data_1CH8
# 
_entry.id   1CH8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1CH8         
RCSB  RCSB000769   
WWPDB D_1000000769 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1CH8 
_pdbx_database_status.recvd_initial_deposition_date   1999-03-31 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hou, Z.'        1 
'Cashel, M.'     2 
'Fromm, H.J.'    3 
'Honzatko, R.B.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Effectors of the stringent response target the active site of Escherichia coli adenylosuccinate synthetase.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            274 
_citation.page_first                17505 
_citation.page_last                 17510 
_citation.year                      1999 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10364182 
_citation.pdbx_database_id_DOI      10.1074/jbc.274.25.17505 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hou, Z.'        1 
primary 'Cashel, M.'     2 
primary 'Fromm, H.J.'    3 
primary 'Honzatko, R.B.' 4 
# 
_cell.entry_id           1CH8 
_cell.length_a           80.300 
_cell.length_b           80.300 
_cell.length_c           158.200 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1CH8 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN (ADENYLOSUCCINATE SYNTHETASE)'               47269.598 1   6.3.4.4 ? ? ? 
2 non-polymer syn 'NITRATE ION'                                         62.005    1   ?       ? ? ? 
3 non-polymer syn 'MAGNESIUM ION'                                       24.305    1   ?       ? ? ? 
4 non-polymer syn 
;GUANOSINE 5'-DIPHOSPHATE 2':3'-CYCLIC MONOPHOSPHATE
;
505.165   1   ?       ? ? ? 
5 non-polymer syn HADACIDIN                                             119.076   1   ?       ? ? ? 
6 non-polymer syn 'INOSINIC ACID'                                       348.206   1   ?       ? ? ? 
7 water       nat water                                                 18.015    354 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AMPSASE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILRENVTSIIGNGVVLSPAALM
KEMKELEDRGIPVRERLLLSEACPLILDYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEK
LKEVMEYHNFQLVNYYKAEAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVTS
SNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQ
LNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTTPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIK
RIEELTGVPIDIISTGPDRTETMILRDPFDA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILRENVTSIIGNGVVLSPAALM
KEMKELEDRGIPVRERLLLSEACPLILDYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEK
LKEVMEYHNFQLVNYYKAEAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVTS
SNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQ
LNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTTPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIK
RIEELTGVPIDIISTGPDRTETMILRDPFDA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ASN n 
1 3   ASN n 
1 4   VAL n 
1 5   VAL n 
1 6   VAL n 
1 7   LEU n 
1 8   GLY n 
1 9   THR n 
1 10  GLN n 
1 11  TRP n 
1 12  GLY n 
1 13  ASP n 
1 14  GLU n 
1 15  GLY n 
1 16  LYS n 
1 17  GLY n 
1 18  LYS n 
1 19  ILE n 
1 20  VAL n 
1 21  ASP n 
1 22  LEU n 
1 23  LEU n 
1 24  THR n 
1 25  GLU n 
1 26  ARG n 
1 27  ALA n 
1 28  LYS n 
1 29  TYR n 
1 30  VAL n 
1 31  VAL n 
1 32  ARG n 
1 33  TYR n 
1 34  GLN n 
1 35  GLY n 
1 36  GLY n 
1 37  HIS n 
1 38  ASN n 
1 39  ALA n 
1 40  GLY n 
1 41  HIS n 
1 42  THR n 
1 43  LEU n 
1 44  VAL n 
1 45  ILE n 
1 46  ASN n 
1 47  GLY n 
1 48  GLU n 
1 49  LYS n 
1 50  THR n 
1 51  VAL n 
1 52  LEU n 
1 53  HIS n 
1 54  LEU n 
1 55  ILE n 
1 56  PRO n 
1 57  SER n 
1 58  GLY n 
1 59  ILE n 
1 60  LEU n 
1 61  ARG n 
1 62  GLU n 
1 63  ASN n 
1 64  VAL n 
1 65  THR n 
1 66  SER n 
1 67  ILE n 
1 68  ILE n 
1 69  GLY n 
1 70  ASN n 
1 71  GLY n 
1 72  VAL n 
1 73  VAL n 
1 74  LEU n 
1 75  SER n 
1 76  PRO n 
1 77  ALA n 
1 78  ALA n 
1 79  LEU n 
1 80  MET n 
1 81  LYS n 
1 82  GLU n 
1 83  MET n 
1 84  LYS n 
1 85  GLU n 
1 86  LEU n 
1 87  GLU n 
1 88  ASP n 
1 89  ARG n 
1 90  GLY n 
1 91  ILE n 
1 92  PRO n 
1 93  VAL n 
1 94  ARG n 
1 95  GLU n 
1 96  ARG n 
1 97  LEU n 
1 98  LEU n 
1 99  LEU n 
1 100 SER n 
1 101 GLU n 
1 102 ALA n 
1 103 CYS n 
1 104 PRO n 
1 105 LEU n 
1 106 ILE n 
1 107 LEU n 
1 108 ASP n 
1 109 TYR n 
1 110 HIS n 
1 111 VAL n 
1 112 ALA n 
1 113 LEU n 
1 114 ASP n 
1 115 ASN n 
1 116 ALA n 
1 117 ARG n 
1 118 GLU n 
1 119 LYS n 
1 120 ALA n 
1 121 ARG n 
1 122 GLY n 
1 123 ALA n 
1 124 LYS n 
1 125 ALA n 
1 126 ILE n 
1 127 GLY n 
1 128 THR n 
1 129 THR n 
1 130 GLY n 
1 131 ARG n 
1 132 GLY n 
1 133 ILE n 
1 134 GLY n 
1 135 PRO n 
1 136 ALA n 
1 137 TYR n 
1 138 GLU n 
1 139 ASP n 
1 140 LYS n 
1 141 VAL n 
1 142 ALA n 
1 143 ARG n 
1 144 ARG n 
1 145 GLY n 
1 146 LEU n 
1 147 ARG n 
1 148 VAL n 
1 149 GLY n 
1 150 ASP n 
1 151 LEU n 
1 152 PHE n 
1 153 ASP n 
1 154 LYS n 
1 155 GLU n 
1 156 THR n 
1 157 PHE n 
1 158 ALA n 
1 159 GLU n 
1 160 LYS n 
1 161 LEU n 
1 162 LYS n 
1 163 GLU n 
1 164 VAL n 
1 165 MET n 
1 166 GLU n 
1 167 TYR n 
1 168 HIS n 
1 169 ASN n 
1 170 PHE n 
1 171 GLN n 
1 172 LEU n 
1 173 VAL n 
1 174 ASN n 
1 175 TYR n 
1 176 TYR n 
1 177 LYS n 
1 178 ALA n 
1 179 GLU n 
1 180 ALA n 
1 181 VAL n 
1 182 ASP n 
1 183 TYR n 
1 184 GLN n 
1 185 LYS n 
1 186 VAL n 
1 187 LEU n 
1 188 ASP n 
1 189 ASP n 
1 190 THR n 
1 191 MET n 
1 192 ALA n 
1 193 VAL n 
1 194 ALA n 
1 195 ASP n 
1 196 ILE n 
1 197 LEU n 
1 198 THR n 
1 199 SER n 
1 200 MET n 
1 201 VAL n 
1 202 VAL n 
1 203 ASP n 
1 204 VAL n 
1 205 SER n 
1 206 ASP n 
1 207 LEU n 
1 208 LEU n 
1 209 ASP n 
1 210 GLN n 
1 211 ALA n 
1 212 ARG n 
1 213 GLN n 
1 214 ARG n 
1 215 GLY n 
1 216 ASP n 
1 217 PHE n 
1 218 VAL n 
1 219 MET n 
1 220 PHE n 
1 221 GLU n 
1 222 GLY n 
1 223 ALA n 
1 224 GLN n 
1 225 GLY n 
1 226 THR n 
1 227 LEU n 
1 228 LEU n 
1 229 ASP n 
1 230 ILE n 
1 231 ASP n 
1 232 HIS n 
1 233 GLY n 
1 234 THR n 
1 235 TYR n 
1 236 PRO n 
1 237 TYR n 
1 238 VAL n 
1 239 THR n 
1 240 SER n 
1 241 SER n 
1 242 ASN n 
1 243 THR n 
1 244 THR n 
1 245 ALA n 
1 246 GLY n 
1 247 GLY n 
1 248 VAL n 
1 249 ALA n 
1 250 THR n 
1 251 GLY n 
1 252 SER n 
1 253 GLY n 
1 254 LEU n 
1 255 GLY n 
1 256 PRO n 
1 257 ARG n 
1 258 TYR n 
1 259 VAL n 
1 260 ASP n 
1 261 TYR n 
1 262 VAL n 
1 263 LEU n 
1 264 GLY n 
1 265 ILE n 
1 266 LEU n 
1 267 LYS n 
1 268 ALA n 
1 269 TYR n 
1 270 SER n 
1 271 THR n 
1 272 ARG n 
1 273 VAL n 
1 274 GLY n 
1 275 ALA n 
1 276 GLY n 
1 277 PRO n 
1 278 PHE n 
1 279 PRO n 
1 280 THR n 
1 281 GLU n 
1 282 LEU n 
1 283 PHE n 
1 284 ASP n 
1 285 GLU n 
1 286 THR n 
1 287 GLY n 
1 288 GLU n 
1 289 PHE n 
1 290 LEU n 
1 291 CYS n 
1 292 LYS n 
1 293 GLN n 
1 294 GLY n 
1 295 ASN n 
1 296 GLU n 
1 297 PHE n 
1 298 GLY n 
1 299 ALA n 
1 300 THR n 
1 301 THR n 
1 302 GLY n 
1 303 ARG n 
1 304 ARG n 
1 305 ARG n 
1 306 ARG n 
1 307 THR n 
1 308 GLY n 
1 309 TRP n 
1 310 LEU n 
1 311 ASP n 
1 312 THR n 
1 313 VAL n 
1 314 ALA n 
1 315 VAL n 
1 316 ARG n 
1 317 ARG n 
1 318 ALA n 
1 319 VAL n 
1 320 GLN n 
1 321 LEU n 
1 322 ASN n 
1 323 SER n 
1 324 LEU n 
1 325 SER n 
1 326 GLY n 
1 327 PHE n 
1 328 CYS n 
1 329 LEU n 
1 330 THR n 
1 331 LYS n 
1 332 LEU n 
1 333 ASP n 
1 334 VAL n 
1 335 LEU n 
1 336 ASP n 
1 337 GLY n 
1 338 LEU n 
1 339 LYS n 
1 340 GLU n 
1 341 VAL n 
1 342 LYS n 
1 343 LEU n 
1 344 CYS n 
1 345 VAL n 
1 346 ALA n 
1 347 TYR n 
1 348 ARG n 
1 349 MET n 
1 350 PRO n 
1 351 ASP n 
1 352 GLY n 
1 353 ARG n 
1 354 GLU n 
1 355 VAL n 
1 356 THR n 
1 357 THR n 
1 358 THR n 
1 359 PRO n 
1 360 LEU n 
1 361 ALA n 
1 362 ALA n 
1 363 ASP n 
1 364 ASP n 
1 365 TRP n 
1 366 LYS n 
1 367 GLY n 
1 368 VAL n 
1 369 GLU n 
1 370 PRO n 
1 371 ILE n 
1 372 TYR n 
1 373 GLU n 
1 374 THR n 
1 375 MET n 
1 376 PRO n 
1 377 GLY n 
1 378 TRP n 
1 379 SER n 
1 380 GLU n 
1 381 SER n 
1 382 THR n 
1 383 PHE n 
1 384 GLY n 
1 385 VAL n 
1 386 LYS n 
1 387 ASP n 
1 388 ARG n 
1 389 SER n 
1 390 GLY n 
1 391 LEU n 
1 392 PRO n 
1 393 GLN n 
1 394 ALA n 
1 395 ALA n 
1 396 LEU n 
1 397 ASN n 
1 398 TYR n 
1 399 ILE n 
1 400 LYS n 
1 401 ARG n 
1 402 ILE n 
1 403 GLU n 
1 404 GLU n 
1 405 LEU n 
1 406 THR n 
1 407 GLY n 
1 408 VAL n 
1 409 PRO n 
1 410 ILE n 
1 411 ASP n 
1 412 ILE n 
1 413 ILE n 
1 414 SER n 
1 415 THR n 
1 416 GLY n 
1 417 PRO n 
1 418 ASP n 
1 419 ARG n 
1 420 THR n 
1 421 GLU n 
1 422 THR n 
1 423 MET n 
1 424 ILE n 
1 425 LEU n 
1 426 ARG n 
1 427 ASP n 
1 428 PRO n 
1 429 PHE n 
1 430 ASP n 
1 431 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   coli 
_entity_src_gen.gene_src_strain                    K-12 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     83333 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'PUR A- STRAIN H1238' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PTRC99A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PURA_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P0A7D4 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1CH8 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 431 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P0A7D4 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  431 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       431 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                               ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                              ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                            ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                       ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                              ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                             ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                       ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                               ? 'C2 H5 N O2'        75.067  
GPX non-polymer         . 
;GUANOSINE 5'-DIPHOSPHATE 2':3'-CYCLIC MONOPHOSPHATE
;
? 'C10 H14 N5 O13 P3' 505.165 
HDA non-polymer         . HADACIDIN                                             ? 'C3 H5 N O4'        119.076 
HIS 'L-peptide linking' y HISTIDINE                                             ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                 ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                            ? 'C6 H13 N O2'       131.173 
IMP non-polymer         n 'INOSINIC ACID'                                       ? 'C10 H13 N4 O8 P'   348.206 
LEU 'L-peptide linking' y LEUCINE                                               ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                            ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                       ? 'Mg 2'              24.305  
NO3 non-polymer         . 'NITRATE ION'                                         ? 'N O3 -1'           62.005  
PHE 'L-peptide linking' y PHENYLALANINE                                         ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                               ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                             ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                            ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                              ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                                ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1CH8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.11 
_exptl_crystal.density_percent_sol   60.50 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    '16% PEG 8000, 100MM NA-CACODYLATE (PH 6.5)' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           120 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   SIEMENS 
_diffrn_detector.pdbx_collection_date   1997-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        SIEMENS 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1CH8 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.4 
_reflns.number_obs                   23427 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99 
_reflns.pdbx_Rmerge_I_obs            0.0920000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.4 
_reflns_shell.d_res_low              2.6 
_reflns_shell.percent_possible_all   99 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1CH8 
_refine.ls_number_reflns_obs                     15550 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                0 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             5 
_refine.ls_d_res_high                            2.5 
_refine.ls_percent_reflns_obs                    86 
_refine.ls_R_factor_obs                          0.1900000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1900000 
_refine.ls_R_factor_R_free                       0.2500000 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10 
_refine.ls_number_reflns_R_free                  1555 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               25 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1GIM 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3321 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         67 
_refine_hist.number_atoms_solvent             354 
_refine_hist.number_atoms_total               3742 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        5 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.016 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.61  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARNAH1E.DNA TOPH19.PEP   'X-RAY DIFFRACTION' 
3 PARAM19.SOL  ?            'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1CH8 
_struct.title                     
;STRUCTURE OF ADENYLOSUCCINATE SYNTHETASE FROM E. COLI COMPLEXED WITH A STRINGENT EFFECTOR, PPG2':3'P
;
_struct.pdbx_descriptor           'ADENYLOSUCCINATE SYNTHETASE (E.C.6.3.4.4)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1CH8 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            
;LIGASE, ADENYLOSUCCINATE SYNTHETASE, GTP-HYDROLYSING ENZYMES, PURINE 2 NUCLEOTIDE BIOSYNTHESIS, PPGPP, PPG2':3'P, STRINGENT EFFECTOR
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 16  ? GLU A 25  ? LYS A 16  GLU A 25  1 ? 10 
HELX_P HELX_P2  2  PRO A 76  ? ARG A 89  ? PRO A 76  ARG A 89  1 ? 14 
HELX_P HELX_P3  3  VAL A 93  ? ARG A 96  ? VAL A 93  ARG A 96  1 ? 4  
HELX_P HELX_P4  4  ASP A 108 ? ALA A 120 ? ASP A 108 ALA A 120 1 ? 13 
HELX_P HELX_P5  5  GLY A 122 ? LYS A 124 ? GLY A 122 LYS A 124 5 ? 3  
HELX_P HELX_P6  6  ILE A 133 ? VAL A 141 ? ILE A 133 VAL A 141 1 ? 9  
HELX_P HELX_P7  7  VAL A 148 ? PHE A 152 ? VAL A 148 PHE A 152 5 ? 5  
HELX_P HELX_P8  8  LYS A 154 ? ASN A 174 ? LYS A 154 ASN A 174 1 ? 21 
HELX_P HELX_P9  9  TYR A 183 ? MET A 191 ? TYR A 183 MET A 191 1 ? 9  
HELX_P HELX_P10 10 ALA A 194 ? MET A 200 ? ALA A 194 MET A 200 1 ? 7  
HELX_P HELX_P11 11 VAL A 204 ? ARG A 214 ? VAL A 204 ARG A 214 1 ? 11 
HELX_P HELX_P12 12 THR A 226 ? LEU A 228 ? THR A 226 LEU A 228 5 ? 3  
HELX_P HELX_P13 13 ALA A 245 ? THR A 250 ? ALA A 245 THR A 250 5 ? 6  
HELX_P HELX_P14 14 PRO A 256 ? TYR A 258 ? PRO A 256 TYR A 258 5 ? 3  
HELX_P HELX_P15 15 GLU A 285 ? GLN A 293 ? GLU A 285 GLN A 293 1 ? 9  
HELX_P HELX_P16 16 THR A 312 ? ASN A 322 ? THR A 312 ASN A 322 1 ? 11 
HELX_P HELX_P17 17 LEU A 332 ? LEU A 335 ? LEU A 332 LEU A 335 5 ? 4  
HELX_P HELX_P18 18 ALA A 362 ? TRP A 365 ? ALA A 362 TRP A 365 5 ? 4  
HELX_P HELX_P19 19 ARG A 388 ? GLY A 390 ? ARG A 388 GLY A 390 5 ? 3  
HELX_P HELX_P20 20 GLN A 393 ? THR A 406 ? GLN A 393 THR A 406 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? C MG . MG ? ? ? 1_555 A ASP 13 OD1 ? ? A MG 434 A ASP 13  1_555 ? ? ? ? ? ? ? 2.466 ? 
metalc2 metalc ? ? C MG . MG ? ? ? 1_555 A GLY 40 O   ? ? A MG 434 A GLY 40  1_555 ? ? ? ? ? ? ? 2.037 ? 
metalc3 metalc ? ? C MG . MG ? ? ? 1_555 B NO3 .  O2  ? ? A MG 434 A NO3 433 1_555 ? ? ? ? ? ? ? 2.297 ? 
metalc4 metalc ? ? C MG . MG ? ? ? 1_555 D GPX .  O1A ? ? A MG 434 A GPX 432 1_555 ? ? ? ? ? ? ? 2.287 ? 
metalc5 metalc ? ? C MG . MG ? ? ? 1_555 D GPX .  O2B ? ? A MG 434 A GPX 432 1_555 ? ? ? ? ? ? ? 2.095 ? 
metalc6 metalc ? ? C MG . MG ? ? ? 1_555 E HDA .  O   ? ? A MG 434 A HDA 437 1_555 ? ? ? ? ? ? ? 2.187 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TYR 
_struct_mon_prot_cis.label_seq_id           235 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TYR 
_struct_mon_prot_cis.auth_seq_id            235 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    236 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     236 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.13 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? parallel      
A 8 9 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 422 ? ILE A 424 ? THR A 422 ILE A 424 
A 2 ILE A 410 ? SER A 414 ? ILE A 410 SER A 414 
A 3 GLY A 326 ? THR A 330 ? GLY A 326 THR A 330 
A 4 TYR A 261 ? LYS A 267 ? TYR A 261 LYS A 267 
A 5 ASN A 3   ? GLY A 8   ? ASN A 3   GLY A 8   
A 6 VAL A 218 ? GLU A 221 ? VAL A 218 GLU A 221 
A 7 TYR A 29  ? ARG A 32  ? TYR A 29  ARG A 32  
A 8 THR A 65  ? ILE A 68  ? THR A 65  ILE A 68  
A 9 LEU A 97  ? LEU A 99  ? LEU A 97  LEU A 99  
B 1 HIS A 41  ? ILE A 45  ? HIS A 41  ILE A 45  
B 2 GLU A 48  ? LEU A 52  ? GLU A 48  LEU A 52  
C 1 SER A 270 ? ARG A 272 ? SER A 270 ARG A 272 
C 2 ARG A 306 ? GLY A 308 ? ARG A 306 GLY A 308 
D 1 GLU A 340 ? ARG A 348 ? GLU A 340 ARG A 348 
D 2 GLU A 369 ? PRO A 376 ? GLU A 369 PRO A 376 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O MET A 423 ? O MET A 423 N ILE A 413 ? N ILE A 413 
A 2 3 O ASP A 411 ? O ASP A 411 N PHE A 327 ? N PHE A 327 
A 3 4 O GLY A 326 ? O GLY A 326 N GLY A 264 ? N GLY A 264 
A 4 5 O TYR A 261 ? O TYR A 261 N VAL A 5   ? N VAL A 5   
A 5 6 O VAL A 4   ? O VAL A 4   N VAL A 218 ? N VAL A 218 
A 6 7 O MET A 219 ? O MET A 219 N TYR A 29  ? N TYR A 29  
A 7 8 O VAL A 30  ? O VAL A 30  N THR A 65  ? N THR A 65  
A 8 9 O SER A 66  ? O SER A 66  N LEU A 98  ? N LEU A 98  
B 1 2 O HIS A 41  ? O HIS A 41  N LEU A 52  ? N LEU A 52  
C 1 2 O SER A 270 ? O SER A 270 N GLY A 308 ? N GLY A 308 
D 1 2 O VAL A 341 ? O VAL A 341 N MET A 375 ? N MET A 375 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE NO3 A 433' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 434'  
AC3 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE GPX A 432' 
AC4 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE HDA A 437' 
AC5 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE IMP A 440' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 ASP A 13  ? ASP A 13  . ? 1_555 ? 
2  AC1 10 LYS A 16  ? LYS A 16  . ? 1_555 ? 
3  AC1 10 ALA A 39  ? ALA A 39  . ? 1_555 ? 
4  AC1 10 GLY A 40  ? GLY A 40  . ? 1_555 ? 
5  AC1 10 ALA A 223 ? ALA A 223 . ? 1_555 ? 
6  AC1 10 GLN A 224 ? GLN A 224 . ? 1_555 ? 
7  AC1 10 GPX D .   ? GPX A 432 . ? 1_555 ? 
8  AC1 10 MG  C .   ? MG  A 434 . ? 1_555 ? 
9  AC1 10 HDA E .   ? HDA A 437 . ? 1_555 ? 
10 AC1 10 IMP F .   ? IMP A 440 . ? 1_555 ? 
11 AC2 5  ASP A 13  ? ASP A 13  . ? 1_555 ? 
12 AC2 5  GLY A 40  ? GLY A 40  . ? 1_555 ? 
13 AC2 5  GPX D .   ? GPX A 432 . ? 1_555 ? 
14 AC2 5  NO3 B .   ? NO3 A 433 . ? 1_555 ? 
15 AC2 5  HDA E .   ? HDA A 437 . ? 1_555 ? 
16 AC3 23 ASP A 13  ? ASP A 13  . ? 1_555 ? 
17 AC3 23 GLU A 14  ? GLU A 14  . ? 1_555 ? 
18 AC3 23 GLY A 15  ? GLY A 15  . ? 1_555 ? 
19 AC3 23 LYS A 16  ? LYS A 16  . ? 1_555 ? 
20 AC3 23 GLY A 17  ? GLY A 17  . ? 1_555 ? 
21 AC3 23 GLY A 40  ? GLY A 40  . ? 1_555 ? 
22 AC3 23 HIS A 41  ? HIS A 41  . ? 1_555 ? 
23 AC3 23 THR A 42  ? THR A 42  . ? 1_555 ? 
24 AC3 23 LYS A 49  ? LYS A 49  . ? 1_555 ? 
25 AC3 23 ARG A 305 ? ARG A 305 . ? 1_555 ? 
26 AC3 23 LYS A 331 ? LYS A 331 . ? 1_555 ? 
27 AC3 23 ASP A 333 ? ASP A 333 . ? 1_555 ? 
28 AC3 23 SER A 414 ? SER A 414 . ? 1_555 ? 
29 AC3 23 GLY A 416 ? GLY A 416 . ? 1_555 ? 
30 AC3 23 PRO A 417 ? PRO A 417 . ? 1_555 ? 
31 AC3 23 NO3 B .   ? NO3 A 433 . ? 1_555 ? 
32 AC3 23 MG  C .   ? MG  A 434 . ? 1_555 ? 
33 AC3 23 HDA E .   ? HDA A 437 . ? 1_555 ? 
34 AC3 23 HOH G .   ? HOH A 501 . ? 1_555 ? 
35 AC3 23 HOH G .   ? HOH A 587 . ? 1_555 ? 
36 AC3 23 HOH G .   ? HOH A 605 . ? 1_555 ? 
37 AC3 23 HOH G .   ? HOH A 738 . ? 1_555 ? 
38 AC3 23 HOH G .   ? HOH A 863 . ? 1_555 ? 
39 AC4 13 ASP A 13  ? ASP A 13  . ? 1_555 ? 
40 AC4 13 GLY A 40  ? GLY A 40  . ? 1_555 ? 
41 AC4 13 THR A 129 ? THR A 129 . ? 1_555 ? 
42 AC4 13 GLY A 298 ? GLY A 298 . ? 1_555 ? 
43 AC4 13 ALA A 299 ? ALA A 299 . ? 1_555 ? 
44 AC4 13 THR A 300 ? THR A 300 . ? 1_555 ? 
45 AC4 13 THR A 301 ? THR A 301 . ? 1_555 ? 
46 AC4 13 ARG A 303 ? ARG A 303 . ? 1_555 ? 
47 AC4 13 ARG A 305 ? ARG A 305 . ? 1_555 ? 
48 AC4 13 GPX D .   ? GPX A 432 . ? 1_555 ? 
49 AC4 13 NO3 B .   ? NO3 A 433 . ? 1_555 ? 
50 AC4 13 MG  C .   ? MG  A 434 . ? 1_555 ? 
51 AC4 13 IMP F .   ? IMP A 440 . ? 1_555 ? 
52 AC5 20 ASP A 13  ? ASP A 13  . ? 1_555 ? 
53 AC5 20 ASN A 38  ? ASN A 38  . ? 1_555 ? 
54 AC5 20 ALA A 39  ? ALA A 39  . ? 1_555 ? 
55 AC5 20 ILE A 126 ? ILE A 126 . ? 1_555 ? 
56 AC5 20 GLY A 127 ? GLY A 127 . ? 1_555 ? 
57 AC5 20 THR A 128 ? THR A 128 . ? 1_555 ? 
58 AC5 20 THR A 129 ? THR A 129 . ? 1_555 ? 
59 AC5 20 ARG A 143 ? ARG A 143 . ? 6_555 ? 
60 AC5 20 GLN A 224 ? GLN A 224 . ? 1_555 ? 
61 AC5 20 VAL A 238 ? VAL A 238 . ? 1_555 ? 
62 AC5 20 THR A 239 ? THR A 239 . ? 1_555 ? 
63 AC5 20 VAL A 273 ? VAL A 273 . ? 1_555 ? 
64 AC5 20 GLY A 274 ? GLY A 274 . ? 1_555 ? 
65 AC5 20 ARG A 303 ? ARG A 303 . ? 1_555 ? 
66 AC5 20 NO3 B .   ? NO3 A 433 . ? 1_555 ? 
67 AC5 20 HDA E .   ? HDA A 437 . ? 1_555 ? 
68 AC5 20 HOH G .   ? HOH A 546 . ? 1_555 ? 
69 AC5 20 HOH G .   ? HOH A 692 . ? 1_555 ? 
70 AC5 20 HOH G .   ? HOH A 697 . ? 1_555 ? 
71 AC5 20 HOH G .   ? HOH A 702 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1CH8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1CH8 
_atom_sites.fract_transf_matrix[1][1]   0.012520 
_atom_sites.fract_transf_matrix[1][2]   0.007230 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014460 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006310 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? -5.004  24.638 45.260 1.00 27.83 ? 1   GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? -6.486  24.540 45.157 1.00 23.58 ? 1   GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? -6.987  25.062 43.830 1.00 19.99 ? 1   GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? -6.274  25.787 43.148 1.00 18.60 ? 1   GLY A O     1 
ATOM   5    N  N     . ASN A 1 2   ? -8.211  24.694 43.466 1.00 20.58 ? 2   ASN A N     1 
ATOM   6    C  CA    . ASN A 1 2   ? -8.815  25.131 42.209 1.00 18.07 ? 2   ASN A CA    1 
ATOM   7    C  C     . ASN A 1 2   ? -9.324  26.546 42.306 1.00 16.88 ? 2   ASN A C     1 
ATOM   8    O  O     . ASN A 1 2   ? -9.212  27.307 41.361 1.00 22.99 ? 2   ASN A O     1 
ATOM   9    C  CB    . ASN A 1 2   ? -9.980  24.220 41.812 1.00 19.83 ? 2   ASN A CB    1 
ATOM   10   C  CG    . ASN A 1 2   ? -9.528  22.849 41.367 1.00 19.28 ? 2   ASN A CG    1 
ATOM   11   O  OD1   . ASN A 1 2   ? -8.341  22.626 41.128 1.00 25.81 ? 2   ASN A OD1   1 
ATOM   12   N  ND2   . ASN A 1 2   ? -10.471 21.913 41.259 1.00 16.71 ? 2   ASN A ND2   1 
ATOM   13   N  N     . ASN A 1 3   ? -9.952  26.875 43.427 1.00 17.34 ? 3   ASN A N     1 
ATOM   14   C  CA    . ASN A 1 3   ? -10.503 28.206 43.659 1.00 14.39 ? 3   ASN A CA    1 
ATOM   15   C  C     . ASN A 1 3   ? -9.659  28.928 44.688 1.00 16.90 ? 3   ASN A C     1 
ATOM   16   O  O     . ASN A 1 3   ? -9.589  28.514 45.857 1.00 21.97 ? 3   ASN A O     1 
ATOM   17   C  CB    . ASN A 1 3   ? -11.936 28.084 44.151 1.00 15.69 ? 3   ASN A CB    1 
ATOM   18   C  CG    . ASN A 1 3   ? -12.796 27.275 43.210 1.00 17.95 ? 3   ASN A CG    1 
ATOM   19   O  OD1   . ASN A 1 3   ? -13.562 26.410 43.632 1.00 22.24 ? 3   ASN A OD1   1 
ATOM   20   N  ND2   . ASN A 1 3   ? -12.650 27.524 41.923 1.00 20.09 ? 3   ASN A ND2   1 
ATOM   21   N  N     . VAL A 1 4   ? -8.998  29.991 44.254 1.00 14.69 ? 4   VAL A N     1 
ATOM   22   C  CA    . VAL A 1 4   ? -8.119  30.755 45.131 1.00 13.05 ? 4   VAL A CA    1 
ATOM   23   C  C     . VAL A 1 4   ? -8.717  32.116 45.375 1.00 13.40 ? 4   VAL A C     1 
ATOM   24   O  O     . VAL A 1 4   ? -9.201  32.752 44.437 1.00 18.64 ? 4   VAL A O     1 
ATOM   25   C  CB    . VAL A 1 4   ? -6.697  30.978 44.488 1.00 13.60 ? 4   VAL A CB    1 
ATOM   26   C  CG1   . VAL A 1 4   ? -5.841  31.920 45.365 1.00 6.08  ? 4   VAL A CG1   1 
ATOM   27   C  CG2   . VAL A 1 4   ? -5.987  29.648 44.273 1.00 5.01  ? 4   VAL A CG2   1 
ATOM   28   N  N     . VAL A 1 5   ? -8.691  32.565 46.628 1.00 12.18 ? 5   VAL A N     1 
ATOM   29   C  CA    . VAL A 1 5   ? -9.200  33.890 46.962 1.00 6.91  ? 5   VAL A CA    1 
ATOM   30   C  C     . VAL A 1 5   ? -8.010  34.774 47.345 1.00 6.77  ? 5   VAL A C     1 
ATOM   31   O  O     . VAL A 1 5   ? -7.111  34.327 48.055 1.00 5.01  ? 5   VAL A O     1 
ATOM   32   C  CB    . VAL A 1 5   ? -10.220 33.824 48.113 1.00 10.62 ? 5   VAL A CB    1 
ATOM   33   C  CG1   . VAL A 1 5   ? -10.698 35.229 48.490 1.00 5.01  ? 5   VAL A CG1   1 
ATOM   34   C  CG2   . VAL A 1 5   ? -11.404 32.922 47.714 1.00 8.04  ? 5   VAL A CG2   1 
ATOM   35   N  N     . VAL A 1 6   ? -7.963  35.982 46.784 1.00 6.28  ? 6   VAL A N     1 
ATOM   36   C  CA    . VAL A 1 6   ? -6.904  36.949 47.064 1.00 6.49  ? 6   VAL A CA    1 
ATOM   37   C  C     . VAL A 1 6   ? -7.552  38.265 47.499 1.00 10.65 ? 6   VAL A C     1 
ATOM   38   O  O     . VAL A 1 6   ? -8.274  38.894 46.718 1.00 13.36 ? 6   VAL A O     1 
ATOM   39   C  CB    . VAL A 1 6   ? -6.062  37.196 45.825 1.00 6.32  ? 6   VAL A CB    1 
ATOM   40   C  CG1   . VAL A 1 6   ? -5.179  38.414 46.012 1.00 5.01  ? 6   VAL A CG1   1 
ATOM   41   C  CG2   . VAL A 1 6   ? -5.239  35.953 45.521 1.00 9.33  ? 6   VAL A CG2   1 
ATOM   42   N  N     . LEU A 1 7   ? -7.334  38.648 48.755 1.00 11.24 ? 7   LEU A N     1 
ATOM   43   C  CA    . LEU A 1 7   ? -7.919  39.866 49.302 1.00 9.22  ? 7   LEU A CA    1 
ATOM   44   C  C     . LEU A 1 7   ? -6.943  40.700 50.124 1.00 8.10  ? 7   LEU A C     1 
ATOM   45   O  O     . LEU A 1 7   ? -5.781  40.330 50.302 1.00 10.67 ? 7   LEU A O     1 
ATOM   46   C  CB    . LEU A 1 7   ? -9.167  39.537 50.124 1.00 12.88 ? 7   LEU A CB    1 
ATOM   47   C  CG    . LEU A 1 7   ? -9.200  38.447 51.207 1.00 13.93 ? 7   LEU A CG    1 
ATOM   48   C  CD1   . LEU A 1 7   ? -8.826  37.138 50.575 1.00 19.87 ? 7   LEU A CD1   1 
ATOM   49   C  CD2   . LEU A 1 7   ? -8.254  38.757 52.389 1.00 17.71 ? 7   LEU A CD2   1 
ATOM   50   N  N     . GLY A 1 8   ? -7.401  41.859 50.578 1.00 11.91 ? 8   GLY A N     1 
ATOM   51   C  CA    . GLY A 1 8   ? -6.558  42.744 51.371 1.00 13.09 ? 8   GLY A CA    1 
ATOM   52   C  C     . GLY A 1 8   ? -6.653  42.447 52.852 1.00 9.32  ? 8   GLY A C     1 
ATOM   53   O  O     . GLY A 1 8   ? -7.752  42.360 53.397 1.00 17.67 ? 8   GLY A O     1 
ATOM   54   N  N     . THR A 1 9   ? -5.514  42.301 53.513 1.00 10.97 ? 9   THR A N     1 
ATOM   55   C  CA    . THR A 1 9   ? -5.497  41.977 54.936 1.00 12.86 ? 9   THR A CA    1 
ATOM   56   C  C     . THR A 1 9   ? -5.507  43.184 55.867 1.00 14.32 ? 9   THR A C     1 
ATOM   57   O  O     . THR A 1 9   ? -5.675  43.032 57.076 1.00 15.66 ? 9   THR A O     1 
ATOM   58   C  CB    . THR A 1 9   ? -4.276  41.095 55.295 1.00 11.30 ? 9   THR A CB    1 
ATOM   59   O  OG1   . THR A 1 9   ? -3.079  41.708 54.812 1.00 10.81 ? 9   THR A OG1   1 
ATOM   60   C  CG2   . THR A 1 9   ? -4.397  39.713 54.671 1.00 9.64  ? 9   THR A CG2   1 
ATOM   61   N  N     . GLN A 1 10  ? -5.376  44.380 55.302 1.00 14.09 ? 10  GLN A N     1 
ATOM   62   C  CA    . GLN A 1 10  ? -5.326  45.599 56.100 1.00 9.71  ? 10  GLN A CA    1 
ATOM   63   C  C     . GLN A 1 10  ? -6.460  46.548 55.755 1.00 11.84 ? 10  GLN A C     1 
ATOM   64   O  O     . GLN A 1 10  ? -7.636  46.260 56.042 1.00 6.01  ? 10  GLN A O     1 
ATOM   65   C  CB    . GLN A 1 10  ? -3.943  46.263 55.937 1.00 6.90  ? 10  GLN A CB    1 
ATOM   66   C  CG    . GLN A 1 10  ? -2.777  45.374 56.429 1.00 9.32  ? 10  GLN A CG    1 
ATOM   67   C  CD    . GLN A 1 10  ? -1.525  45.394 55.543 1.00 18.62 ? 10  GLN A CD    1 
ATOM   68   O  OE1   . GLN A 1 10  ? -1.606  45.227 54.329 1.00 18.30 ? 10  GLN A OE1   1 
ATOM   69   N  NE2   . GLN A 1 10  ? -0.352  45.553 56.165 1.00 15.57 ? 10  GLN A NE2   1 
ATOM   70   N  N     . TRP A 1 11  ? -6.109  47.665 55.124 1.00 14.55 ? 11  TRP A N     1 
ATOM   71   C  CA    . TRP A 1 11  ? -7.081  48.680 54.730 1.00 15.17 ? 11  TRP A CA    1 
ATOM   72   C  C     . TRP A 1 11  ? -7.073  48.973 53.219 1.00 15.01 ? 11  TRP A C     1 
ATOM   73   O  O     . TRP A 1 11  ? -7.271  50.117 52.799 1.00 11.29 ? 11  TRP A O     1 
ATOM   74   C  CB    . TRP A 1 11  ? -6.795  49.976 55.486 1.00 17.14 ? 11  TRP A CB    1 
ATOM   75   C  CG    . TRP A 1 11  ? -6.941  49.887 56.950 1.00 15.31 ? 11  TRP A CG    1 
ATOM   76   C  CD1   . TRP A 1 11  ? -8.098  50.026 57.673 1.00 17.99 ? 11  TRP A CD1   1 
ATOM   77   C  CD2   . TRP A 1 11  ? -5.885  49.763 57.900 1.00 15.36 ? 11  TRP A CD2   1 
ATOM   78   N  NE1   . TRP A 1 11  ? -7.817  50.020 59.021 1.00 10.67 ? 11  TRP A NE1   1 
ATOM   79   C  CE2   . TRP A 1 11  ? -6.464  49.870 59.189 1.00 13.65 ? 11  TRP A CE2   1 
ATOM   80   C  CE3   . TRP A 1 11  ? -4.501  49.585 57.793 1.00 19.49 ? 11  TRP A CE3   1 
ATOM   81   C  CZ2   . TRP A 1 11  ? -5.704  49.806 60.356 1.00 8.08  ? 11  TRP A CZ2   1 
ATOM   82   C  CZ3   . TRP A 1 11  ? -3.743  49.515 58.964 1.00 14.30 ? 11  TRP A CZ3   1 
ATOM   83   C  CH2   . TRP A 1 11  ? -4.349  49.630 60.222 1.00 9.30  ? 11  TRP A CH2   1 
ATOM   84   N  N     . GLY A 1 12  ? -6.896  47.939 52.410 1.00 12.57 ? 12  GLY A N     1 
ATOM   85   C  CA    . GLY A 1 12  ? -6.850  48.126 50.975 1.00 14.08 ? 12  GLY A CA    1 
ATOM   86   C  C     . GLY A 1 12  ? -5.482  48.587 50.499 1.00 16.04 ? 12  GLY A C     1 
ATOM   87   O  O     . GLY A 1 12  ? -4.640  48.989 51.310 1.00 14.50 ? 12  GLY A O     1 
ATOM   88   N  N     . ASP A 1 13  ? -5.257  48.527 49.186 1.00 13.22 ? 13  ASP A N     1 
ATOM   89   C  CA    . ASP A 1 13  ? -3.990  48.961 48.582 1.00 11.78 ? 13  ASP A CA    1 
ATOM   90   C  C     . ASP A 1 13  ? -2.779  48.216 49.080 1.00 11.58 ? 13  ASP A C     1 
ATOM   91   O  O     . ASP A 1 13  ? -1.671  48.781 49.131 1.00 12.57 ? 13  ASP A O     1 
ATOM   92   C  CB    . ASP A 1 13  ? -3.723  50.459 48.778 1.00 7.47  ? 13  ASP A CB    1 
ATOM   93   C  CG    . ASP A 1 13  ? -4.950  51.317 48.569 1.00 11.26 ? 13  ASP A CG    1 
ATOM   94   O  OD1   . ASP A 1 13  ? -5.874  50.948 47.810 1.00 8.84  ? 13  ASP A OD1   1 
ATOM   95   O  OD2   . ASP A 1 13  ? -4.988  52.381 49.202 1.00 14.56 ? 13  ASP A OD2   1 
ATOM   96   N  N     . GLU A 1 14  ? -2.984  46.950 49.429 1.00 11.72 ? 14  GLU A N     1 
ATOM   97   C  CA    . GLU A 1 14  ? -1.905  46.087 49.898 1.00 15.54 ? 14  GLU A CA    1 
ATOM   98   C  C     . GLU A 1 14  ? -1.096  45.596 48.682 1.00 20.08 ? 14  GLU A C     1 
ATOM   99   O  O     . GLU A 1 14  ? 0.044   45.161 48.841 1.00 24.15 ? 14  GLU A O     1 
ATOM   100  C  CB    . GLU A 1 14  ? -2.459  44.869 50.661 1.00 13.23 ? 14  GLU A CB    1 
ATOM   101  C  CG    . GLU A 1 14  ? -3.314  45.192 51.900 1.00 19.97 ? 14  GLU A CG    1 
ATOM   102  C  CD    . GLU A 1 14  ? -4.799  45.451 51.619 1.00 21.61 ? 14  GLU A CD    1 
ATOM   103  O  OE1   . GLU A 1 14  ? -5.212  45.539 50.442 1.00 23.42 ? 14  GLU A OE1   1 
ATOM   104  O  OE2   . GLU A 1 14  ? -5.567  45.555 52.599 1.00 17.15 ? 14  GLU A OE2   1 
ATOM   105  N  N     . GLY A 1 15  ? -1.712  45.632 47.493 1.00 19.81 ? 15  GLY A N     1 
ATOM   106  C  CA    . GLY A 1 15  ? -1.067  45.202 46.255 1.00 14.74 ? 15  GLY A CA    1 
ATOM   107  C  C     . GLY A 1 15  ? -1.809  44.062 45.575 1.00 15.29 ? 15  GLY A C     1 
ATOM   108  O  O     . GLY A 1 15  ? -1.207  43.206 44.937 1.00 21.08 ? 15  GLY A O     1 
ATOM   109  N  N     . LYS A 1 16  ? -3.128  44.056 45.694 1.00 16.46 ? 16  LYS A N     1 
ATOM   110  C  CA    . LYS A 1 16  ? -3.962  42.994 45.119 1.00 16.13 ? 16  LYS A CA    1 
ATOM   111  C  C     . LYS A 1 16  ? -3.932  42.899 43.581 1.00 17.52 ? 16  LYS A C     1 
ATOM   112  O  O     . LYS A 1 16  ? -3.830  41.793 43.042 1.00 18.03 ? 16  LYS A O     1 
ATOM   113  C  CB    . LYS A 1 16  ? -5.413  43.134 45.615 1.00 16.14 ? 16  LYS A CB    1 
ATOM   114  C  CG    . LYS A 1 16  ? -5.644  42.821 47.105 1.00 17.21 ? 16  LYS A CG    1 
ATOM   115  C  CD    . LYS A 1 16  ? -6.897  43.543 47.617 1.00 15.04 ? 16  LYS A CD    1 
ATOM   116  C  CE    . LYS A 1 16  ? -6.629  45.043 47.634 1.00 21.39 ? 16  LYS A CE    1 
ATOM   117  N  NZ    . LYS A 1 16  ? -7.832  45.889 47.567 1.00 27.57 ? 16  LYS A NZ    1 
ATOM   118  N  N     . GLY A 1 17  ? -4.034  44.039 42.889 1.00 14.73 ? 17  GLY A N     1 
ATOM   119  C  CA    . GLY A 1 17  ? -4.005  44.054 41.432 1.00 16.80 ? 17  GLY A CA    1 
ATOM   120  C  C     . GLY A 1 17  ? -2.809  43.345 40.805 1.00 18.11 ? 17  GLY A C     1 
ATOM   121  O  O     . GLY A 1 17  ? -2.962  42.470 39.947 1.00 17.85 ? 17  GLY A O     1 
ATOM   122  N  N     . LYS A 1 18  ? -1.609  43.699 41.245 1.00 18.91 ? 18  LYS A N     1 
ATOM   123  C  CA    . LYS A 1 18  ? -0.406  43.051 40.732 1.00 17.25 ? 18  LYS A CA    1 
ATOM   124  C  C     . LYS A 1 18  ? -0.464  41.534 40.933 1.00 18.07 ? 18  LYS A C     1 
ATOM   125  O  O     . LYS A 1 18  ? -0.224  40.763 40.005 1.00 20.50 ? 18  LYS A O     1 
ATOM   126  C  CB    . LYS A 1 18  ? 0.856   43.583 41.433 1.00 13.90 ? 18  LYS A CB    1 
ATOM   127  C  CG    . LYS A 1 18  ? 2.031   42.636 41.258 1.00 15.63 ? 18  LYS A CG    1 
ATOM   128  C  CD    . LYS A 1 18  ? 3.353   43.131 41.778 1.00 16.75 ? 18  LYS A CD    1 
ATOM   129  C  CE    . LYS A 1 18  ? 4.338   41.987 41.665 1.00 14.74 ? 18  LYS A CE    1 
ATOM   130  N  NZ    . LYS A 1 18  ? 5.732   42.348 42.023 1.00 21.45 ? 18  LYS A NZ    1 
ATOM   131  N  N     . ILE A 1 19  ? -0.759  41.111 42.158 1.00 17.36 ? 19  ILE A N     1 
ATOM   132  C  CA    . ILE A 1 19  ? -0.800  39.691 42.468 1.00 13.23 ? 19  ILE A CA    1 
ATOM   133  C  C     . ILE A 1 19  ? -1.852  38.939 41.681 1.00 10.02 ? 19  ILE A C     1 
ATOM   134  O  O     . ILE A 1 19  ? -1.598  37.825 41.220 1.00 11.54 ? 19  ILE A O     1 
ATOM   135  C  CB    . ILE A 1 19  ? -0.921  39.438 44.007 1.00 10.77 ? 19  ILE A CB    1 
ATOM   136  C  CG1   . ILE A 1 19  ? 0.221   40.162 44.712 1.00 11.83 ? 19  ILE A CG1   1 
ATOM   137  C  CG2   . ILE A 1 19  ? -0.769  37.956 44.327 1.00 5.01  ? 19  ILE A CG2   1 
ATOM   138  C  CD1   . ILE A 1 19  ? 1.574   39.772 44.174 1.00 5.01  ? 19  ILE A CD1   1 
ATOM   139  N  N     . VAL A 1 20  ? -3.025  39.535 41.509 1.00 10.80 ? 20  VAL A N     1 
ATOM   140  C  CA    . VAL A 1 20  ? -4.067  38.867 40.750 1.00 11.70 ? 20  VAL A CA    1 
ATOM   141  C  C     . VAL A 1 20  ? -3.592  38.709 39.303 1.00 13.42 ? 20  VAL A C     1 
ATOM   142  O  O     . VAL A 1 20  ? -3.708  37.630 38.729 1.00 13.26 ? 20  VAL A O     1 
ATOM   143  C  CB    . VAL A 1 20  ? -5.411  39.614 40.814 1.00 8.79  ? 20  VAL A CB    1 
ATOM   144  C  CG1   . VAL A 1 20  ? -6.471  38.856 39.992 1.00 11.83 ? 20  VAL A CG1   1 
ATOM   145  C  CG2   . VAL A 1 20  ? -5.869  39.748 42.250 1.00 5.01  ? 20  VAL A CG2   1 
ATOM   146  N  N     . ASP A 1 21  ? -3.029  39.773 38.729 1.00 16.52 ? 21  ASP A N     1 
ATOM   147  C  CA    . ASP A 1 21  ? -2.502  39.728 37.356 1.00 21.04 ? 21  ASP A CA    1 
ATOM   148  C  C     . ASP A 1 21  ? -1.475  38.586 37.229 1.00 20.08 ? 21  ASP A C     1 
ATOM   149  O  O     . ASP A 1 21  ? -1.582  37.720 36.366 1.00 19.60 ? 21  ASP A O     1 
ATOM   150  C  CB    . ASP A 1 21  ? -1.866  41.083 37.000 1.00 21.80 ? 21  ASP A CB    1 
ATOM   151  C  CG    . ASP A 1 21  ? -1.073  41.048 35.700 1.00 27.25 ? 21  ASP A CG    1 
ATOM   152  O  OD1   . ASP A 1 21  ? -1.674  40.948 34.603 1.00 24.95 ? 21  ASP A OD1   1 
ATOM   153  O  OD2   . ASP A 1 21  ? 0.168   41.159 35.784 1.00 29.63 ? 21  ASP A OD2   1 
ATOM   154  N  N     . LEU A 1 22  ? -0.528  38.564 38.156 1.00 20.27 ? 22  LEU A N     1 
ATOM   155  C  CA    . LEU A 1 22  ? 0.505   37.548 38.211 1.00 18.96 ? 22  LEU A CA    1 
ATOM   156  C  C     . LEU A 1 22  ? -0.042  36.133 38.312 1.00 19.58 ? 22  LEU A C     1 
ATOM   157  O  O     . LEU A 1 22  ? 0.304   35.274 37.500 1.00 23.57 ? 22  LEU A O     1 
ATOM   158  C  CB    . LEU A 1 22  ? 1.420   37.807 39.416 1.00 18.18 ? 22  LEU A CB    1 
ATOM   159  C  CG    . LEU A 1 22  ? 2.589   36.849 39.688 1.00 16.32 ? 22  LEU A CG    1 
ATOM   160  C  CD1   . LEU A 1 22  ? 3.651   36.951 38.578 1.00 11.03 ? 22  LEU A CD1   1 
ATOM   161  C  CD2   . LEU A 1 22  ? 3.195   37.181 41.052 1.00 14.05 ? 22  LEU A CD2   1 
ATOM   162  N  N     . LEU A 1 23  ? -0.882  35.876 39.309 1.00 16.45 ? 23  LEU A N     1 
ATOM   163  C  CA    . LEU A 1 23  ? -1.399  34.524 39.512 1.00 15.71 ? 23  LEU A CA    1 
ATOM   164  C  C     . LEU A 1 23  ? -2.451  34.023 38.520 1.00 19.69 ? 23  LEU A C     1 
ATOM   165  O  O     . LEU A 1 23  ? -2.704  32.811 38.417 1.00 19.96 ? 23  LEU A O     1 
ATOM   166  C  CB    . LEU A 1 23  ? -1.881  34.342 40.953 1.00 12.92 ? 23  LEU A CB    1 
ATOM   167  C  CG    . LEU A 1 23  ? -0.850  34.484 42.081 1.00 15.20 ? 23  LEU A CG    1 
ATOM   168  C  CD1   . LEU A 1 23  ? -1.567  34.424 43.410 1.00 16.91 ? 23  LEU A CD1   1 
ATOM   169  C  CD2   . LEU A 1 23  ? 0.221   33.395 42.014 1.00 14.21 ? 23  LEU A CD2   1 
ATOM   170  N  N     . THR A 1 24  ? -3.066  34.936 37.782 1.00 20.26 ? 24  THR A N     1 
ATOM   171  C  CA    . THR A 1 24  ? -4.072  34.526 36.819 1.00 19.55 ? 24  THR A CA    1 
ATOM   172  C  C     . THR A 1 24  ? -3.494  33.841 35.577 1.00 25.69 ? 24  THR A C     1 
ATOM   173  O  O     . THR A 1 24  ? -4.243  33.408 34.698 1.00 29.45 ? 24  THR A O     1 
ATOM   174  C  CB    . THR A 1 24  ? -4.976  35.686 36.430 1.00 16.52 ? 24  THR A CB    1 
ATOM   175  O  OG1   . THR A 1 24  ? -4.194  36.865 36.201 1.00 15.88 ? 24  THR A OG1   1 
ATOM   176  C  CG2   . THR A 1 24  ? -5.960  35.941 37.537 1.00 11.08 ? 24  THR A CG2   1 
ATOM   177  N  N     . GLU A 1 25  ? -2.168  33.684 35.547 1.00 25.64 ? 25  GLU A N     1 
ATOM   178  C  CA    . GLU A 1 25  ? -1.486  33.030 34.439 1.00 27.10 ? 25  GLU A CA    1 
ATOM   179  C  C     . GLU A 1 25  ? -1.981  31.599 34.277 1.00 28.51 ? 25  GLU A C     1 
ATOM   180  O  O     . GLU A 1 25  ? -1.887  31.024 33.196 1.00 30.92 ? 25  GLU A O     1 
ATOM   181  C  CB    . GLU A 1 25  ? 0.031   33.010 34.671 1.00 30.20 ? 25  GLU A CB    1 
ATOM   182  C  CG    . GLU A 1 25  ? 0.820   32.326 33.551 1.00 34.32 ? 25  GLU A CG    1 
ATOM   183  C  CD    . GLU A 1 25  ? 2.309   32.198 33.837 1.00 37.32 ? 25  GLU A CD    1 
ATOM   184  O  OE1   . GLU A 1 25  ? 3.109   32.771 33.072 1.00 39.84 ? 25  GLU A OE1   1 
ATOM   185  O  OE2   . GLU A 1 25  ? 2.689   31.508 34.808 1.00 37.12 ? 25  GLU A OE2   1 
ATOM   186  N  N     . ARG A 1 26  ? -2.487  31.012 35.353 1.00 26.57 ? 26  ARG A N     1 
ATOM   187  C  CA    . ARG A 1 26  ? -2.971  29.640 35.286 1.00 25.10 ? 26  ARG A CA    1 
ATOM   188  C  C     . ARG A 1 26  ? -4.482  29.487 35.362 1.00 22.53 ? 26  ARG A C     1 
ATOM   189  O  O     . ARG A 1 26  ? -5.012  28.403 35.101 1.00 20.02 ? 26  ARG A O     1 
ATOM   190  C  CB    . ARG A 1 26  ? -2.286  28.797 36.368 1.00 24.64 ? 26  ARG A CB    1 
ATOM   191  C  CG    . ARG A 1 26  ? -0.836  28.471 36.025 1.00 27.92 ? 26  ARG A CG    1 
ATOM   192  C  CD    . ARG A 1 26  ? -0.062  27.930 37.200 1.00 28.43 ? 26  ARG A CD    1 
ATOM   193  N  NE    . ARG A 1 26  ? -0.489  26.588 37.577 1.00 27.17 ? 26  ARG A NE    1 
ATOM   194  C  CZ    . ARG A 1 26  ? -0.142  26.076 38.754 1.00 24.44 ? 26  ARG A CZ    1 
ATOM   195  N  NH1   . ARG A 1 26  ? 0.590   26.796 39.596 1.00 20.55 ? 26  ARG A NH1   1 
ATOM   196  N  NH2   . ARG A 1 26  ? -0.498  24.834 39.070 1.00 22.02 ? 26  ARG A NH2   1 
ATOM   197  N  N     . ALA A 1 27  ? -5.171  30.590 35.642 1.00 21.64 ? 27  ALA A N     1 
ATOM   198  C  CA    . ALA A 1 27  ? -6.617  30.585 35.801 1.00 18.25 ? 27  ALA A CA    1 
ATOM   199  C  C     . ALA A 1 27  ? -7.448  30.742 34.534 1.00 17.63 ? 27  ALA A C     1 
ATOM   200  O  O     . ALA A 1 27  ? -6.975  31.258 33.529 1.00 19.94 ? 27  ALA A O     1 
ATOM   201  C  CB    . ALA A 1 27  ? -7.008  31.647 36.794 1.00 20.23 ? 27  ALA A CB    1 
ATOM   202  N  N     . LYS A 1 28  ? -8.688  30.263 34.605 1.00 17.54 ? 28  LYS A N     1 
ATOM   203  C  CA    . LYS A 1 28  ? -9.657  30.370 33.522 1.00 16.24 ? 28  LYS A CA    1 
ATOM   204  C  C     . LYS A 1 28  ? -10.506 31.573 33.877 1.00 16.55 ? 28  LYS A C     1 
ATOM   205  O  O     . LYS A 1 28  ? -10.780 32.419 33.021 1.00 20.72 ? 28  LYS A O     1 
ATOM   206  C  CB    . LYS A 1 28  ? -10.583 29.161 33.489 1.00 19.07 ? 28  LYS A CB    1 
ATOM   207  C  CG    . LYS A 1 28  ? -9.894  27.840 33.288 1.00 35.35 ? 28  LYS A CG    1 
ATOM   208  C  CD    . LYS A 1 28  ? -9.468  27.632 31.833 1.00 38.72 ? 28  LYS A CD    1 
ATOM   209  C  CE    . LYS A 1 28  ? -8.861  26.244 31.632 1.00 38.40 ? 28  LYS A CE    1 
ATOM   210  N  NZ    . LYS A 1 28  ? -9.797  25.148 32.026 1.00 38.11 ? 28  LYS A NZ    1 
ATOM   211  N  N     . TYR A 1 29  ? -10.904 31.652 35.154 1.00 16.69 ? 29  TYR A N     1 
ATOM   212  C  CA    . TYR A 1 29  ? -11.748 32.740 35.655 1.00 12.38 ? 29  TYR A CA    1 
ATOM   213  C  C     . TYR A 1 29  ? -11.156 33.597 36.769 1.00 12.16 ? 29  TYR A C     1 
