438  O  O     . GLY A 1 58  ? -7.644  38.903 32.161 1.00 23.33 ? 58  GLY A O     1 
ATOM   439  N  N     . ILE A 1 59  ? -8.477  40.871 32.875 1.00 26.64 ? 59  ILE A N     1 
ATOM   440  C  CA    . ILE A 1 59  ? -8.847  41.357 31.553 1.00 25.81 ? 59  ILE A CA    1 
ATOM   441  C  C     . ILE A 1 59  ? -7.715  41.434 30.515 1.00 27.63 ? 59  ILE A C     1 
ATOM   442  O  O     . ILE A 1 59  ? -7.986  41.435 29.306 1.00 31.07 ? 59  ILE A O     1 
ATOM   443  C  CB    . ILE A 1 59  ? -9.593  42.725 31.664 1.00 25.01 ? 59  ILE A CB    1 
ATOM   444  C  CG1   . ILE A 1 59  ? -10.310 43.071 30.349 1.00 25.41 ? 59  ILE A CG1   1 
ATOM   445  C  CG2   . ILE A 1 59  ? -8.643  43.804 31.982 1.00 20.37 ? 59  ILE A CG2   1 
ATOM   446  C  CD1   . ILE A 1 59  ? -11.508 42.205 30.044 1.00 18.13 ? 59  ILE A CD1   1 
ATOM   447  N  N     . LEU A 1 60  ? -6.455  41.465 30.956 1.00 27.15 ? 60  LEU A N     1 
ATOM   448  C  CA    . LEU A 1 60  ? -5.339  41.525 30.009 1.00 26.95 ? 60  LEU A CA    1 
ATOM   449  C  C     . LEU A 1 60  ? -4.912  40.153 29.521 1.00 30.49 ? 60  LEU A C     1 
ATOM   450  O  O     . LEU A 1 60  ? -4.073  40.057 28.623 1.00 39.29 ? 60  LEU A O     1 
ATOM   451  C  CB    . LEU A 1 60  ? -4.116  42.243 30.589 1.00 23.89 ? 60  LEU A CB    1 
ATOM   452  C  CG    . LEU A 1 60  ? -4.267  43.667 31.135 1.00 19.07 ? 60  LEU A CG    1 
ATOM   453  C  CD1   . LEU A 1 60  ? -2.911  44.226 31.431 1.00 25.01 ? 60  LEU A CD1   1 
ATOM   454  C  CD2   . LEU A 1 60  ? -4.940  44.534 30.143 1.00 21.44 ? 60  LEU A CD2   1 
ATOM   455  N  N     . ARG A 1 61  ? -5.489  39.079 30.052 1.00 29.27 ? 61  ARG A N     1 
ATOM   456  C  CA    . ARG A 1 61  ? -5.089  37.746 29.605 1.00 30.12 ? 61  ARG A CA    1 
ATOM   457  C  C     . ARG A 1 61  ? -6.219  37.084 28.805 1.00 33.68 ? 61  ARG A C     1 
ATOM   458  O  O     . ARG A 1 61  ? -7.250  36.672 29.366 1.00 35.98 ? 61  ARG A O     1 
ATOM   459  C  CB    . ARG A 1 61  ? -4.604  36.904 30.808 1.00 26.04 ? 61  ARG A CB    1 
ATOM   460  C  CG    . ARG A 1 61  ? -3.398  37.550 31.491 1.00 28.99 ? 61  ARG A CG    1 
ATOM   461  C  CD    . ARG A 1 61  ? -2.828  36.768 32.692 1.00 26.44 ? 61  ARG A CD    1 
ATOM   462  N  NE    . ARG A 1 61  ? -1.538  36.155 32.381 1.00 27.30 ? 61  ARG A NE    1 
ATOM   463  C  CZ    . ARG A 1 61  ? -0.474  36.290 33.158 1.00 27.87 ? 61  ARG A CZ    1 
ATOM   464  N  NH1   . ARG A 1 61  ? -0.520  37.014 34.256 1.00 30.71 ? 61  ARG A NH1   1 
ATOM   465  N  NH2   . ARG A 1 61  ? 0.634   35.625 32.870 1.00 39.34 ? 61  ARG A NH2   1 
ATOM   466  N  N     . GLU A 1 62  ? -6.034  36.982 27.483 1.00 36.56 ? 62  GLU A N     1 
ATOM   467  C  CA    . GLU A 1 62  ? -7.075  36.416 26.625 1.00 34.58 ? 62  GLU A CA    1 
ATOM   468  C  C     . GLU A 1 62  ? -7.522  35.024 26.959 1.00 32.47 ? 62  GLU A C     1 
ATOM   469  O  O     . GLU A 1 62  ? -8.615  34.631 26.580 1.00 38.26 ? 62  GLU A O     1 
ATOM   470  C  CB    . GLU A 1 62  ? -6.733  36.532 25.150 1.00 36.17 ? 62  GLU A CB    1 
ATOM   471  C  CG    . GLU A 1 62  ? -5.809  35.508 24.603 1.00 43.78 ? 62  GLU A CG    1 
ATOM   472  C  CD    . GLU A 1 62  ? -6.504  34.220 24.220 1.00 51.50 ? 62  GLU A CD    1 
ATOM   473  O  OE1   . GLU A 1 62  ? -6.041  33.143 24.667 1.00 55.95 ? 62  GLU A OE1   1 
ATOM   474  O  OE2   . GLU A 1 62  ? -7.500  34.278 23.467 1.00 54.23 ? 62  GLU A OE2   1 
ATOM   475  N  N     . ASN A 1 63  ? -6.713  34.290 27.713 1.00 31.31 ? 63  ASN A N     1 
ATOM   476  C  CA    . ASN A 1 63  ? -7.069  32.923 28.107 1.00 29.83 ? 63  ASN A CA    1 
ATOM   477  C  C     . ASN A 1 63  ? -8.029  32.913 29.279 1.00 28.03 ? 63  ASN A C     1 
ATOM   478  O  O     . ASN A 1 63  ? -8.539  31.848 29.636 1.00 27.86 ? 63  ASN A O     1 
ATOM   479  C  CB    . ASN A 1 63  ? -5.810  32.130 28.505 1.00 33.86 ? 63  ASN A CB    1 
ATOM   480  C  CG    . ASN A 1 63  ? -5.126  32.688 29.767 1.00 38.49 ? 63  ASN A CG    1 
ATOM   481  O  OD1   . ASN A 1 63  ? -5.262  32.129 30.853 1.00 44.94 ? 63  ASN A OD1   1 
ATOM   482  N  ND2   . ASN A 1 63  ? -4.374  33.779 29.613 1.00 34.55 ? 63  ASN A ND2   1 
ATOM   483  N  N     . VAL A 1 64  ? -8.285  34.083 29.872 1.00 29.51 ? 64  VAL A N     1 
ATOM   484  C  CA    . VAL A 1 64  ? -9.157  34.202 31.044 1.00 30.36 ? 64  VAL A CA    1 
ATOM   485  C  C     . VAL A 1 64  ? -10.429 34.985 30.769 1.00 30.65 ? 64  VAL A C     1 
ATOM   486  O  O     . VAL A 1 64  ? -10.402 35.988 30.056 1.00 29.09 ? 64  VAL A O     1 
ATOM   487  C  CB    . VAL A 1 64  ? -8.439  34.942 32.203 1.00 33.97 ? 64  VAL A CB    1 
ATOM   488  C  CG1   . VAL A 1 64  ? -9.126  34.661 33.524 1.00 34.12 ? 64  VAL A CG1   1 
ATOM   489  C  CG2   . VAL A 1 64  ? -6.975  34.535 32.294 1.00 39.09 ? 64  VAL A CG2   1 
ATOM   490  N  N     . THR A 1 65  ? -11.535 34.527 31.359 1.00 31.19 ? 65  THR A N     1 
ATOM   491  C  CA    . THR A 1 65  ? -12.847 35.178 31.227 1.00 29.42 ? 65  THR A CA    1 
ATOM   492  C  C     . THR A 1 65  ? -13.087 36.003 32.499 1.00 27.44 ? 65  THR A C     1 
ATOM   493  O  O     . THR A 1 65  ? -13.200 35.451 33.588 1.00 24.08 ? 65  THR A O     1 
ATOM   494  C  CB    . THR A 1 65  ? -14.002 34.139 31.127 1.00 33.56 ? 65  THR A CB    1 
ATOM   495  O  OG1   . THR A 1 65  ? -13.619 33.067 30.265 1.00 37.33 ? 65  THR A OG1   1 
ATOM   496  C  CG2   . THR A 1 65  ? -15.270 34.777 30.563 1.00 34.61 ? 65  THR A CG2   1 
ATOM   497  N  N     . SER A 1 66  ? -13.155 37.318 32.367 1.00 23.43 ? 66  SER A N     1 
ATOM   498  C  CA    . SER A 1 66  ? -13.358 38.142 33.519 1.00 22.75 ? 66  SER A CA    1 
ATOM   499  C  C     . SER A 1 66  ? -14.839 38.338 33.841 1.00 24.69 ? 66  SER A C     1 
ATOM   500  O  O     . SER A 1 66  ? -15.632 38.653 32.949 1.00 21.40 ? 66  SER A O     1 
ATOM   501  C  CB    . SER A 1 66  ? -12.619 39.441 33.331 1.00 22.33 ? 66  SER A CB    1 
ATOM   502  O  OG    . SER A 1 66  ? -11.252 39.148 33.183 1.00 23.72 ? 66  SER A OG    1 
ATOM   503  N  N     . ILE A 1 67  ? -15.206 38.102 35.108 1.00 22.68 ? 67  ILE A N     1 
ATOM   504  C  CA    . ILE A 1 67  ? -16.578 38.218 35.544 1.00 22.21 ? 67  ILE A CA    1 
ATOM   505  C  C     . ILE A 1 67  ? -16.846 39.245 36.614 1.00 22.26 ? 67  ILE A C     1 
ATOM   506  O  O     . ILE A 1 67  ? -16.109 39.376 37.577 1.00 23.55 ? 67  ILE A O     1 
ATOM   507  C  CB    . ILE A 1 67  ? -17.104 36.891 36.048 1.00 24.54 ? 67  ILE A CB    1 
ATOM   508  C  CG1   . ILE A 1 67  ? -16.974 35.821 34.957 1.00 25.73 ? 67  ILE A CG1   1 
ATOM   509  C  CG2   . ILE A 1 67  ? -18.557 37.039 36.520 1.00 32.09 ? 67  ILE A CG2   1 
ATOM   510  C  CD1   . ILE A 1 67  ? -17.483 34.465 35.363 1.00 30.87 ? 67  ILE A CD1   1 
ATOM   511  N  N     . ILE A 1 68  ? -17.907 40.002 36.416 1.00 21.97 ? 68  ILE A N     1 
ATOM   512  C  CA    . ILE A 1 68  ? -18.319 40.988 37.382 1.00 24.71 ? 68  ILE A CA    1 
ATOM   513  C  C     . ILE A 1 68  ? -19.466 40.279 38.100 1.00 27.28 ? 68  ILE A C     1 
ATOM   514  O  O     . ILE A 1 68  ? -20.545 40.051 37.535 1.00 31.58 ? 68  ILE A O     1 
ATOM   515  C  CB    . ILE A 1 68  ? -18.714 42.350 36.698 1.00 27.25 ? 68  ILE A CB    1 
ATOM   516  C  CG1   . ILE A 1 68  ? -17.427 43.141 36.377 1.00 27.79 ? 68  ILE A CG1   1 
ATOM   517  C  CG2   . ILE A 1 68  ? -19.647 43.206 37.626 1.00 22.57 ? 68  ILE A CG2   1 
ATOM   518  C  CD1   . ILE A 1 68  ? -17.636 44.304 35.453 1.00 21.23 ? 68  ILE A CD1   1 
ATOM   519  N  N     . GLY A 1 69  ? -19.185 39.841 39.319 1.00 26.88 ? 69  GLY A N     1 
ATOM   520  C  CA    . GLY A 1 69  ? -20.164 39.109 40.098 1.00 27.40 ? 69  GLY A CA    1 
ATOM   521  C  C     . GLY A 1 69  ? -21.283 39.967 40.614 1.00 27.48 ? 69  GLY A C     1 
ATOM   522  O  O     . GLY A 1 69  ? -21.124 41.179 40.788 1.00 26.27 ? 69  GLY A O     1 
ATOM   523  N  N     . ASN A 1 70  ? -22.397 39.326 40.932 1.00 25.15 ? 70  ASN A N     1 
ATOM   524  C  CA    . ASN A 1 70  ? -23.557 40.051 41.425 1.00 23.07 ? 70  ASN A CA    1 
ATOM   525  C  C     . ASN A 1 70  ? -23.260 40.981 42.590 1.00 19.60 ? 70  ASN A C     1 
ATOM   526  O  O     . ASN A 1 70  ? -23.925 41.980 42.793 1.00 22.95 ? 70  ASN A O     1 
ATOM   527  C  CB    . ASN A 1 70  ? -24.673 39.071 41.768 1.00 23.10 ? 70  ASN A CB    1 
ATOM   528  C  CG    . ASN A 1 70  ? -24.299 38.148 42.862 1.00 23.02 ? 70  ASN A CG    1 
ATOM   529  O  OD1   . ASN A 1 70  ? -23.677 37.103 42.643 1.00 28.31 ? 70  ASN A OD1   1 
ATOM   530  N  ND2   . ASN A 1 70  ? -24.646 38.528 44.071 1.00 33.14 ? 70  ASN A ND2   1 
ATOM   531  N  N     . GLY A 1 71  ? -22.247 40.673 43.373 1.00 18.25 ? 71  GLY A N     1 
ATOM   532  C  CA    . GLY A 1 71  ? -21.940 41.524 44.494 1.00 18.45 ? 71  GLY A CA    1 
ATOM   533  C  C     . GLY A 1 71  ? -21.533 42.923 44.092 1.00 17.93 ? 71  GLY A C     1 
ATOM   534  O  O     . GLY A 1 71  ? -21.719 43.867 44.841 1.00 26.31 ? 71  GLY A O     1 
ATOM   535  N  N     . VAL A 1 72  ? -20.952 43.081 42.922 1.00 20.52 ? 72  VAL A N     1 
ATOM   536  C  CA    . VAL A 1 72  ? -20.469 44.376 42.462 1.00 21.37 ? 72  VAL A CA    1 
ATOM   537  C  C     . VAL A 1 72  ? -21.528 45.443 42.144 1.00 25.70 ? 72  VAL A C     1 
ATOM   538  O  O     . VAL A 1 72  ? -22.547 45.175 41.477 1.00 25.77 ? 72  VAL A O     1 
ATOM   539  C  CB    . VAL A 1 72  ? -19.589 44.192 41.199 1.00 19.68 ? 72  VAL A CB    1 
ATOM   540  C  CG1   . VAL A 1 72  ? -19.108 45.549 40.625 1.00 22.48 ? 72  VAL A CG1   1 
ATOM   541  C  CG2   . VAL A 1 72  ? -18.436 43.277 41.514 1.00 21.02 ? 72  VAL A CG2   1 
ATOM   542  N  N     . VAL A 1 73  ? -21.291 46.662 42.636 1.00 28.82 ? 73  VAL A N     1 
ATOM   543  C  CA    . VAL A 1 73  ? -22.169 47.775 42.335 1.00 28.44 ? 73  VAL A CA    1 
ATOM   544  C  C     . VAL A 1 73  ? -21.528 48.325 41.079 1.00 29.76 ? 73  VAL A C     1 
ATOM   545  O  O     . VAL A 1 73  ? -20.357 48.743 41.081 1.00 29.40 ? 73  VAL A O     1 
ATOM   546  C  CB    . VAL A 1 73  ? -22.242 48.790 43.472 1.00 27.58 ? 73  VAL A CB    1 
ATOM   547  C  CG1   . VAL A 1 73  ? -23.086 48.193 44.575 1.00 23.19 ? 73  VAL A CG1   1 
ATOM   548  C  CG2   . VAL A 1 73  ? -20.858 49.165 43.970 1.00 24.14 ? 73  VAL A CG2   1 
ATOM   549  N  N     . LEU A 1 74  ? -22.286 48.251 39.985 1.00 28.91 ? 74  LEU A N     1 
ATOM   550  C  CA    . LEU A 1 74  ? -21.790 48.627 38.671 1.00 33.01 ? 74  LEU A CA    1 
ATOM   551  C  C     . LEU A 1 74  ? -22.296 49.910 38.016 1.00 32.49 ? 74  LEU A C     1 
ATOM   552  O  O     . LEU A 1 74  ? -23.482 50.085 37.756 1.00 36.28 ? 74  LEU A O     1 
ATOM   553  C  CB    . LEU A 1 74  ? -21.924 47.398 37.737 1.00 33.18 ? 74  LEU A CB    1 
ATOM   554  C  CG    . LEU A 1 74  ? -22.127 47.341 36.216 1.00 33.21 ? 74  LEU A CG    1 
ATOM   555  C  CD1   . LEU A 1 74  ? -21.204 48.244 35.437 1.00 32.03 ? 74  LEU A CD1   1 
ATOM   556  C  CD2   . LEU A 1 74  ? -21.906 45.901 35.799 1.00 32.50 ? 74  LEU A CD2   1 
ATOM   557  N  N     . SER A 1 75  ? -21.357 50.793 37.716 1.00 32.49 ? 75  SER A N     1 
ATOM   558  C  CA    . SER A 1 75  ? -21.641 52.070 37.075 1.00 29.36 ? 75  SER A CA    1 
ATOM   559  C  C     . SER A 1 75  ? -21.496 51.906 35.573 1.00 31.81 ? 75  SER A C     1 
ATOM   560  O  O     . SER A 1 75  ? -20.371 51.731 35.067 1.00 30.83 ? 75  SER A O     1 
ATOM   561  C  CB    . SER A 1 75  ? -20.634 53.108 37.548 1.00 25.38 ? 75  SER A CB    1 
ATOM   562  O  OG    . SER A 1 75  ? -20.753 54.286 36.781 1.00 28.70 ? 75  SER A OG    1 
ATOM   563  N  N     . PRO A 1 76  ? -22.620 51.963 34.827 1.00 33.32 ? 76  PRO A N     1 
ATOM   564  C  CA    . PRO A 1 76  ? -22.601 51.814 33.360 1.00 31.44 ? 76  PRO A CA    1 
ATOM   565  C  C     . PRO A 1 76  ? -21.585 52.791 32.770 1.00 31.02 ? 76  PRO A C     1 
ATOM   566  O  O     . PRO A 1 76  ? -20.747 52.419 31.960 1.00 34.09 ? 76  PRO A O     1 
ATOM   567  C  CB    . PRO A 1 76  ? -24.026 52.189 32.956 1.00 35.63 ? 76  PRO A CB    1 
ATOM   568  C  CG    . PRO A 1 76  ? -24.852 51.830 34.175 1.00 35.24 ? 76  PRO A CG    1 
ATOM   569  C  CD    . PRO A 1 76  ? -23.970 52.315 35.307 1.00 32.30 ? 76  PRO A CD    1 
ATOM   570  N  N     . ALA A 1 77  ? -21.650 54.046 33.200 1.00 28.54 ? 77  ALA A N     1 
ATOM   571  C  CA    . ALA A 1 77  ? -20.714 55.057 32.741 1.00 30.14 ? 77  ALA A CA    1 
ATOM   572  C  C     . ALA A 1 77  ? -19.267 54.582 32.984 1.00 33.21 ? 77  ALA A C     1 
ATOM   573  O  O     . ALA A 1 77  ? -18.429 54.668 32.089 1.00 37.36 ? 77  ALA A O     1 
ATOM   574  C  CB    . ALA A 1 77  ? -20.958 56.336 33.500 1.00 30.30 ? 77  ALA A CB    1 
ATOM   575  N  N     . ALA A 1 78  ? -18.978 54.115 34.203 1.00 32.83 ? 78  ALA A N     1 
ATOM   576  C  CA    . ALA A 1 78  ? -17.647 53.625 34.569 1.00 31.17 ? 78  ALA A CA    1 
ATOM   577  C  C     . ALA A 1 78  ? -17.243 52.460 33.705 1.00 31.13 ? 78  ALA A C     1 
ATOM   578  O  O     . ALA A 1 78  ? -16.132 52.428 33.175 1.00 35.92 ? 78  ALA A O     1 
ATOM   579  C  CB    . ALA A 1 78  ? -17.595 53.213 36.011 1.00 34.45 ? 78  ALA A CB    1 
ATOM   580  N  N     . LEU A 1 79  ? -18.124 51.485 33.558 1.00 28.19 ? 79  LEU A N     1 
ATOM   581  C  CA    . LEU A 1 79  ? -17.789 50.351 32.710 1.00 28.91 ? 79  LEU A CA    1 
ATOM   582  C  C     . LEU A 1 79  ? -17.415 50.814 31.279 1.00 31.66 ? 79  LEU A C     1 
ATOM   583  O  O     . LEU A 1 79  ? -16.348 50.470 30.748 1.00 29.33 ? 79  LEU A O     1 
ATOM   584  C  CB    . LEU A 1 79  ? -18.962 49.385 32.643 1.00 24.03 ? 79  LEU A CB    1 
ATOM   585  C  CG    . LEU A 1 79  ? -18.698 48.149 31.783 1.00 25.10 ? 79  LEU A CG    1 
ATOM   586  C  CD1   . LEU A 1 79  ? -17.432 47.408 32.310 1.00 17.29 ? 79  LEU A CD1   1 
ATOM   587  C  CD2   . LEU A 1 79  ? -19.967 47.260 31.852 1.00 21.64 ? 79  LEU A CD2   1 
ATOM   588  N  N     . MET A 1 80  ? -18.306 51.591 30.664 1.00 30.62 ? 80  MET A N     1 
ATOM   589  C  CA    . MET A 1 80  ? -18.095 52.099 29.324 1.00 29.73 ? 80  MET A CA    1 
ATOM   590  C  C     . MET A 1 80  ? -16.759 52.795 29.200 1.00 30.90 ? 80  MET A C     1 
ATOM   591  O  O     . MET A 1 80  ? -15.986 52.519 28.272 1.00 34.46 ? 80  MET A O     1 
ATOM   592  C  CB    . MET A 1 80  ? -19.213 53.047 28.955 1.00 24.58 ? 80  MET A CB    1 
ATOM   593  C  CG    . MET A 1 80  ? -20.544 52.370 28.824 1.00 27.14 ? 80  MET A CG    1 
ATOM   594  S  SD    . MET A 1 80  ? -20.459 50.845 27.833 1.00 35.51 ? 80  MET A SD    1 
ATOM   595  C  CE    . MET A 1 80  ? -21.258 49.797 29.003 1.00 26.06 ? 80  MET A CE    1 
ATOM   596  N  N     . LYS A 1 81  ? -16.478 53.692 30.135 1.00 32.24 ? 81  LYS A N     1 
ATOM   597  C  CA    . LYS A 1 81  ? -15.223 54.415 30.147 1.00 32.93 ? 81  LYS A CA    1 
ATOM   598  C  C     . LYS A 1 81  ? -14.015 53.508 30.160 1.00 34.38 ? 81  LYS A C     1 
ATOM   599  O  O     . LYS A 1 81  ? -13.068 53.738 29.423 1.00 37.55 ? 81  LYS A O     1 
ATOM   600  C  CB    . LYS A 1 81  ? -15.147 55.337 31.340 1.00 33.74 ? 81  LYS A CB    1 
ATOM   601  C  CG    . LYS A 1 81  ? -13.853 56.113 31.360 1.00 33.46 ? 81  LYS A CG    1 
ATOM   602  C  CD    . LYS A 1 81  ? -13.971 57.240 32.337 1.00 38.34 ? 81  LYS A CD    1 
ATOM   603  C  CE    . LYS A 1 81  ? -12.681 57.978 32.469 1.00 39.69 ? 81  LYS A CE    1 
ATOM   604  N  NZ    . LYS A 1 81  ? -11.636 56.950 32.522 1.00 48.23 ? 81  LYS A NZ    1 
ATOM   605  N  N     . GLU A 1 82  ? -14.014 52.512 31.030 1.00 34.71 ? 82  GLU A N     1 
ATOM   606  C  CA    . GLU A 1 82  ? -12.897 51.594 31.100 1.00 35.38 ? 82  GLU A CA    1 
ATOM   607  C  C     . GLU A 1 82  ? -12.823 50.699 29.851 1.00 36.44 ? 82  GLU A C     1 
ATOM   608  O  O     . GLU A 1 82  ? -11.754 50.523 29.262 1.00 42.01 ? 82  GLU A O     1 
ATOM   609  C  CB    . GLU A 1 82  ? -12.987 50.759 32.368 1.00 35.53 ? 82  GLU A CB    1 
ATOM   610  C  CG    . GLU A 1 82  ? -12.453 51.473 33.585 1.00 42.52 ? 82  GLU A CG    1 
ATOM   611  C  CD    . GLU A 1 82  ? -12.627 50.673 34.873 1.00 47.42 ? 82  GLU A CD    1 
ATOM   612  O  OE1   . GLU A 1 82  ? -11.845 49.714 35.142 1.00 45.83 ? 82  GLU A OE1   1 
ATOM   613  O  OE2   . GLU A 1 82  ? -13.538 51.036 35.645 1.00 47.28 ? 82  GLU A OE2   1 
ATOM   614  N  N     . MET A 1 83  ? -13.942 50.130 29.433 1.00 31.77 ? 83  MET A N     1 
ATOM   615  C  CA    . MET A 1 83  ? -13.933 49.286 28.250 1.00 35.54 ? 83  MET A CA    1 
ATOM   616  C  C     . MET A 1 83  ? -13.250 50.033 27.104 1.00 38.84 ? 83  MET A C     1 
ATOM   617  O  O     . MET A 1 83  ? -12.276 49.539 26.513 1.00 38.80 ? 83  MET A O     1 
ATOM   618  C  CB    . MET A 1 83  ? -15.362 48.923 27.827 1.00 35.23 ? 83  MET A CB    1 
ATOM   619  C  CG    . MET A 1 83  ? -16.068 47.998 28.764 1.00 36.78 ? 83  MET A CG    1 
ATOM   620  S  SD    . MET A 1 83  ? -17.469 47.203 28.018 1.00 42.10 ? 83  MET A SD    1 
ATOM   621  C  CE    . MET A 1 83  ? -17.341 47.803 26.302 1.00 39.64 ? 83  MET A CE    1 
ATOM   622  N  N     . LYS A 1 84  ? -13.743 51.239 26.816 1.00 38.88 ? 84  LYS A N     1 
ATOM   623  C  CA    . LYS A 1 84  ? -13.186 52.033 25.735 1.00 41.23 ? 84  LYS A CA    1 
ATOM   624  C  C     . LYS A 1 84  ? -11.679 52.153 25.866 1.00 38.85 ? 84  LYS A C     1 
ATOM   625  O  O     . LYS A 1 84  ? -10.943 51.889 24.921 1.00 38.48 ? 84  LYS A O     1 
ATOM   626  C  CB    . LYS A 1 84  ? -13.830 53.418 25.704 1.00 45.77 ? 84  LYS A CB    1 
ATOM   627  C  CG    . LYS A 1 84  ? -13.904 54.049 24.309 1.00 49.44 ? 84  LYS A CG    1 
ATOM   628  C  CD    . LYS A 1 84  ? -12.587 54.683 23.911 1.00 58.35 ? 84  LYS A CD    1 
ATOM   629  C  CE    . LYS A 1 84  ? -12.627 55.257 22.490 1.00 62.12 ? 84  LYS A CE    1 
ATOM   630  N  NZ    . LYS A 1 84  ? -12.661 54.214 21.415 1.00 60.69 ? 84  LYS A NZ    1 
ATOM   631  N  N     . GLU A 1 85  ? -11.215 52.519 27.044 1.00 39.04 ? 85  GLU A N     1 
ATOM   632  C  CA    . GLU A 1 85  ? -9.782  52.680 27.271 1.00 40.84 ? 85  GLU A CA    1 
ATOM   633  C  C     . GLU A 1 85  ? -8.972  51.428 27.010 1.00 38.36 ? 85  GLU A C     1 
ATOM   634  O  O     . GLU A 1 85  ? -7.865  51.506 26.476 1.00 37.81 ? 85  GLU A O     1 
ATOM   635  C  CB    . GLU A 1 85  ? -9.512  53.177 28.686 1.00 41.70 ? 85  GLU A CB    1 
ATOM   636  C  CG    . GLU A 1 85  ? -10.036 54.582 28.932 1.00 45.08 ? 85  GLU A CG    1 
ATOM   637  C  CD    . GLU A 1 85  ? -9.846  55.054 30.359 1.00 47.17 ? 85  GLU A CD    1 
ATOM   638  O  OE1   . GLU A 1 85  ? -9.518  54.215 31.231 1.00 50.30 ? 85  GLU A OE1   1 
ATOM   639  O  OE2   . GLU A 1 85  ? -10.045 56.265 30.619 1.00 43.39 ? 85  GLU A OE2   1 
ATOM   640  N  N     . LEU A 1 86  ? -9.497  50.275 27.406 1.00 36.73 ? 86  LEU A N     1 
ATOM   641  C  CA    . LEU A 1 86  ? -8.767  49.033 27.196 1.00 34.30 ? 86  LEU A CA    1 
ATOM   642  C  C     . LEU A 1 86  ? -8.798  48.631 25.729 1.00 34.71 ? 86  LEU A C     1 
ATOM   643  O  O     . LEU A 1 86  ? -7.822  48.076 25.203 1.00 35.71 ? 86  LEU A O     1 
ATOM   644  C  CB    . LEU A 1 86  ? -9.328  47.918 28.075 1.00 32.81 ? 86  LEU A CB    1 
ATOM   645  C  CG    . LEU A 1 86  ? -9.314  48.206 29.571 1.00 34.01 ? 86  LEU A CG    1 
ATOM   646  C  CD1   . LEU A 1 86  ? -9.998  47.096 30.286 1.00 31.10 ? 86  LEU A CD1   1 
ATOM   647  C  CD2   . LEU A 1 86  ? -7.893  48.381 30.053 1.00 32.14 ? 86  LEU A CD2   1 
ATOM   648  N  N     . GLU A 1 87  ? -9.924  48.903 25.079 1.00 34.92 ? 87  GLU A N     1 
ATOM   649  C  CA    . GLU A 1 87  ? -10.109 48.587 23.661 1.00 35.04 ? 87  GLU A CA    1 
ATOM   650  C  C     . GLU A 1 87  ? -9.136  49.351 22.764 1.00 32.91 ? 87  GLU A C     1 
ATOM   651  O  O     . GLU A 1 87  ? -8.545  48.784 21.849 1.00 33.28 ? 87  GLU A O     1 
ATOM   652  C  CB    . GLU A 1 87  ? -11.569 48.819 23.260 1.00 27.73 ? 87  GLU A CB    1 
ATOM   653  C  CG    . GLU A 1 87  ? -12.430 47.747 23.785 1.00 25.98 ? 87  GLU A CG    1 
ATOM   654  C  CD    . GLU A 1 87  ? -13.899 47.984 23.574 1.00 33.38 ? 87  GLU A CD    1 
ATOM   655  O  OE1   . GLU A 1 87  ? -14.272 49.147 23.288 1.00 31.40 ? 87  GLU A OE1   1 
ATOM   656  O  OE2   . GLU A 1 87  ? -14.696 47.007 23.729 1.00 30.84 ? 87  GLU A OE2   1 
ATOM   657  N  N     . ASP A 1 88  ? -8.934  50.622 23.052 1.00 31.26 ? 88  ASP A N     1 
ATOM   658  C  CA    . ASP A 1 88  ? -8.003  51.388 22.260 1.00 32.43 ? 88  ASP A CA    1 
ATOM   659  C  C     . ASP A 1 88  ? -6.619  50.827 22.395 1.00 34.49 ? 88  ASP A C     1 
ATOM   660  O  O     . ASP A 1 88  ? -5.788  51.033 21.507 1.00 38.71 ? 88  ASP A O     1 
ATOM   661  C  CB    . ASP A 1 88  ? -8.007  52.831 22.686 1.00 31.20 ? 88  ASP A CB    1 
ATOM   662  C  CG    . ASP A 1 88  ? -9.315  53.510 22.379 1.00 35.60 ? 88  ASP A CG    1 
ATOM   663  O  OD1   . ASP A 1 88  ? -9.573  54.581 22.967 1.00 44.98 ? 88  ASP A OD1   1 
ATOM   664  O  OD2   . ASP A 1 88  ? -10.092 52.999 21.537 1.00 36.67 ? 88  ASP A OD2   1 
ATOM   665  N  N     . ARG A 1 89  ? -6.375  50.084 23.475 1.00 35.66 ? 89  ARG A N     1 
ATOM   666  C  CA    . ARG A 1 89  ? -5.055  49.508 23.747 1.00 33.97 ? 89  ARG A CA    1 
ATOM   667  C  C     . ARG A 1 89  ? -4.914  48.064 23.255 1.00 32.34 ? 89  ARG A C     1 
ATOM   668  O  O     . ARG A 1 89  ? -3.960  47.360 23.589 1.00 29.61 ? 89  ARG A O     1 
ATOM   669  C  CB    . ARG A 1 89  ? -4.743  49.636 25.247 1.00 33.82 ? 89  ARG A CB    1 
ATOM   670  C  CG    . ARG A 1 89  ? -4.632  51.104 25.746 1.00 40.36 ? 89  ARG A CG    1 
ATOM   671  C  CD    . ARG A 1 89  ? -4.852  51.293 27.276 1.00 42.07 ? 89  ARG A CD    1 
ATOM   672  N  NE    . ARG A 1 89  ? -3.609  51.170 28.038 1.00 45.06 ? 89  ARG A NE    1 
ATOM   673  C  CZ    . ARG A 1 89  ? -3.218  50.009 28.566 1.00 44.75 ? 89  ARG A CZ    1 
ATOM   674  N  NH1   . ARG A 1 89  ? -3.968  48.916 28.423 1.00 50.04 ? 89  ARG A NH1   1 
ATOM   675  N  NH2   . ARG A 1 89  ? -2.050  49.924 29.189 1.00 38.39 ? 89  ARG A NH2   1 
ATOM   676  N  N     . GLY A 1 90  ? -5.872  47.619 22.456 1.00 29.16 ? 90  GLY A N     1 
ATOM   677  C  CA    . GLY A 1 90  ? -5.788  46.274 21.947 1.00 29.10 ? 90  GLY A CA    1 
ATOM   678  C  C     . GLY A 1 90  ? -6.497  45.225 22.758 1.00 31.03 ? 90  GLY A C     1 
ATOM   679  O  O     . GLY A 1 90  ? -6.481  44.044 22.385 1.00 33.25 ? 90  GLY A O     1 
ATOM   680  N  N     . ILE A 1 91  ? -7.124  45.636 23.867 1.00 33.38 ? 91  ILE A N     1 
ATOM   681  C  CA    . ILE A 1 91  ? -7.848  44.689 24.714 1.00 31.10 ? 91  ILE A CA    1 
ATOM   682  C  C     . ILE A 1 91  ? -9.309  44.599 24.301 1.00 27.41 ? 91  ILE A C     1 
ATOM   683  O  O     . ILE A 1 91  ? -10.074 45.530 24.512 1.00 28.57 ? 91  ILE A O     1 
ATOM   684  C  CB    . ILE A 1 91  ? -7.749  45.034 26.230 1.00 30.10 ? 91  ILE A CB    1 
ATOM   685  C  CG1   . ILE A 1 91  ? -6.296  44.851 26.720 1.00 25.25 ? 91  ILE A CG1   1 
ATOM   686  C  CG2   . ILE A 1 91  ? -8.640  44.054 27.044 1.00 29.88 ? 91  ILE A CG2   1 
ATOM   687  C  CD1   . ILE A 1 91  ? -5.491  46.154 26.882 1.00 29.08 ? 91  ILE A CD1   1 
ATOM   688  N  N     . PRO A 1 92  ? -9.705  43.477 23.678 1.00 23.79 ? 92  PRO A N     1 
ATOM   689  C  CA    . PRO A 1 92  ? -11.096 43.301 23.248 1.00 26.27 ? 92  PRO A CA    1 
ATOM   690  C  C     . PRO A 1 92  ? -12.025 42.945 24.437 1.00 28.52 ? 92  PRO A C     1 
ATOM   691  O  O     . PRO A 1 92  ? -12.638 41.866 24.468 1.00 29.15 ? 92  PRO A O     1 
ATOM   692  C  CB    . PRO A 1 92  ? -10.992 42.154 22.233 1.00 24.63 ? 92  PRO A CB    1 
ATOM   693  C  CG    . PRO A 1 92  ? -9.926  41.298 22.806 1.00 22.31 ? 92  PRO A CG    1 
ATOM   694  C  CD    . PRO A 1 92  ? -8.872  42.335 23.254 1.00 18.65 ? 92  PRO A CD    1 
ATOM   695  N  N     . VAL A 1 93  ? -12.158 43.866 25.398 1.00 30.59 ? 93  VAL A N     1 
ATOM   696  C  CA    . VAL A 1 93  ? -12.986 43.636 26.605 1.00 30.38 ? 93  VAL A CA    1 
ATOM   697  C  C     . VAL A 1 93  ? -14.270 42.817 26.403 1.00 31.50 ? 93  VAL A C     1 
ATOM   698  O  O     . VAL A 1 93  ? -14.466 41.788 27.048 1.00 33.66 ? 93  VAL A O     1 
ATOM   699  C  CB    . VAL A 1 93  ? -13.368 44.955 27.310 1.00 25.65 ? 93  VAL A CB    1 
ATOM   700  C  CG1   . VAL A 1 93  ? -14.181 44.654 28.565 1.00 25.25 ? 93  VAL A CG1   1 
ATOM   701  C  CG2   . VAL A 1 93  ? -12.122 45.715 27.700 1.00 24.50 ? 93  VAL A CG2   1 
ATOM   702  N  N     . ARG A 1 94  ? -15.136 43.270 25.515 1.00 31.46 ? 94  ARG A N     1 
ATOM   703  C  CA    . ARG A 1 94  ? -16.387 42.595 25.239 1.00 30.75 ? 94  ARG A CA    1 
ATOM   704  C  C     . ARG A 1 94  ? -16.222 41.127 24.916 1.00 31.84 ? 94  ARG A C     1 
ATOM   705  O  O     . ARG A 1 94  ? -17.156 40.343 25.094 1.00 30.40 ? 94  ARG A O     1 
ATOM   706  C  CB    . ARG A 1 94  ? -17.143 43.319 24.127 1.00 32.94 ? 94  ARG A CB    1 
ATOM   707  C  CG    . ARG A 1 94  ? -18.172 44.318 24.668 1.00 44.35 ? 94  ARG A CG    1 
ATOM   708  C  CD    . ARG A 1 94  ? -18.549 45.411 23.674 1.00 48.38 ? 94  ARG A CD    1 
ATOM   709  N  NE    . ARG A 1 94  ? -17.518 46.444 23.664 1.00 58.05 ? 94  ARG A NE    1 
ATOM   710  C  CZ    . ARG A 1 94  ? -17.755 47.664 23.192 1.00 58.95 ? 94  ARG A CZ    1 
ATOM   711  N  NH1   . ARG A 1 94  ? -18.952 47.971 22.707 1.00 61.60 ? 94  ARG A NH1   1 
ATOM   712  N  NH2   . ARG A 1 94  ? -16.789 48.569 23.199 1.00 55.07 ? 94  ARG A NH2   1 
ATOM   713  N  N     . GLU A 1 95  ? -15.044 40.738 24.442 1.00 32.48 ? 95  GLU A N     1 
ATOM   714  C  CA    . GLU A 1 95  ? -14.830 39.344 24.129 1.00 36.43 ? 95  GLU A CA    1 
ATOM   715  C  C     . GLU A 1 95  ? -14.530 38.539 25.389 1.00 40.76 ? 95  GLU A C     1 
ATOM   716  O  O     . GLU A 1 95  ? -14.898 37.366 25.461 1.00 42.76 ? 95  GLU A O     1 
ATOM   717  C  CB    . GLU A 1 95  ? -13.703 39.184 23.106 1.00 40.75 ? 95  GLU A CB    1 
ATOM   718  C  CG    . GLU A 1 95  ? -14.086 39.724 21.722 1.00 53.25 ? 95  GLU A CG    1 
ATOM   719  C  CD    . GLU A 1 95  ? -13.009 39.524 20.641 1.00 62.81 ? 95  GLU A CD    1 
ATOM   720  O  OE1   . GLU A 1 95  ? -13.165 40.112 19.532 1.00 67.19 ? 95  GLU A OE1   1 
ATOM   721  O  OE2   . GLU A 1 95  ? -12.024 38.784 20.885 1.00 63.60 ? 95  GLU A OE2   1 
ATOM   722  N  N     . ARG A 1 96  ? -13.916 39.183 26.398 1.00 42.18 ? 96  ARG A N     1 
ATOM   723  C  CA    . ARG A 1 96  ? -13.504 38.526 27.655 1.00 39.41 ? 96  ARG A CA    1 
ATOM   724  C  C     . ARG A 1 96  ? -14.357 38.787 28.893 1.00 38.80 ? 96  ARG A C     1 
ATOM   725  O  O     . ARG A 1 96  ? -14.280 38.030 29.858 1.00 33.71 ? 96  ARG A O     1 
ATOM   726  C  CB    . ARG A 1 96  ? -12.070 38.952 28.016 1.00 42.29 ? 96  ARG A CB    1 
ATOM   727  C  CG    . ARG A 1 96  ? -11.080 38.861 26.869 1.00 44.17 ? 96  ARG A CG    1 
ATOM   728  C  CD    . ARG A 1 96  ? -9.724  39.452 27.194 1.00 40.04 ? 96  ARG A CD    1 
ATOM   729  N  NE    . ARG A 1 96  ? -8.794  39.205 26.089 1.00 44.37 ? 96  ARG A NE    1 
ATOM   730  C  CZ    . ARG A 1 96  ? -7.613  39.807 26.042 1.00 45.01 ? 96  ARG A CZ    1 
ATOM   731  N  NH1   . ARG A 1 96  ? -7.250  40.642 26.997 1.00 51.87 ? 96  ARG A NH1   1 
ATOM   732  N  NH2   . ARG A 1 96  ? -6.801  39.595 25.028 1.00 44.99 ? 96  ARG A NH2   1 
ATOM   733  N  N     . LEU A 1 97  ? -15.127 39.875 28.888 1.00 38.82 ? 97  LEU A N     1 
ATOM   734  C  CA    . LEU A 1 97  ? -15.942 40.258 30.051 1.00 35.70 ? 97  LEU A CA    1 
ATOM   735  C  C     . LEU A 1 97  ? -17.407 39.829 30.080 1.00 34.92 ? 97  LEU A C     1 
ATOM   736  O  O     . LEU A 1 97  ? -18.172 40.086 29.148 1.00 35.70 ? 97  LEU A O     1 
ATOM   737  C  CB    . LEU A 1 97  ? -15.863 41.772 30.260 1.00 32.80 ? 97  LEU A CB    1 
ATOM   738  C  CG    . LEU A 1 97  ? -16.619 42.327 31.455 1.00 31.58 ? 97  LEU A CG    1 
ATOM   739  C  CD1   . LEU A 1 97  ? -15.773 42.100 32.702 1.00 27.32 ? 97  LEU A CD1   1 
ATOM   740  C  CD2   . LEU A 1 97  ? -16.873 43.799 31.252 1.00 28.73 ? 97  LEU A CD2   1 
ATOM   741  N  N     . LEU A 1 98  ? -17.795 39.197 31.174 1.00 34.43 ? 98  LEU A N     1 
ATOM   742  C  CA    . LEU A 1 98  ? -19.169 38.747 31.374 1.00 32.28 ? 98  LEU A CA    1 
ATOM   743  C  C     . LEU A 1 98  ? -19.654 39.414 32.662 1.00 33.98 ? 98  LEU A C     1 
ATOM   744  O  O     . LEU A 1 98  ? -18.862 39.996 33.407 1.00 30.71 ? 98  LEU A O     1 
ATOM   745  C  CB    . LEU A 1 98  ? -19.235 37.224 31.510 1.00 31.55 ? 98  LEU A CB    1 
ATOM   746  C  CG    . LEU A 1 98  ? -18.963 36.364 30.268 1.00 33.05 ? 98  LEU A CG    1 
ATOM   747  C  CD1   . LEU A 1 98  ? -19.247 34.908 30.595 1.00 22.31 ? 98  LEU A CD1   1 
ATOM   748  C  CD2   . LEU A 1 98  ? -19.830 36.821 29.099 1.00 28.40 ? 98  LEU A CD2   1 
ATOM   749  N  N     . LEU A 1 99  ? -20.947 39.391 32.922 1.00 33.94 ? 99  LEU A N     1 
ATOM   750  C  CA    . LEU A 1 99  ? -21.427 40.028 34.137 1.00 34.11 ? 99  LEU A CA    1 
ATOM   751  C  C     . LEU A 1 99  ? -22.816 39.632 34.608 1.00 34.82 ? 99  LEU A C     1 
ATOM   752  O  O     . LEU A 1 99  ? -23.661 39.215 33.824 1.00 34.89 ? 99  LEU A O     1 
ATOM   753  C  CB    . LEU A 1 99  ? -21.255 41.550 34.074 1.00 29.50 ? 99  LEU A CB    1 
ATOM   754  C  CG    . LEU A 1 99  ? -21.571 42.336 32.816 1.00 28.85 ? 99  LEU A CG    1 
ATOM   755  C  CD1   . LEU A 1 99  ? -23.037 42.648 32.765 1.00 31.24 ? 99  LEU A CD1   1 
ATOM   756  C  CD2   . LEU A 1 99  ? -20.781 43.629 32.807 1.00 27.90 ? 99  LEU A CD2   1 
ATOM   757  N  N     . SER A 1 100 ? -23.013 39.717 35.914 1.00 36.38 ? 100 SER A N     1 
ATOM   758  C  CA    . SER A 1 100 ? -24.272 39.346 36.540 1.00 33.90 ? 100 SER A CA    1 
ATOM   759  C  C     . SER A 1 100 ? -25.435 40.327 36.375 1.00 31.45 ? 100 SER A C     1 
ATOM   760  O  O     . SER A 1 100 ? -25.303 41.520 36.620 1.00 30.24 ? 100 SER A O     1 
ATOM   761  C  CB    . SER A 1 100 ? -24.032 39.092 38.025 1.00 30.56 ? 100 SER A CB    1 
ATOM   762  O  OG    . SER A 1 100 ? -25.165 38.497 38.636 1.00 29.86 ? 100 SER A OG    1 
ATOM   763  N  N     . GLU A 1 101 ? -26.587 39.787 35.993 1.00 26.20 ? 101 GLU A N     1 
ATOM   764  C  CA    . GLU A 1 101 ? -27.791 40.580 35.846 1.00 27.42 ? 101 GLU A CA    1 
ATOM   765  C  C     . GLU A 1 101 ? -28.232 41.068 37.229 1.00 27.09 ? 101 GLU A C     1 
ATOM   766  O  O     . GLU A 1 101 ? -29.036 41.994 37.337 1.00 25.51 ? 101 GLU A O     1 
ATOM   767  C  CB    . GLU A 1 101 ? -28.900 39.727 35.241 1.00 28.79 ? 101 GLU A CB    1 
ATOM   768  C  CG    . GLU A 1 101 ? -29.232 38.532 36.074 1.00 28.63 ? 101 GLU A CG    1 
ATOM   769  C  CD    . GLU A 1 101 ? -30.113 37.546 35.341 1.00 41.05 ? 101 GLU A CD    1 
ATOM   770  O  OE1   . GLU A 1 101 ? -31.365 37.671 35.432 1.00 41.37 ? 101 GLU A OE1   1 
ATOM   771  O  OE2   . GLU A 1 101 ? -29.559 36.630 34.685 1.00 45.12 ? 101 GLU A OE2   1 
ATOM   772  N  N     . ALA A 1 102 ? -27.722 40.439 38.289 1.00 24.53 ? 102 ALA A N     1 
ATOM   773  C  CA    . ALA A 1 102 ? -28.100 40.813 39.642 1.00 22.74 ? 102 ALA A CA    1 
ATOM   774  C  C     . ALA A 1 102 ? -27.333 42.010 40.165 1.00 23.76 ? 102 ALA A C     1 
ATOM   775  O  O     . ALA A 1 102 ? -27.654 42.511 41.240 1.00 25.45 ? 102 ALA A O     1 
ATOM   776  C  CB    . ALA A 1 102 ? -27.898 39.647 40.574 1.00 17.57 ? 102 ALA A CB    1 
ATOM   777  N  N     . CYS A 1 103 ? -26.312 42.458 39.449 1.00 22.21 ? 103 CYS A N     1 
ATOM   778  C  CA    . CYS A 1 103 ? -25.533 43.601 39.911 1.00 25.63 ? 103 CYS A CA    1 
ATOM   779  C  C     . CYS A 1 103 ? -26.355 44.868 40.027 1.00 25.32 ? 103 CYS A C     1 
ATOM   780  O  O     . CYS A 1 103 ? -27.092 45.211 39.098 1.00 26.13 ? 103 CYS A O     1 
ATOM   781  C  CB    . CYS A 1 103 ? -24.391 43.947 38.954 1.00 21.43 ? 103 CYS A CB    1 
ATOM   782  S  SG    . CYS A 1 103 ? -23.197 42.721 38.749 1.00 22.64 ? 103 CYS A SG    1 
ATOM   783  N  N     . PRO A 1 104 ? -26.318 45.523 41.195 1.00 23.43 ? 104 PRO A N     1 
ATOM   784  C  CA    . PRO A 1 104 ? -27.096 46.760 41.281 1.00 24.63 ? 104 PRO A CA    1 
ATOM   785  C  C     . PRO A 1 104 ? -26.394 47.829 40.400 1.00 25.80 ? 104 PRO A C     1 
ATOM   786  O  O     . PRO A 1 104 ? -25.204 47.716 40.093 1.00 23.64 ? 104 PRO A O     1 
ATOM   787  C  CB    . PRO A 1 104 ? -27.078 47.087 42.790 1.00 23.04 ? 104 PRO A CB    1 
ATOM   788  C  CG    . PRO A 1 104 ? -25.977 46.191 43.375 1.00 20.10 ? 104 PRO A CG    1 
ATOM   789  C  CD    . PRO A 1 104 ? -26.045 44.972 42.534 1.00 18.18 ? 104 PRO A CD    1 
ATOM   790  N  N     . LEU A 1 105 ? -27.141 48.826 39.935 1.00 28.92 ? 105 LEU A N     1 
ATOM   791  C  CA    . LEU A 1 105 ? -26.574 49.881 39.085 1.00 28.38 ? 105 LEU A CA    1 
ATOM   792  C  C     . LEU A 1 105 ? -26.308 51.122 39.916 1.00 32.33 ? 105 LEU A C     1 
ATOM   793  O  O     . LEU A 1 105 ? -27.104 51.467 40.802 1.00 30.42 ? 105 LEU A O     1 
ATOM   794  C  CB    . LEU A 1 105 ? -27.530 50.275 37.941 1.00 20.62 ? 105 LEU A CB    1 
ATOM   795  C  CG    . LEU A 1 105 ? -28.031 49.162 37.006 1.00 23.09 ? 105 LEU A CG    1 
ATOM   796  C  CD1   . LEU A 1 105 ? -29.385 49.539 36.398 1.00 15.57 ? 105 LEU A CD1   1 
ATOM   797  C  CD2   . LEU A 1 105 ? -26.978 48.827 35.932 1.00 17.58 ? 105 LEU A CD2   1 
ATOM   798  N  N     . ILE A 1 106 ? -25.162 51.757 39.629 1.00 36.57 ? 106 ILE A N     1 
ATOM   799  C  CA    . ILE A 1 106 ? -24.711 53.010 40.250 1.00 30.00 ? 106 ILE A CA    1 
ATOM   800  C  C     . ILE A 1 106 ? -25.015 54.082 39.186 1.00 31.42 ? 106 ILE A C     1 
ATOM   801  O  O     . ILE A 1 106 ? -24.404 54.103 38.109 1.00 33.17 ? 106 ILE A O     1 
ATOM   802  C  CB    . ILE A 1 106 ? -23.205 52.997 40.508 1.00 29.77 ? 106 ILE A CB    1 
ATOM   803  C  CG1   . ILE A 1 106 ? -22.815 51.856 41.437 1.00 28.02 ? 106 ILE A CG1   1 
ATOM   804  C  CG2   . ILE A 1 106 ? -22.772 54.284 41.144 1.00 33.72 ? 106 ILE A CG2   1 
ATOM   805  C  CD1   . ILE A 1 106 ? -21.374 51.986 41.929 1.00 22.43 ? 106 ILE A CD1   1 
ATOM   806  N  N     . LEU A 1 107 ? -25.998 54.929 39.456 1.00 26.98 ? 107 LEU A N     1 
ATOM   807  C  CA    . LEU A 1 107 ? -26.398 55.942 38.510 1.00 23.21 ? 107 LEU A CA    1 
ATOM   808  C  C     . LEU A 1 107 ? -26.041 57.273 39.112 1.00 29.10 ? 107 LEU A C     1 
ATOM   809  O  O     . LEU A 1 107 ? -25.584 57.310 40.250 1.00 35.22 ? 107 LEU A O     1 
ATOM   810  C  CB    . LEU A 1 107 ? -27.898 55.829 38.221 1.00 22.66 ? 107 LEU A CB    1 
ATOM   811  C  CG    . LEU A 1 107 ? -28.412 54.469 37.713 1.00 16.55 ? 107 LEU A CG    1 
ATOM   812  C  CD1   . LEU A 1 107 ? -29.872 54.506 37.304 1.00 20.16 ? 107 LEU A CD1   1 
ATOM   813  C  CD2   . LEU A 1 107 ? -27.637 54.003 36.554 1.00 13.82 ? 107 LEU A CD2   1 
ATOM   814  N  N     . ASP A 1 108 ? -26.260 58.371 38.394 1.00 34.35 ? 108 ASP A N     1 
ATOM   815  C  CA    . ASP A 1 108 ? -25.874 59.696 38.889 1.00 39.05 ? 108 ASP A CA    1 
ATOM   816  C  C     . ASP A 1 108 ? -26.317 60.112 40.272 1.00 39.91 ? 108 ASP A C     1 
ATOM   817  O  O     . ASP A 1 108 ? -25.496 60.582 41.070 1.00 41.06 ? 108 ASP A O     1 
ATOM   818  C  CB    . ASP A 1 108 ? -26.245 60.790 37.893 1.00 45.45 ? 108 ASP A CB    1 
ATOM   819  C  CG    . ASP A 1 108 ? -25.265 60.883 36.752 1.00 56.13 ? 108 ASP A CG    1 
ATOM   820  O  OD1   . ASP A 1 108 ? -24.111 60.388 36.905 1.00 65.31 ? 108 ASP A OD1   1 
ATOM   821  O  OD2   . ASP A 1 108 ? -25.638 61.452 35.698 1.00 58.39 ? 108 ASP A OD2   1 
ATOM   822  N  N     . TYR A 1 109 ? -27.612 59.974 40.571 1.00 37.61 ? 109 TYR A N     1 
ATOM   823  C  CA    . TYR A 1 109 ? -28.101 60.363 41.893 1.00 34.43 ? 109 TYR A CA    1 
ATOM   824  C  C     . TYR A 1 109 ? -27.254 59.727 43.004 1.00 33.86 ? 109 TYR A C     1 
ATOM   825  O  O     . TYR A 1 109 ? -26.956 60.392 43.997 1.00 29.17 ? 109 TYR A O     1 
ATOM   826  C  CB    . TYR A 1 109 ? -29.585 60.051 42.061 1.00 30.14 ? 109 TYR A CB    1 
ATOM   827  C  CG    . TYR A 1 109 ? -29.986 58.662 41.649 1.00 30.39 ? 109 TYR A CG    1 
ATOM   828  C  CD1   . TYR A 1 109 ? -30.170 57.644 42.593 1.00 30.35 ? 109 TYR A CD1   1 
ATOM   829  C  CD2   . TYR A 1 109 ? -30.263 58.384 40.328 1.00 28.88 ? 109 TYR A CD2   1 
ATOM   830  C  CE1   . TYR A 1 109 ? -30.628 56.388 42.197 1.00 31.99 ? 109 TYR A CE1   1 
ATOM   831  C  CE2   . TYR A 1 109 ? -30.710 57.139 39.929 1.00 31.57 ? 109 TYR A CE2   1 
ATOM   832  C  CZ    . TYR A 1 109 ? -30.897 56.158 40.854 1.00 32.02 ? 109 TYR A CZ    1 
ATOM   833  O  OH    . TYR A 1 109 ? -31.358 54.951 40.421 1.00 34.30 ? 109 TYR A OH    1 
ATOM   834  N  N     . HIS A 1 110 ? -26.814 58.479 42.811 1.00 31.62 ? 110 HIS A N     1 
ATOM   835  C  CA    . HIS A 1 110 ? -25.976 57.805 43.797 1.00 28.33 ? 110 HIS A CA    1 
ATOM   836  C  C     . HIS A 1 110 ? -24.780 58.702 44.098 1.00 30.06 ? 110 HIS A C     1 
ATOM   837  O  O     . HIS A 1 110 ? -24.454 58.920 45.265 1.00 32.60 ? 110 HIS A O     1 
ATOM   838  C  CB    . HIS A 1 110 ? -25.528 56.434 43.313 1.00 24.91 ? 110 HIS A CB    1 
ATOM   839  C  CG    . HIS A 1 110 ? -26.653 55.434 43.157 1.00 29.07 ? 110 HIS A CG    1 
ATOM   840  N  ND1   . HIS A 1 110 ? -26.730 54.584 42.089 1.00 30.40 ? 110 HIS A ND1   1 
ATOM   841  C  CD2   . HIS A 1 110 ? -27.719 55.234 43.990 1.00 27.40 ? 110 HIS A CD2   1 
ATOM   842  C  CE1   . HIS A 1 110 ? -27.840 53.874 42.277 1.00 24.41 ? 110 HIS A CE1   1 
ATOM   843  N  NE2   . HIS A 1 110 ? -28.461 54.227 43.396 1.00 27.51 ? 110 HIS A NE2   1 
ATOM   844  N  N     . VAL A 1 111 ? -24.126 59.265 43.080 1.00 28.58 ? 111 VAL A N     1 
ATOM   845  C  CA    . VAL A 1 111 ? -22.991 60.165 43.376 1.00 28.66 ? 111 VAL A CA    1 
ATOM   846  C  C     . VAL A 1 111 ? -23.488 61.445 44.035 1.00 28.75 ? 111 VAL A C     1 
ATOM   847  O  O     . VAL A 1 111 ? -22.835 61.998 44.937 1.00 23.30 ? 111 VAL A O     1 
ATOM   848  C  CB    . VAL A 1 111 ? -22.186 60.513 42.142 1.00 24.67 ? 111 VAL A CB    1 
ATOM   849  C  CG1   . VAL A 1 111 ? -20.951 61.266 42.538 1.00 24.60 ? 111 VAL A CG1   1 
ATOM   850  C  CG2   . VAL A 1 111 ? -21.767 59.238 41.500 1.00 26.75 ? 111 VAL A CG2   1 
ATOM   851  N  N     . ALA A 1 112 ? -24.659 61.905 43.583 1.00 29.01 ? 112 ALA A N     1 
ATOM   852  C  CA    . ALA A 1 112 ? -25.292 63.089 44.135 1.00 27.73 ? 112 ALA A CA    1 
ATOM   853  C  C     . ALA A 1 112 ? -25.427 62.825 45.631 1.00 30.72 ? 112 ALA A C     1 
ATOM   854  O  O     . ALA A 1 112 ? -24.950 63.607 46.456 1.00 32.92 ? 112 ALA A O     1 
ATOM   855  C  CB    . ALA A 1 112 ? -26.645 63.286 43.492 1.00 27.93 ? 112 ALA A CB    1 
ATOM   856  N  N     . LEU A 1 113 ? -26.026 61.686 45.977 1.00 32.96 ? 113 LEU A N     1 
ATOM   857  C  CA    . LEU A 1 113 ? -26.212 61.256 47.370 1.00 31.87 ? 113 LEU A CA    1 
ATOM   858  C  C     . LEU A 1 113 ? -24.875 61.130 48.088 1.00 34.49 ? 113 LEU A C     1 