ATOM   214  O  O     . TYR A 1 29  ? -10.344 33.129 37.570 1.00 12.08 ? 29  TYR A O     1 
ATOM   215  C  CB    . TYR A 1 29  ? -13.076 32.181 36.152 1.00 12.92 ? 29  TYR A CB    1 
ATOM   216  C  CG    . TYR A 1 29  ? -13.831 31.379 35.124 1.00 14.97 ? 29  TYR A CG    1 
ATOM   217  C  CD1   . TYR A 1 29  ? -14.539 32.008 34.086 1.00 13.35 ? 29  TYR A CD1   1 
ATOM   218  C  CD2   . TYR A 1 29  ? -13.819 29.986 35.169 1.00 17.34 ? 29  TYR A CD2   1 
ATOM   219  C  CE1   . TYR A 1 29  ? -15.208 31.258 33.119 1.00 12.64 ? 29  TYR A CE1   1 
ATOM   220  C  CE2   . TYR A 1 29  ? -14.491 29.225 34.210 1.00 18.11 ? 29  TYR A CE2   1 
ATOM   221  C  CZ    . TYR A 1 29  ? -15.180 29.866 33.187 1.00 16.45 ? 29  TYR A CZ    1 
ATOM   222  O  OH    . TYR A 1 29  ? -15.819 29.090 32.237 1.00 22.53 ? 29  TYR A OH    1 
ATOM   223  N  N     . VAL A 1 30  ? -11.575 34.859 36.785 1.00 12.24 ? 30  VAL A N     1 
ATOM   224  C  CA    . VAL A 1 30  ? -11.206 35.851 37.793 1.00 15.20 ? 30  VAL A CA    1 
ATOM   225  C  C     . VAL A 1 30  ? -12.562 36.469 38.129 1.00 17.41 ? 30  VAL A C     1 
ATOM   226  O  O     . VAL A 1 30  ? -13.349 36.752 37.223 1.00 17.44 ? 30  VAL A O     1 
ATOM   227  C  CB    . VAL A 1 30  ? -10.322 37.003 37.258 1.00 17.77 ? 30  VAL A CB    1 
ATOM   228  C  CG1   . VAL A 1 30  ? -9.942  37.928 38.401 1.00 20.76 ? 30  VAL A CG1   1 
ATOM   229  C  CG2   . VAL A 1 30  ? -9.074  36.479 36.649 1.00 24.38 ? 30  VAL A CG2   1 
ATOM   230  N  N     . VAL A 1 31  ? -12.832 36.690 39.415 1.00 19.05 ? 31  VAL A N     1 
ATOM   231  C  CA    . VAL A 1 31  ? -14.113 37.248 39.843 1.00 12.68 ? 31  VAL A CA    1 
ATOM   232  C  C     . VAL A 1 31  ? -13.985 38.330 40.915 1.00 13.57 ? 31  VAL A C     1 
ATOM   233  O  O     . VAL A 1 31  ? -13.290 38.140 41.906 1.00 14.24 ? 31  VAL A O     1 
ATOM   234  C  CB    . VAL A 1 31  ? -15.042 36.135 40.410 1.00 6.72  ? 31  VAL A CB    1 
ATOM   235  C  CG1   . VAL A 1 31  ? -16.502 36.615 40.482 1.00 5.94  ? 31  VAL A CG1   1 
ATOM   236  C  CG2   . VAL A 1 31  ? -14.943 34.873 39.570 1.00 9.74  ? 31  VAL A CG2   1 
ATOM   237  N  N     . ARG A 1 32  ? -14.552 39.499 40.641 1.00 14.09 ? 32  ARG A N     1 
ATOM   238  C  CA    . ARG A 1 32  ? -14.608 40.596 41.602 1.00 12.24 ? 32  ARG A CA    1 
ATOM   239  C  C     . ARG A 1 32  ? -15.955 40.248 42.239 1.00 13.96 ? 32  ARG A C     1 
ATOM   240  O  O     . ARG A 1 32  ? -16.899 39.942 41.513 1.00 17.52 ? 32  ARG A O     1 
ATOM   241  C  CB    . ARG A 1 32  ? -14.693 41.950 40.895 1.00 8.93  ? 32  ARG A CB    1 
ATOM   242  C  CG    . ARG A 1 32  ? -13.367 42.640 40.674 1.00 11.38 ? 32  ARG A CG    1 
ATOM   243  C  CD    . ARG A 1 32  ? -12.769 43.219 41.963 1.00 12.56 ? 32  ARG A CD    1 
ATOM   244  N  NE    . ARG A 1 32  ? -13.672 44.141 42.649 1.00 15.12 ? 32  ARG A NE    1 
ATOM   245  C  CZ    . ARG A 1 32  ? -13.740 45.439 42.347 1.00 18.33 ? 32  ARG A CZ    1 
ATOM   246  N  NH1   . ARG A 1 32  ? -12.976 45.957 41.388 1.00 18.42 ? 32  ARG A NH1   1 
ATOM   247  N  NH2   . ARG A 1 32  ? -14.568 46.231 43.038 1.00 15.36 ? 32  ARG A NH2   1 
ATOM   248  N  N     . TYR A 1 33  ? -16.053 40.263 43.567 1.00 16.05 ? 33  TYR A N     1 
ATOM   249  C  CA    . TYR A 1 33  ? -17.294 39.870 44.246 1.00 14.45 ? 33  TYR A CA    1 
ATOM   250  C  C     . TYR A 1 33  ? -17.898 40.941 45.160 1.00 14.24 ? 33  TYR A C     1 
ATOM   251  O  O     . TYR A 1 33  ? -18.938 40.723 45.790 1.00 15.99 ? 33  TYR A O     1 
ATOM   252  C  CB    . TYR A 1 33  ? -17.066 38.550 45.017 1.00 11.15 ? 33  TYR A CB    1 
ATOM   253  C  CG    . TYR A 1 33  ? -15.897 38.609 45.990 1.00 15.45 ? 33  TYR A CG    1 
ATOM   254  C  CD1   . TYR A 1 33  ? -14.639 38.116 45.637 1.00 9.39  ? 33  TYR A CD1   1 
ATOM   255  C  CD2   . TYR A 1 33  ? -16.030 39.244 47.230 1.00 12.40 ? 33  TYR A CD2   1 
ATOM   256  C  CE1   . TYR A 1 33  ? -13.542 38.261 46.478 1.00 10.32 ? 33  TYR A CE1   1 
ATOM   257  C  CE2   . TYR A 1 33  ? -14.935 39.400 48.081 1.00 14.95 ? 33  TYR A CE2   1 
ATOM   258  C  CZ    . TYR A 1 33  ? -13.696 38.912 47.703 1.00 18.00 ? 33  TYR A CZ    1 
ATOM   259  O  OH    . TYR A 1 33  ? -12.621 39.100 48.538 1.00 11.45 ? 33  TYR A OH    1 
ATOM   260  N  N     . GLN A 1 34  ? -17.247 42.096 45.232 1.00 17.03 ? 34  GLN A N     1 
ATOM   261  C  CA    . GLN A 1 34  ? -17.731 43.216 46.055 1.00 16.81 ? 34  GLN A CA    1 
ATOM   262  C  C     . GLN A 1 34  ? -17.074 44.538 45.670 1.00 15.48 ? 34  GLN A C     1 
ATOM   263  O  O     . GLN A 1 34  ? -16.108 44.569 44.889 1.00 18.41 ? 34  GLN A O     1 
ATOM   264  C  CB    . GLN A 1 34  ? -17.530 42.944 47.560 1.00 13.89 ? 34  GLN A CB    1 
ATOM   265  C  CG    . GLN A 1 34  ? -16.132 42.456 47.968 1.00 5.71  ? 34  GLN A CG    1 
ATOM   266  C  CD    . GLN A 1 34  ? -15.124 43.561 48.027 1.00 8.20  ? 34  GLN A CD    1 
ATOM   267  O  OE1   . GLN A 1 34  ? -13.957 43.388 47.668 1.00 6.00  ? 34  GLN A OE1   1 
ATOM   268  N  NE2   . GLN A 1 34  ? -15.564 44.719 48.479 1.00 9.03  ? 34  GLN A NE2   1 
ATOM   269  N  N     . GLY A 1 35  ? -17.610 45.625 46.205 1.00 11.06 ? 35  GLY A N     1 
ATOM   270  C  CA    . GLY A 1 35  ? -17.053 46.930 45.922 1.00 9.39  ? 35  GLY A CA    1 
ATOM   271  C  C     . GLY A 1 35  ? -17.528 47.457 44.586 1.00 11.54 ? 35  GLY A C     1 
ATOM   272  O  O     . GLY A 1 35  ? -18.482 46.910 44.006 1.00 8.38  ? 35  GLY A O     1 
ATOM   273  N  N     . GLY A 1 36  ? -16.866 48.511 44.103 1.00 7.27  ? 36  GLY A N     1 
ATOM   274  C  CA    . GLY A 1 36  ? -17.235 49.121 42.837 1.00 10.56 ? 36  GLY A CA    1 
ATOM   275  C  C     . GLY A 1 36  ? -16.037 49.833 42.246 1.00 10.31 ? 36  GLY A C     1 
ATOM   276  O  O     . GLY A 1 36  ? -14.960 49.252 42.151 1.00 8.12  ? 36  GLY A O     1 
ATOM   277  N  N     . HIS A 1 37  ? -16.201 51.084 41.822 1.00 9.75  ? 37  HIS A N     1 
ATOM   278  C  CA    . HIS A 1 37  ? -15.046 51.780 41.269 1.00 14.95 ? 37  HIS A CA    1 
ATOM   279  C  C     . HIS A 1 37  ? -14.263 52.589 42.301 1.00 14.71 ? 37  HIS A C     1 
ATOM   280  O  O     . HIS A 1 37  ? -13.402 53.388 41.946 1.00 18.79 ? 37  HIS A O     1 
ATOM   281  C  CB    . HIS A 1 37  ? -15.354 52.577 39.970 1.00 11.30 ? 37  HIS A CB    1 
ATOM   282  C  CG    . HIS A 1 37  ? -16.465 53.569 40.092 1.00 5.64  ? 37  HIS A CG    1 
ATOM   283  N  ND1   . HIS A 1 37  ? -17.757 53.211 40.414 1.00 6.12  ? 37  HIS A ND1   1 
ATOM   284  C  CD2   . HIS A 1 37  ? -16.491 54.906 39.888 1.00 5.01  ? 37  HIS A CD2   1 
ATOM   285  C  CE1   . HIS A 1 37  ? -18.530 54.281 40.401 1.00 5.01  ? 37  HIS A CE1   1 
ATOM   286  N  NE2   . HIS A 1 37  ? -17.784 55.322 40.082 1.00 5.88  ? 37  HIS A NE2   1 
ATOM   287  N  N     . ASN A 1 38  ? -14.586 52.368 43.579 1.00 17.03 ? 38  ASN A N     1 
ATOM   288  C  CA    . ASN A 1 38  ? -13.881 52.993 44.711 1.00 8.84  ? 38  ASN A CA    1 
ATOM   289  C  C     . ASN A 1 38  ? -12.468 52.399 44.682 1.00 7.94  ? 38  ASN A C     1 
ATOM   290  O  O     . ASN A 1 38  ? -11.476 53.090 44.914 1.00 9.09  ? 38  ASN A O     1 
ATOM   291  C  CB    . ASN A 1 38  ? -14.589 52.693 46.060 1.00 12.02 ? 38  ASN A CB    1 
ATOM   292  C  CG    . ASN A 1 38  ? -14.980 51.201 46.245 1.00 16.76 ? 38  ASN A CG    1 
ATOM   293  O  OD1   . ASN A 1 38  ? -14.820 50.360 45.346 1.00 16.97 ? 38  ASN A OD1   1 
ATOM   294  N  ND2   . ASN A 1 38  ? -15.533 50.888 47.411 1.00 13.94 ? 38  ASN A ND2   1 
ATOM   295  N  N     . ALA A 1 39  ? -12.388 51.116 44.344 1.00 6.33  ? 39  ALA A N     1 
ATOM   296  C  CA    . ALA A 1 39  ? -11.111 50.418 44.214 1.00 7.20  ? 39  ALA A CA    1 
ATOM   297  C  C     . ALA A 1 39  ? -10.282 51.023 43.072 1.00 6.02  ? 39  ALA A C     1 
ATOM   298  O  O     . ALA A 1 39  ? -10.822 51.557 42.107 1.00 7.38  ? 39  ALA A O     1 
ATOM   299  C  CB    . ALA A 1 39  ? -11.354 48.933 43.957 1.00 5.01  ? 39  ALA A CB    1 
ATOM   300  N  N     . GLY A 1 40  ? -8.970  50.950 43.203 1.00 7.77  ? 40  GLY A N     1 
ATOM   301  C  CA    . GLY A 1 40  ? -8.080  51.472 42.189 1.00 12.57 ? 40  GLY A CA    1 
ATOM   302  C  C     . GLY A 1 40  ? -6.779  50.701 42.297 1.00 17.38 ? 40  GLY A C     1 
ATOM   303  O  O     . GLY A 1 40  ? -6.176  50.668 43.376 1.00 20.73 ? 40  GLY A O     1 
ATOM   304  N  N     . HIS A 1 41  ? -6.379  50.015 41.228 1.00 17.22 ? 41  HIS A N     1 
ATOM   305  C  CA    . HIS A 1 41  ? -5.140  49.239 41.259 1.00 18.08 ? 41  HIS A CA    1 
ATOM   306  C  C     . HIS A 1 41  ? -4.199  49.598 40.117 1.00 18.27 ? 41  HIS A C     1 
ATOM   307  O  O     . HIS A 1 41  ? -4.635  49.835 38.988 1.00 20.81 ? 41  HIS A O     1 
ATOM   308  C  CB    . HIS A 1 41  ? -5.404  47.728 41.158 1.00 17.76 ? 41  HIS A CB    1 
ATOM   309  C  CG    . HIS A 1 41  ? -6.781  47.302 41.566 1.00 16.14 ? 41  HIS A CG    1 
ATOM   310  N  ND1   . HIS A 1 41  ? -7.104  46.976 42.863 1.00 18.19 ? 41  HIS A ND1   1 
ATOM   311  C  CD2   . HIS A 1 41  ? -7.890  47.049 40.827 1.00 15.06 ? 41  HIS A CD2   1 
ATOM   312  C  CE1   . HIS A 1 41  ? -8.350  46.532 42.906 1.00 17.40 ? 41  HIS A CE1   1 
ATOM   313  N  NE2   . HIS A 1 41  ? -8.846  46.566 41.684 1.00 13.50 ? 41  HIS A NE2   1 
ATOM   314  N  N     . THR A 1 42  ? -2.906  49.595 40.403 1.00 18.83 ? 42  THR A N     1 
ATOM   315  C  CA    . THR A 1 42  ? -1.914  49.874 39.384 1.00 20.08 ? 42  THR A CA    1 
ATOM   316  C  C     . THR A 1 42  ? -1.146  48.602 39.013 1.00 21.83 ? 42  THR A C     1 
ATOM   317  O  O     . THR A 1 42  ? -0.424  48.027 39.842 1.00 22.67 ? 42  THR A O     1 
ATOM   318  C  CB    . THR A 1 42  ? -0.924  50.939 39.839 1.00 16.95 ? 42  THR A CB    1 
ATOM   319  O  OG1   . THR A 1 42  ? -1.610  52.180 40.032 1.00 21.30 ? 42  THR A OG1   1 
ATOM   320  C  CG2   . THR A 1 42  ? 0.178   51.117 38.807 1.00 20.65 ? 42  THR A CG2   1 
ATOM   321  N  N     . LEU A 1 43  ? -1.360  48.129 37.790 1.00 19.63 ? 43  LEU A N     1 
ATOM   322  C  CA    . LEU A 1 43  ? -0.657  46.958 37.293 1.00 18.18 ? 43  LEU A CA    1 
ATOM   323  C  C     . LEU A 1 43  ? 0.490   47.462 36.418 1.00 20.80 ? 43  LEU A C     1 
ATOM   324  O  O     . LEU A 1 43  ? 0.380   48.521 35.777 1.00 18.71 ? 43  LEU A O     1 
ATOM   325  C  CB    . LEU A 1 43  ? -1.586  46.055 36.489 1.00 24.22 ? 43  LEU A CB    1 
ATOM   326  C  CG    . LEU A 1 43  ? -2.671  45.268 37.228 1.00 18.75 ? 43  LEU A CG    1 
ATOM   327  C  CD1   . LEU A 1 43  ? -3.761  46.189 37.713 1.00 19.21 ? 43  LEU A CD1   1 
ATOM   328  C  CD2   . LEU A 1 43  ? -3.237  44.245 36.275 1.00 19.00 ? 43  LEU A CD2   1 
ATOM   329  N  N     . VAL A 1 44  ? 1.599   46.726 36.423 1.00 23.41 ? 44  VAL A N     1 
ATOM   330  C  CA    . VAL A 1 44  ? 2.781   47.101 35.660 1.00 22.42 ? 44  VAL A CA    1 
ATOM   331  C  C     . VAL A 1 44  ? 3.443   45.907 35.003 1.00 25.40 ? 44  VAL A C     1 
ATOM   332  O  O     . VAL A 1 44  ? 3.902   44.989 35.688 1.00 27.40 ? 44  VAL A O     1 
ATOM   333  C  CB    . VAL A 1 44  ? 3.827   47.780 36.574 1.00 25.12 ? 44  VAL A CB    1 
ATOM   334  C  CG1   . VAL A 1 44  ? 5.134   48.043 35.813 1.00 19.46 ? 44  VAL A CG1   1 
ATOM   335  C  CG2   . VAL A 1 44  ? 3.258   49.075 37.151 1.00 25.17 ? 44  VAL A CG2   1 
ATOM   336  N  N     . ILE A 1 45  ? 3.493   45.923 33.673 1.00 28.31 ? 45  ILE A N     1 
ATOM   337  C  CA    . ILE A 1 45  ? 4.141   44.855 32.909 1.00 29.29 ? 45  ILE A CA    1 
ATOM   338  C  C     . ILE A 1 45  ? 5.186   45.471 31.992 1.00 33.06 ? 45  ILE A C     1 
ATOM   339  O  O     . ILE A 1 45  ? 4.884   46.358 31.183 1.00 33.67 ? 45  ILE A O     1 
ATOM   340  C  CB    . ILE A 1 45  ? 3.173   44.018 32.039 1.00 28.61 ? 45  ILE A CB    1 
ATOM   341  C  CG1   . ILE A 1 45  ? 2.172   43.252 32.907 1.00 30.75 ? 45  ILE A CG1   1 
ATOM   342  C  CG2   . ILE A 1 45  ? 3.968   42.984 31.245 1.00 27.30 ? 45  ILE A CG2   1 
ATOM   343  C  CD1   . ILE A 1 45  ? 0.959   44.044 33.322 1.00 37.37 ? 45  ILE A CD1   1 
ATOM   344  N  N     . ASN A 1 46  ? 6.421   45.000 32.139 1.00 35.38 ? 46  ASN A N     1 
ATOM   345  C  CA    . ASN A 1 46  ? 7.561   45.471 31.358 1.00 31.64 ? 46  ASN A CA    1 
ATOM   346  C  C     . ASN A 1 46  ? 7.624   46.978 31.384 1.00 27.90 ? 46  ASN A C     1 
ATOM   347  O  O     . ASN A 1 46  ? 8.095   47.598 30.440 1.00 30.09 ? 46  ASN A O     1 
ATOM   348  C  CB    . ASN A 1 46  ? 7.495   44.958 29.920 1.00 37.42 ? 46  ASN A CB    1 
ATOM   349  C  CG    . ASN A 1 46  ? 7.649   43.442 29.828 1.00 47.24 ? 46  ASN A CG    1 
ATOM   350  O  OD1   . ASN A 1 46  ? 7.319   42.702 30.769 1.00 52.46 ? 46  ASN A OD1   1 
ATOM   351  N  ND2   . ASN A 1 46  ? 8.135   42.969 28.684 1.00 51.89 ? 46  ASN A ND2   1 
ATOM   352  N  N     . GLY A 1 47  ? 7.158   47.560 32.486 1.00 21.68 ? 47  GLY A N     1 
ATOM   353  C  CA    . GLY A 1 47  ? 7.167   49.003 32.627 1.00 17.15 ? 47  GLY A CA    1 
ATOM   354  C  C     . GLY A 1 47  ? 5.891   49.696 32.208 1.00 14.55 ? 47  GLY A C     1 
ATOM   355  O  O     . GLY A 1 47  ? 5.711   50.879 32.476 1.00 15.01 ? 47  GLY A O     1 
ATOM   356  N  N     . GLU A 1 48  ? 4.993   48.962 31.566 1.00 14.41 ? 48  GLU A N     1 
ATOM   357  C  CA    . GLU A 1 48  ? 3.736   49.529 31.112 1.00 13.63 ? 48  GLU A CA    1 
ATOM   358  C  C     . GLU A 1 48  ? 2.702   49.460 32.246 1.00 15.17 ? 48  GLU A C     1 
ATOM   359  O  O     . GLU A 1 48  ? 2.440   48.388 32.786 1.00 11.33 ? 48  GLU A O     1 
ATOM   360  C  CB    . GLU A 1 48  ? 3.263   48.759 29.880 1.00 14.78 ? 48  GLU A CB    1 
ATOM   361  C  CG    . GLU A 1 48  ? 2.138   49.419 29.082 1.00 14.05 ? 48  GLU A CG    1 
ATOM   362  C  CD    . GLU A 1 48  ? 1.470   48.448 28.120 1.00 14.29 ? 48  GLU A CD    1 
ATOM   363  O  OE1   . GLU A 1 48  ? 1.736   47.225 28.210 1.00 17.86 ? 48  GLU A OE1   1 
ATOM   364  O  OE2   . GLU A 1 48  ? 0.657   48.895 27.291 1.00 13.49 ? 48  GLU A OE2   1 
ATOM   365  N  N     . LYS A 1 49  ? 2.140   50.606 32.612 1.00 17.71 ? 49  LYS A N     1 
ATOM   366  C  CA    . LYS A 1 49  ? 1.162   50.673 33.693 1.00 23.86 ? 49  LYS A CA    1 
ATOM   367  C  C     . LYS A 1 49  ? -0.274  50.593 33.216 1.00 26.73 ? 49  LYS A C     1 
ATOM   368  O  O     . LYS A 1 49  ? -0.618  51.116 32.152 1.00 29.91 ? 49  LYS A O     1 
ATOM   369  C  CB    . LYS A 1 49  ? 1.284   51.994 34.451 1.00 24.81 ? 49  LYS A CB    1 
ATOM   370  C  CG    . LYS A 1 49  ? 2.679   52.461 34.754 1.00 32.70 ? 49  LYS A CG    1 
ATOM   371  C  CD    . LYS A 1 49  ? 2.617   53.727 35.592 1.00 41.46 ? 49  LYS A CD    1 
ATOM   372  C  CE    . LYS A 1 49  ? 2.274   53.434 37.053 1.00 43.60 ? 49  LYS A CE    1 
ATOM   373  N  NZ    . LYS A 1 49  ? 3.494   53.256 37.895 1.00 49.76 ? 49  LYS A NZ    1 
ATOM   374  N  N     . THR A 1 50  ? -1.118  49.990 34.042 1.00 25.73 ? 50  THR A N     1 
ATOM   375  C  CA    . THR A 1 50  ? -2.544  49.907 33.759 1.00 25.93 ? 50  THR A CA    1 
ATOM   376  C  C     . THR A 1 50  ? -3.244  50.115 35.112 1.00 23.74 ? 50  THR A C     1 
ATOM   377  O  O     . THR A 1 50  ? -2.855  49.517 36.117 1.00 23.86 ? 50  THR A O     1 
ATOM   378  C  CB    . THR A 1 50  ? -2.947  48.535 33.117 1.00 27.62 ? 50  THR A CB    1 
ATOM   379  O  OG1   . THR A 1 50  ? -2.202  48.323 31.907 1.00 23.49 ? 50  THR A OG1   1 
ATOM   380  C  CG2   . THR A 1 50  ? -4.435  48.518 32.768 1.00 22.48 ? 50  THR A CG2   1 
ATOM   381  N  N     . VAL A 1 51  ? -4.188  51.047 35.162 1.00 20.35 ? 51  VAL A N     1 
ATOM   382  C  CA    . VAL A 1 51  ? -4.926  51.313 36.391 1.00 15.98 ? 51  VAL A CA    1 
ATOM   383  C  C     . VAL A 1 51  ? -6.358  50.854 36.211 1.00 16.34 ? 51  VAL A C     1 
ATOM   384  O  O     . VAL A 1 51  ? -7.080  51.363 35.344 1.00 16.47 ? 51  VAL A O     1 
ATOM   385  C  CB    . VAL A 1 51  ? -4.939  52.799 36.750 1.00 14.45 ? 51  VAL A CB    1 
ATOM   386  C  CG1   . VAL A 1 51  ? -5.769  53.025 37.997 1.00 12.60 ? 51  VAL A CG1   1 
ATOM   387  C  CG2   . VAL A 1 51  ? -3.521  53.297 36.946 1.00 16.72 ? 51  VAL A CG2   1 
ATOM   388  N  N     . LEU A 1 52  ? -6.754  49.894 37.039 1.00 14.43 ? 52  LEU A N     1 
ATOM   389  C  CA    . LEU A 1 52  ? -8.095  49.333 37.001 1.00 12.72 ? 52  LEU A CA    1 
ATOM   390  C  C     . LEU A 1 52  ? -8.880  49.802 38.211 1.00 15.78 ? 52  LEU A C     1 
ATOM   391  O  O     . LEU A 1 52  ? -8.296  50.217 39.229 1.00 18.90 ? 52  LEU A O     1 
ATOM   392  C  CB    . LEU A 1 52  ? -8.017  47.810 37.008 1.00 10.95 ? 52  LEU A CB    1 
ATOM   393  C  CG    . LEU A 1 52  ? -7.203  47.198 35.866 1.00 11.56 ? 52  LEU A CG    1 
ATOM   394  C  CD1   . LEU A 1 52  ? -7.035  45.710 36.107 1.00 12.07 ? 52  LEU A CD1   1 
ATOM   395  C  CD2   . LEU A 1 52  ? -7.880  47.474 34.508 1.00 10.45 ? 52  LEU A CD2   1 
ATOM   396  N  N     . HIS A 1 53  ? -10.201 49.752 38.105 1.00 14.22 ? 53  HIS A N     1 
ATOM   397  C  CA    . HIS A 1 53  ? -11.067 50.157 39.210 1.00 16.11 ? 53  HIS A CA    1 
ATOM   398  C  C     . HIS A 1 53  ? -12.158 49.114 39.346 1.00 16.18 ? 53  HIS A C     1 
ATOM   399  O  O     . HIS A 1 53  ? -12.119 48.277 40.255 1.00 16.57 ? 53  HIS A O     1 
ATOM   400  C  CB    . HIS A 1 53  ? -11.681 51.556 38.978 1.00 18.55 ? 53  HIS A CB    1 
ATOM   401  C  CG    . HIS A 1 53  ? -10.687 52.681 39.016 1.00 19.95 ? 53  HIS A CG    1 
ATOM   402  N  ND1   . HIS A 1 53  ? -10.160 53.177 40.193 1.00 24.24 ? 53  HIS A ND1   1 
ATOM   403  C  CD2   . HIS A 1 53  ? -10.104 53.394 38.023 1.00 19.99 ? 53  HIS A CD2   1 
ATOM   404  C  CE1   . HIS A 1 53  ? -9.298  54.137 39.923 1.00 19.23 ? 53  HIS A CE1   1 
ATOM   405  N  NE2   . HIS A 1 53  ? -9.245  54.291 38.611 1.00 22.53 ? 53  HIS A NE2   1 
ATOM   406  N  N     . LEU A 1 54  ? -13.097 49.127 38.406 1.00 12.84 ? 54  LEU A N     1 
ATOM   407  C  CA    . LEU A 1 54  ? -14.201 48.176 38.422 1.00 14.37 ? 54  LEU A CA    1 
ATOM   408  C  C     . LEU A 1 54  ? -13.893 46.878 37.681 1.00 14.89 ? 54  LEU A C     1 
ATOM   409  O  O     . LEU A 1 54  ? -14.506 45.846 37.974 1.00 14.73 ? 54  LEU A O     1 
ATOM   410  C  CB    . LEU A 1 54  ? -15.477 48.830 37.867 1.00 15.25 ? 54  LEU A CB    1 
ATOM   411  C  CG    . LEU A 1 54  ? -16.732 47.990 37.584 1.00 13.31 ? 54  LEU A CG    1 
ATOM   412  C  CD1   . LEU A 1 54  ? -17.276 47.377 38.857 1.00 5.47  ? 54  LEU A CD1   1 
ATOM   413  C  CD2   . LEU A 1 54  ? -17.774 48.867 36.905 1.00 5.02  ? 54  LEU A CD2   1 
ATOM   414  N  N     . ILE A 1 55  ? -12.931 46.913 36.751 1.00 16.32 ? 55  ILE A N     1 
ATOM   415  C  CA    . ILE A 1 55  ? -12.567 45.721 35.975 1.00 13.89 ? 55  ILE A CA    1 
ATOM   416  C  C     . ILE A 1 55  ? -11.547 44.842 36.695 1.00 11.06 ? 55  ILE A C     1 
ATOM   417  O  O     . ILE A 1 55  ? -10.496 45.325 37.122 1.00 10.90 ? 55  ILE A O     1 
ATOM   418  C  CB    . ILE A 1 55  ? -12.072 46.104 34.571 1.00 16.73 ? 55  ILE A CB    1 
ATOM   419  C  CG1   . ILE A 1 55  ? -13.207 46.751 33.787 1.00 14.85 ? 55  ILE A CG1   1 
ATOM   420  C  CG2   . ILE A 1 55  ? -11.595 44.872 33.813 1.00 12.46 ? 55  ILE A CG2   1 
ATOM   421  C  CD1   . ILE A 1 55  ? -12.800 47.162 32.374 1.00 22.99 ? 55  ILE A CD1   1 
ATOM   422  N  N     . PRO A 1 56  ? -11.839 43.530 36.818 1.00 9.76  ? 56  PRO A N     1 
ATOM   423  C  CA    . PRO A 1 56  ? -10.979 42.550 37.486 1.00 11.01 ? 56  PRO A CA    1 
ATOM   424  C  C     . PRO A 1 56  ? -9.548  42.550 36.964 1.00 18.04 ? 56  PRO A C     1 
ATOM   425  O  O     . PRO A 1 56  ? -9.305  42.682 35.759 1.00 21.58 ? 56  PRO A O     1 
ATOM   426  C  CB    . PRO A 1 56  ? -11.682 41.227 37.208 1.00 5.85  ? 56  PRO A CB    1 
ATOM   427  C  CG    . PRO A 1 56  ? -13.092 41.601 37.042 1.00 5.01  ? 56  PRO A CG    1 
ATOM   428  C  CD    . PRO A 1 56  ? -13.007 42.859 36.229 1.00 7.63  ? 56  PRO A CD    1 
ATOM   429  N  N     . SER A 1 57  ? -8.605  42.318 37.869 1.00 19.22 ? 57  SER A N     1 
ATOM   430  C  CA    . SER A 1 57  ? -7.207  42.348 37.514 1.00 18.79 ? 57  SER A CA    1 
ATOM   431  C  C     . SER A 1 57  ? -6.619  41.201 36.710 1.00 19.76 ? 57  SER A C     1 
ATOM   432  O  O     . SER A 1 57  ? -5.465  40.826 36.903 1.00 18.90 ? 57  SER A O     1 
ATOM   433  C  CB    . SER A 1 57  ? -6.380  42.656 38.745 1.00 9.65  ? 57  SER A CB    1 
ATOM   434  O  OG    . SER A 1 57  ? -6.731  43.943 39.180 1.00 6.38  ? 57  SER A OG    1 
ATOM   435  N  N     . GLY A 1 58  ? -7.400  40.692 35.770 1.00 20.69 ? 58  GLY A N     1 
ATOM   436  C  CA    . GLY A 1 58  ? -6.934  39.621 34.905 1.00 24.09 ? 58  GLY A CA    1 
ATOM   437  C  C     . GLY A 1 58  ? -7.372  39.932 33.482 1.00 23.89 ? 58  GLY A C     1 
ATOM   438  O  O     . GLY A 1 58  ? -7.188  39.131 32.564 1.00 21.68 ? 58  GLY A O     1 
ATOM   439  N  N     . ILE A 1 59  ? -7.916  41.135 33.303 1.00 22.16 ? 59  ILE A N     1 
ATOM   440  C  CA    . ILE A 1 59  ? -8.430  41.597 32.023 1.00 17.20 ? 59  ILE A CA    1 
ATOM   441  C  C     . ILE A 1 59  ? -7.372  41.691 30.918 1.00 16.04 ? 59  ILE A C     1 
ATOM   442  O  O     . ILE A 1 59  ? -7.698  41.865 29.755 1.00 15.27 ? 59  ILE A O     1 
ATOM   443  C  CB    . ILE A 1 59  ? -9.110  42.954 32.207 1.00 9.74  ? 59  ILE A CB    1 
ATOM   444  C  CG1   . ILE A 1 59  ? -9.991  43.277 31.009 1.00 9.63  ? 59  ILE A CG1   1 
ATOM   445  C  CG2   . ILE A 1 59  ? -8.066  44.026 32.438 1.00 12.18 ? 59  ILE A CG2   1 
ATOM   446  C  CD1   . ILE A 1 59  ? -11.087 42.246 30.748 1.00 5.01  ? 59  ILE A CD1   1 
ATOM   447  N  N     . LEU A 1 60  ? -6.111  41.533 31.289 1.00 17.67 ? 60  LEU A N     1 
ATOM   448  C  CA    . LEU A 1 60  ? -4.983  41.627 30.359 1.00 16.87 ? 60  LEU A CA    1 
ATOM   449  C  C     . LEU A 1 60  ? -4.570  40.280 29.787 1.00 13.37 ? 60  LEU A C     1 
ATOM   450  O  O     . LEU A 1 60  ? -3.599  40.193 29.050 1.00 15.37 ? 60  LEU A O     1 
ATOM   451  C  CB    . LEU A 1 60  ? -3.775  42.215 31.107 1.00 14.23 ? 60  LEU A CB    1 
ATOM   452  C  CG    . LEU A 1 60  ? -3.439  43.708 31.106 1.00 19.05 ? 60  LEU A CG    1 
ATOM   453  C  CD1   . LEU A 1 60  ? -4.659  44.580 30.962 1.00 10.27 ? 60  LEU A CD1   1 
ATOM   454  C  CD2   . LEU A 1 60  ? -2.641  44.047 32.364 1.00 18.30 ? 60  LEU A CD2   1 
ATOM   455  N  N     . ARG A 1 61  ? -5.271  39.225 30.166 1.00 12.91 ? 61  ARG A N     1 
ATOM   456  C  CA    . ARG A 1 61  ? -4.921  37.893 29.722 1.00 10.49 ? 61  ARG A CA    1 
ATOM   457  C  C     . ARG A 1 61  ? -6.115  37.331 29.006 1.00 15.93 ? 61  ARG A C     1 
ATOM   458  O  O     . ARG A 1 61  ? -7.199  37.197 29.584 1.00 17.07 ? 61  ARG A O     1 
ATOM   459  C  CB    . ARG A 1 61  ? -4.540  37.045 30.931 1.00 13.50 ? 61  ARG A CB    1 
ATOM   460  C  CG    . ARG A 1 61  ? -3.604  37.805 31.912 1.00 16.78 ? 61  ARG A CG    1 
ATOM   461  C  CD    . ARG A 1 61  ? -3.317  37.038 33.189 1.00 15.91 ? 61  ARG A CD    1 
ATOM   462  N  NE    . ARG A 1 61  ? -2.165  36.159 33.071 1.00 16.12 ? 61  ARG A NE    1 
ATOM   463  C  CZ    . ARG A 1 61  ? -0.929  36.639 33.196 1.00 23.17 ? 61  ARG A CZ    1 
ATOM   464  N  NH1   . ARG A 1 61  ? -0.740  37.929 33.430 1.00 32.16 ? 61  ARG A NH1   1 
ATOM   465  N  NH2   . ARG A 1 61  ? 0.120   35.834 33.092 1.00 19.94 ? 61  ARG A NH2   1 
ATOM   466  N  N     . GLU A 1 62  ? -5.916  37.024 27.723 1.00 21.65 ? 62  GLU A N     1 
ATOM   467  C  CA    . GLU A 1 62  ? -6.977  36.511 26.867 1.00 19.42 ? 62  GLU A CA    1 
ATOM   468  C  C     . GLU A 1 62  ? -7.401  35.116 27.235 1.00 16.79 ? 62  GLU A C     1 
ATOM   469  O  O     . GLU A 1 62  ? -8.484  34.675 26.869 1.00 16.53 ? 62  GLU A O     1 
ATOM   470  C  CB    . GLU A 1 62  ? -6.561  36.591 25.397 1.00 26.71 ? 62  GLU A CB    1 
ATOM   471  C  CG    . GLU A 1 62  ? -5.409  35.707 25.011 1.00 28.86 ? 62  GLU A CG    1 
ATOM   472  C  CD    . GLU A 1 62  ? -5.823  34.261 24.866 1.00 36.89 ? 62  GLU A CD    1 
ATOM   473  O  OE1   . GLU A 1 62  ? -6.897  33.997 24.278 1.00 35.31 ? 62  GLU A OE1   1 
ATOM   474  O  OE2   . GLU A 1 62  ? -5.083  33.391 25.372 1.00 43.27 ? 62  GLU A OE2   1 
ATOM   475  N  N     . ASN A 1 63  ? -6.531  34.417 27.955 1.00 21.21 ? 63  ASN A N     1 
ATOM   476  C  CA    . ASN A 1 63  ? -6.815  33.051 28.388 1.00 19.66 ? 63  ASN A CA    1 
ATOM   477  C  C     . ASN A 1 63  ? -7.670  33.028 29.643 1.00 19.75 ? 63  ASN A C     1 
ATOM   478  O  O     . ASN A 1 63  ? -8.016  31.948 30.135 1.00 22.02 ? 63  ASN A O     1 
ATOM   479  C  CB    . ASN A 1 63  ? -5.512  32.283 28.643 1.00 23.15 ? 63  ASN A CB    1 
ATOM   480  C  CG    . ASN A 1 63  ? -4.770  32.773 29.873 1.00 24.81 ? 63  ASN A CG    1 
ATOM   481  O  OD1   . ASN A 1 63  ? -4.778  32.120 30.903 1.00 31.98 ? 63  ASN A OD1   1 
ATOM   482  N  ND2   . ASN A 1 63  ? -4.088  33.904 29.752 1.00 27.00 ? 63  ASN A ND2   1 
ATOM   483  N  N     . VAL A 1 64  ? -8.018  34.212 30.147 1.00 16.93 ? 64  VAL A N     1 
ATOM   484  C  CA    . VAL A 1 64  ? -8.813  34.334 31.364 1.00 15.45 ? 64  VAL A CA    1 
ATOM   485  C  C     . VAL A 1 64  ? -10.086 35.139 31.125 1.00 13.14 ? 64  VAL A C     1 
ATOM   486  O  O     . VAL A 1 64  ? -10.045 36.178 30.454 1.00 9.60  ? 64  VAL A O     1 
ATOM   487  C  CB    . VAL A 1 64  ? -7.991  35.044 32.494 1.00 16.45 ? 64  VAL A CB    1 
ATOM   488  C  CG1   . VAL A 1 64  ? -8.878  35.372 33.666 1.00 13.53 ? 64  VAL A CG1   1 
ATOM   489  C  CG2   . VAL A 1 64  ? -6.835  34.174 32.956 1.00 12.98 ? 64  VAL A CG2   1 
ATOM   490  N  N     . THR A 1 65  ? -11.210 34.634 31.634 1.00 8.45  ? 65  THR A N     1 
ATOM   491  C  CA    . THR A 1 65  ? -12.497 35.332 31.536 1.00 12.46 ? 65  THR A CA    1 
ATOM   492  C  C     . THR A 1 65  ? -12.656 36.132 32.834 1.00 14.01 ? 65  THR A C     1 
ATOM   493  O  O     . THR A 1 65  ? -12.695 35.545 33.915 1.00 15.69 ? 65  THR A O     1 
ATOM   494  C  CB    . THR A 1 65  ? -13.701 34.362 31.475 1.00 9.39  ? 65  THR A CB    1 
ATOM   495  O  OG1   . THR A 1 65  ? -13.460 33.351 30.502 1.00 13.19 ? 65  THR A OG1   1 
ATOM   496  C  CG2   . THR A 1 65  ? -14.976 35.112 31.092 1.00 6.42  ? 65  THR A CG2   1 
ATOM   497  N  N     . SER A 1 66  ? -12.729 37.454 32.735 1.00 16.07 ? 66  SER A N     1 
ATOM   498  C  CA    . SER A 1 66  ? -12.896 38.305 33.910 1.00 16.60 ? 66  SER A CA    1 
ATOM   499  C  C     . SER A 1 66  ? -14.392 38.383 34.202 1.00 18.90 ? 66  SER A C     1 
ATOM   500  O  O     . SER A 1 66  ? -15.199 38.427 33.264 1.00 15.86 ? 66  SER A O     1 
ATOM   501  C  CB    . SER A 1 66  ? -12.326 39.691 33.642 1.00 13.61 ? 66  SER A CB    1 
ATOM   502  O  OG    . SER A 1 66  ? -10.940 39.603 33.353 1.00 18.73 ? 66  SER A OG    1 
ATOM   503  N  N     . ILE A 1 67  ? -14.772 38.376 35.481 1.00 17.13 ? 67  ILE A N     1 
ATOM   504  C  CA    . ILE A 1 67  ? -16.194 38.423 35.833 1.00 19.59 ? 67  ILE A CA    1 
ATOM   505  C  C     . ILE A 1 67  ? -16.506 39.328 37.012 1.00 20.26 ? 67  ILE A C     1 
ATOM   506  O  O     . ILE A 1 67  ? -15.791 39.287 38.019 1.00 22.36 ? 67  ILE A O     1 
ATOM   507  C  CB    . ILE A 1 67  ? -16.694 37.014 36.250 1.00 23.32 ? 67  ILE A CB    1 
ATOM   508  C  CG1   . ILE A 1 67  ? -16.372 35.984 35.163 1.00 22.38 ? 67  ILE A CG1   1 
ATOM   509  C  CG2   . ILE A 1 67  ? -18.191 37.055 36.609 1.00 19.96 ? 67  ILE A CG2   1 
ATOM   510  C  CD1   . ILE A 1 67  ? -16.786 34.576 35.525 1.00 27.61 ? 67  ILE A CD1   1 
ATOM   511  N  N     . ILE A 1 68  ? -17.526 40.179 36.892 1.00 17.83 ? 68  ILE A N     1 
ATOM   512  C  CA    . ILE A 1 68  ? -17.928 40.992 38.048 1.00 17.46 ? 68  ILE A CA    1 
ATOM   513  C  C     . ILE A 1 68  ? -19.236 40.367 38.545 1.00 14.80 ? 68  ILE A C     1 
ATOM   514  O  O     . ILE A 1 68  ? -20.272 40.394 37.850 1.00 9.72  ? 68  ILE A O     1 
ATOM   515  C  CB    . ILE A 1 68  ? -18.042 42.547 37.796 1.00 22.34 ? 68  ILE A CB    1 
ATOM   516  C  CG1   . ILE A 1 68  ? -19.494 43.009 37.891 1.00 20.08 ? 68  ILE A CG1   1 
ATOM   517  C  CG2   . ILE A 1 68  ? -17.331 42.984 36.485 1.00 22.63 ? 68  ILE A CG2   1 
ATOM   518  C  CD1   . ILE A 1 68  ? -19.641 44.424 38.331 1.00 26.89 ? 68  ILE A CD1   1 
ATOM   519  N  N     . GLY A 1 69  ? -19.129 39.688 39.690 1.00 11.70 ? 69  GLY A N     1 
ATOM   520  C  CA    . GLY A 1 69  ? -20.258 38.990 40.277 1.00 5.01  ? 69  GLY A CA    1 
ATOM   521  C  C     . GLY A 1 69  ? -21.257 39.929 40.909 1.00 6.00  ? 69  GLY A C     1 
ATOM   522  O  O     . GLY A 1 69  ? -20.965 41.101 41.153 1.00 5.01  ? 69  GLY A O     1 
ATOM   523  N  N     . ASN A 1 70  ? -22.425 39.382 41.216 1.00 5.01  ? 70  ASN A N     1 
ATOM   524  C  CA    . ASN A 1 70  ? -23.529 40.101 41.834 1.00 5.01  ? 70  ASN A CA    1 
ATOM   525  C  C     . ASN A 1 70  ? -23.210 41.003 43.032 1.00 5.02  ? 70  ASN A C     1 
ATOM   526  O  O     . ASN A 1 70  ? -23.932 41.956 43.297 1.00 7.86  ? 70  ASN A O     1 
ATOM   527  C  CB    . ASN A 1 70  ? -24.604 39.092 42.244 1.00 10.72 ? 70  ASN A CB    1 
ATOM   528  C  CG    . ASN A 1 70  ? -24.193 38.244 43.450 1.00 12.24 ? 70  ASN A CG    1 
ATOM   529  O  OD1   . ASN A 1 70  ? -23.456 37.267 43.322 1.00 14.70 ? 70  ASN A OD1   1 
ATOM   530  N  ND2   . ASN A 1 70  ? -24.675 38.616 44.621 1.00 12.64 ? 70  ASN A ND2   1 
ATOM   531  N  N     . GLY A 1 71  ? -22.146 40.716 43.763 1.00 9.37  ? 71  GLY A N     1 
ATOM   532  C  CA    . GLY A 1 71  ? -21.828 41.537 44.919 1.00 15.47 ? 71  GLY A CA    1 
ATOM   533  C  C     . GLY A 1 71  ? -21.358 42.951 44.615 1.00 19.27 ? 71  GLY A C     1 
ATOM   534  O  O     . GLY A 1 71  ? -21.516 43.872 45.443 1.00 21.34 ? 71  GLY A O     1 
ATOM   535  N  N     . VAL A 1 72  ? -20.814 43.139 43.415 1.00 17.69 ? 72  VAL A N     1 
ATOM   536  C  CA    . VAL A 1 72  ? -20.271 44.423 42.987 1.00 9.28  ? 72  VAL A CA    1 
ATOM   537  C  C     . VAL A 1 72  ? -21.335 45.436 42.619 1.00 8.03  ? 72  VAL A C     1 
ATOM   538  O  O     . VAL A 1 72  ? -22.345 45.074 42.016 1.00 12.57 ? 72  VAL A O     1 
ATOM   539  C  CB    . VAL A 1 72  ? -19.326 44.184 41.791 1.00 8.90  ? 72  VAL A CB    1 
ATOM   540  C  CG1   . VAL A 1 72  ? -18.687 45.489 41.299 1.00 5.01  ? 72  VAL A CG1   1 
ATOM   541  C  CG2   . VAL A 1 72  ? -18.248 43.187 42.196 1.00 5.01  ? 72  VAL A CG2   1 
ATOM   542  N  N     . VAL A 1 73  ? -21.179 46.681 43.063 1.00 6.18  ? 73  VAL A N     1 
ATOM   543  C  CA    . VAL A 1 73  ? -22.146 47.712 42.680 1.00 9.86  ? 73  VAL A CA    1 
ATOM   544  C  C     . VAL A 1 73  ? -21.601 48.363 41.379 1.00 12.77 ? 73  VAL A C     1 
ATOM   545  O  O     . VAL A 1 73  ? -20.602 49.092 41.389 1.00 12.69 ? 73  VAL A O     1 
ATOM   546  C  CB    . VAL A 1 73  ? -22.420 48.728 43.828 1.00 12.38 ? 73  VAL A CB    1 
ATOM   547  C  CG1   . VAL A 1 73  ? -23.167 48.021 44.979 1.00 11.48 ? 73  VAL A CG1   1 
ATOM   548  C  CG2   . VAL A 1 73  ? -21.139 49.355 44.344 1.00 9.90  ? 73  VAL A CG2   1 
ATOM   549  N  N     . LEU A 1 74  ? -22.260 48.080 40.258 1.00 12.40 ? 74  LEU A N     1 
ATOM   550  C  CA    . LEU A 1 74  ? -21.800 48.522 38.945 1.00 15.28 ? 74  LEU A CA    1 
ATOM   551  C  C     . LEU A 1 74  ? -22.189 49.896 38.395 1.00 15.16 ? 74  LEU A C     1 
ATOM   552  O  O     . LEU A 1 74  ? -23.373 50.237 38.288 1.00 15.70 ? 74  LEU A O     1 
ATOM   553  C  CB    . LEU A 1 74  ? -22.104 47.400 37.933 1.00 17.39 ? 74  LEU A CB    1 
ATOM   554  C  CG    . LEU A 1 74  ? -22.042 47.535 36.401 1.00 20.42 ? 74  LEU A CG    1 
ATOM   555  C  CD1   . LEU A 1 74  ? -20.886 48.364 35.971 1.00 16.28 ? 74  LEU A CD1   1 
ATOM   556  C  CD2   . LEU A 1 74  ? -21.983 46.139 35.758 1.00 18.74 ? 74  LEU A CD2   1 
ATOM   557  N  N     . SER A 1 75  ? -21.174 50.683 38.044 1.00 17.69 ? 75  SER A N     1 
ATOM   558  C  CA    . SER A 1 75  ? -21.385 52.014 37.461 1.00 19.60 ? 75  SER A CA    1 
ATOM   559  C  C     . SER A 1 75  ? -21.220 51.926 35.954 1.00 18.83 ? 75  SER A C     1 
ATOM   560  O  O     . SER A 1 75  ? -20.111 51.710 35.466 1.00 22.70 ? 75  SER A O     1 
ATOM   561  C  CB    . SER A 1 75  ? -20.367 53.020 37.975 1.00 17.20 ? 75  SER A CB    1 
ATOM   562  O  OG    . SER A 1 75  ? -20.508 54.263 37.291 1.00 19.03 ? 75  SER A OG    1 
ATOM   563  N  N     . PRO A 1 76  ? -22.306 52.137 35.196 1.00 19.50 ? 76  PRO A N     1 
ATOM   564  C  CA    . PRO A 1 76  ? -22.264 52.073 33.729 1.00 18.75 ? 76  PRO A CA    1 
ATOM   565  C  C     . PRO A 1 76  ? -21.229 53.034 33.120 1.00 18.11 ? 76  PRO A C     1 
ATOM   566  O  O     . PRO A 1 76  ? -20.474 52.656 32.226 1.00 13.50 ? 76  PRO A O     1 
ATOM   567  C  CB    . PRO A 1 76  ? -23.701 52.433 33.341 1.00 23.17 ? 76  PRO A CB    1 
ATOM   568  C  CG    . PRO A 1 76  ? -24.515 51.919 34.540 1.00 16.14 ? 76  PRO A CG    1 
ATOM   569  C  CD    . PRO A 1 76  ? -23.673 52.435 35.668 1.00 18.61 ? 76  PRO A CD    1 
ATOM   570  N  N     . ALA A 1 77  ? -21.156 54.250 33.647 1.00 13.36 ? 77  ALA A N     1 
ATOM   571  C  CA    . ALA A 1 77  ? -20.198 55.232 33.162 1.00 16.93 ? 77  ALA A CA    1 
ATOM   572  C  C     . ALA A 1 77  ? -18.795 54.714 33.398 1.00 20.69 ? 77  ALA A C     1 
ATOM   573  O  O     . ALA A 1 77  ? -17.971 54.665 32.480 1.00 24.70 ? 77  ALA A O     1 
ATOM   574  C  CB    . ALA A 1 77  ? -20.383 56.546 33.891 1.00 18.63 ? 77  ALA A CB    1 
ATOM   575  N  N     . ALA A 1 78  ? -18.529 54.318 34.640 1.00 22.34 ? 78  ALA A N     1 
ATOM   576  C  CA    . ALA A 1 78  ? -17.231 53.780 35.029 1.00 21.26 ? 78  ALA A CA    1 
ATOM   577  C  C     . ALA A 1 78  ? -16.839 52.633 34.108 1.00 19.10 ? 78  ALA A C     1 
ATOM   578  O  O     . ALA A 1 78  ? -15.745 52.628 33.549 1.00 24.68 ? 78  ALA A O     1 
ATOM   579  C  CB    . ALA A 1 78  ? -17.271 53.302 36.483 1.00 21.27 ? 78  ALA A CB    1 
ATOM   580  N  N     . LEU A 1 79  ? -17.729 51.665 33.946 1.00 14.78 ? 79  LEU A N     1 
ATOM   581  C  CA    . LEU A 1 79  ? -17.454 50.526 33.076 1.00 17.69 ? 79  LEU A CA    1 
ATOM   582  C  C     . LEU A 1 79  ? -17.068 51.004 31.663 1.00 22.13 ? 79  LEU A C     1 
ATOM   583  O  O     . LEU A 1 79  ? -16.025 50.609 31.124 1.00 21.91 ? 79  LEU A O     1 
ATOM   584  C  CB    . LEU A 1 79  ? -18.677 49.617 32.999 1.00 11.01 ? 79  LEU A CB    1 
ATOM   585  C  CG    . LEU A 1 79  ? -18.427 48.320 32.244 1.00 15.45 ? 79  LEU A CG    1 
ATOM   586  C  CD1   . LEU A 1 79  ? -17.286 47.549 32.904 1.00 8.52  ? 79  LEU A CD1   1 
ATOM   587  C  CD2   . LEU A 1 79  ? -19.700 47.494 32.208 1.00 12.71 ? 79  LEU A CD2   1 
ATOM   588  N  N     . MET A 1 80  ? -17.895 51.878 31.084 1.00 21.95 ? 80  MET A N     1 
ATOM   589  C  CA    . MET A 1 80  ? -17.647 52.417 29.755 1.00 18.44 ? 80  MET A CA    1 
ATOM   590  C  C     . MET A 1 80  ? -16.314 53.127 29.666 1.00 21.68 ? 80  MET A C     1 
ATOM   591  O  O     . MET A 1 80  ? -15.588 52.948 28.686 1.00 25.78 ? 80  MET A O     1 
ATOM   592  C  CB    . MET A 1 80  ? -18.759 53.363 29.330 1.00 19.93 ? 80  MET A CB    1 
ATOM   593  C  CG    . MET A 1 80  ? -20.103 52.684 29.118 1.00 21.69 ? 80  MET A CG    1 
ATOM   594  S  SD    . MET A 1 80  ? -19.981 51.134 28.203 1.00 34.04 ? 80  MET A SD    1 
ATOM   595  C  CE    . MET A 1 80  ? -20.609 49.961 29.395 1.00 24.78 ? 80  MET A CE    1 
ATOM   596  N  N     . LYS A 1 81  ? -15.981 53.926 30.677 1.00 21.00 ? 81  LYS A N     1 
ATOM   597  C  CA    . LYS A 1 81  ? -14.696 54.635 30.694 1.00 17.85 ? 81  LYS A CA    1 
ATOM   598  C  C     . LYS A 1 81  ? -13.511 53.674 30.732 1.00 19.44 ? 81  LYS A C     1 
ATOM   599  O  O     . LYS A 1 81  ? -12.465 53.950 30.162 1.00 20.10 ? 81  LYS A O     1 
ATOM   600  C  CB    . LYS A 1 81  ? -14.621 55.575 31.889 1.00 18.96 ? 81  LYS A CB    1 
ATOM   601  C  CG    . LYS A 1 81  ? -13.358 56.411 31.954 1.00 18.55 ? 81  LYS A CG    1 
ATOM   602  C  CD    . LYS A 1 81  ? -13.360 57.294 33.184 1.00 18.10 ? 81  LYS A CD    1 
ATOM   603  C  CE    . LYS A 1 81  ? -12.119 58.183 33.254 1.00 24.45 ? 81  LYS A CE    1 
ATOM   604  N  NZ    . LYS A 1 81  ? -10.854 57.386 33.195 1.00 27.07 ? 81  LYS A NZ    1 
ATOM   605  N  N     . GLU A 1 82  ? -13.665 52.547 31.415 1.00 26.47 ? 82  GLU A N     1 
ATOM   606  C  CA    . GLU A 1 82  ? -12.588 51.566 31.498 1.00 27.53 ? 82  GLU A CA    1 
ATOM   607  C  C     . GLU A 1 82  ? -12.479 50.711 30.239 1.00 26.69 ? 82  GLU A C     1 
ATOM   608  O  O     . GLU A 1 82  ? -11.384 50.503 29.724 1.00 28.35 ? 82  GLU A O     1 
ATOM   609  C  CB    . GLU A 1 82  ? -12.745 50.697 32.741 1.00 26.45 ? 82  GLU A CB    1 
ATOM   610  C  CG    . GLU A 1 82  ? -11.689 50.971 33.796 1.00 28.99 ? 82  GLU A CG    1 
ATOM   611  C  CD    . GLU A 1 82  ? -12.042 50.380 35.147 1.00 29.88 ? 82  GLU A CD    1 
ATOM   612  O  OE1   . GLU A 1 82  ? -12.824 51.023 35.884 1.00 30.49 ? 82  GLU A OE1   1 
ATOM   613  O  OE2   . GLU A 1 82  ? -11.547 49.280 35.477 1.00 29.17 ? 82  GLU A OE2   1 
ATOM   614  N  N     . MET A 1 83  ? -13.607 50.226 29.732 1.00 27.24 ? 83  MET A N     1 
ATOM   615  C  CA    . MET A 1 83  ? -13.588 49.425 28.509 1.00 28.41 ? 83  MET A CA    1 
ATOM   616  C  C     . MET A 1 83  ? -12.888 50.194 27.399 1.00 28.06 ? 83  MET A C     1 
ATOM   617  O  O     . MET A 1 83  ? -11.941 49.689 26.805 1.00 28.51 ? 83  MET A O     1 
ATOM   618  C  CB    . MET A 1 83  ? -15.002 49.047 28.078 1.00 31.25 ? 83  MET A CB    1 
ATOM   619  C  CG    . MET A 1 83  ? -15.684 48.121 29.074 1.00 39.57 ? 83  MET A CG    1 
ATOM   620  S  SD    . MET A 1 83  ? -17.382 47.711 28.685 1.00 37.91 ? 83  MET A SD    1 
ATOM   621  C  CE    . MET A 1 83  ? -17.142 46.219 27.733 1.00 40.16 ? 83  MET A CE    1 
ATOM   622  N  N     . LYS A 1 84  ? -13.272 51.455 27.204 1.00 27.18 ? 84  LYS A N     1 
ATOM   623  C  CA    . LYS A 1 84  ? -12.656 52.271 26.170 1.00 27.55 ? 84  LYS A CA    1 
ATOM   624  C  C     . LYS A 1 84  ? -11.158 52.476 26.362 1.00 27.71 ? 84  LYS A C     1 
ATOM   625  O  O     . LYS A 1 84  ? -10.387 52.299 25.411 1.00 31.15 ? 84  LYS A O     1 
ATOM   626  C  CB    . LYS A 1 84  ? -13.371 53.610 26.002 1.00 29.52 ? 84  LYS A CB    1 
ATOM   627  C  CG    . LYS A 1 84  ? -12.752 54.514 24.930 1.00 38.09 ? 84  LYS A CG    1 
ATOM   628  C  CD    . LYS A 1 84  ? -13.143 54.155 23.483 1.00 46.29 ? 84  LYS A CD    1 
ATOM   629  C  CE    . LYS A 1 84  ? -12.840 52.698 23.113 1.00 53.04 ? 84  LYS A CE    1 
ATOM   630  N  NZ    . LYS A 1 84  ? -12.495 52.480 21.680 1.00 54.69 ? 84  LYS A NZ    1 
ATOM   631  N  N     . GLU A 1 85  ? -10.733 52.797 27.582 1.00 25.94 ? 85  GLU A N     1 
ATOM   632  C  CA    . GLU A 1 85  ? -9.313  53.008 27.858 1.00 21.65 ? 85  GLU A CA    1 
ATOM   633  C  C     . GLU A 1 85  ? -8.486  51.796 27.471 1.00 24.19 ? 85  GLU A C     1 
ATOM   634  O  O     . GLU A 1 85  ? -7.400  51.930 26.910 1.00 22.68 ? 85  GLU A O     1 
ATOM   635  C  CB    . GLU A 1 85  ? -9.083  53.283 29.342 1.00 27.21 ? 85  GLU A CB    1 
ATOM   636  C  CG    . GLU A 1 85  ? -9.644  54.599 29.866 1.00 32.21 ? 85  GLU A CG    1 
ATOM   637  C  CD    . GLU A 1 85  ? -9.466  54.752 31.370 1.00 30.51 ? 85  GLU A CD    1 
ATOM   638  O  OE1   . GLU A 1 85  ? -9.702  53.773 32.105 1.00 28.14 ? 85  GLU A OE1   1 
ATOM   639  O  OE2   . GLU A 1 85  ? -9.093  55.854 31.818 1.00 34.51 ? 85  GLU A OE2   1 
ATOM   640  N  N     . LEU A 1 86  ? -8.985  50.609 27.806 1.00 25.77 ? 86  LEU A N     1 
ATOM   641  C  CA    . LEU A 1 86  ? -8.275  49.361 27.504 1.00 27.37 ? 86  LEU A CA    1 
ATOM   642  C  C     . LEU A 1 86  ? -8.327  48.996 26.023 1.00 26.49 ? 86  LEU A C     1 
ATOM   643  O  O     . LEU A 1 86  ? -7.335  48.520 25.458 1.00 26.57 ? 86  LEU A O     1 
ATOM   644  C  CB    . LEU A 1 86  ? -8.833  48.206 28.346 1.00 26.74 ? 86  LEU A CB    1 
ATOM   645  C  CG    . LEU A 1 86  ? -8.907  48.466 29.854 1.00 25.11 ? 86  LEU A CG    1 
ATOM   646  C  CD1   . LEU A 1 86  ? -9.434  47.233 30.574 1.00 20.93 ? 86  LEU A CD1   1 
ATOM   647  C  CD2   . LEU A 1 86  ? -7.533  48.877 30.383 1.00 24.36 ? 86  LEU A CD2   1 
ATOM   648  N  N     . GLU A 1 87  ? -9.502  49.175 25.421 1.00 26.59 ? 87  GLU A N     1 
ATOM   649  C  CA    . GLU A 1 87  ? -9.721  48.891 24.005 1.00 22.80 ? 87  GLU A CA    1 
ATOM   650  C  C     . GLU A 1 87  ? -8.771  49.718 23.142 1.00 17.25 ? 87  GLU A C     1 
ATOM   651  O  O     . GLU A 1 87  ? -8.094  49.166 22.286 1.00 16.92 ? 87  GLU A O     1 
ATOM   652  C  CB    . GLU A 1 87  ? -11.192 49.101 23.653 1.00 20.88 ? 87  GLU A CB    1 
ATOM   653  C  CG    . GLU A 1 87  ? -12.080 48.109 24.405 1.00 20.05 ? 87  GLU A CG    1 
ATOM   654  C  CD    . GLU A 1 87  ? -13.564 48.315 24.199 1.00 19.63 ? 87  GLU A CD    1 
ATOM   655  O  OE1   . GLU A 1 87  ? -13.984 49.441 23.860 1.00 20.82 ? 87  GLU A OE1   1 
ATOM   656  O  OE2   . GLU A 1 87  ? -14.317 47.334 24.390 1.00 24.29 ? 87  GLU A OE2   1 
ATOM   657  N  N     . ASP A 1 88  ? -8.620  51.003 23.443 1.00 13.19 ? 88  ASP A N     1 
ATOM   658  C  CA    . ASP A 1 88  ? -7.671  51.833 22.706 1.00 14.06 ? 88  ASP A CA    1 
ATOM   659  C  C     . ASP A 1 88  ? -6.248  51.334 22.948 1.00 15.37 ? 88  ASP A C     1 
ATOM   660  O  O     . ASP A 1 88  ? -5.282  51.876 22.395 1.00 17.17 ? 88  ASP A O     1 
ATOM   661  C  CB    . ASP A 1 88  ? -7.732  53.282 23.174 1.00 14.53 ? 88  ASP A CB    1 
ATOM   662  C  CG    . ASP A 1 88  ? -9.082  53.916 22.942 1.00 21.77 ? 88  ASP A CG    1 
ATOM   663  O  OD1   . ASP A 1 88  ? -9.919  53.308 22.226 1.00 22.16 ? 88  ASP A OD1   1 
ATOM   664  O  OD2   . ASP A 1 88  ? -9.302  55.028 23.485 1.00 23.16 ? 88  ASP A OD2   1 
ATOM   665  N  N     . ARG A 1 89  ? -6.108  50.315 23.790 1.00 15.97 ? 89  ARG A N     1 
ATOM   666  C  CA    . ARG A 1 89  ? -4.800  49.772 24.106 1.00 13.73 ? 89  ARG A CA    1 
ATOM   667  C  C     . ARG A 1 89  ? -4.600  48.358 23.623 1.00 12.43 ? 89  ARG A C     1 
ATOM   668  O  O     . ARG A 1 89  ? -3.564  47.756 23.906 1.00 14.86 ? 89  ARG A O     1 
ATOM   669  C  CB    . ARG A 1 89  ? -4.542  49.853 25.610 1.00 14.73 ? 89  ARG A CB    1 
ATOM   670  C  CG    . ARG A 1 89  ? -4.431  51.283 26.123 1.00 16.97 ? 89  ARG A CG    1 