ATOM   859  O  O     . LEU A 1 113 ? -24.677 61.711 49.147 1.00 34.32 ? 113 LEU A O     1 
ATOM   860  C  CB    . LEU A 1 113 ? -26.911 59.906 47.421 1.00 27.50 ? 113 LEU A CB    1 
ATOM   861  C  CG    . LEU A 1 113 ? -28.336 59.917 46.878 1.00 30.73 ? 113 LEU A CG    1 
ATOM   862  C  CD1   . LEU A 1 113 ? -28.832 58.511 46.602 1.00 30.94 ? 113 LEU A CD1   1 
ATOM   863  C  CD2   . LEU A 1 113 ? -29.234 60.621 47.893 1.00 35.38 ? 113 LEU A CD2   1 
ATOM   864  N  N     . ASP A 1 114 ? -23.948 60.387 47.498 1.00 35.61 ? 114 ASP A N     1 
ATOM   865  C  CA    . ASP A 1 114 ? -22.654 60.187 48.117 1.00 37.71 ? 114 ASP A CA    1 
ATOM   866  C  C     . ASP A 1 114 ? -22.044 61.528 48.516 1.00 39.95 ? 114 ASP A C     1 
ATOM   867  O  O     . ASP A 1 114 ? -21.525 61.676 49.628 1.00 41.02 ? 114 ASP A O     1 
ATOM   868  C  CB    . ASP A 1 114 ? -21.725 59.381 47.189 1.00 35.44 ? 114 ASP A CB    1 
ATOM   869  C  CG    . ASP A 1 114 ? -20.421 58.995 47.856 1.00 39.09 ? 114 ASP A CG    1 
ATOM   870  O  OD1   . ASP A 1 114 ? -20.165 57.797 48.055 1.00 35.39 ? 114 ASP A OD1   1 
ATOM   871  O  OD2   . ASP A 1 114 ? -19.630 59.903 48.201 1.00 51.78 ? 114 ASP A OD2   1 
ATOM   872  N  N     . ASN A 1 115 ? -22.143 62.516 47.634 1.00 39.99 ? 115 ASN A N     1 
ATOM   873  C  CA    . ASN A 1 115 ? -21.594 63.837 47.922 1.00 40.14 ? 115 ASN A CA    1 
ATOM   874  C  C     . ASN A 1 115 ? -22.365 64.541 49.033 1.00 39.93 ? 115 ASN A C     1 
ATOM   875  O  O     . ASN A 1 115 ? -21.773 65.068 49.998 1.00 38.48 ? 115 ASN A O     1 
ATOM   876  C  CB    . ASN A 1 115 ? -21.584 64.690 46.656 1.00 44.40 ? 115 ASN A CB    1 
ATOM   877  C  CG    . ASN A 1 115 ? -20.736 64.080 45.532 1.00 47.98 ? 115 ASN A CG    1 
ATOM   878  O  OD1   . ASN A 1 115 ? -21.017 64.300 44.347 1.00 47.44 ? 115 ASN A OD1   1 
ATOM   879  N  ND2   . ASN A 1 115 ? -19.685 63.334 45.899 1.00 45.50 ? 115 ASN A ND2   1 
ATOM   880  N  N     . ALA A 1 116 ? -23.690 64.536 48.920 1.00 37.51 ? 116 ALA A N     1 
ATOM   881  C  CA    . ALA A 1 116 ? -24.530 65.159 49.937 1.00 35.52 ? 116 ALA A CA    1 
ATOM   882  C  C     . ALA A 1 116 ? -24.224 64.601 51.330 1.00 37.13 ? 116 ALA A C     1 
ATOM   883  O  O     . ALA A 1 116 ? -23.866 65.353 52.236 1.00 36.70 ? 116 ALA A O     1 
ATOM   884  C  CB    . ALA A 1 116 ? -25.983 64.963 49.600 1.00 31.92 ? 116 ALA A CB    1 
ATOM   885  N  N     . ARG A 1 117 ? -24.316 63.284 51.497 1.00 36.96 ? 117 ARG A N     1 
ATOM   886  C  CA    . ARG A 1 117 ? -24.070 62.683 52.807 1.00 38.96 ? 117 ARG A CA    1 
ATOM   887  C  C     . ARG A 1 117 ? -22.724 63.153 53.316 1.00 38.41 ? 117 ARG A C     1 
ATOM   888  O  O     . ARG A 1 117 ? -22.610 63.760 54.385 1.00 41.52 ? 117 ARG A O     1 
ATOM   889  C  CB    . ARG A 1 117 ? -24.070 61.160 52.761 1.00 37.02 ? 117 ARG A CB    1 
ATOM   890  C  CG    . ARG A 1 117 ? -24.898 60.538 51.679 1.00 39.11 ? 117 ARG A CG    1 
ATOM   891  C  CD    . ARG A 1 117 ? -26.248 60.138 52.163 1.00 40.63 ? 117 ARG A CD    1 
ATOM   892  N  NE    . ARG A 1 117 ? -26.642 58.852 51.570 1.00 42.05 ? 117 ARG A NE    1 
ATOM   893  C  CZ    . ARG A 1 117 ? -27.919 58.477 51.551 1.00 43.30 ? 117 ARG A CZ    1 
ATOM   894  N  NH1   . ARG A 1 117 ? -28.853 59.272 52.087 1.00 40.12 ? 117 ARG A NH1   1 
ATOM   895  N  NH2   . ARG A 1 117 ? -28.270 57.344 50.947 1.00 36.67 ? 117 ARG A NH2   1 
ATOM   896  N  N     . GLU A 1 118 ? -21.702 62.879 52.532 1.00 39.18 ? 118 GLU A N     1 
ATOM   897  C  CA    . GLU A 1 118 ? -20.363 63.271 52.899 1.00 44.68 ? 118 GLU A CA    1 
ATOM   898  C  C     . GLU A 1 118 ? -20.357 64.700 53.446 1.00 48.11 ? 118 GLU A C     1 
ATOM   899  O  O     . GLU A 1 118 ? -19.767 64.963 54.511 1.00 49.20 ? 118 GLU A O     1 
ATOM   900  C  CB    . GLU A 1 118 ? -19.443 63.123 51.689 1.00 44.88 ? 118 GLU A CB    1 
ATOM   901  C  CG    . GLU A 1 118 ? -18.011 62.826 52.037 1.00 42.32 ? 118 GLU A CG    1 
ATOM   902  C  CD    . GLU A 1 118 ? -17.820 61.549 52.827 1.00 40.47 ? 118 GLU A CD    1 
ATOM   903  O  OE1   . GLU A 1 118 ? -16.652 61.145 52.946 1.00 40.66 ? 118 GLU A OE1   1 
ATOM   904  O  OE2   . GLU A 1 118 ? -18.792 60.965 53.363 1.00 38.50 ? 118 GLU A OE2   1 
ATOM   905  N  N     . LYS A 1 119 ? -21.035 65.606 52.732 1.00 50.70 ? 119 LYS A N     1 
ATOM   906  C  CA    . LYS A 1 119 ? -21.140 67.004 53.157 1.00 50.32 ? 119 LYS A CA    1 
ATOM   907  C  C     . LYS A 1 119 ? -21.776 67.058 54.549 1.00 48.63 ? 119 LYS A C     1 
ATOM   908  O  O     . LYS A 1 119 ? -21.162 67.560 55.490 1.00 47.13 ? 119 LYS A O     1 
ATOM   909  C  CB    . LYS A 1 119 ? -22.005 67.789 52.163 1.00 55.53 ? 119 LYS A CB    1 
ATOM   910  C  CG    . LYS A 1 119 ? -22.282 69.246 52.537 1.00 57.23 ? 119 LYS A CG    1 
ATOM   911  C  CD    . LYS A 1 119 ? -21.114 70.175 52.172 1.00 57.80 ? 119 LYS A CD    1 
ATOM   912  C  CE    . LYS A 1 119 ? -21.551 71.351 51.265 1.00 54.56 ? 119 LYS A CE    1 
ATOM   913  N  NZ    . LYS A 1 119 ? -22.471 72.326 51.920 1.00 50.20 ? 119 LYS A NZ    1 
ATOM   914  N  N     . ALA A 1 120 ? -22.981 66.495 54.677 1.00 44.19 ? 120 ALA A N     1 
ATOM   915  C  CA    . ALA A 1 120 ? -23.705 66.492 55.945 1.00 40.28 ? 120 ALA A CA    1 
ATOM   916  C  C     . ALA A 1 120 ? -22.894 66.077 57.156 1.00 41.82 ? 120 ALA A C     1 
ATOM   917  O  O     . ALA A 1 120 ? -23.087 66.632 58.241 1.00 42.39 ? 120 ALA A O     1 
ATOM   918  C  CB    . ALA A 1 120 ? -24.917 65.644 55.843 1.00 40.85 ? 120 ALA A CB    1 
ATOM   919  N  N     . ARG A 1 121 ? -22.029 65.076 56.998 1.00 43.92 ? 121 ARG A N     1 
ATOM   920  C  CA    . ARG A 1 121 ? -21.183 64.589 58.098 1.00 44.11 ? 121 ARG A CA    1 
ATOM   921  C  C     . ARG A 1 121 ? -20.124 65.615 58.524 1.00 46.18 ? 121 ARG A C     1 
ATOM   922  O  O     . ARG A 1 121 ? -19.530 65.508 59.607 1.00 46.76 ? 121 ARG A O     1 
ATOM   923  C  CB    . ARG A 1 121 ? -20.493 63.279 57.713 1.00 42.73 ? 121 ARG A CB    1 
ATOM   924  C  CG    . ARG A 1 121 ? -21.452 62.098 57.539 1.00 45.78 ? 121 ARG A CG    1 
ATOM   925  C  CD    . ARG A 1 121 ? -20.706 60.747 57.498 1.00 43.32 ? 121 ARG A CD    1 
ATOM   926  N  NE    . ARG A 1 121 ? -19.822 60.577 58.665 1.00 45.14 ? 121 ARG A NE    1 
ATOM   927  C  CZ    . ARG A 1 121 ? -19.848 59.478 59.414 1.00 42.66 ? 121 ARG A CZ    1 
ATOM   928  N  NH1   . ARG A 1 121 ? -20.690 58.480 59.129 1.00 40.58 ? 121 ARG A NH1   1 
ATOM   929  N  NH2   . ARG A 1 121 ? -18.995 59.362 60.421 1.00 40.69 ? 121 ARG A NH2   1 
ATOM   930  N  N     . GLY A 1 122 ? -19.878 66.601 57.672 1.00 44.38 ? 122 GLY A N     1 
ATOM   931  C  CA    . GLY A 1 122 ? -18.902 67.613 57.987 1.00 41.60 ? 122 GLY A CA    1 
ATOM   932  C  C     . GLY A 1 122 ? -17.553 67.079 58.419 1.00 44.52 ? 122 GLY A C     1 
ATOM   933  O  O     . GLY A 1 122 ? -16.874 66.388 57.672 1.00 40.77 ? 122 GLY A O     1 
ATOM   934  N  N     . ALA A 1 123 ? -17.166 67.419 59.647 1.00 50.83 ? 123 ALA A N     1 
ATOM   935  C  CA    . ALA A 1 123 ? -15.873 66.997 60.193 1.00 54.43 ? 123 ALA A CA    1 
ATOM   936  C  C     . ALA A 1 123 ? -15.716 65.489 60.309 1.00 55.74 ? 123 ALA A C     1 
ATOM   937  O  O     . ALA A 1 123 ? -14.735 64.931 59.833 1.00 57.30 ? 123 ALA A O     1 
ATOM   938  C  CB    . ALA A 1 123 ? -15.622 67.653 61.539 1.00 54.30 ? 123 ALA A CB    1 
ATOM   939  N  N     . LYS A 1 124 ? -16.678 64.813 60.913 1.00 56.96 ? 124 LYS A N     1 
ATOM   940  C  CA    . LYS A 1 124 ? -16.550 63.365 61.051 1.00 58.15 ? 124 LYS A CA    1 
ATOM   941  C  C     . LYS A 1 124 ? -16.874 62.636 59.743 1.00 56.42 ? 124 LYS A C     1 
ATOM   942  O  O     . LYS A 1 124 ? -17.555 61.593 59.751 1.00 55.66 ? 124 LYS A O     1 
ATOM   943  C  CB    . LYS A 1 124 ? -17.417 62.854 62.216 1.00 60.81 ? 124 LYS A CB    1 
ATOM   944  C  CG    . LYS A 1 124 ? -18.904 63.129 62.112 1.00 65.22 ? 124 LYS A CG    1 
ATOM   945  C  CD    . LYS A 1 124 ? -19.655 62.426 63.236 1.00 70.23 ? 124 LYS A CD    1 
ATOM   946  C  CE    . LYS A 1 124 ? -21.179 62.584 63.100 1.00 73.53 ? 124 LYS A CE    1 
ATOM   947  N  NZ    . LYS A 1 124 ? -21.912 61.926 64.227 1.00 73.10 ? 124 LYS A NZ    1 
ATOM   948  N  N     . ALA A 1 125 ? -16.369 63.182 58.629 1.00 55.03 ? 125 ALA A N     1 
ATOM   949  C  CA    . ALA A 1 125 ? -16.607 62.637 57.286 1.00 53.40 ? 125 ALA A CA    1 
ATOM   950  C  C     . ALA A 1 125 ? -15.787 61.398 56.978 1.00 50.47 ? 125 ALA A C     1 
ATOM   951  O  O     . ALA A 1 125 ? -14.569 61.402 57.142 1.00 52.44 ? 125 ALA A O     1 
ATOM   952  C  CB    . ALA A 1 125 ? -16.350 63.681 56.252 1.00 53.05 ? 125 ALA A CB    1 
ATOM   953  N  N     . ILE A 1 126 ? -16.465 60.369 56.477 1.00 46.42 ? 126 ILE A N     1 
ATOM   954  C  CA    . ILE A 1 126 ? -15.864 59.074 56.155 1.00 43.31 ? 126 ILE A CA    1 
ATOM   955  C  C     . ILE A 1 126 ? -14.673 59.127 55.184 1.00 43.88 ? 126 ILE A C     1 
ATOM   956  O  O     . ILE A 1 126 ? -13.636 58.448 55.392 1.00 41.97 ? 126 ILE A O     1 
ATOM   957  C  CB    . ILE A 1 126 ? -16.939 58.126 55.604 1.00 40.99 ? 126 ILE A CB    1 
ATOM   958  C  CG1   . ILE A 1 126 ? -17.920 57.759 56.714 1.00 42.67 ? 126 ILE A CG1   1 
ATOM   959  C  CG2   . ILE A 1 126 ? -16.335 56.888 55.050 1.00 36.88 ? 126 ILE A CG2   1 
ATOM   960  C  CD1   . ILE A 1 126 ? -19.209 57.040 56.214 1.00 43.00 ? 126 ILE A CD1   1 
ATOM   961  N  N     . GLY A 1 127 ? -14.802 59.956 54.155 1.00 40.95 ? 127 GLY A N     1 
ATOM   962  C  CA    . GLY A 1 127 ? -13.768 60.061 53.155 1.00 30.87 ? 127 GLY A CA    1 
ATOM   963  C  C     . GLY A 1 127 ? -14.000 59.002 52.108 1.00 30.32 ? 127 GLY A C     1 
ATOM   964  O  O     . GLY A 1 127 ? -13.105 58.214 51.807 1.00 32.53 ? 127 GLY A O     1 
ATOM   965  N  N     . THR A 1 128 ? -15.204 58.962 51.545 1.00 29.93 ? 128 THR A N     1 
ATOM   966  C  CA    . THR A 1 128 ? -15.517 57.977 50.535 1.00 33.76 ? 128 THR A CA    1 
ATOM   967  C  C     . THR A 1 128 ? -14.992 58.470 49.207 1.00 35.80 ? 128 THR A C     1 
ATOM   968  O  O     . THR A 1 128 ? -14.966 59.672 48.963 1.00 37.54 ? 128 THR A O     1 
ATOM   969  C  CB    . THR A 1 128 ? -17.013 57.734 50.378 1.00 34.21 ? 128 THR A CB    1 
ATOM   970  O  OG1   . THR A 1 128 ? -17.652 58.963 50.040 1.00 42.17 ? 128 THR A OG1   1 
ATOM   971  C  CG2   . THR A 1 128 ? -17.614 57.164 51.635 1.00 29.35 ? 128 THR A CG2   1 
ATOM   972  N  N     . THR A 1 129 ? -14.608 57.520 48.345 1.00 36.50 ? 129 THR A N     1 
ATOM   973  C  CA    . THR A 1 129 ? -14.046 57.810 47.025 1.00 35.07 ? 129 THR A CA    1 
ATOM   974  C  C     . THR A 1 129 ? -14.899 58.669 46.063 1.00 33.47 ? 129 THR A C     1 
ATOM   975  O  O     . THR A 1 129 ? -14.463 58.973 44.937 1.00 34.64 ? 129 THR A O     1 
ATOM   976  C  CB    . THR A 1 129 ? -13.606 56.512 46.320 1.00 34.27 ? 129 THR A CB    1 
ATOM   977  O  OG1   . THR A 1 129 ? -14.751 55.671 46.110 1.00 36.84 ? 129 THR A OG1   1 
ATOM   978  C  CG2   . THR A 1 129 ? -12.557 55.778 47.163 1.00 31.22 ? 129 THR A CG2   1 
ATOM   979  N  N     . GLY A 1 130 ? -16.104 59.053 46.471 1.00 31.76 ? 130 GLY A N     1 
ATOM   980  C  CA    . GLY A 1 130 ? -16.921 59.892 45.615 1.00 34.27 ? 130 GLY A CA    1 
ATOM   981  C  C     . GLY A 1 130 ? -17.685 59.226 44.499 1.00 35.41 ? 130 GLY A C     1 
ATOM   982  O  O     . GLY A 1 130 ? -18.335 59.918 43.700 1.00 42.15 ? 130 GLY A O     1 
ATOM   983  N  N     . ARG A 1 131 ? -17.514 57.917 44.328 1.00 35.68 ? 131 ARG A N     1 
ATOM   984  C  CA    . ARG A 1 131 ? -18.304 57.174 43.340 1.00 34.08 ? 131 ARG A CA    1 
ATOM   985  C  C     . ARG A 1 131 ? -19.602 56.980 44.129 1.00 38.17 ? 131 ARG A C     1 
ATOM   986  O  O     . ARG A 1 131 ? -19.644 57.334 45.319 1.00 45.57 ? 131 ARG A O     1 
ATOM   987  C  CB    . ARG A 1 131 ? -17.702 55.817 43.111 1.00 34.58 ? 131 ARG A CB    1 
ATOM   988  C  CG    . ARG A 1 131 ? -16.414 55.783 42.312 1.00 39.60 ? 131 ARG A CG    1 
ATOM   989  C  CD    . ARG A 1 131 ? -15.249 56.507 42.908 1.00 35.52 ? 131 ARG A CD    1 
ATOM   990  N  NE    . ARG A 1 131 ? -15.020 57.737 42.177 1.00 39.61 ? 131 ARG A NE    1 
ATOM   991  C  CZ    . ARG A 1 131 ? -13.809 58.269 42.066 1.00 45.40 ? 131 ARG A CZ    1 
ATOM   992  N  NH1   . ARG A 1 131 ? -12.759 57.673 42.615 1.00 44.12 ? 131 ARG A NH1   1 
ATOM   993  N  NH2   . ARG A 1 131 ? -13.660 59.440 41.453 1.00 50.80 ? 131 ARG A NH2   1 
ATOM   994  N  N     . GLY A 1 132 ? -20.663 56.419 43.582 1.00 31.98 ? 132 GLY A N     1 
ATOM   995  C  CA    . GLY A 1 132 ? -21.825 56.293 44.472 1.00 33.27 ? 132 GLY A CA    1 
ATOM   996  C  C     . GLY A 1 132 ? -21.956 54.931 45.148 1.00 31.27 ? 132 GLY A C     1 
ATOM   997  O  O     . GLY A 1 132 ? -23.032 54.355 45.204 1.00 34.29 ? 132 GLY A O     1 
ATOM   998  N  N     . ILE A 1 133 ? -20.864 54.404 45.684 1.00 29.61 ? 133 ILE A N     1 
ATOM   999  C  CA    . ILE A 1 133 ? -20.875 53.069 46.256 1.00 26.65 ? 133 ILE A CA    1 
ATOM   1000 C  C     . ILE A 1 133 ? -21.879 52.856 47.364 1.00 28.35 ? 133 ILE A C     1 
ATOM   1001 O  O     . ILE A 1 133 ? -22.721 51.956 47.278 1.00 27.25 ? 133 ILE A O     1 
ATOM   1002 C  CB    . ILE A 1 133 ? -19.494 52.664 46.739 1.00 24.24 ? 133 ILE A CB    1 
ATOM   1003 C  CG1   . ILE A 1 133 ? -18.454 52.877 45.646 1.00 24.99 ? 133 ILE A CG1   1 
ATOM   1004 C  CG2   . ILE A 1 133 ? -19.492 51.217 47.085 1.00 29.55 ? 133 ILE A CG2   1 
ATOM   1005 C  CD1   . ILE A 1 133 ? -18.754 52.185 44.348 1.00 21.59 ? 133 ILE A CD1   1 
ATOM   1006 N  N     . GLY A 1 134 ? -21.837 53.739 48.361 1.00 28.90 ? 134 GLY A N     1 
ATOM   1007 C  CA    . GLY A 1 134 ? -22.719 53.645 49.509 1.00 28.27 ? 134 GLY A CA    1 
ATOM   1008 C  C     . GLY A 1 134 ? -24.176 53.584 49.148 1.00 30.27 ? 134 GLY A C     1 
ATOM   1009 O  O     . GLY A 1 134 ? -24.837 52.593 49.461 1.00 32.14 ? 134 GLY A O     1 
ATOM   1010 N  N     . PRO A 1 135 ? -24.702 54.614 48.447 1.00 30.44 ? 135 PRO A N     1 
ATOM   1011 C  CA    . PRO A 1 135 ? -26.114 54.658 48.047 1.00 29.43 ? 135 PRO A CA    1 
ATOM   1012 C  C     . PRO A 1 135 ? -26.546 53.478 47.203 1.00 28.19 ? 135 PRO A C     1 
ATOM   1013 O  O     . PRO A 1 135 ? -27.633 52.963 47.389 1.00 27.91 ? 135 PRO A O     1 
ATOM   1014 C  CB    . PRO A 1 135 ? -26.206 55.968 47.269 1.00 33.28 ? 135 PRO A CB    1 
ATOM   1015 C  CG    . PRO A 1 135 ? -25.130 56.839 47.959 1.00 31.34 ? 135 PRO A CG    1 
ATOM   1016 C  CD    . PRO A 1 135 ? -24.001 55.837 48.000 1.00 29.99 ? 135 PRO A CD    1 
ATOM   1017 N  N     . ALA A 1 136 ? -25.693 53.036 46.289 1.00 28.82 ? 136 ALA A N     1 
ATOM   1018 C  CA    . ALA A 1 136 ? -26.019 51.907 45.430 1.00 26.90 ? 136 ALA A CA    1 
ATOM   1019 C  C     . ALA A 1 136 ? -26.274 50.695 46.315 1.00 29.33 ? 136 ALA A C     1 
ATOM   1020 O  O     . ALA A 1 136 ? -27.287 49.992 46.136 1.00 29.13 ? 136 ALA A O     1 
ATOM   1021 C  CB    . ALA A 1 136 ? -24.920 51.660 44.460 1.00 20.79 ? 136 ALA A CB    1 
ATOM   1022 N  N     . TYR A 1 137 ? -25.399 50.456 47.295 1.00 31.17 ? 137 TYR A N     1 
ATOM   1023 C  CA    . TYR A 1 137 ? -25.617 49.324 48.216 1.00 34.07 ? 137 TYR A CA    1 
ATOM   1024 C  C     . TYR A 1 137 ? -26.902 49.511 49.057 1.00 35.14 ? 137 TYR A C     1 
ATOM   1025 O  O     . TYR A 1 137 ? -27.650 48.556 49.255 1.00 37.52 ? 137 TYR A O     1 
ATOM   1026 C  CB    . TYR A 1 137 ? -24.400 49.095 49.108 1.00 29.85 ? 137 TYR A CB    1 
ATOM   1027 C  CG    . TYR A 1 137 ? -23.320 48.266 48.441 1.00 28.57 ? 137 TYR A CG    1 
ATOM   1028 C  CD1   . TYR A 1 137 ? -22.020 48.745 48.299 1.00 24.28 ? 137 TYR A CD1   1 
ATOM   1029 C  CD2   . TYR A 1 137 ? -23.611 47.005 47.940 1.00 23.96 ? 137 TYR A CD2   1 
ATOM   1030 C  CE1   . TYR A 1 137 ? -21.049 47.980 47.686 1.00 27.44 ? 137 TYR A CE1   1 
ATOM   1031 C  CE2   . TYR A 1 137 ? -22.648 46.230 47.334 1.00 25.83 ? 137 TYR A CE2   1 
ATOM   1032 C  CZ    . TYR A 1 137 ? -21.372 46.721 47.196 1.00 27.26 ? 137 TYR A CZ    1 
ATOM   1033 O  OH    . TYR A 1 137 ? -20.426 45.964 46.536 1.00 25.73 ? 137 TYR A OH    1 
ATOM   1034 N  N     . GLU A 1 138 ? -27.161 50.741 49.528 1.00 34.04 ? 138 GLU A N     1 
ATOM   1035 C  CA    . GLU A 1 138 ? -28.378 51.067 50.291 1.00 28.32 ? 138 GLU A CA    1 
ATOM   1036 C  C     . GLU A 1 138 ? -29.603 50.740 49.453 1.00 25.25 ? 138 GLU A C     1 
ATOM   1037 O  O     . GLU A 1 138 ? -30.511 50.081 49.924 1.00 27.35 ? 138 GLU A O     1 
ATOM   1038 C  CB    . GLU A 1 138 ? -28.449 52.545 50.623 1.00 29.36 ? 138 GLU A CB    1 
ATOM   1039 C  CG    . GLU A 1 138 ? -27.187 53.192 51.103 1.00 33.11 ? 138 GLU A CG    1 
ATOM   1040 C  CD    . GLU A 1 138 ? -27.406 54.661 51.435 1.00 39.60 ? 138 GLU A CD    1 
ATOM   1041 O  OE1   . GLU A 1 138 ? -28.455 54.971 52.060 1.00 44.40 ? 138 GLU A OE1   1 
ATOM   1042 O  OE2   . GLU A 1 138 ? -26.545 55.511 51.089 1.00 36.47 ? 138 GLU A OE2   1 
ATOM   1043 N  N     . ASP A 1 139 ? -29.651 51.247 48.221 1.00 23.45 ? 139 ASP A N     1 
ATOM   1044 C  CA    . ASP A 1 139 ? -30.753 50.966 47.286 1.00 24.03 ? 139 ASP A CA    1 
ATOM   1045 C  C     . ASP A 1 139 ? -30.941 49.459 47.062 1.00 23.65 ? 139 ASP A C     1 
ATOM   1046 O  O     . ASP A 1 139 ? -32.073 48.992 46.853 1.00 22.35 ? 139 ASP A O     1 
ATOM   1047 C  CB    . ASP A 1 139 ? -30.522 51.652 45.944 1.00 24.20 ? 139 ASP A CB    1 
ATOM   1048 C  CG    . ASP A 1 139 ? -31.051 53.076 45.911 1.00 27.16 ? 139 ASP A CG    1 
ATOM   1049 O  OD1   . ASP A 1 139 ? -31.424 53.528 44.805 1.00 21.31 ? 139 ASP A OD1   1 
ATOM   1050 O  OD2   . ASP A 1 139 ? -31.100 53.744 46.982 1.00 32.70 ? 139 ASP A OD2   1 
ATOM   1051 N  N     . LYS A 1 140 ? -29.834 48.709 47.052 1.00 21.45 ? 140 LYS A N     1 
ATOM   1052 C  CA    . LYS A 1 140 ? -29.901 47.248 46.932 1.00 21.02 ? 140 LYS A CA    1 
ATOM   1053 C  C     . LYS A 1 140 ? -30.686 46.716 48.126 1.00 24.07 ? 140 LYS A C     1 
ATOM   1054 O  O     . LYS A 1 140 ? -31.804 46.211 48.014 1.00 26.52 ? 140 LYS A O     1 
ATOM   1055 C  CB    . LYS A 1 140 ? -28.486 46.650 46.970 1.00 18.49 ? 140 LYS A CB    1 
ATOM   1056 C  CG    . LYS A 1 140 ? -28.454 45.123 47.138 1.00 12.69 ? 140 LYS A CG    1 
ATOM   1057 C  CD    . LYS A 1 140 ? -27.025 44.652 47.397 1.00 9.30  ? 140 LYS A CD    1 
ATOM   1058 C  CE    . LYS A 1 140 ? -26.959 43.161 47.626 1.00 9.25  ? 140 LYS A CE    1 
ATOM   1059 N  NZ    . LYS A 1 140 ? -25.616 42.558 47.280 1.00 8.27  ? 140 LYS A NZ    1 
ATOM   1060 N  N     . VAL A 1 141 ? -30.108 46.912 49.302 1.00 27.40 ? 141 VAL A N     1 
ATOM   1061 C  CA    . VAL A 1 141 ? -30.676 46.456 50.561 1.00 28.01 ? 141 VAL A CA    1 
ATOM   1062 C  C     . VAL A 1 141 ? -32.104 46.963 50.802 1.00 25.07 ? 141 VAL A C     1 
ATOM   1063 O  O     . VAL A 1 141 ? -32.926 46.259 51.387 1.00 22.34 ? 141 VAL A O     1 
ATOM   1064 C  CB    . VAL A 1 141 ? -29.685 46.802 51.722 1.00 26.10 ? 141 VAL A CB    1 
ATOM   1065 C  CG1   . VAL A 1 141 ? -30.378 47.374 52.909 1.00 35.07 ? 141 VAL A CG1   1 
ATOM   1066 C  CG2   . VAL A 1 141 ? -28.965 45.564 52.129 1.00 28.55 ? 141 VAL A CG2   1 
ATOM   1067 N  N     . ALA A 1 142 ? -32.414 48.170 50.364 1.00 20.17 ? 142 ALA A N     1 
ATOM   1068 C  CA    . ALA A 1 142 ? -33.742 48.661 50.559 1.00 19.90 ? 142 ALA A CA    1 
ATOM   1069 C  C     . ALA A 1 142 ? -34.685 48.023 49.550 1.00 24.27 ? 142 ALA A C     1 
ATOM   1070 O  O     . ALA A 1 142 ? -35.888 48.176 49.661 1.00 34.16 ? 142 ALA A O     1 
ATOM   1071 C  CB    . ALA A 1 142 ? -33.764 50.162 50.443 1.00 12.60 ? 142 ALA A CB    1 
ATOM   1072 N  N     . ARG A 1 143 ? -34.153 47.310 48.565 1.00 25.19 ? 143 ARG A N     1 
ATOM   1073 C  CA    . ARG A 1 143 ? -34.947 46.672 47.500 1.00 26.01 ? 143 ARG A CA    1 
ATOM   1074 C  C     . ARG A 1 143 ? -35.665 47.656 46.569 1.00 27.79 ? 143 ARG A C     1 
ATOM   1075 O  O     . ARG A 1 143 ? -36.773 47.378 46.098 1.00 31.05 ? 143 ARG A O     1 
ATOM   1076 C  CB    . ARG A 1 143 ? -35.942 45.654 48.046 1.00 26.43 ? 143 ARG A CB    1 
ATOM   1077 C  CG    . ARG A 1 143 ? -35.304 44.491 48.780 1.00 27.07 ? 143 ARG A CG    1 
ATOM   1078 C  CD    . ARG A 1 143 ? -35.543 44.640 50.269 1.00 30.18 ? 143 ARG A CD    1 
ATOM   1079 N  NE    . ARG A 1 143 ? -36.533 43.685 50.753 1.00 27.84 ? 143 ARG A NE    1 
ATOM   1080 C  CZ    . ARG A 1 143 ? -37.284 43.934 51.818 1.00 24.83 ? 143 ARG A CZ    1 
ATOM   1081 N  NH1   . ARG A 1 143 ? -37.186 45.072 52.481 1.00 28.99 ? 143 ARG A NH1   1 
ATOM   1082 N  NH2   . ARG A 1 143 ? -38.102 43.001 52.242 1.00 27.11 ? 143 ARG A NH2   1 
ATOM   1083 N  N     . ARG A 1 144 ? -35.028 48.798 46.297 1.00 28.06 ? 144 ARG A N     1 
ATOM   1084 C  CA    . ARG A 1 144 ? -35.588 49.810 45.409 1.00 28.83 ? 144 ARG A CA    1 
ATOM   1085 C  C     . ARG A 1 144 ? -34.602 50.119 44.307 1.00 31.87 ? 144 ARG A C     1 
ATOM   1086 O  O     . ARG A 1 144 ? -34.921 50.830 43.359 1.00 33.49 ? 144 ARG A O     1 
ATOM   1087 C  CB    . ARG A 1 144 ? -35.885 51.105 46.168 1.00 27.94 ? 144 ARG A CB    1 
ATOM   1088 C  CG    . ARG A 1 144 ? -34.699 52.027 46.378 1.00 29.27 ? 144 ARG A CG    1 
ATOM   1089 C  CD    . ARG A 1 144 ? -35.121 53.341 47.046 1.00 34.76 ? 144 ARG A CD    1 
ATOM   1090 N  NE    . ARG A 1 144 ? -34.281 53.692 48.192 1.00 41.50 ? 144 ARG A NE    1 
ATOM   1091 C  CZ    . ARG A 1 144 ? -34.640 53.342 49.420 1.00 42.12 ? 144 ARG A CZ    1 
ATOM   1092 N  NH1   . ARG A 1 144 ? -35.764 52.679 49.638 1.00 47.93 ? 144 ARG A NH1   1 
ATOM   1093 N  NH2   . ARG A 1 144 ? -33.866 53.639 50.443 1.00 43.30 ? 144 ARG A NH2   1 
ATOM   1094 N  N     . GLY A 1 145 ? -33.383 49.621 44.454 1.00 31.29 ? 145 GLY A N     1 
ATOM   1095 C  CA    . GLY A 1 145 ? -32.384 49.888 43.450 1.00 32.92 ? 145 GLY A CA    1 
ATOM   1096 C  C     . GLY A 1 145 ? -32.577 49.106 42.162 1.00 36.69 ? 145 GLY A C     1 
ATOM   1097 O  O     . GLY A 1 145 ? -33.253 48.057 42.140 1.00 36.89 ? 145 GLY A O     1 
ATOM   1098 N  N     . LEU A 1 146 ? -31.990 49.630 41.084 1.00 33.43 ? 146 LEU A N     1 
ATOM   1099 C  CA    . LEU A 1 146 ? -32.063 48.991 39.794 1.00 31.68 ? 146 LEU A CA    1 
ATOM   1100 C  C     . LEU A 1 146 ? -30.871 48.045 39.636 1.00 31.52 ? 146 LEU A C     1 
ATOM   1101 O  O     . LEU A 1 146 ? -29.796 48.296 40.182 1.00 31.26 ? 146 LEU A O     1 
ATOM   1102 C  CB    . LEU A 1 146 ? -32.045 50.034 38.690 1.00 34.76 ? 146 LEU A CB    1 
ATOM   1103 C  CG    . LEU A 1 146 ? -33.261 50.944 38.576 1.00 38.27 ? 146 LEU A CG    1 
ATOM   1104 C  CD1   . LEU A 1 146 ? -34.532 50.131 38.661 1.00 35.29 ? 146 LEU A CD1   1 
ATOM   1105 C  CD2   . LEU A 1 146 ? -33.233 51.992 39.671 1.00 43.99 ? 146 LEU A CD2   1 
ATOM   1106 N  N     . ARG A 1 147 ? -31.072 46.962 38.900 1.00 32.48 ? 147 ARG A N     1 
ATOM   1107 C  CA    . ARG A 1 147 ? -30.039 45.976 38.645 1.00 36.30 ? 147 ARG A CA    1 
ATOM   1108 C  C     . ARG A 1 147 ? -29.850 45.882 37.135 1.00 37.42 ? 147 ARG A C     1 
ATOM   1109 O  O     . ARG A 1 147 ? -30.632 46.442 36.361 1.00 37.27 ? 147 ARG A O     1 
ATOM   1110 C  CB    . ARG A 1 147 ? -30.439 44.595 39.222 1.00 37.90 ? 147 ARG A CB    1 
ATOM   1111 C  CG    . ARG A 1 147 ? -30.971 44.646 40.680 1.00 42.01 ? 147 ARG A CG    1 
ATOM   1112 C  CD    . ARG A 1 147 ? -30.736 43.353 41.483 1.00 37.42 ? 147 ARG A CD    1 
ATOM   1113 N  NE    . ARG A 1 147 ? -31.407 42.168 40.932 1.00 40.73 ? 147 ARG A NE    1 
ATOM   1114 C  CZ    . ARG A 1 147 ? -31.260 40.969 41.502 1.00 39.28 ? 147 ARG A CZ    1 
ATOM   1115 N  NH1   . ARG A 1 147 ? -30.494 40.848 42.578 1.00 42.09 ? 147 ARG A NH1   1 
ATOM   1116 N  NH2   . ARG A 1 147 ? -31.865 39.887 40.993 1.00 37.07 ? 147 ARG A NH2   1 
ATOM   1117 N  N     . VAL A 1 148 ? -28.794 45.201 36.712 1.00 36.87 ? 148 VAL A N     1 
ATOM   1118 C  CA    . VAL A 1 148 ? -28.554 45.033 35.295 1.00 34.60 ? 148 VAL A CA    1 
ATOM   1119 C  C     . VAL A 1 148 ? -29.820 44.445 34.636 1.00 34.40 ? 148 VAL A C     1 
ATOM   1120 O  O     . VAL A 1 148 ? -30.371 45.056 33.738 1.00 35.95 ? 148 VAL A O     1 
ATOM   1121 C  CB    . VAL A 1 148 ? -27.301 44.132 35.024 1.00 33.50 ? 148 VAL A CB    1 
ATOM   1122 C  CG1   . VAL A 1 148 ? -27.175 43.830 33.543 1.00 31.82 ? 148 VAL A CG1   1 
ATOM   1123 C  CG2   . VAL A 1 148 ? -26.039 44.843 35.478 1.00 30.93 ? 148 VAL A CG2   1 
ATOM   1124 N  N     . GLY A 1 149 ? -30.299 43.292 35.100 1.00 32.72 ? 149 GLY A N     1 
ATOM   1125 C  CA    . GLY A 1 149 ? -31.473 42.652 34.524 1.00 26.55 ? 149 GLY A CA    1 
ATOM   1126 C  C     . GLY A 1 149 ? -32.693 43.556 34.377 1.00 30.22 ? 149 GLY A C     1 
ATOM   1127 O  O     . GLY A 1 149 ? -33.644 43.219 33.669 1.00 27.92 ? 149 GLY A O     1 
ATOM   1128 N  N     . ASP A 1 150 ? -32.705 44.709 35.039 1.00 31.09 ? 150 ASP A N     1 
ATOM   1129 C  CA    . ASP A 1 150 ? -33.858 45.591 34.890 1.00 33.67 ? 150 ASP A CA    1 
ATOM   1130 C  C     . ASP A 1 150 ? -33.898 46.190 33.501 1.00 35.54 ? 150 ASP A C     1 
ATOM   1131 O  O     . ASP A 1 150 ? -34.941 46.672 33.080 1.00 40.80 ? 150 ASP A O     1 
ATOM   1132 C  CB    . ASP A 1 150 ? -33.863 46.711 35.931 1.00 32.09 ? 150 ASP A CB    1 
ATOM   1133 C  CG    . ASP A 1 150 ? -34.348 46.249 37.283 1.00 23.64 ? 150 ASP A CG    1 
ATOM   1134 O  OD1   . ASP A 1 150 ? -35.561 46.046 37.476 1.00 28.64 ? 150 ASP A OD1   1 
ATOM   1135 O  OD2   . ASP A 1 150 ? -33.518 46.096 38.169 1.00 31.76 ? 150 ASP A OD2   1 
ATOM   1136 N  N     . LEU A 1 151 ? -32.764 46.169 32.801 1.00 36.00 ? 151 LEU A N     1 
ATOM   1137 C  CA    . LEU A 1 151 ? -32.669 46.713 31.446 1.00 36.47 ? 151 LEU A CA    1 
ATOM   1138 C  C     . LEU A 1 151 ? -33.322 45.764 30.421 1.00 38.50 ? 151 LEU A C     1 
ATOM   1139 O  O     . LEU A 1 151 ? -33.415 46.087 29.237 1.00 37.00 ? 151 LEU A O     1 
ATOM   1140 C  CB    . LEU A 1 151 ? -31.197 46.975 31.077 1.00 33.80 ? 151 LEU A CB    1 
ATOM   1141 C  CG    . LEU A 1 151 ? -30.403 47.926 32.000 1.00 34.67 ? 151 LEU A CG    1 
ATOM   1142 C  CD1   . LEU A 1 151 ? -28.939 47.988 31.623 1.00 34.17 ? 151 LEU A CD1   1 
ATOM   1143 C  CD2   . LEU A 1 151 ? -30.962 49.312 31.979 1.00 31.51 ? 151 LEU A CD2   1 
ATOM   1144 N  N     . PHE A 1 152 ? -33.754 44.584 30.868 1.00 39.33 ? 152 PHE A N     1 
ATOM   1145 C  CA    . PHE A 1 152 ? -34.382 43.617 29.966 1.00 38.32 ? 152 PHE A CA    1 
ATOM   1146 C  C     . PHE A 1 152 ? -35.734 44.142 29.501 1.00 38.32 ? 152 PHE A C     1 
ATOM   1147 O  O     . PHE A 1 152 ? -36.404 43.494 28.726 1.00 40.41 ? 152 PHE A O     1 
ATOM   1148 C  CB    . PHE A 1 152 ? -34.635 42.292 30.689 1.00 38.79 ? 152 PHE A CB    1 
ATOM   1149 C  CG    . PHE A 1 152 ? -33.403 41.650 31.270 1.00 41.33 ? 152 PHE A CG    1 
ATOM   1150 C  CD1   . PHE A 1 152 ? -33.526 40.523 32.096 1.00 41.88 ? 152 PHE A CD1   1 
ATOM   1151 C  CD2   . PHE A 1 152 ? -32.131 42.078 30.908 1.00 38.78 ? 152 PHE A CD2   1 
ATOM   1152 C  CE1   . PHE A 1 152 ? -32.404 39.845 32.535 1.00 43.47 ? 152 PHE A CE1   1 
ATOM   1153 C  CE2   . PHE A 1 152 ? -31.005 41.403 31.344 1.00 39.08 ? 152 PHE A CE2   1 
ATOM   1154 C  CZ    . PHE A 1 152 ? -31.138 40.283 32.150 1.00 39.94 ? 152 PHE A CZ    1 
ATOM   1155 N  N     . ASP A 1 153 ? -36.172 45.267 30.042 1.00 37.14 ? 153 ASP A N     1 
ATOM   1156 C  CA    . ASP A 1 153 ? -37.450 45.832 29.659 1.00 34.58 ? 153 ASP A CA    1 
ATOM   1157 C  C     . ASP A 1 153 ? -37.272 47.313 29.900 1.00 35.52 ? 153 ASP A C     1 
ATOM   1158 O  O     . ASP A 1 153 ? -37.377 47.801 31.020 1.00 35.04 ? 153 ASP A O     1 
ATOM   1159 C  CB    . ASP A 1 153 ? -38.513 45.243 30.534 1.00 37.09 ? 153 ASP A CB    1 
ATOM   1160 C  CG    . ASP A 1 153 ? -39.856 45.771 30.225 1.00 40.20 ? 153 ASP A CG    1 
ATOM   1161 O  OD1   . ASP A 1 153 ? -40.804 44.979 30.338 1.00 46.68 ? 153 ASP A OD1   1 
ATOM   1162 O  OD2   . ASP A 1 153 ? -39.978 46.970 29.918 1.00 43.15 ? 153 ASP A OD2   1 
ATOM   1163 N  N     . LYS A 1 154 ? -36.928 48.022 28.837 1.00 37.59 ? 154 LYS A N     1 
ATOM   1164 C  CA    . LYS A 1 154 ? -36.645 49.435 28.938 1.00 37.63 ? 154 LYS A CA    1 
ATOM   1165 C  C     . LYS A 1 154 ? -37.803 50.307 29.403 1.00 42.39 ? 154 LYS A C     1 
ATOM   1166 O  O     . LYS A 1 154 ? -37.579 51.270 30.141 1.00 46.33 ? 154 LYS A O     1 
ATOM   1167 C  CB    . LYS A 1 154 ? -36.064 49.929 27.625 1.00 39.23 ? 154 LYS A CB    1 
ATOM   1168 C  CG    . LYS A 1 154 ? -34.831 49.134 27.113 1.00 37.82 ? 154 LYS A CG    1 
ATOM   1169 C  CD    . LYS A 1 154 ? -34.097 49.963 26.035 1.00 41.40 ? 154 LYS A CD    1 
ATOM   1170 C  CE    . LYS A 1 154 ? -32.722 49.435 25.687 1.00 35.11 ? 154 LYS A CE    1 
ATOM   1171 N  NZ    . LYS A 1 154 ? -32.815 48.245 24.827 1.00 37.23 ? 154 LYS A NZ    1 
ATOM   1172 N  N     . GLU A 1 155 ? -39.039 49.970 29.014 1.00 44.06 ? 155 GLU A N     1 
ATOM   1173 C  CA    . GLU A 1 155 ? -40.203 50.769 29.425 1.00 46.77 ? 155 GLU A CA    1 
ATOM   1174 C  C     . GLU A 1 155 ? -40.467 50.637 30.912 1.00 45.01 ? 155 GLU A C     1 
ATOM   1175 O  O     . GLU A 1 155 ? -40.714 51.624 31.615 1.00 40.01 ? 155 GLU A O     1 
ATOM   1176 C  CB    . GLU A 1 155 ? -41.434 50.389 28.625 1.00 52.21 ? 155 GLU A CB    1 
ATOM   1177 C  CG    . GLU A 1 155 ? -41.430 50.980 27.239 1.00 62.61 ? 155 GLU A CG    1 
ATOM   1178 C  CD    . GLU A 1 155 ? -42.457 50.315 26.358 1.00 72.40 ? 155 GLU A CD    1 
ATOM   1179 O  OE1   . GLU A 1 155 ? -42.191 49.171 25.910 1.00 75.63 ? 155 GLU A OE1   1 
ATOM   1180 O  OE2   . GLU A 1 155 ? -43.525 50.927 26.126 1.00 74.90 ? 155 GLU A OE2   1 
ATOM   1181 N  N     . THR A 1 156 ? -40.408 49.406 31.389 1.00 45.11 ? 156 THR A N     1 
ATOM   1182 C  CA    . THR A 1 156 ? -40.572 49.140 32.794 1.00 43.10 ? 156 THR A CA    1 
ATOM   1183 C  C     . THR A 1 156 ? -39.414 49.837 33.510 1.00 43.15 ? 156 THR A C     1 
ATOM   1184 O  O     . THR A 1 156 ? -39.610 50.413 34.592 1.00 40.69 ? 156 THR A O     1 
ATOM   1185 C  CB    . THR A 1 156 ? -40.495 47.651 33.034 1.00 46.40 ? 156 THR A CB    1 
ATOM   1186 O  OG1   . THR A 1 156 ? -41.688 47.035 32.548 1.00 46.08 ? 156 THR A OG1   1 
ATOM   1187 C  CG2   . THR A 1 156 ? -40.358 47.356 34.486 1.00 54.11 ? 156 THR A CG2   1 
ATOM   1188 N  N     . PHE A 1 157 ? -38.213 49.794 32.912 1.00 43.08 ? 157 PHE A N     1 
ATOM   1189 C  CA    . PHE A 1 157 ? -37.037 50.435 33.515 1.00 41.83 ? 157 PHE A CA    1 
ATOM   1190 C  C     . PHE A 1 157 ? -37.267 51.925 33.707 1.00 42.03 ? 157 PHE A C     1 
ATOM   1191 O  O     . PHE A 1 157 ? -36.936 52.480 34.770 1.00 41.24 ? 157 PHE A O     1 
ATOM   1192 C  CB    . PHE A 1 157 ? -35.762 50.168 32.717 1.00 35.65 ? 157 PHE A CB    1 
ATOM   1193 C  CG    . PHE A 1 157 ? -34.511 50.715 33.373 1.00 34.67 ? 157 PHE A CG    1 
ATOM   1194 C  CD1   . PHE A 1 157 ? -33.749 49.922 34.215 1.00 36.96 ? 157 PHE A CD1   1 
ATOM   1195 C  CD2   . PHE A 1 157 ? -34.097 52.020 33.154 1.00 34.07 ? 157 PHE A CD2   1 
ATOM   1196 C  CE1   . PHE A 1 157 ? -32.598 50.422 34.825 1.00 36.12 ? 157 PHE A CE1   1 
ATOM   1197 C  CE2   . PHE A 1 157 ? -32.942 52.527 33.761 1.00 35.60 ? 157 PHE A CE2   1 
ATOM   1198 C  CZ    . PHE A 1 157 ? -32.200 51.729 34.594 1.00 33.59 ? 157 PHE A CZ    1 
ATOM   1199 N  N     . ALA A 1 158 ? -37.831 52.572 32.691 1.00 40.55 ? 158 ALA A N     1 
ATOM   1200 C  CA    . ALA A 1 158 ? -38.162 53.991 32.760 1.00 38.36 ? 158 ALA A CA    1 
ATOM   1201 C  C     . ALA A 1 158 ? -39.147 54.232 33.897 1.00 38.55 ? 158 ALA A C     1 
ATOM   1202 O  O     . ALA A 1 158 ? -39.084 55.250 34.587 1.00 37.09 ? 158 ALA A O     1 
ATOM   1203 C  CB    . ALA A 1 158 ? -38.771 54.417 31.469 1.00 45.65 ? 158 ALA A CB    1 
ATOM   1204 N  N     . GLU A 1 159 ? -40.079 53.298 34.063 1.00 43.19 ? 159 GLU A N     1 
ATOM   1205 C  CA    . GLU A 1 159 ? -41.065 53.365 35.145 1.00 47.55 ? 159 GLU A CA    1 
ATOM   1206 C  C     . GLU A 1 159 ? -40.365 53.331 36.502 1.00 47.01 ? 159 GLU A C     1 
ATOM   1207 O  O     . GLU A 1 159 ? -40.468 54.285 37.268 1.00 48.46 ? 159 GLU A O     1 
ATOM   1208 C  CB    . GLU A 1 159 ? -42.080 52.225 35.028 1.00 48.88 ? 159 GLU A CB    1 
ATOM   1209 C  CG    . GLU A 1 159 ? -42.883 52.287 33.734 1.00 57.29 ? 159 GLU A CG    1 
ATOM   1210 C  CD    . GLU A 1 159 ? -44.031 51.285 33.659 1.00 62.32 ? 159 GLU A CD    1 
ATOM   1211 O  OE1   . GLU A 1 159 ? -45.079 51.610 33.055 1.00 61.89 ? 159 GLU A OE1   1 
ATOM   1212 O  OE2   . GLU A 1 159 ? -43.886 50.160 34.191 1.00 69.84 ? 159 GLU A OE2   1 
ATOM   1213 N  N     . LYS A 1 160 ? -39.615 52.256 36.770 1.00 48.91 ? 160 LYS A N     1 
ATOM   1214 C  CA    . LYS A 1 160 ? -38.854 52.085 38.029 1.00 46.67 ? 160 LYS A CA    1 
ATOM   1215 C  C     . LYS A 1 160 ? -37.869 53.247 38.276 1.00 47.30 ? 160 LYS A C     1 
ATOM   1216 O  O     . LYS A 1 160 ? -37.792 53.787 39.392 1.00 45.78 ? 160 LYS A O     1 
ATOM   1217 C  CB    . LYS A 1 160 ? -38.078 50.760 38.004 1.00 44.37 ? 160 LYS A CB    1 
ATOM   1218 C  CG    . LYS A 1 160 ? -38.949 49.519 37.901 1.00 43.10 ? 160 LYS A CG    1 
ATOM   1219 C  CD    . LYS A 1 160 ? -38.181 48.364 37.271 1.00 47.52 ? 160 LYS A CD    1 
ATOM   1220 C  CE    . LYS A 1 160 ? -38.899 47.036 37.439 1.00 46.41 ? 160 LYS A CE    1 
ATOM   1221 N  NZ    . LYS A 1 160 ? -38.138 45.905 36.857 1.00 40.54 ? 160 LYS A NZ    1 
ATOM   1222 N  N     . LEU A 1 161 ? -37.106 53.610 37.240 1.00 46.11 ? 161 LEU A N     1 
ATOM   1223 C  CA    . LEU A 1 161 ? -36.152 54.710 37.337 1.00 43.14 ? 161 LEU A CA    1 
ATOM   1224 C  C     . LEU A 1 161 ? -36.847 56.044 37.689 1.00 42.94 ? 161 LEU A C     1 
ATOM   1225 O  O     . LEU A 1 161 ? -36.321 56.816 38.499 1.00 38.76 ? 161 LEU A O     1 
ATOM   1226 C  CB    . LEU A 1 161 ? -35.352 54.856 36.031 1.00 38.63 ? 161 LEU A CB    1 
ATOM   1227 C  CG    . LEU A 1 161 ? -34.369 56.044 36.058 1.00 44.13 ? 161 LEU A CG    1 
ATOM   1228 C  CD1   . LEU A 1 161 ? -33.245 55.784 37.049 1.00 42.31 ? 161 LEU A CD1   1 
ATOM   1229 C  CD2   . LEU A 1 161 ? -33.793 56.355 34.688 1.00 42.10 ? 161 LEU A CD2   1 
ATOM   1230 N  N     . LYS A 1 162 ? -38.003 56.327 37.070 1.00 45.70 ? 162 LYS A N     1 
ATOM   1231 C  CA    . LYS A 1 162 ? -38.762 57.576 37.333 1.00 47.24 ? 162 LYS A CA    1 
ATOM   1232 C  C     . LYS A 1 162 ? -39.093 57.633 38.821 1.00 43.11 ? 162 LYS A C     1 
ATOM   1233 O  O     . LYS A 1 162 ? -38.860 58.646 39.483 1.00 40.63 ? 162 LYS A O     1 
ATOM   1234 C  CB    . LYS A 1 162 ? -40.036 57.640 36.443 1.00 49.85 ? 162 LYS A CB    1 
ATOM   1235 C  CG    . LYS A 1 162 ? -41.071 58.762 36.748 1.00 53.65 ? 162 LYS A CG    1 
ATOM   1236 C  CD    . LYS A 1 162 ? -40.721 60.135 36.173 1.00 58.74 ? 162 LYS A CD    1 
ATOM   1237 C  CE    . LYS A 1 162 ? -40.317 61.163 37.267 1.00 63.86 ? 162 LYS A CE    1 
ATOM   1238 N  NZ    . LYS A 1 162 ? -41.429 61.679 38.128 1.00 57.88 ? 162 LYS A NZ    1 
ATOM   1239 N  N     . GLU A 1 163 ? -39.548 56.498 39.341 1.00 42.19 ? 163 GLU A N     1 
ATOM   1240 C  CA    . GLU A 1 163 ? -39.898 56.361 40.742 1.00 43.66 ? 163 GLU A CA    1 
ATOM   1241 C  C     . GLU A 1 163 ? -38.711 56.613 41.669 1.00 43.34 ? 163 GLU A C     1 
ATOM   1242 O  O     . GLU A 1 163 ? -38.721 57.525 42.493 1.00 47.09 ? 163 GLU A O     1 
ATOM   1243 C  CB    . GLU A 1 163 ? -40.403 54.946 41.037 1.00 45.98 ? 163 GLU A CB    1 
ATOM   1244 C  CG    . GLU A 1 163 ? -41.478 54.421 40.145 1.00 51.36 ? 163 GLU A CG    1 
ATOM   1245 C  CD    . GLU A 1 163 ? -42.402 53.483 40.890 1.00 56.93 ? 163 GLU A CD    1 
ATOM   1246 O  OE1   . GLU A 1 163 ? -42.781 53.835 42.020 1.00 59.09 ? 163 GLU A OE1   1 
ATOM   1247 O  OE2   . GLU A 1 163 ? -42.752 52.398 40.364 1.00 61.23 ? 163 GLU A OE2   1 
ATOM   1248 N  N     . VAL A 1 164 ? -37.703 55.755 41.565 1.00 42.19 ? 164 VAL A N     1 
ATOM   1249 C  CA    . VAL A 1 164 ? -36.526 55.833 42.414 1.00 39.04 ? 164 VAL A CA    1 
ATOM   1250 C  C     . VAL A 1 164 ? -35.887 57.217 42.392 1.00 38.33 ? 164 VAL A C     1 
ATOM   1251 O  O     . VAL A 1 164 ? -35.391 57.711 43.418 1.00 34.02 ? 164 VAL A O     1 
ATOM   1252 C  CB    . VAL A 1 164 ? -35.519 54.726 42.029 1.00 41.43 ? 164 VAL A CB    1 
ATOM   1253 C  CG1   . VAL A 1 164 ? -34.851 55.031 40.701 1.00 45.84 ? 164 VAL A CG1   1 
ATOM   1254 C  CG2   . VAL A 1 164 ? -34.507 54.539 43.103 1.00 47.53 ? 164 VAL A CG2   1 
ATOM   1255 N  N     . MET A 1 165 ? -35.918 57.849 41.222 1.00 40.04 ? 165 MET A N     1 
ATOM   1256 C  CA    . MET A 1 165 ? -35.348 59.179 41.078 1.00 44.24 ? 165 MET A CA    1 
ATOM   1257 C  C     . MET A 1 165 ? -36.220 60.238 41.769 1.00 48.67 ? 165 MET A C     1 
ATOM   1258 O  O     . MET A 1 165 ? -35.685 61.058 42.540 1.00 49.40 ? 165 MET A O     1 
ATOM   1259 C  CB    . MET A 1 165 ? -35.092 59.511 39.605 1.00 44.80 ? 165 MET A CB    1 
ATOM   1260 C  CG    . MET A 1 165 ? -34.142 58.534 38.914 1.00 38.89 ? 165 MET A CG    1 
ATOM   1261 S  SD    . MET A 1 165 ? -33.175 59.255 37.616 1.00 41.48 ? 165 MET A SD    1 
ATOM   1262 C  CE    . MET A 1 165 ? -32.565 60.701 38.487 1.00 31.34 ? 165 MET A CE    1 
ATOM   1263 N  N     . GLU A 1 166 ? -37.541 60.246 41.539 1.00 47.78 ? 166 GLU A N     1 
ATOM   1264 C  CA    . GLU A 1 166 ? -38.335 61.242 42.252 1.00 50.54 ? 166 GLU A CA    1 
ATOM   1265 C  C     . GLU A 1 166 ? -38.055 61.113 43.759 1.00 51.69 ? 166 GLU A C     1 
ATOM   1266 O  O     . GLU A 1 166 ? -37.729 62.105 44.436 1.00 52.18 ? 166 GLU A O     1 
ATOM   1267 C  CB    . GLU A 1 166 ? -39.841 61.178 41.923 1.00 53.93 ? 166 GLU A CB    1 
ATOM   1268 C  CG    . GLU A 1 166 ? -40.440 59.836 41.466 1.00 59.93 ? 166 GLU A CG    1 
ATOM   1269 C  CD    . GLU A 1 166 ? -41.744 59.998 40.636 1.00 62.75 ? 166 GLU A CD    1 
ATOM   1270 O  OE1   . GLU A 1 166 ? -42.396 58.983 40.292 1.00 62.33 ? 166 GLU A OE1   1 
ATOM   1271 O  OE2   . GLU A 1 166 ? -42.107 61.147 40.298 1.00 65.06 ? 166 GLU A OE2   1 
ATOM   1272 N  N     . TYR A 1 167 ? -38.081 59.873 44.247 1.00 49.95 ? 167 TYR A N     1 
ATOM   1273 C  CA    . TYR A 1 167 ? -37.820 59.570 45.648 1.00 46.33 ? 167 TYR A CA    1 
ATOM   1274 C  C     . TYR A 1 167 ? -36.533 60.227 46.126 1.00 47.86 ? 167 TYR A C     1 
ATOM   1275 O  O     . TYR A 1 167 ? -36.525 60.945 47.136 1.00 49.03 ? 167 TYR A O     1 
ATOM   1276 C  CB    . TYR A 1 167 ? -37.704 58.057 45.848 1.00 45.34 ? 167 TYR A CB    1 
ATOM   1277 C  CG    . TYR A 1 167 ? -37.218 57.667 47.231 1.00 43.27 ? 167 TYR A CG    1 
ATOM   1278 C  CD1   . TYR A 1 167 ? -38.014 57.876 48.350 1.00 41.08 ? 167 TYR A CD1   1 
ATOM   1279 C  CD2   . TYR A 1 167 ? -35.934 57.150 47.426 1.00 39.62 ? 167 TYR A CD2   1 