ATOM   671  C  CD    . ARG A 1 89  ? -4.113  51.343 27.594 1.00 16.82 ? 89  ARG A CD    1 
ATOM   672  N  NE    . ARG A 1 89  ? -2.786  50.813 27.891 1.00 18.29 ? 89  ARG A NE    1 
ATOM   673  C  CZ    . ARG A 1 89  ? -2.579  50.100 28.993 1.00 19.12 ? 89  ARG A CZ    1 
ATOM   674  N  NH1   . ARG A 1 89  ? -3.576  49.862 29.832 1.00 20.04 ? 89  ARG A NH1   1 
ATOM   675  N  NH2   . ARG A 1 89  ? -1.375  49.616 29.260 1.00 11.83 ? 89  ARG A NH2   1 
ATOM   676  N  N     . GLY A 1 90  ? -5.575  47.825 22.893 1.00 9.87  ? 90  GLY A N     1 
ATOM   677  C  CA    . GLY A 1 90  ? -5.447  46.471 22.386 1.00 11.84 ? 90  GLY A CA    1 
ATOM   678  C  C     . GLY A 1 90  ? -6.082  45.364 23.216 1.00 18.20 ? 90  GLY A C     1 
ATOM   679  O  O     . GLY A 1 90  ? -5.864  44.180 22.942 1.00 17.76 ? 90  GLY A O     1 
ATOM   680  N  N     . ILE A 1 91  ? -6.850  45.729 24.239 1.00 19.84 ? 91  ILE A N     1 
ATOM   681  C  CA    . ILE A 1 91  ? -7.514  44.737 25.072 1.00 18.98 ? 91  ILE A CA    1 
ATOM   682  C  C     . ILE A 1 91  ? -8.994  44.694 24.673 1.00 19.27 ? 91  ILE A C     1 
ATOM   683  O  O     . ILE A 1 91  ? -9.750  45.631 24.935 1.00 19.78 ? 91  ILE A O     1 
ATOM   684  C  CB    . ILE A 1 91  ? -7.358  45.061 26.609 1.00 22.62 ? 91  ILE A CB    1 
ATOM   685  C  CG1   . ILE A 1 91  ? -5.879  44.996 27.033 1.00 19.42 ? 91  ILE A CG1   1 
ATOM   686  C  CG2   . ILE A 1 91  ? -8.159  44.054 27.456 1.00 20.08 ? 91  ILE A CG2   1 
ATOM   687  C  CD1   . ILE A 1 91  ? -5.115  46.316 26.902 1.00 11.16 ? 91  ILE A CD1   1 
ATOM   688  N  N     . PRO A 1 92  ? -9.421  43.622 23.996 1.00 18.92 ? 92  PRO A N     1 
ATOM   689  C  CA    . PRO A 1 92  ? -10.832 43.560 23.601 1.00 22.50 ? 92  PRO A CA    1 
ATOM   690  C  C     . PRO A 1 92  ? -11.744 43.227 24.796 1.00 23.95 ? 92  PRO A C     1 
ATOM   691  O  O     . PRO A 1 92  ? -12.376 42.167 24.838 1.00 25.77 ? 92  PRO A O     1 
ATOM   692  C  CB    . PRO A 1 92  ? -10.823 42.474 22.525 1.00 20.61 ? 92  PRO A CB    1 
ATOM   693  C  CG    . PRO A 1 92  ? -9.754  41.541 22.996 1.00 19.26 ? 92  PRO A CG    1 
ATOM   694  C  CD    . PRO A 1 92  ? -8.666  42.463 23.485 1.00 19.20 ? 92  PRO A CD    1 
ATOM   695  N  N     . VAL A 1 93  ? -11.826 44.171 25.740 1.00 22.90 ? 93  VAL A N     1 
ATOM   696  C  CA    . VAL A 1 93  ? -12.614 44.041 26.976 1.00 20.85 ? 93  VAL A CA    1 
ATOM   697  C  C     . VAL A 1 93  ? -13.931 43.292 26.804 1.00 19.31 ? 93  VAL A C     1 
ATOM   698  O  O     . VAL A 1 93  ? -14.184 42.299 27.470 1.00 16.49 ? 93  VAL A O     1 
ATOM   699  C  CB    . VAL A 1 93  ? -12.883 45.437 27.613 1.00 20.60 ? 93  VAL A CB    1 
ATOM   700  C  CG1   . VAL A 1 93  ? -13.651 45.304 28.917 1.00 21.08 ? 93  VAL A CG1   1 
ATOM   701  C  CG2   . VAL A 1 93  ? -11.575 46.169 27.855 1.00 12.27 ? 93  VAL A CG2   1 
ATOM   702  N  N     . ARG A 1 94  ? -14.733 43.739 25.852 1.00 27.94 ? 94  ARG A N     1 
ATOM   703  C  CA    . ARG A 1 94  ? -16.027 43.130 25.560 1.00 29.70 ? 94  ARG A CA    1 
ATOM   704  C  C     . ARG A 1 94  ? -16.023 41.617 25.416 1.00 28.94 ? 94  ARG A C     1 
ATOM   705  O  O     . ARG A 1 94  ? -17.010 40.971 25.747 1.00 26.36 ? 94  ARG A O     1 
ATOM   706  C  CB    . ARG A 1 94  ? -16.595 43.670 24.250 1.00 34.57 ? 94  ARG A CB    1 
ATOM   707  C  CG    . ARG A 1 94  ? -17.057 45.098 24.222 1.00 38.88 ? 94  ARG A CG    1 
ATOM   708  C  CD    . ARG A 1 94  ? -17.870 45.236 22.960 1.00 41.09 ? 94  ARG A CD    1 
ATOM   709  N  NE    . ARG A 1 94  ? -18.269 46.598 22.639 1.00 42.35 ? 94  ARG A NE    1 
ATOM   710  C  CZ    . ARG A 1 94  ? -19.343 46.798 21.881 1.00 46.17 ? 94  ARG A CZ    1 
ATOM   711  N  NH1   . ARG A 1 94  ? -20.049 45.759 21.432 1.00 45.95 ? 94  ARG A NH1   1 
ATOM   712  N  NH2   . ARG A 1 94  ? -19.702 48.033 21.551 1.00 51.44 ? 94  ARG A NH2   1 
ATOM   713  N  N     . GLU A 1 95  ? -14.950 41.052 24.877 1.00 29.13 ? 95  GLU A N     1 
ATOM   714  C  CA    . GLU A 1 95  ? -14.923 39.613 24.660 1.00 30.44 ? 95  GLU A CA    1 
ATOM   715  C  C     . GLU A 1 95  ? -14.378 38.735 25.773 1.00 27.94 ? 95  GLU A C     1 
ATOM   716  O  O     . GLU A 1 95  ? -14.464 37.500 25.684 1.00 24.74 ? 95  GLU A O     1 
ATOM   717  C  CB    . GLU A 1 95  ? -14.257 39.287 23.326 1.00 35.96 ? 95  GLU A CB    1 
ATOM   718  C  CG    . GLU A 1 95  ? -12.922 39.939 23.121 1.00 48.29 ? 95  GLU A CG    1 
ATOM   719  C  CD    . GLU A 1 95  ? -12.377 39.717 21.726 1.00 55.08 ? 95  GLU A CD    1 
ATOM   720  O  OE1   . GLU A 1 95  ? -12.918 40.324 20.778 1.00 58.10 ? 95  GLU A OE1   1 
ATOM   721  O  OE2   . GLU A 1 95  ? -11.404 38.946 21.580 1.00 59.26 ? 95  GLU A OE2   1 
ATOM   722  N  N     . ARG A 1 96  ? -13.856 39.362 26.828 1.00 24.73 ? 96  ARG A N     1 
ATOM   723  C  CA    . ARG A 1 96  ? -13.322 38.615 27.964 1.00 21.43 ? 96  ARG A CA    1 
ATOM   724  C  C     . ARG A 1 96  ? -13.963 38.938 29.334 1.00 20.17 ? 96  ARG A C     1 
ATOM   725  O  O     . ARG A 1 96  ? -13.787 38.181 30.293 1.00 14.03 ? 96  ARG A O     1 
ATOM   726  C  CB    . ARG A 1 96  ? -11.805 38.734 28.016 1.00 15.29 ? 96  ARG A CB    1 
ATOM   727  C  CG    . ARG A 1 96  ? -11.306 40.133 27.974 1.00 15.77 ? 96  ARG A CG    1 
ATOM   728  C  CD    . ARG A 1 96  ? -9.790  40.141 28.014 1.00 19.17 ? 96  ARG A CD    1 
ATOM   729  N  NE    . ARG A 1 96  ? -9.184  39.711 26.755 1.00 20.43 ? 96  ARG A NE    1 
ATOM   730  C  CZ    . ARG A 1 96  ? -7.897  39.947 26.508 1.00 17.54 ? 96  ARG A CZ    1 
ATOM   731  N  NH1   . ARG A 1 96  ? -7.148  40.559 27.412 1.00 17.84 ? 96  ARG A NH1   1 
ATOM   732  N  NH2   . ARG A 1 96  ? -7.373  39.638 25.325 1.00 19.95 ? 96  ARG A NH2   1 
ATOM   733  N  N     . LEU A 1 97  ? -14.758 40.009 29.394 1.00 17.33 ? 97  LEU A N     1 
ATOM   734  C  CA    . LEU A 1 97  ? -15.430 40.432 30.626 1.00 14.08 ? 97  LEU A CA    1 
ATOM   735  C  C     . LEU A 1 97  ? -16.915 40.119 30.648 1.00 15.98 ? 97  LEU A C     1 
ATOM   736  O  O     . LEU A 1 97  ? -17.686 40.674 29.867 1.00 19.18 ? 97  LEU A O     1 
ATOM   737  C  CB    . LEU A 1 97  ? -15.253 41.941 30.832 1.00 10.84 ? 97  LEU A CB    1 
ATOM   738  C  CG    . LEU A 1 97  ? -16.064 42.686 31.903 1.00 12.75 ? 97  LEU A CG    1 
ATOM   739  C  CD1   . LEU A 1 97  ? -15.498 42.386 33.298 1.00 10.74 ? 97  LEU A CD1   1 
ATOM   740  C  CD2   . LEU A 1 97  ? -16.020 44.190 31.639 1.00 5.89  ? 97  LEU A CD2   1 
ATOM   741  N  N     . LEU A 1 98  ? -17.312 39.214 31.531 1.00 16.18 ? 98  LEU A N     1 
ATOM   742  C  CA    . LEU A 1 98  ? -18.723 38.871 31.704 1.00 16.95 ? 98  LEU A CA    1 
ATOM   743  C  C     . LEU A 1 98  ? -19.272 39.504 33.014 1.00 17.59 ? 98  LEU A C     1 
ATOM   744  O  O     . LEU A 1 98  ? -18.515 39.874 33.918 1.00 15.94 ? 98  LEU A O     1 
ATOM   745  C  CB    . LEU A 1 98  ? -18.887 37.362 31.737 1.00 15.94 ? 98  LEU A CB    1 
ATOM   746  C  CG    . LEU A 1 98  ? -18.560 36.610 30.453 1.00 12.13 ? 98  LEU A CG    1 
ATOM   747  C  CD1   . LEU A 1 98  ? -18.486 35.132 30.781 1.00 8.20  ? 98  LEU A CD1   1 
ATOM   748  C  CD2   . LEU A 1 98  ? -19.633 36.887 29.394 1.00 5.95  ? 98  LEU A CD2   1 
ATOM   749  N  N     . LEU A 1 99  ? -20.583 39.633 33.134 1.00 16.13 ? 99  LEU A N     1 
ATOM   750  C  CA    . LEU A 1 99  ? -21.110 40.241 34.339 1.00 16.96 ? 99  LEU A CA    1 
ATOM   751  C  C     . LEU A 1 99  ? -22.455 39.691 34.780 1.00 20.86 ? 99  LEU A C     1 
ATOM   752  O  O     . LEU A 1 99  ? -23.181 39.089 33.982 1.00 23.72 ? 99  LEU A O     1 
ATOM   753  C  CB    . LEU A 1 99  ? -21.140 41.778 34.211 1.00 16.79 ? 99  LEU A CB    1 
ATOM   754  C  CG    . LEU A 1 99  ? -21.863 42.506 33.066 1.00 15.24 ? 99  LEU A CG    1 
ATOM   755  C  CD1   . LEU A 1 99  ? -23.367 42.405 33.183 1.00 15.80 ? 99  LEU A CD1   1 
ATOM   756  C  CD2   . LEU A 1 99  ? -21.474 43.953 33.094 1.00 18.39 ? 99  LEU A CD2   1 
ATOM   757  N  N     . SER A 1 100 ? -22.744 39.855 36.072 1.00 22.55 ? 100 SER A N     1 
ATOM   758  C  CA    . SER A 1 100 ? -23.988 39.389 36.669 1.00 19.01 ? 100 SER A CA    1 
ATOM   759  C  C     . SER A 1 100 ? -25.134 40.374 36.538 1.00 17.79 ? 100 SER A C     1 
ATOM   760  O  O     . SER A 1 100 ? -25.029 41.538 36.932 1.00 17.53 ? 100 SER A O     1 
ATOM   761  C  CB    . SER A 1 100 ? -23.801 39.081 38.158 1.00 19.54 ? 100 SER A CB    1 
ATOM   762  O  OG    . SER A 1 100 ? -25.051 38.745 38.763 1.00 13.93 ? 100 SER A OG    1 
ATOM   763  N  N     . GLU A 1 101 ? -26.271 39.854 36.103 1.00 15.21 ? 101 GLU A N     1 
ATOM   764  C  CA    . GLU A 1 101 ? -27.473 40.652 35.956 1.00 15.56 ? 101 GLU A CA    1 
ATOM   765  C  C     . GLU A 1 101 ? -27.950 41.180 37.313 1.00 11.05 ? 101 GLU A C     1 
ATOM   766  O  O     . GLU A 1 101 ? -28.731 42.130 37.366 1.00 8.40  ? 101 GLU A O     1 
ATOM   767  C  CB    . GLU A 1 101 ? -28.568 39.804 35.314 1.00 15.20 ? 101 GLU A CB    1 
ATOM   768  C  CG    . GLU A 1 101 ? -28.717 38.469 35.982 1.00 18.56 ? 101 GLU A CG    1 
ATOM   769  C  CD    . GLU A 1 101 ? -29.855 37.679 35.420 1.00 22.25 ? 101 GLU A CD    1 
ATOM   770  O  OE1   . GLU A 1 101 ? -31.011 38.073 35.657 1.00 17.91 ? 101 GLU A OE1   1 
ATOM   771  O  OE2   . GLU A 1 101 ? -29.597 36.656 34.751 1.00 27.93 ? 101 GLU A OE2   1 
ATOM   772  N  N     . ALA A 1 102 ? -27.477 40.565 38.395 1.00 12.62 ? 102 ALA A N     1 
ATOM   773  C  CA    . ALA A 1 102 ? -27.852 40.966 39.753 1.00 10.89 ? 102 ALA A CA    1 
ATOM   774  C  C     . ALA A 1 102 ? -27.082 42.171 40.269 1.00 10.36 ? 102 ALA A C     1 
ATOM   775  O  O     . ALA A 1 102 ? -27.498 42.801 41.224 1.00 16.25 ? 102 ALA A O     1 
ATOM   776  C  CB    . ALA A 1 102 ? -27.694 39.798 40.721 1.00 11.62 ? 102 ALA A CB    1 
ATOM   777  N  N     . CYS A 1 103 ? -25.949 42.492 39.662 1.00 11.87 ? 103 CYS A N     1 
ATOM   778  C  CA    . CYS A 1 103 ? -25.181 43.634 40.127 1.00 10.90 ? 103 CYS A CA    1 
ATOM   779  C  C     . CYS A 1 103 ? -26.078 44.865 40.209 1.00 14.89 ? 103 CYS A C     1 
ATOM   780  O  O     . CYS A 1 103 ? -26.876 45.111 39.305 1.00 20.74 ? 103 CYS A O     1 
ATOM   781  C  CB    . CYS A 1 103 ? -24.044 43.964 39.167 1.00 5.01  ? 103 CYS A CB    1 
ATOM   782  S  SG    . CYS A 1 103 ? -22.825 42.725 38.877 1.00 10.46 ? 103 CYS A SG    1 
ATOM   783  N  N     . PRO A 1 104 ? -26.036 45.588 41.336 1.00 17.41 ? 104 PRO A N     1 
ATOM   784  C  CA    . PRO A 1 104 ? -26.820 46.808 41.552 1.00 18.85 ? 104 PRO A CA    1 
ATOM   785  C  C     . PRO A 1 104 ? -26.171 47.903 40.694 1.00 18.96 ? 104 PRO A C     1 
ATOM   786  O  O     . PRO A 1 104 ? -24.952 47.881 40.507 1.00 21.72 ? 104 PRO A O     1 
ATOM   787  C  CB    . PRO A 1 104 ? -26.574 47.097 43.036 1.00 17.59 ? 104 PRO A CB    1 
ATOM   788  C  CG    . PRO A 1 104 ? -26.373 45.725 43.614 1.00 17.82 ? 104 PRO A CG    1 
ATOM   789  C  CD    . PRO A 1 104 ? -25.452 45.123 42.603 1.00 18.93 ? 104 PRO A CD    1 
ATOM   790  N  N     . LEU A 1 105 ? -26.950 48.862 40.197 1.00 15.34 ? 105 LEU A N     1 
ATOM   791  C  CA    . LEU A 1 105 ? -26.391 49.938 39.369 1.00 12.69 ? 105 LEU A CA    1 
ATOM   792  C  C     . LEU A 1 105 ? -26.124 51.197 40.162 1.00 14.63 ? 105 LEU A C     1 
ATOM   793  O  O     . LEU A 1 105 ? -26.973 51.639 40.938 1.00 19.41 ? 105 LEU A O     1 
ATOM   794  C  CB    . LEU A 1 105 ? -27.351 50.315 38.239 1.00 10.13 ? 105 LEU A CB    1 
ATOM   795  C  CG    . LEU A 1 105 ? -27.773 49.268 37.207 1.00 12.31 ? 105 LEU A CG    1 
ATOM   796  C  CD1   . LEU A 1 105 ? -28.948 49.789 36.379 1.00 5.01  ? 105 LEU A CD1   1 
ATOM   797  C  CD2   . LEU A 1 105 ? -26.584 48.891 36.325 1.00 14.02 ? 105 LEU A CD2   1 
ATOM   798  N  N     . ILE A 1 106 ? -24.971 51.809 39.927 1.00 16.73 ? 106 ILE A N     1 
ATOM   799  C  CA    . ILE A 1 106 ? -24.606 53.064 40.581 1.00 15.03 ? 106 ILE A CA    1 
ATOM   800  C  C     . ILE A 1 106 ? -24.852 54.181 39.564 1.00 17.94 ? 106 ILE A C     1 
ATOM   801  O  O     . ILE A 1 106 ? -24.092 54.328 38.603 1.00 20.41 ? 106 ILE A O     1 
ATOM   802  C  CB    . ILE A 1 106 ? -23.104 53.127 40.943 1.00 13.75 ? 106 ILE A CB    1 
ATOM   803  C  CG1   . ILE A 1 106 ? -22.707 52.003 41.897 1.00 10.95 ? 106 ILE A CG1   1 
ATOM   804  C  CG2   . ILE A 1 106 ? -22.776 54.482 41.564 1.00 18.01 ? 106 ILE A CG2   1 
ATOM   805  C  CD1   . ILE A 1 106 ? -21.248 52.118 42.350 1.00 10.19 ? 106 ILE A CD1   1 
ATOM   806  N  N     . LEU A 1 107 ? -25.902 54.969 39.767 1.00 20.74 ? 107 LEU A N     1 
ATOM   807  C  CA    . LEU A 1 107 ? -26.216 56.059 38.851 1.00 17.26 ? 107 LEU A CA    1 
ATOM   808  C  C     . LEU A 1 107 ? -25.871 57.408 39.498 1.00 22.25 ? 107 LEU A C     1 
ATOM   809  O  O     . LEU A 1 107 ? -25.618 57.469 40.704 1.00 18.59 ? 107 LEU A O     1 
ATOM   810  C  CB    . LEU A 1 107 ? -27.681 55.969 38.409 1.00 13.25 ? 107 LEU A CB    1 
ATOM   811  C  CG    . LEU A 1 107 ? -28.125 54.613 37.814 1.00 5.09  ? 107 LEU A CG    1 
ATOM   812  C  CD1   . LEU A 1 107 ? -29.585 54.622 37.562 1.00 5.01  ? 107 LEU A CD1   1 
ATOM   813  C  CD2   . LEU A 1 107 ? -27.407 54.273 36.527 1.00 9.42  ? 107 LEU A CD2   1 
ATOM   814  N  N     . ASP A 1 108 ? -25.820 58.469 38.689 1.00 24.27 ? 108 ASP A N     1 
ATOM   815  C  CA    . ASP A 1 108 ? -25.460 59.813 39.144 1.00 22.02 ? 108 ASP A CA    1 
ATOM   816  C  C     . ASP A 1 108 ? -25.981 60.256 40.506 1.00 20.33 ? 108 ASP A C     1 
ATOM   817  O  O     . ASP A 1 108 ? -25.234 60.853 41.301 1.00 15.50 ? 108 ASP A O     1 
ATOM   818  C  CB    . ASP A 1 108 ? -25.866 60.863 38.100 1.00 30.77 ? 108 ASP A CB    1 
ATOM   819  C  CG    . ASP A 1 108 ? -24.741 61.214 37.127 1.00 42.36 ? 108 ASP A CG    1 
ATOM   820  O  OD1   . ASP A 1 108 ? -25.017 61.990 36.176 1.00 46.06 ? 108 ASP A OD1   1 
ATOM   821  O  OD2   . ASP A 1 108 ? -23.592 60.735 37.305 1.00 44.44 ? 108 ASP A OD2   1 
ATOM   822  N  N     . TYR A 1 109 ? -27.256 59.985 40.775 1.00 15.16 ? 109 TYR A N     1 
ATOM   823  C  CA    . TYR A 1 109 ? -27.860 60.408 42.041 1.00 17.86 ? 109 TYR A CA    1 
ATOM   824  C  C     . TYR A 1 109 ? -27.220 59.799 43.300 1.00 17.18 ? 109 TYR A C     1 
ATOM   825  O  O     . TYR A 1 109 ? -27.230 60.417 44.370 1.00 18.38 ? 109 TYR A O     1 
ATOM   826  C  CB    . TYR A 1 109 ? -29.377 60.217 42.023 1.00 14.80 ? 109 TYR A CB    1 
ATOM   827  C  CG    . TYR A 1 109 ? -29.824 58.841 41.635 1.00 19.33 ? 109 TYR A CG    1 
ATOM   828  C  CD1   . TYR A 1 109 ? -30.110 58.532 40.311 1.00 18.13 ? 109 TYR A CD1   1 
ATOM   829  C  CD2   . TYR A 1 109 ? -29.990 57.845 42.599 1.00 18.89 ? 109 TYR A CD2   1 
ATOM   830  C  CE1   . TYR A 1 109 ? -30.554 57.265 39.954 1.00 18.34 ? 109 TYR A CE1   1 
ATOM   831  C  CE2   . TYR A 1 109 ? -30.434 56.582 42.251 1.00 18.15 ? 109 TYR A CE2   1 
ATOM   832  C  CZ    . TYR A 1 109 ? -30.717 56.297 40.926 1.00 15.80 ? 109 TYR A CZ    1 
ATOM   833  O  OH    . TYR A 1 109 ? -31.178 55.051 40.588 1.00 13.90 ? 109 TYR A OH    1 
ATOM   834  N  N     . HIS A 1 110 ? -26.613 58.624 43.154 1.00 12.48 ? 110 HIS A N     1 
ATOM   835  C  CA    . HIS A 1 110 ? -25.923 57.977 44.255 1.00 11.94 ? 110 HIS A CA    1 
ATOM   836  C  C     . HIS A 1 110 ? -24.684 58.808 44.603 1.00 13.14 ? 110 HIS A C     1 
ATOM   837  O  O     . HIS A 1 110 ? -24.322 58.928 45.774 1.00 16.34 ? 110 HIS A O     1 
ATOM   838  C  CB    . HIS A 1 110 ? -25.518 56.550 43.877 1.00 11.74 ? 110 HIS A CB    1 
ATOM   839  C  CG    . HIS A 1 110 ? -26.667 55.586 43.844 1.00 9.24  ? 110 HIS A CG    1 
ATOM   840  N  ND1   . HIS A 1 110 ? -26.852 54.679 42.824 1.00 11.63 ? 110 HIS A ND1   1 
ATOM   841  C  CD2   . HIS A 1 110 ? -27.685 55.388 44.712 1.00 5.01  ? 110 HIS A CD2   1 
ATOM   842  C  CE1   . HIS A 1 110 ? -27.936 53.964 43.059 1.00 12.98 ? 110 HIS A CE1   1 
ATOM   843  N  NE2   . HIS A 1 110 ? -28.460 54.373 44.201 1.00 9.83  ? 110 HIS A NE2   1 
ATOM   844  N  N     . VAL A 1 111 ? -24.061 59.412 43.591 1.00 17.02 ? 111 VAL A N     1 
ATOM   845  C  CA    . VAL A 1 111 ? -22.876 60.255 43.799 1.00 16.22 ? 111 VAL A CA    1 
ATOM   846  C  C     . VAL A 1 111 ? -23.313 61.546 44.503 1.00 18.89 ? 111 VAL A C     1 
ATOM   847  O  O     . VAL A 1 111 ? -22.620 62.051 45.402 1.00 20.71 ? 111 VAL A O     1 
ATOM   848  C  CB    . VAL A 1 111 ? -22.145 60.589 42.460 1.00 11.86 ? 111 VAL A CB    1 
ATOM   849  C  CG1   . VAL A 1 111 ? -20.832 61.319 42.739 1.00 12.12 ? 111 VAL A CG1   1 
ATOM   850  C  CG2   . VAL A 1 111 ? -21.842 59.298 41.691 1.00 12.82 ? 111 VAL A CG2   1 
ATOM   851  N  N     . ALA A 1 112 ? -24.475 62.065 44.113 1.00 15.64 ? 112 ALA A N     1 
ATOM   852  C  CA    . ALA A 1 112 ? -25.016 63.268 44.741 1.00 15.56 ? 112 ALA A CA    1 
ATOM   853  C  C     . ALA A 1 112 ? -25.270 62.942 46.221 1.00 17.47 ? 112 ALA A C     1 
ATOM   854  O  O     . ALA A 1 112 ? -24.803 63.658 47.113 1.00 18.64 ? 112 ALA A O     1 
ATOM   855  C  CB    . ALA A 1 112 ? -26.296 63.681 44.073 1.00 8.68  ? 112 ALA A CB    1 
ATOM   856  N  N     . LEU A 1 113 ? -25.983 61.847 46.468 1.00 15.75 ? 113 LEU A N     1 
ATOM   857  C  CA    . LEU A 1 113 ? -26.267 61.389 47.824 1.00 16.65 ? 113 LEU A CA    1 
ATOM   858  C  C     . LEU A 1 113 ? -24.968 61.229 48.634 1.00 18.22 ? 113 LEU A C     1 
ATOM   859  O  O     . LEU A 1 113 ? -24.842 61.781 49.732 1.00 16.84 ? 113 LEU A O     1 
ATOM   860  C  CB    . LEU A 1 113 ? -27.030 60.067 47.770 1.00 12.71 ? 113 LEU A CB    1 
ATOM   861  C  CG    . LEU A 1 113 ? -28.403 60.182 47.104 1.00 9.15  ? 113 LEU A CG    1 
ATOM   862  C  CD1   . LEU A 1 113 ? -29.061 58.822 46.962 1.00 17.45 ? 113 LEU A CD1   1 
ATOM   863  C  CD2   . LEU A 1 113 ? -29.271 61.096 47.918 1.00 12.12 ? 113 LEU A CD2   1 
ATOM   864  N  N     . ASP A 1 114 ? -23.996 60.521 48.062 1.00 17.22 ? 114 ASP A N     1 
ATOM   865  C  CA    . ASP A 1 114 ? -22.702 60.286 48.705 1.00 21.83 ? 114 ASP A CA    1 
ATOM   866  C  C     . ASP A 1 114 ? -22.118 61.635 49.170 1.00 23.58 ? 114 ASP A C     1 
ATOM   867  O  O     . ASP A 1 114 ? -21.812 61.834 50.358 1.00 23.78 ? 114 ASP A O     1 
ATOM   868  C  CB    . ASP A 1 114 ? -21.758 59.571 47.702 1.00 21.89 ? 114 ASP A CB    1 
ATOM   869  C  CG    . ASP A 1 114 ? -20.519 58.922 48.364 1.00 25.65 ? 114 ASP A CG    1 
ATOM   870  O  OD1   . ASP A 1 114 ? -20.217 59.195 49.542 1.00 28.68 ? 114 ASP A OD1   1 
ATOM   871  O  OD2   . ASP A 1 114 ? -19.819 58.129 47.687 1.00 20.29 ? 114 ASP A OD2   1 
ATOM   872  N  N     . ASN A 1 115 ? -22.034 62.576 48.237 1.00 26.37 ? 115 ASN A N     1 
ATOM   873  C  CA    . ASN A 1 115 ? -21.497 63.904 48.504 1.00 23.00 ? 115 ASN A CA    1 
ATOM   874  C  C     . ASN A 1 115 ? -22.305 64.690 49.528 1.00 22.23 ? 115 ASN A C     1 
ATOM   875  O  O     . ASN A 1 115 ? -21.752 65.208 50.510 1.00 21.26 ? 115 ASN A O     1 
ATOM   876  C  CB    . ASN A 1 115 ? -21.434 64.705 47.210 1.00 28.57 ? 115 ASN A CB    1 
ATOM   877  C  CG    . ASN A 1 115 ? -20.528 64.073 46.167 1.00 29.65 ? 115 ASN A CG    1 
ATOM   878  O  OD1   . ASN A 1 115 ? -19.864 63.060 46.409 1.00 32.48 ? 115 ASN A OD1   1 
ATOM   879  N  ND2   . ASN A 1 115 ? -20.506 64.672 44.990 1.00 37.39 ? 115 ASN A ND2   1 
ATOM   880  N  N     . ALA A 1 116 ? -23.611 64.790 49.301 1.00 18.39 ? 116 ALA A N     1 
ATOM   881  C  CA    . ALA A 1 116 ? -24.479 65.525 50.209 1.00 18.88 ? 116 ALA A CA    1 
ATOM   882  C  C     . ALA A 1 116 ? -24.335 65.048 51.650 1.00 22.43 ? 116 ALA A C     1 
ATOM   883  O  O     . ALA A 1 116 ? -24.215 65.861 52.578 1.00 25.95 ? 116 ALA A O     1 
ATOM   884  C  CB    . ALA A 1 116 ? -25.916 65.413 49.765 1.00 16.28 ? 116 ALA A CB    1 
ATOM   885  N  N     . ARG A 1 117 ? -24.318 63.731 51.833 1.00 22.67 ? 117 ARG A N     1 
ATOM   886  C  CA    . ARG A 1 117 ? -24.198 63.148 53.164 1.00 22.96 ? 117 ARG A CA    1 
ATOM   887  C  C     . ARG A 1 117 ? -22.832 63.397 53.781 1.00 21.44 ? 117 ARG A C     1 
ATOM   888  O  O     . ARG A 1 117 ? -22.716 63.841 54.924 1.00 19.84 ? 117 ARG A O     1 
ATOM   889  C  CB    . ARG A 1 117 ? -24.494 61.652 53.109 1.00 21.09 ? 117 ARG A CB    1 
ATOM   890  C  CG    . ARG A 1 117 ? -25.790 61.343 52.404 1.00 17.65 ? 117 ARG A CG    1 
ATOM   891  C  CD    . ARG A 1 117 ? -26.559 60.267 53.104 1.00 19.46 ? 117 ARG A CD    1 
ATOM   892  N  NE    . ARG A 1 117 ? -26.800 59.113 52.245 1.00 17.09 ? 117 ARG A NE    1 
ATOM   893  C  CZ    . ARG A 1 117 ? -28.031 58.781 51.887 1.00 9.59  ? 117 ARG A CZ    1 
ATOM   894  N  NH1   . ARG A 1 117 ? -29.059 59.498 52.286 1.00 12.32 ? 117 ARG A NH1   1 
ATOM   895  N  NH2   . ARG A 1 117 ? -28.237 57.682 51.193 1.00 18.99 ? 117 ARG A NH2   1 
ATOM   896  N  N     . GLU A 1 118 ? -21.797 63.174 52.991 1.00 22.09 ? 118 GLU A N     1 
ATOM   897  C  CA    . GLU A 1 118 ? -20.442 63.369 53.458 1.00 23.17 ? 118 GLU A CA    1 
ATOM   898  C  C     . GLU A 1 118 ? -20.222 64.804 53.947 1.00 25.16 ? 118 GLU A C     1 
ATOM   899  O  O     . GLU A 1 118 ? -19.427 65.060 54.849 1.00 23.34 ? 118 GLU A O     1 
ATOM   900  C  CB    . GLU A 1 118 ? -19.484 63.004 52.333 1.00 22.33 ? 118 GLU A CB    1 
ATOM   901  C  CG    . GLU A 1 118 ? -18.072 62.734 52.790 1.00 19.33 ? 118 GLU A CG    1 
ATOM   902  C  CD    . GLU A 1 118 ? -17.930 61.467 53.598 1.00 16.80 ? 118 GLU A CD    1 
ATOM   903  O  OE1   . GLU A 1 118 ? -18.929 60.957 54.157 1.00 14.43 ? 118 GLU A OE1   1 
ATOM   904  O  OE2   . GLU A 1 118 ? -16.787 60.984 53.676 1.00 14.36 ? 118 GLU A OE2   1 
ATOM   905  N  N     . LYS A 1 119 ? -20.914 65.741 53.317 1.00 30.99 ? 119 LYS A N     1 
ATOM   906  C  CA    . LYS A 1 119 ? -20.835 67.140 53.698 1.00 31.23 ? 119 LYS A CA    1 
ATOM   907  C  C     . LYS A 1 119 ? -21.684 67.305 54.964 1.00 28.08 ? 119 LYS A C     1 
ATOM   908  O  O     . LYS A 1 119 ? -21.317 68.044 55.871 1.00 27.89 ? 119 LYS A O     1 
ATOM   909  C  CB    . LYS A 1 119 ? -21.393 68.009 52.568 1.00 37.88 ? 119 LYS A CB    1 
ATOM   910  C  CG    . LYS A 1 119 ? -21.188 69.516 52.735 1.00 40.97 ? 119 LYS A CG    1 
ATOM   911  C  CD    . LYS A 1 119 ? -21.937 70.300 51.667 1.00 42.33 ? 119 LYS A CD    1 
ATOM   912  C  CE    . LYS A 1 119 ? -23.466 70.234 51.864 1.00 48.75 ? 119 LYS A CE    1 
ATOM   913  N  NZ    . LYS A 1 119 ? -24.101 68.871 51.789 1.00 45.80 ? 119 LYS A NZ    1 
ATOM   914  N  N     . ALA A 1 120 ? -22.816 66.611 55.015 1.00 23.19 ? 120 ALA A N     1 
ATOM   915  C  CA    . ALA A 1 120 ? -23.708 66.665 56.168 1.00 25.13 ? 120 ALA A CA    1 
ATOM   916  C  C     . ALA A 1 120 ? -22.966 66.212 57.428 1.00 27.86 ? 120 ALA A C     1 
ATOM   917  O  O     . ALA A 1 120 ? -23.156 66.781 58.504 1.00 31.18 ? 120 ALA A O     1 
ATOM   918  C  CB    . ALA A 1 120 ? -24.913 65.788 55.927 1.00 25.94 ? 120 ALA A CB    1 
ATOM   919  N  N     . ARG A 1 121 ? -22.135 65.176 57.290 1.00 29.97 ? 121 ARG A N     1 
ATOM   920  C  CA    . ARG A 1 121 ? -21.323 64.655 58.397 1.00 28.04 ? 121 ARG A CA    1 
ATOM   921  C  C     . ARG A 1 121 ? -20.365 65.712 58.958 1.00 25.67 ? 121 ARG A C     1 
ATOM   922  O  O     . ARG A 1 121 ? -19.809 65.546 60.039 1.00 25.78 ? 121 ARG A O     1 
ATOM   923  C  CB    . ARG A 1 121 ? -20.519 63.416 57.962 1.00 27.32 ? 121 ARG A CB    1 
ATOM   924  C  CG    . ARG A 1 121 ? -21.351 62.145 57.859 1.00 30.48 ? 121 ARG A CG    1 
ATOM   925  C  CD    . ARG A 1 121 ? -20.497 60.880 57.748 1.00 34.67 ? 121 ARG A CD    1 
ATOM   926  N  NE    . ARG A 1 121 ? -19.625 60.643 58.914 1.00 45.58 ? 121 ARG A NE    1 
ATOM   927  C  CZ    . ARG A 1 121 ? -19.951 59.806 59.909 1.00 45.06 ? 121 ARG A CZ    1 
ATOM   928  N  NH1   . ARG A 1 121 ? -21.101 59.144 59.903 1.00 46.56 ? 121 ARG A NH1   1 
ATOM   929  N  NH2   . ARG A 1 121 ? -19.090 59.592 60.899 1.00 43.28 ? 121 ARG A NH2   1 
ATOM   930  N  N     . GLY A 1 122 ? -20.155 66.784 58.206 1.00 26.01 ? 122 GLY A N     1 
ATOM   931  C  CA    . GLY A 1 122 ? -19.273 67.842 58.652 1.00 28.34 ? 122 GLY A CA    1 
ATOM   932  C  C     . GLY A 1 122 ? -17.854 67.395 58.939 1.00 31.27 ? 122 GLY A C     1 
ATOM   933  O  O     . GLY A 1 122 ? -17.112 67.014 58.032 1.00 33.66 ? 122 GLY A O     1 
ATOM   934  N  N     . ALA A 1 123 ? -17.486 67.431 60.215 1.00 33.37 ? 123 ALA A N     1 
ATOM   935  C  CA    . ALA A 1 123 ? -16.151 67.049 60.652 1.00 31.18 ? 123 ALA A CA    1 
ATOM   936  C  C     . ALA A 1 123 ? -15.974 65.531 60.735 1.00 30.48 ? 123 ALA A C     1 
ATOM   937  O  O     . ALA A 1 123 ? -14.872 65.016 60.533 1.00 28.95 ? 123 ALA A O     1 
ATOM   938  C  CB    . ALA A 1 123 ? -15.848 67.691 62.001 1.00 30.85 ? 123 ALA A CB    1 
ATOM   939  N  N     . LYS A 1 124 ? -17.063 64.813 60.994 1.00 30.62 ? 124 LYS A N     1 
ATOM   940  C  CA    . LYS A 1 124 ? -16.986 63.362 61.122 1.00 31.27 ? 124 LYS A CA    1 
ATOM   941  C  C     . LYS A 1 124 ? -17.103 62.611 59.791 1.00 31.37 ? 124 LYS A C     1 
ATOM   942  O  O     . LYS A 1 124 ? -17.391 61.413 59.758 1.00 33.00 ? 124 LYS A O     1 
ATOM   943  C  CB    . LYS A 1 124 ? -18.004 62.844 62.148 1.00 33.10 ? 124 LYS A CB    1 
ATOM   944  C  CG    . LYS A 1 124 ? -19.444 63.241 61.892 1.00 37.15 ? 124 LYS A CG    1 
ATOM   945  C  CD    . LYS A 1 124 ? -20.398 62.209 62.469 1.00 45.80 ? 124 LYS A CD    1 
ATOM   946  C  CE    . LYS A 1 124 ? -21.856 62.641 62.357 1.00 52.35 ? 124 LYS A CE    1 
ATOM   947  N  NZ    . LYS A 1 124 ? -22.328 62.902 60.966 1.00 53.17 ? 124 LYS A NZ    1 
ATOM   948  N  N     . ALA A 1 125 ? -16.848 63.311 58.693 1.00 29.28 ? 125 ALA A N     1 
ATOM   949  C  CA    . ALA A 1 125 ? -16.904 62.704 57.376 1.00 23.87 ? 125 ALA A CA    1 
ATOM   950  C  C     . ALA A 1 125 ? -16.033 61.447 57.304 1.00 23.46 ? 125 ALA A C     1 
ATOM   951  O  O     . ALA A 1 125 ? -14.966 61.360 57.921 1.00 20.33 ? 125 ALA A O     1 
ATOM   952  C  CB    . ALA A 1 125 ? -16.456 63.696 56.331 1.00 24.24 ? 125 ALA A CB    1 
ATOM   953  N  N     . ILE A 1 126 ? -16.488 60.502 56.489 1.00 22.37 ? 126 ILE A N     1 
ATOM   954  C  CA    . ILE A 1 126 ? -15.825 59.226 56.274 1.00 17.87 ? 126 ILE A CA    1 
ATOM   955  C  C     . ILE A 1 126 ? -14.580 59.265 55.366 1.00 17.17 ? 126 ILE A C     1 
ATOM   956  O  O     . ILE A 1 126 ? -13.666 58.446 55.530 1.00 19.39 ? 126 ILE A O     1 
ATOM   957  C  CB    . ILE A 1 126 ? -16.862 58.223 55.703 1.00 16.15 ? 126 ILE A CB    1 
ATOM   958  C  CG1   . ILE A 1 126 ? -17.891 57.894 56.778 1.00 13.99 ? 126 ILE A CG1   1 
ATOM   959  C  CG2   . ILE A 1 126 ? -16.206 56.943 55.220 1.00 13.85 ? 126 ILE A CG2   1 
ATOM   960  C  CD1   . ILE A 1 126 ? -18.906 56.888 56.333 1.00 21.19 ? 126 ILE A CD1   1 
ATOM   961  N  N     . GLY A 1 127 ? -14.494 60.251 54.474 1.00 11.56 ? 127 GLY A N     1 
ATOM   962  C  CA    . GLY A 1 127 ? -13.381 60.282 53.546 1.00 12.18 ? 127 GLY A CA    1 
ATOM   963  C  C     . GLY A 1 127 ? -13.612 59.251 52.435 1.00 14.58 ? 127 GLY A C     1 
ATOM   964  O  O     . GLY A 1 127 ? -12.680 58.574 51.968 1.00 12.03 ? 127 GLY A O     1 
ATOM   965  N  N     . THR A 1 128 ? -14.868 59.114 52.015 1.00 14.22 ? 128 THR A N     1 
ATOM   966  C  CA    . THR A 1 128 ? -15.222 58.165 50.963 1.00 18.32 ? 128 THR A CA    1 
ATOM   967  C  C     . THR A 1 128 ? -14.608 58.632 49.650 1.00 17.99 ? 128 THR A C     1 
ATOM   968  O  O     . THR A 1 128 ? -14.267 59.812 49.515 1.00 19.50 ? 128 THR A O     1 
ATOM   969  C  CB    . THR A 1 128 ? -16.757 58.072 50.761 1.00 16.42 ? 128 THR A CB    1 
ATOM   970  O  OG1   . THR A 1 128 ? -17.280 59.378 50.522 1.00 17.80 ? 128 THR A OG1   1 
ATOM   971  C  CG2   . THR A 1 128 ? -17.446 57.469 51.960 1.00 17.10 ? 128 THR A CG2   1 
ATOM   972  N  N     . THR A 1 129 ? -14.517 57.722 48.678 1.00 22.20 ? 129 THR A N     1 
ATOM   973  C  CA    . THR A 1 129 ? -13.959 58.035 47.344 1.00 25.07 ? 129 THR A CA    1 
ATOM   974  C  C     . THR A 1 129 ? -14.932 58.795 46.406 1.00 23.89 ? 129 THR A C     1 
ATOM   975  O  O     . THR A 1 129 ? -14.648 58.970 45.214 1.00 27.43 ? 129 THR A O     1 
ATOM   976  C  CB    . THR A 1 129 ? -13.481 56.757 46.603 1.00 18.56 ? 129 THR A CB    1 
ATOM   977  O  OG1   . THR A 1 129 ? -14.561 55.814 46.510 1.00 18.76 ? 129 THR A OG1   1 
ATOM   978  C  CG2   . THR A 1 129 ? -12.305 56.115 47.320 1.00 17.42 ? 129 THR A CG2   1 
ATOM   979  N  N     . GLY A 1 130 ? -16.075 59.220 46.940 1.00 21.15 ? 130 GLY A N     1 
ATOM   980  C  CA    . GLY A 1 130 ? -17.057 59.940 46.146 1.00 18.88 ? 130 GLY A CA    1 
ATOM   981  C  C     . GLY A 1 130 ? -17.574 59.209 44.920 1.00 17.03 ? 130 GLY A C     1 
ATOM   982  O  O     . GLY A 1 130 ? -17.979 59.845 43.945 1.00 17.71 ? 130 GLY A O     1 
ATOM   983  N  N     . ARG A 1 131 ? -17.603 57.882 44.978 1.00 13.64 ? 131 ARG A N     1 
ATOM   984  C  CA    . ARG A 1 131 ? -18.077 57.083 43.858 1.00 14.54 ? 131 ARG A CA    1 
ATOM   985  C  C     . ARG A 1 131 ? -19.530 56.656 43.996 1.00 16.10 ? 131 ARG A C     1 
ATOM   986  O  O     . ARG A 1 131 ? -20.085 56.013 43.093 1.00 17.57 ? 131 ARG A O     1 
ATOM   987  C  CB    . ARG A 1 131 ? -17.183 55.856 43.667 1.00 14.61 ? 131 ARG A CB    1 
ATOM   988  C  CG    . ARG A 1 131 ? -15.713 56.182 43.443 1.00 15.52 ? 131 ARG A CG    1 
ATOM   989  C  CD    . ARG A 1 131 ? -15.504 57.089 42.225 1.00 18.42 ? 131 ARG A CD    1 
ATOM   990  N  NE    . ARG A 1 131 ? -14.084 57.319 41.940 1.00 22.31 ? 131 ARG A NE    1 
ATOM   991  C  CZ    . ARG A 1 131 ? -13.647 58.498 41.504 1.00 20.77 ? 131 ARG A CZ    1 
ATOM   992  N  NH1   . ARG A 1 131 ? -14.493 59.496 41.314 1.00 31.92 ? 131 ARG A NH1   1 
ATOM   993  N  NH2   . ARG A 1 131 ? -12.366 58.678 41.241 1.00 17.95 ? 131 ARG A NH2   1 
ATOM   994  N  N     . GLY A 1 132 ? -20.139 56.990 45.135 1.00 17.91 ? 132 GLY A N     1 
ATOM   995  C  CA    . GLY A 1 132 ? -21.535 56.638 45.385 1.00 12.97 ? 132 GLY A CA    1 
ATOM   996  C  C     . GLY A 1 132 ? -21.760 55.194 45.789 1.00 8.75  ? 132 GLY A C     1 
ATOM   997  O  O     . GLY A 1 132 ? -22.876 54.689 45.687 1.00 8.66  ? 132 GLY A O     1 
ATOM   998  N  N     . ILE A 1 133 ? -20.723 54.555 46.331 1.00 9.11  ? 133 ILE A N     1 
ATOM   999  C  CA    . ILE A 1 133 ? -20.810 53.150 46.724 1.00 9.15  ? 133 ILE A CA    1 
ATOM   1000 C  C     . ILE A 1 133 ? -21.806 52.925 47.857 1.00 10.37 ? 133 ILE A C     1 
ATOM   1001 O  O     . ILE A 1 133 ? -22.627 52.010 47.794 1.00 12.70 ? 133 ILE A O     1 
ATOM   1002 C  CB    . ILE A 1 133 ? -19.425 52.574 47.116 1.00 6.53  ? 133 ILE A CB    1 
ATOM   1003 C  CG1   . ILE A 1 133 ? -18.366 52.980 46.086 1.00 11.64 ? 133 ILE A CG1   1 
ATOM   1004 C  CG2   . ILE A 1 133 ? -19.480 51.049 47.159 1.00 9.56  ? 133 ILE A CG2   1 
ATOM   1005 C  CD1   . ILE A 1 133 ? -18.570 52.433 44.665 1.00 5.01  ? 133 ILE A CD1   1 
ATOM   1006 N  N     . GLY A 1 134 ? -21.780 53.816 48.850 1.00 14.49 ? 134 GLY A N     1 
ATOM   1007 C  CA    . GLY A 1 134 ? -22.672 53.715 49.991 1.00 11.56 ? 134 GLY A CA    1 
ATOM   1008 C  C     . GLY A 1 134 ? -24.132 53.695 49.594 1.00 10.61 ? 134 GLY A C     1 
ATOM   1009 O  O     . GLY A 1 134 ? -24.841 52.717 49.868 1.00 13.96 ? 134 GLY A O     1 
ATOM   1010 N  N     . PRO A 1 135 ? -24.614 54.766 48.946 1.00 9.59  ? 135 PRO A N     1 
ATOM   1011 C  CA    . PRO A 1 135 ? -26.010 54.885 48.498 1.00 7.53  ? 135 PRO A CA    1 
ATOM   1012 C  C     . PRO A 1 135 ? -26.470 53.738 47.600 1.00 10.59 ? 135 PRO A C     1 
ATOM   1013 O  O     . PRO A 1 135 ? -27.647 53.388 47.586 1.00 9.21  ? 135 PRO A O     1 
ATOM   1014 C  CB    . PRO A 1 135 ? -26.015 56.225 47.766 1.00 10.23 ? 135 PRO A CB    1 
ATOM   1015 C  CG    . PRO A 1 135 ? -24.974 57.022 48.527 1.00 7.90  ? 135 PRO A CG    1 
ATOM   1016 C  CD    . PRO A 1 135 ? -23.872 56.018 48.706 1.00 7.27  ? 135 PRO A CD    1 
ATOM   1017 N  N     . ALA A 1 136 ? -25.540 53.141 46.856 1.00 13.52 ? 136 ALA A N     1 
ATOM   1018 C  CA    . ALA A 1 136 ? -25.883 52.026 45.978 1.00 16.15 ? 136 ALA A CA    1 
ATOM   1019 C  C     . ALA A 1 136 ? -26.256 50.805 46.806 1.00 15.75 ? 136 ALA A C     1 
ATOM   1020 O  O     . ALA A 1 136 ? -27.293 50.173 46.582 1.00 16.29 ? 136 ALA A O     1 
ATOM   1021 C  CB    . ALA A 1 136 ? -24.711 51.701 45.050 1.00 18.12 ? 136 ALA A CB    1 
ATOM   1022 N  N     . TYR A 1 137 ? -25.395 50.466 47.760 1.00 16.58 ? 137 TYR A N     1 
ATOM   1023 C  CA    . TYR A 1 137 ? -25.640 49.326 48.632 1.00 17.29 ? 137 TYR A CA    1 
ATOM   1024 C  C     . TYR A 1 137 ? -26.903 49.553 49.462 1.00 18.06 ? 137 TYR A C     1 
ATOM   1025 O  O     . TYR A 1 137 ? -27.636 48.606 49.768 1.00 18.09 ? 137 TYR A O     1 
ATOM   1026 C  CB    . TYR A 1 137 ? -24.424 49.069 49.521 1.00 16.81 ? 137 TYR A CB    1 
ATOM   1027 C  CG    . TYR A 1 137 ? -23.341 48.255 48.844 1.00 9.04  ? 137 TYR A CG    1 
ATOM   1028 C  CD1   . TYR A 1 137 ? -23.550 46.916 48.550 1.00 6.80  ? 137 TYR A CD1   1 
ATOM   1029 C  CD2   . TYR A 1 137 ? -22.097 48.812 48.532 1.00 6.94  ? 137 TYR A CD2   1 
ATOM   1030 C  CE1   . TYR A 1 137 ? -22.560 46.146 47.972 1.00 5.72  ? 137 TYR A CE1   1 
ATOM   1031 C  CE2   . TYR A 1 137 ? -21.090 48.044 47.949 1.00 5.01  ? 137 TYR A CE2   1 
ATOM   1032 C  CZ    . TYR A 1 137 ? -21.335 46.713 47.678 1.00 5.01  ? 137 TYR A CZ    1 
ATOM   1033 O  OH    . TYR A 1 137 ? -20.352 45.901 47.152 1.00 8.83  ? 137 TYR A OH    1 
ATOM   1034 N  N     . GLU A 1 138 ? -27.156 50.816 49.804 1.00 18.07 ? 138 GLU A N     1 
ATOM   1035 C  CA    . GLU A 1 138 ? -28.339 51.198 50.559 1.00 12.03 ? 138 GLU A CA    1 
ATOM   1036 C  C     . GLU A 1 138 ? -29.584 50.865 49.716 1.00 14.13 ? 138 GLU A C     1 
ATOM   1037 O  O     . GLU A 1 138 ? -30.448 50.099 50.149 1.00 18.81 ? 138 GLU A O     1 
ATOM   1038 C  CB    . GLU A 1 138 ? -28.275 52.680 50.897 1.00 10.30 ? 138 GLU A CB    1 
ATOM   1039 C  CG    . GLU A 1 138 ? -28.903 53.033 52.235 1.00 18.07 ? 138 GLU A CG    1 
ATOM   1040 C  CD    . GLU A 1 138 ? -29.076 54.534 52.440 1.00 24.18 ? 138 GLU A CD    1 
ATOM   1041 O  OE1   . GLU A 1 138 ? -30.049 54.951 53.116 1.00 16.14 ? 138 GLU A OE1   1 
ATOM   1042 O  OE2   . GLU A 1 138 ? -28.236 55.299 51.918 1.00 24.16 ? 138 GLU A OE2   1 
ATOM   1043 N  N     . ASP A 1 139 ? -29.670 51.403 48.504 1.00 11.98 ? 139 ASP A N     1 
ATOM   1044 C  CA    . ASP A 1 139 ? -30.799 51.104 47.623 1.00 12.28 ? 139 ASP A CA    1 
ATOM   1045 C  C     . ASP A 1 139 ? -30.966 49.603 47.444 1.00 8.99  ? 139 ASP A C     1 
ATOM   1046 O  O     . ASP A 1 139 ? -32.083 49.102 47.333 1.00 10.78 ? 139 ASP A O     1 
ATOM   1047 C  CB    . ASP A 1 139 ? -30.579 51.710 46.231 1.00 17.77 ? 139 ASP A CB    1 
ATOM   1048 C  CG    . ASP A 1 139 ? -30.911 53.182 46.163 1.00 23.33 ? 139 ASP A CG    1 
ATOM   1049 O  OD1   . ASP A 1 139 ? -30.899 53.872 47.220 1.00 22.44 ? 139 ASP A OD1   1 
ATOM   1050 O  OD2   . ASP A 1 139 ? -31.161 53.645 45.024 1.00 22.31 ? 139 ASP A OD2   1 
ATOM   1051 N  N     . LYS A 1 140 ? -29.848 48.913 47.260 1.00 10.97 ? 140 LYS A N     1 
ATOM   1052 C  CA    . LYS A 1 140 ? -29.867 47.467 47.088 1.00 10.97 ? 140 LYS A CA    1 
ATOM   1053 C  C     . LYS A 1 140 ? -30.600 46.818 48.243 1.00 11.93 ? 140 LYS A C     1 
ATOM   1054 O  O     . LYS A 1 140 ? -31.655 46.201 48.054 1.00 17.58 ? 140 LYS A O     1 
ATOM   1055 C  CB    . LYS A 1 140 ? -28.445 46.885 47.062 1.00 11.94 ? 140 LYS A CB    1 
ATOM   1056 C  CG    . LYS A 1 140 ? -28.418 45.372 47.387 1.00 8.00  ? 140 LYS A CG    1 
ATOM   1057 C  CD    . LYS A 1 140 ? -27.042 44.884 47.772 1.00 5.42  ? 140 LYS A CD    1 
ATOM   1058 C  CE    . LYS A 1 140 ? -27.025 43.371 47.877 1.00 5.01  ? 140 LYS A CE    1 
ATOM   1059 N  NZ    . LYS A 1 140 ? -25.642 42.826 48.077 1.00 15.17 ? 140 LYS A NZ    1 
ATOM   1060 N  N     . VAL A 1 141 ? -30.022 46.959 49.435 1.00 5.87  ? 141 VAL A N     1 
ATOM   1061 C  CA    . VAL A 1 141 ? -30.574 46.369 50.646 1.00 8.96  ? 141 VAL A CA    1 
ATOM   1062 C  C     . VAL A 1 141 ? -32.037 46.772 50.918 1.00 11.14 ? 141 VAL A C     1 
ATOM   1063 O  O     . VAL A 1 141 ? -32.835 45.963 51.398 1.00 13.44 ? 141 VAL A O     1 
ATOM   1064 C  CB    . VAL A 1 141 ? -29.609 46.616 51.847 1.00 12.12 ? 141 VAL A CB    1 
ATOM   1065 C  CG1   . VAL A 1 141 ? -30.241 47.490 52.932 1.00 5.01  ? 141 VAL A CG1   1 
ATOM   1066 C  CG2   . VAL A 1 141 ? -29.124 45.276 52.389 1.00 9.92  ? 141 VAL A CG2   1 
ATOM   1067 N  N     . ALA A 1 142 ? -32.401 48.003 50.571 1.00 7.36  ? 142 ALA A N     1 
ATOM   1068 C  CA    . ALA A 1 142 ? -33.769 48.452 50.742 1.00 7.78  ? 142 ALA A CA    1 
ATOM   1069 C  C     . ALA A 1 142 ? -34.697 47.778 49.724 1.00 11.75 ? 142 ALA A C     1 
ATOM   1070 O  O     . ALA A 1 142 ? -35.917 47.866 49.830 1.00 14.87 ? 142 ALA A O     1 
ATOM   1071 C  CB    . ALA A 1 142 ? -33.840 49.960 50.615 1.00 9.20  ? 142 ALA A CB    1 
ATOM   1072 N  N     . ARG A 1 143 ? -34.123 47.099 48.742 1.00 11.98 ? 143 ARG A N     1 
ATOM   1073 C  CA    . ARG A 1 143 ? -34.905 46.406 47.716 1.00 16.88 ? 143 ARG A CA    1 
ATOM   1074 C  C     . ARG A 1 143 ? -35.610 47.344 46.751 1.00 20.99 ? 143 ARG A C     1 
ATOM   1075 O  O     . ARG A 1 143 ? -36.594 46.960 46.104 1.00 25.25 ? 143 ARG A O     1 
ATOM   1076 C  CB    . ARG A 1 143 ? -35.908 45.435 48.342 1.00 10.95 ? 143 ARG A CB    1 
ATOM   1077 C  CG    . ARG A 1 143 ? -35.233 44.260 49.050 1.00 18.17 ? 143 ARG A CG    1 
ATOM   1078 C  CD    . ARG A 1 143 ? -36.081 43.689 50.189 1.00 15.80 ? 143 ARG A CD    1 
ATOM   1079 N  NE    . ARG A 1 143 ? -36.387 44.736 51.158 1.00 15.90 ? 143 ARG A NE    1 
ATOM   1080 C  CZ    . ARG A 1 143 ? -37.328 44.571 52.074 1.00 6.25  ? 143 ARG A CZ    1 
ATOM   1081 N  NH1   . ARG A 1 143 ? -38.009 43.445 52.143 1.00 9.42  ? 143 ARG A NH1   1 
ATOM   1082 N  NH2   . ARG A 1 143 ? -37.623 45.564 52.887 1.00 16.09 ? 143 ARG A NH2   1 
ATOM   1083 N  N     . ARG A 1 144 ? -35.068 48.551 46.612 1.00 21.65 ? 144 ARG A N     1 
ATOM   1084 C  CA    . ARG A 1 144 ? -35.625 49.552 45.706 1.00 21.20 ? 144 ARG A CA    1 
ATOM   1085 C  C     . ARG A 1 144 ? -34.633 49.923 44.599 1.00 22.88 ? 144 ARG A C     1 
ATOM   1086 O  O     . ARG A 1 144 ? -34.966 50.661 43.669 1.00 22.76 ? 144 ARG A O     1 
ATOM   1087 C  CB    . ARG A 1 144 ? -35.975 50.820 46.471 1.00 19.50 ? 144 ARG A CB    1 
ATOM   1088 C  CG    . ARG A 1 144 ? -34.785 51.577 47.009 1.00 17.71 ? 144 ARG A CG    1 
ATOM   1089 C  CD    . ARG A 1 144 ? -35.173 53.011 47.328 1.00 21.00 ? 144 ARG A CD    1 
ATOM   1090 N  NE    . ARG A 1 144 ? -34.568 53.445 48.579 1.00 25.76 ? 144 ARG A NE    1 
ATOM   1091 C  CZ    . ARG A 1 144 ? -35.242 53.339 49.716 1.00 28.86 ? 144 ARG A CZ    1 
ATOM   1092 N  NH1   . ARG A 1 144 ? -36.476 52.849 49.716 1.00 31.80 ? 144 ARG A NH1   1 
ATOM   1093 N  NH2   . ARG A 1 144 ? -34.665 53.682 50.860 1.00 33.31 ? 144 ARG A NH2   1 
ATOM   1094 N  N     . GLY A 1 145 ? -33.399 49.462 44.745 1.00 20.78 ? 145 GLY A N     1 
ATOM   1095 C  CA    . GLY A 1 145 ? -32.375 49.778 43.776 1.00 21.42 ? 145 GLY A CA    1 
ATOM   1096 C  C     . GLY A 1 145 ? -32.527 49.073 42.452 1.00 20.51 ? 145 GLY A C     1 
ATOM   1097 O  O     . GLY A 1 145 ? -33.238 48.067 42.330 1.00 18.57 ? 145 GLY A O     1 
ATOM   1098 N  N     . LEU A 1 146 ? -31.830 49.604 41.456 1.00 17.93 ? 146 LEU A N     1 
ATOM   1099 C  CA    . LEU A 1 146 ? -31.862 49.044 40.125 1.00 17.00 ? 146 LEU A CA    1 
ATOM   1100 C  C     . LEU A 1 146 ? -30.676 48.102 39.913 1.00 14.80 ? 146 LEU A C     1 
ATOM   1101 O  O     . LEU A 1 146 ? -29.565 48.361 40.386 1.00 19.67 ? 146 LEU A O     1 
ATOM   1102 C  CB    . LEU A 1 146 ? -31.874 50.178 39.106 1.00 15.25 ? 146 LEU A CB    1 
ATOM   1103 C  CG    . LEU A 1 146 ? -33.160 51.002 39.148 1.00 12.24 ? 146 LEU A CG    1 
ATOM   1104 C  CD1   . LEU A 1 146 ? -32.950 52.383 38.553 1.00 13.98 ? 146 LEU A CD1   1 
ATOM   1105 C  CD2   . LEU A 1 146 ? -34.231 50.264 38.412 1.00 9.26  ? 146 LEU A CD2   1 
ATOM   1106 N  N     . ARG A 1 147 ? -30.928 46.987 39.241 1.00 13.09 ? 147 ARG A N     1 
ATOM   1107 C  CA    . ARG A 1 147 ? -29.898 45.996 38.960 1.00 13.69 ? 147 ARG A CA    1 
ATOM   1108 C  C     . ARG A 1 147 ? -29.732 45.869 37.447 1.00 14.65 ? 147 ARG A C     1 
ATOM   1109 O  O     . ARG A 1 147 ? -30.577 46.363 36.699 1.00 15.48 ? 147 ARG A O     1 
ATOM   1110 C  CB    . ARG A 1 147 ? -30.286 44.651 39.588 1.00 11.57 ? 147 ARG A CB    1 
ATOM   1111 C  CG    . ARG A 1 147 ? -30.716 44.780 41.065 1.00 13.17 ? 147 ARG A CG    1 
ATOM   1112 C  CD    . ARG A 1 147 ? -30.582 43.481 41.820 1.00 6.64  ? 147 ARG A CD    1 
ATOM   1113 N  NE    . ARG A 1 147 ? -31.266 42.392 41.136 1.00 8.99  ? 147 ARG A NE    1 
ATOM   1114 C  CZ    . ARG A 1 147 ? -31.319 41.172 41.663 1.00 11.60 ? 147 ARG A CZ    1 
ATOM   1115 N  NH1   . ARG A 1 147 ? -30.766 40.925 42.847 1.00 11.35 ? 147 ARG A NH1   1 
ATOM   1116 N  NH2   . ARG A 1 147 ? -31.832 40.170 40.953 1.00 11.97 ? 147 ARG A NH2   1 
ATOM   1117 N  N     . VAL A 1 148 ? -28.645 45.237 37.000 1.00 11.90 ? 148 VAL A N     1 
ATOM   1118 C  CA    . VAL A 1 148 ? -28.391 45.060 35.568 1.00 12.76 ? 148 VAL A CA    1 
ATOM   1119 C  C     . VAL A 1 148 ? -29.604 44.443 34.843 1.00 15.92 ? 148 VAL A C     1 
ATOM   1120 O  O     . VAL A 1 148 ? -30.092 44.995 33.847 1.00 17.91 ? 148 VAL A O     1 
ATOM   1121 C  CB    . VAL A 1 148 ? -27.100 44.223 35.321 1.00 12.30 ? 148 VAL A CB    1 
ATOM   1122 C  CG1   . VAL A 1 148 ? -26.927 43.899 33.852 1.00 10.62 ? 148 VAL A CG1   1 
ATOM   1123 C  CG2   . VAL A 1 148 ? -25.877 44.987 35.808 1.00 11.71 ? 148 VAL A CG2   1 
ATOM   1124 N  N     . GLY A 1 149 ? -30.130 43.343 35.373 1.00 14.04 ? 149 GLY A N     1 
ATOM   1125 C  CA    . GLY A 1 149 ? -31.290 42.709 34.769 1.00 13.62 ? 149 GLY A CA    1 
ATOM   1126 C  C     . GLY A 1 149 ? -32.514 43.606 34.549 1.00 17.41 ? 149 GLY A C     1 