ATOM   1280 C  CE1   . TYR A 1 167 ? -37.547 57.589 49.621 1.00 38.05 ? 167 TYR A CE1   1 
ATOM   1281 C  CE2   . TYR A 1 167 ? -35.464 56.875 48.691 1.00 35.06 ? 167 TYR A CE2   1 
ATOM   1282 C  CZ    . TYR A 1 167 ? -36.281 57.092 49.783 1.00 34.07 ? 167 TYR A CZ    1 
ATOM   1283 O  OH    . TYR A 1 167 ? -35.842 56.795 51.054 1.00 38.17 ? 167 TYR A OH    1 
ATOM   1284 N  N     . HIS A 1 168 ? -35.433 59.952 45.433 1.00 45.68 ? 168 HIS A N     1 
ATOM   1285 C  CA    . HIS A 1 168 ? -34.147 60.526 45.824 1.00 44.94 ? 168 HIS A CA    1 
ATOM   1286 C  C     . HIS A 1 168 ? -34.076 62.019 45.614 1.00 44.45 ? 168 HIS A C     1 
ATOM   1287 O  O     . HIS A 1 168 ? -33.460 62.728 46.424 1.00 40.95 ? 168 HIS A O     1 
ATOM   1288 C  CB    . HIS A 1 168 ? -32.992 59.859 45.072 1.00 48.03 ? 168 HIS A CB    1 
ATOM   1289 C  CG    . HIS A 1 168 ? -32.687 58.475 45.541 1.00 50.77 ? 168 HIS A CG    1 
ATOM   1290 N  ND1   . HIS A 1 168 ? -32.830 57.367 44.743 1.00 49.02 ? 168 HIS A ND1   1 
ATOM   1291 C  CD2   . HIS A 1 168 ? -32.264 58.014 46.748 1.00 47.92 ? 168 HIS A CD2   1 
ATOM   1292 C  CE1   . HIS A 1 168 ? -32.505 56.280 45.426 1.00 48.51 ? 168 HIS A CE1   1 
ATOM   1293 N  NE2   . HIS A 1 168 ? -32.159 56.654 46.645 1.00 47.46 ? 168 HIS A NE2   1 
ATOM   1294 N  N     . ASN A 1 169 ? -34.675 62.483 44.509 1.00 40.87 ? 169 ASN A N     1 
ATOM   1295 C  CA    . ASN A 1 169 ? -34.677 63.900 44.170 1.00 37.41 ? 169 ASN A CA    1 
ATOM   1296 C  C     . ASN A 1 169 ? -35.285 64.667 45.343 1.00 36.14 ? 169 ASN A C     1 
ATOM   1297 O  O     . ASN A 1 169 ? -34.708 65.630 45.823 1.00 32.16 ? 169 ASN A O     1 
ATOM   1298 C  CB    . ASN A 1 169 ? -35.463 64.149 42.865 1.00 39.94 ? 169 ASN A CB    1 
ATOM   1299 C  CG    . ASN A 1 169 ? -34.587 64.060 41.580 1.00 40.94 ? 169 ASN A CG    1 
ATOM   1300 O  OD1   . ASN A 1 169 ? -33.437 64.522 41.554 1.00 42.08 ? 169 ASN A OD1   1 
ATOM   1301 N  ND2   . ASN A 1 169 ? -35.152 63.498 40.513 1.00 33.06 ? 169 ASN A ND2   1 
ATOM   1302 N  N     . PHE A 1 170 ? -36.431 64.213 45.840 1.00 37.14 ? 170 PHE A N     1 
ATOM   1303 C  CA    . PHE A 1 170 ? -37.091 64.878 46.962 1.00 40.84 ? 170 PHE A CA    1 
ATOM   1304 C  C     . PHE A 1 170 ? -36.098 65.135 48.092 1.00 43.08 ? 170 PHE A C     1 
ATOM   1305 O  O     . PHE A 1 170 ? -35.991 66.247 48.600 1.00 44.59 ? 170 PHE A O     1 
ATOM   1306 C  CB    . PHE A 1 170 ? -38.265 64.025 47.459 1.00 39.81 ? 170 PHE A CB    1 
ATOM   1307 C  CG    . PHE A 1 170 ? -39.019 64.627 48.603 1.00 45.08 ? 170 PHE A CG    1 
ATOM   1308 C  CD1   . PHE A 1 170 ? -40.311 65.077 48.426 1.00 48.74 ? 170 PHE A CD1   1 
ATOM   1309 C  CD2   . PHE A 1 170 ? -38.429 64.759 49.859 1.00 49.11 ? 170 PHE A CD2   1 
ATOM   1310 C  CE1   . PHE A 1 170 ? -41.015 65.650 49.477 1.00 49.80 ? 170 PHE A CE1   1 
ATOM   1311 C  CE2   . PHE A 1 170 ? -39.122 65.334 50.924 1.00 49.08 ? 170 PHE A CE2   1 
ATOM   1312 C  CZ    . PHE A 1 170 ? -40.416 65.783 50.731 1.00 50.07 ? 170 PHE A CZ    1 
ATOM   1313 N  N     . GLN A 1 171 ? -35.368 64.097 48.472 1.00 48.17 ? 171 GLN A N     1 
ATOM   1314 C  CA    . GLN A 1 171 ? -34.365 64.132 49.549 1.00 54.15 ? 171 GLN A CA    1 
ATOM   1315 C  C     . GLN A 1 171 ? -33.208 65.144 49.243 1.00 54.99 ? 171 GLN A C     1 
ATOM   1316 O  O     . GLN A 1 171 ? -32.787 65.951 50.103 1.00 50.68 ? 171 GLN A O     1 
ATOM   1317 C  CB    . GLN A 1 171 ? -33.853 62.686 49.699 1.00 58.56 ? 171 GLN A CB    1 
ATOM   1318 C  CG    . GLN A 1 171 ? -32.861 62.343 50.788 1.00 67.88 ? 171 GLN A CG    1 
ATOM   1319 C  CD    . GLN A 1 171 ? -32.185 60.984 50.508 1.00 75.55 ? 171 GLN A CD    1 
ATOM   1320 O  OE1   . GLN A 1 171 ? -32.602 60.234 49.605 1.00 78.67 ? 171 GLN A OE1   1 
ATOM   1321 N  NE2   . GLN A 1 171 ? -31.125 60.678 51.249 1.00 78.45 ? 171 GLN A NE2   1 
ATOM   1322 N  N     . LEU A 1 172 ? -32.716 65.110 48.012 1.00 56.12 ? 172 LEU A N     1 
ATOM   1323 C  CA    . LEU A 1 172 ? -31.637 65.994 47.589 1.00 55.42 ? 172 LEU A CA    1 
ATOM   1324 C  C     . LEU A 1 172 ? -31.957 67.489 47.678 1.00 55.93 ? 172 LEU A C     1 
ATOM   1325 O  O     . LEU A 1 172 ? -31.153 68.270 48.210 1.00 55.55 ? 172 LEU A O     1 
ATOM   1326 C  CB    . LEU A 1 172 ? -31.195 65.641 46.162 1.00 53.85 ? 172 LEU A CB    1 
ATOM   1327 C  CG    . LEU A 1 172 ? -30.399 64.338 46.028 1.00 53.15 ? 172 LEU A CG    1 
ATOM   1328 C  CD1   . LEU A 1 172 ? -30.047 64.081 44.589 1.00 49.90 ? 172 LEU A CD1   1 
ATOM   1329 C  CD2   . LEU A 1 172 ? -29.145 64.418 46.882 1.00 52.82 ? 172 LEU A CD2   1 
ATOM   1330 N  N     . VAL A 1 173 ? -33.119 67.892 47.167 1.00 53.20 ? 173 VAL A N     1 
ATOM   1331 C  CA    . VAL A 1 173 ? -33.481 69.302 47.188 1.00 52.45 ? 173 VAL A CA    1 
ATOM   1332 C  C     . VAL A 1 173 ? -34.081 69.804 48.506 1.00 51.57 ? 173 VAL A C     1 
ATOM   1333 O  O     . VAL A 1 173 ? -33.657 70.840 49.035 1.00 49.49 ? 173 VAL A O     1 
ATOM   1334 C  CB    . VAL A 1 173 ? -34.410 69.656 46.012 1.00 54.31 ? 173 VAL A CB    1 
ATOM   1335 C  CG1   . VAL A 1 173 ? -33.958 68.911 44.766 1.00 56.12 ? 173 VAL A CG1   1 
ATOM   1336 C  CG2   . VAL A 1 173 ? -35.864 69.336 46.342 1.00 56.01 ? 173 VAL A CG2   1 
ATOM   1337 N  N     . ASN A 1 174 ? -35.004 69.043 49.078 1.00 48.80 ? 174 ASN A N     1 
ATOM   1338 C  CA    . ASN A 1 174 ? -35.653 69.479 50.303 1.00 51.27 ? 174 ASN A CA    1 
ATOM   1339 C  C     . ASN A 1 174 ? -34.843 69.360 51.591 1.00 52.60 ? 174 ASN A C     1 
ATOM   1340 O  O     . ASN A 1 174 ? -34.819 70.284 52.428 1.00 53.77 ? 174 ASN A O     1 
ATOM   1341 C  CB    . ASN A 1 174 ? -37.003 68.791 50.433 1.00 49.12 ? 174 ASN A CB    1 
ATOM   1342 C  CG    . ASN A 1 174 ? -37.862 69.039 49.230 1.00 51.40 ? 174 ASN A CG    1 
ATOM   1343 O  OD1   . ASN A 1 174 ? -37.713 70.063 48.570 1.00 54.86 ? 174 ASN A OD1   1 
ATOM   1344 N  ND2   . ASN A 1 174 ? -38.707 68.085 48.881 1.00 52.77 ? 174 ASN A ND2   1 
ATOM   1345 N  N     . TYR A 1 175 ? -34.158 68.240 51.749 1.00 51.10 ? 175 TYR A N     1 
ATOM   1346 C  CA    . TYR A 1 175 ? -33.381 68.041 52.958 1.00 47.29 ? 175 TYR A CA    1 
ATOM   1347 C  C     . TYR A 1 175 ? -31.982 68.565 52.741 1.00 47.23 ? 175 TYR A C     1 
ATOM   1348 O  O     . TYR A 1 175 ? -31.610 69.590 53.301 1.00 46.74 ? 175 TYR A O     1 
ATOM   1349 C  CB    . TYR A 1 175 ? -33.381 66.563 53.331 1.00 41.78 ? 175 TYR A CB    1 
ATOM   1350 C  CG    . TYR A 1 175 ? -32.658 66.227 54.598 1.00 36.79 ? 175 TYR A CG    1 
ATOM   1351 C  CD1   . TYR A 1 175 ? -31.292 65.934 54.576 1.00 38.04 ? 175 TYR A CD1   1 
ATOM   1352 C  CD2   . TYR A 1 175 ? -33.337 66.109 55.809 1.00 33.31 ? 175 TYR A CD2   1 
ATOM   1353 C  CE1   . TYR A 1 175 ? -30.626 65.515 55.699 1.00 32.43 ? 175 TYR A CE1   1 
ATOM   1354 C  CE2   . TYR A 1 175 ? -32.673 65.683 56.935 1.00 28.74 ? 175 TYR A CE2   1 
ATOM   1355 C  CZ    . TYR A 1 175 ? -31.317 65.390 56.860 1.00 31.22 ? 175 TYR A CZ    1 
ATOM   1356 O  OH    . TYR A 1 175 ? -30.643 64.909 57.941 1.00 37.72 ? 175 TYR A OH    1 
ATOM   1357 N  N     . TYR A 1 176 ? -31.239 67.908 51.862 1.00 50.28 ? 176 TYR A N     1 
ATOM   1358 C  CA    . TYR A 1 176 ? -29.867 68.319 51.594 1.00 52.25 ? 176 TYR A CA    1 
ATOM   1359 C  C     . TYR A 1 176 ? -29.761 69.693 50.945 1.00 52.44 ? 176 TYR A C     1 
ATOM   1360 O  O     . TYR A 1 176 ? -28.677 70.276 50.906 1.00 54.52 ? 176 TYR A O     1 
ATOM   1361 C  CB    . TYR A 1 176 ? -29.167 67.288 50.716 1.00 52.29 ? 176 TYR A CB    1 
ATOM   1362 C  CG    . TYR A 1 176 ? -29.025 65.912 51.345 1.00 51.98 ? 176 TYR A CG    1 
ATOM   1363 C  CD1   . TYR A 1 176 ? -29.799 64.851 50.906 1.00 54.37 ? 176 TYR A CD1   1 
ATOM   1364 C  CD2   . TYR A 1 176 ? -28.061 65.662 52.318 1.00 52.43 ? 176 TYR A CD2   1 
ATOM   1365 C  CE1   . TYR A 1 176 ? -29.618 63.580 51.407 1.00 57.79 ? 176 TYR A CE1   1 
ATOM   1366 C  CE2   . TYR A 1 176 ? -27.870 64.396 52.832 1.00 55.63 ? 176 TYR A CE2   1 
ATOM   1367 C  CZ    . TYR A 1 176 ? -28.648 63.350 52.370 1.00 59.04 ? 176 TYR A CZ    1 
ATOM   1368 O  OH    . TYR A 1 176 ? -28.482 62.067 52.869 1.00 61.40 ? 176 TYR A OH    1 
ATOM   1369 N  N     . LYS A 1 177 ? -30.886 70.201 50.437 1.00 52.53 ? 177 LYS A N     1 
ATOM   1370 C  CA    . LYS A 1 177 ? -30.922 71.495 49.779 1.00 51.77 ? 177 LYS A CA    1 
ATOM   1371 C  C     . LYS A 1 177 ? -29.874 71.498 48.675 1.00 53.39 ? 177 LYS A C     1 
ATOM   1372 O  O     . LYS A 1 177 ? -29.148 72.466 48.477 1.00 54.39 ? 177 LYS A O     1 
ATOM   1373 C  CB    . LYS A 1 177 ? -30.718 72.606 50.811 1.00 50.90 ? 177 LYS A CB    1 
ATOM   1374 C  CG    . LYS A 1 177 ? -31.935 72.760 51.710 1.00 51.30 ? 177 LYS A CG    1 
ATOM   1375 C  CD    . LYS A 1 177 ? -31.601 73.391 53.048 1.00 56.25 ? 177 LYS A CD    1 
ATOM   1376 C  CE    . LYS A 1 177 ? -32.885 73.658 53.872 1.00 62.21 ? 177 LYS A CE    1 
ATOM   1377 N  NZ    . LYS A 1 177 ? -33.708 72.429 54.144 1.00 60.19 ? 177 LYS A NZ    1 
ATOM   1378 N  N     . ALA A 1 178 ? -29.817 70.375 47.959 1.00 55.13 ? 178 ALA A N     1 
ATOM   1379 C  CA    . ALA A 1 178 ? -28.887 70.162 46.859 1.00 53.79 ? 178 ALA A CA    1 
ATOM   1380 C  C     . ALA A 1 178 ? -29.668 70.139 45.560 1.00 53.40 ? 178 ALA A C     1 
ATOM   1381 O  O     . ALA A 1 178 ? -30.897 70.041 45.582 1.00 53.25 ? 178 ALA A O     1 
ATOM   1382 C  CB    . ALA A 1 178 ? -28.163 68.846 47.044 1.00 54.74 ? 178 ALA A CB    1 
ATOM   1383 N  N     . GLU A 1 179 ? -28.968 70.221 44.426 1.00 53.20 ? 179 GLU A N     1 
ATOM   1384 C  CA    . GLU A 1 179 ? -29.650 70.216 43.134 1.00 54.38 ? 179 GLU A CA    1 
ATOM   1385 C  C     . GLU A 1 179 ? -30.153 68.822 42.763 1.00 53.43 ? 179 GLU A C     1 
ATOM   1386 O  O     . GLU A 1 179 ? -29.509 67.819 43.064 1.00 53.88 ? 179 GLU A O     1 
ATOM   1387 C  CB    . GLU A 1 179 ? -28.770 70.810 42.023 1.00 55.08 ? 179 GLU A CB    1 
ATOM   1388 C  CG    . GLU A 1 179 ? -27.517 70.024 41.709 1.00 61.80 ? 179 GLU A CG    1 
ATOM   1389 C  CD    . GLU A 1 179 ? -26.495 70.818 40.889 1.00 68.89 ? 179 GLU A CD    1 
ATOM   1390 O  OE1   . GLU A 1 179 ? -26.902 71.730 40.133 1.00 71.75 ? 179 GLU A OE1   1 
ATOM   1391 O  OE2   . GLU A 1 179 ? -25.274 70.531 41.012 1.00 71.19 ? 179 GLU A OE2   1 
ATOM   1392 N  N     . ALA A 1 180 ? -31.338 68.770 42.163 1.00 50.03 ? 180 ALA A N     1 
ATOM   1393 C  CA    . ALA A 1 180 ? -31.938 67.519 41.746 1.00 47.10 ? 180 ALA A CA    1 
ATOM   1394 C  C     . ALA A 1 180 ? -31.113 66.905 40.624 1.00 46.51 ? 180 ALA A C     1 
ATOM   1395 O  O     . ALA A 1 180 ? -30.298 67.576 40.005 1.00 45.83 ? 180 ALA A O     1 
ATOM   1396 C  CB    . ALA A 1 180 ? -33.358 67.767 41.267 1.00 43.31 ? 180 ALA A CB    1 
ATOM   1397 N  N     . VAL A 1 181 ? -31.309 65.623 40.370 1.00 44.16 ? 181 VAL A N     1 
ATOM   1398 C  CA    . VAL A 1 181 ? -30.592 64.959 39.302 1.00 41.08 ? 181 VAL A CA    1 
ATOM   1399 C  C     . VAL A 1 181 ? -31.634 64.680 38.213 1.00 45.47 ? 181 VAL A C     1 
ATOM   1400 O  O     . VAL A 1 181 ? -32.649 64.015 38.455 1.00 48.16 ? 181 VAL A O     1 
ATOM   1401 C  CB    . VAL A 1 181 ? -29.912 63.677 39.819 1.00 37.07 ? 181 VAL A CB    1 
ATOM   1402 C  CG1   . VAL A 1 181 ? -29.356 62.839 38.693 1.00 28.61 ? 181 VAL A CG1   1 
ATOM   1403 C  CG2   . VAL A 1 181 ? -28.792 64.064 40.736 1.00 36.22 ? 181 VAL A CG2   1 
ATOM   1404 N  N     . ASP A 1 182 ? -31.409 65.205 37.019 1.00 45.98 ? 182 ASP A N     1 
ATOM   1405 C  CA    . ASP A 1 182 ? -32.377 65.007 35.960 1.00 45.43 ? 182 ASP A CA    1 
ATOM   1406 C  C     . ASP A 1 182 ? -32.684 63.587 35.534 1.00 42.18 ? 182 ASP A C     1 
ATOM   1407 O  O     . ASP A 1 182 ? -31.888 62.924 34.871 1.00 42.31 ? 182 ASP A O     1 
ATOM   1408 C  CB    . ASP A 1 182 ? -32.050 65.824 34.718 1.00 48.72 ? 182 ASP A CB    1 
ATOM   1409 C  CG    . ASP A 1 182 ? -33.120 65.698 33.674 1.00 56.58 ? 182 ASP A CG    1 
ATOM   1410 O  OD1   . ASP A 1 182 ? -32.891 64.984 32.676 1.00 60.46 ? 182 ASP A OD1   1 
ATOM   1411 O  OD2   . ASP A 1 182 ? -34.223 66.254 33.881 1.00 59.20 ? 182 ASP A OD2   1 
ATOM   1412 N  N     . TYR A 1 183 ? -33.894 63.163 35.851 1.00 41.31 ? 183 TYR A N     1 
ATOM   1413 C  CA    . TYR A 1 183 ? -34.348 61.841 35.463 1.00 42.62 ? 183 TYR A CA    1 
ATOM   1414 C  C     . TYR A 1 183 ? -34.046 61.504 33.994 1.00 43.45 ? 183 TYR A C     1 
ATOM   1415 O  O     . TYR A 1 183 ? -33.400 60.489 33.724 1.00 45.89 ? 183 TYR A O     1 
ATOM   1416 C  CB    . TYR A 1 183 ? -35.850 61.714 35.708 1.00 34.68 ? 183 TYR A CB    1 
ATOM   1417 C  CG    . TYR A 1 183 ? -36.472 60.548 35.001 1.00 32.53 ? 183 TYR A CG    1 
ATOM   1418 C  CD1   . TYR A 1 183 ? -36.476 59.309 35.579 1.00 34.21 ? 183 TYR A CD1   1 
ATOM   1419 C  CD2   . TYR A 1 183 ? -37.090 60.698 33.760 1.00 34.78 ? 183 TYR A CD2   1 
ATOM   1420 C  CE1   . TYR A 1 183 ? -37.060 58.231 34.970 1.00 37.65 ? 183 TYR A CE1   1 
ATOM   1421 C  CE2   . TYR A 1 183 ? -37.691 59.617 33.130 1.00 38.46 ? 183 TYR A CE2   1 
ATOM   1422 C  CZ    . TYR A 1 183 ? -37.676 58.372 33.753 1.00 42.67 ? 183 TYR A CZ    1 
ATOM   1423 O  OH    . TYR A 1 183 ? -38.271 57.253 33.178 1.00 45.01 ? 183 TYR A OH    1 
ATOM   1424 N  N     . GLN A 1 184 ? -34.505 62.338 33.055 1.00 44.74 ? 184 GLN A N     1 
ATOM   1425 C  CA    . GLN A 1 184 ? -34.302 62.081 31.617 1.00 44.08 ? 184 GLN A CA    1 
ATOM   1426 C  C     . GLN A 1 184 ? -32.847 61.949 31.193 1.00 41.07 ? 184 GLN A C     1 
ATOM   1427 O  O     . GLN A 1 184 ? -32.541 61.173 30.290 1.00 35.78 ? 184 GLN A O     1 
ATOM   1428 C  CB    . GLN A 1 184 ? -34.959 63.158 30.761 1.00 48.30 ? 184 GLN A CB    1 
ATOM   1429 C  CG    . GLN A 1 184 ? -35.017 62.787 29.283 1.00 46.49 ? 184 GLN A CG    1 
ATOM   1430 C  CD    . GLN A 1 184 ? -35.900 61.585 29.041 1.00 48.88 ? 184 GLN A CD    1 
ATOM   1431 O  OE1   . GLN A 1 184 ? -37.062 61.555 29.466 1.00 51.69 ? 184 GLN A OE1   1 
ATOM   1432 N  NE2   . GLN A 1 184 ? -35.359 60.579 28.376 1.00 44.96 ? 184 GLN A NE2   1 
ATOM   1433 N  N     . LYS A 1 185 ? -31.967 62.709 31.839 1.00 38.34 ? 185 LYS A N     1 
ATOM   1434 C  CA    . LYS A 1 185 ? -30.551 62.661 31.537 1.00 37.80 ? 185 LYS A CA    1 
ATOM   1435 C  C     . LYS A 1 185 ? -30.093 61.250 31.900 1.00 39.95 ? 185 LYS A C     1 
ATOM   1436 O  O     . LYS A 1 185 ? -29.472 60.556 31.088 1.00 41.62 ? 185 LYS A O     1 
ATOM   1437 C  CB    . LYS A 1 185 ? -29.827 63.699 32.378 1.00 37.48 ? 185 LYS A CB    1 
ATOM   1438 C  CG    . LYS A 1 185 ? -28.551 64.222 31.770 1.00 40.41 ? 185 LYS A CG    1 
ATOM   1439 C  CD    . LYS A 1 185 ? -27.430 63.257 31.954 1.00 46.56 ? 185 LYS A CD    1 
ATOM   1440 C  CE    . LYS A 1 185 ? -26.085 63.889 31.635 1.00 49.55 ? 185 LYS A CE    1 
ATOM   1441 N  NZ    . LYS A 1 185 ? -24.956 63.070 32.171 1.00 50.70 ? 185 LYS A NZ    1 
ATOM   1442 N  N     . VAL A 1 186 ? -30.440 60.812 33.107 1.00 36.42 ? 186 VAL A N     1 
ATOM   1443 C  CA    . VAL A 1 186 ? -30.066 59.479 33.555 1.00 36.55 ? 186 VAL A CA    1 
ATOM   1444 C  C     . VAL A 1 186 ? -30.662 58.404 32.630 1.00 36.67 ? 186 VAL A C     1 
ATOM   1445 O  O     . VAL A 1 186 ? -29.939 57.552 32.092 1.00 37.52 ? 186 VAL A O     1 
ATOM   1446 C  CB    . VAL A 1 186 ? -30.510 59.225 35.044 1.00 34.58 ? 186 VAL A CB    1 
ATOM   1447 C  CG1   . VAL A 1 186 ? -30.203 57.776 35.465 1.00 37.47 ? 186 VAL A CG1   1 
ATOM   1448 C  CG2   . VAL A 1 186 ? -29.792 60.188 35.989 1.00 37.11 ? 186 VAL A CG2   1 
ATOM   1449 N  N     . LEU A 1 187 ? -31.970 58.435 32.414 1.00 34.11 ? 187 LEU A N     1 
ATOM   1450 C  CA    . LEU A 1 187 ? -32.554 57.410 31.588 1.00 37.50 ? 187 LEU A CA    1 
ATOM   1451 C  C     . LEU A 1 187 ? -31.857 57.333 30.250 1.00 38.54 ? 187 LEU A C     1 
ATOM   1452 O  O     . LEU A 1 187 ? -31.551 56.239 29.781 1.00 36.43 ? 187 LEU A O     1 
ATOM   1453 C  CB    . LEU A 1 187 ? -34.056 57.617 31.430 1.00 37.01 ? 187 LEU A CB    1 
ATOM   1454 C  CG    . LEU A 1 187 ? -34.868 56.586 30.645 1.00 40.49 ? 187 LEU A CG    1 
ATOM   1455 C  CD1   . LEU A 1 187 ? -34.531 55.156 31.034 1.00 35.94 ? 187 LEU A CD1   1 
ATOM   1456 C  CD2   . LEU A 1 187 ? -36.363 56.882 30.794 1.00 40.31 ? 187 LEU A CD2   1 
ATOM   1457 N  N     . ASP A 1 188 ? -31.564 58.488 29.652 1.00 41.55 ? 188 ASP A N     1 
ATOM   1458 C  CA    . ASP A 1 188 ? -30.902 58.529 28.348 1.00 44.88 ? 188 ASP A CA    1 
ATOM   1459 C  C     . ASP A 1 188 ? -29.507 57.926 28.358 1.00 42.62 ? 188 ASP A C     1 
ATOM   1460 O  O     . ASP A 1 188 ? -29.255 56.971 27.610 1.00 47.38 ? 188 ASP A O     1 
ATOM   1461 C  CB    . ASP A 1 188 ? -30.862 59.952 27.782 1.00 45.08 ? 188 ASP A CB    1 
ATOM   1462 C  CG    . ASP A 1 188 ? -32.237 60.470 27.406 1.00 45.73 ? 188 ASP A CG    1 
ATOM   1463 O  OD1   . ASP A 1 188 ? -32.372 61.714 27.314 1.00 51.34 ? 188 ASP A OD1   1 
ATOM   1464 O  OD2   . ASP A 1 188 ? -33.177 59.657 27.198 1.00 37.33 ? 188 ASP A OD2   1 
ATOM   1465 N  N     . ASP A 1 189 ? -28.610 58.469 29.186 1.00 38.34 ? 189 ASP A N     1 
ATOM   1466 C  CA    . ASP A 1 189 ? -27.244 57.955 29.303 1.00 34.90 ? 189 ASP A CA    1 
ATOM   1467 C  C     . ASP A 1 189 ? -27.264 56.428 29.477 1.00 35.80 ? 189 ASP A C     1 
ATOM   1468 O  O     . ASP A 1 189 ? -26.432 55.693 28.937 1.00 37.64 ? 189 ASP A O     1 
ATOM   1469 C  CB    . ASP A 1 189 ? -26.575 58.559 30.520 1.00 33.02 ? 189 ASP A CB    1 
ATOM   1470 C  CG    . ASP A 1 189 ? -26.226 60.006 30.359 1.00 36.53 ? 189 ASP A CG    1 
ATOM   1471 O  OD1   . ASP A 1 189 ? -25.930 60.647 31.388 1.00 39.33 ? 189 ASP A OD1   1 
ATOM   1472 O  OD2   . ASP A 1 189 ? -26.176 60.518 29.226 1.00 39.78 ? 189 ASP A OD2   1 
ATOM   1473 N  N     . THR A 1 190 ? -28.221 55.960 30.257 1.00 35.51 ? 190 THR A N     1 
ATOM   1474 C  CA    . THR A 1 190 ? -28.382 54.543 30.531 1.00 36.77 ? 190 THR A CA    1 
ATOM   1475 C  C     . THR A 1 190 ? -28.808 53.736 29.303 1.00 36.03 ? 190 THR A C     1 
ATOM   1476 O  O     . THR A 1 190 ? -28.091 52.829 28.885 1.00 34.94 ? 190 THR A O     1 
ATOM   1477 C  CB    . THR A 1 190 ? -29.380 54.373 31.696 1.00 37.92 ? 190 THR A CB    1 
ATOM   1478 O  OG1   . THR A 1 190 ? -28.850 55.061 32.856 1.00 30.62 ? 190 THR A OG1   1 
ATOM   1479 C  CG2   . THR A 1 190 ? -29.671 52.886 31.978 1.00 35.55 ? 190 THR A CG2   1 
ATOM   1480 N  N     . MET A 1 191 ? -29.943 54.103 28.700 1.00 38.13 ? 191 MET A N     1 
ATOM   1481 C  CA    . MET A 1 191 ? -30.475 53.415 27.531 1.00 35.36 ? 191 MET A CA    1 
ATOM   1482 C  C     . MET A 1 191 ? -29.506 53.328 26.374 1.00 36.54 ? 191 MET A C     1 
ATOM   1483 O  O     . MET A 1 191 ? -29.568 52.371 25.582 1.00 35.30 ? 191 MET A O     1 
ATOM   1484 C  CB    . MET A 1 191 ? -31.771 54.058 27.095 1.00 40.07 ? 191 MET A CB    1 
ATOM   1485 C  CG    . MET A 1 191 ? -32.905 53.861 28.091 1.00 50.23 ? 191 MET A CG    1 
ATOM   1486 S  SD    . MET A 1 191 ? -33.473 52.133 28.348 1.00 53.57 ? 191 MET A SD    1 
ATOM   1487 C  CE    . MET A 1 191 ? -33.009 51.914 30.071 1.00 51.64 ? 191 MET A CE    1 
ATOM   1488 N  N     . ALA A 1 192 ? -28.635 54.329 26.240 1.00 33.73 ? 192 ALA A N     1 
ATOM   1489 C  CA    . ALA A 1 192 ? -27.629 54.309 25.173 1.00 31.88 ? 192 ALA A CA    1 
ATOM   1490 C  C     . ALA A 1 192 ? -26.713 53.100 25.326 1.00 32.14 ? 192 ALA A C     1 
ATOM   1491 O  O     . ALA A 1 192 ? -26.400 52.437 24.345 1.00 33.79 ? 192 ALA A O     1 
ATOM   1492 C  CB    . ALA A 1 192 ? -26.800 55.584 25.185 1.00 30.81 ? 192 ALA A CB    1 
ATOM   1493 N  N     . VAL A 1 193 ? -26.278 52.826 26.557 1.00 32.80 ? 193 VAL A N     1 
ATOM   1494 C  CA    . VAL A 1 193 ? -25.372 51.702 26.840 1.00 33.22 ? 193 VAL A CA    1 
ATOM   1495 C  C     . VAL A 1 193 ? -26.075 50.365 27.167 1.00 33.23 ? 193 VAL A C     1 
ATOM   1496 O  O     . VAL A 1 193 ? -25.486 49.290 27.008 1.00 32.82 ? 193 VAL A O     1 
ATOM   1497 C  CB    . VAL A 1 193 ? -24.385 52.058 27.981 1.00 34.78 ? 193 VAL A CB    1 
ATOM   1498 C  CG1   . VAL A 1 193 ? -23.606 53.328 27.640 1.00 25.16 ? 193 VAL A CG1   1 
ATOM   1499 C  CG2   . VAL A 1 193 ? -25.140 52.250 29.281 1.00 38.77 ? 193 VAL A CG2   1 
ATOM   1500 N  N     . ALA A 1 194 ? -27.325 50.439 27.614 1.00 33.05 ? 194 ALA A N     1 
ATOM   1501 C  CA    . ALA A 1 194 ? -28.102 49.272 27.947 1.00 31.71 ? 194 ALA A CA    1 
ATOM   1502 C  C     . ALA A 1 194 ? -27.762 48.057 27.120 1.00 33.98 ? 194 ALA A C     1 
ATOM   1503 O  O     . ALA A 1 194 ? -27.379 47.038 27.689 1.00 36.76 ? 194 ALA A O     1 
ATOM   1504 C  CB    . ALA A 1 194 ? -29.571 49.576 27.854 1.00 31.28 ? 194 ALA A CB    1 
ATOM   1505 N  N     . ASP A 1 195 ? -27.888 48.136 25.794 1.00 36.01 ? 195 ASP A N     1 
ATOM   1506 C  CA    . ASP A 1 195 ? -27.593 46.988 24.913 1.00 37.11 ? 195 ASP A CA    1 
ATOM   1507 C  C     . ASP A 1 195 ? -26.217 46.351 25.108 1.00 35.63 ? 195 ASP A C     1 
ATOM   1508 O  O     . ASP A 1 195 ? -26.106 45.116 25.162 1.00 37.50 ? 195 ASP A O     1 
ATOM   1509 C  CB    . ASP A 1 195 ? -27.803 47.358 23.443 1.00 42.07 ? 195 ASP A CB    1 
ATOM   1510 C  CG    . ASP A 1 195 ? -29.249 47.387 23.067 1.00 41.45 ? 195 ASP A CG    1 
ATOM   1511 O  OD1   . ASP A 1 195 ? -29.963 48.292 23.526 1.00 50.14 ? 195 ASP A OD1   1 
ATOM   1512 O  OD2   . ASP A 1 195 ? -29.700 46.465 22.373 1.00 49.62 ? 195 ASP A OD2   1 
ATOM   1513 N  N     . ILE A 1 196 ? -25.168 47.174 25.192 1.00 33.26 ? 196 ILE A N     1 
ATOM   1514 C  CA    . ILE A 1 196 ? -23.817 46.660 25.420 1.00 30.70 ? 196 ILE A CA    1 
ATOM   1515 C  C     . ILE A 1 196 ? -23.867 45.916 26.763 1.00 34.01 ? 196 ILE A C     1 
ATOM   1516 O  O     . ILE A 1 196 ? -23.493 44.737 26.870 1.00 32.31 ? 196 ILE A O     1 
ATOM   1517 C  CB    . ILE A 1 196 ? -22.806 47.801 25.558 1.00 26.30 ? 196 ILE A CB    1 
ATOM   1518 C  CG1   . ILE A 1 196 ? -22.652 48.520 24.238 1.00 25.41 ? 196 ILE A CG1   1 
ATOM   1519 C  CG2   . ILE A 1 196 ? -21.458 47.271 26.028 1.00 28.15 ? 196 ILE A CG2   1 
ATOM   1520 C  CD1   . ILE A 1 196 ? -21.667 49.582 24.336 1.00 24.66 ? 196 ILE A CD1   1 
ATOM   1521 N  N     . LEU A 1 197 ? -24.355 46.625 27.783 1.00 36.11 ? 197 LEU A N     1 
ATOM   1522 C  CA    . LEU A 1 197 ? -24.497 46.103 29.134 1.00 36.83 ? 197 LEU A CA    1 
ATOM   1523 C  C     . LEU A 1 197 ? -25.182 44.731 29.103 1.00 37.88 ? 197 LEU A C     1 
ATOM   1524 O  O     . LEU A 1 197 ? -24.629 43.724 29.549 1.00 42.73 ? 197 LEU A O     1 
ATOM   1525 C  CB    . LEU A 1 197 ? -25.349 47.070 29.958 1.00 36.88 ? 197 LEU A CB    1 
ATOM   1526 C  CG    . LEU A 1 197 ? -24.734 47.671 31.206 1.00 37.37 ? 197 LEU A CG    1 
ATOM   1527 C  CD1   . LEU A 1 197 ? -24.226 46.568 32.124 1.00 42.95 ? 197 LEU A CD1   1 
ATOM   1528 C  CD2   . LEU A 1 197 ? -23.613 48.540 30.823 1.00 34.67 ? 197 LEU A CD2   1 
ATOM   1529 N  N     . THR A 1 198 ? -26.384 44.679 28.559 1.00 34.35 ? 198 THR A N     1 
ATOM   1530 C  CA    . THR A 1 198 ? -27.109 43.423 28.520 1.00 37.58 ? 198 THR A CA    1 
ATOM   1531 C  C     . THR A 1 198 ? -26.339 42.320 27.766 1.00 37.84 ? 198 THR A C     1 
ATOM   1532 O  O     . THR A 1 198 ? -26.370 41.154 28.167 1.00 38.08 ? 198 THR A O     1 
ATOM   1533 C  CB    . THR A 1 198 ? -28.540 43.633 27.917 1.00 39.41 ? 198 THR A CB    1 
ATOM   1534 O  OG1   . THR A 1 198 ? -29.187 44.710 28.610 1.00 46.65 ? 198 THR A OG1   1 
ATOM   1535 C  CG2   . THR A 1 198 ? -29.399 42.394 28.106 1.00 45.98 ? 198 THR A CG2   1 
ATOM   1536 N  N     . SER A 1 199 ? -25.632 42.674 26.691 1.00 35.41 ? 199 SER A N     1 
ATOM   1537 C  CA    . SER A 1 199 ? -24.928 41.655 25.941 1.00 31.72 ? 199 SER A CA    1 
ATOM   1538 C  C     . SER A 1 199 ? -23.955 40.816 26.787 1.00 30.56 ? 199 SER A C     1 
ATOM   1539 O  O     . SER A 1 199 ? -23.850 39.602 26.583 1.00 31.30 ? 199 SER A O     1 
ATOM   1540 C  CB    . SER A 1 199 ? -24.225 42.271 24.750 1.00 30.82 ? 199 SER A CB    1 
ATOM   1541 O  OG    . SER A 1 199 ? -22.999 42.857 25.128 1.00 40.15 ? 199 SER A OG    1 
ATOM   1542 N  N     . MET A 1 200 ? -23.293 41.428 27.770 1.00 28.75 ? 200 MET A N     1 
ATOM   1543 C  CA    . MET A 1 200 ? -22.340 40.688 28.596 1.00 24.48 ? 200 MET A CA    1 
ATOM   1544 C  C     . MET A 1 200 ? -22.918 39.816 29.723 1.00 28.64 ? 200 MET A C     1 
ATOM   1545 O  O     . MET A 1 200 ? -22.188 39.125 30.423 1.00 31.93 ? 200 MET A O     1 
ATOM   1546 C  CB    . MET A 1 200 ? -21.287 41.651 29.132 1.00 20.41 ? 200 MET A CB    1 
ATOM   1547 C  CG    . MET A 1 200 ? -20.396 42.204 28.031 1.00 19.02 ? 200 MET A CG    1 
ATOM   1548 S  SD    . MET A 1 200 ? -19.214 43.461 28.536 1.00 29.34 ? 200 MET A SD    1 
ATOM   1549 C  CE    . MET A 1 200 ? -20.264 44.934 28.698 1.00 15.10 ? 200 MET A CE    1 
ATOM   1550 N  N     . VAL A 1 201 ? -24.231 39.821 29.893 1.00 28.48 ? 201 VAL A N     1 
ATOM   1551 C  CA    . VAL A 1 201 ? -24.853 39.042 30.942 1.00 24.34 ? 201 VAL A CA    1 
ATOM   1552 C  C     . VAL A 1 201 ? -24.736 37.521 30.799 1.00 29.11 ? 201 VAL A C     1 
ATOM   1553 O  O     . VAL A 1 201 ? -24.807 36.949 29.708 1.00 28.30 ? 201 VAL A O     1 
ATOM   1554 C  CB    . VAL A 1 201 ? -26.324 39.465 31.163 1.00 25.60 ? 201 VAL A CB    1 
ATOM   1555 C  CG1   . VAL A 1 201 ? -27.071 38.453 32.067 1.00 23.43 ? 201 VAL A CG1   1 
ATOM   1556 C  CG2   . VAL A 1 201 ? -26.354 40.879 31.795 1.00 18.71 ? 201 VAL A CG2   1 
ATOM   1557 N  N     . VAL A 1 202 ? -24.517 36.890 31.945 1.00 31.07 ? 202 VAL A N     1 
ATOM   1558 C  CA    . VAL A 1 202 ? -24.382 35.461 32.044 1.00 27.81 ? 202 VAL A CA    1 
ATOM   1559 C  C     . VAL A 1 202 ? -24.916 35.126 33.429 1.00 27.03 ? 202 VAL A C     1 
ATOM   1560 O  O     . VAL A 1 202 ? -24.934 35.980 34.318 1.00 30.73 ? 202 VAL A O     1 
ATOM   1561 C  CB    . VAL A 1 202 ? -22.880 35.036 31.961 1.00 33.37 ? 202 VAL A CB    1 
ATOM   1562 C  CG1   . VAL A 1 202 ? -22.128 35.502 33.168 1.00 26.76 ? 202 VAL A CG1   1 
ATOM   1563 C  CG2   . VAL A 1 202 ? -22.734 33.535 31.859 1.00 33.77 ? 202 VAL A CG2   1 
ATOM   1564 N  N     . ASP A 1 203 ? -25.405 33.906 33.583 1.00 22.54 ? 203 ASP A N     1 
ATOM   1565 C  CA    . ASP A 1 203 ? -25.873 33.418 34.868 1.00 22.25 ? 203 ASP A CA    1 
ATOM   1566 C  C     . ASP A 1 203 ? -24.580 32.977 35.624 1.00 23.42 ? 203 ASP A C     1 
ATOM   1567 O  O     . ASP A 1 203 ? -24.183 31.808 35.546 1.00 20.77 ? 203 ASP A O     1 
ATOM   1568 C  CB    . ASP A 1 203 ? -26.781 32.212 34.607 1.00 22.19 ? 203 ASP A CB    1 
ATOM   1569 C  CG    . ASP A 1 203 ? -27.326 31.587 35.858 1.00 28.04 ? 203 ASP A CG    1 
ATOM   1570 O  OD1   . ASP A 1 203 ? -28.403 30.942 35.780 1.00 28.49 ? 203 ASP A OD1   1 
ATOM   1571 O  OD2   . ASP A 1 203 ? -26.689 31.716 36.920 1.00 33.56 ? 203 ASP A OD2   1 
ATOM   1572 N  N     . VAL A 1 204 ? -23.932 33.893 36.344 1.00 21.09 ? 204 VAL A N     1 
ATOM   1573 C  CA    . VAL A 1 204 ? -22.683 33.615 37.081 1.00 21.94 ? 204 VAL A CA    1 
ATOM   1574 C  C     . VAL A 1 204 ? -22.620 32.425 38.096 1.00 26.28 ? 204 VAL A C     1 
ATOM   1575 O  O     . VAL A 1 204 ? -21.627 31.653 38.162 1.00 22.73 ? 204 VAL A O     1 
ATOM   1576 C  CB    . VAL A 1 204 ? -22.193 34.899 37.774 1.00 18.34 ? 204 VAL A CB    1 
ATOM   1577 C  CG1   . VAL A 1 204 ? -20.844 34.663 38.441 1.00 17.61 ? 204 VAL A CG1   1 
ATOM   1578 C  CG2   . VAL A 1 204 ? -22.064 36.020 36.772 1.00 12.10 ? 204 VAL A CG2   1 
ATOM   1579 N  N     . SER A 1 205 ? -23.660 32.260 38.905 1.00 26.41 ? 205 SER A N     1 
ATOM   1580 C  CA    . SER A 1 205 ? -23.632 31.169 39.862 1.00 27.97 ? 205 SER A CA    1 
ATOM   1581 C  C     . SER A 1 205 ? -23.519 29.872 39.129 1.00 26.64 ? 205 SER A C     1 
ATOM   1582 O  O     . SER A 1 205 ? -22.664 29.050 39.466 1.00 26.90 ? 205 SER A O     1 
ATOM   1583 C  CB    . SER A 1 205 ? -24.885 31.121 40.738 1.00 29.21 ? 205 SER A CB    1 
ATOM   1584 O  OG    . SER A 1 205 ? -25.802 32.139 40.382 1.00 46.05 ? 205 SER A OG    1 
ATOM   1585 N  N     . ASP A 1 206 ? -24.390 29.676 38.138 1.00 27.05 ? 206 ASP A N     1 
ATOM   1586 C  CA    . ASP A 1 206 ? -24.390 28.427 37.369 1.00 30.99 ? 206 ASP A CA    1 
ATOM   1587 C  C     . ASP A 1 206 ? -23.063 28.173 36.626 1.00 30.07 ? 206 ASP A C     1 
ATOM   1588 O  O     . ASP A 1 206 ? -22.514 27.049 36.613 1.00 25.43 ? 206 ASP A O     1 
ATOM   1589 C  CB    . ASP A 1 206 ? -25.568 28.416 36.388 1.00 35.23 ? 206 ASP A CB    1 
ATOM   1590 C  CG    . ASP A 1 206 ? -25.811 27.051 35.792 1.00 35.91 ? 206 ASP A CG    1 
ATOM   1591 O  OD1   . ASP A 1 206 ? -25.267 26.764 34.707 1.00 38.64 ? 206 ASP A OD1   1 
ATOM   1592 O  OD2   . ASP A 1 206 ? -26.543 26.264 36.415 1.00 35.43 ? 206 ASP A OD2   1 
ATOM   1593 N  N     . LEU A 1 207 ? -22.543 29.236 36.026 1.00 27.21 ? 207 LEU A N     1 
ATOM   1594 C  CA    . LEU A 1 207 ? -21.304 29.162 35.290 1.00 27.53 ? 207 LEU A CA    1 
ATOM   1595 C  C     . LEU A 1 207 ? -20.253 28.701 36.284 1.00 27.01 ? 207 LEU A C     1 
ATOM   1596 O  O     . LEU A 1 207 ? -19.514 27.744 35.990 1.00 27.68 ? 207 LEU A O     1 
ATOM   1597 C  CB    . LEU A 1 207 ? -20.981 30.529 34.687 1.00 24.37 ? 207 LEU A CB    1 
ATOM   1598 C  CG    . LEU A 1 207 ? -19.722 30.799 33.865 1.00 24.22 ? 207 LEU A CG    1 
ATOM   1599 C  CD1   . LEU A 1 207 ? -19.869 32.102 33.035 1.00 21.76 ? 207 LEU A CD1   1 
ATOM   1600 C  CD2   . LEU A 1 207 ? -18.565 30.962 34.829 1.00 31.63 ? 207 LEU A CD2   1 
ATOM   1601 N  N     . LEU A 1 208 ? -20.197 29.348 37.453 1.00 25.47 ? 208 LEU A N     1 
ATOM   1602 C  CA    . LEU A 1 208 ? -19.242 28.968 38.517 1.00 24.07 ? 208 LEU A CA    1 
ATOM   1603 C  C     . LEU A 1 208 ? -19.477 27.539 39.062 1.00 23.08 ? 208 LEU A C     1 
ATOM   1604 O  O     . LEU A 1 208 ? -18.532 26.838 39.391 1.00 23.35 ? 208 LEU A O     1 
ATOM   1605 C  CB    . LEU A 1 208 ? -19.271 29.974 39.669 1.00 25.88 ? 208 LEU A CB    1 
ATOM   1606 C  CG    . LEU A 1 208 ? -18.825 31.400 39.359 1.00 28.11 ? 208 LEU A CG    1 
ATOM   1607 C  CD1   . LEU A 1 208 ? -19.044 32.233 40.592 1.00 24.70 ? 208 LEU A CD1   1 
ATOM   1608 C  CD2   . LEU A 1 208 ? -17.356 31.391 38.880 1.00 23.69 ? 208 LEU A CD2   1 
ATOM   1609 N  N     . ASP A 1 209 ? -20.719 27.115 39.208 1.00 22.49 ? 209 ASP A N     1 
ATOM   1610 C  CA    . ASP A 1 209 ? -20.955 25.755 39.654 1.00 25.77 ? 209 ASP A CA    1 
ATOM   1611 C  C     . ASP A 1 209 ? -20.392 24.801 38.591 1.00 25.00 ? 209 ASP A C     1 
ATOM   1612 O  O     . ASP A 1 209 ? -19.778 23.787 38.902 1.00 25.11 ? 209 ASP A O     1 
ATOM   1613 C  CB    . ASP A 1 209 ? -22.463 25.510 39.835 1.00 30.43 ? 209 ASP A CB    1 
ATOM   1614 C  CG    . ASP A 1 209 ? -22.790 24.093 40.306 1.00 35.15 ? 209 ASP A CG    1 
ATOM   1615 O  OD1   . ASP A 1 209 ? -23.877 23.611 39.929 1.00 38.03 ? 209 ASP A OD1   1 
ATOM   1616 O  OD2   . ASP A 1 209 ? -21.991 23.461 41.061 1.00 33.45 ? 209 ASP A OD2   1 
ATOM   1617 N  N     . GLN A 1 210 ? -20.628 25.108 37.316 1.00 28.12 ? 210 GLN A N     1 
ATOM   1618 C  CA    . GLN A 1 210 ? -20.121 24.269 36.219 1.00 31.00 ? 210 GLN A CA    1 
ATOM   1619 C  C     . GLN A 1 210 ? -18.588 24.291 36.250 1.00 30.00 ? 210 GLN A C     1 
ATOM   1620 O  O     . GLN A 1 210 ? -17.930 23.255 36.309 1.00 31.02 ? 210 GLN A O     1 
ATOM   1621 C  CB    . GLN A 1 210 ? -20.636 24.782 34.866 1.00 36.07 ? 210 GLN A CB    1 
ATOM   1622 C  CG    . GLN A 1 210 ? -22.149 24.791 34.719 1.00 41.59 ? 210 GLN A CG    1 
ATOM   1623 C  CD    . GLN A 1 210 ? -22.600 25.602 33.518 1.00 45.66 ? 210 GLN A CD    1 
ATOM   1624 O  OE1   . GLN A 1 210 ? -22.041 26.653 33.224 1.00 53.30 ? 210 GLN A OE1   1 
ATOM   1625 N  NE2   . GLN A 1 210 ? -23.629 25.138 32.835 1.00 51.92 ? 210 GLN A NE2   1 
ATOM   1626 N  N     . ALA A 1 211 ? -18.005 25.475 36.207 1.00 28.03 ? 211 ALA A N     1 
ATOM   1627 C  CA    . ALA A 1 211 ? -16.551 25.566 36.265 1.00 29.52 ? 211 ALA A CA    1 
ATOM   1628 C  C     . ALA A 1 211 ? -16.050 24.697 37.426 1.00 31.08 ? 211 ALA A C     1 
ATOM   1629 O  O     . ALA A 1 211 ? -15.173 23.851 37.276 1.00 33.80 ? 211 ALA A O     1 
ATOM   1630 C  CB    . ALA A 1 211 ? -16.126 27.030 36.483 1.00 24.10 ? 211 ALA A CB    1 
ATOM   1631 N  N     . ARG A 1 212 ? -16.647 24.891 38.585 1.00 30.99 ? 212 ARG A N     1 
ATOM   1632 C  CA    . ARG A 1 212 ? -16.247 24.181 39.777 1.00 31.79 ? 212 ARG A CA    1 
ATOM   1633 C  C     . ARG A 1 212 ? -16.254 22.694 39.540 1.00 31.90 ? 212 ARG A C     1 
ATOM   1634 O  O     . ARG A 1 212 ? -15.272 22.021 39.859 1.00 35.61 ? 212 ARG A O     1 
ATOM   1635 C  CB    . ARG A 1 212 ? -17.155 24.581 40.938 1.00 31.61 ? 212 ARG A CB    1 
ATOM   1636 C  CG    . ARG A 1 212 ? -16.631 24.265 42.294 1.00 32.90 ? 212 ARG A CG    1 
ATOM   1637 C  CD    . ARG A 1 212 ? -16.989 22.858 42.702 1.00 23.17 ? 212 ARG A CD    1 
ATOM   1638 N  NE    . ARG A 1 212 ? -18.416 22.632 42.503 1.00 27.43 ? 212 ARG A NE    1 
ATOM   1639 C  CZ    . ARG A 1 212 ? -18.950 21.466 42.824 1.00 25.96 ? 212 ARG A CZ    1 
ATOM   1640 N  NH1   . ARG A 1 212 ? -18.167 20.536 43.327 1.00 29.27 ? 212 ARG A NH1   1 
ATOM   1641 N  NH2   . ARG A 1 212 ? -20.228 21.219 42.571 1.00 22.44 ? 212 ARG A NH2   1 
ATOM   1642 N  N     . GLN A 1 213 ? -17.336 22.184 38.958 1.00 30.87 ? 213 GLN A N     1 
ATOM   1643 C  CA    . GLN A 1 213 ? -17.454 20.748 38.664 1.00 31.64 ? 213 GLN A CA    1 
ATOM   1644 C  C     . GLN A 1 213 ? -16.503 20.231 37.570 1.00 33.60 ? 213 GLN A C     1 
ATOM   1645 O  O     . GLN A 1 213 ? -16.353 19.031 37.403 1.00 35.91 ? 213 GLN A O     1 
ATOM   1646 C  CB    . GLN A 1 213 ? -18.893 20.429 38.290 1.00 30.49 ? 213 GLN A CB    1 
ATOM   1647 C  CG    . GLN A 1 213 ? -19.855 20.793 39.405 1.00 37.30 ? 213 GLN A CG    1 
ATOM   1648 C  CD    . GLN A 1 213 ? -21.301 20.570 39.056 1.00 34.75 ? 213 GLN A CD    1 
ATOM   1649 O  OE1   . GLN A 1 213 ? -22.168 21.327 39.484 1.00 35.43 ? 213 GLN A OE1   1 
ATOM   1650 N  NE2   . GLN A 1 213 ? -21.584 19.486 38.364 1.00 31.44 ? 213 GLN A NE2   1 
ATOM   1651 N  N     . ARG A 1 214 ? -15.904 21.133 36.794 1.00 34.85 ? 214 ARG A N     1 
ATOM   1652 C  CA    . ARG A 1 214 ? -14.963 20.753 35.744 1.00 34.60 ? 214 ARG A CA    1 
ATOM   1653 C  C     . ARG A 1 214 ? -13.546 20.736 36.291 1.00 34.11 ? 214 ARG A C     1 
ATOM   1654 O  O     . ARG A 1 214 ? -12.692 19.968 35.858 1.00 36.89 ? 214 ARG A O     1 
ATOM   1655 C  CB    . ARG A 1 214 ? -15.048 21.725 34.556 1.00 33.15 ? 214 ARG A CB    1 
ATOM   1656 C  CG    . ARG A 1 214 ? -16.356 21.647 33.825 1.00 34.57 ? 214 ARG A CG    1 
ATOM   1657 C  CD    . ARG A 1 214 ? -16.283 22.244 32.447 1.00 35.72 ? 214 ARG A CD    1 
ATOM   1658 N  NE    . ARG A 1 214 ? -15.957 23.658 32.519 1.00 39.82 ? 214 ARG A NE    1 
ATOM   1659 C  CZ    . ARG A 1 214 ? -16.908 24.583 32.520 1.00 39.45 ? 214 ARG A CZ    1 
ATOM   1660 N  NH1   . ARG A 1 214 ? -18.188 24.221 32.451 1.00 37.31 ? 214 ARG A NH1   1 
ATOM   1661 N  NH2   . ARG A 1 214 ? -16.576 25.875 32.583 1.00 40.34 ? 214 ARG A NH2   1 
ATOM   1662 N  N     . GLY A 1 215 ? -13.294 21.583 37.265 1.00 35.28 ? 215 GLY A N     1 
ATOM   1663 C  CA    . GLY A 1 215 ? -11.969 21.637 37.831 1.00 35.81 ? 215 GLY A CA    1 
ATOM   1664 C  C     . GLY A 1 215 ? -11.323 22.937 37.412 1.00 34.05 ? 215 GLY A C     1 
ATOM   1665 O  O     . GLY A 1 215 ? -10.198 23.219 37.796 1.00 35.36 ? 215 GLY A O     1 
ATOM   1666 N  N     . ASP A 1 216 ? -12.066 23.767 36.695 1.00 30.21 ? 216 ASP A N     1 
ATOM   1667 C  CA    . ASP A 1 216 ? -11.514 25.022 36.238 1.00 35.75 ? 216 ASP A CA    1 
ATOM   1668 C  C     . ASP A 1 216 ? -10.884 25.902 37.313 1.00 34.41 ? 216 ASP A C     1 
ATOM   1669 O  O     . ASP A 1 216 ? -11.383 26.025 38.427 1.00 32.10 ? 216 ASP A O     1 
ATOM   1670 C  CB    . ASP A 1 216 ? -12.555 25.812 35.439 1.00 38.65 ? 216 ASP A CB    1 
ATOM   1671 C  CG    . ASP A 1 216 ? -13.031 25.051 34.228 1.00 44.63 ? 216 ASP A CG    1 
ATOM   1672 O  OD1   . ASP A 1 216 ? -12.184 24.413 33.556 1.00 49.58 ? 216 ASP A OD1   1 
ATOM   1673 O  OD2   . ASP A 1 216 ? -14.246 25.059 33.948 1.00 46.50 ? 216 ASP A OD2   1 
ATOM   1674 N  N     . PHE A 1 217 ? -9.749  26.489 36.953 1.00 32.55 ? 217 PHE A N     1 
ATOM   1675 C  CA    . PHE A 1 217 ? -9.043  27.388 37.830 1.00 26.24 ? 217 PHE A CA    1 
ATOM   1676 C  C     . PHE A 1 217 ? -9.821  28.683 37.835 1.00 25.03 ? 217 PHE A C     1 
ATOM   1677 O  O     . PHE A 1 217 ? -10.065 29.280 36.783 1.00 25.58 ? 217 PHE A O     1 
ATOM   1678 C  CB    . PHE A 1 217 ? -7.629  27.631 37.302 1.00 25.19 ? 217 PHE A CB    1 
ATOM   1679 C  CG    . PHE A 1 217 ? -6.644  26.573 37.708 1.00 22.92 ? 217 PHE A CG    1 
ATOM   1680 C  CD1   . PHE A 1 217 ? -7.083  25.361 38.228 1.00 25.86 ? 217 PHE A CD1   1 
ATOM   1681 C  CD2   . PHE A 1 217 ? -5.279  26.785 37.536 1.00 19.61 ? 217 PHE A CD2   1 
ATOM   1682 C  CE1   . PHE A 1 217 ? -6.175  24.367 38.576 1.00 24.94 ? 217 PHE A CE1   1 
ATOM   1683 C  CE2   . PHE A 1 217 ? -4.352  25.800 37.887 1.00 22.13 ? 217 PHE A CE2   1 
ATOM   1684 C  CZ    . PHE A 1 217 ? -4.803  24.582 38.401 1.00 17.08 ? 217 PHE A CZ    1 
ATOM   1685 N  N     . VAL A 1 218 ? -10.220 29.120 39.017 1.00 21.77 ? 218 VAL A N     1 
ATOM   1686 C  CA    . VAL A 1 218 ? -10.972 30.356 39.140 1.00 20.92 ? 218 VAL A CA    1 
ATOM   1687 C  C     . VAL A 1 218 ? -10.315 31.234 40.205 1.00 22.20 ? 218 VAL A C     1 
ATOM   1688 O  O     . VAL A 1 218 ? -9.938  30.757 41.295 1.00 22.54 ? 218 VAL A O     1 
ATOM   1689 C  CB    . VAL A 1 218 ? -12.424 30.085 39.583 1.00 22.93 ? 218 VAL A CB    1 
ATOM   1690 C  CG1   . VAL A 1 218 ? -13.233 31.369 39.572 1.00 22.54 ? 218 VAL A CG1   1 
ATOM   1691 C  CG2   . VAL A 1 218 ? -13.078 29.015 38.687 1.00 26.13 ? 218 VAL A CG2   1 
ATOM   1692 N  N     . MET A 1 219 ? -10.164 32.509 39.896 1.00 16.80 ? 219 MET A N     1 
ATOM   1693 C  CA    . MET A 1 219 ? -9.589  33.405 40.847 1.00 16.53 ? 219 MET A CA    1 
ATOM   1694 C  C     . MET A 1 219 ? -10.630 34.420 41.203 1.00 19.67 ? 219 MET A C     1 
ATOM   1695 O  O     . MET A 1 219 ? -11.339 34.920 40.326 1.00 20.11 ? 219 MET A O     1 
ATOM   1696 C  CB    . MET A 1 219 ? -8.368  34.096 40.256 1.00 20.94 ? 219 MET A CB    1 
ATOM   1697 C  CG    . MET A 1 219 ? -7.681  35.018 41.260 1.00 25.92 ? 219 MET A CG    1 
ATOM   1698 S  SD    . MET A 1 219 ? -5.942  35.113 40.942 1.00 35.87 ? 219 MET A SD    1 
ATOM   1699 C  CE    . MET A 1 219 ? -5.402  33.513 41.496 1.00 26.42 ? 219 MET A CE    1 
ATOM   1700 N  N     . PHE A 1 220 ? -10.784 34.692 42.491 1.00 22.60 ? 220 PHE A N     1 
ATOM   1701 C  CA    . PHE A 1 220 ? -11.751 35.699 42.937 1.00 22.78 ? 220 PHE A CA    1 
ATOM   1702 C  C     . PHE A 1 220 ? -10.900 36.865 43.347 1.00 25.39 ? 220 PHE A C     1 
ATOM   1703 O  O     . PHE A 1 220 ? -9.944  36.706 44.100 1.00 28.70 ? 220 PHE A O     1 
ATOM   1704 C  CB    . PHE A 1 220 ? -12.621 35.172 44.080 1.00 22.58 ? 220 PHE A CB    1 
ATOM   1705 C  CG    . PHE A 1 220 ? -13.515 34.032 43.676 1.00 19.10 ? 220 PHE A CG    1 
ATOM   1706 C  CD1   . PHE A 1 220 ? -13.043 32.710 43.674 1.00 17.65 ? 220 PHE A CD1   1 
ATOM   1707 C  CD2   . PHE A 1 220 ? -14.807 34.276 43.242 1.00 16.01 ? 220 PHE A CD2   1 
ATOM   1708 C  CE1   . PHE A 1 220 ? -13.849 31.633 43.238 1.00 15.79 ? 220 PHE A CE1   1 
ATOM   1709 C  CE2   . PHE A 1 220 ? -15.613 33.226 42.812 1.00 20.60 ? 220 PHE A CE2   1 
ATOM   1710 C  CZ    . PHE A 1 220 ? -15.130 31.891 42.806 1.00 16.02 ? 220 PHE A CZ    1 
ATOM   1711 N  N     . GLU A 1 221 ? -11.216 38.033 42.818 1.00 27.79 ? 221 GLU A N     1 
ATOM   1712 C  CA    . GLU A 1 221 ? -10.436 39.223 43.073 1.00 25.04 ? 221 GLU A CA    1 
ATOM   1713 C  C     . GLU A 1 221 ? -11.089 40.125 44.078 1.00 27.75 ? 221 GLU A C     1 
ATOM   1714 O  O     . GLU A 1 221 ? -12.203 40.612 43.845 1.00 25.69 ? 221 GLU A O     1 
ATOM   1715 C  CB    . GLU A 1 221 ? -10.270 39.993 41.786 1.00 28.00 ? 221 GLU A CB    1 
ATOM   1716 C  CG    . GLU A 1 221 ? -9.405  41.215 41.923 1.00 26.22 ? 221 GLU A CG    1 
ATOM   1717 C  CD    . GLU A 1 221 ? -9.437  42.036 40.684 1.00 24.47 ? 221 GLU A CD    1 
ATOM   1718 O  OE1   . GLU A 1 221 ? -8.922  43.165 40.704 1.00 33.62 ? 221 GLU A OE1   1 
ATOM   1719 O  OE2   . GLU A 1 221 ? -9.964  41.557 39.667 1.00 24.46 ? 221 GLU A OE2   1 
ATOM   1720 N  N     . GLY A 1 222 ? -10.402 40.384 45.185 1.00 24.62 ? 222 GLY A N     1 
ATOM   1721 C  CA    . GLY A 1 222 ? -11.003 41.248 46.175 1.00 23.55 ? 222 GLY A CA    1 
ATOM   1722 C  C     . GLY A 1 222 ? -10.777 42.700 45.884 1.00 22.28 ? 222 GLY A C     1 
ATOM   1723 O  O     . GLY A 1 222 ? -9.780  43.029 45.261 1.00 24.35 ? 222 GLY A O     1 
ATOM   1724 N  N     . ALA A 1 223 ? -11.676 43.553 46.375 1.00 22.02 ? 223 ALA A N     1 
ATOM   1725 C  CA    . ALA A 1 223 ? -11.604 45.018 46.234 1.00 24.22 ? 223 ALA A CA    1 
ATOM   1726 C  C     . ALA A 1 223 ? -11.550 45.536 47.667 1.00 25.96 ? 223 ALA A C     1 
ATOM   1727 O  O     . ALA A 1 223 ? -12.132 44.935 48.578 1.00 28.26 ? 223 ALA A O     1 
ATOM   1728 C  CB    . ALA A 1 223 ? -12.836 45.564 45.527 1.00 22.92 ? 223 ALA A CB    1 
ATOM   1729 N  N     . GLN A 1 224 ? -10.865 46.649 47.877 1.00 27.42 ? 224 GLN A N     1 
ATOM   1730 C  CA    . GLN A 1 224 ? -10.717 47.201 49.216 1.00 30.03 ? 224 GLN A CA    1 
ATOM   1731 C  C     . GLN A 1 224 ? -9.998  46.181 50.137 1.00 30.72 ? 224 GLN A C     1 
ATOM   1732 O  O     . GLN A 1 224 ? -9.366  45.246 49.665 1.00 29.33 ? 224 GLN A O     1 
ATOM   1733 C  CB    . GLN A 1 224 ? -12.076 47.628 49.799 1.00 25.01 ? 224 GLN A CB    1 
ATOM   1734 C  CG    . GLN A 1 224 ? -12.647 48.894 49.220 1.00 28.62 ? 224 GLN A CG    1 
ATOM   1735 C  CD    . GLN A 1 224 ? -13.316 48.688 47.845 1.00 35.84 ? 224 GLN A CD    1 
ATOM   1736 O  OE1   . GLN A 1 224 ? -14.280 47.941 47.718 1.00 31.16 ? 224 GLN A OE1   1 
ATOM   1737 N  NE2   . GLN A 1 224 ? -12.812 49.382 46.816 1.00 34.44 ? 224 GLN A NE2   1 
ATOM   1738 N  N     . GLY A 1 225 ? -10.061 46.373 51.444 1.00 31.94 ? 225 GLY A N     1 
ATOM   1739 C  CA    . GLY A 1 225 ? -9.386  45.447 52.323 1.00 29.02 ? 225 GLY A CA    1 
ATOM   1740 C  C     . GLY A 1 225 ? -10.199 45.060 53.525 1.00 27.48 ? 225 GLY A C     1 
ATOM   1741 O  O     . GLY A 1 225 ? -11.192 45.718 53.835 1.00 29.65 ? 225 GLY A O     1 
ATOM   1742 N  N     . THR A 1 226 ? -9.774  43.983 54.184 1.00 27.82 ? 226 THR A N     1 
ATOM   1743 C  CA    . THR A 1 226 ? -10.437 43.440 55.362 1.00 27.91 ? 226 THR A CA    1 
ATOM   1744 C  C     . THR A 1 226 ? -10.962 44.462 56.359 1.00 30.37 ? 226 THR A C     1 
ATOM   1745 O  O     . THR A 1 226 ? -12.161 44.448 56.687 1.00 28.25 ? 226 THR A O     1 
ATOM   1746 C  CB    . THR A 1 226 ? -9.516  42.524 56.135 1.00 26.01 ? 226 THR A CB    1 
ATOM   1747 O  OG1   . THR A 1 226 ? -9.207  41.377 55.333 1.00 31.52 ? 226 THR A OG1   1 
ATOM   1748 C  CG2   . THR A 1 226 ? -10.172 42.100 57.449 1.00 25.60 ? 226 THR A CG2   1 
ATOM   1749 N  N     . LEU A 1 227 ? -10.085 45.364 56.810 1.00 29.67 ? 227 LEU A N     1 
ATOM   1750 C  CA    . LEU A 1 227 ? -10.494 46.344 57.813 1.00 30.29 ? 227 LEU A CA    1 
ATOM   1751 C  C     . LEU A 1 227 ? -11.450 47.437 57.373 1.00 27.92 ? 227 LEU A C     1 
ATOM   1752 O  O     . LEU A 1 227 ? -11.796 48.312 58.165 1.00 25.25 ? 227 LEU A O     1 
ATOM   1753 C  CB    . LEU A 1 227 ? -9.301  46.897 58.595 1.00 30.79 ? 227 LEU A CB    1 
ATOM   1754 C  CG    . LEU A 1 227 ? -8.662  45.911 59.590 1.00 29.52 ? 227 LEU A CG    1 
ATOM   1755 C  CD1   . LEU A 1 227 ? -7.471  46.576 60.265 1.00 32.57 ? 227 LEU A CD1   1 
ATOM   1756 C  CD2   . LEU A 1 227 ? -9.648  45.450 60.640 1.00 22.93 ? 227 LEU A CD2   1 
ATOM   1757 N  N     . LEU A 1 228 ? -11.880 47.363 56.109 1.00 25.73 ? 228 LEU A N     1 
ATOM   1758 C  CA    . LEU A 1 228 ? -12.865 48.284 55.542 1.00 24.12 ? 228 LEU A CA    1 
ATOM   1759 C  C     . LEU A 1 228 ? -14.192 47.542 55.347 1.00 22.35 ? 228 LEU A C     1 
ATOM   1760 O  O     . LEU A 1 228 ? -15.126 48.037 54.694 1.00 25.85 ? 228 LEU A O     1 
ATOM   1761 C  CB    . LEU A 1 228 ? -12.381 48.868 54.212 1.00 21.60 ? 228 LEU A CB    1 
ATOM   1762 C  CG    . LEU A 1 228 ? -11.171 49.791 54.301 1.00 17.18 ? 228 LEU A CG    1 
ATOM   1763 C  CD1   . LEU A 1 228 ? -10.768 50.201 52.896 1.00 22.07 ? 228 LEU A CD1   1 
ATOM   1764 C  CD2   . LEU A 1 228 ? -11.540 50.977 55.111 1.00 12.36 ? 228 LEU A CD2   1 
ATOM   1765 N  N     . ASP A 1 229 ? -14.255 46.341 55.893 1.00 20.27 ? 229 ASP A N     1 
ATOM   1766 C  CA    . ASP A 1 229 ? -15.445 45.505 55.831 1.00 22.22 ? 229 ASP A CA    1 
ATOM   1767 C  C     . ASP A 1 229 ? -16.612 46.170 56.592 1.00 22.15 ? 229 ASP A C     1 
ATOM   1768 O  O     . ASP A 1 229 ? -16.463 46.590 57.749 1.00 21.33 ? 229 ASP A O     1 
ATOM   1769 C  CB    . ASP A 1 229 ? -15.134 44.106 56.410 1.00 16.08 ? 229 ASP A CB    1 
ATOM   1770 C  CG    . ASP A 1 229 ? -16.286 43.144 56.259 1.00 14.71 ? 229 ASP A CG    1 
ATOM   1771 O  OD1   . ASP A 1 229 ? -16.204 42.275 55.377 1.00 12.27 ? 229 ASP A OD1   1 
ATOM   1772 O  OD2   . ASP A 1 229 ? -17.266 43.242 57.045 1.00 14.70 ? 229 ASP A OD2   1 
ATOM   1773 N  N     . ILE A 1 230 ? -17.759 46.272 55.920 1.00 23.41 ? 230 ILE A N     1 
ATOM   1774 C  CA    . ILE A 1 230 ? -18.943 46.886 56.516 1.00 22.69 ? 230 ILE A CA    1 
ATOM   1775 C  C     . ILE A 1 230 ? -19.307 46.320 57.900 1.00 25.15 ? 230 ILE A C     1 
ATOM   1776 O  O     . ILE A 1 230 ? -19.799 47.047 58.783 1.00 20.41 ? 230 ILE A O     1 
ATOM   1777 C  CB    . ILE A 1 230 ? -20.154 46.765 55.562 1.00 21.56 ? 230 ILE A CB    1 
ATOM   1778 C  CG1   . ILE A 1 230 ? -21.330 47.665 56.053 1.00 25.03 ? 230 ILE A CG1   1 
ATOM   1779 C  CG2   . ILE A 1 230 ? -20.541 45.285 55.376 1.00 13.34 ? 230 ILE A CG2   1 
ATOM   1780 C  CD1   . ILE A 1 230 ? -20.965 49.217 56.252 1.00 16.48 ? 230 ILE A CD1   1 
ATOM   1781 N  N     . ASP A 1 231 ? -19.062 45.021 58.083 1.00 27.69 ? 231 ASP A N     1 
ATOM   1782 C  CA    . ASP A 1 231 ? -19.380 44.317 59.333 1.00 28.75 ? 231 ASP A CA    1 
ATOM   1783 C  C     . ASP A 1 231 ? -18.184 44.246 60.270 1.00 26.72 ? 231 ASP A C     1 
ATOM   1784 O  O     . ASP A 1 231 ? -18.279 44.561 61.456 1.00 24.67 ? 231 ASP A O     1 
ATOM   1785 C  CB    . ASP A 1 231 ? -19.805 42.851 59.038 1.00 27.75 ? 231 ASP A CB    1 
ATOM   1786 C  CG    . ASP A 1 231 ? -21.276 42.702 58.663 1.00 30.54 ? 231 ASP A CG    1 
ATOM   1787 O  OD1   . ASP A 1 231 ? -22.131 42.695 59.574 1.00 29.17 ? 231 ASP A OD1   1 
ATOM   1788 O  OD2   . ASP A 1 231 ? -21.611 42.538 57.464 1.00 26.88 ? 231 ASP A OD2   1 
ATOM   1789 N  N     . HIS A 1 232 ? -17.062 43.816 59.714 1.00 25.61 ? 232 HIS A N     1 
ATOM   1790 C  CA    . HIS A 1 232 ? -15.865 43.591 60.502 1.00 25.43 ? 232 HIS A CA    1 
ATOM   1791 C  C     . HIS A 1 232 ? -14.802 44.680 60.543 1.00 29.27 ? 232 HIS A C     1 
ATOM   1792 O  O     . HIS A 1 232 ? -13.901 44.637 61.404 1.00 31.26 ? 232 HIS A O     1 
ATOM   1793 C  CB    . HIS A 1 232 ? -15.285 42.235 60.091 1.00 19.26 ? 232 HIS A CB    1 
ATOM   1794 C  CG    . HIS A 1 232 ? -16.306 41.126 60.094 1.00 24.59 ? 232 HIS A CG    1 
ATOM   1795 N  ND1   . HIS A 1 232 ? -16.480 40.304 61.174 1.00 25.37 ? 232 HIS A ND1   1 
ATOM   1796 C  CD2   . HIS A 1 232 ? -17.223 40.801 59.134 1.00 26.62 ? 232 HIS A CD2   1 
ATOM   1797 C  CE1   . HIS A 1 232 ? -17.490 39.506 60.859 1.00 25.43 ? 232 HIS A CE1   1 
ATOM   1798 N  NE2   . HIS A 1 232 ? -17.971 39.762 59.646 1.00 18.38 ? 232 HIS A NE2   1 
ATOM   1799 N  N     . GLY A 1 233 ? -14.924 45.674 59.657 1.00 28.75 ? 233 GLY A N     1 
ATOM   1800 C  CA    . GLY A 1 233 ? -13.968 46.773 59.629 1.00 27.43 ? 233 GLY A CA    1 
ATOM   1801 C  C     . GLY A 1 233 ? -14.236 47.863 60.674 1.00 30.83 ? 233 GLY A C     1 
ATOM   1802 O  O     . GLY A 1 233 ? -15.182 47.789 61.501 1.00 30.14 ? 233 GLY A O     1 
ATOM   1803 N  N     . THR A 1 234 ? -13.412 48.908 60.618 1.00 29.80 ? 234 THR A N     1 
ATOM   1804 C  CA    . THR A 1 234 ? -13.501 50.027 61.541 1.00 23.17 ? 234 THR A CA    1 
ATOM   1805 C  C     . THR A 1 234 ? -14.726 50.885 61.284 1.00 24.57 ? 234 THR A C     1 
ATOM   1806 O  O     . THR A 1 234 ? -14.631 52.093 60.995 1.00 19.62 ? 234 THR A O     1 
ATOM   1807 C  CB    . THR A 1 234 ? -12.197 50.848 61.538 1.00 22.32 ? 234 THR A CB    1 
ATOM   1808 O  OG1   . THR A 1 234 ? -11.971 51.440 60.238 1.00 18.53 ? 234 THR A OG1   1 
ATOM   1809 C  CG2   . THR A 1 234 ? -11.030 49.918 61.890 1.00 11.42 ? 234 THR A CG2   1 
ATOM   1810 N  N     . TYR A 1 235 ? -15.887 50.246 61.370 1.00 25.96 ? 235 TYR A N     1 
ATOM   1811 C  CA    . TYR A 1 235 ? -17.165 50.932 61.191 1.00 29.25 ? 235 TYR A CA    1 
ATOM   1812 C  C     . TYR A 1 235 ? -17.265 52.242 62.034 1.00 29.94 ? 235 TYR A C     1 
ATOM   1813 O  O     . TYR A 1 235 ? -16.833 52.286 63.200 1.00 35.22 ? 235 TYR A O     1 
ATOM   1814 C  CB    . TYR A 1 235 ? -18.293 49.987 61.629 1.00 22.11 ? 235 TYR A CB    1 
ATOM   1815 C  CG    . TYR A 1 235 ? -19.656 50.563 61.386 1.00 25.79 ? 235 TYR A CG    1 
ATOM   1816 C  CD1   . TYR A 1 235 ? -20.309 51.334 62.341 1.00 21.33 ? 235 TYR A CD1   1 
ATOM   1817 C  CD2   . TYR A 1 235 ? -20.304 50.334 60.196 1.00 27.10 ? 235 TYR A CD2   1 
ATOM   1818 C  CE1   . TYR A 1 235 ? -21.585 51.830 62.103 1.00 22.71 ? 235 TYR A CE1   1 
ATOM   1819 C  CE2   . TYR A 1 235 ? -21.566 50.839 59.959 1.00 26.16 ? 235 TYR A CE2   1 
ATOM   1820 C  CZ    . TYR A 1 235 ? -22.203 51.580 60.907 1.00 24.33 ? 235 TYR A CZ    1 
ATOM   1821 O  OH    . TYR A 1 235 ? -23.493 52.007 60.651 1.00 28.46 ? 235 TYR A OH    1 
ATOM   1822 N  N     . PRO A 1 236 ? -17.829 53.324 61.461 1.00 26.52 ? 236 PRO A N     1 
ATOM   1823 C  CA    . PRO A 1 236 ? -18.418 53.461 60.128 1.00 24.31 ? 236 PRO A CA    1 
ATOM   1824 C  C     . PRO A 1 236 ? -17.394 53.870 59.067 1.00 23.44 ? 236 PRO A C     1 
ATOM   1825 O  O     . PRO A 1 236 ? -17.772 54.207 57.947 1.00 25.40 ? 236 PRO A O     1 
ATOM   1826 C  CB    . PRO A 1 236 ? -19.385 54.608 60.328 1.00 23.52 ? 236 PRO A CB    1 
ATOM   1827 C  CG    . PRO A 1 236 ? -18.577 55.524 61.185 1.00 16.79 ? 236 PRO A CG    1 
ATOM   1828 C  CD    . PRO A 1 236 ? -18.078 54.552 62.246 1.00 23.73 ? 236 PRO A CD    1 
ATOM   1829 N  N     . TYR A 1 237 ? -16.115 53.861 59.417 1.00 21.58 ? 237 TYR A N     1 
ATOM   1830 C  CA    . TYR A 1 237 ? -15.090 54.275 58.497 1.00 20.41 ? 237 TYR A CA    1 
ATOM   1831 C  C     . TYR A 1 237 ? -14.702 53.052 57.700 1.00 23.32 ? 237 TYR A C     1 
ATOM   1832 O  O     . TYR A 1 237 ? -13.615 52.494 57.838 1.00 24.23 ? 237 TYR A O     1 
ATOM   1833 C  CB    . TYR A 1 237 ? -13.933 54.851 59.291 1.00 24.62 ? 237 TYR A CB    1 
ATOM   1834 C  CG    . TYR A 1 237 ? -14.274 56.203 59.833 1.00 26.52 ? 237 TYR A CG    1 
ATOM   1835 C  CD1   . TYR A 1 237 ? -14.408 57.288 58.966 1.00 33.02 ? 237 TYR A CD1   1 
ATOM   1836 C  CD2   . TYR A 1 237 ? -14.526 56.400 61.188 1.00 28.68 ? 237 TYR A CD2   1 
ATOM   1837 C  CE1   . TYR A 1 237 ? -14.788 58.541 59.420 1.00 34.96 ? 237 TYR A CE1   1 
ATOM   1838 C  CE2   . TYR A 1 237 ? -14.924 57.667 61.668 1.00 35.44 ? 237 TYR A CE2   1 
ATOM   1839 C  CZ    . TYR A 1 237 ? -15.046 58.726 60.764 1.00 39.18 ? 237 TYR A CZ    1 
ATOM   1840 O  OH    . TYR A 1 237 ? -15.425 59.967 61.181 1.00 45.67 ? 237 TYR A OH    1 
ATOM   1841 N  N     . VAL A 1 238 ? -15.628 52.626 56.863 1.00 22.92 ? 238 VAL A N     1 
ATOM   1842 C  CA    . VAL A 1 238 ? -15.422 51.435 56.076 1.00 22.77 ? 238 VAL A CA    1 
ATOM   1843 C  C     . VAL A 1 238 ? -16.112 51.582 54.726 1.00 24.27 ? 238 VAL A C     1 
ATOM   1844 O  O     . VAL A 1 238 ? -16.732 52.630 54.431 1.00 23.24 ? 238 VAL A O     1 
ATOM   1845 C  CB    . VAL A 1 238 ? -16.038 50.188 56.802 1.00 18.23 ? 238 VAL A CB    1 
ATOM   1846 C  CG1   . VAL A 1 238 ? -15.331 49.918 58.088 1.00 14.68 ? 238 VAL A CG1   1 
ATOM   1847 C  CG2   . VAL A 1 238 ? -17.518 50.393 57.061 1.00 13.96 ? 238 VAL A CG2   1 
ATOM   1848 N  N     . THR A 1 239 ? -15.998 50.535 53.912 1.00 21.28 ? 239 THR A N     1 
ATOM   1849 C  CA    . THR A 1 239 ? -16.659 50.551 52.628 1.00 25.62 ? 239 THR A CA    1 
ATOM   1850 C  C     . THR A 1 239 ? -17.956 49.827 52.934 1.00 23.98 ? 239 THR A C     1 
ATOM   1851 O  O     . THR A 1 239 ? -18.048 49.159 53.946 1.00 26.27 ? 239 THR A O     1 
ATOM   1852 C  CB    . THR A 1 239 ? -15.830 49.852 51.491 1.00 24.63 ? 239 THR A CB    1 
ATOM   1853 O  OG1   . THR A 1 239 ? -16.478 50.060 50.226 1.00 20.97 ? 239 THR A OG1   1 
ATOM   1854 C  CG2   . THR A 1 239 ? -15.682 48.381 51.757 1.00 20.64 ? 239 THR A CG2   1 
ATOM   1855 N  N     . SER A 1 240 ? -18.947 49.974 52.066 1.00 25.98 ? 240 SER A N     1 
ATOM   1856 C  CA    . SER A 1 240 ? -20.254 49.349 52.269 1.00 26.02 ? 240 SER A CA    1 
ATOM   1857 C  C     . SER A 1 240 ? -20.473 47.896 51.859 1.00 20.75 ? 240 SER A C     1 
ATOM   1858 O  O     . SER A 1 240 ? -21.602 47.445 51.832 1.00 23.92 ? 240 SER A O     1 
ATOM   1859 C  CB    . SER A 1 240 ? -21.322 50.232 51.646 1.00 25.29 ? 240 SER A CB    1 
ATOM   1860 O  OG    . SER A 1 240 ? -21.301 51.503 52.292 1.00 28.38 ? 240 SER A OG    1 
ATOM   1861 N  N     . SER A 1 241 ? -19.404 47.179 51.525 1.00 21.99 ? 241 SER A N     1 
ATOM   1862 C  CA    . SER A 1 241 ? -19.502 45.776 51.142 1.00 21.63 ? 241 SER A CA    1 
ATOM   1863 C  C     . SER A 1 241 ? -18.634 44.920 52.086 1.00 23.70 ? 241 SER A C     1 
ATOM   1864 O  O     . SER A 1 241 ? -17.864 45.444 52.891 1.00 20.50 ? 241 SER A O     1 
ATOM   1865 C  CB    . SER A 1 241 ? -19.035 45.604 49.703 1.00 19.69 ? 241 SER A CB    1 
ATOM   1866 O  OG    . SER A 1 241 ? -17.694 46.036 49.577 1.00 20.19 ? 241 SER A OG    1 
ATOM   1867 N  N     . ASN A 1 242 ? -18.835 43.606 52.064 1.00 27.66 ? 242 ASN A N     1 
ATOM   1868 C  CA    . ASN A 1 242 ? -18.030 42.704 52.897 1.00 24.28 ? 242 ASN A CA    1 
ATOM   1869 C  C     . ASN A 1 242 ? -16.806 42.382 52.056 1.00 19.45 ? 242 ASN A C     1 
ATOM   1870 O  O     . ASN A 1 242 ? -16.898 41.657 51.050 1.00 12.27 ? 242 ASN A O     1 
ATOM   1871 C  CB    . ASN A 1 242 ? -18.781 41.402 53.222 1.00 28.48 ? 242 ASN A CB    1 
ATOM   1872 C  CG    . ASN A 1 242 ? -19.867 41.586 54.272 1.00 30.90 ? 242 ASN A CG    1 
ATOM   1873 O  OD1   . ASN A 1 242 ? -21.051 41.594 53.954 1.00 33.02 ? 242 ASN A OD1   1 
ATOM   1874 N  ND2   . ASN A 1 242 ? -19.470 41.707 55.531 1.00 30.52 ? 242 ASN A ND2   1 
ATOM   1875 N  N     . THR A 1 243 ? -15.678 42.969 52.453 1.00 18.93 ? 243 THR A N     1 
ATOM   1876 C  CA    . THR A 1 243 ? -14.390 42.792 51.792 1.00 18.50 ? 243 THR A CA    1 
ATOM   1877 C  C     . THR A 1 243 ? -13.687 41.513 52.287 1.00 22.82 ? 243 THR A C     1 
ATOM   1878 O  O     . THR A 1 243 ? -12.601 41.124 51.800 1.00 21.61 ? 243 THR A O     1 
ATOM   1879 C  CB    . THR A 1 243 ? -13.501 44.009 52.053 1.00 17.18 ? 243 THR A CB    1 
ATOM   1880 O  OG1   . THR A 1 243 ? -13.244 44.119 53.454 1.00 20.13 ? 243 THR A OG1   1 
ATOM   1881 C  CG2   . THR A 1 243 ? -14.191 45.267 51.618 1.00 7.84  ? 243 THR A CG2   1 
ATOM   1882 N  N     . THR A 1 244 ? -14.304 40.868 53.275 1.00 25.25 ? 244 THR A N     1 
ATOM   1883 C  CA    . THR A 1 244 ? -13.793 39.638 53.832 1.00 26.85 ? 244 THR A CA    1 
ATOM   1884 C  C     . THR A 1 244 ? -14.227 38.453 52.919 1.00 28.99 ? 244 THR A C     1 
ATOM   1885 O  O     . THR A 1 244 ? -15.238 38.544 52.185 1.00 26.31 ? 244 THR A O     1 
ATOM   1886 C  CB    . THR A 1 244 ? -14.251 39.478 55.296 1.00 29.04 ? 244 THR A CB    1 
ATOM   1887 O  OG1   . THR A 1 244 ? -15.676 39.555 55.381 1.00 30.26 ? 244 THR A OG1   1 
ATOM   1888 C  CG2   . THR A 1 244 ? -13.661 40.593 56.180 1.00 26.59 ? 244 THR A CG2   1 
ATOM   1889 N  N     . ALA A 1 245 ? -13.439 37.370 52.941 1.00 26.90 ? 245 ALA A N     1 
ATOM   1890 C  CA    . ALA A 1 245 ? -13.686 36.202 52.100 1.00 27.10 ? 245 ALA A CA    1 
ATOM   1891 C  C     . ALA A 1 245 ? -15.136 35.756 51.980 1.00 27.89 ? 245 ALA A C     1 
ATOM   1892 O  O     . ALA A 1 245 ? -15.491 35.075 51.012 1.00 33.52 ? 245 ALA A O     1 
ATOM   1893 C  CB    . ALA A 1 245 ? -12.815 35.043 52.534 1.00 27.53 ? 245 ALA A CB    1 
ATOM   1894 N  N     . GLY A 1 246 ? -15.973 36.132 52.950 1.00 25.60 ? 246 GLY A N     1 
ATOM   1895 C  CA    . GLY A 1 246 ? -17.391 35.761 52.914 1.00 22.61 ? 246 GLY A CA    1 
ATOM   1896 C  C     . GLY A 1 246 ? -18.192 36.384 51.795 1.00 16.67 ? 246 GLY A C     1 
ATOM   1897 O  O     . GLY A 1 246 ? -19.270 35.885 51.450 1.00 16.65 ? 246 GLY A O     1 
ATOM   1898 N  N     . GLY A 1 247 ? -17.676 37.498 51.265 1.00 18.26 ? 247 GLY A N     1 
ATOM   1899 C  CA    . GLY A 1 247 ? -18.298 38.179 50.150 1.00 15.31 ? 247 GLY A CA    1 
ATOM   1900 C  C     . GLY A 1 247 ? -18.147 37.389 48.862 1.00 20.02 ? 247 GLY A C     1 
ATOM   1901 O  O     . GLY A 1 247 ? -18.954 37.544 47.947 1.00 22.88 ? 247 GLY A O     1 
ATOM   1902 N  N     . VAL A 1 248 ? -17.143 36.519 48.772 1.00 16.42 ? 248 VAL A N     1 
ATOM   1903 C  CA    . VAL A 1 248 ? -16.936 35.737 47.561 1.00 15.42 ? 248 VAL A CA    1 
ATOM   1904 C  C     . VAL A 1 248 ? -18.199 34.931 47.223 1.00 18.41 ? 248 VAL A C     1 
ATOM   1905 O  O     . VAL A 1 248 ? -18.753 35.058 46.153 1.00 22.45 ? 248 VAL A O     1 
ATOM   1906 C  CB    . VAL A 1 248 ? -15.688 34.815 47.707 1.00 14.37 ? 248 VAL A CB    1 
ATOM   1907 C  CG1   . VAL A 1 248 ? -15.641 33.793 46.588 1.00 11.18 ? 248 VAL A CG1   1 
ATOM   1908 C  CG2   . VAL A 1 248 ? -14.405 35.646 47.759 1.00 12.88 ? 248 VAL A CG2   1 
ATOM   1909 N  N     . ALA A 1 249 ? -18.641 34.087 48.149 1.00 21.25 ? 249 ALA A N     1 
ATOM   1910 C  CA    . ALA A 1 249 ? -19.822 33.275 47.935 1.00 18.25 ? 249 ALA A CA    1 
ATOM   1911 C  C     . ALA A 1 249 ? -21.065 34.167 47.835 1.00 21.42 ? 249 ALA A C     1 
ATOM   1912 O  O     . ALA A 1 249 ? -21.875 33.943 46.961 1.00 26.87 ? 249 ALA A O     1 
ATOM   1913 C  CB    . ALA A 1 249 ? -19.952 32.277 49.036 1.00 9.50  ? 249 ALA A CB    1 
ATOM   1914 N  N     . THR A 1 250 ? -21.220 35.202 48.672 1.00 22.55 ? 250 THR A N     1 
ATOM   1915 C  CA    . THR A 1 250 ? -22.406 36.076 48.552 1.00 17.77 ? 250 THR A CA    1 
ATOM   1916 C  C     . THR A 1 250 ? -22.409 36.900 47.231 1.00 18.19 ? 250 THR A C     1 
ATOM   1917 O  O     . THR A 1 250 ? -23.440 36.984 46.555 1.00 17.29 ? 250 THR A O     1 
ATOM   1918 C  CB    . THR A 1 250 ? -22.501 37.085 49.715 1.00 18.76 ? 250 THR A CB    1 
ATOM   1919 O  OG1   . THR A 1 250 ? -21.260 37.792 49.822 1.00 23.09 ? 250 THR A OG1   1 
ATOM   1920 C  CG2   . THR A 1 250 ? -22.821 36.385 51.037 1.00 8.62  ? 250 THR A CG2   1 
ATOM   1921 N  N     . GLY A 1 251 ? -21.278 37.507 46.889 1.00 13.19 ? 251 GLY A N     1 
ATOM   1922 C  CA    . GLY A 1 251 ? -21.176 38.292 45.671 1.00 17.59 ? 251 GLY A CA    1 
ATOM   1923 C  C     . GLY A 1 251 ? -20.816 37.555 44.372 1.00 20.06 ? 251 GLY A C     1 
ATOM   1924 O  O     . GLY A 1 251 ? -20.588 38.192 43.327 1.00 21.32 ? 251 GLY A O     1 
ATOM   1925 N  N     . SER A 1 252 ? -20.732 36.235 44.406 1.00 18.44 ? 252 SER A N     1 
ATOM   1926 C  CA    . SER A 1 252 ? -20.417 35.506 43.178 1.00 21.74 ? 252 SER A CA    1 
ATOM   1927 C  C     . SER A 1 252 ? -21.454 34.415 42.971 1.00 25.25 ? 252 SER A C     1 
ATOM   1928 O  O     . SER A 1 252 ? -21.724 34.028 41.830 1.00 25.13 ? 252 SER A O     1 
ATOM   1929 C  CB    . SER A 1 252 ? -19.052 34.849 43.246 1.00 15.45 ? 252 SER A CB    1 
ATOM   1930 O  OG    . SER A 1 252 ? -19.107 33.738 44.106 1.00 20.37 ? 252 SER A OG    1 
ATOM   1931 N  N     . GLY A 1 253 ? -22.035 33.921 44.066 1.00 23.77 ? 253 GLY A N     1 
ATOM   1932 C  CA    . GLY A 1 253 ? -23.039 32.883 43.979 1.00 18.70 ? 253 GLY A CA    1 
ATOM   1933 C  C     . GLY A 1 253 ? -22.428 31.506 44.047 1.00 17.89 ? 253 GLY A C     1 
ATOM   1934 O  O     . GLY A 1 253 ? -23.154 30.544 43.947 1.00 18.82 ? 253 GLY A O     1 
ATOM   1935 N  N     . LEU A 1 254 ? -21.104 31.407 44.166 1.00 20.28 ? 254 LEU A N     1 
ATOM   1936 C  CA    . LEU A 1 254 ? -20.434 30.119 44.289 1.00 21.72 ? 254 LEU A CA    1 
ATOM   1937 C  C     . LEU A 1 254 ? -20.576 29.669 45.760 1.00 24.05 ? 254 LEU A C     1 
ATOM   1938 O  O     . LEU A 1 254 ? -20.368 30.463 46.701 1.00 26.20 ? 254 LEU A O     1 
ATOM   1939 C  CB    . LEU A 1 254 ? -18.945 30.219 43.882 1.00 23.22 ? 254 LEU A CB    1 
ATOM   1940 C  CG    . LEU A 1 254 ? -18.096 28.908 44.003 1.00 23.21 ? 254 LEU A CG    1 
ATOM   1941 C  CD1   . LEU A 1 254 ? -18.415 27.852 42.979 1.00 7.83  ? 254 LEU A CD1   1 
ATOM   1942 C  CD2   . LEU A 1 254 ? -16.616 29.226 43.948 1.00 17.47 ? 254 LEU A CD2   1 
ATOM   1943 N  N     . GLY A 1 255 ? -20.914 28.399 45.965 1.00 20.26 ? 255 GLY A N     1 
ATOM   1944 C  CA    . GLY A 1 255 ? -21.083 27.922 47.307 1.00 18.12 ? 255 GLY A CA    1 
ATOM   1945 C  C     . GLY A 1 255 ? -19.805 28.063 48.126 1.00 22.75 ? 255 GLY A C     1 
ATOM   1946 O  O     . GLY A 1 255 ? -18.725 27.685 47.649 1.00 18.33 ? 255 GLY A O     1 
ATOM   1947 N  N     . PRO A 1 256 ? -19.905 28.536 49.391 1.00 24.12 ? 256 PRO A N     1 
ATOM   1948 C  CA    . PRO A 1 256 ? -18.779 28.737 50.325 1.00 25.46 ? 256 PRO A CA    1 
ATOM   1949 C  C     . PRO A 1 256 ? -17.834 27.544 50.475 1.00 25.64 ? 256 PRO A C     1 
ATOM   1950 O  O     . PRO A 1 256 ? -16.628 27.718 50.635 1.00 24.65 ? 256 PRO A O     1 
ATOM   1951 C  CB    . PRO A 1 256 ? -19.481 29.051 51.650 1.00 20.42 ? 256 PRO A CB    1 
ATOM   1952 C  CG    . PRO A 1 256 ? -20.849 28.427 51.471 1.00 22.66 ? 256 PRO A CG    1 
ATOM   1953 C  CD    . PRO A 1 256 ? -21.184 28.814 50.067 1.00 17.92 ? 256 PRO A CD    1 
ATOM   1954 N  N     . ARG A 1 257 ? -18.370 26.332 50.445 1.00 29.34 ? 257 ARG A N     1 
ATOM   1955 C  CA    . ARG A 1 257 ? -17.521 25.143 50.565 1.00 28.41 ? 257 ARG A CA    1 
ATOM   1956 C  C     . ARG A 1 257 ? -16.549 24.972 49.384 1.00 26.74 ? 257 ARG A C     1 
ATOM   1957 O  O     . ARG A 1 257 ? -15.623 24.185 49.455 1.00 29.59 ? 257 ARG A O     1 
ATOM   1958 C  CB    . ARG A 1 257 ? -18.363 23.872 50.744 1.00 25.17 ? 257 ARG A CB    1 
ATOM   1959 C  CG    . ARG A 1 257 ? -19.031 23.797 52.101 1.00 21.22 ? 257 ARG A CG    1 
ATOM   1960 C  CD    . ARG A 1 257 ? -19.482 22.396 52.394 1.00 26.07 ? 257 ARG A CD    1 
ATOM   1961 N  NE    . ARG A 1 257 ? -20.449 21.905 51.414 1.00 30.14 ? 257 ARG A NE    1 
ATOM   1962 C  CZ    . ARG A 1 257 ? -20.173 20.891 50.602 1.00 29.20 ? 257 ARG A CZ    1 
ATOM   1963 N  NH1   . ARG A 1 257 ? -18.992 20.295 50.669 1.00 33.60 ? 257 ARG A NH1   1 
ATOM   1964 N  NH2   . ARG A 1 257 ? -21.076 20.478 49.714 1.00 28.29 ? 257 ARG A NH2   1 
ATOM   1965 N  N     . TYR A 1 258 ? -16.735 25.713 48.306 1.00 24.68 ? 258 TYR A N     1 
ATOM   1966 C  CA    . TYR A 1 258 ? -15.843 25.568 47.191 1.00 25.98 ? 258 TYR A CA    1 
ATOM   1967 C  C     . TYR A 1 258 ? -14.694 26.578 47.125 1.00 29.12 ? 258 TYR A C     1 
ATOM   1968 O  O     . TYR A 1 258 ? -14.046 26.728 46.098 1.00 32.98 ? 258 TYR A O     1 
ATOM   1969 C  CB    . TYR A 1 258 ? -16.660 25.499 45.919 1.00 25.94 ? 258 TYR A CB    1 
ATOM   1970 C  CG    . TYR A 1 258 ? -17.727 24.427 46.007 1.00 19.53 ? 258 TYR A CG    1 
ATOM   1971 C  CD1   . TYR A 1 258 ? -17.411 23.141 46.345 1.00 20.93 ? 258 TYR A CD1   1 
ATOM   1972 C  CD2   . TYR A 1 258 ? -19.036 24.715 45.779 1.00 16.63 ? 258 TYR A CD2   1 
ATOM   1973 C  CE1   . TYR A 1 258 ? -18.364 22.188 46.450 1.00 18.62 ? 258 TYR A CE1   1 
ATOM   1974 C  CE2   . TYR A 1 258 ? -20.008 23.755 45.894 1.00 17.55 ? 258 TYR A CE2   1 
ATOM   1975 C  CZ    . TYR A 1 258 ? -19.661 22.507 46.236 1.00 18.21 ? 258 TYR A CZ    1 
ATOM   1976 O  OH    . TYR A 1 258 ? -20.617 21.554 46.439 1.00 25.62 ? 258 TYR A OH    1 
ATOM   1977 N  N     . VAL A 1 259 ? -14.445 27.299 48.205 1.00 29.47 ? 259 VAL A N     1 
ATOM   1978 C  CA    . VAL A 1 259 ? -13.299 28.214 48.229 1.00 32.18 ? 259 VAL A CA    1 
ATOM   1979 C  C     . VAL A 1 259 ? -12.128 27.290 48.628 1.00 33.56 ? 259 VAL A C     1 
ATOM   1980 O  O     . VAL A 1 259 ? -12.197 26.570 49.632 1.00 36.72 ? 259 VAL A O     1 
ATOM   1981 C  CB    . VAL A 1 259 ? -13.477 29.307 49.296 1.00 33.33 ? 259 VAL A CB    1 
ATOM   1982 C  CG1   . VAL A 1 259 ? -12.177 30.066 49.488 1.00 36.48 ? 259 VAL A CG1   1 
ATOM   1983 C  CG2   . VAL A 1 259 ? -14.609 30.277 48.874 1.00 30.37 ? 259 VAL A CG2   1 
ATOM   1984 N  N     . ASP A 1 260 ? -11.046 27.295 47.876 1.00 30.79 ? 260 ASP A N     1 
ATOM   1985 C  CA    . ASP A 1 260 ? -9.982  26.373 48.215 1.00 28.67 ? 260 ASP A CA    1 
ATOM   1986 C  C     . ASP A 1 260 ? -8.770  26.944 48.969 1.00 29.96 ? 260 ASP A C     1 
ATOM   1987 O  O     . ASP A 1 260 ? -8.220  26.301 49.888 1.00 27.98 ? 260 ASP A O     1 
ATOM   1988 C  CB    . ASP A 1 260 ? -9.547  25.661 46.928 1.00 26.76 ? 260 ASP A CB    1 
ATOM   1989 C  CG    . ASP A 1 260 ? -10.623 24.737 46.402 1.00 29.55 ? 260 ASP A CG    1 
ATOM   1990 O  OD1   . ASP A 1 260 ? -11.077 23.857 47.159 1.00 29.79 ? 260 ASP A OD1   1 
ATOM   1991 O  OD2   . ASP A 1 260 ? -11.029 24.901 45.233 1.00 35.54 ? 260 ASP A OD2   1 
ATOM   1992 N  N     . TYR A 1 261 ? -8.373  28.155 48.580 1.00 28.18 ? 261 TYR A N     1 
ATOM   1993 C  CA    . TYR A 1 261 ? -7.213  28.831 49.147 1.00 26.12 ? 261 TYR A CA    1 
ATOM   1994 C  C     . TYR A 1 261 ? -7.557  30.296 49.154 1.00 27.16 ? 261 TYR A C     1 
ATOM   1995 O  O     . TYR A 1 261 ? -8.102  30.804 48.168 1.00 30.96 ? 261 TYR A O     1 
ATOM   1996 C  CB    . TYR A 1 261 ? -6.028  28.614 48.212 1.00 24.03 ? 261 TYR A CB    1 
ATOM   1997 C  CG    . TYR A 1 261 ? -4.692  29.169 48.682 1.00 26.57 ? 261 TYR A CG    1 
ATOM   1998 C  CD1   . TYR A 1 261 ? -4.356  30.490 48.447 1.00 26.54 ? 261 TYR A CD1   1 
ATOM   1999 C  CD2   . TYR A 1 261 ? -3.741  28.347 49.309 1.00 28.33 ? 261 TYR A CD2   1 
ATOM   2000 C  CE1   . TYR A 1 261 ? -3.119  30.990 48.816 1.00 23.39 ? 261 TYR A CE1   1 
ATOM   2001 C  CE2   . TYR A 1 261 ? -2.507  28.840 49.681 1.00 26.90 ? 261 TYR A CE2   1 
ATOM   2002 C  CZ    . TYR A 1 261 ? -2.206  30.162 49.430 1.00 26.60 ? 261 TYR A CZ    1 
ATOM   2003 O  OH    . TYR A 1 261 ? -1.007  30.688 49.799 1.00 28.97 ? 261 TYR A OH    1 
ATOM   2004 N  N     . VAL A 1 262 ? -7.294  30.957 50.285 1.00 25.45 ? 262 VAL A N     1 
ATOM   2005 C  CA    . VAL A 1 262 ? -7.542  32.391 50.414 1.00 22.65 ? 262 VAL A CA    1 
ATOM   2006 C  C     . VAL A 1 262 ? -6.173  33.009 50.503 1.00 26.56 ? 262 VAL A C     1 
ATOM   2007 O  O     . VAL A 1 262 ? -5.431  32.739 51.452 1.00 30.45 ? 262 VAL A O     1 
ATOM   2008 C  CB    . VAL A 1 262 ? -8.324  32.780 51.699 1.00 18.61 ? 262 VAL A CB    1 
ATOM   2009 C  CG1   . VAL A 1 262 ? -8.484  34.277 51.737 1.00 20.23 ? 262 VAL A CG1   1 
ATOM   2010 C  CG2   . VAL A 1 262 ? -9.710  32.121 51.727 1.00 18.65 ? 262 VAL A CG2   1 
ATOM   2011 N  N     . LEU A 1 263 ? -5.792  33.775 49.488 1.00 29.35 ? 263 LEU A N     1 
ATOM   2012 C  CA    . LEU A 1 263 ? -4.494  34.433 49.496 1.00 29.15 ? 263 LEU A CA    1 
ATOM   2013 C  C     . LEU A 1 263 ? -4.745  35.870 49.964 1.00 26.57 ? 263 LEU A C     1 
ATOM   2014 O  O     . LEU A 1 263 ? -5.617  36.546 49.443 1.00 29.63 ? 263 LEU A O     1 
ATOM   2015 C  CB    . LEU A 1 263 ? -3.884  34.392 48.093 1.00 33.48 ? 263 LEU A CB    1 
ATOM   2016 C  CG    . LEU A 1 263 ? -2.370  34.544 47.838 1.00 35.27 ? 263 LEU A CG    1 
ATOM   2017 C  CD1   . LEU A 1 263 ? -2.062  35.924 47.330 1.00 36.18 ? 263 LEU A CD1   1 
ATOM   2018 C  CD2   . LEU A 1 263 ? -1.561  34.216 49.077 1.00 34.01 ? 263 LEU A CD2   1 
ATOM   2019 N  N     . GLY A 1 264 ? -4.030  36.310 50.992 1.00 22.08 ? 264 GLY A N     1 
ATOM   2020 C  CA    . GLY A 1 264 ? -4.212  37.663 51.489 1.00 21.27 ? 264 GLY A CA    1 
ATOM   2021 C  C     . GLY A 1 264 ? -3.023  38.529 51.090 1.00 24.30 ? 264 GLY A C     1 
ATOM   2022 O  O     . GLY A 1 264 ? -1.841  38.115 51.254 1.00 23.70 ? 264 GLY A O     1 
ATOM   2023 N  N     . ILE A 1 265 ? -3.294  39.702 50.527 1.00 19.90 ? 265 ILE A N     1 
ATOM   2024 C  CA    . ILE A 1 265 ? -2.217  40.558 50.081 1.00 20.45 ? 265 ILE A CA    1 
ATOM   2025 C  C     . ILE A 1 265 ? -1.828  41.374 51.265 1.00 22.47 ? 265 ILE A C     1 
ATOM   2026 O  O     . ILE A 1 265 ? -2.691  41.953 51.920 1.00 20.08 ? 265 ILE A O     1 
ATOM   2027 C  CB    . ILE A 1 265 ? -2.618  41.443 48.916 1.00 20.78 ? 265 ILE A CB    1 
ATOM   2028 C  CG1   . ILE A 1 265 ? -3.244  40.609 47.794 1.00 20.82 ? 265 ILE A CG1   1 
ATOM   2029 C  CG2   . ILE A 1 265 ? -1.414  42.125 48.348 1.00 19.16 ? 265 ILE A CG2   1 
ATOM   2030 C  CD1   . ILE A 1 265 ? -2.514  39.326 47.481 1.00 18.89 ? 265 ILE A CD1   1 
ATOM   2031 N  N     . LEU A 1 266 ? -0.516  41.406 51.531 1.00 25.80 ? 266 LEU A N     1 
ATOM   2032 C  CA    . LEU A 1 266 ? 0.082   42.073 52.684 1.00 27.53 ? 266 LEU A CA    1 
ATOM   2033 C  C     . LEU A 1 266 ? 1.190   43.029 52.224 1.00 30.83 ? 266 LEU A C     1 
ATOM   2034 O  O     . LEU A 1 266 ? 2.229   42.565 51.728 1.00 30.90 ? 266 LEU A O     1 
ATOM   2035 C  CB    . LEU A 1 266 ? 0.686   40.986 53.583 1.00 24.63 ? 266 LEU A CB    1 
ATOM   2036 C  CG    . LEU A 1 266 ? 1.068   41.301 55.022 1.00 21.19 ? 266 LEU A CG    1 
ATOM   2037 C  CD1   . LEU A 1 266 ? -0.157  41.592 55.812 1.00 21.56 ? 266 LEU A CD1   1 
ATOM   2038 C  CD2   . LEU A 1 266 ? 1.787   40.143 55.610 1.00 20.94 ? 266 LEU A CD2   1 
ATOM   2039 N  N     . LYS A 1 267 ? 0.995   44.335 52.443 1.00 32.89 ? 267 LYS A N     1 
ATOM   2040 C  CA    . LYS A 1 267 ? 1.920   45.400 52.031 1.00 34.67 ? 267 LYS A CA    1 
ATOM   2041 C  C     . LYS A 1 267 ? 3.293   45.575 52.688 1.00 38.99 ? 267 LYS A C     1 
ATOM   2042 O  O     . LYS A 1 267 ? 4.071   46.444 52.276 1.00 45.04 ? 267 LYS A O     1 
ATOM   2043 C  CB    . LYS A 1 267 ? 1.198   46.755 52.063 1.00 31.19 ? 267 LYS A CB    1 
ATOM   2044 C  CG    . LYS A 1 267 ? 1.956   47.912 51.398 1.00 29.64 ? 267 LYS A CG    1 
ATOM   2045 C  CD    . LYS A 1 267 ? 1.200   49.207 51.437 1.00 36.46 ? 267 LYS A CD    1 
ATOM   2046 C  CE    . LYS A 1 267 ? 0.113   49.224 50.387 1.00 39.16 ? 267 LYS A CE    1 
ATOM   2047 N  NZ    . LYS A 1 267 ? -0.533  50.581 50.216 1.00 38.87 ? 267 LYS A NZ    1 
ATOM   2048 N  N     . ALA A 1 268 ? 3.623   44.808 53.711 1.00 39.81 ? 268 ALA A N     1 
ATOM   2049 C  CA    . ALA A 1 268 ? 4.941   44.978 54.359 1.00 38.10 ? 268 ALA A CA    1 
ATOM   2050 C  C     . ALA A 1 268 ? 5.051   46.289 55.174 1.00 35.12 ? 268 ALA A C     1 
ATOM   2051 O  O     . ALA A 1 268 ? 5.947   46.439 56.017 1.00 29.47 ? 268 ALA A O     1 
ATOM   2052 C  CB    . ALA A 1 268 ? 6.084   44.849 53.337 1.00 35.39 ? 268 ALA A CB    1 
ATOM   2053 N  N     . TYR A 1 269 ? 4.132   47.219 54.933 1.00 33.20 ? 269 TYR A N     1 
ATOM   2054 C  CA    . TYR A 1 269 ? 4.018   48.468 55.686 1.00 35.97 ? 269 TYR A CA    1 
ATOM   2055 C  C     . TYR A 1 269 ? 2.556   48.871 55.460 1.00 37.13 ? 269 TYR A C     1 
ATOM   2056 O  O     . TYR A 1 269 ? 1.944   48.385 54.510 1.00 39.04 ? 269 TYR A O     1 
ATOM   2057 C  CB    . TYR A 1 269 ? 5.027   49.544 55.247 1.00 31.89 ? 269 TYR A CB    1 
ATOM   2058 C  CG    . TYR A 1 269 ? 4.838   50.043 53.859 1.00 30.02 ? 269 TYR A CG    1 
ATOM   2059 C  CD1   . TYR A 1 269 ? 4.100   51.182 53.610 1.00 29.24 ? 269 TYR A CD1   1 
ATOM   2060 C  CD2   . TYR A 1 269 ? 5.418   49.379 52.775 1.00 29.01 ? 269 TYR A CD2   1 
ATOM   2061 C  CE1   . TYR A 1 269 ? 3.936   51.661 52.304 1.00 33.22 ? 269 TYR A CE1   1 
ATOM   2062 C  CE2   . TYR A 1 269 ? 5.265   49.839 51.473 1.00 28.22 ? 269 TYR A CE2   1 
ATOM   2063 C  CZ    . TYR A 1 269 ? 4.532   50.986 51.237 1.00 29.73 ? 269 TYR A CZ    1 
ATOM   2064 O  OH    . TYR A 1 269 ? 4.435   51.470 49.955 1.00 32.37 ? 269 TYR A OH    1 
ATOM   2065 N  N     . SER A 1 270 ? 1.995   49.746 56.288 1.00 35.71 ? 270 SER A N     1 
ATOM   2066 C  CA    . SER A 1 270 ? 0.586   50.065 56.162 1.00 32.19 ? 270 SER A CA    1 
ATOM   2067 C  C     . SER A 1 270 ? 0.194   51.403 55.549 1.00 32.72 ? 270 SER A C     1 
ATOM   2068 O  O     . SER A 1 270 ? 0.910   52.382 55.671 1.00 31.11 ? 270 SER A O     1 
ATOM   2069 C  CB    . SER A 1 270 ? -0.073  49.921 57.547 1.00 34.66 ? 270 SER A CB    1 
ATOM   2070 O  OG    . SER A 1 270 ? 0.257   48.676 58.170 1.00 27.78 ? 270 SER A OG    1 
ATOM   2071 N  N     . THR A 1 271 ? -0.986  51.444 54.929 1.00 34.03 ? 271 THR A N     1 
ATOM   2072 C  CA    . THR A 1 271 ? -1.516  52.665 54.317 1.00 31.92 ? 271 THR A CA    1 
ATOM   2073 C  C     . THR A 1 271 ? -3.028  52.708 54.487 1.00 30.70 ? 271 THR A C     1 
ATOM   2074 O  O     . THR A 1 271 ? -3.665  51.675 54.691 1.00 30.46 ? 271 THR A O     1 
ATOM   2075 C  CB    . THR A 1 271 ? -1.193  52.813 52.773 1.00 30.05 ? 271 THR A CB    1 
ATOM   2076 O  OG1   . THR A 1 271 ? -1.876  51.797 52.008 1.00 31.23 ? 271 THR A OG1   1 
ATOM   2077 C  CG2   . THR A 1 271 ? 0.324   52.744 52.500 1.00 27.64 ? 271 THR A CG2   1 
ATOM   2078 N  N     . ARG A 1 272 ? -3.579  53.914 54.433 1.00 26.56 ? 272 ARG A N     1 
ATOM   2079 C  CA    . ARG A 1 272 ? -5.005  54.132 54.539 1.00 28.22 ? 272 ARG A CA    1 
ATOM   2080 C  C     . ARG A 1 272 ? -5.300  55.436 53.813 1.00 28.81 ? 272 ARG A C     1 
ATOM   2081 O  O     . ARG A 1 272 ? -4.522  56.366 53.853 1.00 30.04 ? 272 ARG A O     1 
ATOM   2082 C  CB    . ARG A 1 272 ? -5.449  54.345 55.996 1.00 33.93 ? 272 ARG A CB    1 
ATOM   2083 C  CG    . ARG A 1 272 ? -6.122  53.185 56.694 1.00 31.58 ? 272 ARG A CG    1 
ATOM   2084 C  CD    . ARG A 1 272 ? -6.935  53.655 57.915 1.00 32.82 ? 272 ARG A CD    1 
ATOM   2085 N  NE    . ARG A 1 272 ? -8.341  53.944 57.579 1.00 33.99 ? 272 ARG A NE    1 
ATOM   2086 C  CZ    . ARG A 1 272 ? -9.372  53.411 58.244 1.00 27.98 ? 272 ARG A CZ    1 
ATOM   2087 N  NH1   . ARG A 1 272 ? -9.196  52.597 59.277 1.00 32.22 ? 272 ARG A NH1   1 
ATOM   2088 N  NH2   . ARG A 1 272 ? -10.589 53.623 57.822 1.00 27.08 ? 272 ARG A NH2   1 
ATOM   2089 N  N     . VAL A 1 273 ? -6.428  55.477 53.136 1.00 31.13 ? 273 VAL A N     1 
ATOM   2090 C  CA    . VAL A 1 273 ? -6.934  56.671 52.488 1.00 32.82 ? 273 VAL A CA    1 
ATOM   2091 C  C     . VAL A 1 273 ? -8.332  56.676 53.084 1.00 34.07 ? 273 VAL A C     1 
ATOM   2092 O  O     . VAL A 1 273 ? -9.036  55.632 53.064 1.00 36.29 ? 273 VAL A O     1 
ATOM   2093 C  CB    . VAL A 1 273 ? -7.023  56.592 50.959 1.00 32.68 ? 273 VAL A CB    1 
ATOM   2094 C  CG1   . VAL A 1 273 ? -5.875  57.400 50.376 1.00 40.99 ? 273 VAL A CG1   1 
ATOM   2095 C  CG2   . VAL A 1 273 ? -6.940  55.186 50.483 1.00 33.22 ? 273 VAL A CG2   1 
ATOM   2096 N  N     . GLY A 1 274 ? -8.696  57.792 53.703 1.00 31.98 ? 274 GLY A N     1 
ATOM   2097 C  CA    . GLY A 1 274 ? -10.004 57.893 54.320 1.00 31.47 ? 274 GLY A CA    1 
ATOM   2098 C  C     . GLY A 1 274 ? -9.778  58.030 55.805 1.00 32.78 ? 274 GLY A C     1 
ATOM   2099 O  O     . GLY A 1 274 ? -8.677  57.727 56.324 1.00 30.09 ? 274 GLY A O     1 
ATOM   2100 N  N     . ALA A 1 275 ? -10.808 58.495 56.503 1.00 33.32 ? 275 ALA A N     1 
ATOM   2101 C  CA    . ALA A 1 275 ? -10.698 58.703 57.929 1.00 33.62 ? 275 ALA A CA    1 
ATOM   2102 C  C     . ALA A 1 275 ? -10.669 57.354 58.633 1.00 33.87 ? 275 ALA A C     1 
ATOM   2103 O  O     . ALA A 1 275 ? -10.878 56.303 57.993 1.00 32.54 ? 275 ALA A O     1 
ATOM   2104 C  CB    . ALA A 1 275 ? -11.864 59.496 58.390 1.00 33.22 ? 275 ALA A CB    1 
ATOM   2105 N  N     . GLY A 1 276 ? -10.331 57.364 59.920 1.00 27.52 ? 276 GLY A N     1 
ATOM   2106 C  CA    . GLY A 1 276 ? -10.370 56.126 60.648 1.00 31.13 ? 276 GLY A CA    1 
ATOM   2107 C  C     . GLY A 1 276 ? -9.156  55.707 61.433 1.00 32.39 ? 276 GLY A C     1 
ATOM   2108 O  O     . GLY A 1 276 ? -8.021  56.147 61.156 1.00 36.45 ? 276 GLY A O     1 
ATOM   2109 N  N     . PRO A 1 277 ? -9.367  54.781 62.383 1.00 27.36 ? 277 PRO A N     1 
ATOM   2110 C  CA    . PRO A 1 277 ? -8.325  54.242 63.248 1.00 27.69 ? 277 PRO A CA    1 
ATOM   2111 C  C     . PRO A 1 277 ? -7.153  53.786 62.420 1.00 29.01 ? 277 PRO A C     1 
ATOM   2112 O  O     . PRO A 1 277 ? -7.339  53.292 61.309 1.00 28.30 ? 277 PRO A O     1 
ATOM   2113 C  CB    . PRO A 1 277 ? -9.004  53.026 63.884 1.00 26.34 ? 277 PRO A CB    1 
ATOM   2114 C  CG    . PRO A 1 277 ? -10.441 53.426 63.933 1.00 28.60 ? 277 PRO A CG    1 
ATOM   2115 C  CD    . PRO A 1 277 ? -10.660 54.110 62.615 1.00 24.56 ? 277 PRO A CD    1 
ATOM   2116 N  N     . PHE A 1 278 ? -5.960  53.921 62.989 1.00 29.20 ? 278 PHE A N     1 
ATOM   2117 C  CA    . PHE A 1 278 ? -4.734  53.496 62.343 1.00 29.07 ? 278 PHE A CA    1 
ATOM   2118 C  C     . PHE A 1 278 ? -3.617  53.631 63.404 1.00 31.96 ? 278 PHE A C     1 
ATOM   2119 O  O     . PHE A 1 278 ? -2.828  54.588 63.408 1.00 25.94 ? 278 PHE A O     1 
ATOM   2120 C  CB    . PHE A 1 278 ? -4.486  54.360 61.104 1.00 31.86 ? 278 PHE A CB    1 