ATOM   1127 O  O     . GLY A 1 149 ? -33.441 43.229 33.838 1.00 16.70 ? 149 GLY A O     1 
ATOM   1128 N  N     . ASP A 1 150 ? -32.551 44.784 35.158 1.00 17.17 ? 150 ASP A N     1 
ATOM   1129 C  CA    . ASP A 1 150 ? -33.691 45.672 34.955 1.00 23.42 ? 150 ASP A CA    1 
ATOM   1130 C  C     . ASP A 1 150 ? -33.689 46.264 33.528 1.00 25.10 ? 150 ASP A C     1 
ATOM   1131 O  O     . ASP A 1 150 ? -34.743 46.580 32.959 1.00 23.23 ? 150 ASP A O     1 
ATOM   1132 C  CB    . ASP A 1 150 ? -33.724 46.778 36.024 1.00 25.77 ? 150 ASP A CB    1 
ATOM   1133 C  CG    . ASP A 1 150 ? -34.341 46.309 37.335 1.00 22.71 ? 150 ASP A CG    1 
ATOM   1134 O  OD1   . ASP A 1 150 ? -35.474 45.786 37.319 1.00 22.71 ? 150 ASP A OD1   1 
ATOM   1135 O  OD2   . ASP A 1 150 ? -33.701 46.474 38.389 1.00 26.05 ? 150 ASP A OD2   1 
ATOM   1136 N  N     . LEU A 1 151 ? -32.497 46.358 32.943 1.00 26.42 ? 151 LEU A N     1 
ATOM   1137 C  CA    . LEU A 1 151 ? -32.315 46.867 31.588 1.00 26.41 ? 151 LEU A CA    1 
ATOM   1138 C  C     . LEU A 1 151 ? -32.925 45.872 30.568 1.00 30.49 ? 151 LEU A C     1 
ATOM   1139 O  O     . LEU A 1 151 ? -33.020 46.161 29.365 1.00 32.88 ? 151 LEU A O     1 
ATOM   1140 C  CB    . LEU A 1 151 ? -30.810 47.051 31.307 1.00 21.48 ? 151 LEU A CB    1 
ATOM   1141 C  CG    . LEU A 1 151 ? -30.010 48.004 32.215 1.00 19.51 ? 151 LEU A CG    1 
ATOM   1142 C  CD1   . LEU A 1 151 ? -28.534 48.030 31.844 1.00 11.53 ? 151 LEU A CD1   1 
ATOM   1143 C  CD2   . LEU A 1 151 ? -30.589 49.404 32.127 1.00 14.92 ? 151 LEU A CD2   1 
ATOM   1144 N  N     . PHE A 1 152 ? -33.339 44.700 31.047 1.00 28.90 ? 152 PHE A N     1 
ATOM   1145 C  CA    . PHE A 1 152 ? -33.912 43.694 30.167 1.00 28.25 ? 152 PHE A CA    1 
ATOM   1146 C  C     . PHE A 1 152 ? -35.175 44.223 29.516 1.00 30.04 ? 152 PHE A C     1 
ATOM   1147 O  O     . PHE A 1 152 ? -35.522 43.822 28.408 1.00 34.55 ? 152 PHE A O     1 
ATOM   1148 C  CB    . PHE A 1 152 ? -34.183 42.389 30.924 1.00 27.57 ? 152 PHE A CB    1 
ATOM   1149 C  CG    . PHE A 1 152 ? -32.930 41.686 31.399 1.00 27.49 ? 152 PHE A CG    1 
ATOM   1150 C  CD1   . PHE A 1 152 ? -31.676 42.042 30.892 1.00 27.73 ? 152 PHE A CD1   1 
ATOM   1151 C  CD2   . PHE A 1 152 ? -33.004 40.666 32.340 1.00 22.36 ? 152 PHE A CD2   1 
ATOM   1152 C  CE1   . PHE A 1 152 ? -30.522 41.398 31.310 1.00 23.31 ? 152 PHE A CE1   1 
ATOM   1153 C  CE2   . PHE A 1 152 ? -31.859 40.015 32.765 1.00 26.99 ? 152 PHE A CE2   1 
ATOM   1154 C  CZ    . PHE A 1 152 ? -30.610 40.382 32.247 1.00 26.75 ? 152 PHE A CZ    1 
ATOM   1155 N  N     . ASP A 1 153 ? -35.867 45.119 30.208 1.00 29.65 ? 153 ASP A N     1 
ATOM   1156 C  CA    . ASP A 1 153 ? -37.074 45.719 29.671 1.00 27.06 ? 153 ASP A CA    1 
ATOM   1157 C  C     . ASP A 1 153 ? -36.895 47.205 29.815 1.00 25.61 ? 153 ASP A C     1 
ATOM   1158 O  O     . ASP A 1 153 ? -37.137 47.767 30.893 1.00 27.98 ? 153 ASP A O     1 
ATOM   1159 C  CB    . ASP A 1 153 ? -38.310 45.273 30.445 1.00 30.20 ? 153 ASP A CB    1 
ATOM   1160 C  CG    . ASP A 1 153 ? -39.603 45.832 29.861 1.00 30.06 ? 153 ASP A CG    1 
ATOM   1161 O  OD1   . ASP A 1 153 ? -39.695 47.049 29.614 1.00 30.84 ? 153 ASP A OD1   1 
ATOM   1162 O  OD2   . ASP A 1 153 ? -40.547 45.050 29.666 1.00 33.47 ? 153 ASP A OD2   1 
ATOM   1163 N  N     . LYS A 1 154 ? -36.510 47.845 28.720 1.00 21.71 ? 154 LYS A N     1 
ATOM   1164 C  CA    . LYS A 1 154 ? -36.285 49.276 28.721 1.00 25.08 ? 154 LYS A CA    1 
ATOM   1165 C  C     . LYS A 1 154 ? -37.476 50.119 29.214 1.00 29.00 ? 154 LYS A C     1 
ATOM   1166 O  O     . LYS A 1 154 ? -37.301 51.050 30.008 1.00 29.05 ? 154 LYS A O     1 
ATOM   1167 C  CB    . LYS A 1 154 ? -35.822 49.723 27.339 1.00 23.98 ? 154 LYS A CB    1 
ATOM   1168 C  CG    . LYS A 1 154 ? -34.508 49.079 26.875 1.00 22.61 ? 154 LYS A CG    1 
ATOM   1169 C  CD    . LYS A 1 154 ? -33.979 49.835 25.664 1.00 24.13 ? 154 LYS A CD    1 
ATOM   1170 C  CE    . LYS A 1 154 ? -32.508 49.547 25.355 1.00 26.39 ? 154 LYS A CE    1 
ATOM   1171 N  NZ    . LYS A 1 154 ? -32.268 48.238 24.659 1.00 24.67 ? 154 LYS A NZ    1 
ATOM   1172 N  N     . GLU A 1 155 ? -38.692 49.759 28.811 1.00 33.35 ? 155 GLU A N     1 
ATOM   1173 C  CA    . GLU A 1 155 ? -39.871 50.523 29.230 1.00 34.87 ? 155 GLU A CA    1 
ATOM   1174 C  C     . GLU A 1 155 ? -40.110 50.518 30.726 1.00 30.97 ? 155 GLU A C     1 
ATOM   1175 O  O     . GLU A 1 155 ? -40.267 51.576 31.330 1.00 30.78 ? 155 GLU A O     1 
ATOM   1176 C  CB    . GLU A 1 155 ? -41.139 50.062 28.499 1.00 41.70 ? 155 GLU A CB    1 
ATOM   1177 C  CG    . GLU A 1 155 ? -41.187 50.454 27.015 1.00 49.65 ? 155 GLU A CG    1 
ATOM   1178 C  CD    . GLU A 1 155 ? -42.612 50.525 26.476 1.00 54.58 ? 155 GLU A CD    1 
ATOM   1179 O  OE1   . GLU A 1 155 ? -43.233 49.456 26.249 1.00 54.76 ? 155 GLU A OE1   1 
ATOM   1180 O  OE2   . GLU A 1 155 ? -43.113 51.659 26.289 1.00 56.23 ? 155 GLU A OE2   1 
ATOM   1181 N  N     . THR A 1 156 ? -40.125 49.339 31.336 1.00 31.39 ? 156 THR A N     1 
ATOM   1182 C  CA    . THR A 1 156 ? -40.351 49.267 32.770 1.00 30.98 ? 156 THR A CA    1 
ATOM   1183 C  C     . THR A 1 156 ? -39.162 49.813 33.575 1.00 30.55 ? 156 THR A C     1 
ATOM   1184 O  O     . THR A 1 156 ? -39.340 50.344 34.677 1.00 28.88 ? 156 THR A O     1 
ATOM   1185 C  CB    . THR A 1 156 ? -40.774 47.850 33.225 1.00 31.05 ? 156 THR A CB    1 
ATOM   1186 O  OG1   . THR A 1 156 ? -39.714 46.914 33.009 1.00 31.61 ? 156 THR A OG1   1 
ATOM   1187 C  CG2   . THR A 1 156 ? -41.990 47.400 32.439 1.00 29.88 ? 156 THR A CG2   1 
ATOM   1188 N  N     . PHE A 1 157 ? -37.959 49.737 33.005 1.00 30.53 ? 157 PHE A N     1 
ATOM   1189 C  CA    . PHE A 1 157 ? -36.776 50.269 33.684 1.00 32.74 ? 157 PHE A CA    1 
ATOM   1190 C  C     . PHE A 1 157 ? -36.959 51.773 33.900 1.00 33.43 ? 157 PHE A C     1 
ATOM   1191 O  O     . PHE A 1 157 ? -36.822 52.283 35.028 1.00 31.86 ? 157 PHE A O     1 
ATOM   1192 C  CB    . PHE A 1 157 ? -35.501 50.015 32.856 1.00 32.09 ? 157 PHE A CB    1 
ATOM   1193 C  CG    . PHE A 1 157 ? -34.254 50.645 33.444 1.00 29.23 ? 157 PHE A CG    1 
ATOM   1194 C  CD1   . PHE A 1 157 ? -33.554 50.017 34.474 1.00 29.37 ? 157 PHE A CD1   1 
ATOM   1195 C  CD2   . PHE A 1 157 ? -33.792 51.875 32.980 1.00 28.48 ? 157 PHE A CD2   1 
ATOM   1196 C  CE1   . PHE A 1 157 ? -32.406 50.611 35.037 1.00 28.48 ? 157 PHE A CE1   1 
ATOM   1197 C  CE2   . PHE A 1 157 ? -32.650 52.477 33.534 1.00 29.30 ? 157 PHE A CE2   1 
ATOM   1198 C  CZ    . PHE A 1 157 ? -31.959 51.841 34.565 1.00 26.00 ? 157 PHE A CZ    1 
ATOM   1199 N  N     . ALA A 1 158 ? -37.270 52.467 32.802 1.00 34.16 ? 158 ALA A N     1 
ATOM   1200 C  CA    . ALA A 1 158 ? -37.485 53.911 32.789 1.00 31.20 ? 158 ALA A CA    1 
ATOM   1201 C  C     . ALA A 1 158 ? -38.496 54.356 33.850 1.00 30.40 ? 158 ALA A C     1 
ATOM   1202 O  O     . ALA A 1 158 ? -38.301 55.389 34.492 1.00 26.75 ? 158 ALA A O     1 
ATOM   1203 C  CB    . ALA A 1 158 ? -37.923 54.353 31.403 1.00 26.33 ? 158 ALA A CB    1 
ATOM   1204 N  N     . GLU A 1 159 ? -39.563 53.578 34.027 1.00 30.29 ? 159 GLU A N     1 
ATOM   1205 C  CA    . GLU A 1 159 ? -40.587 53.873 35.035 1.00 34.99 ? 159 GLU A CA    1 
ATOM   1206 C  C     . GLU A 1 159 ? -40.001 53.758 36.454 1.00 35.03 ? 159 GLU A C     1 
ATOM   1207 O  O     . GLU A 1 159 ? -40.200 54.633 37.316 1.00 29.56 ? 159 GLU A O     1 
ATOM   1208 C  CB    . GLU A 1 159 ? -41.739 52.881 34.918 1.00 40.75 ? 159 GLU A CB    1 
ATOM   1209 C  CG    . GLU A 1 159 ? -42.370 52.781 33.554 1.00 45.92 ? 159 GLU A CG    1 
ATOM   1210 C  CD    . GLU A 1 159 ? -43.389 51.660 33.486 1.00 50.35 ? 159 GLU A CD    1 
ATOM   1211 O  OE1   . GLU A 1 159 ? -44.400 51.817 32.773 1.00 54.89 ? 159 GLU A OE1   1 
ATOM   1212 O  OE2   . GLU A 1 159 ? -43.187 50.618 34.150 1.00 53.90 ? 159 GLU A OE2   1 
ATOM   1213 N  N     . LYS A 1 160 ? -39.314 52.642 36.691 1.00 32.70 ? 160 LYS A N     1 
ATOM   1214 C  CA    . LYS A 1 160 ? -38.674 52.372 37.976 1.00 30.52 ? 160 LYS A CA    1 
ATOM   1215 C  C     . LYS A 1 160 ? -37.649 53.455 38.287 1.00 28.70 ? 160 LYS A C     1 
ATOM   1216 O  O     . LYS A 1 160 ? -37.500 53.870 39.433 1.00 30.04 ? 160 LYS A O     1 
ATOM   1217 C  CB    . LYS A 1 160 ? -37.985 51.005 37.938 1.00 27.50 ? 160 LYS A CB    1 
ATOM   1218 C  CG    . LYS A 1 160 ? -38.941 49.837 37.790 1.00 24.08 ? 160 LYS A CG    1 
ATOM   1219 C  CD    . LYS A 1 160 ? -38.194 48.560 37.465 1.00 21.69 ? 160 LYS A CD    1 
ATOM   1220 C  CE    . LYS A 1 160 ? -39.113 47.366 37.512 1.00 13.21 ? 160 LYS A CE    1 
ATOM   1221 N  NZ    . LYS A 1 160 ? -38.315 46.169 37.143 1.00 18.29 ? 160 LYS A NZ    1 
ATOM   1222 N  N     . LEU A 1 161 ? -36.919 53.875 37.260 1.00 29.48 ? 161 LEU A N     1 
ATOM   1223 C  CA    . LEU A 1 161 ? -35.909 54.917 37.391 1.00 29.73 ? 161 LEU A CA    1 
ATOM   1224 C  C     . LEU A 1 161 ? -36.535 56.281 37.732 1.00 32.61 ? 161 LEU A C     1 
ATOM   1225 O  O     . LEU A 1 161 ? -35.987 57.031 38.548 1.00 33.91 ? 161 LEU A O     1 
ATOM   1226 C  CB    . LEU A 1 161 ? -35.088 54.995 36.105 1.00 24.08 ? 161 LEU A CB    1 
ATOM   1227 C  CG    . LEU A 1 161 ? -34.025 56.076 36.012 1.00 24.69 ? 161 LEU A CG    1 
ATOM   1228 C  CD1   . LEU A 1 161 ? -32.877 55.784 36.960 1.00 25.75 ? 161 LEU A CD1   1 
ATOM   1229 C  CD2   . LEU A 1 161 ? -33.543 56.161 34.576 1.00 28.82 ? 161 LEU A CD2   1 
ATOM   1230 N  N     . LYS A 1 162 ? -37.679 56.594 37.115 1.00 34.69 ? 162 LYS A N     1 
ATOM   1231 C  CA    . LYS A 1 162 ? -38.399 57.854 37.362 1.00 33.12 ? 162 LYS A CA    1 
ATOM   1232 C  C     . LYS A 1 162 ? -38.801 57.975 38.834 1.00 31.69 ? 162 LYS A C     1 
ATOM   1233 O  O     . LYS A 1 162 ? -38.360 58.888 39.538 1.00 30.05 ? 162 LYS A O     1 
ATOM   1234 C  CB    . LYS A 1 162 ? -39.654 57.933 36.483 1.00 30.65 ? 162 LYS A CB    1 
ATOM   1235 C  CG    . LYS A 1 162 ? -40.509 59.186 36.679 1.00 32.42 ? 162 LYS A CG    1 
ATOM   1236 C  CD    . LYS A 1 162 ? -39.830 60.430 36.117 1.00 43.31 ? 162 LYS A CD    1 
ATOM   1237 C  CE    . LYS A 1 162 ? -40.772 61.654 36.086 1.00 45.56 ? 162 LYS A CE    1 
ATOM   1238 N  NZ    . LYS A 1 162 ? -40.232 62.796 35.266 1.00 41.28 ? 162 LYS A NZ    1 
ATOM   1239 N  N     . GLU A 1 163 ? -39.603 57.030 39.314 1.00 31.23 ? 163 GLU A N     1 
ATOM   1240 C  CA    . GLU A 1 163 ? -40.027 57.083 40.700 1.00 31.88 ? 163 GLU A CA    1 
ATOM   1241 C  C     . GLU A 1 163 ? -38.894 57.025 41.717 1.00 32.81 ? 163 GLU A C     1 
ATOM   1242 O  O     . GLU A 1 163 ? -38.954 57.730 42.721 1.00 38.61 ? 163 GLU A O     1 
ATOM   1243 C  CB    . GLU A 1 163 ? -41.113 56.058 41.009 1.00 30.67 ? 163 GLU A CB    1 
ATOM   1244 C  CG    . GLU A 1 163 ? -40.743 54.623 40.868 1.00 33.23 ? 163 GLU A CG    1 
ATOM   1245 C  CD    . GLU A 1 163 ? -41.866 53.720 41.358 1.00 40.93 ? 163 GLU A CD    1 
ATOM   1246 O  OE1   . GLU A 1 163 ? -41.644 52.960 42.323 1.00 48.83 ? 163 GLU A OE1   1 
ATOM   1247 O  OE2   . GLU A 1 163 ? -42.978 53.775 40.794 1.00 45.21 ? 163 GLU A OE2   1 
ATOM   1248 N  N     . VAL A 1 164 ? -37.847 56.241 41.465 1.00 29.47 ? 164 VAL A N     1 
ATOM   1249 C  CA    . VAL A 1 164 ? -36.731 56.188 42.417 1.00 26.90 ? 164 VAL A CA    1 
ATOM   1250 C  C     . VAL A 1 164 ? -35.965 57.503 42.433 1.00 23.93 ? 164 VAL A C     1 
ATOM   1251 O  O     . VAL A 1 164 ? -35.617 58.015 43.502 1.00 26.67 ? 164 VAL A O     1 
ATOM   1252 C  CB    . VAL A 1 164 ? -35.753 55.007 42.151 1.00 28.33 ? 164 VAL A CB    1 
ATOM   1253 C  CG1   . VAL A 1 164 ? -34.976 55.222 40.863 1.00 28.89 ? 164 VAL A CG1   1 
ATOM   1254 C  CG2   . VAL A 1 164 ? -34.799 54.834 43.343 1.00 26.57 ? 164 VAL A CG2   1 
ATOM   1255 N  N     . MET A 1 165 ? -35.689 58.051 41.252 1.00 24.95 ? 165 MET A N     1 
ATOM   1256 C  CA    . MET A 1 165 ? -34.987 59.324 41.162 1.00 19.14 ? 165 MET A CA    1 
ATOM   1257 C  C     . MET A 1 165 ? -35.872 60.357 41.848 1.00 20.25 ? 165 MET A C     1 
ATOM   1258 O  O     . MET A 1 165 ? -35.376 61.227 42.562 1.00 21.09 ? 165 MET A O     1 
ATOM   1259 C  CB    . MET A 1 165 ? -34.719 59.705 39.702 1.00 15.58 ? 165 MET A CB    1 
ATOM   1260 C  CG    . MET A 1 165 ? -33.672 58.837 39.018 1.00 19.40 ? 165 MET A CG    1 
ATOM   1261 S  SD    . MET A 1 165 ? -32.819 59.662 37.654 1.00 19.03 ? 165 MET A SD    1 
ATOM   1262 C  CE    . MET A 1 165 ? -32.198 61.122 38.431 1.00 13.35 ? 165 MET A CE    1 
ATOM   1263 N  N     . GLU A 1 166 ? -37.186 60.240 41.645 1.00 20.77 ? 166 GLU A N     1 
ATOM   1264 C  CA    . GLU A 1 166 ? -38.157 61.131 42.273 1.00 24.01 ? 166 GLU A CA    1 
ATOM   1265 C  C     . GLU A 1 166 ? -37.911 61.113 43.780 1.00 25.79 ? 166 GLU A C     1 
ATOM   1266 O  O     . GLU A 1 166 ? -37.739 62.166 44.411 1.00 25.67 ? 166 GLU A O     1 
ATOM   1267 C  CB    . GLU A 1 166 ? -39.578 60.634 42.007 1.00 25.92 ? 166 GLU A CB    1 
ATOM   1268 C  CG    . GLU A 1 166 ? -40.268 61.233 40.798 1.00 37.56 ? 166 GLU A CG    1 
ATOM   1269 C  CD    . GLU A 1 166 ? -41.662 60.654 40.569 1.00 44.85 ? 166 GLU A CD    1 
ATOM   1270 O  OE1   . GLU A 1 166 ? -42.024 59.647 41.219 1.00 47.76 ? 166 GLU A OE1   1 
ATOM   1271 O  OE2   . GLU A 1 166 ? -42.402 61.203 39.725 1.00 49.02 ? 166 GLU A OE2   1 
ATOM   1272 N  N     . TYR A 1 167 ? -37.879 59.893 44.327 1.00 26.65 ? 167 TYR A N     1 
ATOM   1273 C  CA    . TYR A 1 167 ? -37.654 59.625 45.743 1.00 22.90 ? 167 TYR A CA    1 
ATOM   1274 C  C     . TYR A 1 167 ? -36.387 60.293 46.241 1.00 23.63 ? 167 TYR A C     1 
ATOM   1275 O  O     . TYR A 1 167 ? -36.426 61.071 47.195 1.00 22.99 ? 167 TYR A O     1 
ATOM   1276 C  CB    . TYR A 1 167 ? -37.578 58.111 45.976 1.00 24.71 ? 167 TYR A CB    1 
ATOM   1277 C  CG    . TYR A 1 167 ? -37.235 57.706 47.392 1.00 28.03 ? 167 TYR A CG    1 
ATOM   1278 C  CD1   . TYR A 1 167 ? -38.220 57.626 48.391 1.00 26.32 ? 167 TYR A CD1   1 
ATOM   1279 C  CD2   . TYR A 1 167 ? -35.917 57.420 47.747 1.00 28.80 ? 167 TYR A CD2   1 
ATOM   1280 C  CE1   . TYR A 1 167 ? -37.884 57.269 49.718 1.00 25.90 ? 167 TYR A CE1   1 
ATOM   1281 C  CE2   . TYR A 1 167 ? -35.576 57.065 49.060 1.00 27.76 ? 167 TYR A CE2   1 
ATOM   1282 C  CZ    . TYR A 1 167 ? -36.555 56.990 50.034 1.00 27.21 ? 167 TYR A CZ    1 
ATOM   1283 O  OH    . TYR A 1 167 ? -36.180 56.610 51.306 1.00 22.96 ? 167 TYR A OH    1 
ATOM   1284 N  N     . HIS A 1 168 ? -35.267 60.009 45.587 1.00 23.22 ? 168 HIS A N     1 
ATOM   1285 C  CA    . HIS A 1 168 ? -33.997 60.592 46.005 1.00 24.54 ? 168 HIS A CA    1 
ATOM   1286 C  C     . HIS A 1 168 ? -33.898 62.090 45.857 1.00 27.04 ? 168 HIS A C     1 
ATOM   1287 O  O     . HIS A 1 168 ? -33.244 62.744 46.675 1.00 29.89 ? 168 HIS A O     1 
ATOM   1288 C  CB    . HIS A 1 168 ? -32.819 59.946 45.282 1.00 25.17 ? 168 HIS A CB    1 
ATOM   1289 C  CG    . HIS A 1 168 ? -32.585 58.522 45.665 1.00 26.43 ? 168 HIS A CG    1 
ATOM   1290 N  ND1   . HIS A 1 168 ? -32.288 57.545 44.742 1.00 29.56 ? 168 HIS A ND1   1 
ATOM   1291 C  CD2   . HIS A 1 168 ? -32.598 57.909 46.872 1.00 28.99 ? 168 HIS A CD2   1 
ATOM   1292 C  CE1   . HIS A 1 168 ? -32.123 56.391 45.361 1.00 30.19 ? 168 HIS A CE1   1 
ATOM   1293 N  NE2   . HIS A 1 168 ? -32.306 56.584 46.655 1.00 30.98 ? 168 HIS A NE2   1 
ATOM   1294 N  N     . ASN A 1 169 ? -34.497 62.641 44.805 1.00 29.75 ? 169 ASN A N     1 
ATOM   1295 C  CA    . ASN A 1 169 ? -34.433 64.089 44.587 1.00 32.11 ? 169 ASN A CA    1 
ATOM   1296 C  C     . ASN A 1 169 ? -35.148 64.889 45.665 1.00 34.10 ? 169 ASN A C     1 
ATOM   1297 O  O     . ASN A 1 169 ? -34.694 65.977 46.049 1.00 33.10 ? 169 ASN A O     1 
ATOM   1298 C  CB    . ASN A 1 169 ? -34.943 64.470 43.199 1.00 31.53 ? 169 ASN A CB    1 
ATOM   1299 C  CG    . ASN A 1 169 ? -33.839 64.464 42.156 1.00 33.01 ? 169 ASN A CG    1 
ATOM   1300 O  OD1   . ASN A 1 169 ? -32.695 64.842 42.442 1.00 28.62 ? 169 ASN A OD1   1 
ATOM   1301 N  ND2   . ASN A 1 169 ? -34.166 64.012 40.944 1.00 27.41 ? 169 ASN A ND2   1 
ATOM   1302 N  N     . PHE A 1 170 ? -36.256 64.348 46.165 1.00 33.11 ? 170 PHE A N     1 
ATOM   1303 C  CA    . PHE A 1 170 ? -36.990 65.010 47.222 1.00 32.34 ? 170 PHE A CA    1 
ATOM   1304 C  C     . PHE A 1 170 ? -36.003 65.248 48.358 1.00 35.07 ? 170 PHE A C     1 
ATOM   1305 O  O     . PHE A 1 170 ? -35.899 66.359 48.881 1.00 35.24 ? 170 PHE A O     1 
ATOM   1306 C  CB    . PHE A 1 170 ? -38.144 64.143 47.706 1.00 31.43 ? 170 PHE A CB    1 
ATOM   1307 C  CG    . PHE A 1 170 ? -39.013 64.820 48.722 1.00 37.58 ? 170 PHE A CG    1 
ATOM   1308 C  CD1   . PHE A 1 170 ? -38.687 64.783 50.076 1.00 40.67 ? 170 PHE A CD1   1 
ATOM   1309 C  CD2   . PHE A 1 170 ? -40.142 65.528 48.328 1.00 39.84 ? 170 PHE A CD2   1 
ATOM   1310 C  CE1   . PHE A 1 170 ? -39.472 65.447 51.025 1.00 40.78 ? 170 PHE A CE1   1 
ATOM   1311 C  CE2   . PHE A 1 170 ? -40.935 66.194 49.272 1.00 40.85 ? 170 PHE A CE2   1 
ATOM   1312 C  CZ    . PHE A 1 170 ? -40.596 66.152 50.622 1.00 37.83 ? 170 PHE A CZ    1 
ATOM   1313 N  N     . GLN A 1 171 ? -35.228 64.215 48.679 1.00 38.42 ? 171 GLN A N     1 
ATOM   1314 C  CA    . GLN A 1 171 ? -34.227 64.287 49.745 1.00 42.45 ? 171 GLN A CA    1 
ATOM   1315 C  C     . GLN A 1 171 ? -33.070 65.257 49.455 1.00 41.95 ? 171 GLN A C     1 
ATOM   1316 O  O     . GLN A 1 171 ? -32.621 65.992 50.346 1.00 42.53 ? 171 GLN A O     1 
ATOM   1317 C  CB    . GLN A 1 171 ? -33.668 62.893 50.041 1.00 42.85 ? 171 GLN A CB    1 
ATOM   1318 C  CG    . GLN A 1 171 ? -32.521 62.925 51.026 1.00 46.53 ? 171 GLN A CG    1 
ATOM   1319 C  CD    . GLN A 1 171 ? -31.915 61.566 51.311 1.00 51.91 ? 171 GLN A CD    1 
ATOM   1320 O  OE1   . GLN A 1 171 ? -31.906 60.664 50.459 1.00 50.97 ? 171 GLN A OE1   1 
ATOM   1321 N  NE2   . GLN A 1 171 ? -31.393 61.411 52.523 1.00 52.12 ? 171 GLN A NE2   1 
ATOM   1322 N  N     . LEU A 1 172 ? -32.568 65.226 48.224 1.00 38.68 ? 172 LEU A N     1 
ATOM   1323 C  CA    . LEU A 1 172 ? -31.470 66.094 47.805 1.00 34.10 ? 172 LEU A CA    1 
ATOM   1324 C  C     . LEU A 1 172 ? -31.836 67.587 47.838 1.00 33.84 ? 172 LEU A C     1 
ATOM   1325 O  O     . LEU A 1 172 ? -31.029 68.433 48.248 1.00 30.38 ? 172 LEU A O     1 
ATOM   1326 C  CB    . LEU A 1 172 ? -31.006 65.701 46.396 1.00 31.21 ? 172 LEU A CB    1 
ATOM   1327 C  CG    . LEU A 1 172 ? -30.221 64.397 46.226 1.00 29.39 ? 172 LEU A CG    1 
ATOM   1328 C  CD1   . LEU A 1 172 ? -30.091 64.058 44.744 1.00 27.67 ? 172 LEU A CD1   1 
ATOM   1329 C  CD2   . LEU A 1 172 ? -28.850 64.523 46.881 1.00 23.39 ? 172 LEU A CD2   1 
ATOM   1330 N  N     . VAL A 1 173 ? -33.047 67.909 47.397 1.00 31.07 ? 173 VAL A N     1 
ATOM   1331 C  CA    . VAL A 1 173 ? -33.486 69.291 47.381 1.00 33.66 ? 173 VAL A CA    1 
ATOM   1332 C  C     . VAL A 1 173 ? -34.033 69.792 48.720 1.00 34.62 ? 173 VAL A C     1 
ATOM   1333 O  O     . VAL A 1 173 ? -33.479 70.731 49.310 1.00 34.59 ? 173 VAL A O     1 
ATOM   1334 C  CB    . VAL A 1 173 ? -34.530 69.534 46.263 1.00 38.60 ? 173 VAL A CB    1 
ATOM   1335 C  CG1   . VAL A 1 173 ? -33.948 69.147 44.918 1.00 44.10 ? 173 VAL A CG1   1 
ATOM   1336 C  CG2   . VAL A 1 173 ? -35.796 68.742 46.508 1.00 42.71 ? 173 VAL A CG2   1 
ATOM   1337 N  N     . ASN A 1 174 ? -35.051 69.102 49.239 1.00 30.56 ? 174 ASN A N     1 
ATOM   1338 C  CA    . ASN A 1 174 ? -35.719 69.480 50.484 1.00 27.92 ? 174 ASN A CA    1 
ATOM   1339 C  C     . ASN A 1 174 ? -34.912 69.322 51.745 1.00 29.02 ? 174 ASN A C     1 
ATOM   1340 O  O     . ASN A 1 174 ? -34.933 70.193 52.615 1.00 27.09 ? 174 ASN A O     1 
ATOM   1341 C  CB    . ASN A 1 174 ? -37.014 68.693 50.657 1.00 22.96 ? 174 ASN A CB    1 
ATOM   1342 C  CG    . ASN A 1 174 ? -38.010 68.981 49.575 1.00 23.23 ? 174 ASN A CG    1 
ATOM   1343 O  OD1   . ASN A 1 174 ? -38.238 70.132 49.212 1.00 26.17 ? 174 ASN A OD1   1 
ATOM   1344 N  ND2   . ASN A 1 174 ? -38.600 67.941 49.037 1.00 24.91 ? 174 ASN A ND2   1 
ATOM   1345 N  N     . TYR A 1 175 ? -34.243 68.186 51.877 1.00 30.01 ? 175 TYR A N     1 
ATOM   1346 C  CA    . TYR A 1 175 ? -33.474 67.934 53.079 1.00 27.40 ? 175 TYR A CA    1 
ATOM   1347 C  C     . TYR A 1 175 ? -32.068 68.480 53.015 1.00 27.23 ? 175 TYR A C     1 
ATOM   1348 O  O     . TYR A 1 175 ? -31.679 69.301 53.851 1.00 29.31 ? 175 TYR A O     1 
ATOM   1349 C  CB    . TYR A 1 175 ? -33.455 66.439 53.412 1.00 25.82 ? 175 TYR A CB    1 
ATOM   1350 C  CG    . TYR A 1 175 ? -32.788 66.120 54.731 1.00 24.15 ? 175 TYR A CG    1 
ATOM   1351 C  CD1   . TYR A 1 175 ? -33.426 66.403 55.936 1.00 23.29 ? 175 TYR A CD1   1 
ATOM   1352 C  CD2   . TYR A 1 175 ? -31.530 65.519 54.776 1.00 20.13 ? 175 TYR A CD2   1 
ATOM   1353 C  CE1   . TYR A 1 175 ? -32.835 66.090 57.153 1.00 22.20 ? 175 TYR A CE1   1 
ATOM   1354 C  CE2   . TYR A 1 175 ? -30.929 65.206 55.987 1.00 22.61 ? 175 TYR A CE2   1 
ATOM   1355 C  CZ    . TYR A 1 175 ? -31.591 65.493 57.174 1.00 22.14 ? 175 TYR A CZ    1 
ATOM   1356 O  OH    . TYR A 1 175 ? -31.022 65.175 58.384 1.00 21.96 ? 175 TYR A OH    1 
ATOM   1357 N  N     . TYR A 1 176 ? -31.301 68.026 52.033 1.00 24.43 ? 176 TYR A N     1 
ATOM   1358 C  CA    . TYR A 1 176 ? -29.921 68.477 51.909 1.00 24.96 ? 176 TYR A CA    1 
ATOM   1359 C  C     . TYR A 1 176 ? -29.765 69.859 51.296 1.00 26.17 ? 176 TYR A C     1 
ATOM   1360 O  O     . TYR A 1 176 ? -28.693 70.459 51.397 1.00 24.46 ? 176 TYR A O     1 
ATOM   1361 C  CB    . TYR A 1 176 ? -29.090 67.454 51.128 1.00 23.48 ? 176 TYR A CB    1 
ATOM   1362 C  CG    . TYR A 1 176 ? -28.943 66.121 51.833 1.00 20.96 ? 176 TYR A CG    1 
ATOM   1363 C  CD1   . TYR A 1 176 ? -28.045 65.964 52.902 1.00 22.14 ? 176 TYR A CD1   1 
ATOM   1364 C  CD2   . TYR A 1 176 ? -29.702 65.019 51.443 1.00 17.63 ? 176 TYR A CD2   1 
ATOM   1365 C  CE1   . TYR A 1 176 ? -27.912 64.739 53.563 1.00 23.28 ? 176 TYR A CE1   1 
ATOM   1366 C  CE2   . TYR A 1 176 ? -29.577 63.794 52.094 1.00 24.10 ? 176 TYR A CE2   1 
ATOM   1367 C  CZ    . TYR A 1 176 ? -28.687 63.660 53.152 1.00 26.07 ? 176 TYR A CZ    1 
ATOM   1368 O  OH    . TYR A 1 176 ? -28.598 62.453 53.805 1.00 31.01 ? 176 TYR A OH    1 
ATOM   1369 N  N     . LYS A 1 177 ? -30.833 70.368 50.682 1.00 29.99 ? 177 LYS A N     1 
ATOM   1370 C  CA    . LYS A 1 177 ? -30.799 71.684 50.041 1.00 36.86 ? 177 LYS A CA    1 
ATOM   1371 C  C     . LYS A 1 177 ? -29.700 71.669 48.974 1.00 38.87 ? 177 LYS A C     1 
ATOM   1372 O  O     . LYS A 1 177 ? -28.914 72.623 48.848 1.00 38.23 ? 177 LYS A O     1 
ATOM   1373 C  CB    . LYS A 1 177 ? -30.515 72.799 51.067 1.00 38.00 ? 177 LYS A CB    1 
ATOM   1374 C  CG    . LYS A 1 177 ? -31.543 72.933 52.182 1.00 39.37 ? 177 LYS A CG    1 
ATOM   1375 C  CD    . LYS A 1 177 ? -32.933 73.093 51.610 1.00 40.68 ? 177 LYS A CD    1 
ATOM   1376 C  CE    . LYS A 1 177 ? -33.955 73.248 52.709 1.00 45.04 ? 177 LYS A CE    1 
ATOM   1377 N  NZ    . LYS A 1 177 ? -35.328 72.975 52.196 1.00 49.52 ? 177 LYS A NZ    1 
ATOM   1378 N  N     . ALA A 1 178 ? -29.631 70.563 48.237 1.00 38.97 ? 178 ALA A N     1 
ATOM   1379 C  CA    . ALA A 1 178 ? -28.632 70.387 47.194 1.00 40.37 ? 178 ALA A CA    1 
ATOM   1380 C  C     . ALA A 1 178 ? -29.306 70.316 45.829 1.00 38.67 ? 178 ALA A C     1 
ATOM   1381 O  O     . ALA A 1 178 ? -30.536 70.243 45.746 1.00 39.04 ? 178 ALA A O     1 
ATOM   1382 C  CB    . ALA A 1 178 ? -27.844 69.107 47.458 1.00 41.01 ? 178 ALA A CB    1 
ATOM   1383 N  N     . GLU A 1 179 ? -28.506 70.355 44.766 1.00 33.07 ? 179 GLU A N     1 
ATOM   1384 C  CA    . GLU A 1 179 ? -29.042 70.257 43.417 1.00 33.17 ? 179 GLU A CA    1 
ATOM   1385 C  C     . GLU A 1 179 ? -29.670 68.888 43.174 1.00 33.04 ? 179 GLU A C     1 
ATOM   1386 O  O     . GLU A 1 179 ? -29.143 67.852 43.613 1.00 32.68 ? 179 GLU A O     1 
ATOM   1387 C  CB    . GLU A 1 179 ? -27.943 70.474 42.373 1.00 38.96 ? 179 GLU A CB    1 
ATOM   1388 C  CG    . GLU A 1 179 ? -27.441 71.906 42.241 1.00 46.87 ? 179 GLU A CG    1 
ATOM   1389 C  CD    . GLU A 1 179 ? -28.467 72.849 41.623 1.00 51.65 ? 179 GLU A CD    1 
ATOM   1390 O  OE1   . GLU A 1 179 ? -29.587 72.978 42.167 1.00 55.81 ? 179 GLU A OE1   1 
ATOM   1391 O  OE2   . GLU A 1 179 ? -28.141 73.479 40.596 1.00 55.40 ? 179 GLU A OE2   1 
ATOM   1392 N  N     . ALA A 1 180 ? -30.796 68.897 42.474 1.00 28.77 ? 180 ALA A N     1 
ATOM   1393 C  CA    . ALA A 1 180 ? -31.510 67.681 42.122 1.00 29.10 ? 180 ALA A CA    1 
ATOM   1394 C  C     . ALA A 1 180 ? -30.821 67.054 40.906 1.00 31.20 ? 180 ALA A C     1 
ATOM   1395 O  O     . ALA A 1 180 ? -30.154 67.754 40.132 1.00 33.53 ? 180 ALA A O     1 
ATOM   1396 C  CB    . ALA A 1 180 ? -32.956 68.013 41.775 1.00 27.76 ? 180 ALA A CB    1 
ATOM   1397 N  N     . VAL A 1 181 ? -30.968 65.741 40.745 1.00 29.69 ? 181 VAL A N     1 
ATOM   1398 C  CA    . VAL A 1 181 ? -30.383 65.033 39.609 1.00 27.60 ? 181 VAL A CA    1 
ATOM   1399 C  C     . VAL A 1 181 ? -31.495 64.829 38.567 1.00 29.04 ? 181 VAL A C     1 
ATOM   1400 O  O     . VAL A 1 181 ? -32.588 64.349 38.889 1.00 24.43 ? 181 VAL A O     1 
ATOM   1401 C  CB    . VAL A 1 181 ? -29.754 63.680 40.048 1.00 28.92 ? 181 VAL A CB    1 
ATOM   1402 C  CG1   . VAL A 1 181 ? -29.147 62.945 38.855 1.00 26.38 ? 181 VAL A CG1   1 
ATOM   1403 C  CG2   . VAL A 1 181 ? -28.671 63.926 41.099 1.00 28.21 ? 181 VAL A CG2   1 
ATOM   1404 N  N     . ASP A 1 182 ? -31.210 65.239 37.332 1.00 30.77 ? 182 ASP A N     1 
ATOM   1405 C  CA    . ASP A 1 182 ? -32.151 65.165 36.210 1.00 30.12 ? 182 ASP A CA    1 
ATOM   1406 C  C     . ASP A 1 182 ? -32.424 63.761 35.691 1.00 29.50 ? 182 ASP A C     1 
ATOM   1407 O  O     . ASP A 1 182 ? -31.527 63.093 35.155 1.00 28.72 ? 182 ASP A O     1 
ATOM   1408 C  CB    . ASP A 1 182 ? -31.644 66.044 35.064 1.00 32.04 ? 182 ASP A CB    1 
ATOM   1409 C  CG    . ASP A 1 182 ? -32.643 66.180 33.938 1.00 36.22 ? 182 ASP A CG    1 
ATOM   1410 O  OD1   . ASP A 1 182 ? -33.863 66.294 34.209 1.00 38.45 ? 182 ASP A OD1   1 
ATOM   1411 O  OD2   . ASP A 1 182 ? -32.200 66.186 32.773 1.00 37.09 ? 182 ASP A OD2   1 
ATOM   1412 N  N     . TYR A 1 183 ? -33.684 63.346 35.798 1.00 28.18 ? 183 TYR A N     1 
ATOM   1413 C  CA    . TYR A 1 183 ? -34.110 62.020 35.353 1.00 30.20 ? 183 TYR A CA    1 
ATOM   1414 C  C     . TYR A 1 183 ? -33.789 61.723 33.877 1.00 32.14 ? 183 TYR A C     1 
ATOM   1415 O  O     . TYR A 1 183 ? -33.098 60.745 33.559 1.00 31.78 ? 183 TYR A O     1 
ATOM   1416 C  CB    . TYR A 1 183 ? -35.612 61.828 35.621 1.00 26.85 ? 183 TYR A CB    1 
ATOM   1417 C  CG    . TYR A 1 183 ? -36.233 60.653 34.884 1.00 32.61 ? 183 TYR A CG    1 
ATOM   1418 C  CD1   . TYR A 1 183 ? -37.004 60.849 33.734 1.00 36.36 ? 183 TYR A CD1   1 
ATOM   1419 C  CD2   . TYR A 1 183 ? -36.035 59.348 35.319 1.00 35.90 ? 183 TYR A CD2   1 
ATOM   1420 C  CE1   . TYR A 1 183 ? -37.557 59.772 33.039 1.00 34.11 ? 183 TYR A CE1   1 
ATOM   1421 C  CE2   . TYR A 1 183 ? -36.583 58.265 34.631 1.00 36.00 ? 183 TYR A CE2   1 
ATOM   1422 C  CZ    . TYR A 1 183 ? -37.340 58.482 33.494 1.00 36.63 ? 183 TYR A CZ    1 
ATOM   1423 O  OH    . TYR A 1 183 ? -37.875 57.406 32.822 1.00 32.43 ? 183 TYR A OH    1 
ATOM   1424 N  N     . GLN A 1 184 ? -34.269 62.587 32.986 1.00 32.76 ? 184 GLN A N     1 
ATOM   1425 C  CA    . GLN A 1 184 ? -34.077 62.410 31.558 1.00 27.66 ? 184 GLN A CA    1 
ATOM   1426 C  C     . GLN A 1 184 ? -32.637 62.152 31.164 1.00 28.36 ? 184 GLN A C     1 
ATOM   1427 O  O     . GLN A 1 184 ? -32.377 61.296 30.314 1.00 29.36 ? 184 GLN A O     1 
ATOM   1428 C  CB    . GLN A 1 184 ? -34.640 63.601 30.790 1.00 28.37 ? 184 GLN A CB    1 
ATOM   1429 C  CG    . GLN A 1 184 ? -34.797 63.346 29.298 1.00 29.55 ? 184 GLN A CG    1 
ATOM   1430 C  CD    . GLN A 1 184 ? -35.631 62.103 28.966 1.00 28.36 ? 184 GLN A CD    1 
ATOM   1431 O  OE1   . GLN A 1 184 ? -36.857 62.103 29.100 1.00 22.74 ? 184 GLN A OE1   1 
ATOM   1432 N  NE2   . GLN A 1 184 ? -34.964 61.044 28.522 1.00 28.72 ? 184 GLN A NE2   1 
ATOM   1433 N  N     . LYS A 1 185 ? -31.694 62.817 31.828 1.00 28.54 ? 185 LYS A N     1 
ATOM   1434 C  CA    . LYS A 1 185 ? -30.279 62.627 31.495 1.00 27.05 ? 185 LYS A CA    1 
ATOM   1435 C  C     . LYS A 1 185 ? -29.724 61.278 31.919 1.00 29.95 ? 185 LYS A C     1 
ATOM   1436 O  O     . LYS A 1 185 ? -29.005 60.632 31.150 1.00 29.30 ? 185 LYS A O     1 
ATOM   1437 C  CB    . LYS A 1 185 ? -29.414 63.730 32.069 1.00 22.73 ? 185 LYS A CB    1 
ATOM   1438 C  CG    . LYS A 1 185 ? -27.945 63.483 31.839 1.00 24.75 ? 185 LYS A CG    1 
ATOM   1439 C  CD    . LYS A 1 185 ? -27.110 64.608 32.406 1.00 23.28 ? 185 LYS A CD    1 
ATOM   1440 C  CE    . LYS A 1 185 ? -25.654 64.221 32.407 1.00 25.74 ? 185 LYS A CE    1 
ATOM   1441 N  NZ    . LYS A 1 185 ? -25.287 63.571 31.122 1.00 29.28 ? 185 LYS A NZ    1 
ATOM   1442 N  N     . VAL A 1 186 ? -30.036 60.868 33.148 1.00 29.13 ? 186 VAL A N     1 
ATOM   1443 C  CA    . VAL A 1 186 ? -29.581 59.574 33.668 1.00 25.84 ? 186 VAL A CA    1 
ATOM   1444 C  C     . VAL A 1 186 ? -30.127 58.451 32.790 1.00 22.53 ? 186 VAL A C     1 
ATOM   1445 O  O     . VAL A 1 186 ? -29.439 57.448 32.536 1.00 17.72 ? 186 VAL A O     1 
ATOM   1446 C  CB    . VAL A 1 186 ? -30.061 59.370 35.111 1.00 24.56 ? 186 VAL A CB    1 
ATOM   1447 C  CG1   . VAL A 1 186 ? -29.753 57.968 35.582 1.00 26.69 ? 186 VAL A CG1   1 
ATOM   1448 C  CG2   . VAL A 1 186 ? -29.407 60.395 36.009 1.00 28.01 ? 186 VAL A CG2   1 
ATOM   1449 N  N     . LEU A 1 187 ? -31.378 58.622 32.359 1.00 21.41 ? 187 LEU A N     1 
ATOM   1450 C  CA    . LEU A 1 187 ? -32.059 57.667 31.489 1.00 20.76 ? 187 LEU A CA    1 
ATOM   1451 C  C     . LEU A 1 187 ? -31.333 57.599 30.154 1.00 23.82 ? 187 LEU A C     1 
ATOM   1452 O  O     . LEU A 1 187 ? -30.961 56.521 29.693 1.00 25.43 ? 187 LEU A O     1 
ATOM   1453 C  CB    . LEU A 1 187 ? -33.511 58.102 31.273 1.00 20.79 ? 187 LEU A CB    1 
ATOM   1454 C  CG    . LEU A 1 187 ? -34.405 57.377 30.260 1.00 15.34 ? 187 LEU A CG    1 
ATOM   1455 C  CD1   . LEU A 1 187 ? -34.519 55.899 30.551 1.00 20.87 ? 187 LEU A CD1   1 
ATOM   1456 C  CD2   . LEU A 1 187 ? -35.764 57.989 30.310 1.00 17.94 ? 187 LEU A CD2   1 
ATOM   1457 N  N     . ASP A 1 188 ? -31.124 58.756 29.535 1.00 27.44 ? 188 ASP A N     1 
ATOM   1458 C  CA    . ASP A 1 188 ? -30.428 58.806 28.259 1.00 27.49 ? 188 ASP A CA    1 
ATOM   1459 C  C     . ASP A 1 188 ? -29.066 58.156 28.389 1.00 28.29 ? 188 ASP A C     1 
ATOM   1460 O  O     . ASP A 1 188 ? -28.795 57.161 27.721 1.00 32.96 ? 188 ASP A O     1 
ATOM   1461 C  CB    . ASP A 1 188 ? -30.268 60.247 27.799 1.00 29.57 ? 188 ASP A CB    1 
ATOM   1462 C  CG    . ASP A 1 188 ? -31.588 60.909 27.510 1.00 32.12 ? 188 ASP A CG    1 
ATOM   1463 O  OD1   . ASP A 1 188 ? -32.567 60.192 27.188 1.00 31.10 ? 188 ASP A OD1   1 
ATOM   1464 O  OD2   . ASP A 1 188 ? -31.647 62.154 27.606 1.00 37.08 ? 188 ASP A OD2   1 
ATOM   1465 N  N     . ASP A 1 189 ? -28.241 58.677 29.293 1.00 24.90 ? 189 ASP A N     1 
ATOM   1466 C  CA    . ASP A 1 189 ? -26.895 58.150 29.516 1.00 26.51 ? 189 ASP A CA    1 
ATOM   1467 C  C     . ASP A 1 189 ? -26.870 56.626 29.630 1.00 24.74 ? 189 ASP A C     1 
ATOM   1468 O  O     . ASP A 1 189 ? -26.069 55.951 28.971 1.00 25.58 ? 189 ASP A O     1 
ATOM   1469 C  CB    . ASP A 1 189 ? -26.285 58.750 30.791 1.00 27.11 ? 189 ASP A CB    1 
ATOM   1470 C  CG    . ASP A 1 189 ? -26.135 60.257 30.730 1.00 30.53 ? 189 ASP A CG    1 
ATOM   1471 O  OD1   . ASP A 1 189 ? -25.402 60.797 31.581 1.00 35.42 ? 189 ASP A OD1   1 
ATOM   1472 O  OD2   . ASP A 1 189 ? -26.748 60.915 29.863 1.00 36.54 ? 189 ASP A OD2   1 
ATOM   1473 N  N     . THR A 1 190 ? -27.753 56.091 30.467 1.00 23.78 ? 190 THR A N     1 
ATOM   1474 C  CA    . THR A 1 190 ? -27.833 54.649 30.695 1.00 26.03 ? 190 THR A CA    1 
ATOM   1475 C  C     . THR A 1 190 ? -28.261 53.911 29.425 1.00 27.26 ? 190 THR A C     1 
ATOM   1476 O  O     . THR A 1 190 ? -27.583 52.980 28.976 1.00 28.92 ? 190 THR A O     1 
ATOM   1477 C  CB    . THR A 1 190 ? -28.800 54.339 31.874 1.00 23.66 ? 190 THR A CB    1 
ATOM   1478 O  OG1   . THR A 1 190 ? -28.394 55.089 33.027 1.00 16.31 ? 190 THR A OG1   1 
ATOM   1479 C  CG2   . THR A 1 190 ? -28.796 52.867 32.209 1.00 20.46 ? 190 THR A CG2   1 
ATOM   1480 N  N     . MET A 1 191 ? -29.368 54.352 28.829 1.00 27.91 ? 191 MET A N     1 
ATOM   1481 C  CA    . MET A 1 191 ? -29.877 53.744 27.607 1.00 28.64 ? 191 MET A CA    1 
ATOM   1482 C  C     . MET A 1 191 ? -28.818 53.741 26.506 1.00 29.48 ? 191 MET A C     1 
ATOM   1483 O  O     . MET A 1 191 ? -28.836 52.888 25.614 1.00 28.89 ? 191 MET A O     1 
ATOM   1484 C  CB    . MET A 1 191 ? -31.114 54.485 27.121 1.00 29.83 ? 191 MET A CB    1 
ATOM   1485 C  CG    . MET A 1 191 ? -32.350 54.202 27.918 1.00 31.00 ? 191 MET A CG    1 
ATOM   1486 S  SD    . MET A 1 191 ? -32.745 52.464 27.909 1.00 38.13 ? 191 MET A SD    1 
ATOM   1487 C  CE    . MET A 1 191 ? -32.835 52.127 29.666 1.00 35.62 ? 191 MET A CE    1 
ATOM   1488 N  N     . ALA A 1 192 ? -27.902 54.703 26.570 1.00 29.56 ? 192 ALA A N     1 
ATOM   1489 C  CA    . ALA A 1 192 ? -26.823 54.813 25.597 1.00 28.56 ? 192 ALA A CA    1 
ATOM   1490 C  C     . ALA A 1 192 ? -25.920 53.581 25.622 1.00 30.62 ? 192 ALA A C     1 
ATOM   1491 O  O     . ALA A 1 192 ? -25.317 53.224 24.600 1.00 32.98 ? 192 ALA A O     1 
ATOM   1492 C  CB    . ALA A 1 192 ? -26.006 56.076 25.858 1.00 24.32 ? 192 ALA A CB    1 
ATOM   1493 N  N     . VAL A 1 193 ? -25.870 52.903 26.769 1.00 28.22 ? 193 VAL A N     1 
ATOM   1494 C  CA    . VAL A 1 193 ? -25.023 51.725 26.913 1.00 26.39 ? 193 VAL A CA    1 
ATOM   1495 C  C     . VAL A 1 193 ? -25.749 50.423 27.291 1.00 27.72 ? 193 VAL A C     1 
ATOM   1496 O  O     . VAL A 1 193 ? -25.123 49.355 27.369 1.00 26.35 ? 193 VAL A O     1 
ATOM   1497 C  CB    . VAL A 1 193 ? -23.865 52.003 27.905 1.00 28.03 ? 193 VAL A CB    1 
ATOM   1498 C  CG1   . VAL A 1 193 ? -23.040 53.188 27.422 1.00 25.26 ? 193 VAL A CG1   1 
ATOM   1499 C  CG2   . VAL A 1 193 ? -24.411 52.281 29.305 1.00 32.40 ? 193 VAL A CG2   1 
ATOM   1500 N  N     . ALA A 1 194 ? -27.065 50.511 27.498 1.00 26.01 ? 194 ALA A N     1 
ATOM   1501 C  CA    . ALA A 1 194 ? -27.899 49.361 27.854 1.00 23.81 ? 194 ALA A CA    1 
ATOM   1502 C  C     . ALA A 1 194 ? -27.551 48.065 27.111 1.00 25.72 ? 194 ALA A C     1 
ATOM   1503 O  O     . ALA A 1 194 ? -27.403 46.986 27.712 1.00 28.82 ? 194 ALA A O     1 
ATOM   1504 C  CB    . ALA A 1 194 ? -29.368 49.698 27.630 1.00 15.53 ? 194 ALA A CB    1 
ATOM   1505 N  N     . ASP A 1 195 ? -27.400 48.169 25.800 1.00 26.88 ? 195 ASP A N     1 
ATOM   1506 C  CA    . ASP A 1 195 ? -27.100 46.996 25.001 1.00 24.30 ? 195 ASP A CA    1 
ATOM   1507 C  C     . ASP A 1 195 ? -25.701 46.451 25.241 1.00 23.95 ? 195 ASP A C     1 
ATOM   1508 O  O     . ASP A 1 195 ? -25.505 45.238 25.204 1.00 23.84 ? 195 ASP A O     1 
ATOM   1509 C  CB    . ASP A 1 195 ? -27.352 47.282 23.525 1.00 25.60 ? 195 ASP A CB    1 
ATOM   1510 C  CG    . ASP A 1 195 ? -28.807 47.600 23.239 1.00 24.01 ? 195 ASP A CG    1 
ATOM   1511 O  OD1   . ASP A 1 195 ? -29.613 46.658 23.195 1.00 25.56 ? 195 ASP A OD1   1 
ATOM   1512 O  OD2   . ASP A 1 195 ? -29.154 48.789 23.071 1.00 27.51 ? 195 ASP A OD2   1 
ATOM   1513 N  N     . ILE A 1 196 ? -24.732 47.323 25.520 1.00 26.68 ? 196 ILE A N     1 
ATOM   1514 C  CA    . ILE A 1 196 ? -23.369 46.847 25.775 1.00 26.39 ? 196 ILE A CA    1 
ATOM   1515 C  C     . ILE A 1 196 ? -23.397 46.083 27.085 1.00 26.99 ? 196 ILE A C     1 
ATOM   1516 O  O     . ILE A 1 196 ? -22.949 44.937 27.147 1.00 25.53 ? 196 ILE A O     1 
ATOM   1517 C  CB    . ILE A 1 196 ? -22.318 47.977 25.869 1.00 21.42 ? 196 ILE A CB    1 
ATOM   1518 C  CG1   . ILE A 1 196 ? -22.293 48.797 24.580 1.00 19.32 ? 196 ILE A CG1   1 
ATOM   1519 C  CG2   . ILE A 1 196 ? -20.943 47.374 26.090 1.00 18.33 ? 196 ILE A CG2   1 
ATOM   1520 C  CD1   . ILE A 1 196 ? -21.208 49.851 24.551 1.00 14.80 ? 196 ILE A CD1   1 
ATOM   1521 N  N     . LEU A 1 197 ? -23.994 46.697 28.105 1.00 29.35 ? 197 LEU A N     1 
ATOM   1522 C  CA    . LEU A 1 197 ? -24.113 46.082 29.425 1.00 27.97 ? 197 LEU A CA    1 
ATOM   1523 C  C     . LEU A 1 197 ? -24.734 44.703 29.331 1.00 26.87 ? 197 LEU A C     1 
ATOM   1524 O  O     . LEU A 1 197 ? -24.119 43.713 29.724 1.00 27.49 ? 197 LEU A O     1 
ATOM   1525 C  CB    . LEU A 1 197 ? -24.966 46.944 30.358 1.00 30.31 ? 197 LEU A CB    1 
ATOM   1526 C  CG    . LEU A 1 197 ? -24.261 48.034 31.167 1.00 31.61 ? 197 LEU A CG    1 
ATOM   1527 C  CD1   . LEU A 1 197 ? -23.220 47.417 32.059 1.00 29.46 ? 197 LEU A CD1   1 
ATOM   1528 C  CD2   . LEU A 1 197 ? -23.622 49.026 30.239 1.00 35.19 ? 197 LEU A CD2   1 
ATOM   1529 N  N     . THR A 1 198 ? -25.938 44.637 28.770 1.00 26.33 ? 198 THR A N     1 
ATOM   1530 C  CA    . THR A 1 198 ? -26.649 43.368 28.644 1.00 24.59 ? 198 THR A CA    1 
ATOM   1531 C  C     . THR A 1 198 ? -25.917 42.310 27.841 1.00 19.69 ? 198 THR A C     1 
ATOM   1532 O  O     . THR A 1 198 ? -26.036 41.123 28.128 1.00 20.23 ? 198 THR A O     1 
ATOM   1533 C  CB    . THR A 1 198 ? -28.064 43.559 28.058 1.00 25.59 ? 198 THR A CB    1 
ATOM   1534 O  OG1   . THR A 1 198 ? -27.988 44.269 26.813 1.00 28.85 ? 198 THR A OG1   1 
ATOM   1535 C  CG2   . THR A 1 198 ? -28.934 44.345 29.037 1.00 27.96 ? 198 THR A CG2   1 
ATOM   1536 N  N     . SER A 1 199 ? -25.128 42.732 26.864 1.00 17.66 ? 199 SER A N     1 
ATOM   1537 C  CA    . SER A 1 199 ? -24.407 41.777 26.039 1.00 18.74 ? 199 SER A CA    1 
ATOM   1538 C  C     . SER A 1 199 ? -23.440 40.931 26.846 1.00 17.41 ? 199 SER A C     1 
ATOM   1539 O  O     . SER A 1 199 ? -23.216 39.774 26.518 1.00 20.57 ? 199 SER A O     1 
ATOM   1540 C  CB    . SER A 1 199 ? -23.677 42.487 24.888 1.00 23.16 ? 199 SER A CB    1 
ATOM   1541 O  OG    . SER A 1 199 ? -22.460 43.084 25.314 1.00 32.62 ? 199 SER A OG    1 
ATOM   1542 N  N     . MET A 1 200 ? -22.903 41.482 27.930 1.00 17.36 ? 200 MET A N     1 
ATOM   1543 C  CA    . MET A 1 200 ? -21.955 40.733 28.757 1.00 17.26 ? 200 MET A CA    1 
ATOM   1544 C  C     . MET A 1 200 ? -22.579 39.904 29.862 1.00 17.31 ? 200 MET A C     1 
ATOM   1545 O  O     . MET A 1 200 ? -21.856 39.307 30.658 1.00 20.36 ? 200 MET A O     1 
ATOM   1546 C  CB    . MET A 1 200 ? -20.946 41.675 29.389 1.00 18.13 ? 200 MET A CB    1 
ATOM   1547 C  CG    . MET A 1 200 ? -20.645 42.852 28.514 1.00 26.86 ? 200 MET A CG    1 
ATOM   1548 S  SD    . MET A 1 200 ? -19.203 43.725 29.001 1.00 27.46 ? 200 MET A SD    1 
ATOM   1549 C  CE    . MET A 1 200 ? -18.037 42.817 28.020 1.00 23.35 ? 200 MET A CE    1 
ATOM   1550 N  N     . VAL A 1 201 ? -23.904 39.839 29.918 1.00 13.65 ? 201 VAL A N     1 
ATOM   1551 C  CA    . VAL A 1 201 ? -24.549 39.093 30.986 1.00 14.02 ? 201 VAL A CA    1 
ATOM   1552 C  C     . VAL A 1 201 ? -24.441 37.578 30.908 1.00 16.62 ? 201 VAL A C     1 
ATOM   1553 O  O     . VAL A 1 201 ? -24.662 36.976 29.852 1.00 19.07 ? 201 VAL A O     1 
ATOM   1554 C  CB    . VAL A 1 201 ? -26.054 39.503 31.163 1.00 11.59 ? 201 VAL A CB    1 
ATOM   1555 C  CG1   . VAL A 1 201 ? -26.766 38.555 32.130 1.00 8.40  ? 201 VAL A CG1   1 
ATOM   1556 C  CG2   . VAL A 1 201 ? -26.161 40.943 31.679 1.00 8.25  ? 201 VAL A CG2   1 
ATOM   1557 N  N     . VAL A 1 202 ? -24.082 36.974 32.042 1.00 18.26 ? 202 VAL A N     1 
ATOM   1558 C  CA    . VAL A 1 202 ? -24.017 35.511 32.176 1.00 16.13 ? 202 VAL A CA    1 
ATOM   1559 C  C     . VAL A 1 202 ? -24.568 35.181 33.564 1.00 16.60 ? 202 VAL A C     1 
ATOM   1560 O  O     . VAL A 1 202 ? -24.662 36.065 34.425 1.00 15.91 ? 202 VAL A O     1 
ATOM   1561 C  CB    . VAL A 1 202 ? -22.579 34.931 32.045 1.00 12.21 ? 202 VAL A CB    1 
ATOM   1562 C  CG1   . VAL A 1 202 ? -21.728 35.304 33.227 1.00 5.01  ? 202 VAL A CG1   1 
ATOM   1563 C  CG2   . VAL A 1 202 ? -22.637 33.428 31.904 1.00 9.28  ? 202 VAL A CG2   1 
ATOM   1564 N  N     . ASP A 1 203 ? -25.037 33.948 33.734 1.00 14.96 ? 203 ASP A N     1 
ATOM   1565 C  CA    . ASP A 1 203 ? -25.553 33.468 35.014 1.00 9.39  ? 203 ASP A CA    1 
ATOM   1566 C  C     . ASP A 1 203 ? -24.273 33.012 35.720 1.00 8.52  ? 203 ASP A C     1 
ATOM   1567 O  O     . ASP A 1 203 ? -23.910 31.825 35.665 1.00 5.01  ? 203 ASP A O     1 
ATOM   1568 C  CB    . ASP A 1 203 ? -26.468 32.283 34.756 1.00 10.53 ? 203 ASP A CB    1 
ATOM   1569 C  CG    . ASP A 1 203 ? -27.143 31.773 36.003 1.00 11.35 ? 203 ASP A CG    1 
ATOM   1570 O  OD1   . ASP A 1 203 ? -26.646 32.032 37.113 1.00 11.24 ? 203 ASP A OD1   1 
ATOM   1571 O  OD2   . ASP A 1 203 ? -28.174 31.077 35.859 1.00 14.46 ? 203 ASP A OD2   1 
ATOM   1572 N  N     . VAL A 1 204 ? -23.582 33.954 36.371 1.00 5.01  ? 204 VAL A N     1 
ATOM   1573 C  CA    . VAL A 1 204 ? -22.312 33.623 37.005 1.00 11.07 ? 204 VAL A CA    1 
ATOM   1574 C  C     . VAL A 1 204 ? -22.310 32.585 38.138 1.00 12.19 ? 204 VAL A C     1 
ATOM   1575 O  O     . VAL A 1 204 ? -21.366 31.794 38.232 1.00 15.73 ? 204 VAL A O     1 
ATOM   1576 C  CB    . VAL A 1 204 ? -21.433 34.891 37.352 1.00 15.33 ? 204 VAL A CB    1 
ATOM   1577 C  CG1   . VAL A 1 204 ? -21.951 36.161 36.627 1.00 6.08  ? 204 VAL A CG1   1 
ATOM   1578 C  CG2   . VAL A 1 204 ? -21.275 35.072 38.868 1.00 13.05 ? 204 VAL A CG2   1 
ATOM   1579 N  N     . SER A 1 205 ? -23.372 32.515 38.940 1.00 11.57 ? 205 SER A N     1 
ATOM   1580 C  CA    . SER A 1 205 ? -23.394 31.530 40.015 1.00 12.45 ? 205 SER A CA    1 
ATOM   1581 C  C     . SER A 1 205 ? -23.410 30.135 39.428 1.00 12.66 ? 205 SER A C     1 
ATOM   1582 O  O     . SER A 1 205 ? -22.668 29.270 39.872 1.00 17.96 ? 205 SER A O     1 