ATOM   2121 C  CG    . PHE A 1 278 ? -3.399  53.848 60.221 1.00 31.01 ? 278 PHE A CG    1 
ATOM   2122 C  CD1   . PHE A 1 278 ? -2.798  52.625 60.467 1.00 28.89 ? 278 PHE A CD1   1 
ATOM   2123 C  CD2   . PHE A 1 278 ? -2.941  54.611 59.173 1.00 29.98 ? 278 PHE A CD2   1 
ATOM   2124 C  CE1   . PHE A 1 278 ? -1.759  52.188 59.676 1.00 34.88 ? 278 PHE A CE1   1 
ATOM   2125 C  CE2   . PHE A 1 278 ? -1.905  54.179 58.386 1.00 28.41 ? 278 PHE A CE2   1 
ATOM   2126 C  CZ    . PHE A 1 278 ? -1.312  52.977 58.635 1.00 35.01 ? 278 PHE A CZ    1 
ATOM   2127 N  N     . PRO A 1 279 ? -3.538  52.635 64.314 1.00 33.46 ? 279 PRO A N     1 
ATOM   2128 C  CA    . PRO A 1 279 ? -2.558  52.587 65.413 1.00 31.94 ? 279 PRO A CA    1 
ATOM   2129 C  C     . PRO A 1 279 ? -1.109  52.785 65.036 1.00 32.07 ? 279 PRO A C     1 
ATOM   2130 O  O     . PRO A 1 279 ? -0.382  53.530 65.703 1.00 33.85 ? 279 PRO A O     1 
ATOM   2131 C  CB    . PRO A 1 279 ? -2.800  51.207 66.041 1.00 31.16 ? 279 PRO A CB    1 
ATOM   2132 C  CG    . PRO A 1 279 ? -4.285  51.024 65.820 1.00 35.02 ? 279 PRO A CG    1 
ATOM   2133 C  CD    . PRO A 1 279 ? -4.410  51.448 64.354 1.00 31.07 ? 279 PRO A CD    1 
ATOM   2134 N  N     . THR A 1 280 ? -0.684  52.118 63.974 1.00 31.65 ? 280 THR A N     1 
ATOM   2135 C  CA    . THR A 1 280 ? 0.703   52.214 63.563 1.00 30.57 ? 280 THR A CA    1 
ATOM   2136 C  C     . THR A 1 280 ? 0.975   53.356 62.604 1.00 31.08 ? 280 THR A C     1 
ATOM   2137 O  O     . THR A 1 280 ? 2.039   53.382 61.966 1.00 27.02 ? 280 THR A O     1 
ATOM   2138 C  CB    . THR A 1 280 ? 1.182   50.891 62.936 1.00 32.17 ? 280 THR A CB    1 
ATOM   2139 O  OG1   . THR A 1 280 ? 0.272   50.501 61.906 1.00 34.16 ? 280 THR A OG1   1 
ATOM   2140 C  CG2   . THR A 1 280 ? 1.252   49.784 63.980 1.00 24.15 ? 280 THR A CG2   1 
ATOM   2141 N  N     . GLU A 1 281 ? 0.025   54.287 62.477 1.00 31.24 ? 281 GLU A N     1 
ATOM   2142 C  CA    . GLU A 1 281 ? 0.212   55.411 61.573 1.00 31.34 ? 281 GLU A CA    1 
ATOM   2143 C  C     . GLU A 1 281 ? 1.474   56.130 62.010 1.00 36.43 ? 281 GLU A C     1 
ATOM   2144 O  O     . GLU A 1 281 ? 1.821   56.159 63.205 1.00 39.59 ? 281 GLU A O     1 
ATOM   2145 C  CB    . GLU A 1 281 ? -0.977  56.360 61.623 1.00 27.98 ? 281 GLU A CB    1 
ATOM   2146 C  CG    . GLU A 1 281 ? -0.954  57.492 60.591 1.00 26.61 ? 281 GLU A CG    1 
ATOM   2147 C  CD    . GLU A 1 281 ? -2.233  58.334 60.613 1.00 31.83 ? 281 GLU A CD    1 
ATOM   2148 O  OE1   . GLU A 1 281 ? -2.538  59.005 59.597 1.00 32.07 ? 281 GLU A OE1   1 
ATOM   2149 O  OE2   . GLU A 1 281 ? -2.971  58.315 61.629 1.00 33.12 ? 281 GLU A OE2   1 
ATOM   2150 N  N     . LEU A 1 282 ? 2.207   56.644 61.030 1.00 38.94 ? 282 LEU A N     1 
ATOM   2151 C  CA    . LEU A 1 282 ? 3.430   57.375 61.299 1.00 36.48 ? 282 LEU A CA    1 
ATOM   2152 C  C     . LEU A 1 282 ? 3.201   58.767 60.776 1.00 36.88 ? 282 LEU A C     1 
ATOM   2153 O  O     . LEU A 1 282 ? 2.464   58.938 59.806 1.00 37.86 ? 282 LEU A O     1 
ATOM   2154 C  CB    . LEU A 1 282 ? 4.622   56.732 60.585 1.00 35.67 ? 282 LEU A CB    1 
ATOM   2155 C  CG    . LEU A 1 282 ? 5.114   55.433 61.221 1.00 35.93 ? 282 LEU A CG    1 
ATOM   2156 C  CD1   . LEU A 1 282 ? 6.341   54.920 60.486 1.00 35.64 ? 282 LEU A CD1   1 
ATOM   2157 C  CD2   . LEU A 1 282 ? 5.423   55.633 62.688 1.00 31.32 ? 282 LEU A CD2   1 
ATOM   2158 N  N     . PHE A 1 283 ? 3.806   59.753 61.439 1.00 36.20 ? 283 PHE A N     1 
ATOM   2159 C  CA    . PHE A 1 283 ? 3.702   61.151 61.047 1.00 38.74 ? 283 PHE A CA    1 
ATOM   2160 C  C     . PHE A 1 283 ? 5.091   61.767 60.945 1.00 42.89 ? 283 PHE A C     1 
ATOM   2161 O  O     . PHE A 1 283 ? 5.241   62.978 60.715 1.00 46.53 ? 283 PHE A O     1 
ATOM   2162 C  CB    . PHE A 1 283 ? 2.881   61.935 62.063 1.00 30.61 ? 283 PHE A CB    1 
ATOM   2163 C  CG    . PHE A 1 283 ? 1.577   61.308 62.391 1.00 24.23 ? 283 PHE A CG    1 
ATOM   2164 C  CD1   . PHE A 1 283 ? 0.396   61.879 61.951 1.00 22.54 ? 283 PHE A CD1   1 
ATOM   2165 C  CD2   . PHE A 1 283 ? 1.534   60.149 63.160 1.00 26.39 ? 283 PHE A CD2   1 
ATOM   2166 C  CE1   . PHE A 1 283 ? -0.827  61.309 62.272 1.00 20.13 ? 283 PHE A CE1   1 
ATOM   2167 C  CE2   . PHE A 1 283 ? 0.328   59.565 63.496 1.00 28.16 ? 283 PHE A CE2   1 
ATOM   2168 C  CZ    . PHE A 1 283 ? -0.869  60.150 63.046 1.00 21.69 ? 283 PHE A CZ    1 
ATOM   2169 N  N     . ASP A 1 284 ? 6.100   60.920 61.052 1.00 43.71 ? 284 ASP A N     1 
ATOM   2170 C  CA    . ASP A 1 284 ? 7.467   61.371 61.020 1.00 44.85 ? 284 ASP A CA    1 
ATOM   2171 C  C     . ASP A 1 284 ? 8.189   61.121 59.679 1.00 46.59 ? 284 ASP A C     1 
ATOM   2172 O  O     . ASP A 1 284 ? 7.586   60.724 58.681 1.00 45.60 ? 284 ASP A O     1 
ATOM   2173 C  CB    . ASP A 1 284 ? 8.198   60.659 62.151 1.00 41.13 ? 284 ASP A CB    1 
ATOM   2174 C  CG    . ASP A 1 284 ? 8.285   59.195 61.925 1.00 39.14 ? 284 ASP A CG    1 
ATOM   2175 O  OD1   . ASP A 1 284 ? 8.840   58.474 62.780 1.00 39.69 ? 284 ASP A OD1   1 
ATOM   2176 O  OD2   . ASP A 1 284 ? 7.794   58.764 60.864 1.00 43.27 ? 284 ASP A OD2   1 
ATOM   2177 N  N     . GLU A 1 285 ? 9.500   61.333 59.695 1.00 49.50 ? 285 GLU A N     1 
ATOM   2178 C  CA    . GLU A 1 285 ? 10.341  61.154 58.523 1.00 49.25 ? 285 GLU A CA    1 
ATOM   2179 C  C     . GLU A 1 285 ? 10.062  59.822 57.851 1.00 49.83 ? 285 GLU A C     1 
ATOM   2180 O  O     . GLU A 1 285 ? 9.676   59.791 56.686 1.00 55.22 ? 285 GLU A O     1 
ATOM   2181 C  CB    . GLU A 1 285 ? 11.823  61.220 58.897 1.00 52.91 ? 285 GLU A CB    1 
ATOM   2182 C  CG    . GLU A 1 285 ? 12.183  62.318 59.889 1.00 61.78 ? 285 GLU A CG    1 
ATOM   2183 C  CD    . GLU A 1 285 ? 13.089  63.380 59.296 1.00 64.32 ? 285 GLU A CD    1 
ATOM   2184 O  OE1   . GLU A 1 285 ? 12.768  64.581 59.458 1.00 68.69 ? 285 GLU A OE1   1 
ATOM   2185 O  OE2   . GLU A 1 285 ? 14.125  63.017 58.689 1.00 62.84 ? 285 GLU A OE2   1 
ATOM   2186 N  N     . THR A 1 286 ? 10.252  58.713 58.569 1.00 47.51 ? 286 THR A N     1 
ATOM   2187 C  CA    . THR A 1 286 ? 10.020  57.400 57.957 1.00 45.29 ? 286 THR A CA    1 
ATOM   2188 C  C     . THR A 1 286 ? 8.646   57.291 57.291 1.00 43.74 ? 286 THR A C     1 
ATOM   2189 O  O     . THR A 1 286 ? 8.511   56.666 56.234 1.00 42.76 ? 286 THR A O     1 
ATOM   2190 C  CB    . THR A 1 286 ? 10.289  56.218 58.929 1.00 45.32 ? 286 THR A CB    1 
ATOM   2191 O  OG1   . THR A 1 286 ? 9.873   54.989 58.321 1.00 49.20 ? 286 THR A OG1   1 
ATOM   2192 C  CG2   . THR A 1 286 ? 9.568   56.390 60.231 1.00 49.59 ? 286 THR A CG2   1 
ATOM   2193 N  N     . GLY A 1 287 ? 7.628   57.908 57.895 1.00 42.71 ? 287 GLY A N     1 
ATOM   2194 C  CA    . GLY A 1 287 ? 6.314   57.876 57.290 1.00 39.02 ? 287 GLY A CA    1 
ATOM   2195 C  C     . GLY A 1 287 ? 6.507   58.460 55.901 1.00 42.24 ? 287 GLY A C     1 
ATOM   2196 O  O     . GLY A 1 287 ? 6.219   57.801 54.876 1.00 40.46 ? 287 GLY A O     1 
ATOM   2197 N  N     . GLU A 1 288 ? 7.022   59.695 55.877 1.00 39.95 ? 288 GLU A N     1 
ATOM   2198 C  CA    . GLU A 1 288 ? 7.266   60.420 54.635 1.00 39.92 ? 288 GLU A CA    1 
ATOM   2199 C  C     . GLU A 1 288 ? 8.017   59.508 53.681 1.00 38.11 ? 288 GLU A C     1 
ATOM   2200 O  O     . GLU A 1 288 ? 7.674   59.415 52.506 1.00 39.03 ? 288 GLU A O     1 
ATOM   2201 C  CB    . GLU A 1 288 ? 8.107   61.653 54.904 1.00 44.72 ? 288 GLU A CB    1 
ATOM   2202 C  CG    . GLU A 1 288 ? 7.433   62.993 54.715 1.00 50.81 ? 288 GLU A CG    1 
ATOM   2203 C  CD    . GLU A 1 288 ? 8.455   64.129 54.723 1.00 59.83 ? 288 GLU A CD    1 
ATOM   2204 O  OE1   . GLU A 1 288 ? 9.673   63.838 54.601 1.00 62.50 ? 288 GLU A OE1   1 
ATOM   2205 O  OE2   . GLU A 1 288 ? 8.045   65.310 54.815 1.00 63.76 ? 288 GLU A OE2   1 
ATOM   2206 N  N     . PHE A 1 289 ? 9.054   58.860 54.190 1.00 36.62 ? 289 PHE A N     1 
ATOM   2207 C  CA    . PHE A 1 289 ? 9.854   57.927 53.412 1.00 38.47 ? 289 PHE A CA    1 
ATOM   2208 C  C     . PHE A 1 289 ? 8.957   56.861 52.778 1.00 42.14 ? 289 PHE A C     1 
ATOM   2209 O  O     . PHE A 1 289 ? 8.920   56.735 51.547 1.00 42.09 ? 289 PHE A O     1 
ATOM   2210 C  CB    . PHE A 1 289 ? 10.857  57.240 54.321 1.00 35.98 ? 289 PHE A CB    1 
ATOM   2211 C  CG    . PHE A 1 289 ? 11.671  56.194 53.643 1.00 36.93 ? 289 PHE A CG    1 
ATOM   2212 C  CD1   . PHE A 1 289 ? 12.839  56.536 52.972 1.00 40.60 ? 289 PHE A CD1   1 
ATOM   2213 C  CD2   . PHE A 1 289 ? 11.316  54.856 53.721 1.00 39.23 ? 289 PHE A CD2   1 
ATOM   2214 C  CE1   . PHE A 1 289 ? 13.656  55.565 52.393 1.00 42.49 ? 289 PHE A CE1   1 
ATOM   2215 C  CE2   . PHE A 1 289 ? 12.128  53.856 53.142 1.00 40.81 ? 289 PHE A CE2   1 
ATOM   2216 C  CZ    . PHE A 1 289 ? 13.301  54.214 52.479 1.00 42.21 ? 289 PHE A CZ    1 
ATOM   2217 N  N     . LEU A 1 290 ? 8.255   56.110 53.638 1.00 42.95 ? 290 LEU A N     1 
ATOM   2218 C  CA    . LEU A 1 290 ? 7.334   55.030 53.234 1.00 39.28 ? 290 LEU A CA    1 
ATOM   2219 C  C     . LEU A 1 290 ? 6.373   55.524 52.149 1.00 36.70 ? 290 LEU A C     1 
ATOM   2220 O  O     . LEU A 1 290 ? 6.099   54.820 51.164 1.00 32.51 ? 290 LEU A O     1 
ATOM   2221 C  CB    . LEU A 1 290 ? 6.547   54.519 54.468 1.00 38.42 ? 290 LEU A CB    1 
ATOM   2222 C  CG    . LEU A 1 290 ? 7.272   53.664 55.531 1.00 36.62 ? 290 LEU A CG    1 
ATOM   2223 C  CD1   . LEU A 1 290 ? 6.276   53.116 56.513 1.00 31.90 ? 290 LEU A CD1   1 
ATOM   2224 C  CD2   . LEU A 1 290 ? 7.983   52.490 54.883 1.00 30.43 ? 290 LEU A CD2   1 
ATOM   2225 N  N     . CYS A 1 291 ? 5.863   56.735 52.330 1.00 35.01 ? 291 CYS A N     1 
ATOM   2226 C  CA    . CYS A 1 291 ? 4.974   57.306 51.349 1.00 38.54 ? 291 CYS A CA    1 
ATOM   2227 C  C     . CYS A 1 291 ? 5.684   57.573 50.007 1.00 42.97 ? 291 CYS A C     1 
ATOM   2228 O  O     . CYS A 1 291 ? 5.223   57.100 48.949 1.00 41.65 ? 291 CYS A O     1 
ATOM   2229 C  CB    . CYS A 1 291 ? 4.370   58.590 51.883 1.00 34.10 ? 291 CYS A CB    1 
ATOM   2230 S  SG    . CYS A 1 291 ? 3.163   59.266 50.775 1.00 38.29 ? 291 CYS A SG    1 
ATOM   2231 N  N     . LYS A 1 292 ? 6.802   58.309 50.036 1.00 43.66 ? 292 LYS A N     1 
ATOM   2232 C  CA    . LYS A 1 292 ? 7.541   58.642 48.820 1.00 42.10 ? 292 LYS A CA    1 
ATOM   2233 C  C     . LYS A 1 292 ? 7.999   57.398 48.072 1.00 41.92 ? 292 LYS A C     1 
ATOM   2234 O  O     . LYS A 1 292 ? 7.632   57.190 46.929 1.00 43.65 ? 292 LYS A O     1 
ATOM   2235 C  CB    . LYS A 1 292 ? 8.767   59.493 49.133 1.00 42.54 ? 292 LYS A CB    1 
ATOM   2236 C  CG    . LYS A 1 292 ? 8.497   60.749 49.863 1.00 49.42 ? 292 LYS A CG    1 
ATOM   2237 C  CD    . LYS A 1 292 ? 9.788   61.275 50.455 1.00 56.70 ? 292 LYS A CD    1 
ATOM   2238 C  CE    . LYS A 1 292 ? 9.545   62.361 51.520 1.00 59.83 ? 292 LYS A CE    1 
ATOM   2239 N  NZ    . LYS A 1 292 ? 9.130   63.679 50.965 1.00 64.23 ? 292 LYS A NZ    1 
ATOM   2240 N  N     . GLN A 1 293 ? 8.788   56.556 48.717 1.00 42.61 ? 293 GLN A N     1 
ATOM   2241 C  CA    . GLN A 1 293 ? 9.304   55.364 48.074 1.00 45.33 ? 293 GLN A CA    1 
ATOM   2242 C  C     . GLN A 1 293 ? 8.179   54.498 47.523 1.00 48.33 ? 293 GLN A C     1 
ATOM   2243 O  O     . GLN A 1 293 ? 8.218   54.058 46.366 1.00 50.65 ? 293 GLN A O     1 
ATOM   2244 C  CB    . GLN A 1 293 ? 10.157  54.580 49.061 1.00 44.84 ? 293 GLN A CB    1 
ATOM   2245 C  CG    . GLN A 1 293 ? 11.408  55.329 49.477 1.00 48.95 ? 293 GLN A CG    1 
ATOM   2246 C  CD    . GLN A 1 293 ? 12.331  55.560 48.293 1.00 48.58 ? 293 GLN A CD    1 
ATOM   2247 O  OE1   . GLN A 1 293 ? 12.939  54.621 47.778 1.00 48.33 ? 293 GLN A OE1   1 
ATOM   2248 N  NE2   . GLN A 1 293 ? 12.411  56.806 47.829 1.00 45.12 ? 293 GLN A NE2   1 
ATOM   2249 N  N     . GLY A 1 294 ? 7.160   54.272 48.351 1.00 48.86 ? 294 GLY A N     1 
ATOM   2250 C  CA    . GLY A 1 294 ? 6.044   53.449 47.920 1.00 44.50 ? 294 GLY A CA    1 
ATOM   2251 C  C     . GLY A 1 294 ? 5.152   54.158 46.938 1.00 41.22 ? 294 GLY A C     1 
ATOM   2252 O  O     . GLY A 1 294 ? 4.271   53.527 46.356 1.00 44.40 ? 294 GLY A O     1 
ATOM   2253 N  N     . ASN A 1 295 ? 5.370   55.457 46.743 1.00 38.77 ? 295 ASN A N     1 
ATOM   2254 C  CA    . ASN A 1 295 ? 4.551   56.242 45.824 1.00 39.06 ? 295 ASN A CA    1 
ATOM   2255 C  C     . ASN A 1 295 ? 3.091   56.057 46.270 1.00 41.40 ? 295 ASN A C     1 
ATOM   2256 O  O     . ASN A 1 295 ? 2.169   55.795 45.475 1.00 37.55 ? 295 ASN A O     1 
ATOM   2257 C  CB    . ASN A 1 295 ? 4.755   55.751 44.400 1.00 36.53 ? 295 ASN A CB    1 
ATOM   2258 C  CG    . ASN A 1 295 ? 4.042   56.595 43.387 1.00 39.51 ? 295 ASN A CG    1 
ATOM   2259 O  OD1   . ASN A 1 295 ? 3.731   56.127 42.300 1.00 45.58 ? 295 ASN A OD1   1 
ATOM   2260 N  ND2   . ASN A 1 295 ? 3.788   57.851 43.720 1.00 42.74 ? 295 ASN A ND2   1 
ATOM   2261 N  N     . GLU A 1 296 ? 2.894   56.186 47.574 1.00 41.81 ? 296 GLU A N     1 
ATOM   2262 C  CA    . GLU A 1 296 ? 1.585   55.979 48.134 1.00 41.26 ? 296 GLU A CA    1 
ATOM   2263 C  C     . GLU A 1 296 ? 0.642   57.124 47.926 1.00 42.96 ? 296 GLU A C     1 
ATOM   2264 O  O     . GLU A 1 296 ? 0.621   58.083 48.691 1.00 45.47 ? 296 GLU A O     1 
ATOM   2265 C  CB    . GLU A 1 296 ? 1.667   55.604 49.616 1.00 41.59 ? 296 GLU A CB    1 
ATOM   2266 C  CG    . GLU A 1 296 ? 2.352   54.260 49.898 1.00 39.49 ? 296 GLU A CG    1 
ATOM   2267 C  CD    . GLU A 1 296 ? 1.686   53.078 49.222 1.00 37.49 ? 296 GLU A CD    1 
ATOM   2268 O  OE1   . GLU A 1 296 ? 2.374   52.084 48.936 1.00 34.96 ? 296 GLU A OE1   1 
ATOM   2269 O  OE2   . GLU A 1 296 ? 0.471   53.114 48.962 1.00 38.84 ? 296 GLU A OE2   1 
ATOM   2270 N  N     . PHE A 1 297 ? -0.136  57.008 46.867 1.00 45.01 ? 297 PHE A N     1 
ATOM   2271 C  CA    . PHE A 1 297 ? -1.159  57.977 46.521 1.00 49.28 ? 297 PHE A CA    1 
ATOM   2272 C  C     . PHE A 1 297 ? -2.236  57.122 45.788 1.00 55.82 ? 297 PHE A C     1 
ATOM   2273 O  O     . PHE A 1 297 ? -1.909  56.349 44.858 1.00 56.59 ? 297 PHE A O     1 
ATOM   2274 C  CB    . PHE A 1 297 ? -0.569  59.084 45.652 1.00 44.31 ? 297 PHE A CB    1 
ATOM   2275 C  CG    . PHE A 1 297 ? 0.630   59.775 46.269 1.00 40.95 ? 297 PHE A CG    1 
ATOM   2276 C  CD1   . PHE A 1 297 ? 0.479   60.909 47.032 1.00 39.22 ? 297 PHE A CD1   1 
ATOM   2277 C  CD2   . PHE A 1 297 ? 1.926   59.290 46.068 1.00 41.70 ? 297 PHE A CD2   1 
ATOM   2278 C  CE1   . PHE A 1 297 ? 1.618   61.564 47.577 1.00 44.45 ? 297 PHE A CE1   1 
ATOM   2279 C  CE2   . PHE A 1 297 ? 3.071   59.940 46.614 1.00 37.29 ? 297 PHE A CE2   1 
ATOM   2280 C  CZ    . PHE A 1 297 ? 2.918   61.061 47.361 1.00 38.71 ? 297 PHE A CZ    1 
ATOM   2281 N  N     . GLY A 1 298 ? -3.487  57.198 46.270 1.00 56.19 ? 298 GLY A N     1 
ATOM   2282 C  CA    . GLY A 1 298 ? -4.587  56.409 45.715 1.00 54.21 ? 298 GLY A CA    1 
ATOM   2283 C  C     . GLY A 1 298 ? -4.802  56.297 44.211 1.00 51.14 ? 298 GLY A C     1 
ATOM   2284 O  O     . GLY A 1 298 ? -5.135  57.278 43.567 1.00 50.68 ? 298 GLY A O     1 
ATOM   2285 N  N     . ALA A 1 299 ? -4.717  55.080 43.684 1.00 50.14 ? 299 ALA A N     1 
ATOM   2286 C  CA    . ALA A 1 299 ? -4.912  54.803 42.256 1.00 52.36 ? 299 ALA A CA    1 
ATOM   2287 C  C     . ALA A 1 299 ? -6.302  55.162 41.726 1.00 53.84 ? 299 ALA A C     1 
ATOM   2288 O  O     . ALA A 1 299 ? -6.528  55.119 40.511 1.00 54.17 ? 299 ALA A O     1 
ATOM   2289 C  CB    . ALA A 1 299 ? -4.633  53.338 41.954 1.00 51.33 ? 299 ALA A CB    1 
ATOM   2290 N  N     . THR A 1 300 ? -7.229  55.464 42.637 1.00 54.88 ? 300 THR A N     1 
ATOM   2291 C  CA    . THR A 1 300 ? -8.598  55.839 42.305 1.00 53.27 ? 300 THR A CA    1 
ATOM   2292 C  C     . THR A 1 300 ? -8.950  57.298 42.668 1.00 58.91 ? 300 THR A C     1 
ATOM   2293 O  O     . THR A 1 300 ? -10.029 57.808 42.311 1.00 60.62 ? 300 THR A O     1 
ATOM   2294 C  CB    . THR A 1 300 ? -9.566  54.945 43.028 1.00 45.64 ? 300 THR A CB    1 
ATOM   2295 O  OG1   . THR A 1 300 ? -9.306  53.595 42.671 1.00 43.53 ? 300 THR A OG1   1 
ATOM   2296 C  CG2   . THR A 1 300 ? -10.958 55.267 42.634 1.00 47.67 ? 300 THR A CG2   1 
ATOM   2297 N  N     . THR A 1 301 ? -8.072  57.985 43.386 1.00 61.50 ? 301 THR A N     1 
ATOM   2298 C  CA    . THR A 1 301 ? -8.396  59.355 43.745 1.00 63.91 ? 301 THR A CA    1 
ATOM   2299 C  C     . THR A 1 301 ? -7.159  60.211 43.942 1.00 63.29 ? 301 THR A C     1 
ATOM   2300 O  O     . THR A 1 301 ? -7.256  61.389 44.283 1.00 61.81 ? 301 THR A O     1 
ATOM   2301 C  CB    . THR A 1 301 ? -9.274  59.375 45.006 1.00 67.14 ? 301 THR A CB    1 
ATOM   2302 O  OG1   . THR A 1 301 ? -10.232 58.302 44.932 1.00 69.52 ? 301 THR A OG1   1 
ATOM   2303 C  CG2   . THR A 1 301 ? -10.024 60.702 45.112 1.00 71.17 ? 301 THR A CG2   1 
ATOM   2304 N  N     . GLY A 1 302 ? -5.996  59.602 43.732 1.00 64.35 ? 302 GLY A N     1 
ATOM   2305 C  CA    . GLY A 1 302 ? -4.734  60.296 43.870 1.00 65.39 ? 302 GLY A CA    1 
ATOM   2306 C  C     . GLY A 1 302 ? -4.348  60.579 45.302 1.00 67.99 ? 302 GLY A C     1 
ATOM   2307 O  O     . GLY A 1 302 ? -3.212  60.291 45.710 1.00 66.39 ? 302 GLY A O     1 
ATOM   2308 N  N     . LEU A 1 303 ? -5.291  61.159 46.049 1.00 70.37 ? 303 LEU A N     1 
ATOM   2309 C  CA    . LEU A 1 303 ? -5.092  61.532 47.454 1.00 70.76 ? 303 LEU A CA    1 
ATOM   2310 C  C     . LEU A 1 303 ? -3.981  60.767 48.160 1.00 70.54 ? 303 LEU A C     1 
ATOM   2311 O  O     . LEU A 1 303 ? -4.053  59.527 48.274 1.00 70.74 ? 303 LEU A O     1 
ATOM   2312 C  CB    . LEU A 1 303 ? -6.387  61.357 48.249 1.00 69.89 ? 303 LEU A CB    1 
ATOM   2313 C  CG    . LEU A 1 303 ? -7.623  62.088 47.738 1.00 70.31 ? 303 LEU A CG    1 
ATOM   2314 C  CD1   . LEU A 1 303 ? -8.662  62.040 48.830 1.00 72.48 ? 303 LEU A CD1   1 
ATOM   2315 C  CD2   . LEU A 1 303 ? -7.316  63.530 47.357 1.00 70.80 ? 303 LEU A CD2   1 
ATOM   2316 N  N     . ARG A 1 304 ? -2.963  61.498 48.629 1.00 67.13 ? 304 ARG A N     1 
ATOM   2317 C  CA    . ARG A 1 304 ? -1.872  60.853 49.345 1.00 65.85 ? 304 ARG A CA    1 
ATOM   2318 C  C     . ARG A 1 304 ? -2.473  59.847 50.333 1.00 62.91 ? 304 ARG A C     1 
ATOM   2319 O  O     . ARG A 1 304 ? -3.599  60.031 50.818 1.00 63.94 ? 304 ARG A O     1 
ATOM   2320 C  CB    . ARG A 1 304 ? -1.028  61.861 50.117 1.00 66.74 ? 304 ARG A CB    1 
ATOM   2321 C  CG    . ARG A 1 304 ? 0.216   61.227 50.699 1.00 72.79 ? 304 ARG A CG    1 
ATOM   2322 C  CD    . ARG A 1 304 ? 0.687   61.909 51.962 1.00 78.27 ? 304 ARG A CD    1 
ATOM   2323 N  NE    . ARG A 1 304 ? 0.786   60.953 53.071 1.00 87.92 ? 304 ARG A NE    1 
ATOM   2324 C  CZ    . ARG A 1 304 ? 1.879   60.895 53.834 1.00 86.66 ? 304 ARG A CZ    1 
ATOM   2325 N  NH1   . ARG A 1 304 ? 2.890   61.713 53.580 1.00 89.03 ? 304 ARG A NH1   1 
ATOM   2326 N  NH2   . ARG A 1 304 ? 1.960   60.041 54.853 1.00 80.68 ? 304 ARG A NH2   1 
ATOM   2327 N  N     . ARG A 1 305 ? -1.742  58.772 50.602 1.00 56.66 ? 305 ARG A N     1 
ATOM   2328 C  CA    . ARG A 1 305 ? -2.218  57.757 51.520 1.00 50.08 ? 305 ARG A CA    1 
ATOM   2329 C  C     . ARG A 1 305 ? -1.443  57.877 52.834 1.00 47.79 ? 305 ARG A C     1 
ATOM   2330 O  O     . ARG A 1 305 ? -0.268  58.254 52.848 1.00 45.98 ? 305 ARG A O     1 
ATOM   2331 C  CB    . ARG A 1 305 ? -2.039  56.358 50.913 1.00 46.74 ? 305 ARG A CB    1 
ATOM   2332 C  CG    . ARG A 1 305 ? -2.718  56.111 49.562 1.00 40.92 ? 305 ARG A CG    1 
ATOM   2333 C  CD    . ARG A 1 305 ? -2.304  54.750 49.013 1.00 34.49 ? 305 ARG A CD    1 
ATOM   2334 N  NE    . ARG A 1 305 ? -2.833  54.510 47.680 1.00 39.33 ? 305 ARG A NE    1 
ATOM   2335 C  CZ    . ARG A 1 305 ? -2.073  54.019 46.702 1.00 43.29 ? 305 ARG A CZ    1 
ATOM   2336 N  NH1   . ARG A 1 305 ? -0.805  53.740 46.919 1.00 50.66 ? 305 ARG A NH1   1 
ATOM   2337 N  NH2   . ARG A 1 305 ? -2.586  53.775 45.511 1.00 43.19 ? 305 ARG A NH2   1 
ATOM   2338 N  N     . ARG A 1 306 ? -2.121  57.603 53.948 1.00 42.67 ? 306 ARG A N     1 
ATOM   2339 C  CA    . ARG A 1 306 ? -1.492  57.645 55.261 1.00 39.17 ? 306 ARG A CA    1 
ATOM   2340 C  C     . ARG A 1 306 ? -0.627  56.386 55.309 1.00 38.68 ? 306 ARG A C     1 
ATOM   2341 O  O     . ARG A 1 306 ? -0.996  55.359 54.732 1.00 36.36 ? 306 ARG A O     1 
ATOM   2342 C  CB    . ARG A 1 306 ? -2.543  57.567 56.371 1.00 39.10 ? 306 ARG A CB    1 
ATOM   2343 C  CG    . ARG A 1 306 ? -3.609  58.600 56.271 1.00 32.07 ? 306 ARG A CG    1 
ATOM   2344 C  CD    . ARG A 1 306 ? -4.865  58.159 56.982 1.00 33.36 ? 306 ARG A CD    1 
ATOM   2345 N  NE    . ARG A 1 306 ? -4.656  58.018 58.416 1.00 37.30 ? 306 ARG A NE    1 
ATOM   2346 C  CZ    . ARG A 1 306 ? -5.641  57.632 59.234 1.00 39.38 ? 306 ARG A CZ    1 
ATOM   2347 N  NH1   . ARG A 1 306 ? -6.858  57.373 58.756 1.00 38.41 ? 306 ARG A NH1   1 
ATOM   2348 N  NH2   . ARG A 1 306 ? -5.393  57.463 60.524 1.00 33.38 ? 306 ARG A NH2   1 
ATOM   2349 N  N     . THR A 1 307 ? 0.525   56.469 55.961 1.00 33.84 ? 307 THR A N     1 
ATOM   2350 C  CA    . THR A 1 307 ? 1.411   55.338 56.062 1.00 33.55 ? 307 THR A CA    1 
ATOM   2351 C  C     . THR A 1 307 ? 1.734   55.080 57.504 1.00 32.97 ? 307 THR A C     1 
ATOM   2352 O  O     . THR A 1 307 ? 1.639   55.987 58.349 1.00 33.37 ? 307 THR A O     1 
ATOM   2353 C  CB    . THR A 1 307 ? 2.703   55.582 55.306 1.00 36.42 ? 307 THR A CB    1 
ATOM   2354 O  OG1   . THR A 1 307 ? 2.852   56.984 55.082 1.00 42.74 ? 307 THR A OG1   1 
ATOM   2355 C  CG2   . THR A 1 307 ? 2.692   54.854 53.961 1.00 44.41 ? 307 THR A CG2   1 
ATOM   2356 N  N     . GLY A 1 308 ? 2.109   53.839 57.788 1.00 31.57 ? 308 GLY A N     1 
ATOM   2357 C  CA    . GLY A 1 308 ? 2.452   53.437 59.136 1.00 28.40 ? 308 GLY A CA    1 
ATOM   2358 C  C     . GLY A 1 308 ? 3.108   52.088 59.058 1.00 28.24 ? 308 GLY A C     1 
ATOM   2359 O  O     . GLY A 1 308 ? 3.189   51.526 57.962 1.00 32.10 ? 308 GLY A O     1 
ATOM   2360 N  N     . TRP A 1 309 ? 3.573   51.542 60.175 1.00 26.31 ? 309 TRP A N     1 
ATOM   2361 C  CA    . TRP A 1 309 ? 4.229   50.241 60.127 1.00 24.91 ? 309 TRP A CA    1 
ATOM   2362 C  C     . TRP A 1 309 ? 3.212   49.119 59.984 1.00 25.19 ? 309 TRP A C     1 
ATOM   2363 O  O     . TRP A 1 309 ? 2.049   49.263 60.355 1.00 23.94 ? 309 TRP A O     1 
ATOM   2364 C  CB    . TRP A 1 309 ? 5.009   49.964 61.414 1.00 27.50 ? 309 TRP A CB    1 
ATOM   2365 C  CG    . TRP A 1 309 ? 6.075   50.938 61.769 1.00 30.27 ? 309 TRP A CG    1 
ATOM   2366 C  CD1   . TRP A 1 309 ? 6.051   51.832 62.789 1.00 31.71 ? 309 TRP A CD1   1 
ATOM   2367 C  CD2   . TRP A 1 309 ? 7.353   51.073 61.140 1.00 34.14 ? 309 TRP A CD2   1 
ATOM   2368 N  NE1   . TRP A 1 309 ? 7.240   52.516 62.847 1.00 35.59 ? 309 TRP A NE1   1 
ATOM   2369 C  CE2   . TRP A 1 309 ? 8.055   52.072 61.848 1.00 36.60 ? 309 TRP A CE2   1 
ATOM   2370 C  CE3   . TRP A 1 309 ? 7.961   50.462 60.041 1.00 34.42 ? 309 TRP A CE3   1 
ATOM   2371 C  CZ2   . TRP A 1 309 ? 9.352   52.452 61.502 1.00 40.77 ? 309 TRP A CZ2   1 
ATOM   2372 C  CZ3   . TRP A 1 309 ? 9.240   50.838 59.697 1.00 35.95 ? 309 TRP A CZ3   1 
ATOM   2373 C  CH2   . TRP A 1 309 ? 9.924   51.830 60.423 1.00 43.53 ? 309 TRP A CH2   1 
ATOM   2374 N  N     . LEU A 1 310 ? 3.654   47.994 59.454 1.00 23.60 ? 310 LEU A N     1 
ATOM   2375 C  CA    . LEU A 1 310 ? 2.815   46.823 59.370 1.00 26.10 ? 310 LEU A CA    1 
ATOM   2376 C  C     . LEU A 1 310 ? 2.286   46.554 60.782 1.00 23.88 ? 310 LEU A C     1 
ATOM   2377 O  O     . LEU A 1 310 ? 3.006   46.730 61.775 1.00 23.10 ? 310 LEU A O     1 
ATOM   2378 C  CB    . LEU A 1 310 ? 3.658   45.627 58.898 1.00 26.61 ? 310 LEU A CB    1 
ATOM   2379 C  CG    . LEU A 1 310 ? 3.040   44.232 58.866 1.00 23.53 ? 310 LEU A CG    1 
ATOM   2380 C  CD1   . LEU A 1 310 ? 1.765   44.241 58.114 1.00 29.44 ? 310 LEU A CD1   1 
ATOM   2381 C  CD2   . LEU A 1 310 ? 3.992   43.304 58.184 1.00 31.97 ? 310 LEU A CD2   1 
ATOM   2382 N  N     . ASP A 1 311 ? 1.056   46.060 60.877 1.00 24.85 ? 311 ASP A N     1 
ATOM   2383 C  CA    . ASP A 1 311 ? 0.433   45.781 62.168 1.00 26.01 ? 311 ASP A CA    1 
ATOM   2384 C  C     . ASP A 1 311 ? -0.068  44.330 62.283 1.00 28.34 ? 311 ASP A C     1 
ATOM   2385 O  O     . ASP A 1 311 ? -1.155  43.997 61.828 1.00 24.50 ? 311 ASP A O     1 
ATOM   2386 C  CB    . ASP A 1 311 ? -0.715  46.762 62.370 1.00 25.46 ? 311 ASP A CB    1 
ATOM   2387 C  CG    . ASP A 1 311 ? -1.480  46.524 63.657 1.00 30.70 ? 311 ASP A CG    1 
ATOM   2388 O  OD1   . ASP A 1 311 ? -1.212  45.520 64.366 1.00 23.82 ? 311 ASP A OD1   1 
ATOM   2389 O  OD2   . ASP A 1 311 ? -2.383  47.354 63.928 1.00 24.88 ? 311 ASP A OD2   1 
ATOM   2390 N  N     . THR A 1 312 ? 0.744   43.477 62.899 1.00 33.03 ? 312 THR A N     1 
ATOM   2391 C  CA    . THR A 1 312 ? 0.418   42.065 63.082 1.00 32.05 ? 312 THR A CA    1 
ATOM   2392 C  C     . THR A 1 312 ? -0.888  41.830 63.836 1.00 31.13 ? 312 THR A C     1 
ATOM   2393 O  O     . THR A 1 312 ? -1.564  40.793 63.638 1.00 32.51 ? 312 THR A O     1 
ATOM   2394 C  CB    . THR A 1 312 ? 1.566   41.331 63.768 1.00 30.34 ? 312 THR A CB    1 
ATOM   2395 O  OG1   . THR A 1 312 ? 2.744   41.499 62.975 1.00 34.55 ? 312 THR A OG1   1 
ATOM   2396 C  CG2   . THR A 1 312 ? 1.274   39.853 63.844 1.00 38.98 ? 312 THR A CG2   1 
ATOM   2397 N  N     . VAL A 1 313 ? -1.268  42.784 64.675 1.00 28.29 ? 313 VAL A N     1 
ATOM   2398 C  CA    . VAL A 1 313 ? -2.511  42.660 65.422 1.00 26.79 ? 313 VAL A CA    1 
ATOM   2399 C  C     . VAL A 1 313 ? -3.691  42.768 64.413 1.00 27.22 ? 313 VAL A C     1 
ATOM   2400 O  O     . VAL A 1 313 ? -4.533  41.842 64.319 1.00 27.78 ? 313 VAL A O     1 
ATOM   2401 C  CB    . VAL A 1 313 ? -2.578  43.744 66.537 1.00 26.06 ? 313 VAL A CB    1 
ATOM   2402 C  CG1   . VAL A 1 313 ? -3.876  43.674 67.328 1.00 24.63 ? 313 VAL A CG1   1 
ATOM   2403 C  CG2   . VAL A 1 313 ? -1.424  43.591 67.452 1.00 25.17 ? 313 VAL A CG2   1 
ATOM   2404 N  N     . ALA A 1 314 ? -3.726  43.868 63.644 1.00 23.85 ? 314 ALA A N     1 
ATOM   2405 C  CA    . ALA A 1 314 ? -4.771  44.085 62.652 1.00 21.57 ? 314 ALA A CA    1 
ATOM   2406 C  C     . ALA A 1 314 ? -4.703  42.944 61.640 1.00 25.59 ? 314 ALA A C     1 
ATOM   2407 O  O     . ALA A 1 314 ? -5.754  42.333 61.332 1.00 23.88 ? 314 ALA A O     1 
ATOM   2408 C  CB    . ALA A 1 314 ? -4.624  45.443 61.961 1.00 17.30 ? 314 ALA A CB    1 
ATOM   2409 N  N     . VAL A 1 315 ? -3.486  42.618 61.151 1.00 28.32 ? 315 VAL A N     1 
ATOM   2410 C  CA    . VAL A 1 315 ? -3.257  41.510 60.187 1.00 27.29 ? 315 VAL A CA    1 
ATOM   2411 C  C     . VAL A 1 315 ? -3.793  40.223 60.797 1.00 27.29 ? 315 VAL A C     1 
ATOM   2412 O  O     . VAL A 1 315 ? -4.428  39.421 60.107 1.00 26.86 ? 315 VAL A O     1 
ATOM   2413 C  CB    . VAL A 1 315 ? -1.777  41.232 59.905 1.00 28.28 ? 315 VAL A CB    1 
ATOM   2414 C  CG1   . VAL A 1 315 ? -1.639  40.116 58.878 1.00 15.57 ? 315 VAL A CG1   1 
ATOM   2415 C  CG2   . VAL A 1 315 ? -1.098  42.492 59.434 1.00 27.36 ? 315 VAL A CG2   1 
ATOM   2416 N  N     . ARG A 1 316 ? -3.524  39.993 62.070 1.00 25.25 ? 316 ARG A N     1 
ATOM   2417 C  CA    . ARG A 1 316 ? -4.077  38.799 62.679 1.00 26.49 ? 316 ARG A CA    1 
ATOM   2418 C  C     . ARG A 1 316 ? -5.631  38.732 62.677 1.00 24.99 ? 316 ARG A C     1 
ATOM   2419 O  O     . ARG A 1 316 ? -6.196  37.650 62.609 1.00 28.17 ? 316 ARG A O     1 
ATOM   2420 C  CB    . ARG A 1 316 ? -3.470  38.546 64.056 1.00 30.02 ? 316 ARG A CB    1 
ATOM   2421 C  CG    . ARG A 1 316 ? -2.236  37.671 63.975 1.00 28.87 ? 316 ARG A CG    1 
ATOM   2422 C  CD    . ARG A 1 316 ? -1.780  37.190 65.319 1.00 36.17 ? 316 ARG A CD    1 
ATOM   2423 N  NE    . ARG A 1 316 ? -0.931  38.168 65.990 1.00 47.17 ? 316 ARG A NE    1 
ATOM   2424 C  CZ    . ARG A 1 316 ? -1.422  38.902 66.981 1.00 49.96 ? 316 ARG A CZ    1 
ATOM   2425 N  NH1   . ARG A 1 316 ? -2.684  38.731 67.362 1.00 53.77 ? 316 ARG A NH1   1 
ATOM   2426 N  NH2   . ARG A 1 316 ? -0.670  39.827 67.571 1.00 49.79 ? 316 ARG A NH2   1 
ATOM   2427 N  N     . ARG A 1 317 ? -6.340  39.855 62.762 1.00 21.57 ? 317 ARG A N     1 
ATOM   2428 C  CA    . ARG A 1 317 ? -7.816  39.778 62.685 1.00 22.99 ? 317 ARG A CA    1 
ATOM   2429 C  C     . ARG A 1 317 ? -8.140  39.301 61.282 1.00 23.37 ? 317 ARG A C     1 
ATOM   2430 O  O     . ARG A 1 317 ? -9.022  38.468 61.062 1.00 22.70 ? 317 ARG A O     1 
ATOM   2431 C  CB    . ARG A 1 317 ? -8.462  41.166 62.878 1.00 23.73 ? 317 ARG A CB    1 
ATOM   2432 C  CG    . ARG A 1 317 ? -9.986  41.223 62.732 1.00 20.09 ? 317 ARG A CG    1 
ATOM   2433 C  CD    . ARG A 1 317 ? -10.703 40.520 63.827 1.00 21.06 ? 317 ARG A CD    1 
ATOM   2434 N  NE    . ARG A 1 317 ? -10.563 41.231 65.088 1.00 27.14 ? 317 ARG A NE    1 
ATOM   2435 C  CZ    . ARG A 1 317 ? -11.240 40.839 66.164 1.00 30.12 ? 317 ARG A CZ    1 
ATOM   2436 N  NH1   . ARG A 1 317 ? -12.048 39.774 66.092 1.00 30.80 ? 317 ARG A NH1   1 
ATOM   2437 N  NH2   . ARG A 1 317 ? -11.187 41.568 67.283 1.00 22.21 ? 317 ARG A NH2   1 
ATOM   2438 N  N     . ALA A 1 318 ? -7.419  39.857 60.316 1.00 26.77 ? 318 ALA A N     1 
ATOM   2439 C  CA    . ALA A 1 318 ? -7.610  39.494 58.924 1.00 27.68 ? 318 ALA A CA    1 
ATOM   2440 C  C     . ALA A 1 318 ? -7.414  37.973 58.725 1.00 26.79 ? 318 ALA A C     1 
ATOM   2441 O  O     . ALA A 1 318 ? -8.173  37.328 58.000 1.00 25.30 ? 318 ALA A O     1 
ATOM   2442 C  CB    . ALA A 1 318 ? -6.670  40.299 58.052 1.00 20.88 ? 318 ALA A CB    1 
ATOM   2443 N  N     . VAL A 1 319 ? -6.399  37.410 59.365 1.00 26.36 ? 319 VAL A N     1 
ATOM   2444 C  CA    . VAL A 1 319 ? -6.130  35.982 59.273 1.00 25.11 ? 319 VAL A CA    1 
ATOM   2445 C  C     . VAL A 1 319 ? -7.358  35.170 59.679 1.00 28.69 ? 319 VAL A C     1 
ATOM   2446 O  O     . VAL A 1 319 ? -7.780  34.257 58.935 1.00 32.56 ? 319 VAL A O     1 
ATOM   2447 C  CB    . VAL A 1 319 ? -4.902  35.544 60.149 1.00 22.51 ? 319 VAL A CB    1 
ATOM   2448 C  CG1   . VAL A 1 319 ? -4.817  34.017 60.189 1.00 19.03 ? 319 VAL A CG1   1 
ATOM   2449 C  CG2   . VAL A 1 319 ? -3.614  36.079 59.570 1.00 13.41 ? 319 VAL A CG2   1 
ATOM   2450 N  N     . GLN A 1 320 ? -7.941  35.462 60.839 1.00 25.34 ? 320 GLN A N     1 
ATOM   2451 C  CA    . GLN A 1 320 ? -9.125  34.700 61.221 1.00 28.50 ? 320 GLN A CA    1 
ATOM   2452 C  C     . GLN A 1 320 ? -10.372 35.017 60.389 1.00 28.31 ? 320 GLN A C     1 
ATOM   2453 O  O     . GLN A 1 320 ? -11.060 34.109 59.916 1.00 31.09 ? 320 GLN A O     1 
ATOM   2454 C  CB    . GLN A 1 320 ? -9.419  34.785 62.715 1.00 29.18 ? 320 GLN A CB    1 
ATOM   2455 C  CG    . GLN A 1 320 ? -9.556  36.154 63.267 1.00 31.62 ? 320 GLN A CG    1 
ATOM   2456 C  CD    . GLN A 1 320 ? -9.671  36.158 64.791 1.00 30.29 ? 320 GLN A CD    1 
ATOM   2457 O  OE1   . GLN A 1 320 ? -10.453 36.912 65.344 1.00 35.44 ? 320 GLN A OE1   1 
ATOM   2458 N  NE2   . GLN A 1 320 ? -8.895  35.328 65.461 1.00 29.25 ? 320 GLN A NE2   1 
ATOM   2459 N  N     . LEU A 1 321 ? -10.658 36.293 60.159 1.00 25.61 ? 321 LEU A N     1 
ATOM   2460 C  CA    . LEU A 1 321 ? -11.818 36.641 59.356 1.00 22.38 ? 321 LEU A CA    1 
ATOM   2461 C  C     . LEU A 1 321 ? -11.854 35.953 57.983 1.00 24.76 ? 321 LEU A C     1 
ATOM   2462 O  O     . LEU A 1 321 ? -12.905 35.446 57.558 1.00 23.94 ? 321 LEU A O     1 
ATOM   2463 C  CB    . LEU A 1 321 ? -11.872 38.137 59.144 1.00 19.42 ? 321 LEU A CB    1 
ATOM   2464 C  CG    . LEU A 1 321 ? -12.416 38.873 60.351 1.00 22.93 ? 321 LEU A CG    1 
ATOM   2465 C  CD1   . LEU A 1 321 ? -12.220 40.377 60.132 1.00 23.77 ? 321 LEU A CD1   1 
ATOM   2466 C  CD2   . LEU A 1 321 ? -13.889 38.478 60.613 1.00 19.10 ? 321 LEU A CD2   1 
ATOM   2467 N  N     . ASN A 1 322 ? -10.720 35.937 57.293 1.00 23.46 ? 322 ASN A N     1 
ATOM   2468 C  CA    . ASN A 1 322 ? -10.643 35.373 55.951 1.00 18.95 ? 322 ASN A CA    1 
ATOM   2469 C  C     . ASN A 1 322 ? -10.148 33.930 55.790 1.00 21.36 ? 322 ASN A C     1 
ATOM   2470 O  O     . ASN A 1 322 ? -10.074 33.424 54.657 1.00 21.81 ? 322 ASN A O     1 
ATOM   2471 C  CB    . ASN A 1 322 ? -9.779  36.290 55.101 1.00 14.47 ? 322 ASN A CB    1 
ATOM   2472 C  CG    . ASN A 1 322 ? -10.241 37.738 55.141 1.00 22.11 ? 322 ASN A CG    1 
ATOM   2473 O  OD1   . ASN A 1 322 ? -11.338 38.074 54.653 1.00 22.34 ? 322 ASN A OD1   1 
ATOM   2474 N  ND2   . ASN A 1 322 ? -9.411  38.616 55.731 1.00 18.70 ? 322 ASN A ND2   1 
ATOM   2475 N  N     . SER A 1 323 ? -9.879  33.232 56.889 1.00 19.43 ? 323 SER A N     1 
ATOM   2476 C  CA    . SER A 1 323 ? -9.328  31.879 56.797 1.00 22.63 ? 323 SER A CA    1 
ATOM   2477 C  C     . SER A 1 323 ? -8.080  31.931 55.900 1.00 24.05 ? 323 SER A C     1 
ATOM   2478 O  O     . SER A 1 323 ? -7.885  31.043 55.052 1.00 22.47 ? 323 SER A O     1 
ATOM   2479 C  CB    . SER A 1 323 ? -10.272 30.877 56.131 1.00 25.74 ? 323 SER A CB    1 
ATOM   2480 O  OG    . SER A 1 323 ? -11.597 31.028 56.529 1.00 31.97 ? 323 SER A OG    1 
ATOM   2481 N  N     . LEU A 1 324 ? -7.240  32.948 56.053 1.00 21.98 ? 324 LEU A N     1 
ATOM   2482 C  CA    . LEU A 1 324 ? -6.048  32.992 55.205 1.00 24.24 ? 324 LEU A CA    1 
ATOM   2483 C  C     . LEU A 1 324 ? -5.373  31.615 55.049 1.00 23.47 ? 324 LEU A C     1 
ATOM   2484 O  O     . LEU A 1 324 ? -5.424  30.764 55.929 1.00 20.13 ? 324 LEU A O     1 
ATOM   2485 C  CB    . LEU A 1 324 ? -5.050  34.012 55.739 1.00 21.20 ? 324 LEU A CB    1 
ATOM   2486 C  CG    . LEU A 1 324 ? -5.066  35.368 55.022 1.00 24.10 ? 324 LEU A CG    1 
ATOM   2487 C  CD1   . LEU A 1 324 ? -6.403  35.649 54.503 1.00 23.42 ? 324 LEU A CD1   1 
ATOM   2488 C  CD2   . LEU A 1 324 ? -4.588  36.506 55.901 1.00 23.09 ? 324 LEU A CD2   1 
ATOM   2489 N  N     . SER A 1 325 ? -4.848  31.375 53.861 1.00 24.55 ? 325 SER A N     1 
ATOM   2490 C  CA    . SER A 1 325 ? -4.135  30.148 53.571 1.00 23.51 ? 325 SER A CA    1 
ATOM   2491 C  C     . SER A 1 325 ? -2.651  30.552 53.461 1.00 21.61 ? 325 SER A C     1 
ATOM   2492 O  O     . SER A 1 325 ? -1.750  29.794 53.829 1.00 18.51 ? 325 SER A O     1 
ATOM   2493 C  CB    . SER A 1 325 ? -4.637  29.553 52.245 1.00 27.58 ? 325 SER A CB    1 
ATOM   2494 O  OG    . SER A 1 325 ? -5.962  29.035 52.353 1.00 32.99 ? 325 SER A OG    1 
ATOM   2495 N  N     . GLY A 1 326 ? -2.414  31.763 52.947 1.00 21.97 ? 326 GLY A N     1 
ATOM   2496 C  CA    . GLY A 1 326 ? -1.061  32.268 52.807 1.00 17.31 ? 326 GLY A CA    1 
ATOM   2497 C  C     . GLY A 1 326 ? -1.094  33.750 52.559 1.00 19.60 ? 326 GLY A C     1 
ATOM   2498 O  O     . GLY A 1 326 ? -2.167  34.346 52.381 1.00 20.18 ? 326 GLY A O     1 
ATOM   2499 N  N     . PHE A 1 327 ? 0.075   34.371 52.577 1.00 25.98 ? 327 PHE A N     1 
ATOM   2500 C  CA    . PHE A 1 327 ? 0.183   35.812 52.352 1.00 28.07 ? 327 PHE A CA    1 
ATOM   2501 C  C     . PHE A 1 327 ? 0.986   36.067 51.114 1.00 27.70 ? 327 PHE A C     1 
ATOM   2502 O  O     . PHE A 1 327 ? 1.715   35.198 50.662 1.00 26.89 ? 327 PHE A O     1 
ATOM   2503 C  CB    . PHE A 1 327 ? 0.961   36.493 53.482 1.00 27.64 ? 327 PHE A CB    1 
ATOM   2504 C  CG    . PHE A 1 327 ? 0.178   36.706 54.740 1.00 28.96 ? 327 PHE A CG    1 
ATOM   2505 C  CD1   . PHE A 1 327 ? 0.668   36.219 55.957 1.00 23.70 ? 327 PHE A CD1   1 
ATOM   2506 C  CD2   . PHE A 1 327 ? -0.982  37.477 54.738 1.00 25.18 ? 327 PHE A CD2   1 
ATOM   2507 C  CE1   . PHE A 1 327 ? 0.037   36.508 57.148 1.00 21.21 ? 327 PHE A CE1   1 
ATOM   2508 C  CE2   . PHE A 1 327 ? -1.621  37.766 55.921 1.00 22.85 ? 327 PHE A CE2   1 
ATOM   2509 C  CZ    . PHE A 1 327 ? -1.110  37.279 57.134 1.00 23.50 ? 327 PHE A CZ    1 
ATOM   2510 N  N     . CYS A 1 328 ? 0.845   37.268 50.572 1.00 29.58 ? 328 CYS A N     1 
ATOM   2511 C  CA    . CYS A 1 328 ? 1.656   37.678 49.449 1.00 27.88 ? 328 CYS A CA    1 
ATOM   2512 C  C     . CYS A 1 328 ? 2.292   38.960 49.898 1.00 27.43 ? 328 CYS A C     1 
ATOM   2513 O  O     . CYS A 1 328 ? 1.706   40.024 49.730 1.00 26.40 ? 328 CYS A O     1 
ATOM   2514 C  CB    . CYS A 1 328 ? 0.848   37.955 48.196 1.00 29.00 ? 328 CYS A CB    1 
ATOM   2515 S  SG    . CYS A 1 328 ? 1.932   38.544 46.885 1.00 27.02 ? 328 CYS A SG    1 
ATOM   2516 N  N     . LEU A 1 329 ? 3.486   38.846 50.478 1.00 28.04 ? 329 LEU A N     1 
ATOM   2517 C  CA    . LEU A 1 329 ? 4.213   40.004 50.972 1.00 27.36 ? 329 LEU A CA    1 
ATOM   2518 C  C     . LEU A 1 329 ? 4.533   40.904 49.801 1.00 31.18 ? 329 LEU A C     1 
ATOM   2519 O  O     . LEU A 1 329 ? 5.316   40.528 48.895 1.00 29.66 ? 329 LEU A O     1 
ATOM   2520 C  CB    . LEU A 1 329 ? 5.499   39.569 51.689 1.00 32.77 ? 329 LEU A CB    1 
ATOM   2521 C  CG    . LEU A 1 329 ? 6.223   40.649 52.489 1.00 29.95 ? 329 LEU A CG    1 
ATOM   2522 C  CD1   . LEU A 1 329 ? 5.252   41.223 53.486 1.00 37.56 ? 329 LEU A CD1   1 
ATOM   2523 C  CD2   . LEU A 1 329 ? 7.433   40.065 53.191 1.00 33.67 ? 329 LEU A CD2   1 
ATOM   2524 N  N     . THR A 1 330 ? 3.906   42.076 49.791 1.00 30.28 ? 330 THR A N     1 
ATOM   2525 C  CA    . THR A 1 330 ? 4.133   43.003 48.713 1.00 30.21 ? 330 THR A CA    1 
ATOM   2526 C  C     . THR A 1 330 ? 4.919   44.212 49.197 1.00 33.64 ? 330 THR A C     1 
ATOM   2527 O  O     . THR A 1 330 ? 4.999   44.463 50.404 1.00 33.01 ? 330 THR A O     1 
ATOM   2528 C  CB    . THR A 1 330 ? 2.808   43.467 48.044 1.00 29.38 ? 330 THR A CB    1 
ATOM   2529 O  OG1   . THR A 1 330 ? 2.097   44.341 48.922 1.00 32.60 ? 330 THR A OG1   1 
ATOM   2530 C  CG2   . THR A 1 330 ? 1.955   42.298 47.687 1.00 23.22 ? 330 THR A CG2   1 
ATOM   2531 N  N     . LYS A 1 331 ? 5.522   44.921 48.229 1.00 34.26 ? 331 LYS A N     1 
ATOM   2532 C  CA    . LYS A 1 331 ? 6.326   46.123 48.427 1.00 29.84 ? 331 LYS A CA    1 
ATOM   2533 C  C     . LYS A 1 331 ? 7.506   46.009 49.391 1.00 32.77 ? 331 LYS A C     1 
ATOM   2534 O  O     . LYS A 1 331 ? 7.948   47.021 49.945 1.00 34.93 ? 331 LYS A O     1 
ATOM   2535 C  CB    . LYS A 1 331 ? 5.435   47.282 48.830 1.00 24.46 ? 331 LYS A CB    1 
ATOM   2536 C  CG    . LYS A 1 331 ? 4.331   47.568 47.854 1.00 22.36 ? 331 LYS A CG    1 
ATOM   2537 C  CD    . LYS A 1 331 ? 4.158   49.047 47.757 1.00 23.18 ? 331 LYS A CD    1 
ATOM   2538 C  CE    . LYS A 1 331 ? 3.037   49.408 46.838 1.00 30.16 ? 331 LYS A CE    1 
ATOM   2539 N  NZ    . LYS A 1 331 ? 2.944   50.898 46.707 1.00 35.78 ? 331 LYS A NZ    1 
ATOM   2540 N  N     . LEU A 1 332 ? 8.016   44.795 49.596 1.00 34.91 ? 332 LEU A N     1 
ATOM   2541 C  CA    . LEU A 1 332 ? 9.171   44.586 50.471 1.00 37.16 ? 332 LEU A CA    1 
ATOM   2542 C  C     . LEU A 1 332 ? 10.312  45.537 50.038 1.00 41.47 ? 332 LEU A C     1 
ATOM   2543 O  O     . LEU A 1 332 ? 11.012  46.151 50.878 1.00 41.20 ? 332 LEU A O     1 
ATOM   2544 C  CB    . LEU A 1 332 ? 9.653   43.156 50.343 1.00 35.47 ? 332 LEU A CB    1 
ATOM   2545 C  CG    . LEU A 1 332 ? 10.798  42.790 51.272 1.00 39.65 ? 332 LEU A CG    1 
ATOM   2546 C  CD1   . LEU A 1 332 ? 10.300  42.766 52.718 1.00 42.09 ? 332 LEU A CD1   1 
ATOM   2547 C  CD2   . LEU A 1 332 ? 11.342  41.417 50.899 1.00 44.18 ? 332 LEU A CD2   1 
ATOM   2548 N  N     . ASP A 1 333 ? 10.461  45.669 48.716 1.00 41.41 ? 333 ASP A N     1 
ATOM   2549 C  CA    . ASP A 1 333 ? 11.478  46.517 48.106 1.00 35.75 ? 333 ASP A CA    1 
ATOM   2550 C  C     . ASP A 1 333 ? 11.412  47.927 48.596 1.00 33.58 ? 333 ASP A C     1 
ATOM   2551 O  O     . ASP A 1 333 ? 12.362  48.666 48.425 1.00 38.73 ? 333 ASP A O     1 
ATOM   2552 C  CB    . ASP A 1 333 ? 11.328  46.546 46.593 1.00 35.99 ? 333 ASP A CB    1 
ATOM   2553 C  CG    . ASP A 1 333 ? 10.119  47.331 46.145 1.00 38.81 ? 333 ASP A CG    1 
ATOM   2554 O  OD1   . ASP A 1 333 ? 8.996   46.776 46.144 1.00 38.54 ? 333 ASP A OD1   1 
ATOM   2555 O  OD2   . ASP A 1 333 ? 10.282  48.512 45.774 1.00 41.39 ? 333 ASP A OD2   1 
ATOM   2556 N  N     . VAL A 1 334 ? 10.298  48.315 49.206 1.00 35.70 ? 334 VAL A N     1 
ATOM   2557 C  CA    . VAL A 1 334 ? 10.126  49.689 49.682 1.00 37.80 ? 334 VAL A CA    1 
ATOM   2558 C  C     . VAL A 1 334 ? 10.813  49.982 51.008 1.00 41.22 ? 334 VAL A C     1 
ATOM   2559 O  O     . VAL A 1 334 ? 11.115  51.135 51.312 1.00 43.23 ? 334 VAL A O     1 
ATOM   2560 C  CB    . VAL A 1 334 ? 8.624   50.073 49.770 1.00 37.18 ? 334 VAL A CB    1 
ATOM   2561 C  CG1   . VAL A 1 334 ? 8.452   51.492 50.353 1.00 33.23 ? 334 VAL A CG1   1 
ATOM   2562 C  CG2   . VAL A 1 334 ? 7.985   49.980 48.381 1.00 28.05 ? 334 VAL A CG2   1 
ATOM   2563 N  N     . LEU A 1 335 ? 11.066  48.933 51.788 1.00 41.30 ? 335 LEU A N     1 
ATOM   2564 C  CA    . LEU A 1 335 ? 11.715  49.093 53.077 1.00 42.17 ? 335 LEU A CA    1 
ATOM   2565 C  C     . LEU A 1 335 ? 13.237  49.322 52.956 1.00 45.26 ? 335 LEU A C     1 
ATOM   2566 O  O     . LEU A 1 335 ? 13.866  49.861 53.879 1.00 46.99 ? 335 LEU A O     1 
ATOM   2567 C  CB    . LEU A 1 335 ? 11.422  47.879 53.966 1.00 38.69 ? 335 LEU A CB    1 
ATOM   2568 C  CG    . LEU A 1 335 ? 9.957   47.584 54.310 1.00 36.23 ? 335 LEU A CG    1 
ATOM   2569 C  CD1   . LEU A 1 335 ? 9.877   46.490 55.324 1.00 33.05 ? 335 LEU A CD1   1 
ATOM   2570 C  CD2   . LEU A 1 335 ? 9.266   48.795 54.864 1.00 34.32 ? 335 LEU A CD2   1 
ATOM   2571 N  N     . ASP A 1 336 ? 13.824  48.899 51.835 1.00 44.82 ? 336 ASP A N     1 
ATOM   2572 C  CA    . ASP A 1 336 ? 15.260  49.053 51.566 1.00 43.93 ? 336 ASP A CA    1 
ATOM   2573 C  C     . ASP A 1 336 ? 15.793  50.407 51.991 1.00 44.41 ? 336 ASP A C     1 
ATOM   2574 O  O     . ASP A 1 336 ? 15.197  51.434 51.657 1.00 43.43 ? 336 ASP A O     1 
ATOM   2575 C  CB    . ASP A 1 336 ? 15.524  48.906 50.077 1.00 41.33 ? 336 ASP A CB    1 
ATOM   2576 C  CG    . ASP A 1 336 ? 15.102  47.574 49.546 1.00 42.31 ? 336 ASP A CG    1 
ATOM   2577 O  OD1   . ASP A 1 336 ? 15.001  47.416 48.312 1.00 40.05 ? 336 ASP A OD1   1 
ATOM   2578 O  OD2   . ASP A 1 336 ? 14.877  46.656 50.362 1.00 44.85 ? 336 ASP A OD2   1 
ATOM   2579 N  N     . GLY A 1 337 ? 16.910  50.399 52.728 1.00 45.89 ? 337 GLY A N     1 
ATOM   2580 C  CA    . GLY A 1 337 ? 17.535  51.638 53.165 1.00 44.12 ? 337 GLY A CA    1 
ATOM   2581 C  C     . GLY A 1 337 ? 17.140  52.185 54.525 1.00 44.09 ? 337 GLY A C     1 
ATOM   2582 O  O     . GLY A 1 337 ? 17.609  53.249 54.938 1.00 43.87 ? 337 GLY A O     1 
ATOM   2583 N  N     . LEU A 1 338 ? 16.234  51.505 55.207 1.00 43.38 ? 338 LEU A N     1 
ATOM   2584 C  CA    . LEU A 1 338 ? 15.844  51.940 56.527 1.00 42.51 ? 338 LEU A CA    1 
ATOM   2585 C  C     . LEU A 1 338 ? 16.859  51.338 57.487 1.00 45.45 ? 338 LEU A C     1 
ATOM   2586 O  O     . LEU A 1 338 ? 17.433  50.275 57.211 1.00 43.58 ? 338 LEU A O     1 
ATOM   2587 C  CB    . LEU A 1 338 ? 14.439  51.441 56.863 1.00 41.37 ? 338 LEU A CB    1 
ATOM   2588 C  CG    . LEU A 1 338 ? 13.272  52.049 56.094 1.00 34.73 ? 338 LEU A CG    1 
ATOM   2589 C  CD1   . LEU A 1 338 ? 12.021  51.256 56.388 1.00 35.82 ? 338 LEU A CD1   1 
ATOM   2590 C  CD2   . LEU A 1 338 ? 13.100  53.497 56.491 1.00 36.71 ? 338 LEU A CD2   1 
ATOM   2591 N  N     . LYS A 1 339 ? 17.097  52.031 58.604 1.00 48.31 ? 339 LYS A N     1 
ATOM   2592 C  CA    . LYS A 1 339 ? 18.032  51.561 59.635 1.00 48.01 ? 339 LYS A CA    1 
ATOM   2593 C  C     . LYS A 1 339 ? 17.367  50.415 60.389 1.00 44.09 ? 339 LYS A C     1 
ATOM   2594 O  O     . LYS A 1 339 ? 17.998  49.410 60.684 1.00 42.77 ? 339 LYS A O     1 
ATOM   2595 C  CB    . LYS A 1 339 ? 18.404  52.701 60.605 1.00 48.59 ? 339 LYS A CB    1 
ATOM   2596 C  CG    . LYS A 1 339 ? 19.304  52.292 61.768 1.00 54.52 ? 339 LYS A CG    1 
ATOM   2597 C  CD    . LYS A 1 339 ? 20.759  52.080 61.342 1.00 56.66 ? 339 LYS A CD    1 
ATOM   2598 C  CE    . LYS A 1 339 ? 21.404  50.921 62.126 1.00 59.68 ? 339 LYS A CE    1 
ATOM   2599 N  NZ    . LYS A 1 339 ? 22.843  50.682 61.761 1.00 58.53 ? 339 LYS A NZ    1 
ATOM   2600 N  N     . GLU A 1 340 ? 16.085  50.568 60.687 1.00 42.08 ? 340 GLU A N     1 
ATOM   2601 C  CA    . GLU A 1 340 ? 15.359  49.523 61.372 1.00 44.16 ? 340 GLU A CA    1 
ATOM   2602 C  C     . GLU A 1 340 ? 13.887  49.554 61.020 1.00 42.92 ? 340 GLU A C     1 
ATOM   2603 O  O     . GLU A 1 340 ? 13.329  50.596 60.693 1.00 42.60 ? 340 GLU A O     1 
ATOM   2604 C  CB    . GLU A 1 340 ? 15.572  49.599 62.881 1.00 49.14 ? 340 GLU A CB    1 
ATOM   2605 C  CG    . GLU A 1 340 ? 15.560  51.014 63.466 1.00 54.87 ? 340 GLU A CG    1 
ATOM   2606 C  CD    . GLU A 1 340 ? 15.527  51.044 64.997 1.00 51.66 ? 340 GLU A CD    1 
ATOM   2607 O  OE1   . GLU A 1 340 ? 16.264  50.283 65.651 1.00 48.40 ? 340 GLU A OE1   1 
ATOM   2608 O  OE2   . GLU A 1 340 ? 14.748  51.837 65.550 1.00 55.47 ? 340 GLU A OE2   1 
ATOM   2609 N  N     . VAL A 1 341 ? 13.276  48.381 61.010 1.00 42.90 ? 341 VAL A N     1 
ATOM   2610 C  CA    . VAL A 1 341 ? 11.860  48.268 60.691 1.00 43.71 ? 341 VAL A CA    1 
ATOM   2611 C  C     . VAL A 1 341 ? 11.208  47.739 61.957 1.00 43.50 ? 341 VAL A C     1 
ATOM   2612 O  O     . VAL A 1 341 ? 11.899  47.264 62.847 1.00 45.41 ? 341 VAL A O     1 
ATOM   2613 C  CB    . VAL A 1 341 ? 11.600  47.294 59.478 1.00 41.16 ? 341 VAL A CB    1 
ATOM   2614 C  CG1   . VAL A 1 341 ? 12.191  47.868 58.199 1.00 36.61 ? 341 VAL A CG1   1 
ATOM   2615 C  CG2   . VAL A 1 341 ? 12.188  45.912 59.751 1.00 39.59 ? 341 VAL A CG2   1 
ATOM   2616 N  N     . LYS A 1 342 ? 9.893   47.836 62.063 1.00 43.51 ? 342 LYS A N     1 
ATOM   2617 C  CA    . LYS A 1 342 ? 9.227   47.331 63.246 1.00 44.01 ? 342 LYS A CA    1 
ATOM   2618 C  C     . LYS A 1 342 ? 7.814   46.892 62.959 1.00 43.08 ? 342 LYS A C     1 
ATOM   2619 O  O     . LYS A 1 342 ? 7.153   47.410 62.045 1.00 41.93 ? 342 LYS A O     1 
ATOM   2620 C  CB    . LYS A 1 342 ? 9.274   48.352 64.394 1.00 48.38 ? 342 LYS A CB    1 
ATOM   2621 C  CG    . LYS A 1 342 ? 8.581   49.661 64.149 1.00 48.74 ? 342 LYS A CG    1 
ATOM   2622 C  CD    . LYS A 1 342 ? 8.732   50.607 65.342 1.00 49.81 ? 342 LYS A CD    1 
ATOM   2623 C  CE    . LYS A 1 342 ? 10.074  51.299 65.375 1.00 43.08 ? 342 LYS A CE    1 
ATOM   2624 N  NZ    . LYS A 1 342 ? 10.038  52.378 66.397 1.00 36.05 ? 342 LYS A NZ    1 
ATOM   2625 N  N     . LEU A 1 343 ? 7.370   45.905 63.726 1.00 41.06 ? 343 LEU A N     1 
ATOM   2626 C  CA    . LEU A 1 343 ? 6.041   45.346 63.574 1.00 38.47 ? 343 LEU A CA    1 
ATOM   2627 C  C     . LEU A 1 343 ? 5.228   45.557 64.840 1.00 38.17 ? 343 LEU A C     1 
ATOM   2628 O  O     . LEU A 1 343 ? 5.703   45.264 65.944 1.00 38.63 ? 343 LEU A O     1 
ATOM   2629 C  CB    . LEU A 1 343 ? 6.120   43.830 63.384 1.00 38.17 ? 343 LEU A CB    1 
ATOM   2630 C  CG    . LEU A 1 343 ? 7.235   43.130 62.649 1.00 36.29 ? 343 LEU A CG    1 
ATOM   2631 C  CD1   . LEU A 1 343 ? 6.941   41.677 62.629 1.00 36.79 ? 343 LEU A CD1   1 
ATOM   2632 C  CD2   . LEU A 1 343 ? 7.276   43.639 61.271 1.00 40.47 ? 343 LEU A CD2   1 
ATOM   2633 N  N     . CYS A 1 344 ? 4.003   46.038 64.694 1.00 34.29 ? 344 CYS A N     1 
ATOM   2634 C  CA    . CYS A 1 344 ? 3.158   46.156 65.865 1.00 31.42 ? 344 CYS A CA    1 
ATOM   2635 C  C     . CYS A 1 344 ? 2.713   44.737 66.254 1.00 30.99 ? 344 CYS A C     1 
ATOM   2636 O  O     . CYS A 1 344 ? 1.991   44.077 65.499 1.00 27.07 ? 344 CYS A O     1 
ATOM   2637 C  CB    . CYS A 1 344 ? 1.935   46.974 65.554 1.00 30.09 ? 344 CYS A CB    1 
ATOM   2638 S  SG    . CYS A 1 344 ? 0.814   46.991 66.921 1.00 31.68 ? 344 CYS A SG    1 
ATOM   2639 N  N     . VAL A 1 345 ? 3.150   44.278 67.426 1.00 32.12 ? 345 VAL A N     1 
ATOM   2640 C  CA    . VAL A 1 345 ? 2.822   42.946 67.949 1.00 31.45 ? 345 VAL A CA    1 
ATOM   2641 C  C     . VAL A 1 345 ? 1.679   42.907 68.971 1.00 33.12 ? 345 VAL A C     1 
ATOM   2642 O  O     . VAL A 1 345 ? 1.049   41.841 69.157 1.00 32.87 ? 345 VAL A O     1 
ATOM   2643 C  CB    . VAL A 1 345 ? 4.012   42.305 68.585 1.00 30.11 ? 345 VAL A CB    1 
ATOM   2644 C  CG1   . VAL A 1 345 ? 5.019   41.983 67.541 1.00 33.65 ? 345 VAL A CG1   1 
ATOM   2645 C  CG2   . VAL A 1 345 ? 4.601   43.256 69.596 1.00 33.57 ? 345 VAL A CG2   1 
ATOM   2646 N  N     . ALA A 1 346 ? 1.424   44.027 69.659 1.00 31.91 ? 346 ALA A N     1 
ATOM   2647 C  CA    . ALA A 1 346 ? 0.312   44.083 70.623 1.00 28.72 ? 346 ALA A CA    1 
ATOM   2648 C  C     . ALA A 1 346 ? -0.246  45.496 70.740 1.00 26.15 ? 346 ALA A C     1 
ATOM   2649 O  O     . ALA A 1 346 ? 0.394   46.451 70.299 1.00 24.74 ? 346 ALA A O     1 
ATOM   2650 C  CB    . ALA A 1 346 ? 0.742   43.560 71.984 1.00 25.77 ? 346 ALA A CB    1 
ATOM   2651 N  N     . TYR A 1 347 ? -1.471  45.619 71.238 1.00 24.97 ? 347 TYR A N     1 
ATOM   2652 C  CA    . TYR A 1 347 ? -2.069  46.937 71.440 1.00 29.02 ? 347 TYR A CA    1 
ATOM   2653 C  C     . TYR A 1 347 ? -2.091  47.253 72.945 1.00 32.34 ? 347 TYR A C     1 
ATOM   2654 O  O     . TYR A 1 347 ? -2.385  46.385 73.788 1.00 30.50 ? 347 TYR A O     1 
ATOM   2655 C  CB    . TYR A 1 347 ? -3.533  47.001 70.953 1.00 34.61 ? 347 TYR A CB    1 
ATOM   2656 C  CG    . TYR A 1 347 ? -3.785  47.105 69.445 1.00 37.36 ? 347 TYR A CG    1 
ATOM   2657 C  CD1   . TYR A 1 347 ? -2.724  47.221 68.519 1.00 38.01 ? 347 TYR A CD1   1 
ATOM   2658 C  CD2   . TYR A 1 347 ? -5.084  47.059 68.951 1.00 29.87 ? 347 TYR A CD2   1 
ATOM   2659 C  CE1   . TYR A 1 347 ? -2.965  47.280 67.140 1.00 32.85 ? 347 TYR A CE1   1 
ATOM   2660 C  CE2   . TYR A 1 347 ? -5.336  47.110 67.577 1.00 37.26 ? 347 TYR A CE2   1 
ATOM   2661 C  CZ    . TYR A 1 347 ? -4.279  47.222 66.674 1.00 37.58 ? 347 TYR A CZ    1 
ATOM   2662 O  OH    . TYR A 1 347 ? -4.575  47.237 65.326 1.00 27.14 ? 347 TYR A OH    1 
ATOM   2663 N  N     . ARG A 1 348 ? -1.743  48.482 73.289 1.00 33.13 ? 348 ARG A N     1 
ATOM   2664 C  CA    . ARG A 1 348 ? -1.823  48.911 74.670 1.00 33.49 ? 348 ARG A CA    1 
ATOM   2665 C  C     . ARG A 1 348 ? -3.178  49.648 74.720 1.00 32.49 ? 348 ARG A C     1 
ATOM   2666 O  O     . ARG A 1 348 ? -3.353  50.685 74.083 1.00 32.46 ? 348 ARG A O     1 
ATOM   2667 C  CB    . ARG A 1 348 ? -0.672  49.844 75.025 1.00 30.90 ? 348 ARG A CB    1 
ATOM   2668 C  CG    . ARG A 1 348 ? -0.788  50.451 76.434 1.00 35.51 ? 348 ARG A CG    1 
ATOM   2669 C  CD    . ARG A 1 348 ? -0.639  49.448 77.587 1.00 36.56 ? 348 ARG A CD    1 
ATOM   2670 N  NE    . ARG A 1 348 ? 0.597   48.686 77.461 1.00 38.14 ? 348 ARG A NE    1 
ATOM   2671 C  CZ    . ARG A 1 348 ? 0.842   47.630 78.231 1.00 34.49 ? 348 ARG A CZ    1 
ATOM   2672 N  NH1   . ARG A 1 348 ? -0.034  47.269 79.159 1.00 35.85 ? 348 ARG A NH1   1 
ATOM   2673 N  NH2   . ARG A 1 348 ? 1.914   46.878 78.009 1.00 23.24 ? 348 ARG A NH2   1 
ATOM   2674 N  N     . MET A 1 349 ? -4.160  49.096 75.418 1.00 31.62 ? 349 MET A N     1 
ATOM   2675 C  CA    . MET A 1 349 ? -5.461  49.743 75.468 1.00 30.20 ? 349 MET A CA    1 
ATOM   2676 C  C     . MET A 1 349 ? -5.397  50.916 76.429 1.00 33.13 ? 349 MET A C     1 
ATOM   2677 O  O     . MET A 1 349 ? -4.536  50.957 77.300 1.00 37.96 ? 349 MET A O     1 
ATOM   2678 C  CB    . MET A 1 349 ? -6.521  48.762 75.933 1.00 27.91 ? 349 MET A CB    1 
ATOM   2679 C  CG    . MET A 1 349 ? -6.773  47.593 75.016 1.00 28.59 ? 349 MET A CG    1 
ATOM   2680 S  SD    . MET A 1 349 ? -6.908  48.096 73.307 1.00 28.26 ? 349 MET A SD    1 
ATOM   2681 C  CE    . MET A 1 349 ? -8.585  48.746 73.218 1.00 19.06 ? 349 MET A CE    1 
ATOM   2682 N  N     . PRO A 1 350 ? -6.330  51.871 76.316 1.00 34.50 ? 350 PRO A N     1 
ATOM   2683 C  CA    . PRO A 1 350 ? -6.388  53.056 77.172 1.00 36.60 ? 350 PRO A CA    1 
ATOM   2684 C  C     . PRO A 1 350 ? -6.607  52.804 78.665 1.00 37.40 ? 350 PRO A C     1 
ATOM   2685 O  O     . PRO A 1 350 ? -6.355  53.711 79.477 1.00 40.54 ? 350 PRO A O     1 
ATOM   2686 C  CB    . PRO A 1 350 ? -7.520  53.873 76.542 1.00 34.16 ? 350 PRO A CB    1 
ATOM   2687 C  CG    . PRO A 1 350 ? -8.369  52.847 75.992 1.00 37.56 ? 350 PRO A CG    1 
ATOM   2688 C  CD    . PRO A 1 350 ? -7.406  51.926 75.322 1.00 35.03 ? 350 PRO A CD    1 
ATOM   2689 N  N     . ASP A 1 351 ? -7.052  51.608 79.052 1.00 34.01 ? 351 ASP A N     1 
ATOM   2690 C  CA    . ASP A 1 351 ? -7.240  51.338 80.479 1.00 33.37 ? 351 ASP A CA    1 
ATOM   2691 C  C     . ASP A 1 351 ? -6.063  50.603 81.030 1.00 31.54 ? 351 ASP A C     1 
ATOM   2692 O  O     . ASP A 1 351 ? -6.143  50.027 82.139 1.00 28.88 ? 351 ASP A O     1 
ATOM   2693 C  CB    . ASP A 1 351 ? -8.507  50.556 80.770 1.00 32.49 ? 351 ASP A CB    1 
ATOM   2694 C  CG    . ASP A 1 351 ? -8.521  49.195 80.111 1.00 39.02 ? 351 ASP A CG    1 
ATOM   2695 O  OD1   . ASP A 1 351 ? -9.541  48.490 80.265 1.00 47.01 ? 351 ASP A OD1   1 
ATOM   2696 O  OD2   . ASP A 1 351 ? -7.538  48.807 79.441 1.00 37.49 ? 351 ASP A OD2   1 
ATOM   2697 N  N     . GLY A 1 352 ? -4.971  50.611 80.264 1.00 34.34 ? 352 GLY A N     1 
ATOM   2698 C  CA    . GLY A 1 352 ? -3.725  49.977 80.665 1.00 34.03 ? 352 GLY A CA    1 
ATOM   2699 C  C     . GLY A 1 352 ? -3.545  48.546 80.246 1.00 32.81 ? 352 GLY A C     1 
ATOM   2700 O  O     . GLY A 1 352 ? -2.429  48.011 80.268 1.00 32.89 ? 352 GLY A O     1 
ATOM   2701 N  N     . ARG A 1 353 ? -4.636  47.926 79.823 1.00 35.18 ? 353 ARG A N     1 
ATOM   2702 C  CA    . ARG A 1 353 ? -4.603  46.533 79.432 1.00 38.63 ? 353 ARG A CA    1 
ATOM   2703 C  C     . ARG A 1 353 ? -3.826  46.332 78.139 1.00 36.35 ? 353 ARG A C     1 
ATOM   2704 O  O     . ARG A 1 353 ? -3.870  47.169 77.240 1.00 32.96 ? 353 ARG A O     1 
ATOM   2705 C  CB    . ARG A 1 353 ? -6.040  45.993 79.330 1.00 39.49 ? 353 ARG A CB    1 
ATOM   2706 C  CG    . ARG A 1 353 ? -6.108  44.502 79.090 1.00 51.08 ? 353 ARG A CG    1 
ATOM   2707 C  CD    . ARG A 1 353 ? -7.534  43.974 79.013 1.00 58.27 ? 353 ARG A CD    1 
ATOM   2708 N  NE    . ARG A 1 353 ? -8.336  44.654 77.992 1.00 66.14 ? 353 ARG A NE    1 
ATOM   2709 C  CZ    . ARG A 1 353 ? -8.977  45.780 78.291 1.00 64.55 ? 353 ARG A CZ    1 
ATOM   2710 N  NH1   . ARG A 1 353 ? -8.889  46.263 79.514 1.00 63.91 ? 353 ARG A NH1   1 
ATOM   2711 N  NH2   . ARG A 1 353 ? -9.666  46.435 77.362 1.00 63.82 ? 353 ARG A NH2   1 
ATOM   2712 N  N     . GLU A 1 354 ? -3.036  45.271 78.081 1.00 38.82 ? 354 GLU A N     1 
ATOM   2713 C  CA    . GLU A 1 354 ? -2.288  44.965 76.860 1.00 43.13 ? 354 GLU A CA    1 
ATOM   2714 C  C     . GLU A 1 354 ? -3.056  43.852 76.137 1.00 41.58 ? 354 GLU A C     1 
ATOM   2715 O  O     . GLU A 1 354 ? -3.426  42.844 76.733 1.00 43.30 ? 354 GLU A O     1 
ATOM   2716 C  CB    . GLU A 1 354 ? -0.877  44.501 77.177 1.00 42.75 ? 354 GLU A CB    1 
ATOM   2717 C  CG    . GLU A 1 354 ? -0.015  44.456 75.967 1.00 44.96 ? 354 GLU A CG    1 
ATOM   2718 C  CD    . GLU A 1 354 ? 1.145   43.540 76.134 1.00 49.71 ? 354 GLU A CD    1 
ATOM   2719 O  OE1   . GLU A 1 354 ? 2.179   43.806 75.498 1.00 58.06 ? 354 GLU A OE1   1 
ATOM   2720 O  OE2   . GLU A 1 354 ? 1.026   42.537 76.874 1.00 54.43 ? 354 GLU A OE2   1 
ATOM   2721 N  N     . VAL A 1 355 ? -3.299  44.021 74.853 1.00 38.68 ? 355 VAL A N     1 
ATOM   2722 C  CA    . VAL A 1 355 ? -4.072  43.039 74.145 1.00 37.48 ? 355 VAL A CA    1 
ATOM   2723 C  C     . VAL A 1 355 ? -3.481  42.726 72.763 1.00 36.75 ? 355 VAL A C     1 
ATOM   2724 O  O     . VAL A 1 355 ? -2.768  43.560 72.190 1.00 37.57 ? 355 VAL A O     1 
ATOM   2725 C  CB    . VAL A 1 355 ? -5.508  43.573 74.048 1.00 34.60 ? 355 VAL A CB    1 
ATOM   2726 C  CG1   . VAL A 1 355 ? -5.544  44.773 73.131 1.00 36.15 ? 355 VAL A CG1   1 
ATOM   2727 C  CG2   . VAL A 1 355 ? -6.463  42.492 73.593 1.00 44.54 ? 355 VAL A CG2   1 
ATOM   2728 N  N     . THR A 1 356 ? -3.692  41.498 72.271 1.00 35.64 ? 356 THR A N     1 
ATOM   2729 C  CA    . THR A 1 356 ? -3.211  41.107 70.938 1.00 34.06 ? 356 THR A CA    1 
ATOM   2730 C  C     . THR A 1 356 ? -4.374  40.923 69.985 1.00 32.68 ? 356 THR A C     1 
ATOM   2731 O  O     . THR A 1 356 ? -4.224  40.313 68.924 1.00 29.72 ? 356 THR A O     1 
ATOM   2732 C  CB    . THR A 1 356 ? -2.372  39.825 70.927 1.00 31.19 ? 356 THR A CB    1 
ATOM   2733 O  OG1   . THR A 1 356 ? -2.856  38.910 71.906 1.00 34.61 ? 356 THR A OG1   1 
ATOM   2734 C  CG2   . THR A 1 356 ? -0.925  40.141 71.175 1.00 33.65 ? 356 THR A CG2   1 
ATOM   2735 N  N     . THR A 1 357 ? -5.516  41.479 70.375 1.00 31.22 ? 357 THR A N     1 
ATOM   2736 C  CA    . THR A 1 357 ? -6.749  41.438 69.608 1.00 30.56 ? 357 THR A CA    1 
ATOM   2737 C  C     . THR A 1 357 ? -7.159  42.897 69.298 1.00 30.33 ? 357 THR A C     1 
ATOM   2738 O  O     . THR A 1 357 ? -6.832  43.820 70.067 1.00 30.24 ? 357 THR A O     1 
ATOM   2739 C  CB    . THR A 1 357 ? -7.811  40.689 70.413 1.00 33.99 ? 357 THR A CB    1 
ATOM   2740 O  OG1   . THR A 1 357 ? -7.929  39.355 69.903 1.00 28.48 ? 357 THR A OG1   1 
ATOM   2741 C  CG2   . THR A 1 357 ? -9.161  41.391 70.370 1.00 40.59 ? 357 THR A CG2   1 
ATOM   2742 N  N     . THR A 1 358 ? -7.847  43.113 68.180 1.00 28.27 ? 358 THR A N     1 
ATOM   2743 C  CA    . THR A 1 358 ? -8.239  44.463 67.771 1.00 24.65 ? 358 THR A CA    1 
ATOM   2744 C  C     . THR A 1 358 ? -9.653  44.752 68.194 1.00 21.72 ? 358 THR A C     1 
ATOM   2745 O  O     . THR A 1 358 ? -10.413 43.818 68.408 1.00 24.32 ? 358 THR A O     1 
ATOM   2746 C  CB    . THR A 1 358 ? -8.333  44.561 66.230 1.00 24.13 ? 358 THR A CB    1 
ATOM   2747 O  OG1   . THR A 1 358 ? -9.232  43.546 65.775 1.00 26.18 ? 358 THR A OG1   1 
ATOM   2748 C  CG2   . THR A 1 358 ? -6.997  44.386 65.529 1.00 22.19 ? 358 THR A CG2   1 
ATOM   2749 N  N     . PRO A 1 359 ? -10.015 46.030 68.404 1.00 23.51 ? 359 PRO A N     1 
ATOM   2750 C  CA    . PRO A 1 359 ? -11.410 46.367 68.777 1.00 24.34 ? 359 PRO A CA    1 
ATOM   2751 C  C     . PRO A 1 359 ? -12.161 46.325 67.404 1.00 25.83 ? 359 PRO A C     1 
ATOM   2752 O  O     . PRO A 1 359 ? -11.555 46.147 66.343 1.00 24.84 ? 359 PRO A O     1 
ATOM   2753 C  CB    . PRO A 1 359 ? -11.324 47.833 69.267 1.00 21.65 ? 359 PRO A CB    1 
ATOM   2754 C  CG    . PRO A 1 359 ? -9.837  48.087 69.535 1.00 26.34 ? 359 PRO A CG    1 
ATOM   2755 C  CD    . PRO A 1 359 ? -9.117  47.199 68.533 1.00 26.19 ? 359 PRO A CD    1 
ATOM   2756 N  N     . LEU A 1 360 ? -13.466 46.508 67.388 1.00 26.63 ? 360 LEU A N     1 
ATOM   2757 C  CA    . LEU A 1 360 ? -14.147 46.479 66.109 1.00 27.93 ? 360 LEU A CA    1 
ATOM   2758 C  C     . LEU A 1 360 ? -14.465 47.891 65.565 1.00 31.17 ? 360 LEU A C     1 
ATOM   2759 O  O     . LEU A 1 360 ? -13.782 48.399 64.665 1.00 29.38 ? 360 LEU A O     1 
ATOM   2760 C  CB    . LEU A 1 360 ? -15.421 45.630 66.201 1.00 35.04 ? 360 LEU A CB    1 
ATOM   2761 C  CG    . LEU A 1 360 ? -15.342 44.281 66.925 1.00 39.98 ? 360 LEU A CG    1 
ATOM   2762 C  CD1   . LEU A 1 360 ? -16.606 43.479 66.561 1.00 38.89 ? 360 LEU A CD1   1 
ATOM   2763 C  CD2   . LEU A 1 360 ? -14.065 43.528 66.560 1.00 35.12 ? 360 LEU A CD2   1 
ATOM   2764 N  N     . ALA A 1 361 ? -15.487 48.538 66.109 1.00 32.98 ? 361 ALA A N     1 
ATOM   2765 C  CA    . ALA A 1 361 ? -15.884 49.854 65.639 1.00 32.07 ? 361 ALA A CA    1 
ATOM   2766 C  C     . ALA A 1 361 ? -14.813 50.874 65.933 1.00 34.10 ? 361 ALA A C     1 
ATOM   2767 O  O     . ALA A 1 361 ? -14.112 50.759 66.939 1.00 36.14 ? 361 ALA A O     1 
ATOM   2768 C  CB    . ALA A 1 361 ? -17.192 50.265 66.290 1.00 31.88 ? 361 ALA A CB    1 
ATOM   2769 N  N     . ALA A 1 362 ? -14.758 51.914 65.100 1.00 33.03 ? 362 ALA A N     1 
ATOM   2770 C  CA    . ALA A 1 362 ? -13.781 53.000 65.231 1.00 32.87 ? 362 ALA A CA    1 
ATOM   2771 C  C     . ALA A 1 362 ? -13.615 53.587 66.633 1.00 34.76 ? 362 ALA A C     1 
ATOM   2772 O  O     . ALA A 1 362 ? -12.485 53.654 67.151 1.00 36.43 ? 362 ALA A O     1 
ATOM   2773 C  CB    . ALA A 1 362 ? -14.088 54.142 64.210 1.00 32.52 ? 362 ALA A CB    1 
ATOM   2774 N  N     . ASP A 1 363 ? -14.722 54.007 67.250 1.00 37.06 ? 363 ASP A N     1 
ATOM   2775 C  CA    . ASP A 1 363 ? -14.668 54.615 68.580 1.00 35.84 ? 363 ASP A CA    1 
ATOM   2776 C  C     . ASP A 1 363 ? -13.916 53.740 69.578 1.00 38.62 ? 363 ASP A C     1 
ATOM   2777 O  O     . ASP A 1 363 ? -13.256 54.259 70.456 1.00 42.01 ? 363 ASP A O     1 
ATOM   2778 C  CB    . ASP A 1 363 ? -16.074 54.922 69.100 1.00 31.98 ? 363 ASP A CB    1 
ATOM   2779 C  CG    . ASP A 1 363 ? -16.738 56.117 68.386 1.00 36.31 ? 363 ASP A CG    1 
ATOM   2780 O  OD1   . ASP A 1 363 ? -16.062 56.812 67.585 1.00 37.10 ? 363 ASP A OD1   1 
ATOM   2781 O  OD2   . ASP A 1 363 ? -17.948 56.396 68.638 1.00 33.93 ? 363 ASP A OD2   1 
ATOM   2782 N  N     . ASP A 1 364 ? -13.991 52.422 69.429 1.00 38.77 ? 364 ASP A N     1 
ATOM   2783 C  CA    . ASP A 1 364 ? -13.299 51.511 70.330 1.00 37.09 ? 364 ASP A CA    1 
ATOM   2784 C  C     . ASP A 1 364 ? -11.790 51.501 70.101 1.00 38.39 ? 364 ASP A C     1 
ATOM   2785 O  O     . ASP A 1 364 ? -11.051 50.910 70.890 1.00 38.59 ? 364 ASP A O     1 
ATOM   2786 C  CB    . ASP A 1 364 ? -13.873 50.102 70.201 1.00 42.85 ? 364 ASP A CB    1 
ATOM   2787 C  CG    . ASP A 1 364 ? -15.319 50.020 70.661 1.00 50.43 ? 364 ASP A CG    1 
ATOM   2788 O  OD1   . ASP A 1 364 ? -16.129 49.260 70.057 1.00 53.25 ? 364 ASP A OD1   1 
ATOM   2789 O  OD2   . ASP A 1 364 ? -15.646 50.738 71.631 1.00 52.83 ? 364 ASP A OD2   1 
ATOM   2790 N  N     . TRP A 1 365 ? -11.326 52.105 68.992 1.00 39.56 ? 365 TRP A N     1 
ATOM   2791 C  CA    . TRP A 1 365 ? -9.875  52.209 68.706 1.00 35.09 ? 365 TRP A CA    1 
ATOM   2792 C  C     . TRP A 1 365 ? -9.346  53.538 69.235 1.00 34.57 ? 365 TRP A C     1 
ATOM   2793 O  O     . TRP A 1 365 ? -8.158  53.729 69.395 1.00 28.05 ? 365 TRP A O     1 
ATOM   2794 C  CB    . TRP A 1 365 ? -9.580  52.127 67.214 1.00 32.25 ? 365 TRP A CB    1 
ATOM   2795 C  CG    . TRP A 1 365 ? -10.089 50.863 66.536 1.00 31.59 ? 365 TRP A CG    1 
ATOM   2796 C  CD1   . TRP A 1 365 ? -11.385 50.482 66.392 1.00 28.82 ? 365 TRP A CD1   1 
ATOM   2797 C  CD2   . TRP A 1 365 ? -9.297  49.870 65.842 1.00 28.44 ? 365 TRP A CD2   1 
ATOM   2798 N  NE1   . TRP A 1 365 ? -11.457 49.330 65.638 1.00 31.76 ? 365 TRP A NE1   1 
ATOM   2799 C  CE2   . TRP A 1 365 ? -10.209 48.943 65.284 1.00 26.38 ? 365 TRP A CE2   1 
ATOM   2800 C  CE3   . TRP A 1 365 ? -7.926  49.704 65.621 1.00 29.29 ? 365 TRP A CE3   1 
ATOM   2801 C  CZ2   . TRP A 1 365 ? -9.772  47.836 64.543 1.00 23.14 ? 365 TRP A CZ2   1 
ATOM   2802 C  CZ3   . TRP A 1 365 ? -7.500  48.604 64.877 1.00 27.78 ? 365 TRP A CZ3   1 
ATOM   2803 C  CH2   . TRP A 1 365 ? -8.424  47.693 64.338 1.00 25.17 ? 365 TRP A CH2   1 
ATOM   2804 N  N     . LYS A 1 366 ? -10.286 54.424 69.544 1.00 43.55 ? 366 LYS A N     1 
ATOM   2805 C  CA    . LYS A 1 366 ? -10.048 55.763 70.050 1.00 47.57 ? 366 LYS A CA    1 
ATOM   2806 C  C     . LYS A 1 366 ? -8.643  56.056 70.485 1.00 47.63 ? 366 LYS A C     1 
ATOM   2807 O  O     . LYS A 1 366 ? -7.922  56.766 69.773 1.00 55.83 ? 366 LYS A O     1 
ATOM   2808 C  CB    . LYS A 1 366 ? -11.040 56.099 71.156 1.00 53.18 ? 366 LYS A CB    1 
ATOM   2809 C  CG    . LYS A 1 366 ? -11.414 57.581 71.233 1.00 61.41 ? 366 LYS A CG    1 
ATOM   2810 C  CD    . LYS A 1 366 ? -12.665 57.786 72.110 1.00 67.53 ? 366 LYS A CD    1 
ATOM   2811 C  CE    . LYS A 1 366 ? -13.931 57.248 71.418 1.00 70.57 ? 366 LYS A CE    1 
ATOM   2812 N  NZ    . LYS A 1 366 ? -15.117 57.082 72.327 1.00 70.15 ? 366 LYS A NZ    1 
ATOM   2813 N  N     . GLY A 1 367 ? -8.230  55.524 71.626 1.00 41.55 ? 367 GLY A N     1 
ATOM   2814 C  CA    . GLY A 1 367 ? -6.878  55.817 72.071 1.00 38.91 ? 367 GLY A CA    1 
ATOM   2815 C  C     . GLY A 1 367 ? -5.904  54.658 72.181 1.00 38.89 ? 367 GLY A C     1 
ATOM   2816 O  O     . GLY A 1 367 ? -4.997  54.705 73.011 1.00 41.48 ? 367 GLY A O     1 
ATOM   2817 N  N     . VAL A 1 368 ? -6.051  53.619 71.369 1.00 37.52 ? 368 VAL A N     1 
ATOM   2818 C  CA    . VAL A 1 368 ? -5.140  52.498 71.499 1.00 37.46 ? 368 VAL A CA    1 
ATOM   2819 C  C     . VAL A 1 368 ? -3.776  52.929 70.998 1.00 35.15 ? 368 VAL A C     1 
ATOM   2820 O  O     . VAL A 1 368 ? -3.675  53.820 70.160 1.00 37.17 ? 368 VAL A O     1 
ATOM   2821 C  CB    . VAL A 1 368 ? -5.666  51.244 70.769 1.00 38.37 ? 368 VAL A CB    1 
ATOM   2822 C  CG1   . VAL A 1 368 ? -7.169  51.032 71.111 1.00 37.19 ? 368 VAL A CG1   1 
ATOM   2823 C  CG2   . VAL A 1 368 ? -5.436  51.352 69.269 1.00 44.42 ? 368 VAL A CG2   1 
ATOM   2824 N  N     . GLU A 1 369 ? -2.729  52.303 71.507 1.00 34.68 ? 369 GLU A N     1 
ATOM   2825 C  CA    . GLU A 1 369 ? -1.370  52.639 71.122 1.00 33.29 ? 369 GLU A CA    1 
ATOM   2826 C  C     . GLU A 1 369 ? -0.629  51.393 70.687 1.00 33.52 ? 369 GLU A C     1 
ATOM   2827 O  O     . GLU A 1 369 ? -0.889  50.299 71.193 1.00 35.43 ? 369 GLU A O     1 
ATOM   2828 C  CB    . GLU A 1 369 ? -0.648  53.244 72.328 1.00 35.14 ? 369 GLU A CB    1 
ATOM   2829 C  CG    . GLU A 1 369 ? -1.181  54.585 72.733 1.00 36.33 ? 369 GLU A CG    1 
ATOM   2830 C  CD    . GLU A 1 369 ? -0.617  55.716 71.908 1.00 33.95 ? 369 GLU A CD    1 
ATOM   2831 O  OE1   . GLU A 1 369 ? -1.282  56.765 71.848 1.00 35.95 ? 369 GLU A OE1   1 
ATOM   2832 O  OE2   . GLU A 1 369 ? 0.496   55.571 71.354 1.00 33.55 ? 369 GLU A OE2   1 
ATOM   2833 N  N     . PRO A 1 370 ? 0.272   51.525 69.708 1.00 36.76 ? 370 PRO A N     1 
ATOM   2834 C  CA    . PRO A 1 370 ? 0.995   50.316 69.289 1.00 35.65 ? 370 PRO A CA    1 
ATOM   2835 C  C     . PRO A 1 370 ? 2.212   49.919 70.115 1.00 34.13 ? 370 PRO A C     1 
ATOM   2836 O  O     . PRO A 1 370 ? 3.036   50.759 70.476 1.00 35.52 ? 370 PRO A O     1 
ATOM   2837 C  CB    . PRO A 1 370 ? 1.395   50.635 67.844 1.00 33.66 ? 370 PRO A CB    1 
ATOM   2838 C  CG    . PRO A 1 370 ? 1.508   52.135 67.818 1.00 29.37 ? 370 PRO A CG    1 
ATOM   2839 C  CD    . PRO A 1 370 ? 0.331   52.579 68.669 1.00 33.43 ? 370 PRO A CD    1 
ATOM   2840 N  N     . ILE A 1 371 ? 2.319   48.634 70.422 1.00 32.49 ? 371 ILE A N     1 
ATOM   2841 C  CA    . ILE A 1 371 ? 3.480   48.115 71.133 1.00 30.93 ? 371 ILE A CA    1 
ATOM   2842 C  C     . ILE A 1 371 ? 4.287   47.385 70.042 1.00 35.51 ? 371 ILE A C     1 
ATOM   2843 O  O     . ILE A 1 371 ? 3.834   46.362 69.504 1.00 36.29 ? 371 ILE A O     1 
ATOM   2844 C  CB    . ILE A 1 371 ? 3.051   47.149 72.228 1.00 28.17 ? 371 ILE A CB    1 
ATOM   2845 C  CG1   . ILE A 1 371 ? 2.318   47.917 73.315 1.00 25.79 ? 371 ILE A CG1   1 
ATOM   2846 C  CG2   . ILE A 1 371 ? 4.253   46.402 72.786 1.00 21.23 ? 371 ILE A CG2   1 
ATOM   2847 C  CD1   . ILE A 1 371 ? 1.512   46.990 74.225 1.00 33.41 ? 371 ILE A CD1   1 
ATOM   2848 N  N     . TYR A 1 372 ? 5.476   47.896 69.729 1.00 34.69 ? 372 TYR A N     1 
ATOM   2849 C  CA    . TYR A 1 372 ? 6.304   47.347 68.659 1.00 34.62 ? 372 TYR A CA    1 
ATOM   2850 C  C     . TYR A 1 372 ? 7.366   46.287 68.939 1.00 34.69 ? 372 TYR A C     1 
ATOM   2851 O  O     . TYR A 1 372 ? 7.710   45.988 70.075 1.00 38.38 ? 372 TYR A O     1 
ATOM   2852 C  CB    . TYR A 1 372 ? 7.017   48.497 67.923 1.00 31.32 ? 372 TYR A CB    1 
ATOM   2853 C  CG    . TYR A 1 372 ? 6.135   49.453 67.178 1.00 30.70 ? 372 TYR A CG    1 
ATOM   2854 C  CD1   . TYR A 1 372 ? 5.648   49.132 65.922 1.00 37.79 ? 372 TYR A CD1   1 
ATOM   2855 C  CD2   . TYR A 1 372 ? 5.792   50.678 67.718 1.00 29.28 ? 372 TYR A CD2   1 
ATOM   2856 C  CE1   . TYR A 1 372 ? 4.830   49.994 65.225 1.00 33.44 ? 372 TYR A CE1   1 
ATOM   2857 C  CE2   . TYR A 1 372 ? 4.972   51.566 67.023 1.00 35.87 ? 372 TYR A CE2   1 
ATOM   2858 C  CZ    . TYR A 1 372 ? 4.496   51.206 65.774 1.00 34.92 ? 372 TYR A CZ    1 
ATOM   2859 O  OH    . TYR A 1 372 ? 3.664   52.038 65.070 1.00 36.89 ? 372 TYR A OH    1 
ATOM   2860 N  N     . GLU A 1 373 ? 7.859   45.708 67.854 1.00 33.22 ? 373 GLU A N     1 
ATOM   2861 C  CA    . GLU A 1 373 ? 8.954   44.771 67.882 1.00 32.59 ? 373 GLU A CA    1 
ATOM   2862 C  C     . GLU A 1 373 ? 9.856   45.509 66.885 1.00 36.08 ? 373 GLU A C     1 
ATOM   2863 O  O     . GLU A 1 373 ? 9.364   45.938 65.850 1.00 36.08 ? 373 GLU A O     1 
ATOM   2864 C  CB    . GLU A 1 373 ? 8.544   43.408 67.343 1.00 35.18 ? 373 GLU A CB    1 
ATOM   2865 C  CG    . GLU A 1 373 ? 8.657   42.314 68.374 1.00 31.96 ? 373 GLU A CG    1 
ATOM   2866 C  CD    . GLU A 1 373 ? 8.795   40.972 67.768 1.00 32.75 ? 373 GLU A CD    1 
ATOM   2867 O  OE1   . GLU A 1 373 ? 9.693   40.809 66.932 1.00 39.81 ? 373 GLU A OE1   1 
ATOM   2868 O  OE2   . GLU A 1 373 ? 8.042   40.065 68.146 1.00 34.50 ? 373 GLU A OE2   1 
ATOM   2869 N  N     . THR A 1 374 ? 11.127  45.742 67.215 1.00 34.61 ? 374 THR A N     1 
ATOM   2870 C  CA    . THR A 1 374 ? 11.992  46.465 66.294 1.00 38.17 ? 374 THR A CA    1 
ATOM   2871 C  C     . THR A 1 374 ? 13.083  45.582 65.708 1.00 41.80 ? 374 THR A C     1 
ATOM   2872 O  O     . THR A 1 374 ? 13.971  45.124 66.432 1.00 47.23 ? 374 THR A O     1 
ATOM   2873 C  CB    . THR A 1 374 ? 12.613  47.686 66.985 1.00 36.45 ? 374 THR A CB    1 
ATOM   2874 O  OG1   . THR A 1 374 ? 11.563  48.513 67.489 1.00 36.53 ? 374 THR A OG1   1 
ATOM   2875 C  CG2   . THR A 1 374 ? 13.462  48.503 66.025 1.00 32.45 ? 374 THR A CG2   1 
ATOM   2876 N  N     . MET A 1 375 ? 13.010  45.345 64.402 1.00 41.65 ? 375 MET A N     1 
ATOM   2877 C  CA    . MET A 1 375 ? 13.985  44.505 63.711 1.00 40.85 ? 375 MET A CA    1 
ATOM   2878 C  C     . MET A 1 375 ? 15.024  45.333 62.941 1.00 39.31 ? 375 MET A C     1 
ATOM   2879 O  O     . MET A 1 375 ? 14.785  46.494 62.570 1.00 38.25 ? 375 MET A O     1 
ATOM   2880 C  CB    . MET A 1 375 ? 13.270  43.559 62.727 1.00 41.19 ? 375 MET A CB    1 
ATOM   2881 C  CG    . MET A 1 375 ? 12.406  42.491 63.382 1.00 45.49 ? 375 MET A CG    1 
ATOM   2882 S  SD    . MET A 1 375 ? 12.062  41.027 62.363 1.00 45.68 ? 375 MET A SD    1 
ATOM   2883 C  CE    . MET A 1 375 ? 10.508  41.581 61.713 1.00 49.48 ? 375 MET A CE    1 
ATOM   2884 N  N     . PRO A 1 376 ? 16.212  44.775 62.746 1.00 37.00 ? 376 PRO A N     1 
ATOM   2885 C  CA    . PRO A 1 376 ? 17.182  45.570 61.998 1.00 40.11 ? 376 PRO A CA    1 
ATOM   2886 C  C     . PRO A 1 376 ? 16.759  45.682 60.505 1.00 43.88 ? 376 PRO A C     1 
ATOM   2887 O  O     . PRO A 1 376 ? 16.232  44.723 59.911 1.00 42.39 ? 376 PRO A O     1 
ATOM   2888 C  CB    . PRO A 1 376 ? 18.488  44.793 62.211 1.00 36.45 ? 376 PRO A CB    1 
ATOM   2889 C  CG    . PRO A 1 376 ? 18.047  43.387 62.470 1.00 34.71 ? 376 PRO A CG    1 
ATOM   2890 C  CD    . PRO A 1 376 ? 16.833  43.576 63.334 1.00 39.01 ? 376 PRO A CD    1 
ATOM   2891 N  N     . GLY A 1 377 ? 16.934  46.868 59.922 1.00 44.28 ? 377 GLY A N     1 
ATOM   2892 C  CA    . GLY A 1 377 ? 16.553  47.059 58.537 1.00 43.37 ? 377 GLY A CA    1 
ATOM   2893 C  C     . GLY A 1 377 ? 17.565  46.384 57.650 1.00 46.41 ? 377 GLY A C     1 
ATOM   2894 O  O     . GLY A 1 377 ? 18.239  45.440 58.092 1.00 45.69 ? 377 GLY A O     1 
ATOM   2895 N  N     . TRP A 1 378 ? 17.652  46.842 56.398 1.00 47.73 ? 378 TRP A N     1 
ATOM   2896 C  CA    . TRP A 1 378 ? 18.609  46.314 55.421 1.00 46.87 ? 378 TRP A CA    1 
ATOM   2897 C  C     . TRP A 1 378 ? 18.893  47.380 54.376 1.00 48.07 ? 378 TRP A C     1 
ATOM   2898 O  O     . TRP A 1 378 ? 17.970  48.067 53.901 1.00 46.02 ? 378 TRP A O     1 
ATOM   2899 C  CB    . TRP A 1 378 ? 18.122  45.016 54.764 1.00 48.39 ? 378 TRP A CB    1 
ATOM   2900 C  CG    . TRP A 1 378 ? 16.770  45.076 54.126 1.00 52.02 ? 378 TRP A CG    1 
ATOM   2901 C  CD1   . TRP A 1 378 ? 16.483  45.513 52.872 1.00 50.65 ? 378 TRP A CD1   1 
ATOM   2902 C  CD2   . TRP A 1 378 ? 15.527  44.637 54.701 1.00 54.81 ? 378 TRP A CD2   1 
ATOM   2903 N  NE1   . TRP A 1 378 ? 15.135  45.387 52.624 1.00 50.61 ? 378 TRP A NE1   1 
ATOM   2904 C  CE2   . TRP A 1 378 ? 14.518  44.865 53.728 1.00 54.02 ? 378 TRP A CE2   1 
ATOM   2905 C  CE3   . TRP A 1 378 ? 15.156  44.102 55.943 1.00 53.62 ? 378 TRP A CE3   1 
ATOM   2906 C  CZ2   . TRP A 1 378 ? 13.172  44.538 53.950 1.00 52.50 ? 378 TRP A CZ2   1 
ATOM   2907 C  CZ3   . TRP A 1 378 ? 13.819  43.775 56.163 1.00 53.51 ? 378 TRP A CZ3   1 
ATOM   2908 C  CH2   . TRP A 1 378 ? 12.842  44.012 55.174 1.00 54.27 ? 378 TRP A CH2   1 
ATOM   2909 N  N     . SER A 1 379 ? 20.174  47.565 54.055 1.00 47.64 ? 379 SER A N     1 
ATOM   2910 C  CA    . SER A 1 379 ? 20.544  48.592 53.085 1.00 45.30 ? 379 SER A CA    1 
ATOM   2911 C  C     . SER A 1 379 ? 20.599  48.083 51.673 1.00 41.67 ? 379 SER A C     1 
ATOM   2912 O  O     . SER A 1 379 ? 20.431  48.862 50.744 1.00 42.92 ? 379 SER A O     1 
ATOM   2913 C  CB    . SER A 1 379 ? 21.855  49.311 53.458 1.00 44.88 ? 379 SER A CB    1 
ATOM   2914 O  OG    . SER A 1 379 ? 22.954  48.423 53.604 1.00 46.05 ? 379 SER A OG    1 
ATOM   2915 N  N     . GLU A 1 380 ? 20.803  46.786 51.499 1.00 38.31 ? 380 GLU A N     1 
ATOM   2916 C  CA    . GLU A 1 380 ? 20.868  46.242 50.157 1.00 40.15 ? 380 GLU A CA    1 
ATOM   2917 C  C     . GLU A 1 380 ? 19.542  46.530 49.437 1.00 42.00 ? 380 GLU A C     1 
ATOM   2918 O  O     . GLU A 1 380 ? 18.557  46.877 50.075 1.00 44.95 ? 380 GLU A O     1 
ATOM   2919 C  CB    . GLU A 1 380 ? 21.162  44.744 50.211 1.00 41.37 ? 380 GLU A CB    1 
ATOM   2920 C  CG    . GLU A 1 380 ? 22.449  44.381 50.973 1.00 44.06 ? 380 GLU A CG    1 
ATOM   2921 C  CD    . GLU A 1 380 ? 22.209  44.086 52.452 1.00 51.25 ? 380 GLU A CD    1 
ATOM   2922 O  OE1   . GLU A 1 380 ? 22.773  43.093 52.976 1.00 48.95 ? 380 GLU A OE1   1 
ATOM   2923 O  OE2   . GLU A 1 380 ? 21.442  44.850 53.096 1.00 53.64 ? 380 GLU A OE2   1 
ATOM   2924 N  N     . SER A 1 381 ? 19.536  46.440 48.110 1.00 41.01 ? 381 SER A N     1 
ATOM   2925 C  CA    . SER A 1 381 ? 18.332  46.668 47.316 1.00 39.85 ? 381 SER A CA    1 
ATOM   2926 C  C     . SER A 1 381 ? 17.626  45.337 47.116 1.00 41.87 ? 381 SER A C     1 
ATOM   2927 O  O     . SER A 1 381 ? 18.284  44.334 46.827 1.00 42.79 ? 381 SER A O     1 
ATOM   2928 C  CB    . SER A 1 381 ? 18.705  47.203 45.938 1.00 40.64 ? 381 SER A CB    1 
ATOM   2929 O  OG    . SER A 1 381 ? 17.564  47.604 45.189 1.00 42.63 ? 381 SER A OG    1 
ATOM   2930 N  N     . THR A 1 382 ? 16.303  45.311 47.285 1.00 39.64 ? 382 THR A N     1 
ATOM   2931 C  CA    . THR A 1 382 ? 15.558  44.070 47.044 1.00 40.34 ? 382 THR A CA    1 
ATOM   2932 C  C     . THR A 1 382 ? 14.652  44.240 45.802 1.00 39.81 ? 382 THR A C     1 
ATOM   2933 O  O     . THR A 1 382 ? 14.039  43.281 45.301 1.00 36.02 ? 382 THR A O     1 
ATOM   2934 C  CB    . THR A 1 382 ? 14.745  43.630 48.282 1.00 39.26 ? 382 THR A CB    1 
ATOM   2935 O  OG1   . THR A 1 382 ? 13.785  44.632 48.615 1.00 38.73 ? 382 THR A OG1   1 
ATOM   2936 C  CG2   . THR A 1 382 ? 15.660  43.420 49.475 1.00 38.97 ? 382 THR A CG2   1 
ATOM   2937 N  N     . PHE A 1 383 ? 14.649  45.454 45.253 1.00 39.49 ? 383 PHE A N     1 
ATOM   2938 C  CA    . PHE A 1 383 ? 13.826  45.754 44.094 1.00 41.70 ? 383 PHE A CA    1 
ATOM   2939 C  C     . PHE A 1 383 ? 14.061  44.810 42.944 1.00 43.57 ? 383 PHE A C     1 
ATOM   2940 O  O     . PHE A 1 383 ? 15.198  44.599 42.537 1.00 47.45 ? 383 PHE A O     1 
ATOM   2941 C  CB    . PHE A 1 383 ? 14.054  47.180 43.595 1.00 38.06 ? 383 PHE A CB    1 
ATOM   2942 C  CG    . PHE A 1 383 ? 13.161  47.553 42.452 1.00 38.96 ? 383 PHE A CG    1 
ATOM   2943 C  CD1   . PHE A 1 383 ? 11.819  47.842 42.664 1.00 39.70 ? 383 PHE A CD1   1 
ATOM   2944 C  CD2   . PHE A 1 383 ? 13.649  47.612 41.165 1.00 40.67 ? 383 PHE A CD2   1 
ATOM   2945 C  CE1   . PHE A 1 383 ? 10.982  48.182 41.613 1.00 35.29 ? 383 PHE A CE1   1 
ATOM   2946 C  CE2   . PHE A 1 383 ? 12.805  47.955 40.104 1.00 35.11 ? 383 PHE A CE2   1 
ATOM   2947 C  CZ    . PHE A 1 383 ? 11.481  48.237 40.342 1.00 35.22 ? 383 PHE A CZ    1 
ATOM   2948 N  N     . GLY A 1 384 ? 12.984  44.267 42.397 1.00 43.45 ? 384 GLY A N     1 
ATOM   2949 C  CA    . GLY A 1 384 ? 13.110  43.371 41.266 1.00 40.79 ? 384 GLY A CA    1 
ATOM   2950 C  C     . GLY A 1 384 ? 13.669  42.003 41.586 1.00 40.30 ? 384 GLY A C     1 
ATOM   2951 O  O     . GLY A 1 384 ? 13.619  41.115 40.724 1.00 40.48 ? 384 GLY A O     1 
ATOM   2952 N  N     . VAL A 1 385 ? 14.169  41.800 42.809 1.00 38.96 ? 385 VAL A N     1 
ATOM   2953 C  CA    . VAL A 1 385 ? 14.710  40.488 43.182 1.00 38.26 ? 385 VAL A CA    1 
ATOM   2954 C  C     . VAL A 1 385 ? 13.599  39.459 43.011 1.00 40.30 ? 385 VAL A C     1 
ATOM   2955 O  O     . VAL A 1 385 ? 12.476  39.678 43.461 1.00 41.33 ? 385 VAL A O     1 
ATOM   2956 C  CB    . VAL A 1 385 ? 15.234  40.475 44.643 1.00 34.08 ? 385 VAL A CB    1 
ATOM   2957 C  CG1   . VAL A 1 385 ? 15.622  39.052 45.072 1.00 29.77 ? 385 VAL A CG1   1 
ATOM   2958 C  CG2   . VAL A 1 385 ? 16.435  41.385 44.755 1.00 33.24 ? 385 VAL A CG2   1 
ATOM   2959 N  N     . LYS A 1 386 ? 13.922  38.339 42.367 1.00 45.43 ? 386 LYS A N     1 
ATOM   2960 C  CA    . LYS A 1 386 ? 12.952  37.267 42.101 1.00 45.46 ? 386 LYS A CA    1 
ATOM   2961 C  C     . LYS A 1 386 ? 13.322  35.919 42.730 1.00 46.71 ? 386 LYS A C     1 
ATOM   2962 O  O     . LYS A 1 386 ? 12.739  34.891 42.397 1.00 45.71 ? 386 LYS A O     1 