ATOM   1583 C  CB    . SER A 1 205 ? -24.567 31.743 40.977 1.00 6.23  ? 205 SER A CB    1 
ATOM   1584 O  OG    . SER A 1 205 ? -25.768 31.187 40.486 1.00 20.39 ? 205 SER A OG    1 
ATOM   1585 N  N     . ASP A 1 206 ? -24.231 29.916 38.407 1.00 18.46 ? 206 ASP A N     1 
ATOM   1586 C  CA    . ASP A 1 206 ? -24.296 28.600 37.758 1.00 18.59 ? 206 ASP A CA    1 
ATOM   1587 C  C     . ASP A 1 206 ? -22.980 28.340 37.006 1.00 18.53 ? 206 ASP A C     1 
ATOM   1588 O  O     . ASP A 1 206 ? -22.475 27.208 36.989 1.00 16.01 ? 206 ASP A O     1 
ATOM   1589 C  CB    . ASP A 1 206 ? -25.505 28.521 36.815 1.00 22.92 ? 206 ASP A CB    1 
ATOM   1590 C  CG    . ASP A 1 206 ? -25.669 27.146 36.169 1.00 29.04 ? 206 ASP A CG    1 
ATOM   1591 O  OD1   . ASP A 1 206 ? -26.047 27.094 34.974 1.00 33.81 ? 206 ASP A OD1   1 
ATOM   1592 O  OD2   . ASP A 1 206 ? -25.421 26.116 36.841 1.00 32.05 ? 206 ASP A OD2   1 
ATOM   1593 N  N     . LEU A 1 207 ? -22.415 29.401 36.421 1.00 17.04 ? 207 LEU A N     1 
ATOM   1594 C  CA    . LEU A 1 207 ? -21.142 29.316 35.700 1.00 19.47 ? 207 LEU A CA    1 
ATOM   1595 C  C     . LEU A 1 207 ? -20.085 28.749 36.638 1.00 21.26 ? 207 LEU A C     1 
ATOM   1596 O  O     . LEU A 1 207 ? -19.462 27.727 36.334 1.00 25.74 ? 207 LEU A O     1 
ATOM   1597 C  CB    . LEU A 1 207 ? -20.673 30.704 35.246 1.00 18.28 ? 207 LEU A CB    1 
ATOM   1598 C  CG    . LEU A 1 207 ? -19.749 30.825 34.028 1.00 13.42 ? 207 LEU A CG    1 
ATOM   1599 C  CD1   . LEU A 1 207 ? -19.031 32.148 34.062 1.00 7.39  ? 207 LEU A CD1   1 
ATOM   1600 C  CD2   . LEU A 1 207 ? -18.747 29.690 33.973 1.00 18.69 ? 207 LEU A CD2   1 
ATOM   1601 N  N     . LEU A 1 208 ? -19.862 29.442 37.754 1.00 20.32 ? 208 LEU A N     1 
ATOM   1602 C  CA    . LEU A 1 208 ? -18.885 29.029 38.758 1.00 11.86 ? 208 LEU A CA    1 
ATOM   1603 C  C     . LEU A 1 208 ? -19.129 27.592 39.215 1.00 10.65 ? 208 LEU A C     1 
ATOM   1604 O  O     . LEU A 1 208 ? -18.189 26.869 39.521 1.00 11.37 ? 208 LEU A O     1 
ATOM   1605 C  CB    . LEU A 1 208 ? -18.935 29.976 39.952 1.00 12.57 ? 208 LEU A CB    1 
ATOM   1606 C  CG    . LEU A 1 208 ? -18.452 31.395 39.687 1.00 13.74 ? 208 LEU A CG    1 
ATOM   1607 C  CD1   . LEU A 1 208 ? -18.545 32.200 40.978 1.00 11.34 ? 208 LEU A CD1   1 
ATOM   1608 C  CD2   . LEU A 1 208 ? -17.037 31.370 39.156 1.00 5.01  ? 208 LEU A CD2   1 
ATOM   1609 N  N     . ASP A 1 209 ? -20.389 27.174 39.248 1.00 13.14 ? 209 ASP A N     1 
ATOM   1610 C  CA    . ASP A 1 209 ? -20.714 25.808 39.638 1.00 17.41 ? 209 ASP A CA    1 
ATOM   1611 C  C     . ASP A 1 209 ? -20.200 24.841 38.566 1.00 19.79 ? 209 ASP A C     1 
ATOM   1612 O  O     . ASP A 1 209 ? -19.535 23.841 38.869 1.00 27.38 ? 209 ASP A O     1 
ATOM   1613 C  CB    . ASP A 1 209 ? -22.223 25.633 39.828 1.00 10.81 ? 209 ASP A CB    1 
ATOM   1614 C  CG    . ASP A 1 209 ? -22.600 24.208 40.194 1.00 16.55 ? 209 ASP A CG    1 
ATOM   1615 O  OD1   . ASP A 1 209 ? -21.775 23.510 40.825 1.00 20.82 ? 209 ASP A OD1   1 
ATOM   1616 O  OD2   . ASP A 1 209 ? -23.722 23.776 39.851 1.00 17.28 ? 209 ASP A OD2   1 
ATOM   1617 N  N     . GLN A 1 210 ? -20.502 25.141 37.312 1.00 19.47 ? 210 GLN A N     1 
ATOM   1618 C  CA    . GLN A 1 210 ? -20.052 24.301 36.213 1.00 22.90 ? 210 GLN A CA    1 
ATOM   1619 C  C     . GLN A 1 210 ? -18.522 24.257 36.181 1.00 19.60 ? 210 GLN A C     1 
ATOM   1620 O  O     . GLN A 1 210 ? -17.917 23.189 36.051 1.00 17.33 ? 210 GLN A O     1 
ATOM   1621 C  CB    . GLN A 1 210 ? -20.610 24.847 34.901 1.00 27.29 ? 210 GLN A CB    1 
ATOM   1622 C  CG    . GLN A 1 210 ? -22.121 24.853 34.860 1.00 32.56 ? 210 GLN A CG    1 
ATOM   1623 C  CD    . GLN A 1 210 ? -22.676 25.699 33.733 1.00 40.20 ? 210 GLN A CD    1 
ATOM   1624 O  OE1   . GLN A 1 210 ? -21.957 26.501 33.121 1.00 41.62 ? 210 GLN A OE1   1 
ATOM   1625 N  NE2   . GLN A 1 210 ? -23.969 25.548 33.468 1.00 39.46 ? 210 GLN A NE2   1 
ATOM   1626 N  N     . ALA A 1 211 ? -17.904 25.424 36.326 1.00 20.12 ? 211 ALA A N     1 
ATOM   1627 C  CA    . ALA A 1 211 ? -16.450 25.544 36.332 1.00 22.64 ? 211 ALA A CA    1 
ATOM   1628 C  C     . ALA A 1 211 ? -15.848 24.688 37.443 1.00 26.01 ? 211 ALA A C     1 
ATOM   1629 O  O     . ALA A 1 211 ? -14.846 23.991 37.232 1.00 29.42 ? 211 ALA A O     1 
ATOM   1630 C  CB    . ALA A 1 211 ? -16.046 27.002 36.517 1.00 22.28 ? 211 ALA A CB    1 
ATOM   1631 N  N     . ARG A 1 212 ? -16.443 24.764 38.630 1.00 23.45 ? 212 ARG A N     1 
ATOM   1632 C  CA    . ARG A 1 212 ? -15.981 23.993 39.768 1.00 23.73 ? 212 ARG A CA    1 
ATOM   1633 C  C     . ARG A 1 212 ? -15.995 22.512 39.467 1.00 23.78 ? 212 ARG A C     1 
ATOM   1634 O  O     . ARG A 1 212 ? -15.051 21.783 39.795 1.00 25.28 ? 212 ARG A O     1 
ATOM   1635 C  CB    . ARG A 1 212 ? -16.882 24.209 40.978 1.00 25.65 ? 212 ARG A CB    1 
ATOM   1636 C  CG    . ARG A 1 212 ? -16.548 23.232 42.091 1.00 26.17 ? 212 ARG A CG    1 
ATOM   1637 C  CD    . ARG A 1 212 ? -17.563 23.214 43.180 1.00 26.36 ? 212 ARG A CD    1 
ATOM   1638 N  NE    . ARG A 1 212 ? -18.830 22.594 42.806 1.00 25.87 ? 212 ARG A NE    1 
ATOM   1639 C  CZ    . ARG A 1 212 ? -18.972 21.273 42.793 1.00 23.51 ? 212 ARG A CZ    1 
ATOM   1640 N  NH1   . ARG A 1 212 ? -17.956 20.483 43.096 1.00 26.81 ? 212 ARG A NH1   1 
ATOM   1641 N  NH2   . ARG A 1 212 ? -20.161 20.746 42.544 1.00 26.69 ? 212 ARG A NH2   1 
ATOM   1642 N  N     . GLN A 1 213 ? -17.119 22.049 38.941 1.00 19.51 ? 213 GLN A N     1 
ATOM   1643 C  CA    . GLN A 1 213 ? -17.261 20.644 38.633 1.00 18.70 ? 213 GLN A CA    1 
ATOM   1644 C  C     . GLN A 1 213 ? -16.232 20.137 37.628 1.00 20.39 ? 213 GLN A C     1 
ATOM   1645 O  O     . GLN A 1 213 ? -15.754 19.001 37.744 1.00 19.84 ? 213 GLN A O     1 
ATOM   1646 C  CB    . GLN A 1 213 ? -18.695 20.351 38.228 1.00 19.46 ? 213 GLN A CB    1 
ATOM   1647 C  CG    . GLN A 1 213 ? -19.665 20.742 39.349 1.00 27.51 ? 213 GLN A CG    1 
ATOM   1648 C  CD    . GLN A 1 213 ? -21.061 20.191 39.163 1.00 29.67 ? 213 GLN A CD    1 
ATOM   1649 O  OE1   . GLN A 1 213 ? -21.257 19.138 38.554 1.00 33.32 ? 213 GLN A OE1   1 
ATOM   1650 N  NE2   . GLN A 1 213 ? -22.041 20.892 39.704 1.00 31.71 ? 213 GLN A NE2   1 
ATOM   1651 N  N     . ARG A 1 214 ? -15.851 20.991 36.681 1.00 21.88 ? 214 ARG A N     1 
ATOM   1652 C  CA    . ARG A 1 214 ? -14.839 20.625 35.688 1.00 25.70 ? 214 ARG A CA    1 
ATOM   1653 C  C     . ARG A 1 214 ? -13.422 20.701 36.283 1.00 28.08 ? 214 ARG A C     1 
ATOM   1654 O  O     . ARG A 1 214 ? -12.469 20.155 35.715 1.00 30.37 ? 214 ARG A O     1 
ATOM   1655 C  CB    . ARG A 1 214 ? -14.939 21.522 34.448 1.00 23.42 ? 214 ARG A CB    1 
ATOM   1656 C  CG    . ARG A 1 214 ? -16.263 21.382 33.704 1.00 23.69 ? 214 ARG A CG    1 
ATOM   1657 C  CD    . ARG A 1 214 ? -16.188 21.995 32.317 1.00 19.74 ? 214 ARG A CD    1 
ATOM   1658 N  NE    . ARG A 1 214 ? -15.861 23.413 32.389 1.00 20.42 ? 214 ARG A NE    1 
ATOM   1659 C  CZ    . ARG A 1 214 ? -16.819 24.327 32.528 1.00 19.83 ? 214 ARG A CZ    1 
ATOM   1660 N  NH1   . ARG A 1 214 ? -18.093 23.951 32.592 1.00 17.20 ? 214 ARG A NH1   1 
ATOM   1661 N  NH2   . ARG A 1 214 ? -16.497 25.615 32.651 1.00 20.51 ? 214 ARG A NH2   1 
ATOM   1662 N  N     . GLY A 1 215 ? -13.290 21.387 37.417 1.00 24.22 ? 215 GLY A N     1 
ATOM   1663 C  CA    . GLY A 1 215 ? -12.000 21.517 38.068 1.00 21.03 ? 215 GLY A CA    1 
ATOM   1664 C  C     . GLY A 1 215 ? -11.184 22.680 37.554 1.00 22.42 ? 215 GLY A C     1 
ATOM   1665 O  O     . GLY A 1 215 ? -9.975  22.706 37.738 1.00 27.55 ? 215 GLY A O     1 
ATOM   1666 N  N     . ASP A 1 216 ? -11.839 23.662 36.946 1.00 24.53 ? 216 ASP A N     1 
ATOM   1667 C  CA    . ASP A 1 216 ? -11.142 24.829 36.416 1.00 25.76 ? 216 ASP A CA    1 
ATOM   1668 C  C     . ASP A 1 216 ? -10.616 25.722 37.536 1.00 26.31 ? 216 ASP A C     1 
ATOM   1669 O  O     . ASP A 1 216 ? -11.200 25.778 38.619 1.00 23.98 ? 216 ASP A O     1 
ATOM   1670 C  CB    . ASP A 1 216 ? -12.078 25.642 35.519 1.00 32.55 ? 216 ASP A CB    1 
ATOM   1671 C  CG    . ASP A 1 216 ? -12.653 24.821 34.373 1.00 40.78 ? 216 ASP A CG    1 
ATOM   1672 O  OD1   . ASP A 1 216 ? -11.876 24.261 33.569 1.00 42.74 ? 216 ASP A OD1   1 
ATOM   1673 O  OD2   . ASP A 1 216 ? -13.892 24.725 34.276 1.00 47.74 ? 216 ASP A OD2   1 
ATOM   1674 N  N     . PHE A 1 217 ? -9.492  26.392 37.288 1.00 24.61 ? 217 PHE A N     1 
ATOM   1675 C  CA    . PHE A 1 217 ? -8.912  27.300 38.274 1.00 21.22 ? 217 PHE A CA    1 
ATOM   1676 C  C     . PHE A 1 217 ? -9.669  28.638 38.274 1.00 22.43 ? 217 PHE A C     1 
ATOM   1677 O  O     . PHE A 1 217 ? -9.817  29.288 37.220 1.00 17.13 ? 217 PHE A O     1 
ATOM   1678 C  CB    . PHE A 1 217 ? -7.441  27.589 37.974 1.00 21.56 ? 217 PHE A CB    1 
ATOM   1679 C  CG    . PHE A 1 217 ? -6.512  26.445 38.241 1.00 18.83 ? 217 PHE A CG    1 
ATOM   1680 C  CD1   . PHE A 1 217 ? -6.994  25.187 38.577 1.00 21.87 ? 217 PHE A CD1   1 
ATOM   1681 C  CD2   . PHE A 1 217 ? -5.139  26.629 38.130 1.00 15.57 ? 217 PHE A CD2   1 
ATOM   1682 C  CE1   . PHE A 1 217 ? -6.114  24.124 38.793 1.00 19.40 ? 217 PHE A CE1   1 
ATOM   1683 C  CE2   . PHE A 1 217 ? -4.258  25.580 38.344 1.00 17.30 ? 217 PHE A CE2   1 
ATOM   1684 C  CZ    . PHE A 1 217 ? -4.745  24.322 38.677 1.00 14.17 ? 217 PHE A CZ    1 
ATOM   1685 N  N     . VAL A 1 218 ? -10.118 29.056 39.458 1.00 15.08 ? 218 VAL A N     1 
ATOM   1686 C  CA    . VAL A 1 218 ? -10.836 30.314 39.601 1.00 12.73 ? 218 VAL A CA    1 
ATOM   1687 C  C     . VAL A 1 218 ? -10.099 31.200 40.590 1.00 13.20 ? 218 VAL A C     1 
ATOM   1688 O  O     . VAL A 1 218 ? -9.633  30.724 41.616 1.00 18.65 ? 218 VAL A O     1 
ATOM   1689 C  CB    . VAL A 1 218 ? -12.246 30.100 40.152 1.00 9.06  ? 218 VAL A CB    1 
ATOM   1690 C  CG1   . VAL A 1 218 ? -12.960 31.407 40.262 1.00 5.01  ? 218 VAL A CG1   1 
ATOM   1691 C  CG2   . VAL A 1 218 ? -13.015 29.134 39.281 1.00 12.46 ? 218 VAL A CG2   1 
ATOM   1692 N  N     . MET A 1 219 ? -9.912  32.465 40.254 1.00 14.93 ? 219 MET A N     1 
ATOM   1693 C  CA    . MET A 1 219 ? -9.277  33.364 41.187 1.00 15.24 ? 219 MET A CA    1 
ATOM   1694 C  C     . MET A 1 219 ? -10.274 34.445 41.562 1.00 18.05 ? 219 MET A C     1 
ATOM   1695 O  O     . MET A 1 219 ? -10.804 35.131 40.689 1.00 24.27 ? 219 MET A O     1 
ATOM   1696 C  CB    . MET A 1 219 ? -8.013  33.978 40.615 1.00 17.40 ? 219 MET A CB    1 
ATOM   1697 C  CG    . MET A 1 219 ? -7.392  34.972 41.576 1.00 16.88 ? 219 MET A CG    1 
ATOM   1698 S  SD    . MET A 1 219 ? -5.643  35.105 41.350 1.00 20.07 ? 219 MET A SD    1 
ATOM   1699 C  CE    . MET A 1 219 ? -5.093  33.607 42.185 1.00 19.64 ? 219 MET A CE    1 
ATOM   1700 N  N     . PHE A 1 220 ? -10.577 34.549 42.854 1.00 16.72 ? 220 PHE A N     1 
ATOM   1701 C  CA    . PHE A 1 220 ? -11.512 35.549 43.358 1.00 8.72  ? 220 PHE A CA    1 
ATOM   1702 C  C     . PHE A 1 220 ? -10.689 36.715 43.835 1.00 10.09 ? 220 PHE A C     1 
ATOM   1703 O  O     . PHE A 1 220 ? -9.707  36.533 44.565 1.00 13.22 ? 220 PHE A O     1 
ATOM   1704 C  CB    . PHE A 1 220 ? -12.343 34.963 44.477 1.00 9.41  ? 220 PHE A CB    1 
ATOM   1705 C  CG    . PHE A 1 220 ? -13.222 33.849 44.027 1.00 6.88  ? 220 PHE A CG    1 
ATOM   1706 C  CD1   . PHE A 1 220 ? -12.717 32.564 43.888 1.00 5.01  ? 220 PHE A CD1   1 
ATOM   1707 C  CD2   . PHE A 1 220 ? -14.549 34.087 43.704 1.00 5.01  ? 220 PHE A CD2   1 
ATOM   1708 C  CE1   . PHE A 1 220 ? -13.530 31.526 43.435 1.00 5.01  ? 220 PHE A CE1   1 
ATOM   1709 C  CE2   . PHE A 1 220 ? -15.354 33.059 43.254 1.00 5.01  ? 220 PHE A CE2   1 
ATOM   1710 C  CZ    . PHE A 1 220 ? -14.839 31.778 43.120 1.00 5.01  ? 220 PHE A CZ    1 
ATOM   1711 N  N     . GLU A 1 221 ? -11.089 37.907 43.415 1.00 9.85  ? 221 GLU A N     1 
ATOM   1712 C  CA    . GLU A 1 221 ? -10.367 39.126 43.731 1.00 9.40  ? 221 GLU A CA    1 
ATOM   1713 C  C     . GLU A 1 221 ? -11.142 40.099 44.624 1.00 13.50 ? 221 GLU A C     1 
ATOM   1714 O  O     . GLU A 1 221 ? -12.240 40.582 44.279 1.00 11.92 ? 221 GLU A O     1 
ATOM   1715 C  CB    . GLU A 1 221 ? -9.969  39.815 42.426 1.00 8.40  ? 221 GLU A CB    1 
ATOM   1716 C  CG    . GLU A 1 221 ? -9.169  41.086 42.599 1.00 14.87 ? 221 GLU A CG    1 
ATOM   1717 C  CD    . GLU A 1 221 ? -9.176  41.977 41.377 1.00 13.79 ? 221 GLU A CD    1 
ATOM   1718 O  OE1   . GLU A 1 221 ? -9.843  41.639 40.384 1.00 18.97 ? 221 GLU A OE1   1 
ATOM   1719 O  OE2   . GLU A 1 221 ? -8.522  43.033 41.414 1.00 13.22 ? 221 GLU A OE2   1 
ATOM   1720 N  N     . GLY A 1 222 ? -10.559 40.404 45.773 1.00 11.57 ? 222 GLY A N     1 
ATOM   1721 C  CA    . GLY A 1 222 ? -11.205 41.328 46.670 1.00 12.14 ? 222 GLY A CA    1 
ATOM   1722 C  C     . GLY A 1 222 ? -10.735 42.746 46.451 1.00 12.12 ? 222 GLY A C     1 
ATOM   1723 O  O     . GLY A 1 222 ? -9.646  42.980 45.925 1.00 15.65 ? 222 GLY A O     1 
ATOM   1724 N  N     . ALA A 1 223 ? -11.592 43.694 46.803 1.00 11.35 ? 223 ALA A N     1 
ATOM   1725 C  CA    . ALA A 1 223 ? -11.284 45.108 46.699 1.00 11.13 ? 223 ALA A CA    1 
ATOM   1726 C  C     . ALA A 1 223 ? -11.130 45.587 48.150 1.00 13.64 ? 223 ALA A C     1 
ATOM   1727 O  O     . ALA A 1 223 ? -11.416 44.834 49.087 1.00 13.12 ? 223 ALA A O     1 
ATOM   1728 C  CB    . ALA A 1 223 ? -12.430 45.840 46.019 1.00 11.21 ? 223 ALA A CB    1 
ATOM   1729 N  N     . GLN A 1 224 ? -10.697 46.832 48.338 1.00 15.86 ? 224 GLN A N     1 
ATOM   1730 C  CA    . GLN A 1 224 ? -10.513 47.385 49.683 1.00 17.82 ? 224 GLN A CA    1 
ATOM   1731 C  C     . GLN A 1 224 ? -9.724  46.409 50.576 1.00 15.19 ? 224 GLN A C     1 
ATOM   1732 O  O     . GLN A 1 224 ? -8.801  45.749 50.102 1.00 17.64 ? 224 GLN A O     1 
ATOM   1733 C  CB    . GLN A 1 224 ? -11.874 47.732 50.305 1.00 15.48 ? 224 GLN A CB    1 
ATOM   1734 C  CG    . GLN A 1 224 ? -12.583 48.929 49.674 1.00 13.53 ? 224 GLN A CG    1 
ATOM   1735 C  CD    . GLN A 1 224 ? -13.282 48.617 48.345 1.00 15.50 ? 224 GLN A CD    1 
ATOM   1736 O  OE1   . GLN A 1 224 ? -14.270 47.880 48.307 1.00 8.19  ? 224 GLN A OE1   1 
ATOM   1737 N  NE2   . GLN A 1 224 ? -12.800 49.225 47.264 1.00 8.03  ? 224 GLN A NE2   1 
ATOM   1738 N  N     . GLY A 1 225 ? -10.090 46.297 51.849 1.00 13.75 ? 225 GLY A N     1 
ATOM   1739 C  CA    . GLY A 1 225 ? -9.375  45.397 52.738 1.00 12.04 ? 225 GLY A CA    1 
ATOM   1740 C  C     . GLY A 1 225 ? -10.191 45.034 53.963 1.00 12.09 ? 225 GLY A C     1 
ATOM   1741 O  O     . GLY A 1 225 ? -11.221 45.667 54.234 1.00 10.93 ? 225 GLY A O     1 
ATOM   1742 N  N     . THR A 1 226 ? -9.717  44.039 54.712 1.00 11.85 ? 226 THR A N     1 
ATOM   1743 C  CA    . THR A 1 226 ? -10.389 43.532 55.908 1.00 11.04 ? 226 THR A CA    1 
ATOM   1744 C  C     . THR A 1 226 ? -10.875 44.559 56.939 1.00 10.40 ? 226 THR A C     1 
ATOM   1745 O  O     . THR A 1 226 ? -12.058 44.549 57.302 1.00 10.71 ? 226 THR A O     1 
ATOM   1746 C  CB    . THR A 1 226 ? -9.538  42.457 56.612 1.00 11.14 ? 226 THR A CB    1 
ATOM   1747 O  OG1   . THR A 1 226 ? -9.163  41.435 55.672 1.00 17.48 ? 226 THR A OG1   1 
ATOM   1748 C  CG2   . THR A 1 226 ? -10.339 41.804 57.721 1.00 14.29 ? 226 THR A CG2   1 
ATOM   1749 N  N     . LEU A 1 227 ? -10.023 45.497 57.350 1.00 7.17  ? 227 LEU A N     1 
ATOM   1750 C  CA    . LEU A 1 227 ? -10.464 46.465 58.344 1.00 10.59 ? 227 LEU A CA    1 
ATOM   1751 C  C     . LEU A 1 227 ? -11.435 47.524 57.829 1.00 12.92 ? 227 LEU A C     1 
ATOM   1752 O  O     . LEU A 1 227 ? -11.876 48.398 58.580 1.00 11.44 ? 227 LEU A O     1 
ATOM   1753 C  CB    . LEU A 1 227 ? -9.287  47.085 59.101 1.00 11.69 ? 227 LEU A CB    1 
ATOM   1754 C  CG    . LEU A 1 227 ? -8.470  46.113 59.978 1.00 9.30  ? 227 LEU A CG    1 
ATOM   1755 C  CD1   . LEU A 1 227 ? -7.749  46.912 61.035 1.00 7.10  ? 227 LEU A CD1   1 
ATOM   1756 C  CD2   . LEU A 1 227 ? -9.346  45.038 60.647 1.00 5.55  ? 227 LEU A CD2   1 
ATOM   1757 N  N     . LEU A 1 228 ? -11.818 47.380 56.560 1.00 17.18 ? 228 LEU A N     1 
ATOM   1758 C  CA    . LEU A 1 228 ? -12.775 48.264 55.894 1.00 14.31 ? 228 LEU A CA    1 
ATOM   1759 C  C     . LEU A 1 228 ? -14.108 47.528 55.674 1.00 13.91 ? 228 LEU A C     1 
ATOM   1760 O  O     . LEU A 1 228 ? -15.057 48.106 55.132 1.00 13.24 ? 228 LEU A O     1 
ATOM   1761 C  CB    . LEU A 1 228 ? -12.215 48.776 54.561 1.00 11.77 ? 228 LEU A CB    1 
ATOM   1762 C  CG    . LEU A 1 228 ? -11.202 49.914 54.664 1.00 9.04  ? 228 LEU A CG    1 
ATOM   1763 C  CD1   . LEU A 1 228 ? -10.625 50.247 53.303 1.00 5.01  ? 228 LEU A CD1   1 
ATOM   1764 C  CD2   . LEU A 1 228 ? -11.864 51.130 55.261 1.00 6.15  ? 228 LEU A CD2   1 
ATOM   1765 N  N     . ASP A 1 229 ? -14.170 46.271 56.121 1.00 12.02 ? 229 ASP A N     1 
ATOM   1766 C  CA    . ASP A 1 229 ? -15.372 45.434 56.033 1.00 10.71 ? 229 ASP A CA    1 
ATOM   1767 C  C     . ASP A 1 229 ? -16.517 46.126 56.793 1.00 15.22 ? 229 ASP A C     1 
ATOM   1768 O  O     . ASP A 1 229 ? -16.314 46.667 57.891 1.00 18.34 ? 229 ASP A O     1 
ATOM   1769 C  CB    . ASP A 1 229 ? -15.077 44.064 56.639 1.00 7.31  ? 229 ASP A CB    1 
ATOM   1770 C  CG    . ASP A 1 229 ? -16.180 43.059 56.393 1.00 7.11  ? 229 ASP A CG    1 
ATOM   1771 O  OD1   . ASP A 1 229 ? -15.958 42.157 55.584 1.00 10.66 ? 229 ASP A OD1   1 
ATOM   1772 O  OD2   . ASP A 1 229 ? -17.245 43.117 57.032 1.00 5.01  ? 229 ASP A OD2   1 
ATOM   1773 N  N     . ILE A 1 230 ? -17.711 46.113 56.198 1.00 16.88 ? 230 ILE A N     1 
ATOM   1774 C  CA    . ILE A 1 230 ? -18.893 46.768 56.760 1.00 13.32 ? 230 ILE A CA    1 
ATOM   1775 C  C     . ILE A 1 230 ? -19.341 46.221 58.124 1.00 12.69 ? 230 ILE A C     1 
ATOM   1776 O  O     . ILE A 1 230 ? -19.807 46.964 58.996 1.00 6.32  ? 230 ILE A O     1 
ATOM   1777 C  CB    . ILE A 1 230 ? -20.076 46.798 55.696 1.00 13.96 ? 230 ILE A CB    1 
ATOM   1778 C  CG1   . ILE A 1 230 ? -21.285 47.594 56.227 1.00 11.30 ? 230 ILE A CG1   1 
ATOM   1779 C  CG2   . ILE A 1 230 ? -20.485 45.383 55.287 1.00 6.37  ? 230 ILE A CG2   1 
ATOM   1780 C  CD1   . ILE A 1 230 ? -20.990 49.044 56.535 1.00 5.01  ? 230 ILE A CD1   1 
ATOM   1781 N  N     . ASP A 1 231 ? -19.179 44.916 58.297 1.00 15.63 ? 231 ASP A N     1 
ATOM   1782 C  CA    . ASP A 1 231 ? -19.544 44.230 59.529 1.00 13.34 ? 231 ASP A CA    1 
ATOM   1783 C  C     . ASP A 1 231 ? -18.379 44.162 60.498 1.00 15.66 ? 231 ASP A C     1 
ATOM   1784 O  O     . ASP A 1 231 ? -18.481 44.599 61.649 1.00 12.50 ? 231 ASP A O     1 
ATOM   1785 C  CB    . ASP A 1 231 ? -19.983 42.800 59.221 1.00 7.79  ? 231 ASP A CB    1 
ATOM   1786 C  CG    . ASP A 1 231 ? -21.421 42.713 58.776 1.00 9.43  ? 231 ASP A CG    1 
ATOM   1787 O  OD1   . ASP A 1 231 ? -22.320 42.779 59.631 1.00 9.90  ? 231 ASP A OD1   1 
ATOM   1788 O  OD2   . ASP A 1 231 ? -21.663 42.575 57.562 1.00 14.56 ? 231 ASP A OD2   1 
ATOM   1789 N  N     . HIS A 1 232 ? -17.244 43.687 59.991 1.00 16.70 ? 232 HIS A N     1 
ATOM   1790 C  CA    . HIS A 1 232 ? -16.057 43.483 60.810 1.00 15.84 ? 232 HIS A CA    1 
ATOM   1791 C  C     . HIS A 1 232 ? -14.995 44.560 60.894 1.00 16.74 ? 232 HIS A C     1 
ATOM   1792 O  O     . HIS A 1 232 ? -13.995 44.376 61.594 1.00 17.84 ? 232 HIS A O     1 
ATOM   1793 C  CB    . HIS A 1 232 ? -15.425 42.141 60.429 1.00 18.71 ? 232 HIS A CB    1 
ATOM   1794 C  CG    . HIS A 1 232 ? -16.389 40.993 60.490 1.00 18.07 ? 232 HIS A CG    1 
ATOM   1795 N  ND1   . HIS A 1 232 ? -16.809 40.440 61.684 1.00 12.79 ? 232 HIS A ND1   1 
ATOM   1796 C  CD2   . HIS A 1 232 ? -17.074 40.354 59.513 1.00 18.67 ? 232 HIS A CD2   1 
ATOM   1797 C  CE1   . HIS A 1 232 ? -17.721 39.514 61.433 1.00 19.65 ? 232 HIS A CE1   1 
ATOM   1798 N  NE2   . HIS A 1 232 ? -17.902 39.443 60.127 1.00 17.97 ? 232 HIS A NE2   1 
ATOM   1799 N  N     . GLY A 1 233 ? -15.212 45.683 60.214 1.00 19.55 ? 233 GLY A N     1 
ATOM   1800 C  CA    . GLY A 1 233 ? -14.241 46.761 60.228 1.00 19.56 ? 233 GLY A CA    1 
ATOM   1801 C  C     . GLY A 1 233 ? -14.432 47.847 61.280 1.00 24.07 ? 233 GLY A C     1 
ATOM   1802 O  O     . GLY A 1 233 ? -15.315 47.776 62.156 1.00 25.12 ? 233 GLY A O     1 
ATOM   1803 N  N     . THR A 1 234 ? -13.618 48.893 61.155 1.00 24.41 ? 234 THR A N     1 
ATOM   1804 C  CA    . THR A 1 234 ? -13.634 50.023 62.072 1.00 17.79 ? 234 THR A CA    1 
ATOM   1805 C  C     . THR A 1 234 ? -14.830 50.931 61.798 1.00 17.08 ? 234 THR A C     1 
ATOM   1806 O  O     . THR A 1 234 ? -14.669 52.112 61.458 1.00 16.20 ? 234 THR A O     1 
ATOM   1807 C  CB    . THR A 1 234 ? -12.310 50.822 61.967 1.00 17.91 ? 234 THR A CB    1 
ATOM   1808 O  OG1   . THR A 1 234 ? -12.213 51.439 60.672 1.00 14.84 ? 234 THR A OG1   1 
ATOM   1809 C  CG2   . THR A 1 234 ? -11.108 49.885 62.170 1.00 13.31 ? 234 THR A CG2   1 
ATOM   1810 N  N     . TYR A 1 235 ? -16.025 50.368 61.973 1.00 16.06 ? 235 TYR A N     1 
ATOM   1811 C  CA    . TYR A 1 235 ? -17.298 51.060 61.747 1.00 13.11 ? 235 TYR A CA    1 
ATOM   1812 C  C     . TYR A 1 235 ? -17.360 52.379 62.520 1.00 19.76 ? 235 TYR A C     1 
ATOM   1813 O  O     . TYR A 1 235 ? -16.978 52.432 63.705 1.00 25.11 ? 235 TYR A O     1 
ATOM   1814 C  CB    . TYR A 1 235 ? -18.437 50.133 62.171 1.00 7.41  ? 235 TYR A CB    1 
ATOM   1815 C  CG    . TYR A 1 235 ? -19.826 50.624 61.852 1.00 7.81  ? 235 TYR A CG    1 
ATOM   1816 C  CD1   . TYR A 1 235 ? -20.555 51.374 62.767 1.00 14.11 ? 235 TYR A CD1   1 
ATOM   1817 C  CD2   . TYR A 1 235 ? -20.432 50.312 60.646 1.00 12.81 ? 235 TYR A CD2   1 
ATOM   1818 C  CE1   . TYR A 1 235 ? -21.859 51.799 62.476 1.00 16.18 ? 235 TYR A CE1   1 
ATOM   1819 C  CE2   . TYR A 1 235 ? -21.732 50.731 60.351 1.00 10.88 ? 235 TYR A CE2   1 
ATOM   1820 C  CZ    . TYR A 1 235 ? -22.431 51.472 61.265 1.00 10.46 ? 235 TYR A CZ    1 
ATOM   1821 O  OH    . TYR A 1 235 ? -23.687 51.904 60.952 1.00 11.14 ? 235 TYR A OH    1 
ATOM   1822 N  N     . PRO A 1 236 ? -17.872 53.461 61.885 1.00 21.08 ? 236 PRO A N     1 
ATOM   1823 C  CA    . PRO A 1 236 ? -18.399 53.584 60.515 1.00 18.19 ? 236 PRO A CA    1 
ATOM   1824 C  C     . PRO A 1 236 ? -17.349 53.994 59.470 1.00 18.22 ? 236 PRO A C     1 
ATOM   1825 O  O     . PRO A 1 236 ? -17.687 54.379 58.350 1.00 17.21 ? 236 PRO A O     1 
ATOM   1826 C  CB    . PRO A 1 236 ? -19.435 54.681 60.680 1.00 16.37 ? 236 PRO A CB    1 
ATOM   1827 C  CG    . PRO A 1 236 ? -18.683 55.650 61.583 1.00 15.24 ? 236 PRO A CG    1 
ATOM   1828 C  CD    . PRO A 1 236 ? -18.041 54.736 62.618 1.00 13.53 ? 236 PRO A CD    1 
ATOM   1829 N  N     . TYR A 1 237 ? -16.082 53.925 59.852 1.00 18.85 ? 237 TYR A N     1 
ATOM   1830 C  CA    . TYR A 1 237 ? -14.983 54.302 58.979 1.00 18.11 ? 237 TYR A CA    1 
ATOM   1831 C  C     . TYR A 1 237 ? -14.601 53.071 58.188 1.00 16.29 ? 237 TYR A C     1 
ATOM   1832 O  O     . TYR A 1 237 ? -13.486 52.566 58.271 1.00 13.22 ? 237 TYR A O     1 
ATOM   1833 C  CB    . TYR A 1 237 ? -13.827 54.842 59.834 1.00 22.69 ? 237 TYR A CB    1 
ATOM   1834 C  CG    . TYR A 1 237 ? -14.225 56.115 60.552 1.00 23.24 ? 237 TYR A CG    1 
ATOM   1835 C  CD1   . TYR A 1 237 ? -14.416 57.302 59.840 1.00 25.59 ? 237 TYR A CD1   1 
ATOM   1836 C  CD2   . TYR A 1 237 ? -14.521 56.109 61.917 1.00 24.40 ? 237 TYR A CD2   1 
ATOM   1837 C  CE1   . TYR A 1 237 ? -14.902 58.452 60.466 1.00 28.92 ? 237 TYR A CE1   1 
ATOM   1838 C  CE2   . TYR A 1 237 ? -15.009 57.249 62.554 1.00 24.28 ? 237 TYR A CE2   1 
ATOM   1839 C  CZ    . TYR A 1 237 ? -15.202 58.418 61.825 1.00 30.35 ? 237 TYR A CZ    1 
ATOM   1840 O  OH    . TYR A 1 237 ? -15.723 59.542 62.443 1.00 31.87 ? 237 TYR A OH    1 
ATOM   1841 N  N     . VAL A 1 238 ? -15.579 52.596 57.430 1.00 14.92 ? 238 VAL A N     1 
ATOM   1842 C  CA    . VAL A 1 238 ? -15.469 51.388 56.622 1.00 13.15 ? 238 VAL A CA    1 
ATOM   1843 C  C     . VAL A 1 238 ? -16.162 51.620 55.277 1.00 15.55 ? 238 VAL A C     1 
ATOM   1844 O  O     . VAL A 1 238 ? -16.671 52.713 55.002 1.00 16.29 ? 238 VAL A O     1 
ATOM   1845 C  CB    . VAL A 1 238 ? -16.218 50.193 57.331 1.00 9.44  ? 238 VAL A CB    1 
ATOM   1846 C  CG1   . VAL A 1 238 ? -15.474 49.735 58.559 1.00 5.01  ? 238 VAL A CG1   1 
ATOM   1847 C  CG2   . VAL A 1 238 ? -17.635 50.620 57.726 1.00 5.01  ? 238 VAL A CG2   1 
ATOM   1848 N  N     . THR A 1 239 ? -16.189 50.580 54.449 1.00 12.97 ? 239 THR A N     1 
ATOM   1849 C  CA    . THR A 1 239 ? -16.865 50.652 53.162 1.00 10.96 ? 239 THR A CA    1 
ATOM   1850 C  C     . THR A 1 239 ? -18.187 49.921 53.377 1.00 10.87 ? 239 THR A C     1 
ATOM   1851 O  O     . THR A 1 239 ? -18.389 49.307 54.433 1.00 11.31 ? 239 THR A O     1 
ATOM   1852 C  CB    . THR A 1 239 ? -16.014 50.041 51.995 1.00 8.05  ? 239 THR A CB    1 
ATOM   1853 O  OG1   . THR A 1 239 ? -16.621 50.371 50.739 1.00 7.62  ? 239 THR A OG1   1 
ATOM   1854 C  CG2   . THR A 1 239 ? -15.894 48.533 52.117 1.00 5.01  ? 239 THR A CG2   1 
ATOM   1855 N  N     . SER A 1 240 ? -19.081 49.964 52.392 1.00 10.89 ? 240 SER A N     1 
ATOM   1856 C  CA    . SER A 1 240 ? -20.392 49.341 52.546 1.00 5.15  ? 240 SER A CA    1 
ATOM   1857 C  C     . SER A 1 240 ? -20.547 47.876 52.209 1.00 5.01  ? 240 SER A C     1 
ATOM   1858 O  O     . SER A 1 240 ? -21.673 47.380 52.166 1.00 8.25  ? 240 SER A O     1 
ATOM   1859 C  CB    . SER A 1 240 ? -21.441 50.138 51.794 1.00 5.01  ? 240 SER A CB    1 
ATOM   1860 O  OG    . SER A 1 240 ? -21.398 51.477 52.221 1.00 5.74  ? 240 SER A OG    1 
ATOM   1861 N  N     . SER A 1 241 ? -19.447 47.163 52.000 1.00 5.62  ? 241 SER A N     1 
ATOM   1862 C  CA    . SER A 1 241 ? -19.558 45.750 51.648 1.00 5.99  ? 241 SER A CA    1 
ATOM   1863 C  C     . SER A 1 241 ? -18.646 44.871 52.472 1.00 5.01  ? 241 SER A C     1 
ATOM   1864 O  O     . SER A 1 241 ? -17.783 45.370 53.192 1.00 5.01  ? 241 SER A O     1 
ATOM   1865 C  CB    . SER A 1 241 ? -19.239 45.553 50.161 1.00 8.18  ? 241 SER A CB    1 
ATOM   1866 O  OG    . SER A 1 241 ? -17.900 45.913 49.880 1.00 5.33  ? 241 SER A OG    1 
ATOM   1867 N  N     . ASN A 1 242 ? -18.820 43.561 52.341 1.00 5.01  ? 242 ASN A N     1 
ATOM   1868 C  CA    . ASN A 1 242 ? -17.972 42.619 53.062 1.00 6.21  ? 242 ASN A CA    1 
ATOM   1869 C  C     . ASN A 1 242 ? -16.695 42.396 52.279 1.00 10.16 ? 242 ASN A C     1 
ATOM   1870 O  O     . ASN A 1 242 ? -16.675 41.671 51.279 1.00 11.43 ? 242 ASN A O     1 
ATOM   1871 C  CB    . ASN A 1 242 ? -18.696 41.293 53.322 1.00 5.01  ? 242 ASN A CB    1 
ATOM   1872 C  CG    . ASN A 1 242 ? -19.907 41.469 54.243 1.00 11.21 ? 242 ASN A CG    1 
ATOM   1873 O  OD1   . ASN A 1 242 ? -21.051 41.200 53.853 1.00 12.53 ? 242 ASN A OD1   1 
ATOM   1874 N  ND2   . ASN A 1 242 ? -19.667 41.965 55.452 1.00 5.01  ? 242 ASN A ND2   1 
ATOM   1875 N  N     . THR A 1 243 ? -15.628 43.052 52.729 1.00 10.18 ? 243 THR A N     1 
ATOM   1876 C  CA    . THR A 1 243 ? -14.333 42.942 52.089 1.00 8.56  ? 243 THR A CA    1 
ATOM   1877 C  C     . THR A 1 243 ? -13.611 41.655 52.462 1.00 10.78 ? 243 THR A C     1 
ATOM   1878 O  O     . THR A 1 243 ? -12.584 41.310 51.864 1.00 14.61 ? 243 THR A O     1 
ATOM   1879 C  CB    . THR A 1 243 ? -13.467 44.131 52.449 1.00 15.57 ? 243 THR A CB    1 
ATOM   1880 O  OG1   . THR A 1 243 ? -13.188 44.109 53.858 1.00 11.80 ? 243 THR A OG1   1 
ATOM   1881 C  CG2   . THR A 1 243 ? -14.196 45.442 52.066 1.00 6.15  ? 243 THR A CG2   1 
ATOM   1882 N  N     . THR A 1 244 ? -14.130 40.955 53.465 1.00 9.74  ? 244 THR A N     1 
ATOM   1883 C  CA    . THR A 1 244 ? -13.539 39.694 53.897 1.00 9.74  ? 244 THR A CA    1 
ATOM   1884 C  C     . THR A 1 244 ? -14.064 38.491 53.096 1.00 9.08  ? 244 THR A C     1 
ATOM   1885 O  O     . THR A 1 244 ? -15.112 38.544 52.429 1.00 7.63  ? 244 THR A O     1 
ATOM   1886 C  CB    . THR A 1 244 ? -13.735 39.436 55.432 1.00 6.04  ? 244 THR A CB    1 
ATOM   1887 O  OG1   . THR A 1 244 ? -15.127 39.442 55.752 1.00 5.86  ? 244 THR A OG1   1 
ATOM   1888 C  CG2   . THR A 1 244 ? -13.041 40.495 56.244 1.00 5.01  ? 244 THR A CG2   1 
ATOM   1889 N  N     . ALA A 1 245 ? -13.361 37.385 53.278 1.00 8.17  ? 245 ALA A N     1 
ATOM   1890 C  CA    . ALA A 1 245 ? -13.605 36.125 52.618 1.00 8.09  ? 245 ALA A CA    1 
ATOM   1891 C  C     . ALA A 1 245 ? -15.042 35.654 52.431 1.00 10.95 ? 245 ALA A C     1 
ATOM   1892 O  O     . ALA A 1 245 ? -15.336 34.969 51.441 1.00 16.13 ? 245 ALA A O     1 
ATOM   1893 C  CB    . ALA A 1 245 ? -12.776 35.060 53.280 1.00 9.41  ? 245 ALA A CB    1 
ATOM   1894 N  N     . GLY A 1 246 ? -15.933 35.976 53.364 1.00 7.46  ? 246 GLY A N     1 
ATOM   1895 C  CA    . GLY A 1 246 ? -17.316 35.555 53.218 1.00 5.01  ? 246 GLY A CA    1 
ATOM   1896 C  C     . GLY A 1 246 ? -18.017 36.301 52.088 1.00 5.01  ? 246 GLY A C     1 
ATOM   1897 O  O     . GLY A 1 246 ? -19.014 35.839 51.552 1.00 5.38  ? 246 GLY A O     1 
ATOM   1898 N  N     . GLY A 1 247 ? -17.497 37.466 51.723 1.00 6.49  ? 247 GLY A N     1 
ATOM   1899 C  CA    . GLY A 1 247 ? -18.091 38.229 50.646 1.00 8.44  ? 247 GLY A CA    1 
ATOM   1900 C  C     . GLY A 1 247 ? -17.986 37.484 49.325 1.00 11.34 ? 247 GLY A C     1 
ATOM   1901 O  O     . GLY A 1 247 ? -18.775 37.729 48.416 1.00 15.87 ? 247 GLY A O     1 
ATOM   1902 N  N     . VAL A 1 248 ? -17.070 36.516 49.254 1.00 9.74  ? 248 VAL A N     1 
ATOM   1903 C  CA    . VAL A 1 248 ? -16.836 35.715 48.056 1.00 6.68  ? 248 VAL A CA    1 
ATOM   1904 C  C     . VAL A 1 248 ? -18.085 34.964 47.655 1.00 12.35 ? 248 VAL A C     1 
ATOM   1905 O  O     . VAL A 1 248 ? -18.599 35.147 46.550 1.00 16.48 ? 248 VAL A O     1 
ATOM   1906 C  CB    . VAL A 1 248 ? -15.678 34.702 48.261 1.00 5.01  ? 248 VAL A CB    1 
ATOM   1907 C  CG1   . VAL A 1 248 ? -15.613 33.735 47.122 1.00 7.15  ? 248 VAL A CG1   1 
ATOM   1908 C  CG2   . VAL A 1 248 ? -14.360 35.410 48.373 1.00 5.01  ? 248 VAL A CG2   1 
ATOM   1909 N  N     . ALA A 1 249 ? -18.580 34.119 48.550 1.00 10.08 ? 249 ALA A N     1 
ATOM   1910 C  CA    . ALA A 1 249 ? -19.769 33.354 48.259 1.00 7.10  ? 249 ALA A CA    1 
ATOM   1911 C  C     . ALA A 1 249 ? -21.042 34.194 48.113 1.00 10.33 ? 249 ALA A C     1 
ATOM   1912 O  O     . ALA A 1 249 ? -21.890 33.881 47.277 1.00 14.93 ? 249 ALA A O     1 
ATOM   1913 C  CB    . ALA A 1 249 ? -19.955 32.263 49.287 1.00 5.01  ? 249 ALA A CB    1 
ATOM   1914 N  N     . THR A 1 250 ? -21.187 35.275 48.872 1.00 7.29  ? 250 THR A N     1 
ATOM   1915 C  CA    . THR A 1 250 ? -22.418 36.059 48.753 1.00 8.10  ? 250 THR A CA    1 
ATOM   1916 C  C     . THR A 1 250 ? -22.480 36.814 47.429 1.00 9.69  ? 250 THR A C     1 
ATOM   1917 O  O     . THR A 1 250 ? -23.528 36.839 46.766 1.00 12.66 ? 250 THR A O     1 
ATOM   1918 C  CB    . THR A 1 250 ? -22.610 37.115 49.901 1.00 8.62  ? 250 THR A CB    1 
ATOM   1919 O  OG1   . THR A 1 250 ? -21.606 38.130 49.787 1.00 6.85  ? 250 THR A OG1   1 
ATOM   1920 C  CG2   . THR A 1 250 ? -22.586 36.470 51.316 1.00 5.01  ? 250 THR A CG2   1 
ATOM   1921 N  N     . GLY A 1 251 ? -21.352 37.408 47.052 1.00 8.70  ? 251 GLY A N     1 
ATOM   1922 C  CA    . GLY A 1 251 ? -21.281 38.194 45.835 1.00 11.75 ? 251 GLY A CA    1 
ATOM   1923 C  C     . GLY A 1 251 ? -20.736 37.522 44.593 1.00 13.71 ? 251 GLY A C     1 
ATOM   1924 O  O     . GLY A 1 251 ? -20.137 38.193 43.748 1.00 14.97 ? 251 GLY A O     1 
ATOM   1925 N  N     . SER A 1 252 ? -20.923 36.210 44.494 1.00 14.93 ? 252 SER A N     1 
ATOM   1926 C  CA    . SER A 1 252 ? -20.479 35.433 43.351 1.00 17.14 ? 252 SER A CA    1 
ATOM   1927 C  C     . SER A 1 252 ? -21.512 34.337 43.076 1.00 19.90 ? 252 SER A C     1 
ATOM   1928 O  O     . SER A 1 252 ? -21.843 34.065 41.909 1.00 26.16 ? 252 SER A O     1 
ATOM   1929 C  CB    . SER A 1 252 ? -19.107 34.800 43.598 1.00 15.90 ? 252 SER A CB    1 
ATOM   1930 O  OG    . SER A 1 252 ? -19.181 33.757 44.554 1.00 17.49 ? 252 SER A OG    1 
ATOM   1931 N  N     . GLY A 1 253 ? -22.057 33.752 44.145 1.00 15.79 ? 253 GLY A N     1 
ATOM   1932 C  CA    . GLY A 1 253 ? -23.041 32.691 44.010 1.00 7.90  ? 253 GLY A CA    1 
ATOM   1933 C  C     . GLY A 1 253 ? -22.407 31.322 44.165 1.00 7.49  ? 253 GLY A C     1 
ATOM   1934 O  O     . GLY A 1 253 ? -23.071 30.295 44.006 1.00 9.91  ? 253 GLY A O     1 
ATOM   1935 N  N     . LEU A 1 254 ? -21.105 31.293 44.417 1.00 11.79 ? 254 LEU A N     1 
ATOM   1936 C  CA    . LEU A 1 254 ? -20.412 30.026 44.609 1.00 13.72 ? 254 LEU A CA    1 
ATOM   1937 C  C     . LEU A 1 254 ? -20.632 29.638 46.068 1.00 15.02 ? 254 LEU A C     1 
ATOM   1938 O  O     . LEU A 1 254 ? -20.741 30.518 46.921 1.00 17.64 ? 254 LEU A O     1 
ATOM   1939 C  CB    . LEU A 1 254 ? -18.912 30.190 44.310 1.00 12.31 ? 254 LEU A CB    1 
ATOM   1940 C  CG    . LEU A 1 254 ? -18.083 28.890 44.264 1.00 10.65 ? 254 LEU A CG    1 
ATOM   1941 C  CD1   . LEU A 1 254 ? -18.571 27.985 43.147 1.00 6.57  ? 254 LEU A CD1   1 
ATOM   1942 C  CD2   . LEU A 1 254 ? -16.612 29.181 44.093 1.00 6.01  ? 254 LEU A CD2   1 
ATOM   1943 N  N     . GLY A 1 255 ? -20.729 28.338 46.345 1.00 17.04 ? 255 GLY A N     1 
ATOM   1944 C  CA    . GLY A 1 255 ? -20.934 27.849 47.706 1.00 16.71 ? 255 GLY A CA    1 
ATOM   1945 C  C     . GLY A 1 255 ? -19.685 27.896 48.569 1.00 18.13 ? 255 GLY A C     1 
ATOM   1946 O  O     . GLY A 1 255 ? -18.605 27.446 48.148 1.00 18.18 ? 255 GLY A O     1 
ATOM   1947 N  N     . PRO A 1 256 ? -19.811 28.362 49.823 1.00 20.50 ? 256 PRO A N     1 
ATOM   1948 C  CA    . PRO A 1 256 ? -18.688 28.479 50.776 1.00 17.92 ? 256 PRO A CA    1 
ATOM   1949 C  C     . PRO A 1 256 ? -17.733 27.302 50.912 1.00 13.71 ? 256 PRO A C     1 
ATOM   1950 O  O     . PRO A 1 256 ? -16.535 27.500 51.077 1.00 16.41 ? 256 PRO A O     1 
ATOM   1951 C  CB    . PRO A 1 256 ? -19.377 28.835 52.104 1.00 13.80 ? 256 PRO A CB    1 
ATOM   1952 C  CG    . PRO A 1 256 ? -20.794 28.399 51.917 1.00 16.28 ? 256 PRO A CG    1 
ATOM   1953 C  CD    . PRO A 1 256 ? -21.082 28.725 50.470 1.00 19.97 ? 256 PRO A CD    1 
ATOM   1954 N  N     . ARG A 1 257 ? -18.242 26.082 50.803 1.00 13.45 ? 257 ARG A N     1 
ATOM   1955 C  CA    . ARG A 1 257 ? -17.393 24.907 50.929 1.00 10.40 ? 257 ARG A CA    1 
ATOM   1956 C  C     . ARG A 1 257 ? -16.384 24.755 49.789 1.00 16.07 ? 257 ARG A C     1 
ATOM   1957 O  O     . ARG A 1 257 ? -15.517 23.878 49.835 1.00 17.23 ? 257 ARG A O     1 
ATOM   1958 C  CB    . ARG A 1 257 ? -18.250 23.651 50.997 1.00 7.44  ? 257 ARG A CB    1 
ATOM   1959 C  CG    . ARG A 1 257 ? -19.072 23.514 52.243 1.00 11.51 ? 257 ARG A CG    1 
ATOM   1960 C  CD    . ARG A 1 257 ? -19.427 22.065 52.486 1.00 13.76 ? 257 ARG A CD    1 
ATOM   1961 N  NE    . ARG A 1 257 ? -20.305 21.539 51.447 1.00 19.29 ? 257 ARG A NE    1 
ATOM   1962 C  CZ    . ARG A 1 257 ? -19.894 20.588 50.612 1.00 19.68 ? 257 ARG A CZ    1 
ATOM   1963 N  NH1   . ARG A 1 257 ? -18.664 20.098 50.709 1.00 16.91 ? 257 ARG A NH1   1 
ATOM   1964 N  NH2   . ARG A 1 257 ? -20.729 20.110 49.691 1.00 18.80 ? 257 ARG A NH2   1 
ATOM   1965 N  N     . TYR A 1 258 ? -16.507 25.589 48.758 1.00 17.79 ? 258 TYR A N     1 
ATOM   1966 C  CA    . TYR A 1 258 ? -15.631 25.498 47.600 1.00 13.53 ? 258 TYR A CA    1 
ATOM   1967 C  C     . TYR A 1 258 ? -14.477 26.497 47.556 1.00 15.59 ? 258 TYR A C     1 
ATOM   1968 O  O     . TYR A 1 258 ? -13.989 26.849 46.496 1.00 17.15 ? 258 TYR A O     1 
ATOM   1969 C  CB    . TYR A 1 258 ? -16.483 25.556 46.331 1.00 11.25 ? 258 TYR A CB    1 
ATOM   1970 C  CG    . TYR A 1 258 ? -17.518 24.445 46.281 1.00 7.49  ? 258 TYR A CG    1 
ATOM   1971 C  CD1   . TYR A 1 258 ? -17.187 23.152 46.669 1.00 6.11  ? 258 TYR A CD1   1 
ATOM   1972 C  CD2   . TYR A 1 258 ? -18.828 24.688 45.853 1.00 11.25 ? 258 TYR A CD2   1 
ATOM   1973 C  CE1   . TYR A 1 258 ? -18.105 22.134 46.631 1.00 5.01  ? 258 TYR A CE1   1 
ATOM   1974 C  CE2   . TYR A 1 258 ? -19.778 23.658 45.823 1.00 7.21  ? 258 TYR A CE2   1 
ATOM   1975 C  CZ    . TYR A 1 258 ? -19.394 22.387 46.211 1.00 7.93  ? 258 TYR A CZ    1 
ATOM   1976 O  OH    . TYR A 1 258 ? -20.286 21.342 46.172 1.00 17.33 ? 258 TYR A OH    1 
ATOM   1977 N  N     . VAL A 1 259 ? -14.072 27.007 48.710 1.00 19.47 ? 259 VAL A N     1 
ATOM   1978 C  CA    . VAL A 1 259 ? -12.937 27.923 48.753 1.00 20.14 ? 259 VAL A CA    1 
ATOM   1979 C  C     . VAL A 1 259 ? -11.823 27.010 49.226 1.00 22.36 ? 259 VAL A C     1 
ATOM   1980 O  O     . VAL A 1 259 ? -11.934 26.375 50.278 1.00 23.38 ? 259 VAL A O     1 
ATOM   1981 C  CB    . VAL A 1 259 ? -13.161 29.092 49.722 1.00 16.40 ? 259 VAL A CB    1 
ATOM   1982 C  CG1   . VAL A 1 259 ? -11.952 30.011 49.705 1.00 12.59 ? 259 VAL A CG1   1 
ATOM   1983 C  CG2   . VAL A 1 259 ? -14.414 29.868 49.322 1.00 16.63 ? 259 VAL A CG2   1 
ATOM   1984 N  N     . ASP A 1 260 ? -10.776 26.894 48.425 1.00 22.48 ? 260 ASP A N     1 
ATOM   1985 C  CA    . ASP A 1 260 ? -9.695  25.989 48.755 1.00 23.22 ? 260 ASP A CA    1 
ATOM   1986 C  C     . ASP A 1 260 ? -8.501  26.627 49.453 1.00 23.87 ? 260 ASP A C     1 
ATOM   1987 O  O     . ASP A 1 260 ? -7.883  26.032 50.354 1.00 25.16 ? 260 ASP A O     1 
ATOM   1988 C  CB    . ASP A 1 260 ? -9.228  25.275 47.476 1.00 26.47 ? 260 ASP A CB    1 
ATOM   1989 C  CG    . ASP A 1 260 ? -10.373 24.605 46.723 1.00 29.19 ? 260 ASP A CG    1 
ATOM   1990 O  OD1   . ASP A 1 260 ? -11.078 23.766 47.321 1.00 29.30 ? 260 ASP A OD1   1 
ATOM   1991 O  OD2   . ASP A 1 260 ? -10.572 24.925 45.530 1.00 28.38 ? 260 ASP A OD2   1 
ATOM   1992 N  N     . TYR A 1 261 ? -8.179  27.840 49.037 1.00 20.70 ? 261 TYR A N     1 
ATOM   1993 C  CA    . TYR A 1 261 ? -7.024  28.533 49.567 1.00 15.43 ? 261 TYR A CA    1 
ATOM   1994 C  C     . TYR A 1 261 ? -7.333  30.020 49.573 1.00 16.84 ? 261 TYR A C     1 
ATOM   1995 O  O     . TYR A 1 261 ? -7.891  30.549 48.600 1.00 16.28 ? 261 TYR A O     1 
ATOM   1996 C  CB    . TYR A 1 261 ? -5.831  28.229 48.653 1.00 15.25 ? 261 TYR A CB    1 
ATOM   1997 C  CG    . TYR A 1 261 ? -4.516  28.823 49.077 1.00 16.73 ? 261 TYR A CG    1 
ATOM   1998 C  CD1   . TYR A 1 261 ? -4.344  30.200 49.117 1.00 22.61 ? 261 TYR A CD1   1 
ATOM   1999 C  CD2   . TYR A 1 261 ? -3.436  28.013 49.439 1.00 17.24 ? 261 TYR A CD2   1 
ATOM   2000 C  CE1   . TYR A 1 261 ? -3.142  30.766 49.507 1.00 25.45 ? 261 TYR A CE1   1 
ATOM   2001 C  CE2   . TYR A 1 261 ? -2.214  28.575 49.834 1.00 19.38 ? 261 TYR A CE2   1 
ATOM   2002 C  CZ    . TYR A 1 261 ? -2.086  29.955 49.863 1.00 20.21 ? 261 TYR A CZ    1 
ATOM   2003 O  OH    . TYR A 1 261 ? -0.932  30.574 50.253 1.00 24.25 ? 261 TYR A OH    1 
ATOM   2004 N  N     . VAL A 1 262 ? -7.035  30.682 50.692 1.00 15.23 ? 262 VAL A N     1 
ATOM   2005 C  CA    . VAL A 1 262 ? -7.266  32.109 50.791 1.00 11.36 ? 262 VAL A CA    1 
ATOM   2006 C  C     . VAL A 1 262 ? -5.901  32.678 51.028 1.00 13.21 ? 262 VAL A C     1 
ATOM   2007 O  O     . VAL A 1 262 ? -5.188  32.224 51.919 1.00 16.03 ? 262 VAL A O     1 
ATOM   2008 C  CB    . VAL A 1 262 ? -8.184  32.484 51.946 1.00 5.01  ? 262 VAL A CB    1 
ATOM   2009 C  CG1   . VAL A 1 262 ? -8.679  33.888 51.771 1.00 5.01  ? 262 VAL A CG1   1 
ATOM   2010 C  CG2   . VAL A 1 262 ? -9.346  31.548 52.014 1.00 12.70 ? 262 VAL A CG2   1 
ATOM   2011 N  N     . LEU A 1 263 ? -5.514  33.602 50.160 1.00 11.05 ? 263 LEU A N     1 
ATOM   2012 C  CA    . LEU A 1 263 ? -4.223  34.252 50.221 1.00 11.50 ? 263 LEU A CA    1 
ATOM   2013 C  C     . LEU A 1 263 ? -4.551  35.676 50.626 1.00 15.44 ? 263 LEU A C     1 
ATOM   2014 O  O     . LEU A 1 263 ? -5.531  36.256 50.134 1.00 18.70 ? 263 LEU A O     1 
ATOM   2015 C  CB    . LEU A 1 263 ? -3.560  34.195 48.834 1.00 9.18  ? 263 LEU A CB    1 
ATOM   2016 C  CG    . LEU A 1 263 ? -2.131  34.617 48.452 1.00 6.94  ? 263 LEU A CG    1 
ATOM   2017 C  CD1   . LEU A 1 263 ? -2.056  36.095 48.425 1.00 12.50 ? 263 LEU A CD1   1 
ATOM   2018 C  CD2   . LEU A 1 263 ? -1.035  34.029 49.337 1.00 5.01  ? 263 LEU A CD2   1 
ATOM   2019 N  N     . GLY A 1 264 ? -3.802  36.189 51.602 1.00 12.72 ? 264 GLY A N     1 
ATOM   2020 C  CA    . GLY A 1 264 ? -4.013  37.535 52.078 1.00 5.01  ? 264 GLY A CA    1 
ATOM   2021 C  C     . GLY A 1 264 ? -2.864  38.373 51.597 1.00 5.75  ? 264 GLY A C     1 
ATOM   2022 O  O     . GLY A 1 264 ? -1.723  37.931 51.633 1.00 6.72  ? 264 GLY A O     1 
ATOM   2023 N  N     . ILE A 1 265 ? -3.158  39.557 51.081 1.00 9.57  ? 265 ILE A N     1 
ATOM   2024 C  CA    . ILE A 1 265 ? -2.110  40.429 50.571 1.00 9.21  ? 265 ILE A CA    1 
ATOM   2025 C  C     . ILE A 1 265 ? -1.710  41.276 51.743 1.00 11.29 ? 265 ILE A C     1 
ATOM   2026 O  O     . ILE A 1 265 ? -2.550  41.990 52.310 1.00 10.58 ? 265 ILE A O     1 
ATOM   2027 C  CB    . ILE A 1 265 ? -2.623  41.317 49.403 1.00 6.05  ? 265 ILE A CB    1 
ATOM   2028 C  CG1   . ILE A 1 265 ? -3.349  40.459 48.369 1.00 8.71  ? 265 ILE A CG1   1 
ATOM   2029 C  CG2   . ILE A 1 265 ? -1.465  42.045 48.740 1.00 6.84  ? 265 ILE A CG2   1 
ATOM   2030 C  CD1   . ILE A 1 265 ? -2.481  39.357 47.772 1.00 12.51 ? 265 ILE A CD1   1 
ATOM   2031 N  N     . LEU A 1 266 ? -0.440  41.159 52.120 1.00 12.77 ? 266 LEU A N     1 
ATOM   2032 C  CA    . LEU A 1 266 ? 0.125   41.867 53.264 1.00 15.37 ? 266 LEU A CA    1 
ATOM   2033 C  C     . LEU A 1 266 ? 1.237   42.837 52.842 1.00 11.92 ? 266 LEU A C     1 
ATOM   2034 O  O     . LEU A 1 266 ? 2.263   42.413 52.307 1.00 11.87 ? 266 LEU A O     1 
ATOM   2035 C  CB    . LEU A 1 266 ? 0.682   40.828 54.256 1.00 15.39 ? 266 LEU A CB    1 
ATOM   2036 C  CG    . LEU A 1 266 ? 1.331   41.283 55.573 1.00 16.75 ? 266 LEU A CG    1 
ATOM   2037 C  CD1   . LEU A 1 266 ? 0.303   42.037 56.406 1.00 15.15 ? 266 LEU A CD1   1 
ATOM   2038 C  CD2   . LEU A 1 266 ? 1.893   40.077 56.348 1.00 12.30 ? 266 LEU A CD2   1 
ATOM   2039 N  N     . LYS A 1 267 ? 1.020   44.133 53.042 1.00 8.93  ? 267 LYS A N     1 
ATOM   2040 C  CA    . LYS A 1 267 ? 2.041   45.115 52.698 1.00 12.50 ? 267 LYS A CA    1 
ATOM   2041 C  C     . LYS A 1 267 ? 2.990   45.271 53.887 1.00 15.70 ? 267 LYS A C     1 
ATOM   2042 O  O     . LYS A 1 267 ? 2.533   45.420 55.020 1.00 19.57 ? 267 LYS A O     1 
ATOM   2043 C  CB    . LYS A 1 267 ? 1.399   46.449 52.353 1.00 7.32  ? 267 LYS A CB    1 
ATOM   2044 C  CG    . LYS A 1 267 ? 2.412   47.546 52.059 1.00 10.16 ? 267 LYS A CG    1 
ATOM   2045 C  CD    . LYS A 1 267 ? 1.808   48.677 51.232 1.00 5.01  ? 267 LYS A CD    1 
ATOM   2046 C  CE    . LYS A 1 267 ? 0.500   49.153 51.802 1.00 8.60  ? 267 LYS A CE    1 
ATOM   2047 N  NZ    . LYS A 1 267 ? -0.063  50.272 51.002 1.00 9.82  ? 267 LYS A NZ    1 
ATOM   2048 N  N     . ALA A 1 268 ? 4.298   45.231 53.628 1.00 17.59 ? 268 ALA A N     1 
ATOM   2049 C  CA    . ALA A 1 268 ? 5.340   45.340 54.668 1.00 19.66 ? 268 ALA A CA    1 
ATOM   2050 C  C     . ALA A 1 268 ? 5.155   46.444 55.741 1.00 18.72 ? 268 ALA A C     1 
ATOM   2051 O  O     . ALA A 1 268 ? 5.800   46.424 56.794 1.00 15.49 ? 268 ALA A O     1 
ATOM   2052 C  CB    . ALA A 1 268 ? 6.730   45.446 54.010 1.00 18.30 ? 268 ALA A CB    1 
ATOM   2053 N  N     . TYR A 1 269 ? 4.331   47.435 55.432 1.00 15.80 ? 269 TYR A N     1 
ATOM   2054 C  CA    . TYR A 1 269 ? 4.014   48.505 56.358 1.00 13.72 ? 269 TYR A CA    1 
ATOM   2055 C  C     . TYR A 1 269 ? 2.509   48.692 56.207 1.00 15.69 ? 269 TYR A C     1 
ATOM   2056 O  O     . TYR A 1 269 ? 1.868   47.954 55.451 1.00 21.04 ? 269 TYR A O     1 
ATOM   2057 C  CB    . TYR A 1 269 ? 4.806   49.783 56.061 1.00 17.29 ? 269 TYR A CB    1 
ATOM   2058 C  CG    . TYR A 1 269 ? 4.746   50.321 54.644 1.00 20.72 ? 269 TYR A CG    1 
ATOM   2059 C  CD1   . TYR A 1 269 ? 3.990   51.455 54.338 1.00 22.81 ? 269 TYR A CD1   1 
ATOM   2060 C  CD2   . TYR A 1 269 ? 5.491   49.725 53.615 1.00 21.78 ? 269 TYR A CD2   1 
ATOM   2061 C  CE1   . TYR A 1 269 ? 3.976   51.985 53.037 1.00 22.51 ? 269 TYR A CE1   1 
ATOM   2062 C  CE2   . TYR A 1 269 ? 5.489   50.245 52.319 1.00 15.70 ? 269 TYR A CE2   1 
ATOM   2063 C  CZ    . TYR A 1 269 ? 4.731   51.368 52.041 1.00 19.14 ? 269 TYR A CZ    1 
ATOM   2064 O  OH    . TYR A 1 269 ? 4.726   51.872 50.774 1.00 16.58 ? 269 TYR A OH    1 
ATOM   2065 N  N     . SER A 1 270 ? 1.926   49.652 56.903 1.00 10.53 ? 270 SER A N     1 
ATOM   2066 C  CA    . SER A 1 270 ? 0.492   49.826 56.814 1.00 5.59  ? 270 SER A CA    1 
ATOM   2067 C  C     . SER A 1 270 ? 0.140   51.173 56.222 1.00 8.59  ? 270 SER A C     1 
ATOM   2068 O  O     . SER A 1 270 ? 0.920   52.129 56.329 1.00 6.33  ? 270 SER A O     1 
ATOM   2069 C  CB    . SER A 1 270 ? -0.137  49.748 58.220 1.00 11.98 ? 270 SER A CB    1 
ATOM   2070 O  OG    . SER A 1 270 ? 0.133   48.537 58.912 1.00 12.15 ? 270 SER A OG    1 
ATOM   2071 N  N     . THR A 1 271 ? -1.015  51.229 55.563 1.00 8.49  ? 271 THR A N     1 
ATOM   2072 C  CA    . THR A 1 271 ? -1.563  52.479 55.016 1.00 9.34  ? 271 THR A CA    1 
ATOM   2073 C  C     . THR A 1 271 ? -3.067  52.446 55.206 1.00 8.50  ? 271 THR A C     1 
ATOM   2074 O  O     . THR A 1 271 ? -3.666  51.383 55.403 1.00 5.01  ? 271 THR A O     1 
ATOM   2075 C  CB    . THR A 1 271 ? -1.285  52.770 53.498 1.00 7.85  ? 271 THR A CB    1 
ATOM   2076 O  OG1   . THR A 1 271 ? -1.592  51.624 52.690 1.00 10.01 ? 271 THR A OG1   1 
ATOM   2077 C  CG2   . THR A 1 271 ? 0.148   53.237 53.284 1.00 8.59  ? 271 THR A CG2   1 
ATOM   2078 N  N     . ARG A 1 272 ? -3.659  53.627 55.172 1.00 7.45  ? 272 ARG A N     1 
ATOM   2079 C  CA    . ARG A 1 272 ? -5.082  53.775 55.319 1.00 13.14 ? 272 ARG A CA    1 
ATOM   2080 C  C     . ARG A 1 272 ? -5.438  55.084 54.594 1.00 14.75 ? 272 ARG A C     1 
ATOM   2081 O  O     . ARG A 1 272 ? -4.684  56.049 54.685 1.00 20.26 ? 272 ARG A O     1 
ATOM   2082 C  CB    . ARG A 1 272 ? -5.439  53.829 56.827 1.00 14.47 ? 272 ARG A CB    1 
ATOM   2083 C  CG    . ARG A 1 272 ? -6.867  54.238 57.095 1.00 13.64 ? 272 ARG A CG    1 
ATOM   2084 C  CD    . ARG A 1 272 ? -7.401  53.954 58.481 1.00 5.01  ? 272 ARG A CD    1 
ATOM   2085 N  NE    . ARG A 1 272 ? -8.855  54.042 58.358 1.00 5.12  ? 272 ARG A NE    1 
ATOM   2086 C  CZ    . ARG A 1 272 ? -9.672  53.185 58.961 1.00 14.25 ? 272 ARG A CZ    1 
ATOM   2087 N  NH1   . ARG A 1 272 ? -9.203  52.227 59.748 1.00 16.66 ? 272 ARG A NH1   1 
ATOM   2088 N  NH2   . ARG A 1 272 ? -10.956 53.176 58.639 1.00 21.14 ? 272 ARG A NH2   1 
ATOM   2089 N  N     . VAL A 1 273 ? -6.489  55.076 53.772 1.00 14.65 ? 273 VAL A N     1 
ATOM   2090 C  CA    . VAL A 1 273 ? -6.939  56.289 53.079 1.00 16.25 ? 273 VAL A CA    1 
ATOM   2091 C  C     . VAL A 1 273 ? -8.362  56.525 53.564 1.00 14.29 ? 273 VAL A C     1 
ATOM   2092 O  O     . VAL A 1 273 ? -9.212  55.644 53.444 1.00 16.24 ? 273 VAL A O     1 
ATOM   2093 C  CB    . VAL A 1 273 ? -7.010  56.138 51.541 1.00 17.47 ? 273 VAL A CB    1 
ATOM   2094 C  CG1   . VAL A 1 273 ? -7.015  57.507 50.896 1.00 19.01 ? 273 VAL A CG1   1 
ATOM   2095 C  CG2   . VAL A 1 273 ? -5.873  55.320 51.030 1.00 24.65 ? 273 VAL A CG2   1 
ATOM   2096 N  N     . GLY A 1 274 ? -8.634  57.730 54.050 1.00 17.51 ? 274 GLY A N     1 
ATOM   2097 C  CA    . GLY A 1 274 ? -9.952  58.044 54.574 1.00 16.01 ? 274 GLY A CA    1 
ATOM   2098 C  C     . GLY A 1 274 ? -9.786  58.189 56.071 1.00 19.39 ? 274 GLY A C     1 
ATOM   2099 O  O     . GLY A 1 274 ? -8.728  57.846 56.612 1.00 21.76 ? 274 GLY A O     1 
ATOM   2100 N  N     . ALA A 1 275 ? -10.807 58.689 56.753 1.00 20.59 ? 275 ALA A N     1 
ATOM   2101 C  CA    . ALA A 1 275 ? -10.733 58.867 58.206 1.00 20.35 ? 275 ALA A CA    1 
ATOM   2102 C  C     . ALA A 1 275 ? -10.766 57.508 58.918 1.00 19.46 ? 275 ALA A C     1 
ATOM   2103 O  O     . ALA A 1 275 ? -11.035 56.482 58.281 1.00 19.36 ? 275 ALA A O     1 
ATOM   2104 C  CB    . ALA A 1 275 ? -11.902 59.745 58.682 1.00 19.31 ? 275 ALA A CB    1 
ATOM   2105 N  N     . GLY A 1 276 ? -10.458 57.490 60.217 1.00 18.73 ? 276 GLY A N     1 
ATOM   2106 C  CA    . GLY A 1 276 ? -10.516 56.242 60.965 1.00 13.96 ? 276 GLY A CA    1 
ATOM   2107 C  C     . GLY A 1 276 ? -9.302  55.845 61.789 1.00 16.45 ? 276 GLY A C     1 
ATOM   2108 O  O     . GLY A 1 276 ? -8.200  56.380 61.596 1.00 17.87 ? 276 GLY A O     1 
ATOM   2109 N  N     . PRO A 1 277 ? -9.473  54.873 62.709 1.00 15.23 ? 277 PRO A N     1 
ATOM   2110 C  CA    . PRO A 1 277 ? -8.466  54.319 63.621 1.00 10.75 ? 277 PRO A CA    1 
ATOM   2111 C  C     . PRO A 1 277 ? -7.248  53.787 62.881 1.00 13.82 ? 277 PRO A C     1 
ATOM   2112 O  O     . PRO A 1 277 ? -7.381  53.048 61.902 1.00 15.60 ? 277 PRO A O     1 
ATOM   2113 C  CB    . PRO A 1 277 ? -9.210  53.165 64.281 1.00 11.49 ? 277 PRO A CB    1 
ATOM   2114 C  CG    . PRO A 1 277 ? -10.641 53.555 64.193 1.00 5.01  ? 277 PRO A CG    1 
ATOM   2115 C  CD    . PRO A 1 277 ? -10.758 54.165 62.859 1.00 13.87 ? 277 PRO A CD    1 
ATOM   2116 N  N     . PHE A 1 278 ? -6.062  54.144 63.364 1.00 13.79 ? 278 PHE A N     1 
ATOM   2117 C  CA    . PHE A 1 278 ? -4.815  53.692 62.768 1.00 11.74 ? 278 PHE A CA    1 
ATOM   2118 C  C     . PHE A 1 278 ? -3.781  53.731 63.880 1.00 17.07 ? 278 PHE A C     1 
ATOM   2119 O  O     . PHE A 1 278 ? -3.027  54.697 64.012 1.00 17.76 ? 278 PHE A O     1 
ATOM   2120 C  CB    . PHE A 1 278 ? -4.378  54.603 61.612 1.00 11.20 ? 278 PHE A CB    1 
ATOM   2121 C  CG    . PHE A 1 278 ? -3.238  54.043 60.764 1.00 8.08  ? 278 PHE A CG    1 
ATOM   2122 C  CD1   . PHE A 1 278 ? -2.711  52.777 60.998 1.00 5.01  ? 278 PHE A CD1   1 
ATOM   2123 C  CD2   . PHE A 1 278 ? -2.731  54.773 59.692 1.00 12.99 ? 278 PHE A CD2   1 
ATOM   2124 C  CE1   . PHE A 1 278 ? -1.710  52.251 60.175 1.00 5.01  ? 278 PHE A CE1   1 
ATOM   2125 C  CE2   . PHE A 1 278 ? -1.725  54.248 58.866 1.00 9.41  ? 278 PHE A CE2   1 
ATOM   2126 C  CZ    . PHE A 1 278 ? -1.220  52.982 59.115 1.00 5.01  ? 278 PHE A CZ    1 
ATOM   2127 N  N     . PRO A 1 279 ? -3.757  52.683 64.719 1.00 18.09 ? 279 PRO A N     1 
ATOM   2128 C  CA    . PRO A 1 279 ? -2.833  52.533 65.844 1.00 16.37 ? 279 PRO A CA    1 
ATOM   2129 C  C     . PRO A 1 279 ? -1.372  52.885 65.541 1.00 18.02 ? 279 PRO A C     1 
ATOM   2130 O  O     . PRO A 1 279 ? -0.830  53.834 66.105 1.00 20.79 ? 279 PRO A O     1 
ATOM   2131 C  CB    . PRO A 1 279 ? -2.988  51.061 66.185 1.00 16.66 ? 279 PRO A CB    1 
ATOM   2132 C  CG    . PRO A 1 279 ? -4.452  50.856 65.983 1.00 17.22 ? 279 PRO A CG    1 
ATOM   2133 C  CD    . PRO A 1 279 ? -4.713  51.562 64.672 1.00 17.68 ? 279 PRO A CD    1 
ATOM   2134 N  N     . THR A 1 280 ? -0.755  52.133 64.636 1.00 16.23 ? 280 THR A N     1 
ATOM   2135 C  CA    . THR A 1 280 ? 0.643   52.319 64.258 1.00 13.98 ? 280 THR A CA    1 
ATOM   2136 C  C     . THR A 1 280 ? 0.939   53.438 63.269 1.00 14.65 ? 280 THR A C     1 
ATOM   2137 O  O     . THR A 1 280 ? 1.967   53.409 62.590 1.00 16.32 ? 280 THR A O     1 
ATOM   2138 C  CB    . THR A 1 280 ? 1.208   51.025 63.643 1.00 20.80 ? 280 THR A CB    1 
ATOM   2139 O  OG1   . THR A 1 280 ? 0.516   50.731 62.411 1.00 19.74 ? 280 THR A OG1   1 
ATOM   2140 C  CG2   . THR A 1 280 ? 1.044   49.855 64.621 1.00 17.91 ? 280 THR A CG2   1 
ATOM   2141 N  N     . GLU A 1 281 ? 0.035   54.396 63.133 1.00 13.22 ? 281 GLU A N     1 
ATOM   2142 C  CA    . GLU A 1 281 ? 0.268   55.483 62.205 1.00 13.57 ? 281 GLU A CA    1 
ATOM   2143 C  C     . GLU A 1 281 ? 1.545   56.252 62.585 1.00 19.58 ? 281 GLU A C     1 
ATOM   2144 O  O     . GLU A 1 281 ? 1.880   56.390 63.773 1.00 17.71 ? 281 GLU A O     1 
ATOM   2145 C  CB    . GLU A 1 281 ? -0.939  56.415 62.186 1.00 11.13 ? 281 GLU A CB    1 
ATOM   2146 C  CG    . GLU A 1 281 ? -0.870  57.497 61.136 1.00 15.26 ? 281 GLU A CG    1 
ATOM   2147 C  CD    . GLU A 1 281 ? -2.119  58.351 61.099 1.00 20.38 ? 281 GLU A CD    1 
ATOM   2148 O  OE1   . GLU A 1 281 ? -3.083  58.047 61.825 1.00 24.26 ? 281 GLU A OE1   1 
ATOM   2149 O  OE2   . GLU A 1 281 ? -2.147  59.336 60.339 1.00 23.90 ? 281 GLU A OE2   1 
ATOM   2150 N  N     . LEU A 1 282 ? 2.275   56.701 61.565 1.00 19.21 ? 282 LEU A N     1 
ATOM   2151 C  CA    . LEU A 1 282 ? 3.507   57.451 61.744 1.00 16.50 ? 282 LEU A CA    1 
ATOM   2152 C  C     . LEU A 1 282 ? 3.256   58.836 61.206 1.00 18.80 ? 282 LEU A C     1 
ATOM   2153 O  O     . LEU A 1 282 ? 2.535   59.015 60.232 1.00 23.19 ? 282 LEU A O     1 
ATOM   2154 C  CB    . LEU A 1 282 ? 4.667   56.799 60.995 1.00 15.15 ? 282 LEU A CB    1 
ATOM   2155 C  CG    . LEU A 1 282 ? 5.193   55.442 61.496 1.00 20.54 ? 282 LEU A CG    1 
ATOM   2156 C  CD1   . LEU A 1 282 ? 6.089   54.805 60.431 1.00 22.61 ? 282 LEU A CD1   1 
ATOM   2157 C  CD2   . LEU A 1 282 ? 5.943   55.577 62.818 1.00 16.56 ? 282 LEU A CD2   1 
ATOM   2158 N  N     . PHE A 1 283 ? 3.816   59.828 61.869 1.00 22.05 ? 283 PHE A N     1 
ATOM   2159 C  CA    . PHE A 1 283 ? 3.632   61.200 61.458 1.00 23.37 ? 283 PHE A CA    1 
ATOM   2160 C  C     . PHE A 1 283 ? 4.979   61.867 61.293 1.00 26.81 ? 283 PHE A C     1 
ATOM   2161 O  O     . PHE A 1 283 ? 5.064   62.998 60.819 1.00 28.82 ? 283 PHE A O     1 
ATOM   2162 C  CB    . PHE A 1 283 ? 2.845   61.949 62.515 1.00 23.23 ? 283 PHE A CB    1 
ATOM   2163 C  CG    . PHE A 1 283 ? 1.559   61.300 62.883 1.00 19.95 ? 283 PHE A CG    1 
ATOM   2164 C  CD1   . PHE A 1 283 ? 0.408   61.554 62.156 1.00 20.37 ? 283 PHE A CD1   1 
ATOM   2165 C  CD2   . PHE A 1 283 ? 1.481   60.474 63.993 1.00 20.91 ? 283 PHE A CD2   1 
ATOM   2166 C  CE1   . PHE A 1 283 ? -0.802  60.997 62.534 1.00 18.36 ? 283 PHE A CE1   1 
ATOM   2167 C  CE2   . PHE A 1 283 ? 0.270   59.914 64.374 1.00 17.24 ? 283 PHE A CE2   1 
ATOM   2168 C  CZ    . PHE A 1 283 ? -0.869  60.176 63.647 1.00 11.62 ? 283 PHE A CZ    1 
ATOM   2169 N  N     . ASP A 1 284 ? 6.021   61.160 61.711 1.00 28.59 ? 284 ASP A N     1 
ATOM   2170 C  CA    . ASP A 1 284 ? 7.393   61.641 61.652 1.00 33.69 ? 284 ASP A CA    1 
ATOM   2171 C  C     . ASP A 1 284 ? 8.006   61.504 60.247 1.00 39.01 ? 284 ASP A C     1 
ATOM   2172 O  O     . ASP A 1 284 ? 7.291   61.385 59.245 1.00 40.42 ? 284 ASP A O     1 
ATOM   2173 C  CB    . ASP A 1 284 ? 8.226   60.848 62.668 1.00 28.85 ? 284 ASP A CB    1 
ATOM   2174 C  CG    . ASP A 1 284 ? 8.282   59.362 62.343 1.00 27.17 ? 284 ASP A CG    1 
ATOM   2175 O  OD1   . ASP A 1 284 ? 7.362   58.845 61.676 1.00 22.53 ? 284 ASP A OD1   1 
ATOM   2176 O  OD2   . ASP A 1 284 ? 9.270   58.709 62.721 1.00 32.87 ? 284 ASP A OD2   1 
ATOM   2177 N  N     . GLU A 1 285 ? 9.340   61.454 60.201 1.00 43.56 ? 285 GLU A N     1 
ATOM   2178 C  CA    . GLU A 1 285 ? 10.106  61.314 58.958 1.00 44.06 ? 285 GLU A CA    1 
ATOM   2179 C  C     . GLU A 1 285 ? 9.909   59.939 58.321 1.00 42.18 ? 285 GLU A C     1 
ATOM   2180 O  O     . GLU A 1 285 ? 9.787   59.839 57.103 1.00 43.85 ? 285 GLU A O     1 
ATOM   2181 C  CB    . GLU A 1 285 ? 11.612  61.542 59.197 1.00 47.40 ? 285 GLU A CB    1 
ATOM   2182 C  CG    . GLU A 1 285 ? 12.012  62.012 60.608 1.00 54.95 ? 285 GLU A CG    1 
ATOM   2183 C  CD    . GLU A 1 285 ? 11.542  63.428 60.925 1.00 57.34 ? 285 GLU A CD    1 
ATOM   2184 O  OE1   . GLU A 1 285 ? 10.494  63.576 61.597 1.00 60.37 ? 285 GLU A OE1   1 
ATOM   2185 O  OE2   . GLU A 1 285 ? 12.224  64.391 60.505 1.00 59.53 ? 285 GLU A OE2   1 
ATOM   2186 N  N     . THR A 1 286 ? 9.889   58.883 59.136 1.00 39.95 ? 286 THR A N     1 
ATOM   2187 C  CA    . THR A 1 286 ? 9.694   57.519 58.634 1.00 36.82 ? 286 THR A CA    1 
ATOM   2188 C  C     . THR A 1 286 ? 8.347   57.399 57.926 1.00 37.08 ? 286 THR A C     1 
ATOM   2189 O  O     . THR A 1 286 ? 8.202   56.597 57.013 1.00 39.67 ? 286 THR A O     1 
ATOM   2190 C  CB    . THR A 1 286 ? 9.741   56.484 59.755 1.00 35.78 ? 286 THR A CB    1 
ATOM   2191 O  OG1   . THR A 1 286 ? 10.914  56.698 60.547 1.00 40.50 ? 286 THR A OG1   1 
ATOM   2192 C  CG2   . THR A 1 286 ? 9.766   55.080 59.183 1.00 31.99 ? 286 THR A CG2   1 
ATOM   2193 N  N     . GLY A 1 287 ? 7.366   58.190 58.360 1.00 36.29 ? 287 GLY A N     1 
ATOM   2194 C  CA    . GLY A 1 287 ? 6.063   58.182 57.720 1.00 33.01 ? 287 GLY A CA    1 
ATOM   2195 C  C     . GLY A 1 287 ? 6.213   58.797 56.336 1.00 31.56 ? 287 GLY A C     1 
ATOM   2196 O  O     . GLY A 1 287 ? 5.704   58.269 55.346 1.00 29.90 ? 287 GLY A O     1 
ATOM   2197 N  N     . GLU A 1 288 ? 6.913   59.925 56.271 1.00 29.32 ? 288 GLU A N     1 
ATOM   2198 C  CA    . GLU A 1 288 ? 7.164   60.585 55.004 1.00 33.60 ? 288 GLU A CA    1 
ATOM   2199 C  C     . GLU A 1 288 ? 7.982   59.650 54.116 1.00 33.50 ? 288 GLU A C     1 
ATOM   2200 O  O     . GLU A 1 288 ? 7.691   59.488 52.935 1.00 36.58 ? 288 GLU A O     1 
ATOM   2201 C  CB    . GLU A 1 288 ? 7.926   61.893 55.230 1.00 40.01 ? 288 GLU A CB    1 
ATOM   2202 C  CG    . GLU A 1 288 ? 8.756   62.392 54.021 1.00 46.16 ? 288 GLU A CG    1 
ATOM   2203 C  CD    . GLU A 1 288 ? 7.922   62.964 52.871 1.00 50.99 ? 288 GLU A CD    1 
ATOM   2204 O  OE1   . GLU A 1 288 ? 6.671   62.984 52.953 1.00 53.51 ? 288 GLU A OE1   1 
ATOM   2205 O  OE2   . GLU A 1 288 ? 8.536   63.416 51.878 1.00 53.56 ? 288 GLU A OE2   1 
ATOM   2206 N  N     . PHE A 1 289 ? 9.004   59.029 54.692 1.00 32.69 ? 289 PHE A N     1 
ATOM   2207 C  CA    . PHE A 1 289 ? 9.858   58.114 53.946 1.00 32.60 ? 289 PHE A CA    1 
ATOM   2208 C  C     . PHE A 1 289 ? 9.016   57.054 53.251 1.00 34.58 ? 289 PHE A C     1 
ATOM   2209 O  O     . PHE A 1 289 ? 9.110   56.882 52.031 1.00 35.40 ? 289 PHE A O     1 
ATOM   2210 C  CB    . PHE A 1 289 ? 10.876  57.454 54.884 1.00 31.59 ? 289 PHE A CB    1 
ATOM   2211 C  CG    . PHE A 1 289 ? 11.729  56.402 54.223 1.00 33.30 ? 289 PHE A CG    1 
ATOM   2212 C  CD1   . PHE A 1 289 ? 12.827  56.762 53.450 1.00 34.44 ? 289 PHE A CD1   1 
ATOM   2213 C  CD2   . PHE A 1 289 ? 11.438  55.047 54.382 1.00 33.90 ? 289 PHE A CD2   1 
ATOM   2214 C  CE1   . PHE A 1 289 ? 13.621  55.784 52.844 1.00 36.20 ? 289 PHE A CE1   1 
ATOM   2215 C  CE2   . PHE A 1 289 ? 12.226  54.063 53.780 1.00 33.16 ? 289 PHE A CE2   1 
ATOM   2216 C  CZ    . PHE A 1 289 ? 13.318  54.432 53.012 1.00 33.35 ? 289 PHE A CZ    1 
ATOM   2217 N  N     . LEU A 1 290 ? 8.184   56.367 54.035 1.00 33.10 ? 290 LEU A N     1 
ATOM   2218 C  CA    . LEU A 1 290 ? 7.318   55.310 53.529 1.00 30.18 ? 290 LEU A CA    1 
ATOM   2219 C  C     . LEU A 1 290 ? 6.441   55.795 52.392 1.00 29.41 ? 290 LEU A C     1 
ATOM   2220 O  O     . LEU A 1 290 ? 6.453   55.207 51.309 1.00 33.68 ? 290 LEU A O     1 
ATOM   2221 C  CB    . LEU A 1 290 ? 6.445   54.735 54.647 1.00 22.54 ? 290 LEU A CB    1 
ATOM   2222 C  CG    . LEU A 1 290 ? 7.138   53.815 55.649 1.00 21.54 ? 290 LEU A CG    1 
ATOM   2223 C  CD1   . LEU A 1 290 ? 6.133   53.286 56.673 1.00 23.92 ? 290 LEU A CD1   1 
ATOM   2224 C  CD2   . LEU A 1 290 ? 7.803   52.665 54.926 1.00 18.79 ? 290 LEU A CD2   1 
ATOM   2225 N  N     . CYS A 1 291 ? 5.687   56.862 52.630 1.00 25.85 ? 291 CYS A N     1 
ATOM   2226 C  CA    . CYS A 1 291 ? 4.812   57.407 51.596 1.00 27.37 ? 291 CYS A CA    1 
ATOM   2227 C  C     . CYS A 1 291 ? 5.598   57.719 50.323 1.00 27.88 ? 291 CYS A C     1 
ATOM   2228 O  O     . CYS A 1 291 ? 5.198   57.339 49.218 1.00 24.61 ? 291 CYS A O     1 
ATOM   2229 C  CB    . CYS A 1 291 ? 4.116   58.675 52.088 1.00 22.70 ? 291 CYS A CB    1 
ATOM   2230 S  SG    . CYS A 1 291 ? 3.064   59.425 50.833 1.00 28.05 ? 291 CYS A SG    1 
ATOM   2231 N  N     . LYS A 1 292 ? 6.713   58.418 50.499 1.00 29.78 ? 292 LYS A N     1 
ATOM   2232 C  CA    . LYS A 1 292 ? 7.587   58.793 49.407 1.00 33.45 ? 292 LYS A CA    1 
ATOM   2233 C  C     . LYS A 1 292 ? 8.087   57.560 48.640 1.00 32.97 ? 292 LYS A C     1 
ATOM   2234 O  O     . LYS A 1 292 ? 7.843   57.427 47.425 1.00 31.28 ? 292 LYS A O     1 
ATOM   2235 C  CB    . LYS A 1 292 ? 8.773   59.607 49.956 1.00 37.20 ? 292 LYS A CB    1 
ATOM   2236 C  CG    . LYS A 1 292 ? 9.963   59.716 48.998 1.00 44.09 ? 292 LYS A CG    1 
ATOM   2237 C  CD    . LYS A 1 292 ? 11.090  60.576 49.545 1.00 46.18 ? 292 LYS A CD    1 
ATOM   2238 C  CE    . LYS A 1 292 ? 10.743  62.052 49.470 1.00 52.34 ? 292 LYS A CE    1 
ATOM   2239 N  NZ    . LYS A 1 292 ? 11.866  62.914 49.949 1.00 57.08 ? 292 LYS A NZ    1 
ATOM   2240 N  N     . GLN A 1 293 ? 8.733   56.647 49.367 1.00 29.84 ? 293 GLN A N     1 
ATOM   2241 C  CA    . GLN A 1 293 ? 9.307   55.431 48.791 1.00 28.59 ? 293 GLN A CA    1 
ATOM   2242 C  C     . GLN A 1 293 ? 8.337   54.429 48.172 1.00 29.70 ? 293 GLN A C     1 
ATOM   2243 O  O     . GLN A 1 293 ? 8.670   53.762 47.170 1.00 26.63 ? 293 GLN A O     1 
ATOM   2244 C  CB    . GLN A 1 293 ? 10.185  54.728 49.821 1.00 29.53 ? 293 GLN A CB    1 
ATOM   2245 C  CG    . GLN A 1 293 ? 11.427  55.504 50.177 1.00 33.35 ? 293 GLN A CG    1 
ATOM   2246 C  CD    . GLN A 1 293 ? 12.211  55.900 48.947 1.00 35.08 ? 293 GLN A CD    1 
ATOM   2247 O  OE1   . GLN A 1 293 ? 12.373  57.093 48.657 1.00 40.29 ? 293 GLN A OE1   1 
ATOM   2248 N  NE2   . GLN A 1 293 ? 12.666  54.907 48.189 1.00 28.12 ? 293 GLN A NE2   1 
ATOM   2249 N  N     . GLY A 1 294 ? 7.173   54.281 48.800 1.00 24.74 ? 294 GLY A N     1 
ATOM   2250 C  CA    . GLY A 1 294 ? 6.172   53.361 48.302 1.00 20.20 ? 294 GLY A CA    1 
ATOM   2251 C  C     . GLY A 1 294 ? 5.102   54.097 47.534 1.00 21.04 ? 294 GLY A C     1 
ATOM   2252 O  O     . GLY A 1 294 ? 4.004   53.572 47.381 1.00 19.46 ? 294 GLY A O     1 
ATOM   2253 N  N     . ASN A 1 295 ? 5.446   55.296 47.048 1.00 21.81 ? 295 ASN A N     1 
ATOM   2254 C  CA    . ASN A 1 295 ? 4.559   56.188 46.285 1.00 22.51 ? 295 ASN A CA    1 
ATOM   2255 C  C     . ASN A 1 295 ? 3.112   56.026 46.696 1.00 24.33 ? 295 ASN A C     1 
ATOM   2256 O  O     . ASN A 1 295 ? 2.236   55.752 45.865 1.00 28.66 ? 295 ASN A O     1 
ATOM   2257 C  CB    . ASN A 1 295 ? 4.692   55.961 44.773 1.00 18.07 ? 295 ASN A CB    1 
ATOM   2258 C  CG    . ASN A 1 295 ? 3.994   57.038 43.966 1.00 16.12 ? 295 ASN A CG    1 
ATOM   2259 O  OD1   . ASN A 1 295 ? 4.118   58.227 44.252 1.00 16.21 ? 295 ASN A OD1   1 
ATOM   2260 N  ND2   . ASN A 1 295 ? 3.260   56.629 42.950 1.00 24.13 ? 295 ASN A ND2   1 
ATOM   2261 N  N     . GLU A 1 296 ? 2.857   56.233 47.977 1.00 22.89 ? 296 GLU A N     1 
ATOM   2262 C  CA    . GLU A 1 296 ? 1.521   56.040 48.502 1.00 18.53 ? 296 GLU A CA    1 
ATOM   2263 C  C     . GLU A 1 296 ? 0.517   57.145 48.252 1.00 17.79 ? 296 GLU A C     1 
ATOM   2264 O  O     . GLU A 1 296 ? 0.335   58.046 49.072 1.00 14.23 ? 296 GLU A O     1 
ATOM   2265 C  CB    . GLU A 1 296 ? 1.590   55.661 49.980 1.00 19.02 ? 296 GLU A CB    1 
ATOM   2266 C  CG    . GLU A 1 296 ? 2.424   54.392 50.254 1.00 20.78 ? 296 GLU A CG    1 
ATOM   2267 C  CD    . GLU A 1 296 ? 1.742   53.085 49.829 1.00 26.00 ? 296 GLU A CD    1 
ATOM   2268 O  OE1   . GLU A 1 296 ? 0.695   53.114 49.147 1.00 28.25 ? 296 GLU A OE1   1 
ATOM   2269 O  OE2   . GLU A 1 296 ? 2.244   52.004 50.198 1.00 26.55 ? 296 GLU A OE2   1 
ATOM   2270 N  N     . PHE A 1 297 ? -0.169  57.032 47.114 1.00 20.44 ? 297 PHE A N     1 
ATOM   2271 C  CA    . PHE A 1 297 ? -1.210  57.972 46.700 1.00 15.16 ? 297 PHE A CA    1 
ATOM   2272 C  C     . PHE A 1 297 ? -2.366  57.191 46.127 1.00 20.33 ? 297 PHE A C     1 
ATOM   2273 O  O     . PHE A 1 297 ? -2.165  56.265 45.336 1.00 26.51 ? 297 PHE A O     1 
ATOM   2274 C  CB    . PHE A 1 297 ? -0.660  58.954 45.681 1.00 12.27 ? 297 PHE A CB    1 
ATOM   2275 C  CG    . PHE A 1 297 ? 0.320   59.902 46.272 1.00 5.01  ? 297 PHE A CG    1 
ATOM   2276 C  CD1   . PHE A 1 297 ? 1.674   59.623 46.233 1.00 6.47  ? 297 PHE A CD1   1 
ATOM   2277 C  CD2   . PHE A 1 297 ? -0.121  61.007 46.981 1.00 5.01  ? 297 PHE A CD2   1 
ATOM   2278 C  CE1   . PHE A 1 297 ? 2.588   60.431 46.912 1.00 10.00 ? 297 PHE A CE1   1 
ATOM   2279 C  CE2   . PHE A 1 297 ? 0.771   61.816 47.657 1.00 8.53  ? 297 PHE A CE2   1 
ATOM   2280 C  CZ    . PHE A 1 297 ? 2.136   61.526 47.625 1.00 8.27  ? 297 PHE A CZ    1 
ATOM   2281 N  N     . GLY A 1 298 ? -3.571  57.518 46.583 1.00 22.90 ? 298 GLY A N     1 
ATOM   2282 C  CA    . GLY A 1 298 ? -4.762  56.821 46.131 1.00 22.40 ? 298 GLY A CA    1 
ATOM   2283 C  C     . GLY A 1 298 ? -4.857  56.670 44.629 1.00 22.58 ? 298 GLY A C     1 
ATOM   2284 O  O     . GLY A 1 298 ? -4.774  57.652 43.900 1.00 25.03 ? 298 GLY A O     1 
ATOM   2285 N  N     . ALA A 1 299 ? -5.036  55.444 44.159 1.00 21.86 ? 299 ALA A N     1 
ATOM   2286 C  CA    . ALA A 1 299 ? -5.147  55.200 42.730 1.00 24.79 ? 299 ALA A CA    1 
ATOM   2287 C  C     . ALA A 1 299 ? -6.511  55.629 42.191 1.00 26.80 ? 299 ALA A C     1 
ATOM   2288 O  O     . ALA A 1 299 ? -6.712  55.673 40.978 1.00 31.46 ? 299 ALA A O     1 
ATOM   2289 C  CB    . ALA A 1 299 ? -4.898  53.729 42.423 1.00 25.34 ? 299 ALA A CB    1 
ATOM   2290 N  N     . THR A 1 300 ? -7.441  55.957 43.085 1.00 25.02 ? 300 THR A N     1 
ATOM   2291 C  CA    . THR A 1 300 ? -8.774  56.360 42.682 1.00 17.29 ? 300 THR A CA    1 
ATOM   2292 C  C     . THR A 1 300 ? -9.060  57.838 42.891 1.00 20.38 ? 300 THR A C     1 
ATOM   2293 O  O     . THR A 1 300 ? -9.694  58.473 42.043 1.00 20.08 ? 300 THR A O     1 
ATOM   2294 C  CB    . THR A 1 300 ? -9.833  55.525 43.384 1.00 9.33  ? 300 THR A CB    1 
ATOM   2295 O  OG1   . THR A 1 300 ? -9.722  54.168 42.953 1.00 11.54 ? 300 THR A OG1   1 
ATOM   2296 C  CG2   . THR A 1 300 ? -11.211 56.006 43.024 1.00 14.17 ? 300 THR A CG2   1 
ATOM   2297 N  N     . THR A 1 301 ? -8.601  58.389 44.010 1.00 21.79 ? 301 THR A N     1 
ATOM   2298 C  CA    . THR A 1 301 ? -8.819  59.808 44.310 1.00 21.17 ? 301 THR A CA    1 
ATOM   2299 C  C     . THR A 1 301 ? -7.504  60.586 44.223 1.00 18.59 ? 301 THR A C     1 
ATOM   2300 O  O     . THR A 1 301 ? -7.497  61.794 43.996 1.00 20.39 ? 301 THR A O     1 
ATOM   2301 C  CB    . THR A 1 301 ? -9.422  60.016 45.729 1.00 18.47 ? 301 THR A CB    1 
ATOM   2302 O  OG1   . THR A 1 301 ? -8.558  59.416 46.712 1.00 16.59 ? 301 THR A OG1   1 
ATOM   2303 C  CG2   . THR A 1 301 ? -10.836 59.435 45.805 1.00 10.05 ? 301 THR A CG2   1 
ATOM   2304 N  N     . GLY A 1 302 ? -6.398  59.887 44.427 1.00 16.35 ? 302 GLY A N     1 
ATOM   2305 C  CA    . GLY A 1 302 ? -5.111  60.535 44.365 1.00 16.12 ? 302 GLY A CA    1 
ATOM   2306 C  C     . GLY A 1 302 ? -4.733  61.097 45.714 1.00 19.91 ? 302 GLY A C     1 
ATOM   2307 O  O     . GLY A 1 302 ? -3.737  61.806 45.817 1.00 24.37 ? 302 GLY A O     1 
ATOM   2308 N  N     . ARG A 1 303 ? -5.519  60.795 46.746 1.00 21.23 ? 303 ARG A N     1 
ATOM   2309 C  CA    . ARG A 1 303 ? -5.242  61.287 48.096 1.00 17.89 ? 303 ARG A CA    1 
ATOM   2310 C  C     . ARG A 1 303 ? -3.994  60.617 48.680 1.00 21.36 ? 303 ARG A C     1 
ATOM   2311 O  O     . ARG A 1 303 ? -3.745  59.436 48.431 1.00 24.81 ? 303 ARG A O     1 
ATOM   2312 C  CB    . ARG A 1 303 ? -6.437  61.010 49.006 1.00 14.05 ? 303 ARG A CB    1 
ATOM   2313 C  CG    . ARG A 1 303 ? -7.707  61.770 48.654 1.00 14.27 ? 303 ARG A CG    1 
ATOM   2314 C  CD    . ARG A 1 303 ? -8.871  61.372 49.578 1.00 15.08 ? 303 ARG A CD    1 
ATOM   2315 N  NE    . ARG A 1 303 ? -9.194  59.952 49.430 1.00 19.01 ? 303 ARG A NE    1 
ATOM   2316 C  CZ    . ARG A 1 303 ? -9.982  59.309 50.284 1.00 18.04 ? 303 ARG A CZ    1 
ATOM   2317 N  NH1   . ARG A 1 303 ? -10.526 59.941 51.311 1.00 22.02 ? 303 ARG A NH1   1 
ATOM   2318 N  NH2   . ARG A 1 303 ? -10.193 58.014 50.127 1.00 13.80 ? 303 ARG A NH2   1 
ATOM   2319 N  N     . ARG A 1 304 ? -3.209  61.388 49.433 1.00 23.98 ? 304 ARG A N     1 
ATOM   2320 C  CA    . ARG A 1 304 ? -1.985  60.908 50.085 1.00 26.26 ? 304 ARG A CA    1 
ATOM   2321 C  C     . ARG A 1 304 ? -2.372  59.867 51.140 1.00 27.18 ? 304 ARG A C     1 
ATOM   2322 O  O     . ARG A 1 304 ? -3.216  60.127 51.998 1.00 31.53 ? 304 ARG A O     1 
ATOM   2323 C  CB    . ARG A 1 304 ? -1.269  62.096 50.744 1.00 26.71 ? 304 ARG A CB    1 
ATOM   2324 C  CG    . ARG A 1 304 ? -0.035  61.758 51.557 1.00 34.43 ? 304 ARG A CG    1 
ATOM   2325 C  CD    . ARG A 1 304 ? 0.524   62.999 52.257 1.00 40.95 ? 304 ARG A CD    1 
ATOM   2326 N  NE    . ARG A 1 304 ? 1.430   63.784 51.406 1.00 53.43 ? 304 ARG A NE    1 
ATOM   2327 C  CZ    . ARG A 1 304 ? 0.992   64.737 50.577 1.00 53.60 ? 304 ARG A CZ    1 
ATOM   2328 N  NH1   . ARG A 1 304 ? -0.304  65.023 50.484 1.00 58.07 ? 304 ARG A NH1   1 
ATOM   2329 N  NH2   . ARG A 1 304 ? 1.860   65.413 49.833 1.00 49.90 ? 304 ARG A NH2   1 
ATOM   2330 N  N     . ARG A 1 305 ? -1.758  58.696 51.091 1.00 25.31 ? 305 ARG A N     1 
ATOM   2331 C  CA    . ARG A 1 305 ? -2.096  57.648 52.045 1.00 22.46 ? 305 ARG A CA    1 
ATOM   2332 C  C     . ARG A 1 305 ? -1.380  57.771 53.393 1.00 22.44 ? 305 ARG A C     1 
ATOM   2333 O  O     . ARG A 1 305 ? -0.153  57.938 53.446 1.00 20.86 ? 305 ARG A O     1 
ATOM   2334 C  CB    . ARG A 1 305 ? -1.808  56.271 51.433 1.00 21.81 ? 305 ARG A CB    1 
ATOM   2335 C  CG    . ARG A 1 305 ? -2.678  55.930 50.227 1.00 21.49 ? 305 ARG A CG    1 
ATOM   2336 C  CD    . ARG A 1 305 ? -2.147  54.728 49.467 1.00 18.91 ? 305 ARG A CD    1 
ATOM   2337 N  NE    . ARG A 1 305 ? -3.034  54.367 48.369 1.00 26.08 ? 305 ARG A NE    1 
ATOM   2338 C  CZ    . ARG A 1 305 ? -2.635  53.563 47.386 1.00 28.12 ? 305 ARG A CZ    1 
ATOM   2339 N  NH1   . ARG A 1 305 ? -1.408  53.066 47.374 1.00 27.43 ? 305 ARG A NH1   1 
ATOM   2340 N  NH2   . ARG A 1 305 ? -3.492  53.204 46.443 1.00 26.77 ? 305 ARG A NH2   1 
ATOM   2341 N  N     . ARG A 1 306 ? -2.153  57.666 54.476 1.00 18.50 ? 306 ARG A N     1 
ATOM   2342 C  CA    . ARG A 1 306 ? -1.617  57.712 55.839 1.00 16.70 ? 306 ARG A CA    1 
ATOM   2343 C  C     . ARG A 1 306 ? -0.752  56.460 55.953 1.00 18.68 ? 306 ARG A C     1 
ATOM   2344 O  O     . ARG A 1 306 ? -1.205  55.382 55.579 1.00 19.06 ? 306 ARG A O     1 
ATOM   2345 C  CB    . ARG A 1 306 ? -2.762  57.607 56.853 1.00 11.17 ? 306 ARG A CB    1 
ATOM   2346 C  CG    . ARG A 1 306 ? -3.743  58.752 56.778 1.00 6.14  ? 306 ARG A CG    1 
ATOM   2347 C  CD    . ARG A 1 306 ? -5.041  58.412 57.481 1.00 15.81 ? 306 ARG A CD    1 
ATOM   2348 N  NE    . ARG A 1 306 ? -4.881  58.179 58.921 1.00 18.60 ? 306 ARG A NE    1 
ATOM   2349 C  CZ    . ARG A 1 306 ? -5.895  57.742 59.674 1.00 16.83 ? 306 ARG A CZ    1 
ATOM   2350 N  NH1   . ARG A 1 306 ? -7.088  57.499 59.144 1.00 17.56 ? 306 ARG A NH1   1 
ATOM   2351 N  NH2   . ARG A 1 306 ? -5.724  57.557 60.975 1.00 12.13 ? 306 ARG A NH2   1 
ATOM   2352 N  N     . THR A 1 307 ? 0.489   56.598 56.414 1.00 20.26 ? 307 THR A N     1 
ATOM   2353 C  CA    . THR A 1 307 ? 1.377   55.442 56.550 1.00 21.81 ? 307 THR A CA    1 
ATOM   2354 C  C     . THR A 1 307 ? 1.675   55.138 58.014 1.00 22.28 ? 307 THR A C     1 
ATOM   2355 O  O     . THR A 1 307 ? 1.487   55.995 58.874 1.00 22.25 ? 307 THR A O     1 
ATOM   2356 C  CB    . THR A 1 307 ? 2.718   55.652 55.797 1.00 26.33 ? 307 THR A CB    1 
ATOM   2357 O  OG1   . THR A 1 307 ? 3.478   56.689 56.430 1.00 32.03 ? 307 THR A OG1   1 
ATOM   2358 C  CG2   . THR A 1 307 ? 2.472   56.028 54.340 1.00 26.64 ? 307 THR A CG2   1 
ATOM   2359 N  N     . GLY A 1 308 ? 2.125   53.913 58.287 1.00 22.92 ? 308 GLY A N     1 
ATOM   2360 C  CA    . GLY A 1 308 ? 2.460   53.488 59.641 1.00 17.43 ? 308 GLY A CA    1 
ATOM   2361 C  C     . GLY A 1 308 ? 3.140   52.129 59.585 1.00 18.79 ? 308 GLY A C     1 
ATOM   2362 O  O     . GLY A 1 308 ? 3.259   51.561 58.494 1.00 22.01 ? 308 GLY A O     1 
ATOM   2363 N  N     . TRP A 1 309 ? 3.578   51.595 60.724 1.00 14.76 ? 309 TRP A N     1 
ATOM   2364 C  CA    . TRP A 1 309 ? 4.252   50.291 60.756 1.00 12.99 ? 309 TRP A CA    1 
ATOM   2365 C  C     . TRP A 1 309 ? 3.226   49.197 60.557 1.00 11.65 ? 309 TRP A C     1 
ATOM   2366 O  O     . TRP A 1 309 ? 2.021   49.445 60.672 1.00 10.09 ? 309 TRP A O     1 
ATOM   2367 C  CB    . TRP A 1 309 ? 4.938   50.025 62.115 1.00 21.05 ? 309 TRP A CB    1 
ATOM   2368 C  CG    . TRP A 1 309 ? 6.024   50.985 62.516 1.00 23.33 ? 309 TRP A CG    1 
ATOM   2369 C  CD1   . TRP A 1 309 ? 5.981   51.893 63.540 1.00 21.80 ? 309 TRP A CD1   1 
ATOM   2370 C  CD2   . TRP A 1 309 ? 7.300   51.147 61.883 1.00 26.86 ? 309 TRP A CD2   1 
ATOM   2371 N  NE1   . TRP A 1 309 ? 7.150   52.618 63.575 1.00 25.00 ? 309 TRP A NE1   1 
ATOM   2372 C  CE2   . TRP A 1 309 ? 7.975   52.182 62.570 1.00 30.59 ? 309 TRP A CE2   1 
ATOM   2373 C  CE3   . TRP A 1 309 ? 7.937   50.525 60.798 1.00 23.60 ? 309 TRP A CE3   1 
ATOM   2374 C  CZ2   . TRP A 1 309 ? 9.265   52.610 62.199 1.00 29.80 ? 309 TRP A CZ2   1 
ATOM   2375 C  CZ3   . TRP A 1 309 ? 9.209   50.949 60.432 1.00 20.83 ? 309 TRP A CZ3   1 
ATOM   2376 C  CH2   . TRP A 1 309 ? 9.857   51.980 61.129 1.00 25.73 ? 309 TRP A CH2   1 
ATOM   2377 N  N     . LEU A 1 310 ? 3.706   47.979 60.323 1.00 10.03 ? 310 LEU A N     1 
ATOM   2378 C  CA    . LEU A 1 310 ? 2.833   46.825 60.152 1.00 10.41 ? 310 LEU A CA    1 
ATOM   2379 C  C     . LEU A 1 310 ? 2.286   46.399 61.540 1.00 16.30 ? 310 LEU A C     1 
ATOM   2380 O  O     . LEU A 1 310 ? 3.036   46.249 62.529 1.00 17.72 ? 310 LEU A O     1 
ATOM   2381 C  CB    . LEU A 1 310 ? 3.591   45.687 59.455 1.00 5.73  ? 310 LEU A CB    1 
ATOM   2382 C  CG    . LEU A 1 310 ? 2.976   44.298 59.351 1.00 5.01  ? 310 LEU A CG    1 
ATOM   2383 C  CD1   . LEU A 1 310 ? 1.543   44.382 58.882 1.00 13.71 ? 310 LEU A CD1   1 
ATOM   2384 C  CD2   . LEU A 1 310 ? 3.779   43.459 58.420 1.00 5.04  ? 310 LEU A CD2   1 
ATOM   2385 N  N     . ASP A 1 311 ? 0.965   46.260 61.609 1.00 16.73 ? 311 ASP A N     1 
ATOM   2386 C  CA    . ASP A 1 311 ? 0.267   45.903 62.831 1.00 8.46  ? 311 ASP A CA    1 
ATOM   2387 C  C     . ASP A 1 311 ? -0.072  44.414 62.851 1.00 9.26  ? 311 ASP A C     1 
ATOM   2388 O  O     . ASP A 1 311 ? -1.092  44.006 62.293 1.00 11.52 ? 311 ASP A O     1 
ATOM   2389 C  CB    . ASP A 1 311 ? -1.018  46.743 62.913 1.00 11.09 ? 311 ASP A CB    1 
ATOM   2390 C  CG    . ASP A 1 311 ? -1.621  46.790 64.324 1.00 17.11 ? 311 ASP A CG    1 
ATOM   2391 O  OD1   . ASP A 1 311 ? -1.550  45.788 65.072 1.00 11.73 ? 311 ASP A OD1   1 
ATOM   2392 O  OD2   . ASP A 1 311 ? -2.194  47.837 64.676 1.00 14.11 ? 311 ASP A OD2   1 
ATOM   2393 N  N     . THR A 1 312 ? 0.746   43.601 63.517 1.00 9.79  ? 312 THR A N     1 
ATOM   2394 C  CA    . THR A 1 312 ? 0.464   42.168 63.587 1.00 9.03  ? 312 THR A CA    1 
ATOM   2395 C  C     . THR A 1 312 ? -0.769  41.863 64.438 1.00 9.40  ? 312 THR A C     1 
ATOM   2396 O  O     . THR A 1 312 ? -1.357  40.786 64.323 1.00 10.06 ? 312 THR A O     1 
ATOM   2397 C  CB    . THR A 1 312 ? 1.657   41.355 64.097 1.00 13.08 ? 312 THR A CB    1 
ATOM   2398 O  OG1   . THR A 1 312 ? 2.818   41.622 63.295 1.00 14.40 ? 312 THR A OG1   1 
ATOM   2399 C  CG2   . THR A 1 312 ? 1.351   39.882 63.982 1.00 23.43 ? 312 THR A CG2   1 
ATOM   2400 N  N     . VAL A 1 313 ? -1.174  42.793 65.302 1.00 10.28 ? 313 VAL A N     1 
ATOM   2401 C  CA    . VAL A 1 313 ? -2.382  42.566 66.100 1.00 13.29 ? 313 VAL A CA    1 
ATOM   2402 C  C     . VAL A 1 313 ? -3.595  42.640 65.163 1.00 17.79 ? 313 VAL A C     1 
ATOM   2403 O  O     . VAL A 1 313 ? -4.505  41.798 65.244 1.00 16.47 ? 313 VAL A O     1 
ATOM   2404 C  CB    . VAL A 1 313 ? -2.557  43.612 67.187 1.00 9.68  ? 313 VAL A CB    1 
ATOM   2405 C  CG1   . VAL A 1 313 ? -3.808  43.318 68.004 1.00 5.01  ? 313 VAL A CG1   1 
ATOM   2406 C  CG2   . VAL A 1 313 ? -1.334  43.650 68.038 1.00 9.89  ? 313 VAL A CG2   1 
ATOM   2407 N  N     . ALA A 1 314 ? -3.588  43.654 64.283 1.00 16.75 ? 314 ALA A N     1 
ATOM   2408 C  CA    . ALA A 1 314 ? -4.637  43.875 63.282 1.00 10.15 ? 314 ALA A CA    1 
ATOM   2409 C  C     . ALA A 1 314 ? -4.579  42.766 62.242 1.00 9.62  ? 314 ALA A C     1 
ATOM   2410 O  O     . ALA A 1 314 ? -5.604  42.201 61.874 1.00 8.75  ? 314 ALA A O     1 
ATOM   2411 C  CB    . ALA A 1 314 ? -4.455  45.240 62.614 1.00 7.04  ? 314 ALA A CB    1 
ATOM   2412 N  N     . VAL A 1 315 ? -3.377  42.411 61.796 1.00 10.19 ? 315 VAL A N     1 
ATOM   2413 C  CA    . VAL A 1 315 ? -3.247  41.348 60.806 1.00 11.68 ? 315 VAL A CA    1 
ATOM   2414 C  C     . VAL A 1 315 ? -3.821  40.049 61.345 1.00 13.28 ? 315 VAL A C     1 
ATOM   2415 O  O     . VAL A 1 315 ? -4.461  39.282 60.610 1.00 15.64 ? 315 VAL A O     1 
ATOM   2416 C  CB    . VAL A 1 315 ? -1.788  41.169 60.322 1.00 13.80 ? 315 VAL A CB    1 
ATOM   2417 C  CG1   . VAL A 1 315 ? -1.672  39.963 59.402 1.00 11.08 ? 315 VAL A CG1   1 
ATOM   2418 C  CG2   . VAL A 1 315 ? -1.342  42.425 59.560 1.00 17.69 ? 315 VAL A CG2   1 
ATOM   2419 N  N     . ARG A 1 316 ? -3.634  39.810 62.638 1.00 13.96 ? 316 ARG A N     1 
ATOM   2420 C  CA    . ARG A 1 316 ? -4.178  38.595 63.240 1.00 11.18 ? 316 ARG A CA    1 
ATOM   2421 C  C     . ARG A 1 316 ? -5.697  38.530 63.282 1.00 5.93  ? 316 ARG A C     1 
ATOM   2422 O  O     . ARG A 1 316 ? -6.251  37.461 63.484 1.00 8.40  ? 316 ARG A O     1 
ATOM   2423 C  CB    . ARG A 1 316 ? -3.583  38.326 64.611 1.00 9.86  ? 316 ARG A CB    1 
ATOM   2424 C  CG    . ARG A 1 316 ? -2.240  37.650 64.539 1.00 11.74 ? 316 ARG A CG    1 
ATOM   2425 C  CD    . ARG A 1 316 ? -1.629  37.568 65.920 1.00 19.37 ? 316 ARG A CD    1 
ATOM   2426 N  NE    . ARG A 1 316 ? -1.370  38.903 66.454 1.00 31.67 ? 316 ARG A NE    1 
ATOM   2427 C  CZ    . ARG A 1 316 ? -0.837  39.080 67.663 1.00 38.16 ? 316 ARG A CZ    1 
ATOM   2428 N  NH1   . ARG A 1 316 ? -0.526  38.037 68.428 1.00 43.27 ? 316 ARG A NH1   1 
ATOM   2429 N  NH2   . ARG A 1 316 ? -0.582  40.307 68.096 1.00 40.28 ? 316 ARG A NH2   1 
ATOM   2430 N  N     . ARG A 1 317 ? -6.382  39.654 63.089 1.00 6.18  ? 317 ARG A N     1 
ATOM   2431 C  CA    . ARG A 1 317 ? -7.848  39.609 63.067 1.00 6.34  ? 317 ARG A CA    1 
ATOM   2432 C  C     . ARG A 1 317 ? -8.174  39.128 61.656 1.00 8.00  ? 317 ARG A C     1 
ATOM   2433 O  O     . ARG A 1 317 ? -9.012  38.241 61.461 1.00 6.45  ? 317 ARG A O     1 
ATOM   2434 C  CB    . ARG A 1 317 ? -8.473  40.989 63.304 1.00 5.01  ? 317 ARG A CB    1 
ATOM   2435 C  CG    . ARG A 1 317 ? -9.962  40.936 63.652 1.00 9.31  ? 317 ARG A CG    1 
ATOM   2436 C  CD    . ARG A 1 317 ? -10.114 40.076 64.903 1.00 25.80 ? 317 ARG A CD    1 
ATOM   2437 N  NE    . ARG A 1 317 ? -11.411 40.161 65.573 1.00 31.89 ? 317 ARG A NE    1 
ATOM   2438 C  CZ    . ARG A 1 317 ? -11.540 40.800 66.731 1.00 28.66 ? 317 ARG A CZ    1 
ATOM   2439 N  NH1   . ARG A 1 317 ? -10.501 41.382 67.302 1.00 31.70 ? 317 ARG A NH1   1 
ATOM   2440 N  NH2   . ARG A 1 317 ? -12.715 40.846 67.327 1.00 34.15 ? 317 ARG A NH2   1 
ATOM   2441 N  N     . ALA A 1 318 ? -7.440  39.685 60.684 1.00 7.87  ? 318 ALA A N     1 
ATOM   2442 C  CA    . ALA A 1 318 ? -7.595  39.342 59.269 1.00 6.03  ? 318 ALA A CA    1 
ATOM   2443 C  C     . ALA A 1 318 ? -7.415  37.828 59.091 1.00 8.18  ? 318 ALA A C     1 
ATOM   2444 O  O     . ALA A 1 318 ? -8.211  37.172 58.420 1.00 7.43  ? 318 ALA A O     1 
ATOM   2445 C  CB    . ALA A 1 318 ? -6.568  40.105 58.446 1.00 5.01  ? 318 ALA A CB    1 
ATOM   2446 N  N     . VAL A 1 319 ? -6.384  37.279 59.729 1.00 10.32 ? 319 VAL A N     1 
ATOM   2447 C  CA    . VAL A 1 319 ? -6.096  35.850 59.676 1.00 9.81  ? 319 VAL A CA    1 
ATOM   2448 C  C     . VAL A 1 319 ? -7.317  35.018 60.022 1.00 14.15 ? 319 VAL A C     1 
ATOM   2449 O  O     . VAL A 1 319 ? -7.718  34.124 59.238 1.00 14.16 ? 319 VAL A O     1 
ATOM   2450 C  CB    . VAL A 1 319 ? -4.957  35.443 60.647 1.00 9.74  ? 319 VAL A CB    1 
ATOM   2451 C  CG1   . VAL A 1 319 ? -4.763  33.944 60.612 1.00 7.20  ? 319 VAL A CG1   1 
ATOM   2452 C  CG2   . VAL A 1 319 ? -3.653  36.125 60.276 1.00 7.34  ? 319 VAL A CG2   1 
ATOM   2453 N  N     . GLN A 1 320 ? -7.904  35.294 61.193 1.00 13.24 ? 320 GLN A N     1 
ATOM   2454 C  CA    . GLN A 1 320 ? -9.084  34.546 61.605 1.00 11.85 ? 320 GLN A CA    1 
ATOM   2455 C  C     . GLN A 1 320 ? -10.341 34.859 60.802 1.00 12.38 ? 320 GLN A C     1 
ATOM   2456 O  O     . GLN A 1 320 ? -11.091 33.943 60.459 1.00 13.53 ? 320 GLN A O     1 
ATOM   2457 C  CB    . GLN A 1 320 ? -9.331  34.646 63.105 1.00 12.62 ? 320 GLN A CB    1 
ATOM   2458 C  CG    . GLN A 1 320 ? -9.318  36.023 63.683 1.00 17.41 ? 320 GLN A CG    1 
ATOM   2459 C  CD    . GLN A 1 320 ? -9.737  36.040 65.161 1.00 16.81 ? 320 GLN A CD    1 
ATOM   2460 O  OE1   . GLN A 1 320 ? -10.381 36.989 65.617 1.00 11.71 ? 320 GLN A OE1   1 
ATOM   2461 N  NE2   . GLN A 1 320 ? -9.360  35.003 65.911 1.00 9.42  ? 320 GLN A NE2   1 
ATOM   2462 N  N     . LEU A 1 321 ? -10.565 36.136 60.489 1.00 13.15 ? 321 LEU A N     1 
ATOM   2463 C  CA    . LEU A 1 321 ? -11.724 36.541 59.685 1.00 13.12 ? 321 LEU A CA    1 
ATOM   2464 C  C     . LEU A 1 321 ? -11.768 35.887 58.289 1.00 11.86 ? 321 LEU A C     1 
ATOM   2465 O  O     . LEU A 1 321 ? -12.835 35.467 57.826 1.00 11.99 ? 321 LEU A O     1 
ATOM   2466 C  CB    . LEU A 1 321 ? -11.789 38.072 59.554 1.00 10.75 ? 321 LEU A CB    1 
ATOM   2467 C  CG    . LEU A 1 321 ? -12.154 38.893 60.812 1.00 14.42 ? 321 LEU A CG    1 
ATOM   2468 C  CD1   . LEU A 1 321 ? -12.003 40.388 60.544 1.00 12.74 ? 321 LEU A CD1   1 
ATOM   2469 C  CD2   . LEU A 1 321 ? -13.564 38.589 61.295 1.00 5.01  ? 321 LEU A CD2   1 
ATOM   2470 N  N     . ASN A 1 322 ? -10.613 35.755 57.641 1.00 10.40 ? 322 ASN A N     1 
ATOM   2471 C  CA    . ASN A 1 322 ? -10.557 35.167 56.293 1.00 11.62 ? 322 ASN A CA    1 
ATOM   2472 C  C     . ASN A 1 322 ? -10.055 33.732 56.216 1.00 10.47 ? 322 ASN A C     1 
ATOM   2473 O  O     . ASN A 1 322 ? -9.995  33.152 55.133 1.00 10.81 ? 322 ASN A O     1 
ATOM   2474 C  CB    . ASN A 1 322 ? -9.674  36.024 55.383 1.00 6.42  ? 322 ASN A CB    1 
ATOM   2475 C  CG    . ASN A 1 322 ? -10.108 37.474 55.348 1.00 6.08  ? 322 ASN A CG    1 
ATOM   2476 O  OD1   . ASN A 1 322 ? -11.230 37.777 54.952 1.00 9.95  ? 322 ASN A OD1   1 
ATOM   2477 N  ND2   . ASN A 1 322 ? -9.225  38.372 55.760 1.00 5.01  ? 322 ASN A ND2   1 
ATOM   2478 N  N     . SER A 1 323 ? -9.702  33.153 57.356 1.00 9.25  ? 323 SER A N     1 
ATOM   2479 C  CA    . SER A 1 323 ? -9.166  31.805 57.393 1.00 7.42  ? 323 SER A CA    1 
ATOM   2480 C  C     . SER A 1 323 ? -8.014  31.732 56.390 1.00 12.47 ? 323 SER A C     1 
ATOM   2481 O  O     . SER A 1 323 ? -7.939  30.818 55.565 1.00 10.04 ? 323 SER A O     1 
ATOM   2482 C  CB    . SER A 1 323 ? -10.248 30.758 57.093 1.00 7.84  ? 323 SER A CB    1 
ATOM   2483 O  OG    . SER A 1 323 ? -10.851 30.923 55.824 1.00 12.04 ? 323 SER A OG    1 
ATOM   2484 N  N     . LEU A 1 324 ? -7.116  32.714 56.472 1.00 14.32 ? 324 LEU A N     1 
ATOM   2485 C  CA    . LEU A 1 324 ? -5.973  32.781 55.571 1.00 12.02 ? 324 LEU A CA    1 
ATOM   2486 C  C     . LEU A 1 324 ? -5.230  31.452 55.502 1.00 13.47 ? 324 LEU A C     1 
ATOM   2487 O  O     . LEU A 1 324 ? -5.190  30.715 56.495 1.00 13.40 ? 324 LEU A O     1 
ATOM   2488 C  CB    . LEU A 1 324 ? -5.018  33.891 55.999 1.00 7.37  ? 324 LEU A CB    1 
ATOM   2489 C  CG    . LEU A 1 324 ? -5.609  35.293 55.903 1.00 6.19  ? 324 LEU A CG    1 
ATOM   2490 C  CD1   . LEU A 1 324 ? -4.548  36.316 56.189 1.00 5.01  ? 324 LEU A CD1   1 
ATOM   2491 C  CD2   . LEU A 1 324 ? -6.160  35.512 54.520 1.00 9.54  ? 324 LEU A CD2   1 
ATOM   2492 N  N     . SER A 1 325 ? -4.748  31.114 54.295 1.00 13.45 ? 325 SER A N     1 
ATOM   2493 C  CA    . SER A 1 325 ? -3.972  29.895 54.041 1.00 5.09  ? 325 SER A CA    1 
ATOM   2494 C  C     . SER A 1 325 ? -2.524  30.322 53.898 1.00 5.08  ? 325 SER A C     1 
ATOM   2495 O  O     . SER A 1 325 ? -1.605  29.599 54.256 1.00 7.82  ? 325 SER A O     1 