ATOM   2963 C  CB    . LYS A 1 386 ? 12.804  37.100 40.586 1.00 42.98 ? 386 LYS A CB    1 
ATOM   2964 C  CG    . LYS A 1 386 ? 12.584  38.410 39.852 1.00 36.68 ? 386 LYS A CG    1 
ATOM   2965 C  CD    . LYS A 1 386 ? 12.541  38.167 38.381 1.00 43.51 ? 386 LYS A CD    1 
ATOM   2966 C  CE    . LYS A 1 386 ? 12.580  39.469 37.599 1.00 48.71 ? 386 LYS A CE    1 
ATOM   2967 N  NZ    . LYS A 1 386 ? 11.498  40.396 37.986 1.00 51.49 ? 386 LYS A NZ    1 
ATOM   2968 N  N     . ASP A 1 387 ? 14.281  35.924 43.647 1.00 52.02 ? 387 ASP A N     1 
ATOM   2969 C  CA    . ASP A 1 387 ? 14.721  34.692 44.310 1.00 54.01 ? 387 ASP A CA    1 
ATOM   2970 C  C     . ASP A 1 387 ? 15.141  35.067 45.720 1.00 51.00 ? 387 ASP A C     1 
ATOM   2971 O  O     . ASP A 1 387 ? 15.881  36.047 45.917 1.00 48.51 ? 387 ASP A O     1 
ATOM   2972 C  CB    . ASP A 1 387 ? 15.909  34.088 43.541 1.00 60.35 ? 387 ASP A CB    1 
ATOM   2973 C  CG    . ASP A 1 387 ? 16.233  32.659 43.968 1.00 69.27 ? 387 ASP A CG    1 
ATOM   2974 O  OD1   . ASP A 1 387 ? 15.449  31.726 43.641 1.00 68.06 ? 387 ASP A OD1   1 
ATOM   2975 O  OD2   . ASP A 1 387 ? 17.293  32.470 44.620 1.00 73.49 ? 387 ASP A OD2   1 
ATOM   2976 N  N     . ARG A 1 388 ? 14.653  34.313 46.701 1.00 48.93 ? 388 ARG A N     1 
ATOM   2977 C  CA    . ARG A 1 388 ? 14.989  34.580 48.102 1.00 51.68 ? 388 ARG A CA    1 
ATOM   2978 C  C     . ARG A 1 388 ? 16.471  34.873 48.270 1.00 52.84 ? 388 ARG A C     1 
ATOM   2979 O  O     . ARG A 1 388 ? 16.835  35.837 48.941 1.00 58.04 ? 388 ARG A O     1 
ATOM   2980 C  CB    . ARG A 1 388 ? 14.615  33.416 49.011 1.00 47.36 ? 388 ARG A CB    1 
ATOM   2981 C  CG    . ARG A 1 388 ? 13.184  32.995 48.921 1.00 45.33 ? 388 ARG A CG    1 
ATOM   2982 C  CD    . ARG A 1 388 ? 12.908  31.861 49.859 1.00 46.39 ? 388 ARG A CD    1 
ATOM   2983 N  NE    . ARG A 1 388 ? 12.268  32.370 51.054 1.00 59.73 ? 388 ARG A NE    1 
ATOM   2984 C  CZ    . ARG A 1 388 ? 11.278  31.688 51.616 1.00 64.55 ? 388 ARG A CZ    1 
ATOM   2985 N  NH1   . ARG A 1 388 ? 10.904  30.526 51.082 1.00 66.44 ? 388 ARG A NH1   1 
ATOM   2986 N  NH2   . ARG A 1 388 ? 10.608  32.207 52.654 1.00 62.33 ? 388 ARG A NH2   1 
ATOM   2987 N  N     . SER A 1 389 ? 17.324  34.043 47.677 1.00 51.21 ? 389 SER A N     1 
ATOM   2988 C  CA    . SER A 1 389 ? 18.769  34.239 47.745 1.00 47.68 ? 389 SER A CA    1 
ATOM   2989 C  C     . SER A 1 389 ? 19.161  35.699 47.526 1.00 44.80 ? 389 SER A C     1 
ATOM   2990 O  O     . SER A 1 389 ? 20.067  36.216 48.174 1.00 47.93 ? 389 SER A O     1 
ATOM   2991 C  CB    . SER A 1 389 ? 19.445  33.380 46.691 1.00 47.93 ? 389 SER A CB    1 
ATOM   2992 O  OG    . SER A 1 389 ? 18.909  32.079 46.755 1.00 51.07 ? 389 SER A OG    1 
ATOM   2993 N  N     . GLY A 1 390 ? 18.458  36.378 46.636 1.00 42.82 ? 390 GLY A N     1 
ATOM   2994 C  CA    . GLY A 1 390 ? 18.790  37.766 46.365 1.00 42.58 ? 390 GLY A CA    1 
ATOM   2995 C  C     . GLY A 1 390 ? 18.397  38.726 47.468 1.00 42.71 ? 390 GLY A C     1 
ATOM   2996 O  O     . GLY A 1 390 ? 18.685  39.924 47.400 1.00 45.04 ? 390 GLY A O     1 
ATOM   2997 N  N     . LEU A 1 391 ? 17.712  38.219 48.479 1.00 44.40 ? 391 LEU A N     1 
ATOM   2998 C  CA    . LEU A 1 391 ? 17.265  39.057 49.588 1.00 42.38 ? 391 LEU A CA    1 
ATOM   2999 C  C     . LEU A 1 391 ? 18.262  38.896 50.709 1.00 42.90 ? 391 LEU A C     1 
ATOM   3000 O  O     . LEU A 1 391 ? 18.656  37.761 51.029 1.00 47.94 ? 391 LEU A O     1 
ATOM   3001 C  CB    . LEU A 1 391 ? 15.893  38.594 50.091 1.00 44.12 ? 391 LEU A CB    1 
ATOM   3002 C  CG    . LEU A 1 391 ? 14.721  38.426 49.118 1.00 47.91 ? 391 LEU A CG    1 
ATOM   3003 C  CD1   . LEU A 1 391 ? 13.572  37.758 49.866 1.00 47.27 ? 391 LEU A CD1   1 
ATOM   3004 C  CD2   . LEU A 1 391 ? 14.281  39.753 48.512 1.00 39.32 ? 391 LEU A CD2   1 
ATOM   3005 N  N     . PRO A 1 392 ? 18.650  40.008 51.357 1.00 38.58 ? 392 PRO A N     1 
ATOM   3006 C  CA    . PRO A 1 392 ? 19.615  40.025 52.472 1.00 37.28 ? 392 PRO A CA    1 
ATOM   3007 C  C     . PRO A 1 392 ? 18.989  39.322 53.655 1.00 38.40 ? 392 PRO A C     1 
ATOM   3008 O  O     . PRO A 1 392 ? 17.764  39.318 53.755 1.00 41.60 ? 392 PRO A O     1 
ATOM   3009 C  CB    . PRO A 1 392 ? 19.783  41.514 52.742 1.00 37.65 ? 392 PRO A CB    1 
ATOM   3010 C  CG    . PRO A 1 392 ? 18.455  42.091 52.361 1.00 38.25 ? 392 PRO A CG    1 
ATOM   3011 C  CD    . PRO A 1 392 ? 18.108  41.353 51.101 1.00 38.03 ? 392 PRO A CD    1 
ATOM   3012 N  N     . GLN A 1 393 ? 19.780  38.783 54.577 1.00 38.12 ? 393 GLN A N     1 
ATOM   3013 C  CA    . GLN A 1 393 ? 19.189  38.059 55.717 1.00 40.74 ? 393 GLN A CA    1 
ATOM   3014 C  C     . GLN A 1 393 ? 18.211  38.860 56.542 1.00 40.67 ? 393 GLN A C     1 
ATOM   3015 O  O     . GLN A 1 393 ? 17.196  38.311 57.004 1.00 38.75 ? 393 GLN A O     1 
ATOM   3016 C  CB    . GLN A 1 393 ? 20.239  37.475 56.640 1.00 47.85 ? 393 GLN A CB    1 
ATOM   3017 C  CG    . GLN A 1 393 ? 19.690  36.322 57.484 1.00 55.38 ? 393 GLN A CG    1 
ATOM   3018 C  CD    . GLN A 1 393 ? 19.475  35.049 56.661 1.00 60.55 ? 393 GLN A CD    1 
ATOM   3019 O  OE1   . GLN A 1 393 ? 18.360  34.507 56.596 1.00 62.65 ? 393 GLN A OE1   1 
ATOM   3020 N  NE2   . GLN A 1 393 ? 20.549  34.559 56.036 1.00 58.36 ? 393 GLN A NE2   1 
ATOM   3021 N  N     . ALA A 1 394 ? 18.514  40.148 56.733 1.00 41.67 ? 394 ALA A N     1 
ATOM   3022 C  CA    . ALA A 1 394 ? 17.652  41.056 57.487 1.00 44.67 ? 394 ALA A CA    1 
ATOM   3023 C  C     . ALA A 1 394 ? 16.227  40.925 56.961 1.00 45.22 ? 394 ALA A C     1 
ATOM   3024 O  O     . ALA A 1 394 ? 15.283  40.759 57.741 1.00 48.77 ? 394 ALA A O     1 
ATOM   3025 C  CB    . ALA A 1 394 ? 18.133  42.493 57.338 1.00 46.75 ? 394 ALA A CB    1 
ATOM   3026 N  N     . ALA A 1 395 ? 16.084  40.957 55.634 1.00 43.07 ? 395 ALA A N     1 
ATOM   3027 C  CA    . ALA A 1 395 ? 14.787  40.808 54.974 1.00 39.77 ? 395 ALA A CA    1 
ATOM   3028 C  C     . ALA A 1 395 ? 14.156  39.441 55.264 1.00 36.42 ? 395 ALA A C     1 
ATOM   3029 O  O     . ALA A 1 395 ? 12.954  39.353 55.525 1.00 34.54 ? 395 ALA A O     1 
ATOM   3030 C  CB    . ALA A 1 395 ? 14.939  40.987 53.467 1.00 39.73 ? 395 ALA A CB    1 
ATOM   3031 N  N     . LEU A 1 396 ? 14.962  38.382 55.221 1.00 34.24 ? 396 LEU A N     1 
ATOM   3032 C  CA    . LEU A 1 396 ? 14.451  37.031 55.446 1.00 34.02 ? 396 LEU A CA    1 
ATOM   3033 C  C     . LEU A 1 396 ? 13.893  36.895 56.844 1.00 36.59 ? 396 LEU A C     1 
ATOM   3034 O  O     . LEU A 1 396 ? 12.909  36.188 57.069 1.00 34.89 ? 396 LEU A O     1 
ATOM   3035 C  CB    . LEU A 1 396 ? 15.546  35.996 55.183 1.00 39.83 ? 396 LEU A CB    1 
ATOM   3036 C  CG    . LEU A 1 396 ? 16.083  35.990 53.737 1.00 47.10 ? 396 LEU A CG    1 
ATOM   3037 C  CD1   . LEU A 1 396 ? 17.374  35.212 53.637 1.00 47.47 ? 396 LEU A CD1   1 
ATOM   3038 C  CD2   . LEU A 1 396 ? 15.039  35.432 52.772 1.00 48.03 ? 396 LEU A CD2   1 
ATOM   3039 N  N     . ASN A 1 397 ? 14.550  37.559 57.794 1.00 40.13 ? 397 ASN A N     1 
ATOM   3040 C  CA    . ASN A 1 397 ? 14.117  37.533 59.191 1.00 37.73 ? 397 ASN A CA    1 
ATOM   3041 C  C     . ASN A 1 397 ? 12.806  38.294 59.313 1.00 39.83 ? 397 ASN A C     1 
ATOM   3042 O  O     . ASN A 1 397 ? 11.867  37.796 59.932 1.00 43.51 ? 397 ASN A O     1 
ATOM   3043 C  CB    . ASN A 1 397 ? 15.170  38.141 60.121 1.00 38.36 ? 397 ASN A CB    1 
ATOM   3044 C  CG    . ASN A 1 397 ? 16.446  37.319 60.200 1.00 37.50 ? 397 ASN A CG    1 
ATOM   3045 O  OD1   . ASN A 1 397 ? 17.514  37.865 60.460 1.00 31.71 ? 397 ASN A OD1   1 
ATOM   3046 N  ND2   . ASN A 1 397 ? 16.340  36.000 59.995 1.00 39.25 ? 397 ASN A ND2   1 
ATOM   3047 N  N     . TYR A 1 398 ? 12.726  39.493 58.751 1.00 35.70 ? 398 TYR A N     1 
ATOM   3048 C  CA    . TYR A 1 398 ? 11.469  40.237 58.787 1.00 36.85 ? 398 TYR A CA    1 
ATOM   3049 C  C     . TYR A 1 398 ? 10.323  39.342 58.277 1.00 37.65 ? 398 TYR A C     1 
ATOM   3050 O  O     . TYR A 1 398 ? 9.221   39.295 58.865 1.00 34.55 ? 398 TYR A O     1 
ATOM   3051 C  CB    . TYR A 1 398 ? 11.590  41.444 57.881 1.00 39.15 ? 398 TYR A CB    1 
ATOM   3052 C  CG    . TYR A 1 398 ? 10.393  42.341 57.853 1.00 38.03 ? 398 TYR A CG    1 
ATOM   3053 C  CD1   . TYR A 1 398 ? 10.157  43.231 58.887 1.00 36.52 ? 398 TYR A CD1   1 
ATOM   3054 C  CD2   . TYR A 1 398 ? 9.547   42.373 56.748 1.00 38.77 ? 398 TYR A CD2   1 
ATOM   3055 C  CE1   . TYR A 1 398 ? 9.120   44.142 58.826 1.00 38.48 ? 398 TYR A CE1   1 
ATOM   3056 C  CE2   . TYR A 1 398 ? 8.498   43.279 56.671 1.00 38.23 ? 398 TYR A CE2   1 
ATOM   3057 C  CZ    . TYR A 1 398 ? 8.293   44.166 57.719 1.00 37.13 ? 398 TYR A CZ    1 
ATOM   3058 O  OH    . TYR A 1 398 ? 7.288   45.107 57.675 1.00 38.75 ? 398 TYR A OH    1 
ATOM   3059 N  N     . ILE A 1 399 ? 10.585  38.646 57.169 1.00 37.27 ? 399 ILE A N     1 
ATOM   3060 C  CA    . ILE A 1 399 ? 9.603   37.757 56.577 1.00 37.18 ? 399 ILE A CA    1 
ATOM   3061 C  C     . ILE A 1 399 ? 9.265   36.619 57.532 1.00 38.80 ? 399 ILE A C     1 
ATOM   3062 O  O     . ILE A 1 399 ? 8.086   36.371 57.789 1.00 43.31 ? 399 ILE A O     1 
ATOM   3063 C  CB    . ILE A 1 399 ? 10.083  37.208 55.227 1.00 40.01 ? 399 ILE A CB    1 
ATOM   3064 C  CG1   . ILE A 1 399 ? 10.254  38.341 54.207 1.00 35.66 ? 399 ILE A CG1   1 
ATOM   3065 C  CG2   . ILE A 1 399 ? 9.111   36.164 54.704 1.00 41.93 ? 399 ILE A CG2   1 
ATOM   3066 C  CD1   . ILE A 1 399 ? 11.128  37.959 53.035 1.00 29.44 ? 399 ILE A CD1   1 
ATOM   3067 N  N     . LYS A 1 400 ? 10.270  35.940 58.093 1.00 35.60 ? 400 LYS A N     1 
ATOM   3068 C  CA    . LYS A 1 400 ? 9.982   34.851 59.015 1.00 30.70 ? 400 LYS A CA    1 
ATOM   3069 C  C     . LYS A 1 400 ? 9.242   35.343 60.225 1.00 30.27 ? 400 LYS A C     1 
ATOM   3070 O  O     . LYS A 1 400 ? 8.369   34.645 60.760 1.00 28.95 ? 400 LYS A O     1 
ATOM   3071 C  CB    . LYS A 1 400 ? 11.242  34.131 59.451 1.00 35.73 ? 400 LYS A CB    1 
ATOM   3072 C  CG    . LYS A 1 400 ? 11.049  32.600 59.552 1.00 41.03 ? 400 LYS A CG    1 
ATOM   3073 C  CD    . LYS A 1 400 ? 10.009  32.210 60.617 1.00 47.35 ? 400 LYS A CD    1 
ATOM   3074 C  CE    . LYS A 1 400 ? 9.388   30.812 60.406 1.00 51.33 ? 400 LYS A CE    1 
ATOM   3075 N  NZ    . LYS A 1 400 ? 8.245   30.793 59.414 1.00 46.73 ? 400 LYS A NZ    1 
ATOM   3076 N  N     . ARG A 1 401 ? 9.586   36.545 60.663 1.00 31.88 ? 401 ARG A N     1 
ATOM   3077 C  CA    . ARG A 1 401 ? 8.959   37.127 61.838 1.00 34.25 ? 401 ARG A CA    1 
ATOM   3078 C  C     . ARG A 1 401 ? 7.470   37.331 61.571 1.00 38.85 ? 401 ARG A C     1 
ATOM   3079 O  O     . ARG A 1 401 ? 6.608   37.064 62.440 1.00 42.34 ? 401 ARG A O     1 
ATOM   3080 C  CB    . ARG A 1 401 ? 9.644   38.440 62.235 1.00 32.96 ? 401 ARG A CB    1 
ATOM   3081 C  CG    . ARG A 1 401 ? 9.253   38.952 63.597 1.00 35.85 ? 401 ARG A CG    1 
ATOM   3082 C  CD    . ARG A 1 401 ? 9.447   37.863 64.660 1.00 38.64 ? 401 ARG A CD    1 
ATOM   3083 N  NE    . ARG A 1 401 ? 8.704   38.132 65.892 1.00 37.90 ? 401 ARG A NE    1 
ATOM   3084 C  CZ    . ARG A 1 401 ? 8.371   37.135 66.707 1.00 38.90 ? 401 ARG A CZ    1 
ATOM   3085 N  NH1   . ARG A 1 401 ? 8.712   35.881 66.423 1.00 29.97 ? 401 ARG A NH1   1 
ATOM   3086 N  NH2   . ARG A 1 401 ? 7.642   37.381 67.783 1.00 39.85 ? 401 ARG A NH2   1 
ATOM   3087 N  N     . ILE A 1 402 ? 7.133   37.779 60.369 1.00 37.74 ? 402 ILE A N     1 
ATOM   3088 C  CA    . ILE A 1 402 ? 5.716   37.967 60.061 1.00 33.06 ? 402 ILE A CA    1 
ATOM   3089 C  C     . ILE A 1 402 ? 5.032   36.604 60.144 1.00 31.92 ? 402 ILE A C     1 
ATOM   3090 O  O     . ILE A 1 402 ? 3.992   36.457 60.776 1.00 35.46 ? 402 ILE A O     1 
ATOM   3091 C  CB    . ILE A 1 402 ? 5.531   38.642 58.706 1.00 28.15 ? 402 ILE A CB    1 
ATOM   3092 C  CG1   . ILE A 1 402 ? 6.166   40.052 58.741 1.00 28.64 ? 402 ILE A CG1   1 
ATOM   3093 C  CG2   . ILE A 1 402 ? 4.075   38.707 58.343 1.00 29.50 ? 402 ILE A CG2   1 
ATOM   3094 C  CD1   . ILE A 1 402 ? 6.227   40.792 57.376 1.00 23.19 ? 402 ILE A CD1   1 
ATOM   3095 N  N     . GLU A 1 403 ? 5.640   35.588 59.552 1.00 32.58 ? 403 GLU A N     1 
ATOM   3096 C  CA    . GLU A 1 403 ? 5.071   34.245 59.613 1.00 34.33 ? 403 GLU A CA    1 
ATOM   3097 C  C     . GLU A 1 403 ? 4.878   33.806 61.077 1.00 34.08 ? 403 GLU A C     1 
ATOM   3098 O  O     . GLU A 1 403 ? 3.802   33.333 61.466 1.00 34.55 ? 403 GLU A O     1 
ATOM   3099 C  CB    . GLU A 1 403 ? 5.968   33.244 58.900 1.00 33.29 ? 403 GLU A CB    1 
ATOM   3100 C  CG    . GLU A 1 403 ? 6.192   33.561 57.452 1.00 37.17 ? 403 GLU A CG    1 
ATOM   3101 C  CD    . GLU A 1 403 ? 7.066   32.524 56.771 1.00 39.50 ? 403 GLU A CD    1 
ATOM   3102 O  OE1   . GLU A 1 403 ? 8.197   32.275 57.249 1.00 37.88 ? 403 GLU A OE1   1 
ATOM   3103 O  OE2   . GLU A 1 403 ? 6.622   31.948 55.761 1.00 40.40 ? 403 GLU A OE2   1 
ATOM   3104 N  N     . GLU A 1 404 ? 5.924   33.958 61.881 1.00 36.12 ? 404 GLU A N     1 
ATOM   3105 C  CA    . GLU A 1 404 ? 5.846   33.581 63.297 1.00 34.84 ? 404 GLU A CA    1 
ATOM   3106 C  C     . GLU A 1 404 ? 4.727   34.328 63.964 1.00 33.63 ? 404 GLU A C     1 
ATOM   3107 O  O     . GLU A 1 404 ? 3.886   33.711 64.610 1.00 35.62 ? 404 GLU A O     1 
ATOM   3108 C  CB    . GLU A 1 404 ? 7.157   33.848 64.046 1.00 34.86 ? 404 GLU A CB    1 
ATOM   3109 C  CG    . GLU A 1 404 ? 8.286   32.960 63.582 1.00 37.34 ? 404 GLU A CG    1 
ATOM   3110 C  CD    . GLU A 1 404 ? 9.616   33.428 64.061 1.00 43.59 ? 404 GLU A CD    1 
ATOM   3111 O  OE1   . GLU A 1 404 ? 9.687   34.591 64.511 1.00 49.22 ? 404 GLU A OE1   1 
ATOM   3112 O  OE2   . GLU A 1 404 ? 10.593  32.648 63.975 1.00 49.25 ? 404 GLU A OE2   1 
ATOM   3113 N  N     . LEU A 1 405 ? 4.695   35.643 63.755 1.00 29.46 ? 405 LEU A N     1 
ATOM   3114 C  CA    . LEU A 1 405 ? 3.674   36.470 64.358 1.00 30.96 ? 405 LEU A CA    1 
ATOM   3115 C  C     . LEU A 1 405 ? 2.230   36.278 63.859 1.00 34.29 ? 405 LEU A C     1 
ATOM   3116 O  O     . LEU A 1 405 ? 1.273   36.723 64.527 1.00 35.62 ? 405 LEU A O     1 
ATOM   3117 C  CB    . LEU A 1 405 ? 4.081   37.935 64.265 1.00 31.23 ? 405 LEU A CB    1 
ATOM   3118 C  CG    . LEU A 1 405 ? 5.143   38.382 65.253 1.00 31.85 ? 405 LEU A CG    1 
ATOM   3119 C  CD1   . LEU A 1 405 ? 5.518   39.769 64.886 1.00 30.58 ? 405 LEU A CD1   1 
ATOM   3120 C  CD2   . LEU A 1 405 ? 4.590   38.323 66.646 1.00 29.83 ? 405 LEU A CD2   1 
ATOM   3121 N  N     . THR A 1 406 ? 2.065   35.635 62.704 1.00 31.74 ? 406 THR A N     1 
ATOM   3122 C  CA    . THR A 1 406 ? 0.728   35.431 62.171 1.00 30.36 ? 406 THR A CA    1 
ATOM   3123 C  C     . THR A 1 406 ? 0.316   33.974 62.018 1.00 32.48 ? 406 THR A C     1 
ATOM   3124 O  O     . THR A 1 406 ? -0.881  33.680 62.058 1.00 35.71 ? 406 THR A O     1 
ATOM   3125 C  CB    . THR A 1 406 ? 0.555   36.082 60.831 1.00 29.68 ? 406 THR A CB    1 
ATOM   3126 O  OG1   . THR A 1 406 ? 1.513   35.524 59.929 1.00 38.72 ? 406 THR A OG1   1 
ATOM   3127 C  CG2   . THR A 1 406 ? 0.792   37.559 60.925 1.00 28.19 ? 406 THR A CG2   1 
ATOM   3128 N  N     . GLY A 1 407 ? 1.280   33.066 61.862 1.00 28.64 ? 407 GLY A N     1 
ATOM   3129 C  CA    . GLY A 1 407 ? 0.930   31.666 61.714 1.00 30.34 ? 407 GLY A CA    1 
ATOM   3130 C  C     . GLY A 1 407 ? 0.514   31.281 60.307 1.00 30.62 ? 407 GLY A C     1 
ATOM   3131 O  O     . GLY A 1 407 ? 0.025   30.161 60.064 1.00 31.98 ? 407 GLY A O     1 
ATOM   3132 N  N     . VAL A 1 408 ? 0.713   32.205 59.369 1.00 28.18 ? 408 VAL A N     1 
ATOM   3133 C  CA    . VAL A 1 408 ? 0.376   31.960 57.968 1.00 25.80 ? 408 VAL A CA    1 
ATOM   3134 C  C     . VAL A 1 408 ? 1.662   32.150 57.143 1.00 23.25 ? 408 VAL A C     1 
ATOM   3135 O  O     . VAL A 1 408 ? 2.382   33.125 57.339 1.00 25.64 ? 408 VAL A O     1 
ATOM   3136 C  CB    . VAL A 1 408 ? -0.759  32.947 57.491 1.00 25.40 ? 408 VAL A CB    1 
ATOM   3137 C  CG1   . VAL A 1 408 ? -0.965  32.882 56.012 1.00 23.98 ? 408 VAL A CG1   1 
ATOM   3138 C  CG2   . VAL A 1 408 ? -2.077  32.623 58.171 1.00 22.53 ? 408 VAL A CG2   1 
ATOM   3139 N  N     . PRO A 1 409 ? 1.975   31.219 56.223 1.00 23.57 ? 409 PRO A N     1 
ATOM   3140 C  CA    . PRO A 1 409 ? 3.198   31.398 55.423 1.00 22.78 ? 409 PRO A CA    1 
ATOM   3141 C  C     . PRO A 1 409 ? 3.115   32.492 54.321 1.00 26.30 ? 409 PRO A C     1 
ATOM   3142 O  O     . PRO A 1 409 ? 2.047   32.806 53.777 1.00 16.48 ? 409 PRO A O     1 
ATOM   3143 C  CB    . PRO A 1 409 ? 3.398   30.026 54.791 1.00 19.05 ? 409 PRO A CB    1 
ATOM   3144 C  CG    . PRO A 1 409 ? 1.943   29.575 54.535 1.00 23.75 ? 409 PRO A CG    1 
ATOM   3145 C  CD    . PRO A 1 409 ? 1.185   30.050 55.757 1.00 23.89 ? 409 PRO A CD    1 
ATOM   3146 N  N     . ILE A 1 410 ? 4.262   33.085 54.009 1.00 28.24 ? 410 ILE A N     1 
ATOM   3147 C  CA    . ILE A 1 410 ? 4.319   34.086 52.955 1.00 28.02 ? 410 ILE A CA    1 
ATOM   3148 C  C     . ILE A 1 410 ? 4.677   33.287 51.710 1.00 29.85 ? 410 ILE A C     1 
ATOM   3149 O  O     . ILE A 1 410 ? 5.844   33.068 51.404 1.00 35.08 ? 410 ILE A O     1 
ATOM   3150 C  CB    . ILE A 1 410 ? 5.378   35.172 53.277 1.00 27.26 ? 410 ILE A CB    1 
ATOM   3151 C  CG1   . ILE A 1 410 ? 4.890   35.982 54.507 1.00 28.81 ? 410 ILE A CG1   1 
ATOM   3152 C  CG2   . ILE A 1 410 ? 5.706   35.983 52.012 1.00 18.89 ? 410 ILE A CG2   1 
ATOM   3153 C  CD1   . ILE A 1 410 ? 5.686   37.228 54.870 1.00 25.32 ? 410 ILE A CD1   1 
ATOM   3154 N  N     . ASP A 1 411 ? 3.658   32.823 51.007 1.00 28.98 ? 411 ASP A N     1 
ATOM   3155 C  CA    . ASP A 1 411 ? 3.864   32.036 49.820 1.00 25.68 ? 411 ASP A CA    1 
ATOM   3156 C  C     . ASP A 1 411 ? 4.315   32.800 48.588 1.00 27.60 ? 411 ASP A C     1 
ATOM   3157 O  O     . ASP A 1 411 ? 4.777   32.180 47.627 1.00 29.07 ? 411 ASP A O     1 
ATOM   3158 C  CB    . ASP A 1 411 ? 2.597   31.271 49.496 1.00 31.87 ? 411 ASP A CB    1 
ATOM   3159 C  CG    . ASP A 1 411 ? 2.286   30.190 50.506 1.00 32.97 ? 411 ASP A CG    1 
ATOM   3160 O  OD1   . ASP A 1 411 ? 1.158   29.645 50.477 1.00 33.64 ? 411 ASP A OD1   1 
ATOM   3161 O  OD2   . ASP A 1 411 ? 3.180   29.854 51.315 1.00 35.33 ? 411 ASP A OD2   1 
ATOM   3162 N  N     . ILE A 1 412 ? 4.152   34.120 48.579 1.00 25.76 ? 412 ILE A N     1 
ATOM   3163 C  CA    . ILE A 1 412 ? 4.524   34.941 47.418 1.00 24.13 ? 412 ILE A CA    1 
ATOM   3164 C  C     . ILE A 1 412 ? 5.102   36.225 47.952 1.00 27.02 ? 412 ILE A C     1 
ATOM   3165 O  O     . ILE A 1 412 ? 4.553   36.791 48.907 1.00 34.51 ? 412 ILE A O     1 
ATOM   3166 C  CB    . ILE A 1 412 ? 3.267   35.336 46.571 1.00 28.23 ? 412 ILE A CB    1 
ATOM   3167 C  CG1   . ILE A 1 412 ? 2.594   34.084 45.983 1.00 27.64 ? 412 ILE A CG1   1 
ATOM   3168 C  CG2   . ILE A 1 412 ? 3.631   36.368 45.486 1.00 23.40 ? 412 ILE A CG2   1 
ATOM   3169 C  CD1   . ILE A 1 412 ? 1.159   34.281 45.582 1.00 26.44 ? 412 ILE A CD1   1 
ATOM   3170 N  N     . ILE A 1 413 ? 6.205   36.676 47.359 1.00 27.75 ? 413 ILE A N     1 
ATOM   3171 C  CA    . ILE A 1 413 ? 6.859   37.913 47.790 1.00 28.40 ? 413 ILE A CA    1 
ATOM   3172 C  C     . ILE A 1 413 ? 7.013   38.735 46.517 1.00 27.44 ? 413 ILE A C     1 
ATOM   3173 O  O     . ILE A 1 413 ? 7.512   38.208 45.508 1.00 23.41 ? 413 ILE A O     1 
ATOM   3174 C  CB    . ILE A 1 413 ? 8.273   37.630 48.424 1.00 30.44 ? 413 ILE A CB    1 
ATOM   3175 C  CG1   . ILE A 1 413 ? 8.218   36.409 49.355 1.00 30.46 ? 413 ILE A CG1   1 
ATOM   3176 C  CG2   . ILE A 1 413 ? 8.760   38.818 49.224 1.00 25.67 ? 413 ILE A CG2   1 
ATOM   3177 C  CD1   . ILE A 1 413 ? 9.536   35.608 49.397 1.00 35.48 ? 413 ILE A CD1   1 
ATOM   3178 N  N     . SER A 1 414 ? 6.526   39.978 46.557 1.00 28.05 ? 414 SER A N     1 
ATOM   3179 C  CA    . SER A 1 414 ? 6.555   40.909 45.437 1.00 25.91 ? 414 SER A CA    1 
ATOM   3180 C  C     . SER A 1 414 ? 7.595   42.008 45.722 1.00 31.59 ? 414 SER A C     1 
ATOM   3181 O  O     . SER A 1 414 ? 7.583   42.639 46.787 1.00 33.21 ? 414 SER A O     1 
ATOM   3182 C  CB    . SER A 1 414 ? 5.152   41.505 45.230 1.00 27.45 ? 414 SER A CB    1 
ATOM   3183 O  OG    . SER A 1 414 ? 5.102   42.497 44.188 1.00 29.47 ? 414 SER A OG    1 
ATOM   3184 N  N     . THR A 1 415 ? 8.458   42.272 44.741 1.00 35.78 ? 415 THR A N     1 
ATOM   3185 C  CA    . THR A 1 415 ? 9.531   43.255 44.919 1.00 34.98 ? 415 THR A CA    1 
ATOM   3186 C  C     . THR A 1 415 ? 9.570   44.387 43.888 1.00 35.87 ? 415 THR A C     1 
ATOM   3187 O  O     . THR A 1 415 ? 10.643  44.901 43.557 1.00 35.13 ? 415 THR A O     1 
ATOM   3188 C  CB    . THR A 1 415 ? 10.894  42.550 44.923 1.00 33.92 ? 415 THR A CB    1 
ATOM   3189 O  OG1   . THR A 1 415 ? 11.140  42.011 43.615 1.00 34.69 ? 415 THR A OG1   1 
ATOM   3190 C  CG2   . THR A 1 415 ? 10.892  41.410 45.957 1.00 29.86 ? 415 THR A CG2   1 
ATOM   3191 N  N     . GLY A 1 416 ? 8.406   44.766 43.369 1.00 35.67 ? 416 GLY A N     1 
ATOM   3192 C  CA    . GLY A 1 416 ? 8.353   45.854 42.406 1.00 33.75 ? 416 GLY A CA    1 
ATOM   3193 C  C     . GLY A 1 416 ? 6.990   45.815 41.757 1.00 34.44 ? 416 GLY A C     1 
ATOM   3194 O  O     . GLY A 1 416 ? 6.300   44.779 41.865 1.00 37.37 ? 416 GLY A O     1 
ATOM   3195 N  N     . PRO A 1 417 ? 6.567   46.880 41.055 1.00 32.95 ? 417 PRO A N     1 
ATOM   3196 C  CA    . PRO A 1 417 ? 5.249   46.919 40.403 1.00 32.30 ? 417 PRO A CA    1 
ATOM   3197 C  C     . PRO A 1 417 ? 5.018   46.012 39.208 1.00 34.12 ? 417 PRO A C     1 
ATOM   3198 O  O     . PRO A 1 417 ? 3.864   45.603 38.954 1.00 32.74 ? 417 PRO A O     1 
ATOM   3199 C  CB    . PRO A 1 417 ? 5.083   48.389 40.038 1.00 26.91 ? 417 PRO A CB    1 
ATOM   3200 C  CG    . PRO A 1 417 ? 6.477   48.830 39.821 1.00 31.57 ? 417 PRO A CG    1 
ATOM   3201 C  CD    . PRO A 1 417 ? 7.283   48.153 40.884 1.00 29.84 ? 417 PRO A CD    1 
ATOM   3202 N  N     . ASP A 1 418 ? 6.095   45.665 38.497 1.00 32.40 ? 418 ASP A N     1 
ATOM   3203 C  CA    . ASP A 1 418 ? 5.989   44.837 37.293 1.00 31.06 ? 418 ASP A CA    1 
ATOM   3204 C  C     . ASP A 1 418 ? 5.663   43.371 37.533 1.00 30.26 ? 418 ASP A C     1 
ATOM   3205 O  O     . ASP A 1 418 ? 6.293   42.707 38.346 1.00 32.11 ? 418 ASP A O     1 
ATOM   3206 C  CB    . ASP A 1 418 ? 7.259   44.950 36.444 1.00 29.38 ? 418 ASP A CB    1 
ATOM   3207 C  CG    . ASP A 1 418 ? 7.008   44.612 34.982 1.00 30.22 ? 418 ASP A CG    1 
ATOM   3208 O  OD1   . ASP A 1 418 ? 6.972   45.540 34.141 1.00 24.27 ? 418 ASP A OD1   1 
ATOM   3209 O  OD2   . ASP A 1 418 ? 6.808   43.421 34.667 1.00 32.07 ? 418 ASP A OD2   1 
ATOM   3210 N  N     . ARG A 1 419 ? 4.691   42.863 36.796 1.00 32.34 ? 419 ARG A N     1 
ATOM   3211 C  CA    . ARG A 1 419 ? 4.238   41.470 36.894 1.00 34.84 ? 419 ARG A CA    1 
ATOM   3212 C  C     . ARG A 1 419 ? 5.310   40.442 37.330 1.00 35.12 ? 419 ARG A C     1 
ATOM   3213 O  O     . ARG A 1 419 ? 5.154   39.759 38.343 1.00 38.82 ? 419 ARG A O     1 
ATOM   3214 C  CB    . ARG A 1 419 ? 3.609   41.056 35.543 1.00 33.64 ? 419 ARG A CB    1 
ATOM   3215 C  CG    . ARG A 1 419 ? 3.168   39.598 35.449 1.00 34.00 ? 419 ARG A CG    1 
ATOM   3216 C  CD    . ARG A 1 419 ? 2.795   39.196 34.039 1.00 31.73 ? 419 ARG A CD    1 
ATOM   3217 N  NE    . ARG A 1 419 ? 1.423   39.496 33.669 1.00 38.41 ? 419 ARG A NE    1 
ATOM   3218 C  CZ    . ARG A 1 419 ? 1.021   39.442 32.390 1.00 45.83 ? 419 ARG A CZ    1 
ATOM   3219 N  NH1   . ARG A 1 419 ? 1.863   39.120 31.406 1.00 42.87 ? 419 ARG A NH1   1 
ATOM   3220 N  NH2   . ARG A 1 419 ? -0.243  39.678 32.076 1.00 48.77 ? 419 ARG A NH2   1 
ATOM   3221 N  N     . THR A 1 420 ? 6.410   40.379 36.582 1.00 35.44 ? 420 THR A N     1 
ATOM   3222 C  CA    . THR A 1 420 ? 7.508   39.445 36.814 1.00 30.40 ? 420 THR A CA    1 
ATOM   3223 C  C     . THR A 1 420 ? 8.460   39.747 37.975 1.00 33.49 ? 420 THR A C     1 
ATOM   3224 O  O     . THR A 1 420 ? 9.402   38.992 38.196 1.00 31.38 ? 420 THR A O     1 
ATOM   3225 C  CB    . THR A 1 420 ? 8.325   39.311 35.532 1.00 31.36 ? 420 THR A CB    1 
ATOM   3226 O  OG1   . THR A 1 420 ? 8.635   40.611 35.025 1.00 32.08 ? 420 THR A OG1   1 
ATOM   3227 C  CG2   . THR A 1 420 ? 7.529   38.568 34.472 1.00 32.85 ? 420 THR A CG2   1 
ATOM   3228 N  N     . GLU A 1 421 ? 8.265   40.866 38.684 1.00 35.24 ? 421 GLU A N     1 
ATOM   3229 C  CA    . GLU A 1 421 ? 9.090   41.245 39.833 1.00 34.76 ? 421 GLU A CA    1 
ATOM   3230 C  C     . GLU A 1 421 ? 8.466   40.606 41.081 1.00 35.84 ? 421 GLU A C     1 
ATOM   3231 O  O     . GLU A 1 421 ? 8.067   41.286 42.041 1.00 35.30 ? 421 GLU A O     1 
ATOM   3232 C  CB    . GLU A 1 421 ? 9.135   42.763 39.969 1.00 31.47 ? 421 GLU A CB    1 
ATOM   3233 C  CG    . GLU A 1 421 ? 9.858   43.406 38.861 1.00 33.54 ? 421 GLU A CG    1 
ATOM   3234 C  CD    . GLU A 1 421 ? 9.858   44.900 38.943 1.00 38.12 ? 421 GLU A CD    1 
ATOM   3235 O  OE1   . GLU A 1 421 ? 10.809  45.503 38.411 1.00 44.30 ? 421 GLU A OE1   1 
ATOM   3236 O  OE2   . GLU A 1 421 ? 8.909   45.494 39.501 1.00 41.76 ? 421 GLU A OE2   1 
ATOM   3237 N  N     . THR A 1 422 ? 8.471   39.283 41.085 1.00 33.72 ? 422 THR A N     1 
ATOM   3238 C  CA    . THR A 1 422 ? 7.838   38.542 42.139 1.00 32.62 ? 422 THR A CA    1 
ATOM   3239 C  C     . THR A 1 422 ? 8.543   37.207 42.429 1.00 34.52 ? 422 THR A C     1 
ATOM   3240 O  O     . THR A 1 422 ? 9.311   36.708 41.611 1.00 36.57 ? 422 THR A O     1 
ATOM   3241 C  CB    . THR A 1 422 ? 6.374   38.305 41.705 1.00 29.92 ? 422 THR A CB    1 
ATOM   3242 O  OG1   . THR A 1 422 ? 5.889   39.506 41.087 1.00 28.73 ? 422 THR A OG1   1 
ATOM   3243 C  CG2   . THR A 1 422 ? 5.469   37.959 42.920 1.00 34.18 ? 422 THR A CG2   1 
ATOM   3244 N  N     . MET A 1 423 ? 8.290   36.661 43.615 1.00 33.95 ? 423 MET A N     1 
ATOM   3245 C  CA    . MET A 1 423 ? 8.849   35.393 44.058 1.00 30.27 ? 423 MET A CA    1 
ATOM   3246 C  C     . MET A 1 423 ? 7.656   34.560 44.395 1.00 29.76 ? 423 MET A C     1 
ATOM   3247 O  O     . MET A 1 423 ? 6.959   34.872 45.352 1.00 34.02 ? 423 MET A O     1 
ATOM   3248 C  CB    . MET A 1 423 ? 9.594   35.599 45.371 1.00 36.64 ? 423 MET A CB    1 
ATOM   3249 C  CG    . MET A 1 423 ? 11.083  35.427 45.307 1.00 39.75 ? 423 MET A CG    1 
ATOM   3250 S  SD    . MET A 1 423 ? 11.862  36.302 46.664 1.00 35.06 ? 423 MET A SD    1 
ATOM   3251 C  CE    . MET A 1 423 ? 11.833  37.970 45.999 1.00 32.70 ? 423 MET A CE    1 
ATOM   3252 N  N     . ILE A 1 424 ? 7.387   33.528 43.621 1.00 25.23 ? 424 ILE A N     1 
ATOM   3253 C  CA    . ILE A 1 424 ? 6.270   32.661 43.915 1.00 26.56 ? 424 ILE A CA    1 
ATOM   3254 C  C     . ILE A 1 424 ? 6.823   31.459 44.647 1.00 29.72 ? 424 ILE A C     1 
ATOM   3255 O  O     . ILE A 1 424 ? 7.325   30.539 44.028 1.00 33.08 ? 424 ILE A O     1 
ATOM   3256 C  CB    . ILE A 1 424 ? 5.560   32.194 42.633 1.00 26.25 ? 424 ILE A CB    1 
ATOM   3257 C  CG1   . ILE A 1 424 ? 4.827   33.374 42.007 1.00 22.74 ? 424 ILE A CG1   1 
ATOM   3258 C  CG2   . ILE A 1 424 ? 4.571   31.068 42.925 1.00 26.77 ? 424 ILE A CG2   1 
ATOM   3259 C  CD1   . ILE A 1 424 ? 3.842   32.965 40.949 1.00 20.69 ? 424 ILE A CD1   1 
ATOM   3260 N  N     . LEU A 1 425 ? 6.728   31.463 45.966 1.00 29.40 ? 425 LEU A N     1 
ATOM   3261 C  CA    . LEU A 1 425 ? 7.239   30.359 46.752 1.00 32.44 ? 425 LEU A CA    1 
ATOM   3262 C  C     . LEU A 1 425 ? 6.271   29.176 46.763 1.00 33.69 ? 425 LEU A C     1 
ATOM   3263 O  O     . LEU A 1 425 ? 6.694   28.034 46.843 1.00 37.54 ? 425 LEU A O     1 
ATOM   3264 C  CB    . LEU A 1 425 ? 7.537   30.823 48.172 1.00 34.71 ? 425 LEU A CB    1 
ATOM   3265 C  CG    . LEU A 1 425 ? 8.240   32.182 48.337 1.00 32.90 ? 425 LEU A CG    1 
ATOM   3266 C  CD1   . LEU A 1 425 ? 8.480   32.452 49.807 1.00 29.50 ? 425 LEU A CD1   1 
ATOM   3267 C  CD2   . LEU A 1 425 ? 9.530   32.212 47.573 1.00 31.23 ? 425 LEU A CD2   1 
ATOM   3268 N  N     . ARG A 1 426 ? 4.973   29.465 46.731 1.00 38.13 ? 426 ARG A N     1 
ATOM   3269 C  CA    . ARG A 1 426 ? 3.897   28.454 46.689 1.00 37.46 ? 426 ARG A CA    1 
ATOM   3270 C  C     . ARG A 1 426 ? 2.720   29.053 45.902 1.00 38.29 ? 426 ARG A C     1 
ATOM   3271 O  O     . ARG A 1 426 ? 2.093   30.015 46.334 1.00 35.77 ? 426 ARG A O     1 
ATOM   3272 C  CB    . ARG A 1 426 ? 3.405   28.068 48.077 1.00 38.17 ? 426 ARG A CB    1 
ATOM   3273 C  CG    . ARG A 1 426 ? 2.241   27.058 48.094 1.00 46.16 ? 426 ARG A CG    1 
ATOM   3274 C  CD    . ARG A 1 426 ? 2.715   25.607 47.834 1.00 57.03 ? 426 ARG A CD    1 
ATOM   3275 N  NE    . ARG A 1 426 ? 1.643   24.605 47.955 1.00 64.62 ? 426 ARG A NE    1 
ATOM   3276 C  CZ    . ARG A 1 426 ? 1.806   23.331 47.562 1.00 68.51 ? 426 ARG A CZ    1 
ATOM   3277 N  NH1   . ARG A 1 426 ? 2.966   22.919 47.052 1.00 70.22 ? 426 ARG A NH1   1 
ATOM   3278 N  NH2   . ARG A 1 426 ? 0.793   22.465 47.644 1.00 66.42 ? 426 ARG A NH2   1 
ATOM   3279 N  N     . ASP A 1 427 ? 2.480   28.500 44.714 1.00 36.74 ? 427 ASP A N     1 
ATOM   3280 C  CA    . ASP A 1 427 ? 1.406   28.933 43.838 1.00 34.21 ? 427 ASP A CA    1 
ATOM   3281 C  C     . ASP A 1 427 ? 0.120   28.331 44.356 1.00 33.93 ? 427 ASP A C     1 
ATOM   3282 O  O     . ASP A 1 427 ? -0.087  27.111 44.298 1.00 37.04 ? 427 ASP A O     1 
ATOM   3283 C  CB    . ASP A 1 427 ? 1.648   28.425 42.423 1.00 38.09 ? 427 ASP A CB    1 
ATOM   3284 C  CG    . ASP A 1 427 ? 0.704   29.028 41.419 1.00 38.52 ? 427 ASP A CG    1 
ATOM   3285 O  OD1   . ASP A 1 427 ? 0.913   30.184 41.013 1.00 43.44 ? 427 ASP A OD1   1 
ATOM   3286 O  OD2   . ASP A 1 427 ? -0.251  28.339 41.040 1.00 41.20 ? 427 ASP A OD2   1 
ATOM   3287 N  N     . PRO A 1 428 ? -0.760  29.163 44.895 1.00 30.45 ? 428 PRO A N     1 
ATOM   3288 C  CA    . PRO A 1 428 ? -2.048  28.738 45.431 1.00 29.38 ? 428 PRO A CA    1 
ATOM   3289 C  C     . PRO A 1 428 ? -2.810  27.666 44.609 1.00 30.83 ? 428 PRO A C     1 
ATOM   3290 O  O     . PRO A 1 428 ? -3.538  26.839 45.196 1.00 27.55 ? 428 PRO A O     1 
ATOM   3291 C  CB    . PRO A 1 428 ? -2.808  30.064 45.486 1.00 33.28 ? 428 PRO A CB    1 
ATOM   3292 C  CG    . PRO A 1 428 ? -1.739  31.027 45.906 1.00 26.34 ? 428 PRO A CG    1 
ATOM   3293 C  CD    . PRO A 1 428 ? -0.566  30.613 45.045 1.00 29.27 ? 428 PRO A CD    1 
ATOM   3294 N  N     . PHE A 1 429 ? -2.666  27.679 43.275 1.00 33.99 ? 429 PHE A N     1 
ATOM   3295 C  CA    . PHE A 1 429 ? -3.365  26.706 42.405 1.00 33.27 ? 429 PHE A CA    1 
ATOM   3296 C  C     . PHE A 1 429 ? -2.989  25.243 42.609 1.00 37.20 ? 429 PHE A C     1 
ATOM   3297 O  O     . PHE A 1 429 ? -3.837  24.355 42.456 1.00 32.87 ? 429 PHE A O     1 
ATOM   3298 C  CB    . PHE A 1 429 ? -3.307  27.106 40.932 1.00 27.30 ? 429 PHE A CB    1 
ATOM   3299 C  CG    . PHE A 1 429 ? -4.351  28.155 40.550 1.00 31.77 ? 429 PHE A CG    1 
ATOM   3300 C  CD1   . PHE A 1 429 ? -3.984  29.361 39.931 1.00 29.55 ? 429 PHE A CD1   1 
ATOM   3301 C  CD2   . PHE A 1 429 ? -5.699  27.958 40.858 1.00 29.74 ? 429 PHE A CD2   1 
ATOM   3302 C  CE1   . PHE A 1 429 ? -4.946  30.352 39.631 1.00 29.78 ? 429 PHE A CE1   1 
ATOM   3303 C  CE2   . PHE A 1 429 ? -6.653  28.937 40.564 1.00 26.41 ? 429 PHE A CE2   1 
ATOM   3304 C  CZ    . PHE A 1 429 ? -6.276  30.135 39.948 1.00 26.85 ? 429 PHE A CZ    1 
ATOM   3305 N  N     . ASP A 1 430 ? -1.733  25.008 43.002 1.00 46.22 ? 430 ASP A N     1 
ATOM   3306 C  CA    . ASP A 1 430 ? -1.200  23.681 43.301 1.00 49.91 ? 430 ASP A CA    1 
ATOM   3307 C  C     . ASP A 1 430 ? -1.453  23.386 44.785 1.00 55.90 ? 430 ASP A C     1 
ATOM   3308 O  O     . ASP A 1 430 ? -1.686  22.237 45.171 1.00 58.95 ? 430 ASP A O     1 
ATOM   3309 C  CB    . ASP A 1 430 ? 0.307   23.665 43.093 1.00 52.85 ? 430 ASP A CB    1 
ATOM   3310 C  CG    . ASP A 1 430 ? 0.719   24.166 41.736 1.00 57.66 ? 430 ASP A CG    1 
ATOM   3311 O  OD1   . ASP A 1 430 ? 1.793   24.807 41.666 1.00 58.84 ? 430 ASP A OD1   1 
ATOM   3312 O  OD2   . ASP A 1 430 ? -0.023  23.931 40.748 1.00 61.79 ? 430 ASP A OD2   1 
ATOM   3313 N  N     . ALA A 1 431 ? -1.352  24.425 45.618 1.00 58.09 ? 431 ALA A N     1 
ATOM   3314 C  CA    . ALA A 1 431 ? -1.551  24.305 47.059 1.00 58.49 ? 431 ALA A CA    1 
ATOM   3315 C  C     . ALA A 1 431 ? -2.761  23.447 47.446 1.00 60.76 ? 431 ALA A C     1 
ATOM   3316 O  O     . ALA A 1 431 ? -3.903  23.924 47.270 1.00 64.68 ? 431 ALA A O     1 
ATOM   3317 C  CB    . ALA A 1 431 ? -1.650  25.683 47.683 1.00 55.03 ? 431 ALA A CB    1 
ATOM   3318 O  OXT   . ALA A 1 431 ? -2.548  22.306 47.910 1.00 59.33 ? 431 ALA A OXT   1 
HETATM 3319 MG MG    . MG  B 2 .   ? -6.112  50.387 44.678 1.00 25.67 ? 435 MG  A MG    1 
HETATM 3320 P  P     . IMO C 3 .   ? -8.683  48.982 46.577 1.00 39.11 ? 440 IMO A P     1 
HETATM 3321 O  O1    . IMO C 3 .   ? -7.743  49.415 45.520 1.00 39.59 ? 440 IMO A O1    1 
HETATM 3322 C  C2    . IMO C 3 .   ? -8.408  51.895 49.748 1.00 31.09 ? 440 IMO A C2    1 
HETATM 3323 C  "C1'" . IMO C 3 .   ? -12.082 53.464 51.209 1.00 35.39 ? 440 IMO A "C1'" 1 
HETATM 3324 C  "C2'" . IMO C 3 .   ? -12.199 54.984 51.183 1.00 34.95 ? 440 IMO A "C2'" 1 
HETATM 3325 C  "C3'" . IMO C 3 .   ? -12.994 55.196 52.454 1.00 38.60 ? 440 IMO A "C3'" 1 
HETATM 3326 C  "C4'" . IMO C 3 .   ? -13.968 54.019 52.477 1.00 33.69 ? 440 IMO A "C4'" 1 
HETATM 3327 C  "C5'" . IMO C 3 .   ? -15.234 54.339 51.880 1.00 32.49 ? 440 IMO A "C5'" 1 
HETATM 3328 O  O2    . IMO C 3 .   ? -7.879  48.698 47.787 1.00 35.41 ? 440 IMO A O2    1 
HETATM 3329 O  O3    . IMO C 3 .   ? -9.390  47.698 46.145 1.00 39.76 ? 440 IMO A O3    1 
HETATM 3330 P  PA    . IMO C 3 .   ? -16.387 54.151 49.540 1.00 37.75 ? 440 IMO A PA    1 
HETATM 3331 O  O1A   . IMO C 3 .   ? -16.123 52.710 49.316 1.00 40.97 ? 440 IMO A O1A   1 
HETATM 3332 O  O2A   . IMO C 3 .   ? -16.297 54.840 48.217 1.00 40.18 ? 440 IMO A O2A   1 
HETATM 3333 O  O3A   . IMO C 3 .   ? -17.745 54.319 50.115 1.00 37.40 ? 440 IMO A O3A   1 
HETATM 3334 O  "O5'" . IMO C 3 .   ? -15.200 54.724 50.510 1.00 32.36 ? 440 IMO A "O5'" 1 
HETATM 3335 O  "O4'" . IMO C 3 .   ? -13.366 52.926 51.760 1.00 33.66 ? 440 IMO A "O4'" 1 
HETATM 3336 N  N9    . IMO C 3 .   ? -11.685 52.999 49.952 1.00 33.62 ? 440 IMO A N9    1 
HETATM 3337 C  C4    . IMO C 3 .   ? -10.487 52.430 49.623 1.00 29.65 ? 440 IMO A C4    1 
HETATM 3338 N  N3    . IMO C 3 .   ? -9.380  52.544 50.266 1.00 27.21 ? 440 IMO A N3    1 
HETATM 3339 N  N1    . IMO C 3 .   ? -8.558  51.176 48.655 1.00 34.44 ? 440 IMO A N1    1 
HETATM 3340 C  C6    . IMO C 3 .   ? -9.656  51.018 47.928 1.00 33.17 ? 440 IMO A C6    1 
HETATM 3341 O  O6    . IMO C 3 .   ? -9.802  50.147 46.809 1.00 40.90 ? 440 IMO A O6    1 
HETATM 3342 C  C5    . IMO C 3 .   ? -10.697 51.727 48.482 1.00 33.80 ? 440 IMO A C5    1 
HETATM 3343 N  N7    . IMO C 3 .   ? -12.013 51.831 48.031 1.00 31.37 ? 440 IMO A N7    1 
HETATM 3344 C  C8    . IMO C 3 .   ? -12.538 52.582 48.924 1.00 32.26 ? 440 IMO A C8    1 
HETATM 3345 O  "O2'" . IMO C 3 .   ? -10.927 55.461 51.350 1.00 36.20 ? 440 IMO A "O2'" 1 
HETATM 3346 O  "O3'" . IMO C 3 .   ? -12.022 55.124 53.554 1.00 39.11 ? 440 IMO A "O3'" 1 
HETATM 3347 P  PB    . GDP D 4 .   ? -4.637  47.370 44.711 1.00 25.06 ? 432 GDP A PB    1 
HETATM 3348 O  O1B   . GDP D 4 .   ? -4.964  46.664 43.426 1.00 27.56 ? 432 GDP A O1B   1 
HETATM 3349 O  O2B   . GDP D 4 .   ? -5.549  48.482 44.903 1.00 19.16 ? 432 GDP A O2B   1 
HETATM 3350 O  O3B   . GDP D 4 .   ? -4.564  46.413 45.848 1.00 24.27 ? 432 GDP A O3B   1 
HETATM 3351 O  O3A   . GDP D 4 .   ? -3.160  47.965 44.665 1.00 29.10 ? 432 GDP A O3A   1 
HETATM 3352 P  PA    . GDP D 4 .   ? -2.936  49.404 43.962 1.00 26.50 ? 432 GDP A PA    1 
HETATM 3353 O  O1A   . GDP D 4 .   ? -2.580  49.185 42.542 1.00 25.74 ? 432 GDP A O1A   1 
HETATM 3354 O  O2A   . GDP D 4 .   ? -3.955  50.488 44.240 1.00 22.79 ? 432 GDP A O2A   1 
HETATM 3355 O  "O5'" . GDP D 4 .   ? -1.590  49.766 44.764 1.00 22.96 ? 432 GDP A "O5'" 1 
HETATM 3356 C  "C5'" . GDP D 4 .   ? -0.497  48.886 44.515 1.00 25.21 ? 432 GDP A "C5'" 1 
HETATM 3357 C  "C4'" . GDP D 4 .   ? 0.552   49.774 43.953 1.00 27.14 ? 432 GDP A "C4'" 1 
HETATM 3358 O  "O4'" . GDP D 4 .   ? 1.885   49.469 44.188 1.00 25.65 ? 432 GDP A "O4'" 1 
HETATM 3359 C  "C3'" . GDP D 4 .   ? 0.554   50.011 42.499 1.00 27.67 ? 432 GDP A "C3'" 1 
HETATM 3360 O  "O3'" . GDP D 4 .   ? 1.280   51.272 42.274 1.00 27.09 ? 432 GDP A "O3'" 1 
HETATM 3361 C  "C2'" . GDP D 4 .   ? 1.513   48.902 41.967 1.00 29.22 ? 432 GDP A "C2'" 1 
HETATM 3362 O  "O2'" . GDP D 4 .   ? 2.022   49.443 40.732 1.00 33.76 ? 432 GDP A "O2'" 1 
HETATM 3363 C  "C1'" . GDP D 4 .   ? 2.551   48.890 43.013 1.00 26.32 ? 432 GDP A "C1'" 1 
HETATM 3364 N  N9    . GDP D 4 .   ? 3.117   47.646 43.326 1.00 27.41 ? 432 GDP A N9    1 
HETATM 3365 C  C8    . GDP D 4 .   ? 2.572   46.369 43.420 1.00 27.26 ? 432 GDP A C8    1 
HETATM 3366 N  N7    . GDP D 4 .   ? 3.414   45.464 43.967 1.00 27.74 ? 432 GDP A N7    1 
HETATM 3367 C  C5    . GDP D 4 .   ? 4.559   46.203 44.247 1.00 20.70 ? 432 GDP A C5    1 
HETATM 3368 C  C6    . GDP D 4 .   ? 5.735   45.767 44.819 1.00 24.52 ? 432 GDP A C6    1 
HETATM 3369 O  O6    . GDP D 4 .   ? 5.996   44.607 45.203 1.00 18.82 ? 432 GDP A O6    1 
HETATM 3370 N  N1    . GDP D 4 .   ? 6.652   46.823 44.904 1.00 19.06 ? 432 GDP A N1    1 
HETATM 3371 C  C2    . GDP D 4 .   ? 6.437   48.127 44.496 1.00 23.09 ? 432 GDP A C2    1 
HETATM 3372 N  N2    . GDP D 4 .   ? 7.393   49.050 44.668 1.00 22.50 ? 432 GDP A N2    1 
HETATM 3373 N  N3    . GDP D 4 .   ? 5.290   48.511 43.956 1.00 22.37 ? 432 GDP A N3    1 
HETATM 3374 C  C4    . GDP D 4 .   ? 4.422   47.502 43.866 1.00 22.77 ? 432 GDP A C4    1 
HETATM 3375 O  O     . HOH E 5 .   ? -6.568  40.561 65.925 1.00 25.68 ? 441 HOH A O     1 
HETATM 3376 O  O     . HOH E 5 .   ? -1.902  46.814 41.925 1.00 33.54 ? 442 HOH A O     1 
HETATM 3377 O  O     . HOH E 5 .   ? -31.572 40.923 38.213 1.00 59.35 ? 443 HOH A O     1 
HETATM 3378 O  O     . HOH E 5 .   ? -6.567  49.789 18.929 1.00 24.21 ? 444 HOH A O     1 
HETATM 3379 O  O     . HOH E 5 .   ? -16.726 53.428 72.794 1.00 29.16 ? 445 HOH A O     1 
HETATM 3380 O  O     . HOH E 5 .   ? -16.513 45.971 63.344 1.00 27.42 ? 446 HOH A O     1 
HETATM 3381 O  O     . HOH E 5 .   ? 2.827   52.985 31.012 1.00 32.73 ? 447 HOH A O     1 
HETATM 3382 O  O     . HOH E 5 .   ? -14.230 54.432 73.168 1.00 47.36 ? 448 HOH A O     1 
HETATM 3383 O  O     . HOH E 5 .   ? -23.710 56.240 51.868 1.00 24.06 ? 449 HOH A O     1 