ATOM   2496 C  CB    . SER A 1 325 ? -4.424  29.238 52.750 1.00 5.01  ? 325 SER A CB    1 
ATOM   2497 O  OG    . SER A 1 325 ? -5.835  29.152 52.697 1.00 13.41 ? 325 SER A OG    1 
ATOM   2498 N  N     . GLY A 1 326 ? -2.329  31.524 53.376 1.00 7.52  ? 326 GLY A N     1 
ATOM   2499 C  CA    . GLY A 1 326 ? -0.989  32.044 53.196 1.00 8.51  ? 326 GLY A CA    1 
ATOM   2500 C  C     . GLY A 1 326 ? -1.016  33.532 52.960 1.00 5.48  ? 326 GLY A C     1 
ATOM   2501 O  O     . GLY A 1 326 ? -2.076  34.127 52.798 1.00 8.75  ? 326 GLY A O     1 
ATOM   2502 N  N     . PHE A 1 327 ? 0.163   34.132 52.968 1.00 10.22 ? 327 PHE A N     1 
ATOM   2503 C  CA    . PHE A 1 327 ? 0.319   35.563 52.757 1.00 11.29 ? 327 PHE A CA    1 
ATOM   2504 C  C     . PHE A 1 327 ? 1.127   35.865 51.507 1.00 11.99 ? 327 PHE A C     1 
ATOM   2505 O  O     . PHE A 1 327 ? 1.870   35.025 50.995 1.00 8.64  ? 327 PHE A O     1 
ATOM   2506 C  CB    . PHE A 1 327 ? 1.155   36.177 53.889 1.00 19.18 ? 327 PHE A CB    1 
ATOM   2507 C  CG    . PHE A 1 327 ? 0.417   36.416 55.160 1.00 20.43 ? 327 PHE A CG    1 
ATOM   2508 C  CD1   . PHE A 1 327 ? -0.696  37.253 55.193 1.00 17.99 ? 327 PHE A CD1   1 
ATOM   2509 C  CD2   . PHE A 1 327 ? 0.887   35.864 56.348 1.00 17.71 ? 327 PHE A CD2   1 
ATOM   2510 C  CE1   . PHE A 1 327 ? -1.327  37.536 56.407 1.00 23.57 ? 327 PHE A CE1   1 
ATOM   2511 C  CE2   . PHE A 1 327 ? 0.263   36.144 57.560 1.00 19.98 ? 327 PHE A CE2   1 
ATOM   2512 C  CZ    . PHE A 1 327 ? -0.841  36.976 57.596 1.00 14.96 ? 327 PHE A CZ    1 
ATOM   2513 N  N     . CYS A 1 328 ? 0.999   37.101 51.053 1.00 11.28 ? 328 CYS A N     1 
ATOM   2514 C  CA    . CYS A 1 328 ? 1.806   37.592 49.965 1.00 12.13 ? 328 CYS A CA    1 
ATOM   2515 C  C     . CYS A 1 328 ? 2.315   38.872 50.587 1.00 8.00  ? 328 CYS A C     1 
ATOM   2516 O  O     . CYS A 1 328 ? 1.532   39.764 50.905 1.00 6.89  ? 328 CYS A O     1 
ATOM   2517 C  CB    . CYS A 1 328 ? 1.005   37.887 48.696 1.00 15.17 ? 328 CYS A CB    1 
ATOM   2518 S  SG    . CYS A 1 328 ? 2.058   38.640 47.424 1.00 10.69 ? 328 CYS A SG    1 
ATOM   2519 N  N     . LEU A 1 329 ? 3.605   38.894 50.894 1.00 10.32 ? 329 LEU A N     1 
ATOM   2520 C  CA    . LEU A 1 329 ? 4.214   40.062 51.512 1.00 11.08 ? 329 LEU A CA    1 
ATOM   2521 C  C     . LEU A 1 329 ? 4.612   40.998 50.383 1.00 11.56 ? 329 LEU A C     1 
ATOM   2522 O  O     . LEU A 1 329 ? 5.364   40.610 49.488 1.00 10.98 ? 329 LEU A O     1 
ATOM   2523 C  CB    . LEU A 1 329 ? 5.430   39.647 52.343 1.00 11.68 ? 329 LEU A CB    1 
ATOM   2524 C  CG    . LEU A 1 329 ? 6.153   40.751 53.113 1.00 10.88 ? 329 LEU A CG    1 
ATOM   2525 C  CD1   . LEU A 1 329 ? 5.265   41.280 54.226 1.00 16.21 ? 329 LEU A CD1   1 
ATOM   2526 C  CD2   . LEU A 1 329 ? 7.442   40.192 53.683 1.00 15.69 ? 329 LEU A CD2   1 
ATOM   2527 N  N     . THR A 1 330 ? 4.091   42.219 50.411 1.00 8.69  ? 330 THR A N     1 
ATOM   2528 C  CA    . THR A 1 330 ? 4.377   43.165 49.358 1.00 10.07 ? 330 THR A CA    1 
ATOM   2529 C  C     . THR A 1 330 ? 5.176   44.359 49.810 1.00 12.17 ? 330 THR A C     1 
ATOM   2530 O  O     . THR A 1 330 ? 5.160   44.719 50.980 1.00 13.74 ? 330 THR A O     1 
ATOM   2531 C  CB    . THR A 1 330 ? 3.081   43.706 48.713 1.00 11.53 ? 330 THR A CB    1 
ATOM   2532 O  OG1   . THR A 1 330 ? 2.305   44.401 49.708 1.00 17.41 ? 330 THR A OG1   1 
ATOM   2533 C  CG2   . THR A 1 330 ? 2.253   42.577 48.081 1.00 5.01  ? 330 THR A CG2   1 
ATOM   2534 N  N     . LYS A 1 331 ? 5.845   44.978 48.840 1.00 11.74 ? 331 LYS A N     1 
ATOM   2535 C  CA    . LYS A 1 331 ? 6.666   46.162 49.023 1.00 9.88  ? 331 LYS A CA    1 
ATOM   2536 C  C     . LYS A 1 331 ? 7.783   46.041 50.064 1.00 14.62 ? 331 LYS A C     1 
ATOM   2537 O  O     . LYS A 1 331 ? 8.106   47.011 50.767 1.00 14.90 ? 331 LYS A O     1 
ATOM   2538 C  CB    . LYS A 1 331 ? 5.772   47.371 49.267 1.00 5.34  ? 331 LYS A CB    1 
ATOM   2539 C  CG    . LYS A 1 331 ? 4.667   47.452 48.238 1.00 11.07 ? 331 LYS A CG    1 
ATOM   2540 C  CD    . LYS A 1 331 ? 3.716   48.633 48.380 1.00 5.01  ? 331 LYS A CD    1 
ATOM   2541 C  CE    . LYS A 1 331 ? 4.253   49.877 47.696 1.00 10.85 ? 331 LYS A CE    1 
ATOM   2542 N  NZ    . LYS A 1 331 ? 3.187   50.921 47.521 1.00 8.76  ? 331 LYS A NZ    1 
ATOM   2543 N  N     . LEU A 1 332 ? 8.438   44.880 50.085 1.00 13.42 ? 332 LEU A N     1 
ATOM   2544 C  CA    . LEU A 1 332 ? 9.540   44.644 51.014 1.00 18.45 ? 332 LEU A CA    1 
ATOM   2545 C  C     . LEU A 1 332 ? 10.667  45.628 50.718 1.00 21.32 ? 332 LEU A C     1 
ATOM   2546 O  O     . LEU A 1 332 ? 11.320  46.170 51.619 1.00 25.12 ? 332 LEU A O     1 
ATOM   2547 C  CB    . LEU A 1 332 ? 10.064  43.215 50.873 1.00 17.87 ? 332 LEU A CB    1 
ATOM   2548 C  CG    . LEU A 1 332 ? 11.184  42.811 51.844 1.00 22.14 ? 332 LEU A CG    1 
ATOM   2549 C  CD1   . LEU A 1 332 ? 10.680  42.855 53.299 1.00 23.59 ? 332 LEU A CD1   1 
ATOM   2550 C  CD2   . LEU A 1 332 ? 11.670  41.407 51.509 1.00 22.40 ? 332 LEU A CD2   1 
ATOM   2551 N  N     . ASP A 1 333 ? 10.857  45.859 49.429 1.00 22.14 ? 333 ASP A N     1 
ATOM   2552 C  CA    . ASP A 1 333 ? 11.875  46.750 48.902 1.00 21.33 ? 333 ASP A CA    1 
ATOM   2553 C  C     . ASP A 1 333 ? 11.749  48.174 49.397 1.00 19.91 ? 333 ASP A C     1 
ATOM   2554 O  O     . ASP A 1 333 ? 12.731  48.900 49.453 1.00 24.20 ? 333 ASP A O     1 
ATOM   2555 C  CB    . ASP A 1 333 ? 11.750  46.772 47.393 1.00 20.02 ? 333 ASP A CB    1 
ATOM   2556 C  CG    . ASP A 1 333 ? 10.364  47.132 46.957 1.00 16.46 ? 333 ASP A CG    1 
ATOM   2557 O  OD1   . ASP A 1 333 ? 9.454   46.300 47.133 1.00 13.10 ? 333 ASP A OD1   1 
ATOM   2558 O  OD2   . ASP A 1 333 ? 10.168  48.266 46.487 1.00 21.60 ? 333 ASP A OD2   1 
ATOM   2559 N  N     . VAL A 1 334 ? 10.538  48.595 49.727 1.00 23.76 ? 334 VAL A N     1 
ATOM   2560 C  CA    . VAL A 1 334 ? 10.325  49.970 50.187 1.00 23.71 ? 334 VAL A CA    1 
ATOM   2561 C  C     . VAL A 1 334 ? 10.986  50.277 51.527 1.00 24.87 ? 334 VAL A C     1 
ATOM   2562 O  O     . VAL A 1 334 ? 11.310  51.435 51.813 1.00 26.24 ? 334 VAL A O     1 
ATOM   2563 C  CB    . VAL A 1 334 ? 8.825   50.308 50.234 1.00 21.89 ? 334 VAL A CB    1 
ATOM   2564 C  CG1   . VAL A 1 334 ? 8.604   51.678 50.877 1.00 22.69 ? 334 VAL A CG1   1 
ATOM   2565 C  CG2   . VAL A 1 334 ? 8.250   50.283 48.798 1.00 19.00 ? 334 VAL A CG2   1 
ATOM   2566 N  N     . LEU A 1 335 ? 11.235  49.228 52.308 1.00 23.27 ? 335 LEU A N     1 
ATOM   2567 C  CA    . LEU A 1 335 ? 11.851  49.359 53.618 1.00 24.45 ? 335 LEU A CA    1 
ATOM   2568 C  C     . LEU A 1 335 ? 13.372  49.378 53.515 1.00 28.78 ? 335 LEU A C     1 
ATOM   2569 O  O     . LEU A 1 335 ? 14.051  49.545 54.532 1.00 33.49 ? 335 LEU A O     1 
ATOM   2570 C  CB    . LEU A 1 335 ? 11.434  48.190 54.522 1.00 20.98 ? 335 LEU A CB    1 
ATOM   2571 C  CG    . LEU A 1 335 ? 9.955   47.832 54.734 1.00 14.94 ? 335 LEU A CG    1 
ATOM   2572 C  CD1   . LEU A 1 335 ? 9.855   46.480 55.419 1.00 7.19  ? 335 LEU A CD1   1 
ATOM   2573 C  CD2   . LEU A 1 335 ? 9.236   48.924 55.527 1.00 9.31  ? 335 LEU A CD2   1 
ATOM   2574 N  N     . ASP A 1 336 ? 13.906  49.179 52.308 1.00 28.92 ? 336 ASP A N     1 
ATOM   2575 C  CA    . ASP A 1 336 ? 15.356  49.159 52.089 1.00 26.45 ? 336 ASP A CA    1 
ATOM   2576 C  C     . ASP A 1 336 ? 16.043  50.399 52.617 1.00 27.15 ? 336 ASP A C     1 
ATOM   2577 O  O     . ASP A 1 336 ? 15.760  51.507 52.157 1.00 21.76 ? 336 ASP A O     1 
ATOM   2578 C  CB    . ASP A 1 336 ? 15.697  49.062 50.605 1.00 27.89 ? 336 ASP A CB    1 
ATOM   2579 C  CG    . ASP A 1 336 ? 15.395  47.716 50.012 1.00 28.82 ? 336 ASP A CG    1 
ATOM   2580 O  OD1   . ASP A 1 336 ? 15.174  46.734 50.756 1.00 29.13 ? 336 ASP A OD1   1 
ATOM   2581 O  OD2   . ASP A 1 336 ? 15.391  47.647 48.768 1.00 31.26 ? 336 ASP A OD2   1 
ATOM   2582 N  N     . GLY A 1 337 ? 16.970  50.206 53.552 1.00 30.16 ? 337 GLY A N     1 
ATOM   2583 C  CA    . GLY A 1 337 ? 17.696  51.332 54.106 1.00 31.54 ? 337 GLY A CA    1 
ATOM   2584 C  C     . GLY A 1 337 ? 17.284  51.832 55.477 1.00 34.55 ? 337 GLY A C     1 
ATOM   2585 O  O     . GLY A 1 337 ? 17.986  52.668 56.037 1.00 40.23 ? 337 GLY A O     1 
ATOM   2586 N  N     . LEU A 1 338 ? 16.149  51.393 56.014 1.00 35.88 ? 338 LEU A N     1 
ATOM   2587 C  CA    . LEU A 1 338 ? 15.752  51.863 57.341 1.00 33.61 ? 338 LEU A CA    1 
ATOM   2588 C  C     . LEU A 1 338 ? 16.701  51.278 58.374 1.00 34.53 ? 338 LEU A C     1 
ATOM   2589 O  O     . LEU A 1 338 ? 17.093  50.113 58.281 1.00 36.92 ? 338 LEU A O     1 
ATOM   2590 C  CB    . LEU A 1 338 ? 14.301  51.486 57.673 1.00 30.02 ? 338 LEU A CB    1 
ATOM   2591 C  CG    . LEU A 1 338 ? 13.198  52.296 56.974 1.00 27.00 ? 338 LEU A CG    1 
ATOM   2592 C  CD1   . LEU A 1 338 ? 11.822  51.779 57.367 1.00 27.96 ? 338 LEU A CD1   1 
ATOM   2593 C  CD2   . LEU A 1 338 ? 13.313  53.757 57.328 1.00 26.12 ? 338 LEU A CD2   1 
ATOM   2594 N  N     . LYS A 1 339 ? 17.090  52.100 59.343 1.00 36.39 ? 339 LYS A N     1 
ATOM   2595 C  CA    . LYS A 1 339 ? 18.001  51.666 60.395 1.00 36.25 ? 339 LYS A CA    1 
ATOM   2596 C  C     . LYS A 1 339 ? 17.344  50.570 61.231 1.00 34.26 ? 339 LYS A C     1 
ATOM   2597 O  O     . LYS A 1 339 ? 18.002  49.639 61.686 1.00 35.34 ? 339 LYS A O     1 
ATOM   2598 C  CB    . LYS A 1 339 ? 18.388  52.860 61.276 1.00 40.34 ? 339 LYS A CB    1 
ATOM   2599 C  CG    . LYS A 1 339 ? 19.818  52.811 61.818 1.00 44.38 ? 339 LYS A CG    1 
ATOM   2600 C  CD    . LYS A 1 339 ? 19.980  51.833 62.990 1.00 49.87 ? 339 LYS A CD    1 
ATOM   2601 C  CE    . LYS A 1 339 ? 19.585  52.450 64.348 1.00 53.31 ? 339 LYS A CE    1 
ATOM   2602 N  NZ    . LYS A 1 339 ? 18.117  52.680 64.533 1.00 54.57 ? 339 LYS A NZ    1 
ATOM   2603 N  N     . GLU A 1 340 ? 16.033  50.663 61.395 1.00 35.28 ? 340 GLU A N     1 
ATOM   2604 C  CA    . GLU A 1 340 ? 15.298  49.680 62.171 1.00 35.43 ? 340 GLU A CA    1 
ATOM   2605 C  C     . GLU A 1 340 ? 13.836  49.657 61.751 1.00 34.12 ? 340 GLU A C     1 
ATOM   2606 O  O     . GLU A 1 340 ? 13.269  50.682 61.360 1.00 33.14 ? 340 GLU A O     1 
ATOM   2607 C  CB    . GLU A 1 340 ? 15.414  49.998 63.658 1.00 38.58 ? 340 GLU A CB    1 
ATOM   2608 C  CG    . GLU A 1 340 ? 14.972  51.407 64.023 1.00 43.63 ? 340 GLU A CG    1 
ATOM   2609 C  CD    . GLU A 1 340 ? 15.221  51.740 65.482 1.00 45.88 ? 340 GLU A CD    1 
ATOM   2610 O  OE1   . GLU A 1 340 ? 16.189  51.196 66.066 1.00 45.90 ? 340 GLU A OE1   1 
ATOM   2611 O  OE2   . GLU A 1 340 ? 14.455  52.559 66.035 1.00 44.76 ? 340 GLU A OE2   1 
ATOM   2612 N  N     . VAL A 1 341 ? 13.242  48.476 61.824 1.00 33.64 ? 341 VAL A N     1 
ATOM   2613 C  CA    . VAL A 1 341 ? 11.848  48.275 61.456 1.00 36.16 ? 341 VAL A CA    1 
ATOM   2614 C  C     . VAL A 1 341 ? 11.078  47.822 62.700 1.00 35.79 ? 341 VAL A C     1 
ATOM   2615 O  O     . VAL A 1 341 ? 11.645  47.218 63.606 1.00 34.30 ? 341 VAL A O     1 
ATOM   2616 C  CB    . VAL A 1 341 ? 11.706  47.216 60.320 1.00 35.81 ? 341 VAL A CB    1 
ATOM   2617 C  CG1   . VAL A 1 341 ? 12.282  47.755 59.008 1.00 30.67 ? 341 VAL A CG1   1 
ATOM   2618 C  CG2   . VAL A 1 341 ? 12.406  45.911 60.716 1.00 35.67 ? 341 VAL A CG2   1 
ATOM   2619 N  N     . LYS A 1 342 ? 9.787   48.110 62.743 1.00 36.75 ? 342 LYS A N     1 
ATOM   2620 C  CA    . LYS A 1 342 ? 8.985   47.733 63.892 1.00 36.44 ? 342 LYS A CA    1 
ATOM   2621 C  C     . LYS A 1 342 ? 7.696   47.010 63.521 1.00 36.12 ? 342 LYS A C     1 
ATOM   2622 O  O     . LYS A 1 342 ? 7.071   47.297 62.495 1.00 37.01 ? 342 LYS A O     1 
ATOM   2623 C  CB    . LYS A 1 342 ? 8.651   48.967 64.733 1.00 34.55 ? 342 LYS A CB    1 
ATOM   2624 C  CG    . LYS A 1 342 ? 9.855   49.715 65.275 1.00 31.64 ? 342 LYS A CG    1 
ATOM   2625 C  CD    . LYS A 1 342 ? 9.386   50.887 66.111 1.00 30.57 ? 342 LYS A CD    1 
ATOM   2626 C  CE    . LYS A 1 342 ? 10.545  51.658 66.706 1.00 31.98 ? 342 LYS A CE    1 
ATOM   2627 N  NZ    . LYS A 1 342 ? 10.066  52.766 67.596 1.00 25.55 ? 342 LYS A NZ    1 
ATOM   2628 N  N     . LEU A 1 343 ? 7.326   46.059 64.371 1.00 36.41 ? 343 LEU A N     1 
ATOM   2629 C  CA    . LEU A 1 343 ? 6.104   45.267 64.232 1.00 32.09 ? 343 LEU A CA    1 
ATOM   2630 C  C     . LEU A 1 343 ? 5.246   45.539 65.466 1.00 29.43 ? 343 LEU A C     1 
ATOM   2631 O  O     . LEU A 1 343 ? 5.769   45.698 66.576 1.00 30.23 ? 343 LEU A O     1 
ATOM   2632 C  CB    . LEU A 1 343 ? 6.447   43.774 64.201 1.00 28.27 ? 343 LEU A CB    1 
ATOM   2633 C  CG    . LEU A 1 343 ? 6.496   43.050 62.863 1.00 25.72 ? 343 LEU A CG    1 
ATOM   2634 C  CD1   . LEU A 1 343 ? 6.894   43.987 61.765 1.00 27.68 ? 343 LEU A CD1   1 
ATOM   2635 C  CD2   . LEU A 1 343 ? 7.455   41.902 62.959 1.00 17.73 ? 343 LEU A CD2   1 
ATOM   2636 N  N     . CYS A 1 344 ? 3.948   45.695 65.283 1.00 25.81 ? 344 CYS A N     1 
ATOM   2637 C  CA    . CYS A 1 344 ? 3.112   45.893 66.448 1.00 23.47 ? 344 CYS A CA    1 
ATOM   2638 C  C     . CYS A 1 344 ? 2.705   44.508 66.936 1.00 24.40 ? 344 CYS A C     1 
ATOM   2639 O  O     . CYS A 1 344 ? 2.034   43.761 66.210 1.00 25.84 ? 344 CYS A O     1 
ATOM   2640 C  CB    . CYS A 1 344 ? 1.897   46.725 66.114 1.00 22.50 ? 344 CYS A CB    1 
ATOM   2641 S  SG    . CYS A 1 344 ? 0.929   47.044 67.566 1.00 15.62 ? 344 CYS A SG    1 
ATOM   2642 N  N     . VAL A 1 345 ? 3.135   44.155 68.148 1.00 22.98 ? 345 VAL A N     1 
ATOM   2643 C  CA    . VAL A 1 345 ? 2.843   42.842 68.726 1.00 16.88 ? 345 VAL A CA    1 
ATOM   2644 C  C     . VAL A 1 345 ? 1.662   42.782 69.704 1.00 19.81 ? 345 VAL A C     1 
ATOM   2645 O  O     . VAL A 1 345 ? 1.139   41.694 69.979 1.00 19.23 ? 345 VAL A O     1 
ATOM   2646 C  CB    . VAL A 1 345 ? 4.085   42.244 69.392 1.00 17.53 ? 345 VAL A CB    1 
ATOM   2647 C  CG1   . VAL A 1 345 ? 5.125   41.930 68.356 1.00 15.40 ? 345 VAL A CG1   1 
ATOM   2648 C  CG2   . VAL A 1 345 ? 4.653   43.211 70.437 1.00 22.38 ? 345 VAL A CG2   1 
ATOM   2649 N  N     . ALA A 1 346 ? 1.246   43.931 70.239 1.00 18.80 ? 346 ALA A N     1 
ATOM   2650 C  CA    . ALA A 1 346 ? 0.114   43.980 71.169 1.00 17.38 ? 346 ALA A CA    1 
ATOM   2651 C  C     . ALA A 1 346 ? -0.404  45.390 71.314 1.00 16.33 ? 346 ALA A C     1 
ATOM   2652 O  O     . ALA A 1 346 ? 0.205   46.346 70.825 1.00 15.89 ? 346 ALA A O     1 
ATOM   2653 C  CB    . ALA A 1 346 ? 0.509   43.430 72.548 1.00 18.23 ? 346 ALA A CB    1 
ATOM   2654 N  N     . TYR A 1 347 ? -1.527  45.513 72.012 1.00 19.27 ? 347 TYR A N     1 
ATOM   2655 C  CA    . TYR A 1 347 ? -2.162  46.808 72.261 1.00 20.19 ? 347 TYR A CA    1 
ATOM   2656 C  C     . TYR A 1 347 ? -2.211  47.120 73.751 1.00 17.19 ? 347 TYR A C     1 
ATOM   2657 O  O     . TYR A 1 347 ? -2.512  46.260 74.578 1.00 14.17 ? 347 TYR A O     1 
ATOM   2658 C  CB    . TYR A 1 347 ? -3.616  46.837 71.752 1.00 21.40 ? 347 TYR A CB    1 
ATOM   2659 C  CG    . TYR A 1 347 ? -3.828  46.983 70.260 1.00 20.34 ? 347 TYR A CG    1 
ATOM   2660 C  CD1   . TYR A 1 347 ? -2.778  47.307 69.402 1.00 21.92 ? 347 TYR A CD1   1 
ATOM   2661 C  CD2   . TYR A 1 347 ? -5.092  46.788 69.711 1.00 21.28 ? 347 TYR A CD2   1 
ATOM   2662 C  CE1   . TYR A 1 347 ? -2.979  47.426 68.037 1.00 22.93 ? 347 TYR A CE1   1 
ATOM   2663 C  CE2   . TYR A 1 347 ? -5.310  46.904 68.354 1.00 21.81 ? 347 TYR A CE2   1 
ATOM   2664 C  CZ    . TYR A 1 347 ? -4.250  47.220 67.514 1.00 26.17 ? 347 TYR A CZ    1 
ATOM   2665 O  OH    . TYR A 1 347 ? -4.463  47.292 66.150 1.00 22.89 ? 347 TYR A OH    1 
ATOM   2666 N  N     . ARG A 1 348 ? -1.879  48.348 74.092 1.00 14.81 ? 348 ARG A N     1 
ATOM   2667 C  CA    . ARG A 1 348 ? -1.976  48.774 75.465 1.00 12.32 ? 348 ARG A CA    1 
ATOM   2668 C  C     . ARG A 1 348 ? -3.350  49.448 75.488 1.00 12.60 ? 348 ARG A C     1 
ATOM   2669 O  O     . ARG A 1 348 ? -3.582  50.420 74.755 1.00 8.79  ? 348 ARG A O     1 
ATOM   2670 C  CB    . ARG A 1 348 ? -0.871  49.773 75.816 1.00 11.77 ? 348 ARG A CB    1 
ATOM   2671 C  CG    . ARG A 1 348 ? -0.938  50.322 77.259 1.00 21.47 ? 348 ARG A CG    1 
ATOM   2672 C  CD    . ARG A 1 348 ? -0.747  49.227 78.325 1.00 14.13 ? 348 ARG A CD    1 
ATOM   2673 N  NE    . ARG A 1 348 ? 0.541   48.552 78.174 1.00 11.82 ? 348 ARG A NE    1 
ATOM   2674 C  CZ    . ARG A 1 348 ? 0.730   47.330 78.661 1.00 9.10  ? 348 ARG A CZ    1 
ATOM   2675 N  NH1   . ARG A 1 348 ? -0.239  46.716 79.314 1.00 9.79  ? 348 ARG A NH1   1 
ATOM   2676 N  NH2   . ARG A 1 348 ? 1.864   46.695 78.429 1.00 10.63 ? 348 ARG A NH2   1 
ATOM   2677 N  N     . MET A 1 349 ? -4.288  48.867 76.235 1.00 14.14 ? 349 MET A N     1 
ATOM   2678 C  CA    . MET A 1 349 ? -5.627  49.439 76.347 1.00 16.24 ? 349 MET A CA    1 
ATOM   2679 C  C     . MET A 1 349 ? -5.623  50.636 77.304 1.00 18.98 ? 349 MET A C     1 
ATOM   2680 O  O     . MET A 1 349 ? -4.817  50.704 78.242 1.00 17.33 ? 349 MET A O     1 
ATOM   2681 C  CB    . MET A 1 349 ? -6.659  48.381 76.782 1.00 18.90 ? 349 MET A CB    1 
ATOM   2682 C  CG    . MET A 1 349 ? -6.910  47.258 75.748 1.00 16.78 ? 349 MET A CG    1 
ATOM   2683 S  SD    . MET A 1 349 ? -7.021  47.879 74.025 1.00 17.92 ? 349 MET A SD    1 
ATOM   2684 C  CE    . MET A 1 349 ? -8.711  48.445 74.006 1.00 10.63 ? 349 MET A CE    1 
ATOM   2685 N  N     . PRO A 1 350 ? -6.514  51.608 77.060 1.00 20.43 ? 350 PRO A N     1 
ATOM   2686 C  CA    . PRO A 1 350 ? -6.711  52.848 77.816 1.00 19.61 ? 350 PRO A CA    1 
ATOM   2687 C  C     . PRO A 1 350 ? -6.877  52.659 79.314 1.00 19.98 ? 350 PRO A C     1 
ATOM   2688 O  O     . PRO A 1 350 ? -6.696  53.610 80.073 1.00 22.96 ? 350 PRO A O     1 
ATOM   2689 C  CB    . PRO A 1 350 ? -7.989  53.404 77.213 1.00 21.91 ? 350 PRO A CB    1 
ATOM   2690 C  CG    . PRO A 1 350 ? -7.891  52.958 75.791 1.00 24.03 ? 350 PRO A CG    1 
ATOM   2691 C  CD    . PRO A 1 350 ? -7.476  51.531 75.949 1.00 22.19 ? 350 PRO A CD    1 
ATOM   2692 N  N     . ASP A 1 351 ? -7.315  51.474 79.727 1.00 20.03 ? 351 ASP A N     1 
ATOM   2693 C  CA    . ASP A 1 351 ? -7.484  51.179 81.146 1.00 19.81 ? 351 ASP A CA    1 
ATOM   2694 C  C     . ASP A 1 351 ? -6.247  50.545 81.768 1.00 21.30 ? 351 ASP A C     1 
ATOM   2695 O  O     . ASP A 1 351 ? -6.202  50.341 82.979 1.00 26.41 ? 351 ASP A O     1 
ATOM   2696 C  CB    . ASP A 1 351 ? -8.701  50.297 81.390 1.00 19.76 ? 351 ASP A CB    1 
ATOM   2697 C  CG    . ASP A 1 351 ? -8.662  49.010 80.608 1.00 21.16 ? 351 ASP A CG    1 
ATOM   2698 O  OD1   . ASP A 1 351 ? -7.588  48.403 80.444 1.00 26.16 ? 351 ASP A OD1   1 
ATOM   2699 O  OD2   . ASP A 1 351 ? -9.737  48.592 80.151 1.00 33.56 ? 351 ASP A OD2   1 
ATOM   2700 N  N     . GLY A 1 352 ? -5.261  50.198 80.941 1.00 22.97 ? 352 GLY A N     1 
ATOM   2701 C  CA    . GLY A 1 352 ? -4.036  49.616 81.456 1.00 17.95 ? 352 GLY A CA    1 
ATOM   2702 C  C     . GLY A 1 352 ? -3.688  48.238 80.943 1.00 18.41 ? 352 GLY A C     1 
ATOM   2703 O  O     . GLY A 1 352 ? -2.514  47.904 80.841 1.00 21.30 ? 352 GLY A O     1 
ATOM   2704 N  N     . ARG A 1 353 ? -4.690  47.443 80.589 1.00 21.04 ? 353 ARG A N     1 
ATOM   2705 C  CA    . ARG A 1 353 ? -4.451  46.077 80.107 1.00 21.20 ? 353 ARG A CA    1 
ATOM   2706 C  C     . ARG A 1 353 ? -3.735  46.021 78.773 1.00 20.62 ? 353 ARG A C     1 
ATOM   2707 O  O     . ARG A 1 353 ? -3.953  46.867 77.910 1.00 25.40 ? 353 ARG A O     1 
ATOM   2708 C  CB    . ARG A 1 353 ? -5.784  45.346 79.938 1.00 23.39 ? 353 ARG A CB    1 
ATOM   2709 C  CG    . ARG A 1 353 ? -6.696  45.370 81.141 1.00 30.64 ? 353 ARG A CG    1 
ATOM   2710 C  CD    . ARG A 1 353 ? -8.090  44.917 80.752 1.00 35.85 ? 353 ARG A CD    1 
ATOM   2711 N  NE    . ARG A 1 353 ? -8.788  45.927 79.949 1.00 43.21 ? 353 ARG A NE    1 
ATOM   2712 C  CZ    . ARG A 1 353 ? -9.162  45.701 78.686 1.00 40.68 ? 353 ARG A CZ    1 
ATOM   2713 N  NH1   . ARG A 1 353 ? -8.910  44.533 78.105 1.00 41.42 ? 353 ARG A NH1   1 
ATOM   2714 N  NH2   . ARG A 1 353 ? -9.790  46.654 78.000 1.00 39.55 ? 353 ARG A NH2   1 
ATOM   2715 N  N     . GLU A 1 354 ? -2.894  45.017 78.593 1.00 22.83 ? 354 GLU A N     1 
ATOM   2716 C  CA    . GLU A 1 354 ? -2.211  44.808 77.316 1.00 24.37 ? 354 GLU A CA    1 
ATOM   2717 C  C     . GLU A 1 354 ? -2.986  43.678 76.647 1.00 26.08 ? 354 GLU A C     1 
ATOM   2718 O  O     . GLU A 1 354 ? -3.241  42.652 77.268 1.00 28.80 ? 354 GLU A O     1 
ATOM   2719 C  CB    . GLU A 1 354 ? -0.788  44.338 77.539 1.00 26.28 ? 354 GLU A CB    1 
ATOM   2720 C  CG    . GLU A 1 354 ? -0.083  43.936 76.279 1.00 27.35 ? 354 GLU A CG    1 
ATOM   2721 C  CD    . GLU A 1 354 ? 1.181   43.186 76.565 1.00 27.84 ? 354 GLU A CD    1 
ATOM   2722 O  OE1   . GLU A 1 354 ? 1.107   41.954 76.746 1.00 33.38 ? 354 GLU A OE1   1 
ATOM   2723 O  OE2   . GLU A 1 354 ? 2.248   43.826 76.620 1.00 34.19 ? 354 GLU A OE2   1 
ATOM   2724 N  N     . VAL A 1 355 ? -3.360  43.847 75.390 1.00 29.24 ? 355 VAL A N     1 
ATOM   2725 C  CA    . VAL A 1 355 ? -4.124  42.813 74.701 1.00 27.61 ? 355 VAL A CA    1 
ATOM   2726 C  C     . VAL A 1 355 ? -3.514  42.507 73.325 1.00 27.01 ? 355 VAL A C     1 
ATOM   2727 O  O     . VAL A 1 355 ? -2.669  43.259 72.832 1.00 27.72 ? 355 VAL A O     1 
ATOM   2728 C  CB    . VAL A 1 355 ? -5.598  43.272 74.566 1.00 27.94 ? 355 VAL A CB    1 
ATOM   2729 C  CG1   . VAL A 1 355 ? -5.736  44.283 73.446 1.00 28.46 ? 355 VAL A CG1   1 
ATOM   2730 C  CG2   . VAL A 1 355 ? -6.530  42.086 74.379 1.00 29.82 ? 355 VAL A CG2   1 
ATOM   2731 N  N     . THR A 1 356 ? -3.876  41.368 72.744 1.00 26.58 ? 356 THR A N     1 
ATOM   2732 C  CA    . THR A 1 356 ? -3.388  41.007 71.414 1.00 23.57 ? 356 THR A CA    1 
ATOM   2733 C  C     . THR A 1 356 ? -4.554  40.747 70.468 1.00 21.52 ? 356 THR A C     1 
ATOM   2734 O  O     . THR A 1 356 ? -4.430  40.023 69.487 1.00 24.97 ? 356 THR A O     1 
ATOM   2735 C  CB    . THR A 1 356 ? -2.410  39.803 71.435 1.00 25.12 ? 356 THR A CB    1 
ATOM   2736 O  OG1   . THR A 1 356 ? -2.981  38.691 72.150 1.00 23.47 ? 356 THR A OG1   1 
ATOM   2737 C  CG2   . THR A 1 356 ? -1.085  40.225 72.067 1.00 23.37 ? 356 THR A CG2   1 
ATOM   2738 N  N     . THR A 1 357 ? -5.680  41.377 70.773 1.00 21.38 ? 357 THR A N     1 
ATOM   2739 C  CA    . THR A 1 357 ? -6.908  41.282 69.995 1.00 23.38 ? 357 THR A CA    1 
ATOM   2740 C  C     . THR A 1 357 ? -7.286  42.730 69.636 1.00 21.59 ? 357 THR A C     1 
ATOM   2741 O  O     . THR A 1 357 ? -6.922  43.664 70.368 1.00 20.32 ? 357 THR A O     1 
ATOM   2742 C  CB    . THR A 1 357 ? -8.022  40.589 70.843 1.00 29.69 ? 357 THR A CB    1 
ATOM   2743 O  OG1   . THR A 1 357 ? -7.738  39.184 70.945 1.00 32.81 ? 357 THR A OG1   1 
ATOM   2744 C  CG2   . THR A 1 357 ? -9.414  40.788 70.235 1.00 30.69 ? 357 THR A CG2   1 
ATOM   2745 N  N     . THR A 1 358 ? -7.933  42.937 68.491 1.00 16.32 ? 358 THR A N     1 
ATOM   2746 C  CA    . THR A 1 358 ? -8.301  44.297 68.092 1.00 14.96 ? 358 THR A CA    1 
ATOM   2747 C  C     . THR A 1 358 ? -9.695  44.604 68.613 1.00 13.20 ? 358 THR A C     1 
ATOM   2748 O  O     . THR A 1 358 ? -10.450 43.681 68.937 1.00 12.20 ? 358 THR A O     1 
ATOM   2749 C  CB    . THR A 1 358 ? -8.242  44.537 66.495 1.00 14.02 ? 358 THR A CB    1 
ATOM   2750 O  OG1   . THR A 1 358 ? -9.166  43.688 65.807 1.00 11.48 ? 358 THR A OG1   1 
ATOM   2751 C  CG2   . THR A 1 358 ? -6.870  44.268 65.934 1.00 7.24  ? 358 THR A CG2   1 
ATOM   2752 N  N     . PRO A 1 359 ? -9.998  45.898 68.834 1.00 10.73 ? 359 PRO A N     1 
ATOM   2753 C  CA    . PRO A 1 359 ? -11.310 46.366 69.316 1.00 10.92 ? 359 PRO A CA    1 
ATOM   2754 C  C     . PRO A 1 359 ? -12.208 46.304 68.078 1.00 15.87 ? 359 PRO A C     1 
ATOM   2755 O  O     . PRO A 1 359 ? -11.692 46.205 66.962 1.00 23.71 ? 359 PRO A O     1 
ATOM   2756 C  CB    . PRO A 1 359 ? -11.043 47.830 69.687 1.00 5.23  ? 359 PRO A CB    1 
ATOM   2757 C  CG    . PRO A 1 359 ? -9.582  47.871 69.970 1.00 8.58  ? 359 PRO A CG    1 
ATOM   2758 C  CD    . PRO A 1 359 ? -9.004  46.981 68.890 1.00 10.10 ? 359 PRO A CD    1 
ATOM   2759 N  N     . LEU A 1 360 ? -13.522 46.387 68.216 1.00 13.35 ? 360 LEU A N     1 
ATOM   2760 C  CA    . LEU A 1 360 ? -14.328 46.319 67.011 1.00 9.60  ? 360 LEU A CA    1 
ATOM   2761 C  C     . LEU A 1 360 ? -14.627 47.673 66.340 1.00 14.35 ? 360 LEU A C     1 
ATOM   2762 O  O     . LEU A 1 360 ? -13.909 48.095 65.410 1.00 14.03 ? 360 LEU A O     1 
ATOM   2763 C  CB    . LEU A 1 360 ? -15.598 45.497 67.243 1.00 11.35 ? 360 LEU A CB    1 
ATOM   2764 C  CG    . LEU A 1 360 ? -15.419 44.012 67.667 1.00 10.77 ? 360 LEU A CG    1 
ATOM   2765 C  CD1   . LEU A 1 360 ? -16.582 43.174 67.135 1.00 5.01  ? 360 LEU A CD1   1 
ATOM   2766 C  CD2   . LEU A 1 360 ? -14.121 43.436 67.185 1.00 5.01  ? 360 LEU A CD2   1 
ATOM   2767 N  N     . ALA A 1 361 ? -15.653 48.368 66.817 1.00 11.47 ? 361 ALA A N     1 
ATOM   2768 C  CA    . ALA A 1 361 ? -16.037 49.652 66.248 1.00 5.23  ? 361 ALA A CA    1 
ATOM   2769 C  C     . ALA A 1 361 ? -14.956 50.710 66.438 1.00 8.88  ? 361 ALA A C     1 
ATOM   2770 O  O     . ALA A 1 361 ? -14.181 50.641 67.396 1.00 14.76 ? 361 ALA A O     1 
ATOM   2771 C  CB    . ALA A 1 361 ? -17.335 50.098 66.845 1.00 6.42  ? 361 ALA A CB    1 
ATOM   2772 N  N     . ALA A 1 362 ? -14.953 51.719 65.566 1.00 7.55  ? 362 ALA A N     1 
ATOM   2773 C  CA    . ALA A 1 362 ? -13.960 52.785 65.587 1.00 6.87  ? 362 ALA A CA    1 
ATOM   2774 C  C     . ALA A 1 362 ? -13.820 53.464 66.933 1.00 10.67 ? 362 ALA A C     1 
ATOM   2775 O  O     . ALA A 1 362 ? -12.711 53.728 67.371 1.00 16.33 ? 362 ALA A O     1 
ATOM   2776 C  CB    . ALA A 1 362 ? -14.268 53.814 64.515 1.00 9.51  ? 362 ALA A CB    1 
ATOM   2777 N  N     . ASP A 1 363 ? -14.934 53.772 67.587 1.00 14.68 ? 363 ASP A N     1 
ATOM   2778 C  CA    . ASP A 1 363 ? -14.895 54.420 68.902 1.00 17.37 ? 363 ASP A CA    1 
ATOM   2779 C  C     . ASP A 1 363 ? -14.067 53.642 69.928 1.00 17.06 ? 363 ASP A C     1 
ATOM   2780 O  O     . ASP A 1 363 ? -13.258 54.226 70.644 1.00 16.99 ? 363 ASP A O     1 
ATOM   2781 C  CB    . ASP A 1 363 ? -16.312 54.658 69.425 1.00 20.45 ? 363 ASP A CB    1 
ATOM   2782 C  CG    . ASP A 1 363 ? -16.960 55.885 68.812 1.00 24.34 ? 363 ASP A CG    1 
ATOM   2783 O  OD1   . ASP A 1 363 ? -16.256 56.666 68.130 1.00 25.19 ? 363 ASP A OD1   1 
ATOM   2784 O  OD2   . ASP A 1 363 ? -18.175 56.084 69.019 1.00 28.08 ? 363 ASP A OD2   1 
ATOM   2785 N  N     . ASP A 1 364 ? -14.206 52.323 69.946 1.00 14.71 ? 364 ASP A N     1 
ATOM   2786 C  CA    . ASP A 1 364 ? -13.438 51.504 70.877 1.00 15.99 ? 364 ASP A CA    1 
ATOM   2787 C  C     . ASP A 1 364 ? -11.921 51.476 70.614 1.00 16.92 ? 364 ASP A C     1 
ATOM   2788 O  O     . ASP A 1 364 ? -11.159 50.861 71.367 1.00 19.91 ? 364 ASP A O     1 
ATOM   2789 C  CB    . ASP A 1 364 ? -13.984 50.090 70.909 1.00 20.40 ? 364 ASP A CB    1 
ATOM   2790 C  CG    . ASP A 1 364 ? -15.480 50.052 71.155 1.00 27.20 ? 364 ASP A CG    1 
ATOM   2791 O  OD1   . ASP A 1 364 ? -15.898 49.537 72.210 1.00 33.48 ? 364 ASP A OD1   1 
ATOM   2792 O  OD2   . ASP A 1 364 ? -16.242 50.522 70.289 1.00 29.97 ? 364 ASP A OD2   1 
ATOM   2793 N  N     . TRP A 1 365 ? -11.470 52.126 69.548 1.00 13.91 ? 365 TRP A N     1 
ATOM   2794 C  CA    . TRP A 1 365 ? -10.040 52.168 69.261 1.00 10.39 ? 365 TRP A CA    1 
ATOM   2795 C  C     . TRP A 1 365 ? -9.468  53.455 69.850 1.00 14.66 ? 365 TRP A C     1 
ATOM   2796 O  O     . TRP A 1 365 ? -8.260  53.675 69.827 1.00 12.48 ? 365 TRP A O     1 
ATOM   2797 C  CB    . TRP A 1 365 ? -9.777  52.175 67.752 1.00 12.84 ? 365 TRP A CB    1 
ATOM   2798 C  CG    . TRP A 1 365 ? -10.137 50.928 67.014 1.00 5.01  ? 365 TRP A CG    1 
ATOM   2799 C  CD1   . TRP A 1 365 ? -11.386 50.424 66.814 1.00 5.25  ? 365 TRP A CD1   1 
ATOM   2800 C  CD2   . TRP A 1 365 ? -9.234  50.031 66.371 1.00 7.26  ? 365 TRP A CD2   1 
ATOM   2801 N  NE1   . TRP A 1 365 ? -11.321 49.262 66.091 1.00 7.12  ? 365 TRP A NE1   1 
ATOM   2802 C  CE2   . TRP A 1 365 ? -10.008 48.997 65.799 1.00 8.12  ? 365 TRP A CE2   1 
ATOM   2803 C  CE3   . TRP A 1 365 ? -7.842  49.998 66.221 1.00 8.65  ? 365 TRP A CE3   1 
ATOM   2804 C  CZ2   . TRP A 1 365 ? -9.437  47.938 65.083 1.00 7.08  ? 365 TRP A CZ2   1 
ATOM   2805 C  CZ3   . TRP A 1 365 ? -7.273  48.948 65.513 1.00 6.81  ? 365 TRP A CZ3   1 
ATOM   2806 C  CH2   . TRP A 1 365 ? -8.074  47.930 64.952 1.00 7.10  ? 365 TRP A CH2   1 
ATOM   2807 N  N     . LYS A 1 366 ? -10.341 54.292 70.399 1.00 23.34 ? 366 LYS A N     1 
ATOM   2808 C  CA    . LYS A 1 366 ? -9.946  55.572 70.966 1.00 31.70 ? 366 LYS A CA    1 
ATOM   2809 C  C     . LYS A 1 366 ? -8.566  55.719 71.623 1.00 32.57 ? 366 LYS A C     1 
ATOM   2810 O  O     . LYS A 1 366 ? -7.658  56.281 70.995 1.00 41.02 ? 366 LYS A O     1 
ATOM   2811 C  CB    . LYS A 1 366 ? -11.056 56.123 71.863 1.00 37.21 ? 366 LYS A CB    1 
ATOM   2812 C  CG    . LYS A 1 366 ? -12.188 56.815 71.078 1.00 45.08 ? 366 LYS A CG    1 
ATOM   2813 C  CD    . LYS A 1 366 ? -13.401 57.099 71.973 1.00 49.63 ? 366 LYS A CD    1 
ATOM   2814 C  CE    . LYS A 1 366 ? -14.502 57.875 71.254 1.00 51.86 ? 366 LYS A CE    1 
ATOM   2815 N  NZ    . LYS A 1 366 ? -15.701 58.087 72.132 1.00 50.86 ? 366 LYS A NZ    1 
ATOM   2816 N  N     . GLY A 1 367 ? -8.369  55.206 72.833 1.00 24.09 ? 367 GLY A N     1 
ATOM   2817 C  CA    . GLY A 1 367 ? -7.069  55.390 73.465 1.00 19.60 ? 367 GLY A CA    1 
ATOM   2818 C  C     . GLY A 1 367 ? -6.050  54.291 73.251 1.00 18.33 ? 367 GLY A C     1 
ATOM   2819 O  O     . GLY A 1 367 ? -5.022  54.266 73.901 1.00 17.38 ? 367 GLY A O     1 
ATOM   2820 N  N     . VAL A 1 368 ? -6.333  53.378 72.337 1.00 20.71 ? 368 VAL A N     1 
ATOM   2821 C  CA    . VAL A 1 368 ? -5.453  52.252 72.047 1.00 21.75 ? 368 VAL A CA    1 
ATOM   2822 C  C     . VAL A 1 368 ? -4.042  52.607 71.574 1.00 21.44 ? 368 VAL A C     1 
ATOM   2823 O  O     . VAL A 1 368 ? -3.853  53.202 70.517 1.00 28.15 ? 368 VAL A O     1 
ATOM   2824 C  CB    . VAL A 1 368 ? -6.130  51.323 71.028 1.00 23.00 ? 368 VAL A CB    1 
ATOM   2825 C  CG1   . VAL A 1 368 ? -5.106  50.396 70.368 1.00 22.68 ? 368 VAL A CG1   1 
ATOM   2826 C  CG2   . VAL A 1 368 ? -7.237  50.538 71.732 1.00 17.95 ? 368 VAL A CG2   1 
ATOM   2827 N  N     . GLU A 1 369 ? -3.049  52.160 72.330 1.00 21.74 ? 369 GLU A N     1 
ATOM   2828 C  CA    . GLU A 1 369 ? -1.657  52.431 72.014 1.00 17.42 ? 369 GLU A CA    1 
ATOM   2829 C  C     . GLU A 1 369 ? -0.950  51.188 71.521 1.00 18.01 ? 369 GLU A C     1 
ATOM   2830 O  O     . GLU A 1 369 ? -1.204  50.088 72.017 1.00 17.85 ? 369 GLU A O     1 
ATOM   2831 C  CB    . GLU A 1 369 ? -0.925  52.953 73.252 1.00 16.96 ? 369 GLU A CB    1 
ATOM   2832 C  CG    . GLU A 1 369 ? -1.283  54.375 73.639 1.00 14.83 ? 369 GLU A CG    1 
ATOM   2833 C  CD    . GLU A 1 369 ? -0.567  55.412 72.795 1.00 16.26 ? 369 GLU A CD    1 
ATOM   2834 O  OE1   . GLU A 1 369 ? 0.588   55.168 72.401 1.00 21.73 ? 369 GLU A OE1   1 
ATOM   2835 O  OE2   . GLU A 1 369 ? -1.144  56.489 72.545 1.00 24.16 ? 369 GLU A OE2   1 
ATOM   2836 N  N     . PRO A 1 370 ? -0.094  51.337 70.491 1.00 18.25 ? 370 PRO A N     1 
ATOM   2837 C  CA    . PRO A 1 370 ? 0.671   50.230 69.914 1.00 16.84 ? 370 PRO A CA    1 
ATOM   2838 C  C     . PRO A 1 370 ? 1.937   49.922 70.712 1.00 19.43 ? 370 PRO A C     1 
ATOM   2839 O  O     . PRO A 1 370 ? 2.654   50.839 71.118 1.00 18.92 ? 370 PRO A O     1 
ATOM   2840 C  CB    . PRO A 1 370 ? 1.025   50.764 68.531 1.00 14.96 ? 370 PRO A CB    1 
ATOM   2841 C  CG    . PRO A 1 370 ? 1.188   52.228 68.786 1.00 10.00 ? 370 PRO A CG    1 
ATOM   2842 C  CD    . PRO A 1 370 ? -0.029  52.514 69.602 1.00 16.35 ? 370 PRO A CD    1 
ATOM   2843 N  N     . ILE A 1 371 ? 2.174   48.633 70.957 1.00 20.87 ? 371 ILE A N     1 
ATOM   2844 C  CA    . ILE A 1 371 ? 3.360   48.135 71.668 1.00 21.66 ? 371 ILE A CA    1 
ATOM   2845 C  C     . ILE A 1 371 ? 4.137   47.409 70.557 1.00 21.78 ? 371 ILE A C     1 
ATOM   2846 O  O     . ILE A 1 371 ? 3.614   46.475 69.949 1.00 25.16 ? 371 ILE A O     1 
ATOM   2847 C  CB    . ILE A 1 371 ? 2.948   47.123 72.770 1.00 21.22 ? 371 ILE A CB    1 
ATOM   2848 C  CG1   . ILE A 1 371 ? 2.056   47.800 73.810 1.00 16.53 ? 371 ILE A CG1   1 
ATOM   2849 C  CG2   . ILE A 1 371 ? 4.162   46.489 73.410 1.00 18.63 ? 371 ILE A CG2   1 
ATOM   2850 C  CD1   . ILE A 1 371 ? 1.532   46.825 74.880 1.00 18.81 ? 371 ILE A CD1   1 
ATOM   2851 N  N     . TYR A 1 372 ? 5.365   47.834 70.284 1.00 21.09 ? 372 TYR A N     1 
ATOM   2852 C  CA    . TYR A 1 372 ? 6.152   47.255 69.184 1.00 20.59 ? 372 TYR A CA    1 
ATOM   2853 C  C     . TYR A 1 372 ? 7.348   46.420 69.576 1.00 20.50 ? 372 TYR A C     1 
ATOM   2854 O  O     . TYR A 1 372 ? 7.879   46.534 70.676 1.00 22.08 ? 372 TYR A O     1 
ATOM   2855 C  CB    . TYR A 1 372 ? 6.758   48.357 68.283 1.00 18.78 ? 372 TYR A CB    1 
ATOM   2856 C  CG    . TYR A 1 372 ? 5.836   49.389 67.686 1.00 15.56 ? 372 TYR A CG    1 
ATOM   2857 C  CD1   . TYR A 1 372 ? 5.131   49.131 66.507 1.00 16.50 ? 372 TYR A CD1   1 
ATOM   2858 C  CD2   . TYR A 1 372 ? 5.746   50.659 68.238 1.00 15.73 ? 372 TYR A CD2   1 
ATOM   2859 C  CE1   . TYR A 1 372 ? 4.365   50.123 65.889 1.00 14.17 ? 372 TYR A CE1   1 
ATOM   2860 C  CE2   . TYR A 1 372 ? 4.985   51.659 67.631 1.00 19.28 ? 372 TYR A CE2   1 
ATOM   2861 C  CZ    . TYR A 1 372 ? 4.298   51.387 66.457 1.00 17.26 ? 372 TYR A CZ    1 
ATOM   2862 O  OH    . TYR A 1 372 ? 3.567   52.385 65.846 1.00 17.43 ? 372 TYR A OH    1 
ATOM   2863 N  N     . GLU A 1 373 ? 7.802   45.637 68.604 1.00 19.93 ? 373 GLU A N     1 
ATOM   2864 C  CA    . GLU A 1 373 ? 9.020   44.838 68.706 1.00 19.52 ? 373 GLU A CA    1 
ATOM   2865 C  C     . GLU A 1 373 ? 9.911   45.558 67.703 1.00 20.05 ? 373 GLU A C     1 
ATOM   2866 O  O     . GLU A 1 373 ? 9.476   45.860 66.586 1.00 21.55 ? 373 GLU A O     1 
ATOM   2867 C  CB    . GLU A 1 373 ? 8.816   43.403 68.244 1.00 19.13 ? 373 GLU A CB    1 
ATOM   2868 C  CG    . GLU A 1 373 ? 8.387   42.468 69.347 1.00 24.21 ? 373 GLU A CG    1 
ATOM   2869 C  CD    . GLU A 1 373 ? 8.544   41.017 68.971 1.00 28.27 ? 373 GLU A CD    1 
ATOM   2870 O  OE1   . GLU A 1 373 ? 8.213   40.144 69.796 1.00 31.83 ? 373 GLU A OE1   1 
ATOM   2871 O  OE2   . GLU A 1 373 ? 9.006   40.737 67.848 1.00 37.84 ? 373 GLU A OE2   1 
ATOM   2872 N  N     . THR A 1 374 ? 11.115  45.915 68.109 1.00 18.61 ? 374 THR A N     1 
ATOM   2873 C  CA    . THR A 1 374 ? 11.991  46.615 67.197 1.00 19.55 ? 374 THR A CA    1 
ATOM   2874 C  C     . THR A 1 374 ? 13.062  45.666 66.696 1.00 20.08 ? 374 THR A C     1 
ATOM   2875 O  O     . THR A 1 374 ? 13.691  44.946 67.487 1.00 24.32 ? 374 THR A O     1 
ATOM   2876 C  CB    . THR A 1 374 ? 12.566  47.864 67.857 1.00 18.42 ? 374 THR A CB    1 
ATOM   2877 O  OG1   . THR A 1 374 ? 11.475  48.674 68.313 1.00 18.01 ? 374 THR A OG1   1 
ATOM   2878 C  CG2   . THR A 1 374 ? 13.384  48.662 66.865 1.00 20.25 ? 374 THR A CG2   1 
ATOM   2879 N  N     . MET A 1 375 ? 13.181  45.595 65.373 1.00 17.67 ? 375 MET A N     1 
ATOM   2880 C  CA    . MET A 1 375 ? 14.143  44.719 64.707 1.00 16.62 ? 375 MET A CA    1 
ATOM   2881 C  C     . MET A 1 375 ? 15.079  45.539 63.841 1.00 16.72 ? 375 MET A C     1 
ATOM   2882 O  O     . MET A 1 375 ? 14.739  46.644 63.403 1.00 17.62 ? 375 MET A O     1 
ATOM   2883 C  CB    . MET A 1 375 ? 13.413  43.708 63.819 1.00 20.69 ? 375 MET A CB    1 
ATOM   2884 C  CG    . MET A 1 375 ? 12.418  42.835 64.550 1.00 19.07 ? 375 MET A CG    1 
ATOM   2885 S  SD    . MET A 1 375 ? 11.672  41.641 63.443 1.00 30.96 ? 375 MET A SD    1 
ATOM   2886 C  CE    . MET A 1 375 ? 13.041  40.547 63.096 1.00 25.92 ? 375 MET A CE    1 
ATOM   2887 N  N     . PRO A 1 376 ? 16.281  45.020 63.586 1.00 15.42 ? 376 PRO A N     1 
ATOM   2888 C  CA    . PRO A 1 376 ? 17.203  45.795 62.749 1.00 19.56 ? 376 PRO A CA    1 
ATOM   2889 C  C     . PRO A 1 376 ? 16.826  45.756 61.262 1.00 24.94 ? 376 PRO A C     1 
ATOM   2890 O  O     . PRO A 1 376 ? 16.314  44.741 60.764 1.00 25.98 ? 376 PRO A O     1 
ATOM   2891 C  CB    . PRO A 1 376 ? 18.557  45.125 63.020 1.00 15.89 ? 376 PRO A CB    1 
ATOM   2892 C  CG    . PRO A 1 376 ? 18.189  43.702 63.346 1.00 14.10 ? 376 PRO A CG    1 
ATOM   2893 C  CD    . PRO A 1 376 ? 16.936  43.843 64.179 1.00 11.81 ? 376 PRO A CD    1 
ATOM   2894 N  N     . GLY A 1 377 ? 17.028  46.882 60.580 1.00 26.47 ? 377 GLY A N     1 
ATOM   2895 C  CA    . GLY A 1 377 ? 16.746  46.960 59.158 1.00 27.45 ? 377 GLY A CA    1 
ATOM   2896 C  C     . GLY A 1 377 ? 17.871  46.384 58.297 1.00 29.80 ? 377 GLY A C     1 
ATOM   2897 O  O     . GLY A 1 377 ? 18.663  45.556 58.770 1.00 25.85 ? 377 GLY A O     1 
ATOM   2898 N  N     . TRP A 1 378 ? 17.925  46.811 57.031 1.00 31.37 ? 378 TRP A N     1 
ATOM   2899 C  CA    . TRP A 1 378 ? 18.926  46.370 56.053 1.00 28.65 ? 378 TRP A CA    1 
ATOM   2900 C  C     . TRP A 1 378 ? 19.146  47.464 55.010 1.00 28.66 ? 378 TRP A C     1 
ATOM   2901 O  O     . TRP A 1 378 ? 18.195  48.092 54.543 1.00 27.51 ? 378 TRP A O     1 
ATOM   2902 C  CB    . TRP A 1 378 ? 18.490  45.063 55.377 1.00 32.04 ? 378 TRP A CB    1 
ATOM   2903 C  CG    . TRP A 1 378 ? 17.113  45.105 54.768 1.00 39.30 ? 378 TRP A CG    1 
ATOM   2904 C  CD1   . TRP A 1 378 ? 16.801  45.392 53.471 1.00 39.22 ? 378 TRP A CD1   1 
ATOM   2905 C  CD2   . TRP A 1 378 ? 15.859  44.870 55.439 1.00 41.52 ? 378 TRP A CD2   1 
ATOM   2906 N  NE1   . TRP A 1 378 ? 15.437  45.354 53.289 1.00 41.98 ? 378 TRP A NE1   1 
ATOM   2907 C  CE2   . TRP A 1 378 ? 14.834  45.036 54.477 1.00 42.34 ? 378 TRP A CE2   1 
ATOM   2908 C  CE3   . TRP A 1 378 ? 15.505  44.540 56.755 1.00 38.21 ? 378 TRP A CE3   1 
ATOM   2909 C  CZ2   . TRP A 1 378 ? 13.477  44.881 54.791 1.00 40.59 ? 378 TRP A CZ2   1 
ATOM   2910 C  CZ3   . TRP A 1 378 ? 14.156  44.389 57.065 1.00 41.21 ? 378 TRP A CZ3   1 
ATOM   2911 C  CH2   . TRP A 1 378 ? 13.158  44.560 56.085 1.00 39.23 ? 378 TRP A CH2   1 
ATOM   2912 N  N     . SER A 1 379 ? 20.406  47.692 54.656 1.00 31.75 ? 379 SER A N     1 
ATOM   2913 C  CA    . SER A 1 379 ? 20.780  48.732 53.696 1.00 35.91 ? 379 SER A CA    1 
ATOM   2914 C  C     . SER A 1 379 ? 20.803  48.253 52.243 1.00 38.30 ? 379 SER A C     1 
ATOM   2915 O  O     . SER A 1 379 ? 20.699  49.052 51.302 1.00 41.13 ? 379 SER A O     1 
ATOM   2916 C  CB    . SER A 1 379 ? 22.153  49.319 54.068 1.00 34.70 ? 379 SER A CB    1 
ATOM   2917 O  OG    . SER A 1 379 ? 23.159  48.312 54.136 1.00 35.63 ? 379 SER A OG    1 
ATOM   2918 N  N     . GLU A 1 380 ? 20.938  46.945 52.074 1.00 37.70 ? 380 GLU A N     1 
ATOM   2919 C  CA    . GLU A 1 380 ? 20.995  46.331 50.759 1.00 35.01 ? 380 GLU A CA    1 
ATOM   2920 C  C     . GLU A 1 380 ? 19.688  46.541 50.006 1.00 32.59 ? 380 GLU A C     1 
ATOM   2921 O  O     . GLU A 1 380 ? 18.628  46.757 50.604 1.00 25.20 ? 380 GLU A O     1 
ATOM   2922 C  CB    . GLU A 1 380 ? 21.309  44.833 50.885 1.00 35.33 ? 380 GLU A CB    1 
ATOM   2923 C  CG    . GLU A 1 380 ? 22.540  44.502 51.740 1.00 40.28 ? 380 GLU A CG    1 
ATOM   2924 C  CD    . GLU A 1 380 ? 22.208  44.186 53.210 1.00 48.26 ? 380 GLU A CD    1 
ATOM   2925 O  OE1   . GLU A 1 380 ? 21.360  44.883 53.806 1.00 50.64 ? 380 GLU A OE1   1 
ATOM   2926 O  OE2   . GLU A 1 380 ? 22.803  43.239 53.785 1.00 49.37 ? 380 GLU A OE2   1 
ATOM   2927 N  N     . SER A 1 381 ? 19.785  46.532 48.684 1.00 34.43 ? 381 SER A N     1 
ATOM   2928 C  CA    . SER A 1 381 ? 18.621  46.707 47.827 1.00 34.07 ? 381 SER A CA    1 
ATOM   2929 C  C     . SER A 1 381 ? 17.984  45.344 47.549 1.00 31.89 ? 381 SER A C     1 
ATOM   2930 O  O     . SER A 1 381 ? 18.665  44.402 47.136 1.00 31.71 ? 381 SER A O     1 
ATOM   2931 C  CB    . SER A 1 381 ? 19.035  47.391 46.518 1.00 35.15 ? 381 SER A CB    1 
ATOM   2932 O  OG    . SER A 1 381 ? 17.984  47.415 45.563 1.00 42.80 ? 381 SER A OG    1 
ATOM   2933 N  N     . THR A 1 382 ? 16.692  45.228 47.837 1.00 28.36 ? 382 THR A N     1 
ATOM   2934 C  CA    . THR A 1 382 ? 15.966  43.991 47.596 1.00 25.56 ? 382 THR A CA    1 
ATOM   2935 C  C     . THR A 1 382 ? 15.097  44.176 46.366 1.00 22.25 ? 382 THR A C     1 
ATOM   2936 O  O     . THR A 1 382 ? 14.570  43.206 45.822 1.00 17.26 ? 382 THR A O     1 
ATOM   2937 C  CB    . THR A 1 382 ? 15.054  43.603 48.792 1.00 30.01 ? 382 THR A CB    1 
ATOM   2938 O  OG1   . THR A 1 382 ? 14.129  44.665 49.062 1.00 32.10 ? 382 THR A OG1   1 
ATOM   2939 C  CG2   . THR A 1 382 ? 15.883  43.325 50.040 1.00 31.71 ? 382 THR A CG2   1 
ATOM   2940 N  N     . PHE A 1 383 ? 14.944  45.425 45.935 1.00 19.41 ? 383 PHE A N     1 
ATOM   2941 C  CA    . PHE A 1 383 ? 14.133  45.726 44.769 1.00 25.99 ? 383 PHE A CA    1 
ATOM   2942 C  C     . PHE A 1 383 ? 14.500  44.840 43.580 1.00 28.35 ? 383 PHE A C     1 
ATOM   2943 O  O     . PHE A 1 383 ? 15.666  44.770 43.183 1.00 30.43 ? 383 PHE A O     1 
ATOM   2944 C  CB    . PHE A 1 383 ? 14.282  47.195 44.371 1.00 30.84 ? 383 PHE A CB    1 
ATOM   2945 C  CG    . PHE A 1 383 ? 13.516  47.562 43.116 1.00 36.27 ? 383 PHE A CG    1 
ATOM   2946 C  CD1   . PHE A 1 383 ? 12.246  48.128 43.199 1.00 33.32 ? 383 PHE A CD1   1 
ATOM   2947 C  CD2   . PHE A 1 383 ? 14.059  47.320 41.852 1.00 34.98 ? 383 PHE A CD2   1 
ATOM   2948 C  CE1   . PHE A 1 383 ? 11.532  48.444 42.055 1.00 29.82 ? 383 PHE A CE1   1 
ATOM   2949 C  CE2   . PHE A 1 383 ? 13.350  47.633 40.705 1.00 31.09 ? 383 PHE A CE2   1 
ATOM   2950 C  CZ    . PHE A 1 383 ? 12.084  48.196 40.808 1.00 33.97 ? 383 PHE A CZ    1 
ATOM   2951 N  N     . GLY A 1 384 ? 13.495  44.175 43.015 1.00 27.55 ? 384 GLY A N     1 
ATOM   2952 C  CA    . GLY A 1 384 ? 13.720  43.312 41.871 1.00 25.43 ? 384 GLY A CA    1 