HETATM 3384 O  O     . HOH E 5 .   ? 14.717  49.268 46.483 1.00 54.16 ? 450 HOH A O     1 
HETATM 3385 O  O     . HOH E 5 .   ? -3.720  49.197 53.464 1.00 28.23 ? 451 HOH A O     1 
HETATM 3386 O  O     . HOH E 5 .   ? -18.125 38.369 27.081 1.00 31.38 ? 452 HOH A O     1 
HETATM 3387 O  O     . HOH E 5 .   ? -16.777 48.179 48.526 1.00 21.34 ? 453 HOH A O     1 
HETATM 3388 O  O     . HOH E 5 .   ? -22.770 28.648 42.299 1.00 26.87 ? 454 HOH A O     1 
HETATM 3389 O  O     . HOH E 5 .   ? -13.172 23.103 40.998 1.00 36.04 ? 455 HOH A O     1 
HETATM 3390 O  O     . HOH E 5 .   ? -17.008 61.585 48.779 1.00 34.58 ? 456 HOH A O     1 
HETATM 3391 O  O     . HOH E 5 .   ? -8.012  25.457 34.450 1.00 28.40 ? 457 HOH A O     1 
HETATM 3392 O  O     . HOH E 5 .   ? 10.572  32.243 55.965 1.00 23.93 ? 458 HOH A O     1 
HETATM 3393 O  O     . HOH E 5 .   ? -10.198 42.405 49.451 1.00 15.92 ? 459 HOH A O     1 
HETATM 3394 O  O     . HOH E 5 .   ? 1.523   44.250 37.793 1.00 10.40 ? 460 HOH A O     1 
HETATM 3395 O  O     . HOH E 5 .   ? 8.550   32.533 40.826 1.00 53.39 ? 461 HOH A O     1 
HETATM 3396 O  O     . HOH E 5 .   ? -10.910 44.840 39.257 1.00 20.34 ? 462 HOH A O     1 
HETATM 3397 O  O     . HOH E 5 .   ? -4.254  56.593 63.656 1.00 51.48 ? 463 HOH A O     1 
HETATM 3398 O  O     . HOH E 5 .   ? -27.751 33.695 41.380 1.00 15.68 ? 464 HOH A O     1 
HETATM 3399 O  O     . HOH E 5 .   ? -29.830 55.368 49.211 1.00 25.66 ? 465 HOH A O     1 
HETATM 3400 O  O     . HOH E 5 .   ? -8.211  52.809 53.180 1.00 27.22 ? 466 HOH A O     1 
HETATM 3401 O  O     . HOH E 5 .   ? -25.544 55.681 33.557 1.00 36.99 ? 467 HOH A O     1 
HETATM 3402 O  O     . HOH E 5 .   ? -21.270 59.294 54.219 1.00 38.88 ? 468 HOH A O     1 
HETATM 3403 O  O     . HOH E 5 .   ? 9.778   55.644 63.222 1.00 46.22 ? 469 HOH A O     1 
HETATM 3404 O  O     . HOH E 5 .   ? 22.480  38.020 53.735 1.00 47.13 ? 470 HOH A O     1 
HETATM 3405 O  O     . HOH E 5 .   ? -27.120 42.001 43.961 1.00 28.05 ? 471 HOH A O     1 
HETATM 3406 O  O     . HOH E 5 .   ? -23.933 57.925 55.448 1.00 44.87 ? 472 HOH A O     1 
HETATM 3407 O  O     . HOH E 5 .   ? -2.405  50.238 62.404 1.00 25.24 ? 473 HOH A O     1 
HETATM 3408 O  O     . HOH E 5 .   ? -24.384 43.825 45.003 1.00 16.70 ? 474 HOH A O     1 
HETATM 3409 O  O     . HOH E 5 .   ? -19.171 56.829 30.161 1.00 51.92 ? 475 HOH A O     1 
HETATM 3410 O  O     . HOH E 5 .   ? 6.483   47.255 59.227 1.00 31.47 ? 476 HOH A O     1 
HETATM 3411 O  O     . HOH E 5 .   ? -29.030 49.377 44.114 1.00 21.64 ? 477 HOH A O     1 
HETATM 3412 O  O     . HOH E 5 .   ? -22.065 58.375 51.265 1.00 29.21 ? 478 HOH A O     1 
HETATM 3413 O  O     . HOH E 5 .   ? -21.876 47.195 60.677 1.00 26.39 ? 479 HOH A O     1 
HETATM 3414 O  O     . HOH E 5 .   ? -33.289 35.823 34.658 1.00 21.03 ? 480 HOH A O     1 
HETATM 3415 O  O     . HOH E 5 .   ? -4.978  26.107 51.905 1.00 53.38 ? 481 HOH A O     1 
HETATM 3416 O  O     . HOH E 5 .   ? -28.299 50.684 24.371 1.00 25.16 ? 482 HOH A O     1 
HETATM 3417 O  O     . HOH E 5 .   ? -4.594  52.538 51.184 1.00 21.26 ? 483 HOH A O     1 
HETATM 3418 O  O     . HOH E 5 .   ? 6.194   58.771 44.362 1.00 37.87 ? 484 HOH A O     1 
HETATM 3419 O  O     . HOH E 5 .   ? -6.442  53.736 26.430 1.00 34.86 ? 485 HOH A O     1 
HETATM 3420 O  O     . HOH E 5 .   ? -23.445 40.329 47.841 1.00 35.52 ? 486 HOH A O     1 
HETATM 3421 O  O     . HOH E 5 .   ? -10.395 55.109 66.483 1.00 55.82 ? 487 HOH A O     1 
HETATM 3422 O  O     . HOH E 5 .   ? -4.719  40.625 33.383 1.00 22.33 ? 488 HOH A O     1 
HETATM 3423 O  O     . HOH E 5 .   ? -31.548 52.919 42.228 1.00 29.29 ? 489 HOH A O     1 
HETATM 3424 O  O     . HOH E 5 .   ? -6.399  52.528 44.405 1.00 46.54 ? 490 HOH A O     1 
HETATM 3425 O  O     . HOH E 5 .   ? -33.904 56.630 26.409 1.00 49.35 ? 491 HOH A O     1 
HETATM 3426 O  O     . HOH E 5 .   ? -12.387 46.334 63.213 1.00 38.99 ? 492 HOH A O     1 
HETATM 3427 O  O     . HOH E 5 .   ? -11.612 59.481 63.150 1.00 48.73 ? 493 HOH A O     1 
HETATM 3428 O  O     . HOH E 5 .   ? -7.671  31.148 60.153 1.00 37.56 ? 494 HOH A O     1 
HETATM 3429 O  O     . HOH E 5 .   ? -12.894 55.658 56.208 1.00 23.66 ? 495 HOH A O     1 
HETATM 3430 O  O     . HOH E 5 .   ? 17.040  40.304 61.266 1.00 46.09 ? 496 HOH A O     1 
HETATM 3431 O  O     . HOH E 5 .   ? -31.388 43.691 23.559 1.00 50.37 ? 497 HOH A O     1 
HETATM 3432 O  O     . HOH E 5 .   ? -1.251  48.439 53.404 1.00 27.60 ? 498 HOH A O     1 
HETATM 3433 O  O     . HOH E 5 .   ? -0.408  53.305 41.823 1.00 58.42 ? 499 HOH A O     1 
HETATM 3434 O  O     . HOH E 5 .   ? -11.690 35.497 27.475 1.00 42.03 ? 500 HOH A O     1 
HETATM 3435 O  O     . HOH E 5 .   ? -8.718  55.577 25.145 1.00 28.48 ? 501 HOH A O     1 
HETATM 3436 O  O     . HOH E 5 .   ? -0.001  46.011 30.414 1.00 40.89 ? 502 HOH A O     1 
HETATM 3437 O  O     . HOH E 5 .   ? -23.640 22.154 42.538 1.00 26.55 ? 503 HOH A O     1 
HETATM 3438 O  O     . HOH E 5 .   ? -11.599 44.336 64.469 1.00 18.41 ? 504 HOH A O     1 
HETATM 3439 O  O     . HOH E 5 .   ? -29.492 57.006 24.894 1.00 50.12 ? 505 HOH A O     1 
HETATM 3440 O  O     . HOH E 5 .   ? -30.752 45.469 44.887 1.00 27.61 ? 506 HOH A O     1 
HETATM 3441 O  O     . HOH E 5 .   ? -1.899  34.542 29.428 1.00 37.27 ? 507 HOH A O     1 
HETATM 3442 O  O     . HOH E 5 .   ? -9.316  50.624 17.927 1.00 43.17 ? 508 HOH A O     1 
HETATM 3443 O  O     . HOH E 5 .   ? 3.358   31.214 64.630 1.00 38.11 ? 509 HOH A O     1 
HETATM 3444 O  O     . HOH E 5 .   ? -16.645 20.761 52.689 1.00 29.33 ? 510 HOH A O     1 
HETATM 3445 O  O     . HOH E 5 .   ? -16.512 60.091 40.933 1.00 39.16 ? 511 HOH A O     1 
HETATM 3446 O  O     . HOH E 5 .   ? -23.290 55.661 35.573 1.00 47.34 ? 512 HOH A O     1 
HETATM 3447 O  O     . HOH E 5 .   ? -23.502 68.177 47.397 1.00 37.52 ? 513 HOH A O     1 
HETATM 3448 O  O     . HOH E 5 .   ? -20.712 42.459 50.052 1.00 60.29 ? 514 HOH A O     1 
HETATM 3449 O  O     . HOH E 5 .   ? 15.083  42.179 60.319 1.00 38.95 ? 515 HOH A O     1 
HETATM 3450 O  O     . HOH E 5 .   ? -43.057 50.570 38.444 1.00 40.39 ? 516 HOH A O     1 
HETATM 3451 O  O     . HOH E 5 .   ? -23.701 42.576 54.799 1.00 28.86 ? 517 HOH A O     1 
HETATM 3452 O  O     . HOH E 5 .   ? -19.589 59.073 63.076 1.00 47.70 ? 518 HOH A O     1 
HETATM 3453 O  O     . HOH E 5 .   ? -24.069 55.806 31.293 1.00 47.96 ? 519 HOH A O     1 
HETATM 3454 O  O     . HOH E 5 .   ? -6.065  51.749 30.141 1.00 43.03 ? 520 HOH A O     1 
HETATM 3455 O  O     . HOH E 5 .   ? -4.188  39.837 22.519 1.00 35.10 ? 521 HOH A O     1 
HETATM 3456 O  O     . HOH E 5 .   ? -18.304 55.903 46.790 1.00 17.97 ? 522 HOH A O     1 
HETATM 3457 O  O     . HOH E 5 .   ? -25.375 32.881 28.358 1.00 44.11 ? 523 HOH A O     1 
HETATM 3458 O  O     . HOH E 5 .   ? -0.510  30.770 38.628 1.00 28.21 ? 524 HOH A O     1 
HETATM 3459 O  O     . HOH E 5 .   ? -30.257 32.597 42.089 1.00 23.52 ? 525 HOH A O     1 
HETATM 3460 O  O     . HOH E 5 .   ? 14.933  47.556 55.507 1.00 24.13 ? 526 HOH A O     1 
HETATM 3461 O  O     . HOH E 5 .   ? -20.170 55.582 49.450 1.00 24.65 ? 527 HOH A O     1 
HETATM 3462 O  O     . HOH E 5 .   ? -42.937 48.282 35.965 1.00 45.91 ? 528 HOH A O     1 
HETATM 3463 O  O     . HOH E 5 .   ? -32.788 45.022 26.765 1.00 33.19 ? 529 HOH A O     1 
HETATM 3464 O  O     . HOH E 5 .   ? -27.014 37.022 35.426 1.00 27.05 ? 530 HOH A O     1 
HETATM 3465 O  O     . HOH E 5 .   ? -25.230 35.893 37.980 1.00 44.75 ? 531 HOH A O     1 
HETATM 3466 O  O     . HOH E 5 .   ? -22.773 36.092 40.432 1.00 23.74 ? 532 HOH A O     1 
HETATM 3467 O  O     . HOH E 5 .   ? -9.259  22.038 44.496 1.00 33.18 ? 533 HOH A O     1 
HETATM 3468 O  O     . HOH E 5 .   ? -33.417 67.489 30.959 1.00 54.48 ? 534 HOH A O     1 
HETATM 3469 O  O     . HOH E 5 .   ? 20.926  41.991 56.520 1.00 32.77 ? 535 HOH A O     1 
HETATM 3470 O  O     . HOH E 5 .   ? -26.600 59.741 33.926 1.00 36.93 ? 536 HOH A O     1 
HETATM 3471 O  O     . HOH E 5 .   ? -14.277 42.028 44.678 1.00 23.38 ? 537 HOH A O     1 
HETATM 3472 O  O     . HOH E 5 .   ? -12.347 41.259 49.333 1.00 27.88 ? 538 HOH A O     1 
HETATM 3473 O  O     . HOH E 5 .   ? -9.819  38.443 31.019 1.00 21.06 ? 539 HOH A O     1 
HETATM 3474 O  O     . HOH E 5 .   ? -10.209 41.629 52.953 1.00 26.27 ? 540 HOH A O     1 
HETATM 3475 O  O     . HOH E 5 .   ? -25.906 70.075 44.360 1.00 42.26 ? 541 HOH A O     1 
HETATM 3476 O  O     . HOH E 5 .   ? -5.260  44.471 58.871 1.00 37.64 ? 542 HOH A O     1 
HETATM 3477 O  O     . HOH E 5 .   ? -9.900  53.864 55.059 1.00 22.95 ? 543 HOH A O     1 
HETATM 3478 O  O     . HOH E 5 .   ? 0.854   41.954 37.293 1.00 17.82 ? 544 HOH A O     1 
HETATM 3479 O  O     . HOH E 5 .   ? -9.451  60.374 61.147 1.00 27.07 ? 545 HOH A O     1 
HETATM 3480 O  O     . HOH E 5 .   ? -0.694  46.275 58.596 1.00 26.52 ? 546 HOH A O     1 
HETATM 3481 O  O     . HOH E 5 .   ? -4.700  52.809 32.514 1.00 22.23 ? 547 HOH A O     1 
HETATM 3482 O  O     . HOH E 5 .   ? -4.992  54.307 28.729 1.00 56.17 ? 548 HOH A O     1 
HETATM 3483 O  O     . HOH E 5 .   ? -7.756  60.748 54.762 1.00 50.78 ? 549 HOH A O     1 
HETATM 3484 O  O     . HOH E 5 .   ? 1.576   46.891 39.690 1.00 19.36 ? 550 HOH A O     1 
HETATM 3485 O  O     . HOH E 5 .   ? 4.365   53.000 41.316 1.00 44.04 ? 551 HOH A O     1 
HETATM 3486 O  O     . HOH E 5 .   ? 3.492   54.589 65.569 1.00 23.13 ? 552 HOH A O     1 
HETATM 3487 O  O     . HOH E 5 .   ? 1.462   58.795 57.550 1.00 37.98 ? 553 HOH A O     1 
HETATM 3488 O  O     . HOH E 5 .   ? 8.393   53.961 65.253 1.00 27.39 ? 554 HOH A O     1 
HETATM 3489 O  O     . HOH E 5 .   ? 16.075  41.030 20.178 1.00 39.40 ? 555 HOH A O     1 
HETATM 3490 O  O     . HOH E 5 .   ? -26.630 32.746 31.096 1.00 35.60 ? 556 HOH A O     1 
HETATM 3491 O  O     . HOH E 5 .   ? -13.423 25.676 40.040 1.00 36.90 ? 557 HOH A O     1 
HETATM 3492 O  O     . HOH E 5 .   ? 12.832  53.424 60.958 1.00 62.69 ? 558 HOH A O     1 
HETATM 3493 O  O     . HOH E 5 .   ? -29.482 51.171 41.858 1.00 32.56 ? 559 HOH A O     1 
HETATM 3494 O  O     . HOH E 5 .   ? -15.955 19.541 43.207 1.00 38.87 ? 560 HOH A O     1 
HETATM 3495 O  O     . HOH E 5 .   ? -15.129 18.167 41.011 1.00 55.78 ? 561 HOH A O     1 
HETATM 3496 O  O     . HOH E 5 .   ? -15.794 27.465 40.337 1.00 47.11 ? 562 HOH A O     1 
HETATM 3497 O  O     . HOH E 5 .   ? -15.651 36.005 57.736 1.00 32.06 ? 563 HOH A O     1 
HETATM 3498 O  O     . HOH E 5 .   ? 18.074  45.718 43.403 1.00 46.74 ? 564 HOH A O     1 
HETATM 3499 O  O     . HOH E 5 .   ? -16.873 35.703 27.044 1.00 65.22 ? 565 HOH A O     1 
HETATM 3500 O  O     . HOH E 5 .   ? -30.430 46.557 26.699 1.00 37.27 ? 566 HOH A O     1 
HETATM 3501 O  O     . HOH E 5 .   ? -25.682 49.920 23.836 1.00 32.35 ? 567 HOH A O     1 
HETATM 3502 O  O     . HOH E 5 .   ? -8.327  29.026 29.520 1.00 47.62 ? 568 HOH A O     1 
HETATM 3503 O  O     . HOH E 5 .   ? -42.497 45.660 35.988 1.00 43.08 ? 569 HOH A O     1 
HETATM 3504 O  O     . HOH E 5 .   ? 20.213  35.782 52.060 1.00 64.95 ? 570 HOH A O     1 
HETATM 3505 O  O     . HOH E 5 .   ? -18.113 50.350 23.858 1.00 23.32 ? 571 HOH A O     1 
HETATM 3506 O  O     . HOH E 5 .   ? -5.953  36.575 66.517 1.00 46.49 ? 572 HOH A O     1 
HETATM 3507 O  O     . HOH E 5 .   ? -28.820 29.438 33.474 1.00 51.99 ? 573 HOH A O     1 
HETATM 3508 O  O     . HOH E 5 .   ? -18.934 50.390 39.183 1.00 35.96 ? 574 HOH A O     1 
HETATM 3509 O  O     . HOH E 5 .   ? -9.370  34.424 21.152 1.00 41.70 ? 575 HOH A O     1 
HETATM 3510 O  O     . HOH E 5 .   ? 9.815   27.323 45.835 1.00 55.10 ? 576 HOH A O     1 
HETATM 3511 O  O     . HOH E 5 .   ? -23.954 70.791 46.148 1.00 36.89 ? 577 HOH A O     1 
HETATM 3512 O  O     . HOH E 5 .   ? -5.864  39.511 73.936 1.00 38.68 ? 578 HOH A O     1 
HETATM 3513 O  O     . HOH E 5 .   ? -17.319 63.139 43.989 1.00 40.94 ? 579 HOH A O     1 
HETATM 3514 O  O     . HOH E 5 .   ? -15.268 63.384 51.528 1.00 40.43 ? 580 HOH A O     1 
HETATM 3515 O  O     . HOH E 5 .   ? -25.233 67.571 51.901 1.00 45.63 ? 581 HOH A O     1 
HETATM 3516 O  O     . HOH E 5 .   ? 0.041   39.824 75.281 1.00 62.75 ? 582 HOH A O     1 
HETATM 3517 O  O     . HOH E 5 .   ? -17.312 52.785 25.654 1.00 40.46 ? 583 HOH A O     1 
HETATM 3518 O  O     . HOH E 5 .   ? 0.072   53.267 30.354 1.00 54.26 ? 584 HOH A O     1 
HETATM 3519 O  O     . HOH E 5 .   ? -0.563  60.528 57.835 1.00 48.68 ? 585 HOH A O     1 
HETATM 3520 O  O     . HOH E 5 .   ? 8.428   47.803 35.191 1.00 50.76 ? 586 HOH A O     1 
HETATM 3521 O  O     . HOH E 5 .   ? 6.091   55.037 65.950 1.00 33.10 ? 587 HOH A O     1 
HETATM 3522 O  O     . HOH E 5 .   ? 5.367   59.203 63.910 1.00 46.67 ? 588 HOH A O     1 
HETATM 3523 O  O     . HOH E 5 .   ? -36.734 46.432 25.994 1.00 44.28 ? 589 HOH A O     1 
HETATM 3524 O  O     . HOH E 5 .   ? -14.181 57.921 65.600 1.00 53.33 ? 590 HOH A O     1 
HETATM 3525 O  O     . HOH E 5 .   ? -27.855 67.515 38.975 1.00 55.44 ? 591 HOH A O     1 
HETATM 3526 O  O     . HOH E 5 .   ? 1.859   39.615 70.574 1.00 48.99 ? 592 HOH A O     1 
HETATM 3527 O  O     . HOH E 5 .   ? 2.287   40.335 73.749 1.00 45.57 ? 593 HOH A O     1 
HETATM 3528 O  O     . HOH E 5 .   ? -24.838 23.858 36.542 1.00 69.59 ? 594 HOH A O     1 
HETATM 3529 O  O     . HOH E 5 .   ? -23.361 36.231 27.483 1.00 70.20 ? 595 HOH A O     1 
HETATM 3530 O  O     . HOH E 5 .   ? -8.578  53.294 46.338 1.00 58.37 ? 596 HOH A O     1 
HETATM 3531 O  O     . HOH E 5 .   ? -8.511  56.181 45.788 1.00 55.97 ? 597 HOH A O     1 
HETATM 3532 O  O     . HOH E 5 .   ? -5.969  59.280 53.535 1.00 65.54 ? 598 HOH A O     1 
HETATM 3533 O  O     . HOH E 5 .   ? -0.177  53.679 44.420 1.00 67.52 ? 599 HOH A O     1 
HETATM 3534 O  O     . HOH E 5 .   ? -6.255  53.937 67.135 1.00 54.38 ? 600 HOH A O     1 
HETATM 3535 O  O     . HOH E 5 .   ? -7.944  56.006 66.578 1.00 77.60 ? 601 HOH A O     1 
HETATM 3536 O  O     . HOH E 5 .   ? -3.221  45.988 59.190 1.00 49.87 ? 602 HOH A O     1 
HETATM 3537 O  O     . HOH E 5 .   ? 1.730   31.827 36.991 1.00 59.67 ? 603 HOH A O     1 
HETATM 3538 O  O     . HOH E 5 .   ? -10.586 57.655 49.936 1.00 69.54 ? 604 HOH A O     1 
HETATM 3539 O  O     . HOH E 5 .   ? -27.789 43.405 23.751 1.00 66.60 ? 605 HOH A O     1 
HETATM 3540 O  O     . HOH E 5 .   ? -10.680 38.006 23.277 1.00 63.30 ? 606 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   1   GLY GLY A . n 
A 1 2   ASN 2   2   2   ASN ASN A . n 
A 1 3   ASN 3   3   3   ASN ASN A . n 
A 1 4   VAL 4   4   4   VAL VAL A . n 
A 1 5   VAL 5   5   5   VAL VAL A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   GLY 8   8   8   GLY GLY A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  GLN 10  10  10  GLN GLN A . n 
A 1 11  TRP 11  11  11  TRP TRP A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  ASP 13  13  13  ASP ASP A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  TYR 29  29  29  TYR TYR A . n 
A 1 30  VAL 30  30  30  VAL VAL A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  ARG 32  32  32  ARG ARG A . n 
A 1 33  TYR 33  33  33  TYR TYR A . n 
A 1 34  GLN 34  34  34  GLN GLN A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  HIS 37  37  37  HIS HIS A . n 
A 1 38  ASN 38  38  38  ASN ASN A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  HIS 41  41  41  HIS HIS A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  ASN 46  46  46  ASN ASN A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  HIS 53  53  53  HIS HIS A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  ILE 55  55  55  ILE ILE A . n 
A 1 56  PRO 56  56  56  PRO PRO A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  ILE 59  59  59  ILE ILE A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ARG 61  61  61  ARG ARG A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  ASN 63  63  63  ASN ASN A . n 
A 1 64  VAL 64  64  64  VAL VAL A . n 
A 1 65  THR 65  65  65  THR THR A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  GLY 69  69  69  GLY GLY A . n 
A 1 70  ASN 70  70  70  ASN ASN A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  ALA 77  77  77  ALA ALA A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  MET 80  80  80  MET MET A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  GLU 85  85  85  GLU GLU A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  ASP 88  88  88  ASP ASP A . n 
A 1 89  ARG 89  89  89  ARG ARG A . n 
A 1 90  GLY 90  90  90  GLY GLY A . n 
A 1 91  ILE 91  91  91  ILE ILE A . n 
A 1 92  PRO 92  92  92  PRO PRO A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  ARG 94  94  94  ARG ARG A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  ARG 96  96  96  ARG ARG A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 SER 100 100 100 SER SER A . n 
A 1 101 GLU 101 101 101 GLU GLU A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 CYS 103 103 103 CYS CYS A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 ASP 108 108 108 ASP ASP A . n 
A 1 109 TYR 109 109 109 TYR TYR A . n 
A 1 110 HIS 110 110 110 HIS HIS A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 ASP 114 114 114 ASP ASP A . n 
A 1 115 ASN 115 115 115 ASN ASN A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 ARG 117 117 117 ARG ARG A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 ARG 121 121 121 ARG ARG A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 LYS 124 124 124 LYS LYS A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 ILE 126 126 126 ILE ILE A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 THR 128 128 128 THR THR A . n 
A 1 129 THR 129 129 129 THR THR A . n 
A 1 130 GLY 130 130 130 GLY GLY A . n 
A 1 131 ARG 131 131 131 ARG ARG A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 ILE 133 133 133 ILE ILE A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 PRO 135 135 135 PRO PRO A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 ASP 139 139 139 ASP ASP A . n 
A 1 140 LYS 140 140 140 LYS LYS A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 ALA 142 142 142 ALA ALA A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 ARG 144 144 144 ARG ARG A . n 
A 1 145 GLY 145 145 145 GLY GLY A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 ARG 147 147 147 ARG ARG A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 ASP 153 153 153 ASP ASP A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 PHE 157 157 157 PHE PHE A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 GLU 159 159 159 GLU GLU A . n 
A 1 160 LYS 160 160 160 LYS LYS A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 LYS 162 162 162 LYS LYS A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 MET 165 165 165 MET MET A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 TYR 167 167 167 TYR TYR A . n 
A 1 168 HIS 168 168 168 HIS HIS A . n 
A 1 169 ASN 169 169 169 ASN ASN A . n 
A 1 170 PHE 170 170 170 PHE PHE A . n 
A 1 171 GLN 171 171 171 GLN GLN A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 ASN 174 174 174 ASN ASN A . n 
A 1 175 TYR 175 175 175 TYR TYR A . n 
A 1 176 TYR 176 176 176 TYR TYR A . n 
A 1 177 LYS 177 177 177 LYS LYS A . n 
A 1 178 ALA 178 178 178 ALA ALA A . n 
A 1 179 GLU 179 179 179 GLU GLU A . n 
A 1 180 ALA 180 180 180 ALA ALA A . n 
A 1 181 VAL 181 181 181 VAL VAL A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 TYR 183 183 183 TYR TYR A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 LYS 185 185 185 LYS LYS A . n 
A 1 186 VAL 186 186 186 VAL VAL A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 ASP 188 188 188 ASP ASP A . n 
A 1 189 ASP 189 189 189 ASP ASP A . n 
A 1 190 THR 190 190 190 THR THR A . n 
A 1 191 MET 191 191 191 MET MET A . n 
A 1 192 ALA 192 192 192 ALA ALA A . n 
A 1 193 VAL 193 193 193 VAL VAL A . n 
A 1 194 ALA 194 194 194 ALA ALA A . n 
A 1 195 ASP 195 195 195 ASP ASP A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 SER 199 199 199 SER SER A . n 
A 1 200 MET 200 200 200 MET MET A . n 
A 1 201 VAL 201 201 201 VAL VAL A . n 
A 1 202 VAL 202 202 202 VAL VAL A . n 
A 1 203 ASP 203 203 203 ASP ASP A . n 
A 1 204 VAL 204 204 204 VAL VAL A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 ASP 206 206 206 ASP ASP A . n 
A 1 207 LEU 207 207 207 LEU LEU A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 ASP 209 209 209 ASP ASP A . n 
A 1 210 GLN 210 210 210 GLN GLN A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 ARG 212 212 212 ARG ARG A . n 
A 1 213 GLN 213 213 213 GLN GLN A . n 
A 1 214 ARG 214 214 214 ARG ARG A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 ASP 216 216 216 ASP ASP A . n 
A 1 217 PHE 217 217 217 PHE PHE A . n 
A 1 218 VAL 218 218 218 VAL VAL A . n 
A 1 219 MET 219 219 219 MET MET A . n 
A 1 220 PHE 220 220 220 PHE PHE A . n 
A 1 221 GLU 221 221 221 GLU GLU A . n 
A 1 222 GLY 222 222 222 GLY GLY A . n 
A 1 223 ALA 223 223 223 ALA ALA A . n 
A 1 224 GLN 224 224 224 GLN GLN A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 THR 226 226 226 THR THR A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 ASP 229 229 229 ASP ASP A . n 
A 1 230 ILE 230 230 230 ILE ILE A . n 
A 1 231 ASP 231 231 231 ASP ASP A . n 
A 1 232 HIS 232 232 232 HIS HIS A . n 
A 1 233 GLY 233 233 233 GLY GLY A . n 
A 1 234 THR 234 234 234 THR THR A . n 
A 1 235 TYR 235 235 235 TYR TYR A . n 
A 1 236 PRO 236 236 236 PRO PRO A . n 
A 1 237 TYR 237 237 237 TYR TYR A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 THR 239 239 239 THR THR A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 ASN 242 242 242 ASN ASN A . n 
A 1 243 THR 243 243 243 THR THR A . n 
A 1 244 THR 244 244 244 THR THR A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 GLY 246 246 246 GLY GLY A . n 
A 1 247 GLY 247 247 247 GLY GLY A . n 
A 1 248 VAL 248 248 248 VAL VAL A . n 
A 1 249 ALA 249 249 249 ALA ALA A . n 
A 1 250 THR 250 250 250 THR THR A . n 
A 1 251 GLY 251 251 251 GLY GLY A . n 
A 1 252 SER 252 252 252 SER SER A . n 
A 1 253 GLY 253 253 253 GLY GLY A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 GLY 255 255 255 GLY GLY A . n 
A 1 256 PRO 256 256 256 PRO PRO A . n 
A 1 257 ARG 257 257 257 ARG ARG A . n 
A 1 258 TYR 258 258 258 TYR TYR A . n 
A 1 259 VAL 259 259 259 VAL VAL A . n 
A 1 260 ASP 260 260 260 ASP ASP A . n 
A 1 261 TYR 261 261 261 TYR TYR A . n 
A 1 262 VAL 262 262 262 VAL VAL A . n 
A 1 263 LEU 263 263 263 LEU LEU A . n 
A 1 264 GLY 264 264 264 GLY GLY A . n 
A 1 265 ILE 265 265 265 ILE ILE A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 LYS 267 267 267 LYS LYS A . n 
A 1 268 ALA 268 268 268 ALA ALA A . n 
A 1 269 TYR 269 269 269 TYR TYR A . n 
A 1 270 SER 270 270 270 SER SER A . n 
A 1 271 THR 271 271 271 THR THR A . n 
A 1 272 ARG 272 272 272 ARG ARG A . n 
A 1 273 VAL 273 273 273 VAL VAL A . n 
A 1 274 GLY 274 274 274 GLY GLY A . n 
A 1 275 ALA 275 275 275 ALA ALA A . n 
A 1 276 GLY 276 276 276 GLY GLY A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 PHE 278 278 278 PHE PHE A . n 
A 1 279 PRO 279 279 279 PRO PRO A . n 
A 1 280 THR 280 280 280 THR THR A . n 
A 1 281 GLU 281 281 281 GLU GLU A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PHE 283 283 283 PHE PHE A . n 
A 1 284 ASP 284 284 284 ASP ASP A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 THR 286 286 286 THR THR A . n 
A 1 287 GLY 287 287 287 GLY GLY A . n 
A 1 288 GLU 288 288 288 GLU GLU A . n 
A 1 289 PHE 289 289 289 PHE PHE A . n 
A 1 290 LEU 290 290 290 LEU LEU A . n 
A 1 291 CYS 291 291 291 CYS CYS A . n 
A 1 292 LYS 292 292 292 LYS LYS A . n 
A 1 293 GLN 293 293 293 GLN GLN A . n 
A 1 294 GLY 294 294 294 GLY GLY A . n 
A 1 295 ASN 295 295 295 ASN ASN A . n 
A 1 296 GLU 296 296 296 GLU GLU A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 THR 300 300 300 THR THR A . n 
A 1 301 THR 301 301 301 THR THR A . n 
A 1 302 GLY 302 302 302 GLY GLY A . n 
A 1 303 LEU 303 303 303 LEU LEU A . n 
A 1 304 ARG 304 304 304 ARG ARG A . n 
A 1 305 ARG 305 305 305 ARG ARG A . n 
A 1 306 ARG 306 306 306 ARG ARG A . n 
A 1 307 THR 307 307 307 THR THR A . n 
A 1 308 GLY 308 308 308 GLY GLY A . n 
A 1 309 TRP 309 309 309 TRP TRP A . n 
A 1 310 LEU 310 310 310 LEU LEU A . n 
A 1 311 ASP 311 311 311 ASP ASP A . n 
A 1 312 THR 312 312 312 THR THR A . n 
A 1 313 VAL 313 313 313 VAL VAL A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 VAL 315 315 315 VAL VAL A . n 
A 1 316 ARG 316 316 316 ARG ARG A . n 
A 1 317 ARG 317 317 317 ARG ARG A . n 
A 1 318 ALA 318 318 318 ALA ALA A . n 
A 1 319 VAL 319 319 319 VAL VAL A . n 
A 1 320 GLN 320 320 320 GLN GLN A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 ASN 322 322 322 ASN ASN A . n 
A 1 323 SER 323 323 323 SER SER A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 SER 325 325 325 SER SER A . n 
A 1 326 GLY 326 326 326 GLY GLY A . n 
A 1 327 PHE 327 327 327 PHE PHE A . n 
A 1 328 CYS 328 328 328 CYS CYS A . n 
A 1 329 LEU 329 329 329 LEU LEU A . n 
A 1 330 THR 330 330 330 THR THR A . n 
A 1 331 LYS 331 331 331 LYS LYS A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 ASP 333 333 333 ASP ASP A . n 
A 1 334 VAL 334 334 334 VAL VAL A . n 
A 1 335 LEU 335 335 335 LEU LEU A . n 
A 1 336 ASP 336 336 336 ASP ASP A . n 
A 1 337 GLY 337 337 337 GLY GLY A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 LYS 339 339 339 LYS LYS A . n 
A 1 340 GLU 340 340 340 GLU GLU A . n 
A 1 341 VAL 341 341 341 VAL VAL A . n 
A 1 342 LYS 342 342 342 LYS LYS A . n 
A 1 343 LEU 343 343 343 LEU LEU A . n 
A 1 344 CYS 344 344 344 CYS CYS A . n 
A 1 345 VAL 345 345 345 VAL VAL A . n 
A 1 346 ALA 346 346 346 ALA ALA A . n 
A 1 347 TYR 347 347 347 TYR TYR A . n 
A 1 348 ARG 348 348 348 ARG ARG A . n 
A 1 349 MET 349 349 349 MET MET A . n 
A 1 350 PRO 350 350 350 PRO PRO A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 GLY 352 352 352 GLY GLY A . n 
A 1 353 ARG 353 353 353 ARG ARG A . n 
A 1 354 GLU 354 354 354 GLU GLU A . n 
A 1 355 VAL 355 355 355 VAL VAL A . n 
A 1 356 THR 356 356 356 THR THR A . n 
A 1 357 THR 357 357 357 THR THR A . n 
A 1 358 THR 358 358 358 THR THR A . n 
A 1 359 PRO 359 359 359 PRO PRO A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 ALA 362 362 362 ALA ALA A . n 
A 1 363 ASP 363 363 363 ASP ASP A . n 
A 1 364 ASP 364 364 364 ASP ASP A . n 
A 1 365 TRP 365 365 365 TRP TRP A . n 
A 1 366 LYS 366 366 366 LYS LYS A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 VAL 368 368 368 VAL VAL A . n 
A 1 369 GLU 369 369 369 GLU GLU A . n 
A 1 370 PRO 370 370 370 PRO PRO A . n 
A 1 371 ILE 371 371 371 ILE ILE A . n 
A 1 372 TYR 372 372 372 TYR TYR A . n 
A 1 373 GLU 373 373 373 GLU GLU A . n 
A 1 374 THR 374 374 374 THR THR A . n 
A 1 375 MET 375 375 375 MET MET A . n 
A 1 376 PRO 376 376 376 PRO PRO A . n 
A 1 377 GLY 377 377 377 GLY GLY A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 SER 379 379 379 SER SER A . n 
A 1 380 GLU 380 380 380 GLU GLU A . n 
A 1 381 SER 381 381 381 SER SER A . n 
A 1 382 THR 382 382 382 THR THR A . n 
A 1 383 PHE 383 383 383 PHE PHE A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 VAL 385 385 385 VAL VAL A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASP 387 387 387 ASP ASP A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 SER 389 389 389 SER SER A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 PRO 392 392 392 PRO PRO A . n 
A 1 393 GLN 393 393 393 GLN GLN A . n 
A 1 394 ALA 394 394 394 ALA ALA A . n 
A 1 395 ALA 395 395 395 ALA ALA A . n 
A 1 396 LEU 396 396 396 LEU LEU A . n 
A 1 397 ASN 397 397 397 ASN ASN A . n 
A 1 398 TYR 398 398 398 TYR TYR A . n 
A 1 399 ILE 399 399 399 ILE ILE A . n 
A 1 400 LYS 400 400 400 LYS LYS A . n 
A 1 401 ARG 401 401 401 ARG ARG A . n 
A 1 402 ILE 402 402 402 ILE ILE A . n 
A 1 403 GLU 403 403 403 GLU GLU A . n 
A 1 404 GLU 404 404 404 GLU GLU A . n 
A 1 405 LEU 405 405 405 LEU LEU A . n 
A 1 406 THR 406 406 406 THR THR A . n 
A 1 407 GLY 407 407 407 GLY GLY A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 PRO 409 409 409 PRO PRO A . n 
A 1 410 ILE 410 410 410 ILE ILE A . n 
A 1 411 ASP 411 411 411 ASP ASP A . n 
A 1 412 ILE 412 412 412 ILE ILE A . n 
A 1 413 ILE 413 413 413 ILE ILE A . n 
A 1 414 SER 414 414 414 SER SER A . n 
A 1 415 THR 415 415 415 THR THR A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 PRO 417 417 417 PRO PRO A . n 
A 1 418 ASP 418 418 418 ASP ASP A . n 
A 1 419 ARG 419 419 419 ARG ARG A . n 
A 1 420 THR 420 420 420 THR THR A . n 
A 1 421 GLU 421 421 421 GLU GLU A . n 
A 1 422 THR 422 422 422 THR THR A . n 
A 1 423 MET 423 423 423 MET MET A . n 
A 1 424 ILE 424 424 424 ILE ILE A . n 
A 1 425 LEU 425 425 425 LEU LEU A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ASP 427 427 427 ASP ASP A . n 
A 1 428 PRO 428 428 428 PRO PRO A . n 
A 1 429 PHE 429 429 429 PHE PHE A . n 
A 1 430 ASP 430 430 430 ASP ASP A . n 
A 1 431 ALA 431 431 431 ALA ALA A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   435 435 MG  MG  A . 
C 3 IMO 1   440 440 IMO IPP A . 
D 4 GDP 1   432 432 GDP GDP A . 
E 5 HOH 1   441 1   HOH HOH A . 
E 5 HOH 2   442 3   HOH HOH A . 
E 5 HOH 3   443 4   HOH HOH A . 
E 5 HOH 4   444 5   HOH HOH A . 
E 5 HOH 5   445 6   HOH HOH A . 
E 5 HOH 6   446 7   HOH HOH A . 
E 5 HOH 7   447 8   HOH HOH A . 
E 5 HOH 8   448 9   HOH HOH A . 
E 5 HOH 9   449 10  HOH HOH A . 
E 5 HOH 10  450 11  HOH HOH A . 
E 5 HOH 11  451 12  HOH HOH A . 
E 5 HOH 12  452 13  HOH HOH A . 
E 5 HOH 13  453 14  HOH HOH A . 
E 5 HOH 14  454 15  HOH HOH A . 
E 5 HOH 15  455 16  HOH HOH A . 
E 5 HOH 16  456 17  HOH HOH A . 
E 5 HOH 17  457 18  HOH HOH A . 
E 5 HOH 18  458 19  HOH HOH A . 
E 5 HOH 19  459 20  HOH HOH A . 
E 5 HOH 20  460 21  HOH HOH A . 
E 5 HOH 21  461 22  HOH HOH A . 
E 5 HOH 22  462 23  HOH HOH A . 
E 5 HOH 23  463 24  HOH HOH A . 
E 5 HOH 24  464 25  HOH HOH A . 
E 5 HOH 25  465 26  HOH HOH A . 
E 5 HOH 26  466 27  HOH HOH A . 
E 5 HOH 27  467 28  HOH HOH A . 
E 5 HOH 28  468 29  HOH HOH A . 
E 5 HOH 29  469 30  HOH HOH A . 
E 5 HOH 30  470 31  HOH HOH A . 
E 5 HOH 31  471 32  HOH HOH A . 
E 5 HOH 32  472 33  HOH HOH A . 
E 5 HOH 33  473 34  HOH HOH A . 
E 5 HOH 34  474 35  HOH HOH A . 
E 5 HOH 35  475 36  HOH HOH A . 
E 5 HOH 36  476 37  HOH HOH A . 
E 5 HOH 37  477 38  HOH HOH A . 
E 5 HOH 38  478 39  HOH HOH A . 
E 5 HOH 39  479 40  HOH HOH A . 
E 5 HOH 40  480 41  HOH HOH A . 
E 5 HOH 41  481 42  HOH HOH A . 
E 5 HOH 42  482 43  HOH HOH A . 
E 5 HOH 43  483 44  HOH HOH A . 
E 5 HOH 44  484 45  HOH HOH A . 
E 5 HOH 45  485 46  HOH HOH A . 
E 5 HOH 46  486 47  HOH HOH A . 
E 5 HOH 47  487 48  HOH HOH A . 
E 5 HOH 48  488 50  HOH HOH A . 
E 5 HOH 49  489 51  HOH HOH A . 
E 5 HOH 50  490 52  HOH HOH A . 
E 5 HOH 51  491 53  HOH HOH A . 
E 5 HOH 52  492 54  HOH HOH A . 
E 5 HOH 53  493 55  HOH HOH A . 
E 5 HOH 54  494 56  HOH HOH A . 
E 5 HOH 55  495 57  HOH HOH A . 
E 5 HOH 56  496 58  HOH HOH A . 
E 5 HOH 57  497 59  HOH HOH A . 
E 5 HOH 58  498 60  HOH HOH A . 
E 5 HOH 59  499 61  HOH HOH A . 
E 5 HOH 60  500 62  HOH HOH A . 
E 5 HOH 61  501 63  HOH HOH A . 
E 5 HOH 62  502 64  HOH HOH A . 
E 5 HOH 63  503 65  HOH HOH A . 
E 5 HOH 64  504 67  HOH HOH A . 
E 5 HOH 65  505 68  HOH HOH A . 
E 5 HOH 66  506 69  HOH HOH A . 
E 5 HOH 67  507 71  HOH HOH A . 
E 5 HOH 68  508 72  HOH HOH A . 
E 5 HOH 69  509 73  HOH HOH A . 
E 5 HOH 70  510 74  HOH HOH A . 
E 5 HOH 71  511 76  HOH HOH A . 
E 5 HOH 72  512 77  HOH HOH A . 
E 5 HOH 73  513 78  HOH HOH A . 
E 5 HOH 74  514 79  HOH HOH A . 
E 5 HOH 75  515 80  HOH HOH A . 
E 5 HOH 76  516 81  HOH HOH A . 
E 5 HOH 77  517 82  HOH HOH A . 
E 5 HOH 78  518 83  HOH HOH A . 
E 5 HOH 79  519 84  HOH HOH A . 
E 5 HOH 80  520 85  HOH HOH A . 
E 5 HOH 81  521 86  HOH HOH A . 
E 5 HOH 82  522 87  HOH HOH A . 
E 5 HOH 83  523 88  HOH HOH A . 
E 5 HOH 84  524 89  HOH HOH A . 
E 5 HOH 85  525 90  HOH HOH A . 
E 5 HOH 86  526 91  HOH HOH A . 
E 5 HOH 87  527 92  HOH HOH A . 
E 5 HOH 88  528 93  HOH HOH A . 
E 5 HOH 89  529 94  HOH HOH A . 
E 5 HOH 90  530 95  HOH HOH A . 
E 5 HOH 91  531 96  HOH HOH A . 
E 5 HOH 92  532 97  HOH HOH A . 
E 5 HOH 93  533 99  HOH HOH A . 
E 5 HOH 94  534 100 HOH HOH A . 
E 5 HOH 95  535 101 HOH HOH A . 
E 5 HOH 96  536 102 HOH HOH A . 
E 5 HOH 97  537 103 HOH HOH A . 
E 5 HOH 98  538 104 HOH HOH A . 
E 5 HOH 99  539 105 HOH HOH A . 
E 5 HOH 100 540 106 HOH HOH A . 
E 5 HOH 101 541 107 HOH HOH A . 
E 5 HOH 102 542 108 HOH HOH A . 
E 5 HOH 103 543 109 HOH HOH A . 
E 5 HOH 104 544 110 HOH HOH A . 
E 5 HOH 105 545 111 HOH HOH A . 
E 5 HOH 106 546 112 HOH HOH A . 
E 5 HOH 107 547 113 HOH HOH A . 
E 5 HOH 108 548 114 HOH HOH A . 
E 5 HOH 109 549 115 HOH HOH A . 
E 5 HOH 110 550 116 HOH HOH A . 
E 5 HOH 111 551 117 HOH HOH A . 
E 5 HOH 112 552 118 HOH HOH A . 
E 5 HOH 113 553 119 HOH HOH A . 
E 5 HOH 114 554 120 HOH HOH A . 
E 5 HOH 115 555 121 HOH HOH A . 
E 5 HOH 116 556 122 HOH HOH A . 
E 5 HOH 117 557 123 HOH HOH A . 
E 5 HOH 118 558 124 HOH HOH A . 
E 5 HOH 119 559 125 HOH HOH A . 
E 5 HOH 120 560 126 HOH HOH A . 
E 5 HOH 121 561 127 HOH HOH A . 
E 5 HOH 122 562 128 HOH HOH A . 
E 5 HOH 123 563 129 HOH HOH A . 
E 5 HOH 124 564 130 HOH HOH A . 
E 5 HOH 125 565 131 HOH HOH A . 
E 5 HOH 126 566 132 HOH HOH A . 
E 5 HOH 127 567 133 HOH HOH A . 
E 5 HOH 128 568 134 HOH HOH A . 
E 5 HOH 129 569 135 HOH HOH A . 
E 5 HOH 130 570 136 HOH HOH A . 
E 5 HOH 131 571 137 HOH HOH A . 
E 5 HOH 132 572 138 HOH HOH A . 
E 5 HOH 133 573 139 HOH HOH A . 
E 5 HOH 134 574 141 HOH HOH A . 
E 5 HOH 135 575 142 HOH HOH A . 
E 5 HOH 136 576 143 HOH HOH A . 
E 5 HOH 137 577 144 HOH HOH A . 
E 5 HOH 138 578 145 HOH HOH A . 
E 5 HOH 139 579 146 HOH HOH A . 
E 5 HOH 140 580 147 HOH HOH A . 
E 5 HOH 141 581 148 HOH HOH A . 
E 5 HOH 142 582 149 HOH HOH A . 
E 5 HOH 143 583 150 HOH HOH A . 
E 5 HOH 144 584 151 HOH HOH A . 
E 5 HOH 145 585 152 HOH HOH A . 
E 5 HOH 146 586 153 HOH HOH A . 
E 5 HOH 147 587 154 HOH HOH A . 
E 5 HOH 148 588 155 HOH HOH A . 
E 5 HOH 149 589 156 HOH HOH A . 
E 5 HOH 150 590 157 HOH HOH A . 
E 5 HOH 151 591 158 HOH HOH A . 
E 5 HOH 152 592 159 HOH HOH A . 
E 5 HOH 153 593 160 HOH HOH A . 
E 5 HOH 154 594 161 HOH HOH A . 
E 5 HOH 155 595 162 HOH HOH A . 
E 5 HOH 156 596 163 HOH HOH A . 
E 5 HOH 157 597 164 HOH HOH A . 
E 5 HOH 158 598 166 HOH HOH A . 
E 5 HOH 159 599 167 HOH HOH A . 
E 5 HOH 160 600 168 HOH HOH A . 
E 5 HOH 161 601 169 HOH HOH A . 
E 5 HOH 162 602 170 HOH HOH A . 
E 5 HOH 163 603 171 HOH HOH A . 
E 5 HOH 164 604 172 HOH HOH A . 
E 5 HOH 165 605 173 HOH HOH A . 
E 5 HOH 166 606 174 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 9190  ? 
1 MORE         -54   ? 
1 'SSA (A^2)'  27600 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z          1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  
1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 6_555 -x,-x+y,-z+2/3 -0.5000000000 -0.8662140575 0.0000000000 0.0000000000 -0.8658367911 
0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 105.6524035922 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O2B ? D GDP .  ? A GDP 432 ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O1  ? C IMO .  ? A IMO 440 ? 1_555 74.3  ? 
2  O2B ? D GDP .  ? A GDP 432 ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O   ? E HOH .  ? A HOH 490 ? 1_555 171.2 ? 
3  O1  ? C IMO .  ? A IMO 440 ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O   ? E HOH .  ? A HOH 490 ? 1_555 114.0 ? 
4  O2B ? D GDP .  ? A GDP 432 ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 OD1 ? A ASP 13 ? A ASP 13  ? 1_555 98.6  ? 
5  O1  ? C IMO .  ? A IMO 440 ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 OD1 ? A ASP 13 ? A ASP 13  ? 1_555 78.1  ? 
6  O   ? E HOH .  ? A HOH 490 ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 OD1 ? A ASP 13 ? A ASP 13  ? 1_555 81.1  ? 
7  O2B ? D GDP .  ? A GDP 432 ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O2A ? D GDP .  ? A GDP 432 ? 1_555 77.9  ? 
8  O1  ? C IMO .  ? A IMO 440 ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O2A ? D GDP .  ? A GDP 432 ? 1_555 150.6 ? 
9  O   ? E HOH .  ? A HOH 490 ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O2A ? D GDP .  ? A GDP 432 ? 1_555 93.4  ? 
10 OD1 ? A ASP 13 ? A ASP 13  ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O2A ? D GDP .  ? A GDP 432 ? 1_555 96.7  ? 
11 O2B ? D GDP .  ? A GDP 432 ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O   ? A GLY 40 ? A GLY 40  ? 1_555 85.7  ? 
12 O1  ? C IMO .  ? A IMO 440 ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O   ? A GLY 40 ? A GLY 40  ? 1_555 105.8 ? 
13 O   ? E HOH .  ? A HOH 490 ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O   ? A GLY 40 ? A GLY 40  ? 1_555 94.2  ? 
14 OD1 ? A ASP 13 ? A ASP 13  ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O   ? A GLY 40 ? A GLY 40  ? 1_555 174.9 ? 
15 O2A ? D GDP .  ? A GDP 432 ? 1_555 MG ? B MG . ? A MG 435 ? 1_555 O   ? A GLY 40 ? A GLY 40  ? 1_555 81.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-06-17 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
5 'Structure model' 1 4 2018-03-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
5 5 'Structure model' 'Database references'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' software           
2 5 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.name'              
2 5 'Structure model' '_struct_ref_seq_dif.details' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' .     ? 1 
X-PLOR refinement       3.851 ? 2 
X-GEN  'data reduction' .     ? 3 
X-GEN  'data scaling'   .     ? 4 
X-PLOR phasing          .     ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA A LEU 7  ? ? CB A LEU 7  ? ? CG A LEU 7  ? ? 132.05 115.30 16.75 2.30 N 
2 1 CA A LEU 74 ? ? CB A LEU 74 ? ? CG A LEU 74 ? ? 129.64 115.30 14.34 2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 10  ? ? -120.63 -112.84 
2  1 ASP A 13  ? ? 49.81   27.38   
3  1 HIS A 53  ? ? -127.62 -65.14  
4  1 LYS A 124 ? ? -77.60  42.83   
5  1 THR A 129 ? ? -56.95  -2.24   
6  1 TYR A 175 ? ? -90.47  -67.05  
7  1 GLN A 224 ? ? 60.41   -164.17 
8  1 ALA A 268 ? ? 70.99   -16.03  
9  1 PHE A 278 ? ? -171.82 79.47   
10 1 ASP A 284 ? ? -103.02 -169.81 
11 1 THR A 301 ? ? -152.44 1.44    
12 1 LEU A 303 ? ? -22.34  118.86  
13 1 LEU A 360 ? ? -100.70 -76.69  
14 1 LYS A 366 ? ? -11.70  -73.94  
15 1 ARG A 419 ? ? -29.42  -56.81  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'                        MG  
3 '6-O-PHOSPHORYL INOSINE MONOPHOSPHATE' IMO 
4 "GUANOSINE-5'-DIPHOSPHATE"             GDP 
5 water                                  HOH 
#