ATOM   2953 C  C     . GLY A 1 384 ? 14.143  41.900 42.214 1.00 26.04 ? 384 GLY A C     1 
ATOM   2954 O  O     . GLY A 1 384 ? 14.100  41.008 41.358 1.00 28.51 ? 384 GLY A O     1 
ATOM   2955 N  N     . VAL A 1 385 ? 14.541  41.678 43.463 1.00 26.16 ? 385 VAL A N     1 
ATOM   2956 C  CA    . VAL A 1 385 ? 14.967  40.349 43.874 1.00 24.63 ? 385 VAL A CA    1 
ATOM   2957 C  C     . VAL A 1 385 ? 13.811  39.361 43.645 1.00 26.11 ? 385 VAL A C     1 
ATOM   2958 O  O     . VAL A 1 385 ? 12.660  39.590 44.054 1.00 21.11 ? 385 VAL A O     1 
ATOM   2959 C  CB    . VAL A 1 385 ? 15.529  40.327 45.346 1.00 22.53 ? 385 VAL A CB    1 
ATOM   2960 C  CG1   . VAL A 1 385 ? 15.753  38.897 45.822 1.00 19.09 ? 385 VAL A CG1   1 
ATOM   2961 C  CG2   . VAL A 1 385 ? 16.864  41.061 45.405 1.00 17.82 ? 385 VAL A CG2   1 
ATOM   2962 N  N     . LYS A 1 386 ? 14.135  38.317 42.890 1.00 28.27 ? 386 LYS A N     1 
ATOM   2963 C  CA    . LYS A 1 386 ? 13.202  37.268 42.514 1.00 29.71 ? 386 LYS A CA    1 
ATOM   2964 C  C     . LYS A 1 386 ? 13.526  35.962 43.220 1.00 32.37 ? 386 LYS A C     1 
ATOM   2965 O  O     . LYS A 1 386 ? 12.965  34.914 42.895 1.00 32.63 ? 386 LYS A O     1 
ATOM   2966 C  CB    . LYS A 1 386 ? 13.255  37.087 40.996 1.00 26.45 ? 386 LYS A CB    1 
ATOM   2967 C  CG    . LYS A 1 386 ? 12.894  38.345 40.261 1.00 19.38 ? 386 LYS A CG    1 
ATOM   2968 C  CD    . LYS A 1 386 ? 13.258  38.258 38.812 1.00 31.07 ? 386 LYS A CD    1 
ATOM   2969 C  CE    . LYS A 1 386 ? 12.723  39.465 38.040 1.00 36.31 ? 386 LYS A CE    1 
ATOM   2970 N  NZ    . LYS A 1 386 ? 13.103  40.777 38.659 1.00 35.41 ? 386 LYS A NZ    1 
ATOM   2971 N  N     . ASP A 1 387 ? 14.416  36.036 44.205 1.00 36.09 ? 387 ASP A N     1 
ATOM   2972 C  CA    . ASP A 1 387 ? 14.808  34.859 44.970 1.00 38.40 ? 387 ASP A CA    1 
ATOM   2973 C  C     . ASP A 1 387 ? 15.343  35.267 46.346 1.00 36.64 ? 387 ASP A C     1 
ATOM   2974 O  O     . ASP A 1 387 ? 16.094  36.242 46.463 1.00 28.94 ? 387 ASP A O     1 
ATOM   2975 C  CB    . ASP A 1 387 ? 15.862  34.070 44.199 1.00 45.68 ? 387 ASP A CB    1 
ATOM   2976 C  CG    . ASP A 1 387 ? 16.002  32.654 44.699 1.00 52.93 ? 387 ASP A CG    1 
ATOM   2977 O  OD1   . ASP A 1 387 ? 16.872  32.430 45.569 1.00 58.94 ? 387 ASP A OD1   1 
ATOM   2978 O  OD2   . ASP A 1 387 ? 15.237  31.772 44.236 1.00 53.93 ? 387 ASP A OD2   1 
ATOM   2979 N  N     . ARG A 1 388 ? 14.942  34.514 47.372 1.00 36.14 ? 388 ARG A N     1 
ATOM   2980 C  CA    . ARG A 1 388 ? 15.336  34.752 48.767 1.00 36.83 ? 388 ARG A CA    1 
ATOM   2981 C  C     . ARG A 1 388 ? 16.841  34.857 48.993 1.00 37.70 ? 388 ARG A C     1 
ATOM   2982 O  O     . ARG A 1 388 ? 17.292  35.495 49.947 1.00 39.23 ? 388 ARG A O     1 
ATOM   2983 C  CB    . ARG A 1 388 ? 14.810  33.645 49.664 1.00 38.33 ? 388 ARG A CB    1 
ATOM   2984 C  CG    . ARG A 1 388 ? 13.376  33.768 50.076 1.00 43.73 ? 388 ARG A CG    1 
ATOM   2985 C  CD    . ARG A 1 388 ? 12.998  32.518 50.843 1.00 47.41 ? 388 ARG A CD    1 
ATOM   2986 N  NE    . ARG A 1 388 ? 11.727  32.648 51.544 1.00 57.69 ? 388 ARG A NE    1 
ATOM   2987 C  CZ    . ARG A 1 388 ? 11.320  31.701 52.387 1.00 62.47 ? 388 ARG A CZ    1 
ATOM   2988 N  NH1   . ARG A 1 388 ? 12.066  30.619 52.596 1.00 64.93 ? 388 ARG A NH1   1 
ATOM   2989 N  NH2   . ARG A 1 388 ? 10.180  31.847 53.051 1.00 62.17 ? 388 ARG A NH2   1 
ATOM   2990 N  N     . SER A 1 389 ? 17.618  34.204 48.141 1.00 37.13 ? 389 SER A N     1 
ATOM   2991 C  CA    . SER A 1 389 ? 19.062  34.250 48.266 1.00 35.57 ? 389 SER A CA    1 
ATOM   2992 C  C     . SER A 1 389 ? 19.554  35.686 48.110 1.00 36.54 ? 389 SER A C     1 
ATOM   2993 O  O     . SER A 1 389 ? 20.599  36.061 48.653 1.00 43.59 ? 389 SER A O     1 
ATOM   2994 C  CB    . SER A 1 389 ? 19.704  33.328 47.231 1.00 34.23 ? 389 SER A CB    1 
ATOM   2995 O  OG    . SER A 1 389 ? 19.197  32.006 47.370 1.00 32.81 ? 389 SER A OG    1 
ATOM   2996 N  N     . GLY A 1 390 ? 18.783  36.501 47.398 1.00 32.67 ? 390 GLY A N     1 
ATOM   2997 C  CA    . GLY A 1 390 ? 19.170  37.883 47.206 1.00 28.54 ? 390 GLY A CA    1 
ATOM   2998 C  C     . GLY A 1 390 ? 18.692  38.742 48.349 1.00 26.40 ? 390 GLY A C     1 
ATOM   2999 O  O     . GLY A 1 390 ? 18.997  39.935 48.410 1.00 23.77 ? 390 GLY A O     1 
ATOM   3000 N  N     . LEU A 1 391 ? 17.915  38.141 49.245 1.00 27.18 ? 391 LEU A N     1 
ATOM   3001 C  CA    . LEU A 1 391 ? 17.377  38.854 50.398 1.00 28.74 ? 391 LEU A CA    1 
ATOM   3002 C  C     . LEU A 1 391 ? 18.357  38.829 51.579 1.00 30.28 ? 391 LEU A C     1 
ATOM   3003 O  O     . LEU A 1 391 ? 18.920  37.776 51.909 1.00 33.33 ? 391 LEU A O     1 
ATOM   3004 C  CB    . LEU A 1 391 ? 16.036  38.243 50.815 1.00 26.13 ? 391 LEU A CB    1 
ATOM   3005 C  CG    . LEU A 1 391 ? 14.898  38.277 49.792 1.00 20.48 ? 391 LEU A CG    1 
ATOM   3006 C  CD1   . LEU A 1 391 ? 13.709  37.594 50.391 1.00 22.28 ? 391 LEU A CD1   1 
ATOM   3007 C  CD2   . LEU A 1 391 ? 14.538  39.708 49.417 1.00 23.98 ? 391 LEU A CD2   1 
ATOM   3008 N  N     . PRO A 1 392 ? 18.610  40.002 52.198 1.00 30.60 ? 392 PRO A N     1 
ATOM   3009 C  CA    . PRO A 1 392 ? 19.527  40.086 53.338 1.00 30.38 ? 392 PRO A CA    1 
ATOM   3010 C  C     . PRO A 1 392 ? 18.942  39.394 54.576 1.00 32.21 ? 392 PRO A C     1 
ATOM   3011 O  O     . PRO A 1 392 ? 17.723  39.231 54.686 1.00 34.26 ? 392 PRO A O     1 
ATOM   3012 C  CB    . PRO A 1 392 ? 19.692  41.600 53.526 1.00 29.88 ? 392 PRO A CB    1 
ATOM   3013 C  CG    . PRO A 1 392 ? 18.393  42.161 53.034 1.00 27.16 ? 392 PRO A CG    1 
ATOM   3014 C  CD    . PRO A 1 392 ? 18.129  41.343 51.806 1.00 31.01 ? 392 PRO A CD    1 
ATOM   3015 N  N     . GLN A 1 393 ? 19.807  39.031 55.521 1.00 31.44 ? 393 GLN A N     1 
ATOM   3016 C  CA    . GLN A 1 393 ? 19.396  38.337 56.744 1.00 28.99 ? 393 GLN A CA    1 
ATOM   3017 C  C     . GLN A 1 393 ? 18.367  39.069 57.597 1.00 25.93 ? 393 GLN A C     1 
ATOM   3018 O  O     . GLN A 1 393 ? 17.512  38.445 58.217 1.00 26.12 ? 393 GLN A O     1 
ATOM   3019 C  CB    . GLN A 1 393 ? 20.613  38.000 57.595 1.00 32.92 ? 393 GLN A CB    1 
ATOM   3020 C  CG    . GLN A 1 393 ? 20.296  37.078 58.735 1.00 30.54 ? 393 GLN A CG    1 
ATOM   3021 C  CD    . GLN A 1 393 ? 19.638  35.815 58.268 1.00 32.57 ? 393 GLN A CD    1 
ATOM   3022 O  OE1   . GLN A 1 393 ? 18.604  35.405 58.801 1.00 34.75 ? 393 GLN A OE1   1 
ATOM   3023 N  NE2   . GLN A 1 393 ? 20.220  35.189 57.249 1.00 32.81 ? 393 GLN A NE2   1 
ATOM   3024 N  N     . ALA A 1 394 ? 18.451  40.391 57.629 1.00 24.05 ? 394 ALA A N     1 
ATOM   3025 C  CA    . ALA A 1 394 ? 17.500  41.190 58.387 1.00 24.77 ? 394 ALA A CA    1 
ATOM   3026 C  C     . ALA A 1 394 ? 16.126  40.959 57.762 1.00 27.52 ? 394 ALA A C     1 
ATOM   3027 O  O     . ALA A 1 394 ? 15.196  40.512 58.445 1.00 28.84 ? 394 ALA A O     1 
ATOM   3028 C  CB    . ALA A 1 394 ? 17.881  42.656 58.329 1.00 18.67 ? 394 ALA A CB    1 
ATOM   3029 N  N     . ALA A 1 395 ? 16.048  41.170 56.444 1.00 28.95 ? 395 ALA A N     1 
ATOM   3030 C  CA    . ALA A 1 395 ? 14.825  40.978 55.658 1.00 27.84 ? 395 ALA A CA    1 
ATOM   3031 C  C     . ALA A 1 395 ? 14.222  39.596 55.909 1.00 27.15 ? 395 ALA A C     1 
ATOM   3032 O  O     . ALA A 1 395 ? 13.018  39.469 56.167 1.00 30.08 ? 395 ALA A O     1 
ATOM   3033 C  CB    . ALA A 1 395 ? 15.116  41.165 54.175 1.00 28.77 ? 395 ALA A CB    1 
ATOM   3034 N  N     . LEU A 1 396 ? 15.050  38.560 55.831 1.00 24.63 ? 396 LEU A N     1 
ATOM   3035 C  CA    . LEU A 1 396 ? 14.585  37.201 56.104 1.00 25.43 ? 396 LEU A CA    1 
ATOM   3036 C  C     . LEU A 1 396 ? 14.075  37.073 57.541 1.00 25.45 ? 396 LEU A C     1 
ATOM   3037 O  O     . LEU A 1 396 ? 13.111  36.359 57.797 1.00 25.81 ? 396 LEU A O     1 
ATOM   3038 C  CB    . LEU A 1 396 ? 15.697  36.186 55.865 1.00 25.14 ? 396 LEU A CB    1 
ATOM   3039 C  CG    . LEU A 1 396 ? 16.015  35.923 54.393 1.00 25.42 ? 396 LEU A CG    1 
ATOM   3040 C  CD1   . LEU A 1 396 ? 17.127  34.883 54.300 1.00 16.10 ? 396 LEU A CD1   1 
ATOM   3041 C  CD2   . LEU A 1 396 ? 14.747  35.461 53.667 1.00 17.35 ? 396 LEU A CD2   1 
ATOM   3042 N  N     . ASN A 1 397 ? 14.712  37.766 58.479 1.00 27.48 ? 397 ASN A N     1 
ATOM   3043 C  CA    . ASN A 1 397 ? 14.264  37.718 59.872 1.00 28.74 ? 397 ASN A CA    1 
ATOM   3044 C  C     . ASN A 1 397 ? 12.883  38.359 60.005 1.00 23.95 ? 397 ASN A C     1 
ATOM   3045 O  O     . ASN A 1 397 ? 11.984  37.785 60.609 1.00 24.45 ? 397 ASN A O     1 
ATOM   3046 C  CB    . ASN A 1 397 ? 15.272  38.410 60.803 1.00 30.37 ? 397 ASN A CB    1 
ATOM   3047 C  CG    . ASN A 1 397 ? 16.604  37.661 60.905 1.00 30.93 ? 397 ASN A CG    1 
ATOM   3048 O  OD1   . ASN A 1 397 ? 17.608  38.232 61.337 1.00 30.43 ? 397 ASN A OD1   1 
ATOM   3049 N  ND2   . ASN A 1 397 ? 16.614  36.386 60.531 1.00 23.38 ? 397 ASN A ND2   1 
ATOM   3050 N  N     . TYR A 1 398 ? 12.717  39.535 59.413 1.00 23.37 ? 398 TYR A N     1 
ATOM   3051 C  CA    . TYR A 1 398 ? 11.440  40.264 59.431 1.00 24.58 ? 398 TYR A CA    1 
ATOM   3052 C  C     . TYR A 1 398 ? 10.342  39.318 58.947 1.00 25.58 ? 398 TYR A C     1 
ATOM   3053 O  O     . TYR A 1 398 ? 9.336   39.085 59.640 1.00 23.71 ? 398 TYR A O     1 
ATOM   3054 C  CB    . TYR A 1 398 ? 11.547  41.458 58.489 1.00 21.68 ? 398 TYR A CB    1 
ATOM   3055 C  CG    . TYR A 1 398 ? 10.379  42.403 58.493 1.00 20.76 ? 398 TYR A CG    1 
ATOM   3056 C  CD1   . TYR A 1 398 ? 10.124  43.210 59.586 1.00 20.98 ? 398 TYR A CD1   1 
ATOM   3057 C  CD2   . TYR A 1 398 ? 9.588   42.567 57.352 1.00 22.28 ? 398 TYR A CD2   1 
ATOM   3058 C  CE1   . TYR A 1 398 ? 9.129   44.164 59.547 1.00 21.47 ? 398 TYR A CE1   1 
ATOM   3059 C  CE2   . TYR A 1 398 ? 8.587   43.517 57.305 1.00 20.22 ? 398 TYR A CE2   1 
ATOM   3060 C  CZ    . TYR A 1 398 ? 8.362   44.322 58.407 1.00 21.05 ? 398 TYR A CZ    1 
ATOM   3061 O  OH    . TYR A 1 398 ? 7.395   45.314 58.379 1.00 18.78 ? 398 TYR A OH    1 
ATOM   3062 N  N     . ILE A 1 399 ? 10.572  38.749 57.764 1.00 25.34 ? 399 ILE A N     1 
ATOM   3063 C  CA    . ILE A 1 399 ? 9.647   37.792 57.160 1.00 28.74 ? 399 ILE A CA    1 
ATOM   3064 C  C     . ILE A 1 399 ? 9.329   36.677 58.168 1.00 28.71 ? 399 ILE A C     1 
ATOM   3065 O  O     . ILE A 1 399 ? 8.166   36.435 58.501 1.00 28.40 ? 399 ILE A O     1 
ATOM   3066 C  CB    . ILE A 1 399 ? 10.262  37.167 55.861 1.00 26.77 ? 399 ILE A CB    1 
ATOM   3067 C  CG1   . ILE A 1 399 ? 10.309  38.209 54.741 1.00 31.06 ? 399 ILE A CG1   1 
ATOM   3068 C  CG2   . ILE A 1 399 ? 9.484   35.946 55.418 1.00 21.19 ? 399 ILE A CG2   1 
ATOM   3069 C  CD1   . ILE A 1 399 ? 11.025  37.733 53.493 1.00 32.02 ? 399 ILE A CD1   1 
ATOM   3070 N  N     . LYS A 1 400 ? 10.380  36.030 58.662 1.00 28.34 ? 400 LYS A N     1 
ATOM   3071 C  CA    . LYS A 1 400 ? 10.267  34.943 59.621 1.00 28.07 ? 400 LYS A CA    1 
ATOM   3072 C  C     . LYS A 1 400 ? 9.513   35.360 60.894 1.00 28.73 ? 400 LYS A C     1 
ATOM   3073 O  O     . LYS A 1 400 ? 8.635   34.626 61.379 1.00 25.37 ? 400 LYS A O     1 
ATOM   3074 C  CB    . LYS A 1 400 ? 11.677  34.416 59.931 1.00 27.04 ? 400 LYS A CB    1 
ATOM   3075 C  CG    . LYS A 1 400 ? 11.768  33.294 60.953 1.00 29.41 ? 400 LYS A CG    1 
ATOM   3076 C  CD    . LYS A 1 400 ? 10.714  32.239 60.750 1.00 24.97 ? 400 LYS A CD    1 
ATOM   3077 C  CE    . LYS A 1 400 ? 10.850  31.164 61.794 1.00 31.64 ? 400 LYS A CE    1 
ATOM   3078 N  NZ    . LYS A 1 400 ? 9.613   30.337 61.905 1.00 39.46 ? 400 LYS A NZ    1 
ATOM   3079 N  N     . ARG A 1 401 ? 9.812   36.549 61.409 1.00 28.69 ? 401 ARG A N     1 
ATOM   3080 C  CA    . ARG A 1 401 ? 9.139   37.021 62.618 1.00 32.15 ? 401 ARG A CA    1 
ATOM   3081 C  C     . ARG A 1 401 ? 7.624   37.194 62.397 1.00 32.27 ? 401 ARG A C     1 
ATOM   3082 O  O     . ARG A 1 401 ? 6.817   36.882 63.290 1.00 33.87 ? 401 ARG A O     1 
ATOM   3083 C  CB    . ARG A 1 401 ? 9.781   38.317 63.132 1.00 31.27 ? 401 ARG A CB    1 
ATOM   3084 C  CG    . ARG A 1 401 ? 9.279   38.756 64.500 1.00 33.05 ? 401 ARG A CG    1 
ATOM   3085 C  CD    . ARG A 1 401 ? 9.529   37.683 65.549 1.00 34.08 ? 401 ARG A CD    1 
ATOM   3086 N  NE    . ARG A 1 401 ? 8.926   38.019 66.838 1.00 32.84 ? 401 ARG A NE    1 
ATOM   3087 C  CZ    . ARG A 1 401 ? 8.409   37.079 67.627 1.00 32.19 ? 401 ARG A CZ    1 
ATOM   3088 N  NH1   . ARG A 1 401 ? 8.434   35.802 67.262 1.00 33.04 ? 401 ARG A NH1   1 
ATOM   3089 N  NH2   . ARG A 1 401 ? 7.837   37.421 68.775 1.00 30.64 ? 401 ARG A NH2   1 
ATOM   3090 N  N     . ILE A 1 402 ? 7.244   37.673 61.208 1.00 28.19 ? 402 ILE A N     1 
ATOM   3091 C  CA    . ILE A 1 402 ? 5.831   37.866 60.842 1.00 20.89 ? 402 ILE A CA    1 
ATOM   3092 C  C     . ILE A 1 402 ? 5.086   36.527 60.827 1.00 22.38 ? 402 ILE A C     1 
ATOM   3093 O  O     . ILE A 1 402 ? 3.932   36.418 61.277 1.00 16.19 ? 402 ILE A O     1 
ATOM   3094 C  CB    . ILE A 1 402 ? 5.723   38.533 59.467 1.00 18.54 ? 402 ILE A CB    1 
ATOM   3095 C  CG1   . ILE A 1 402 ? 6.346   39.927 59.530 1.00 11.35 ? 402 ILE A CG1   1 
ATOM   3096 C  CG2   . ILE A 1 402 ? 4.270   38.599 59.008 1.00 18.46 ? 402 ILE A CG2   1 
ATOM   3097 C  CD1   . ILE A 1 402 ? 6.494   40.576 58.198 1.00 14.54 ? 402 ILE A CD1   1 
ATOM   3098 N  N     . GLU A 1 403 ? 5.749   35.511 60.284 1.00 22.89 ? 403 GLU A N     1 
ATOM   3099 C  CA    . GLU A 1 403 ? 5.182   34.181 60.248 1.00 24.23 ? 403 GLU A CA    1 
ATOM   3100 C  C     . GLU A 1 403 ? 4.985   33.742 61.703 1.00 26.34 ? 403 GLU A C     1 
ATOM   3101 O  O     . GLU A 1 403 ? 3.889   33.320 62.087 1.00 25.11 ? 403 GLU A O     1 
ATOM   3102 C  CB    . GLU A 1 403 ? 6.107   33.223 59.491 1.00 22.31 ? 403 GLU A CB    1 
ATOM   3103 C  CG    . GLU A 1 403 ? 6.372   33.647 58.038 1.00 20.86 ? 403 GLU A CG    1 
ATOM   3104 C  CD    . GLU A 1 403 ? 7.248   32.658 57.270 1.00 19.74 ? 403 GLU A CD    1 
ATOM   3105 O  OE1   . GLU A 1 403 ? 8.453   32.530 57.596 1.00 14.35 ? 403 GLU A OE1   1 
ATOM   3106 O  OE2   . GLU A 1 403 ? 6.727   32.004 56.338 1.00 16.18 ? 403 GLU A OE2   1 
ATOM   3107 N  N     . GLU A 1 404 ? 6.016   33.916 62.530 1.00 29.76 ? 404 GLU A N     1 
ATOM   3108 C  CA    . GLU A 1 404 ? 5.924   33.548 63.955 1.00 31.31 ? 404 GLU A CA    1 
ATOM   3109 C  C     . GLU A 1 404 ? 4.776   34.260 64.681 1.00 28.57 ? 404 GLU A C     1 
ATOM   3110 O  O     . GLU A 1 404 ? 4.038   33.634 65.444 1.00 28.53 ? 404 GLU A O     1 
ATOM   3111 C  CB    . GLU A 1 404 ? 7.240   33.833 64.681 1.00 33.03 ? 404 GLU A CB    1 
ATOM   3112 C  CG    . GLU A 1 404 ? 8.386   32.899 64.310 1.00 34.93 ? 404 GLU A CG    1 
ATOM   3113 C  CD    . GLU A 1 404 ? 9.747   33.516 64.588 1.00 37.00 ? 404 GLU A CD    1 
ATOM   3114 O  OE1   . GLU A 1 404 ? 9.801   34.727 64.878 1.00 40.64 ? 404 GLU A OE1   1 
ATOM   3115 O  OE2   . GLU A 1 404 ? 10.767  32.802 64.502 1.00 37.62 ? 404 GLU A OE2   1 
ATOM   3116 N  N     . LEU A 1 405 ? 4.656   35.566 64.459 1.00 23.31 ? 405 LEU A N     1 
ATOM   3117 C  CA    . LEU A 1 405 ? 3.601   36.370 65.065 1.00 24.48 ? 405 LEU A CA    1 
ATOM   3118 C  C     . LEU A 1 405 ? 2.176   36.032 64.596 1.00 27.98 ? 405 LEU A C     1 
ATOM   3119 O  O     . LEU A 1 405 ? 1.224   36.066 65.394 1.00 27.49 ? 405 LEU A O     1 
ATOM   3120 C  CB    . LEU A 1 405 ? 3.876   37.847 64.818 1.00 21.31 ? 405 LEU A CB    1 
ATOM   3121 C  CG    . LEU A 1 405 ? 5.078   38.437 65.554 1.00 23.65 ? 405 LEU A CG    1 
ATOM   3122 C  CD1   . LEU A 1 405 ? 5.317   39.846 65.055 1.00 22.45 ? 405 LEU A CD1   1 
ATOM   3123 C  CD2   . LEU A 1 405 ? 4.832   38.431 67.072 1.00 20.82 ? 405 LEU A CD2   1 
ATOM   3124 N  N     . THR A 1 406 ? 2.028   35.733 63.304 1.00 27.29 ? 406 THR A N     1 
ATOM   3125 C  CA    . THR A 1 406 ? 0.721   35.395 62.716 1.00 20.94 ? 406 THR A CA    1 
ATOM   3126 C  C     . THR A 1 406 ? 0.388   33.903 62.688 1.00 18.81 ? 406 THR A C     1 
ATOM   3127 O  O     . THR A 1 406 ? -0.780  33.522 62.814 1.00 20.33 ? 406 THR A O     1 
ATOM   3128 C  CB    . THR A 1 406 ? 0.619   35.909 61.263 1.00 20.51 ? 406 THR A CB    1 
ATOM   3129 O  OG1   . THR A 1 406 ? 1.743   35.429 60.521 1.00 23.06 ? 406 THR A OG1   1 
ATOM   3130 C  CG2   . THR A 1 406 ? 0.620   37.430 61.211 1.00 14.14 ? 406 THR A CG2   1 
ATOM   3131 N  N     . GLY A 1 407 ? 1.402   33.060 62.487 1.00 19.15 ? 407 GLY A N     1 
ATOM   3132 C  CA    . GLY A 1 407 ? 1.174   31.625 62.404 1.00 14.35 ? 407 GLY A CA    1 
ATOM   3133 C  C     . GLY A 1 407 ? 0.753   31.229 60.994 1.00 15.04 ? 407 GLY A C     1 
ATOM   3134 O  O     . GLY A 1 407 ? 0.330   30.101 60.741 1.00 11.55 ? 407 GLY A O     1 
ATOM   3135 N  N     . VAL A 1 408 ? 0.865   32.181 60.071 1.00 20.59 ? 408 VAL A N     1 
ATOM   3136 C  CA    . VAL A 1 408 ? 0.523   31.990 58.663 1.00 17.56 ? 408 VAL A CA    1 
ATOM   3137 C  C     . VAL A 1 408 ? 1.780   32.261 57.828 1.00 17.32 ? 408 VAL A C     1 
ATOM   3138 O  O     . VAL A 1 408 ? 2.481   33.263 58.043 1.00 15.02 ? 408 VAL A O     1 
ATOM   3139 C  CB    . VAL A 1 408 ? -0.627  32.958 58.239 1.00 21.27 ? 408 VAL A CB    1 
ATOM   3140 C  CG1   . VAL A 1 408 ? -0.866  32.915 56.723 1.00 16.05 ? 408 VAL A CG1   1 
ATOM   3141 C  CG2   . VAL A 1 408 ? -1.913  32.591 58.991 1.00 16.12 ? 408 VAL A CG2   1 
ATOM   3142 N  N     . PRO A 1 409 ? 2.113   31.341 56.902 1.00 17.61 ? 409 PRO A N     1 
ATOM   3143 C  CA    . PRO A 1 409 ? 3.289   31.476 56.033 1.00 14.72 ? 409 PRO A CA    1 
ATOM   3144 C  C     . PRO A 1 409 ? 3.174   32.484 54.869 1.00 15.60 ? 409 PRO A C     1 
ATOM   3145 O  O     . PRO A 1 409 ? 2.090   32.749 54.318 1.00 5.01  ? 409 PRO A O     1 
ATOM   3146 C  CB    . PRO A 1 409 ? 3.477   30.062 55.510 1.00 15.74 ? 409 PRO A CB    1 
ATOM   3147 C  CG    . PRO A 1 409 ? 2.054   29.603 55.359 1.00 18.15 ? 409 PRO A CG    1 
ATOM   3148 C  CD    . PRO A 1 409 ? 1.429   30.057 56.658 1.00 16.41 ? 409 PRO A CD    1 
ATOM   3149 N  N     . ILE A 1 410 ? 4.333   33.023 54.503 1.00 16.63 ? 410 ILE A N     1 
ATOM   3150 C  CA    . ILE A 1 410 ? 4.468   33.981 53.421 1.00 16.11 ? 410 ILE A CA    1 
ATOM   3151 C  C     . ILE A 1 410 ? 4.904   33.181 52.204 1.00 18.91 ? 410 ILE A C     1 
ATOM   3152 O  O     . ILE A 1 410 ? 6.084   32.902 52.010 1.00 18.62 ? 410 ILE A O     1 
ATOM   3153 C  CB    . ILE A 1 410 ? 5.488   35.063 53.770 1.00 13.03 ? 410 ILE A CB    1 
ATOM   3154 C  CG1   . ILE A 1 410 ? 4.919   35.924 54.906 1.00 16.25 ? 410 ILE A CG1   1 
ATOM   3155 C  CG2   . ILE A 1 410 ? 5.847   35.881 52.532 1.00 11.24 ? 410 ILE A CG2   1 
ATOM   3156 C  CD1   . ILE A 1 410 ? 5.804   37.061 55.345 1.00 18.07 ? 410 ILE A CD1   1 
ATOM   3157 N  N     . ASP A 1 411 ? 3.904   32.762 51.432 1.00 21.22 ? 411 ASP A N     1 
ATOM   3158 C  CA    . ASP A 1 411 ? 4.093   31.964 50.238 1.00 16.73 ? 411 ASP A CA    1 
ATOM   3159 C  C     . ASP A 1 411 ? 4.567   32.750 49.041 1.00 13.41 ? 411 ASP A C     1 
ATOM   3160 O  O     . ASP A 1 411 ? 5.160   32.167 48.135 1.00 14.03 ? 411 ASP A O     1 
ATOM   3161 C  CB    . ASP A 1 411 ? 2.807   31.204 49.912 1.00 17.58 ? 411 ASP A CB    1 
ATOM   3162 C  CG    . ASP A 1 411 ? 2.506   30.109 50.925 1.00 21.67 ? 411 ASP A CG    1 
ATOM   3163 O  OD1   . ASP A 1 411 ? 3.336   29.851 51.836 1.00 18.19 ? 411 ASP A OD1   1 
ATOM   3164 O  OD2   . ASP A 1 411 ? 1.441   29.483 50.802 1.00 24.82 ? 411 ASP A OD2   1 
ATOM   3165 N  N     . ILE A 1 412 ? 4.333   34.062 49.040 1.00 8.76  ? 412 ILE A N     1 
ATOM   3166 C  CA    . ILE A 1 412 ? 4.758   34.916 47.936 1.00 8.80  ? 412 ILE A CA    1 
ATOM   3167 C  C     . ILE A 1 412 ? 5.400   36.196 48.457 1.00 6.91  ? 412 ILE A C     1 
ATOM   3168 O  O     . ILE A 1 412 ? 4.878   36.822 49.372 1.00 17.69 ? 412 ILE A O     1 
ATOM   3169 C  CB    . ILE A 1 412 ? 3.546   35.330 47.024 1.00 12.49 ? 412 ILE A CB    1 
ATOM   3170 C  CG1   . ILE A 1 412 ? 2.876   34.111 46.388 1.00 9.66  ? 412 ILE A CG1   1 
ATOM   3171 C  CG2   . ILE A 1 412 ? 4.002   36.287 45.905 1.00 15.31 ? 412 ILE A CG2   1 
ATOM   3172 C  CD1   . ILE A 1 412 ? 1.635   34.463 45.560 1.00 5.33  ? 412 ILE A CD1   1 
ATOM   3173 N  N     . ILE A 1 413 ? 6.520   36.602 47.876 1.00 7.78  ? 413 ILE A N     1 
ATOM   3174 C  CA    . ILE A 1 413 ? 7.175   37.841 48.294 1.00 11.35 ? 413 ILE A CA    1 
ATOM   3175 C  C     . ILE A 1 413 ? 7.288   38.761 47.083 1.00 14.23 ? 413 ILE A C     1 
ATOM   3176 O  O     . ILE A 1 413 ? 7.762   38.341 46.023 1.00 14.94 ? 413 ILE A O     1 
ATOM   3177 C  CB    . ILE A 1 413 ? 8.605   37.613 48.857 1.00 9.90  ? 413 ILE A CB    1 
ATOM   3178 C  CG1   . ILE A 1 413 ? 8.565   36.676 50.068 1.00 16.15 ? 413 ILE A CG1   1 
ATOM   3179 C  CG2   . ILE A 1 413 ? 9.206   38.934 49.293 1.00 5.01  ? 413 ILE A CG2   1 
ATOM   3180 C  CD1   . ILE A 1 413 ? 9.927   36.135 50.486 1.00 20.72 ? 413 ILE A CD1   1 
ATOM   3181 N  N     . SER A 1 414 ? 6.847   40.005 47.241 1.00 14.18 ? 414 SER A N     1 
ATOM   3182 C  CA    . SER A 1 414 ? 6.913   40.982 46.174 1.00 13.17 ? 414 SER A CA    1 
ATOM   3183 C  C     . SER A 1 414 ? 7.966   42.055 46.464 1.00 16.01 ? 414 SER A C     1 
ATOM   3184 O  O     . SER A 1 414 ? 7.891   42.763 47.463 1.00 11.93 ? 414 SER A O     1 
ATOM   3185 C  CB    . SER A 1 414 ? 5.538   41.592 45.947 1.00 13.83 ? 414 SER A CB    1 
ATOM   3186 O  OG    . SER A 1 414 ? 5.597   42.635 44.997 1.00 16.42 ? 414 SER A OG    1 
ATOM   3187 N  N     . THR A 1 415 ? 8.907   42.210 45.532 1.00 21.91 ? 415 THR A N     1 
ATOM   3188 C  CA    . THR A 1 415 ? 10.010  43.162 45.659 1.00 20.81 ? 415 THR A CA    1 
ATOM   3189 C  C     . THR A 1 415 ? 10.001  44.337 44.656 1.00 21.11 ? 415 THR A C     1 
ATOM   3190 O  O     . THR A 1 415 ? 10.996  45.057 44.508 1.00 22.37 ? 415 THR A O     1 
ATOM   3191 C  CB    . THR A 1 415 ? 11.331  42.411 45.560 1.00 24.28 ? 415 THR A CB    1 
ATOM   3192 O  OG1   . THR A 1 415 ? 11.345  41.660 44.335 1.00 31.00 ? 415 THR A OG1   1 
ATOM   3193 C  CG2   . THR A 1 415 ? 11.484  41.453 46.756 1.00 24.98 ? 415 THR A CG2   1 
ATOM   3194 N  N     . GLY A 1 416 ? 8.868   44.557 43.995 1.00 20.56 ? 416 GLY A N     1 
ATOM   3195 C  CA    . GLY A 1 416 ? 8.761   45.650 43.049 1.00 13.03 ? 416 GLY A CA    1 
ATOM   3196 C  C     . GLY A 1 416 ? 7.390   45.639 42.412 1.00 13.56 ? 416 GLY A C     1 
ATOM   3197 O  O     . GLY A 1 416 ? 6.661   44.642 42.534 1.00 11.70 ? 416 GLY A O     1 
ATOM   3198 N  N     . PRO A 1 417 ? 6.990   46.739 41.747 1.00 12.09 ? 417 PRO A N     1 
ATOM   3199 C  CA    . PRO A 1 417 ? 5.678   46.831 41.093 1.00 15.40 ? 417 PRO A CA    1 
ATOM   3200 C  C     . PRO A 1 417 ? 5.459   45.944 39.858 1.00 21.20 ? 417 PRO A C     1 
ATOM   3201 O  O     . PRO A 1 417 ? 4.369   45.382 39.682 1.00 28.99 ? 417 PRO A O     1 
ATOM   3202 C  CB    . PRO A 1 417 ? 5.554   48.324 40.757 1.00 12.26 ? 417 PRO A CB    1 
ATOM   3203 C  CG    . PRO A 1 417 ? 6.957   48.789 40.631 1.00 13.95 ? 417 PRO A CG    1 
ATOM   3204 C  CD    . PRO A 1 417 ? 7.683   48.040 41.735 1.00 13.09 ? 417 PRO A CD    1 
ATOM   3205 N  N     . ASP A 1 418 ? 6.488   45.784 39.028 1.00 22.71 ? 418 ASP A N     1 
ATOM   3206 C  CA    . ASP A 1 418 ? 6.365   44.994 37.810 1.00 22.11 ? 418 ASP A CA    1 
ATOM   3207 C  C     . ASP A 1 418 ? 5.967   43.571 38.128 1.00 24.30 ? 418 ASP A C     1 
ATOM   3208 O  O     . ASP A 1 418 ? 6.350   43.016 39.162 1.00 26.47 ? 418 ASP A O     1 
ATOM   3209 C  CB    . ASP A 1 418 ? 7.675   44.996 37.009 1.00 24.61 ? 418 ASP A CB    1 
ATOM   3210 C  CG    . ASP A 1 418 ? 7.453   44.778 35.504 1.00 22.77 ? 418 ASP A CG    1 
ATOM   3211 O  OD1   . ASP A 1 418 ? 7.375   43.610 35.061 1.00 18.88 ? 418 ASP A OD1   1 
ATOM   3212 O  OD2   . ASP A 1 418 ? 7.359   45.784 34.766 1.00 20.63 ? 418 ASP A OD2   1 
ATOM   3213 N  N     . ARG A 1 419 ? 5.199   42.992 37.215 1.00 25.25 ? 419 ARG A N     1 
ATOM   3214 C  CA    . ARG A 1 419 ? 4.701   41.632 37.323 1.00 22.03 ? 419 ARG A CA    1 
ATOM   3215 C  C     . ARG A 1 419 ? 5.746   40.589 37.748 1.00 23.78 ? 419 ARG A C     1 
ATOM   3216 O  O     . ARG A 1 419 ? 5.481   39.762 38.621 1.00 25.96 ? 419 ARG A O     1 
ATOM   3217 C  CB    . ARG A 1 419 ? 4.038   41.236 35.993 1.00 18.08 ? 419 ARG A CB    1 
ATOM   3218 C  CG    . ARG A 1 419 ? 3.623   39.771 35.890 1.00 20.47 ? 419 ARG A CG    1 
ATOM   3219 C  CD    . ARG A 1 419 ? 3.274   39.388 34.457 1.00 20.74 ? 419 ARG A CD    1 
ATOM   3220 N  NE    . ARG A 1 419 ? 1.958   39.875 34.060 1.00 25.33 ? 419 ARG A NE    1 
ATOM   3221 C  CZ    . ARG A 1 419 ? 1.510   39.776 32.808 1.00 24.57 ? 419 ARG A CZ    1 
ATOM   3222 N  NH1   . ARG A 1 419 ? 2.252   39.229 31.849 1.00 15.47 ? 419 ARG A NH1   1 
ATOM   3223 N  NH2   . ARG A 1 419 ? 0.287   40.209 32.526 1.00 23.22 ? 419 ARG A NH2   1 
ATOM   3224 N  N     . THR A 1 420 ? 6.948   40.661 37.192 1.00 24.37 ? 420 THR A N     1 
ATOM   3225 C  CA    . THR A 1 420 ? 7.961   39.664 37.515 1.00 23.60 ? 420 THR A CA    1 
ATOM   3226 C  C     . THR A 1 420 ? 8.896   39.942 38.687 1.00 23.31 ? 420 THR A C     1 
ATOM   3227 O  O     . THR A 1 420 ? 9.718   39.091 39.024 1.00 23.46 ? 420 THR A O     1 
ATOM   3228 C  CB    . THR A 1 420 ? 8.781   39.312 36.280 1.00 26.66 ? 420 THR A CB    1 
ATOM   3229 O  OG1   . THR A 1 420 ? 9.376   40.506 35.751 1.00 28.63 ? 420 THR A OG1   1 
ATOM   3230 C  CG2   . THR A 1 420 ? 7.873   38.686 35.228 1.00 27.89 ? 420 THR A CG2   1 
ATOM   3231 N  N     . GLU A 1 421 ? 8.804   41.130 39.284 1.00 21.59 ? 421 GLU A N     1 
ATOM   3232 C  CA    . GLU A 1 421 ? 9.620   41.484 40.454 1.00 19.98 ? 421 GLU A CA    1 
ATOM   3233 C  C     . GLU A 1 421 ? 8.904   40.846 41.669 1.00 20.27 ? 421 GLU A C     1 
ATOM   3234 O  O     . GLU A 1 421 ? 8.475   41.511 42.607 1.00 17.91 ? 421 GLU A O     1 
ATOM   3235 C  CB    . GLU A 1 421 ? 9.720   43.013 40.566 1.00 17.96 ? 421 GLU A CB    1 
ATOM   3236 C  CG    . GLU A 1 421 ? 10.544  43.629 39.432 1.00 9.15  ? 421 GLU A CG    1 
ATOM   3237 C  CD    . GLU A 1 421 ? 10.378  45.128 39.297 1.00 14.20 ? 421 GLU A CD    1 
ATOM   3238 O  OE1   . GLU A 1 421 ? 9.392   45.688 39.813 1.00 15.16 ? 421 GLU A OE1   1 
ATOM   3239 O  OE2   . GLU A 1 421 ? 11.224  45.759 38.637 1.00 14.75 ? 421 GLU A OE2   1 
ATOM   3240 N  N     . THR A 1 422 ? 8.809   39.524 41.625 1.00 20.83 ? 422 THR A N     1 
ATOM   3241 C  CA    . THR A 1 422 ? 8.099   38.760 42.626 1.00 21.05 ? 422 THR A CA    1 
ATOM   3242 C  C     . THR A 1 422 ? 8.782   37.404 42.850 1.00 20.90 ? 422 THR A C     1 
ATOM   3243 O  O     . THR A 1 422 ? 9.437   36.861 41.954 1.00 19.73 ? 422 THR A O     1 
ATOM   3244 C  CB    . THR A 1 422 ? 6.632   38.532 42.131 1.00 24.13 ? 422 THR A CB    1 
ATOM   3245 O  OG1   . THR A 1 422 ? 6.094   39.778 41.667 1.00 21.10 ? 422 THR A OG1   1 
ATOM   3246 C  CG2   . THR A 1 422 ? 5.736   37.981 43.257 1.00 22.01 ? 422 THR A CG2   1 
ATOM   3247 N  N     . MET A 1 423 ? 8.569   36.853 44.039 1.00 17.17 ? 423 MET A N     1 
ATOM   3248 C  CA    . MET A 1 423 ? 9.127   35.580 44.469 1.00 16.90 ? 423 MET A CA    1 
ATOM   3249 C  C     . MET A 1 423 ? 7.962   34.675 44.838 1.00 16.63 ? 423 MET A C     1 
ATOM   3250 O  O     . MET A 1 423 ? 7.230   34.992 45.768 1.00 21.11 ? 423 MET A O     1 
ATOM   3251 C  CB    . MET A 1 423 ? 9.896   35.863 45.747 1.00 25.84 ? 423 MET A CB    1 
ATOM   3252 C  CG    . MET A 1 423 ? 11.180  35.150 45.973 1.00 30.01 ? 423 MET A CG    1 
ATOM   3253 S  SD    . MET A 1 423 ? 11.968  36.026 47.354 1.00 32.11 ? 423 MET A SD    1 
ATOM   3254 C  CE    . MET A 1 423 ? 12.091  37.701 46.671 1.00 29.93 ? 423 MET A CE    1 
ATOM   3255 N  N     . ILE A 1 424 ? 7.756   33.573 44.124 1.00 17.91 ? 424 ILE A N     1 
ATOM   3256 C  CA    . ILE A 1 424 ? 6.669   32.660 44.481 1.00 15.05 ? 424 ILE A CA    1 
ATOM   3257 C  C     . ILE A 1 424 ? 7.288   31.443 45.136 1.00 15.45 ? 424 ILE A C     1 
ATOM   3258 O  O     . ILE A 1 424 ? 7.924   30.638 44.478 1.00 18.71 ? 424 ILE A O     1 
ATOM   3259 C  CB    . ILE A 1 424 ? 5.847   32.182 43.280 1.00 12.12 ? 424 ILE A CB    1 
ATOM   3260 C  CG1   . ILE A 1 424 ? 5.122   33.345 42.616 1.00 11.28 ? 424 ILE A CG1   1 
ATOM   3261 C  CG2   . ILE A 1 424 ? 4.821   31.161 43.739 1.00 7.47  ? 424 ILE A CG2   1 
ATOM   3262 C  CD1   . ILE A 1 424 ? 4.336   32.907 41.393 1.00 17.06 ? 424 ILE A CD1   1 
ATOM   3263 N  N     . LEU A 1 425 ? 7.087   31.303 46.435 1.00 15.51 ? 425 LEU A N     1 
ATOM   3264 C  CA    . LEU A 1 425 ? 7.661   30.193 47.169 1.00 11.48 ? 425 LEU A CA    1 
ATOM   3265 C  C     . LEU A 1 425 ? 6.688   29.037 47.111 1.00 14.41 ? 425 LEU A C     1 
ATOM   3266 O  O     . LEU A 1 425 ? 7.079   27.874 46.985 1.00 16.59 ? 425 LEU A O     1 
ATOM   3267 C  CB    . LEU A 1 425 ? 7.948   30.641 48.598 1.00 12.43 ? 425 LEU A CB    1 
ATOM   3268 C  CG    . LEU A 1 425 ? 8.750   31.952 48.626 1.00 6.04  ? 425 LEU A CG    1 
ATOM   3269 C  CD1   . LEU A 1 425 ? 8.633   32.644 49.970 1.00 12.78 ? 425 LEU A CD1   1 
ATOM   3270 C  CD2   . LEU A 1 425 ? 10.193  31.665 48.302 1.00 9.95  ? 425 LEU A CD2   1 
ATOM   3271 N  N     . ARG A 1 426 ? 5.407   29.366 47.149 1.00 19.16 ? 426 ARG A N     1 
ATOM   3272 C  CA    . ARG A 1 426 ? 4.359   28.362 47.056 1.00 22.52 ? 426 ARG A CA    1 
ATOM   3273 C  C     . ARG A 1 426 ? 3.219   28.970 46.217 1.00 25.13 ? 426 ARG A C     1 
ATOM   3274 O  O     . ARG A 1 426 ? 2.738   30.062 46.515 1.00 23.47 ? 426 ARG A O     1 
ATOM   3275 C  CB    . ARG A 1 426 ? 3.899   27.965 48.464 1.00 22.90 ? 426 ARG A CB    1 
ATOM   3276 C  CG    . ARG A 1 426 ? 2.853   26.853 48.554 1.00 29.93 ? 426 ARG A CG    1 
ATOM   3277 C  CD    . ARG A 1 426 ? 2.432   26.643 50.023 1.00 41.44 ? 426 ARG A CD    1 
ATOM   3278 N  NE    . ARG A 1 426 ? 1.075   26.107 50.196 1.00 45.70 ? 426 ARG A NE    1 
ATOM   3279 C  CZ    . ARG A 1 426 ? 0.317   26.421 51.254 1.00 46.91 ? 426 ARG A CZ    1 
ATOM   3280 N  NH1   . ARG A 1 426 ? 0.761   27.230 52.210 1.00 43.73 ? 426 ARG A NH1   1 
ATOM   3281 N  NH2   . ARG A 1 426 ? -0.932  25.978 51.315 1.00 50.79 ? 426 ARG A NH2   1 
ATOM   3282 N  N     . ASP A 1 427 ? 2.884   28.324 45.099 1.00 28.06 ? 427 ASP A N     1 
ATOM   3283 C  CA    . ASP A 1 427 ? 1.800   28.800 44.236 1.00 26.79 ? 427 ASP A CA    1 
ATOM   3284 C  C     . ASP A 1 427 ? 0.495   28.240 44.783 1.00 25.59 ? 427 ASP A C     1 
ATOM   3285 O  O     . ASP A 1 427 ? 0.321   27.017 44.834 1.00 24.00 ? 427 ASP A O     1 
ATOM   3286 C  CB    . ASP A 1 427 ? 1.994   28.336 42.789 1.00 28.19 ? 427 ASP A CB    1 
ATOM   3287 C  CG    . ASP A 1 427 ? 0.954   28.923 41.844 1.00 31.79 ? 427 ASP A CG    1 
ATOM   3288 O  OD1   . ASP A 1 427 ? -0.241  28.648 42.047 1.00 34.47 ? 427 ASP A OD1   1 
ATOM   3289 O  OD2   . ASP A 1 427 ? 1.317   29.663 40.899 1.00 32.96 ? 427 ASP A OD2   1 
ATOM   3290 N  N     . PRO A 1 428 ? -0.468  29.126 45.124 1.00 23.05 ? 428 PRO A N     1 
ATOM   3291 C  CA    . PRO A 1 428 ? -1.794  28.814 45.674 1.00 20.44 ? 428 PRO A CA    1 
ATOM   3292 C  C     . PRO A 1 428 ? -2.579  27.739 44.928 1.00 22.95 ? 428 PRO A C     1 
ATOM   3293 O  O     . PRO A 1 428 ? -3.269  26.909 45.555 1.00 25.16 ? 428 PRO A O     1 
ATOM   3294 C  CB    . PRO A 1 428 ? -2.521  30.164 45.603 1.00 20.58 ? 428 PRO A CB    1 
ATOM   3295 C  CG    . PRO A 1 428 ? -1.451  31.145 45.774 1.00 18.78 ? 428 PRO A CG    1 
ATOM   3296 C  CD    . PRO A 1 428 ? -0.346  30.578 44.894 1.00 23.44 ? 428 PRO A CD    1 
ATOM   3297 N  N     . PHE A 1 429 ? -2.488  27.769 43.595 1.00 23.83 ? 429 PHE A N     1 
ATOM   3298 C  CA    . PHE A 1 429 ? -3.196  26.822 42.732 1.00 22.88 ? 429 PHE A CA    1 
ATOM   3299 C  C     . PHE A 1 429 ? -2.786  25.374 42.901 1.00 24.04 ? 429 PHE A C     1 
ATOM   3300 O  O     . PHE A 1 429 ? -3.635  24.488 42.899 1.00 23.11 ? 429 PHE A O     1 
ATOM   3301 C  CB    . PHE A 1 429 ? -3.090  27.223 41.254 1.00 18.50 ? 429 PHE A CB    1 
ATOM   3302 C  CG    . PHE A 1 429 ? -4.101  28.260 40.829 1.00 11.95 ? 429 PHE A CG    1 
ATOM   3303 C  CD1   . PHE A 1 429 ? -5.443  28.117 41.164 1.00 12.00 ? 429 PHE A CD1   1 
ATOM   3304 C  CD2   . PHE A 1 429 ? -3.710  29.372 40.094 1.00 9.26  ? 429 PHE A CD2   1 
ATOM   3305 C  CE1   . PHE A 1 429 ? -6.384  29.065 40.777 1.00 11.66 ? 429 PHE A CE1   1 
ATOM   3306 C  CE2   . PHE A 1 429 ? -4.636  30.328 39.696 1.00 14.90 ? 429 PHE A CE2   1 
ATOM   3307 C  CZ    . PHE A 1 429 ? -5.984  30.174 40.039 1.00 17.29 ? 429 PHE A CZ    1 
ATOM   3308 N  N     . ASP A 1 430 ? -1.497  25.113 43.034 1.00 25.43 ? 430 ASP A N     1 
ATOM   3309 C  CA    . ASP A 1 430 ? -1.083  23.731 43.207 1.00 34.87 ? 430 ASP A CA    1 
ATOM   3310 C  C     . ASP A 1 430 ? -0.770  23.443 44.677 1.00 40.44 ? 430 ASP A C     1 
ATOM   3311 O  O     . ASP A 1 430 ? -0.431  22.307 45.044 1.00 41.34 ? 430 ASP A O     1 
ATOM   3312 C  CB    . ASP A 1 430 ? 0.102   23.394 42.286 1.00 34.15 ? 430 ASP A CB    1 
ATOM   3313 C  CG    . ASP A 1 430 ? 1.262   24.341 42.460 1.00 34.28 ? 430 ASP A CG    1 
ATOM   3314 O  OD1   . ASP A 1 430 ? 1.956   24.269 43.490 1.00 40.47 ? 430 ASP A OD1   1 
ATOM   3315 O  OD2   . ASP A 1 430 ? 1.485   25.168 41.566 1.00 38.00 ? 430 ASP A OD2   1 
ATOM   3316 N  N     . ALA A 1 431 ? -0.938  24.475 45.507 1.00 45.15 ? 431 ALA A N     1 
ATOM   3317 C  CA    . ALA A 1 431 ? -0.685  24.407 46.947 1.00 48.52 ? 431 ALA A CA    1 
ATOM   3318 C  C     . ALA A 1 431 ? -1.944  24.135 47.791 1.00 48.89 ? 431 ALA A C     1 
ATOM   3319 O  O     . ALA A 1 431 ? -2.198  24.904 48.745 1.00 52.54 ? 431 ALA A O     1 
ATOM   3320 C  CB    . ALA A 1 431 ? -0.011  25.701 47.404 1.00 46.38 ? 431 ALA A CB    1 
ATOM   3321 O  OXT   . ALA A 1 431 ? -2.659  23.147 47.515 1.00 46.14 ? 431 ALA A OXT   1 
HETATM 3322 N  N     . NO3 B 2 .   ? -8.353  48.733 46.368 1.00 22.75 ? 433 NO3 A N     1 
HETATM 3323 O  O1    . NO3 B 2 .   ? -9.513  48.166 46.287 1.00 24.61 ? 433 NO3 A O1    1 
HETATM 3324 O  O2    . NO3 B 2 .   ? -8.009  49.636 45.500 1.00 18.42 ? 433 NO3 A O2    1 
HETATM 3325 O  O3    . NO3 B 2 .   ? -7.532  48.396 47.322 1.00 24.60 ? 433 NO3 A O3    1 
HETATM 3326 MG MG    . MG  C 3 .   ? -5.885  50.503 45.385 1.00 10.52 ? 434 MG  A MG    1 
HETATM 3327 P  P1    . GPX D 4 .   ? 2.758   51.660 41.473 1.00 35.82 ? 432 GPX A P1    1 
HETATM 3328 N  N9    . GPX D 4 .   ? 3.395   48.178 44.034 1.00 12.53 ? 432 GPX A N9    1 
HETATM 3329 C  C8    . GPX D 4 .   ? 2.736   46.997 44.183 1.00 11.18 ? 432 GPX A C8    1 
HETATM 3330 N  N7    . GPX D 4 .   ? 3.431   46.009 44.670 1.00 13.92 ? 432 GPX A N7    1 
HETATM 3331 C  C5    . GPX D 4 .   ? 4.692   46.586 44.875 1.00 7.48  ? 432 GPX A C5    1 
HETATM 3332 C  C6    . GPX D 4 .   ? 5.844   46.026 45.374 1.00 5.60  ? 432 GPX A C6    1 
HETATM 3333 O  O6    . GPX D 4 .   ? 6.037   44.867 45.749 1.00 9.97  ? 432 GPX A O6    1 
HETATM 3334 N  N1    . GPX D 4 .   ? 6.891   46.925 45.419 1.00 5.01  ? 432 GPX A N1    1 
HETATM 3335 C  C2    . GPX D 4 .   ? 6.779   48.231 45.013 1.00 9.52  ? 432 GPX A C2    1 
HETATM 3336 N  N2    . GPX D 4 .   ? 7.856   49.008 45.086 1.00 11.47 ? 432 GPX A N2    1 
HETATM 3337 N  N3    . GPX D 4 .   ? 5.678   48.765 44.545 1.00 7.29  ? 432 GPX A N3    1 
HETATM 3338 C  C4    . GPX D 4 .   ? 4.679   47.895 44.495 1.00 6.88  ? 432 GPX A C4    1 
HETATM 3339 O  O11   . GPX D 4 .   ? 2.515   52.196 40.115 1.00 43.19 ? 432 GPX A O11   1 
HETATM 3340 O  O21   . GPX D 4 .   ? 3.944   52.332 42.057 1.00 40.26 ? 432 GPX A O21   1 
HETATM 3341 O  "O3'" . GPX D 4 .   ? 1.472   51.825 42.447 1.00 33.07 ? 432 GPX A "O3'" 1 
HETATM 3342 P  PA    . GPX D 4 .   ? -2.507  49.661 44.993 1.00 20.93 ? 432 GPX A PA    1 
HETATM 3343 O  O1A   . GPX D 4 .   ? -3.651  50.598 44.904 1.00 18.31 ? 432 GPX A O1A   1 
HETATM 3344 O  O2A   . GPX D 4 .   ? -1.483  50.221 45.897 1.00 19.44 ? 432 GPX A O2A   1 
HETATM 3345 O  O3A   . GPX D 4 .   ? -2.909  48.189 45.527 1.00 17.44 ? 432 GPX A O3A   1 
HETATM 3346 O  "O5'" . GPX D 4 .   ? -1.774  49.318 43.592 1.00 25.09 ? 432 GPX A "O5'" 1 
HETATM 3347 P  PB    . GPX D 4 .   ? -4.310  47.439 45.314 1.00 22.50 ? 432 GPX A PB    1 
HETATM 3348 O  O1B   . GPX D 4 .   ? -4.422  46.613 44.079 1.00 22.00 ? 432 GPX A O1B   1 
HETATM 3349 O  O2B   . GPX D 4 .   ? -5.364  48.475 45.316 1.00 14.23 ? 432 GPX A O2B   1 
HETATM 3350 O  O3B   . GPX D 4 .   ? -4.469  46.557 46.490 1.00 23.44 ? 432 GPX A O3B   1 
HETATM 3351 C  "C5'" . GPX D 4 .   ? -0.392  48.896 43.908 1.00 28.06 ? 432 GPX A "C5'" 1 
HETATM 3352 C  "C4'" . GPX D 4 .   ? 0.659   50.060 43.994 1.00 27.41 ? 432 GPX A "C4'" 1 
HETATM 3353 O  "O4'" . GPX D 4 .   ? 1.858   49.663 44.622 1.00 23.33 ? 432 GPX A "O4'" 1 
HETATM 3354 C  "C1'" . GPX D 4 .   ? 2.884   49.411 43.681 1.00 18.87 ? 432 GPX A "C1'" 1 
HETATM 3355 C  "C2'" . GPX D 4 .   ? 2.179   49.485 42.341 1.00 27.46 ? 432 GPX A "C2'" 1 
HETATM 3356 O  "O2'" . GPX D 4 .   ? 3.006   50.075 41.325 1.00 36.43 ? 432 GPX A "O2'" 1 
HETATM 3357 C  "C3'" . GPX D 4 .   ? 1.057   50.482 42.624 1.00 27.22 ? 432 GPX A "C3'" 1 
HETATM 3358 N  NA    . HDA E 5 .   ? -7.218  54.059 46.647 1.00 25.52 ? 437 HDA A NA    1 
HETATM 3359 C  C     . HDA E 5 .   ? -7.374  52.950 45.776 1.00 23.32 ? 437 HDA A C     1 
HETATM 3360 O  O     . HDA E 5 .   ? -6.460  52.592 45.085 1.00 20.22 ? 437 HDA A O     1 
HETATM 3361 O  OB    . HDA E 5 .   ? -6.159  53.981 47.575 1.00 23.14 ? 437 HDA A OB    1 
HETATM 3362 C  CB    . HDA E 5 .   ? -8.449  54.692 47.187 1.00 25.20 ? 437 HDA A CB    1 
HETATM 3363 C  CG    . HDA E 5 .   ? -8.483  56.197 46.956 1.00 32.84 ? 437 HDA A CG    1 
HETATM 3364 O  OD1   . HDA E 5 .   ? -9.240  56.889 47.656 1.00 35.43 ? 437 HDA A OD1   1 
HETATM 3365 O  OD2   . HDA E 5 .   ? -7.761  56.713 46.077 1.00 32.36 ? 437 HDA A OD2   1 
HETATM 3366 P  P     . IMP F 6 .   ? -16.432 54.286 50.057 1.00 13.43 ? 440 IMP A P     1 
HETATM 3367 O  O1P   . IMP F 6 .   ? -17.821 54.532 50.579 1.00 8.63  ? 440 IMP A O1P   1 
HETATM 3368 O  O2P   . IMP F 6 .   ? -16.266 52.865 49.703 1.00 8.46  ? 440 IMP A O2P   1 
HETATM 3369 O  O3P   . IMP F 6 .   ? -16.141 55.315 48.842 1.00 14.55 ? 440 IMP A O3P   1 
HETATM 3370 O  "O5'" . IMP F 6 .   ? -15.273 54.701 51.100 1.00 16.58 ? 440 IMP A "O5'" 1 
HETATM 3371 C  "C5'" . IMP F 6 .   ? -15.277 54.496 52.519 1.00 7.47  ? 440 IMP A "C5'" 1 
HETATM 3372 C  "C4'" . IMP F 6 .   ? -13.891 54.461 53.040 1.00 6.60  ? 440 IMP A "C4'" 1 
HETATM 3373 O  "O4'" . IMP F 6 .   ? -13.101 53.390 52.519 1.00 8.21  ? 440 IMP A "O4'" 1 
HETATM 3374 C  "C3'" . IMP F 6 .   ? -13.057 55.657 52.838 1.00 12.63 ? 440 IMP A "C3'" 1 
HETATM 3375 O  "O3'" . IMP F 6 .   ? -12.081 55.734 53.936 1.00 23.00 ? 440 IMP A "O3'" 1 
HETATM 3376 C  "C2'" . IMP F 6 .   ? -12.213 55.251 51.636 1.00 10.57 ? 440 IMP A "C2'" 1 
HETATM 3377 O  "O2'" . IMP F 6 .   ? -11.120 56.097 51.571 1.00 10.96 ? 440 IMP A "O2'" 1 
HETATM 3378 C  "C1'" . IMP F 6 .   ? -11.812 53.834 51.956 1.00 8.52  ? 440 IMP A "C1'" 1 
HETATM 3379 N  N9    . IMP F 6 .   ? -11.632 53.111 50.776 1.00 11.90 ? 440 IMP A N9    1 
HETATM 3380 C  C8    . IMP F 6 .   ? -12.625 52.783 49.890 1.00 11.96 ? 440 IMP A C8    1 
HETATM 3381 N  N7    . IMP F 6 .   ? -12.329 52.144 48.840 1.00 6.79  ? 440 IMP A N7    1 
HETATM 3382 C  C5    . IMP F 6 .   ? -10.979 51.997 48.994 1.00 10.12 ? 440 IMP A C5    1 
HETATM 3383 C  C6    . IMP F 6 .   ? -10.103 51.340 48.101 1.00 10.97 ? 440 IMP A C6    1 
HETATM 3384 O  O6    . IMP F 6 .   ? -10.433 50.695 47.107 1.00 7.70  ? 440 IMP A O6    1 
HETATM 3385 N  N1    . IMP F 6 .   ? -8.810  51.405 48.589 1.00 12.93 ? 440 IMP A N1    1 
HETATM 3386 C  C2    . IMP F 6 .   ? -8.459  52.005 49.789 1.00 10.96 ? 440 IMP A C2    1 
HETATM 3387 N  N3    . IMP F 6 .   ? -9.294  52.613 50.629 1.00 5.33  ? 440 IMP A N3    1 
HETATM 3388 C  C4    . IMP F 6 .   ? -10.528 52.575 50.167 1.00 8.24  ? 440 IMP A C4    1 
HETATM 3389 O  O     . HOH G 7 .   ? -16.586 37.135 56.024 1.00 18.69 ? 500 HOH A O     1 
HETATM 3390 O  O     . HOH G 7 .   ? -1.574  46.468 42.677 1.00 26.95 ? 501 HOH A O     1 
HETATM 3391 O  O     . HOH G 7 .   ? -20.428 41.057 23.971 1.00 48.59 ? 502 HOH A O     1 
HETATM 3392 O  O     . HOH G 7 .   ? -16.728 45.967 64.008 1.00 7.88  ? 503 HOH A O     1 
HETATM 3393 O  O     . HOH G 7 .   ? -25.611 55.486 51.922 1.00 19.42 ? 504 HOH A O     1 
HETATM 3394 O  O     . HOH G 7 .   ? -3.989  49.000 54.085 1.00 12.61 ? 505 HOH A O     1 
HETATM 3395 O  O     . HOH G 7 .   ? -17.080 48.283 48.928 1.00 5.01  ? 506 HOH A O     1 
HETATM 3396 O  O     . HOH G 7 .   ? -35.340 46.474 40.928 1.00 41.74 ? 507 HOH A O     1 
HETATM 3397 O  O     . HOH G 7 .   ? -22.206 28.163 42.277 1.00 19.66 ? 508 HOH A O     1 
HETATM 3398 O  O     . HOH G 7 .   ? -0.926  46.188 59.326 1.00 5.01  ? 509 HOH A O     1 
HETATM 3399 O  O     . HOH G 7 .   ? -8.344  45.444 71.795 1.00 29.46 ? 510 HOH A O     1 
HETATM 3400 O  O     . HOH G 7 .   ? -23.550 57.086 28.006 1.00 35.83 ? 511 HOH A O     1 
HETATM 3401 O  O     . HOH G 7 .   ? -21.296 18.137 42.726 1.00 53.53 ? 512 HOH A O     1 
HETATM 3402 O  O     . HOH G 7 .   ? -7.949  25.968 34.608 1.00 12.20 ? 513 HOH A O     1 
HETATM 3403 O  O     . HOH G 7 .   ? -26.027 33.670 39.325 1.00 12.98 ? 514 HOH A O     1 
HETATM 3404 O  O     . HOH G 7 .   ? -10.134 42.472 50.117 1.00 26.20 ? 515 HOH A O     1 
HETATM 3405 O  O     . HOH G 7 .   ? 1.548   44.015 38.191 1.00 11.99 ? 516 HOH A O     1 
HETATM 3406 O  O     . HOH G 7 .   ? 7.707   34.901 39.702 1.00 27.99 ? 517 HOH A O     1 
HETATM 3407 O  O     . HOH G 7 .   ? -10.404 44.950 40.004 1.00 9.64  ? 518 HOH A O     1 
HETATM 3408 O  O     . HOH G 7 .   ? -5.254  39.295 74.492 1.00 21.39 ? 519 HOH A O     1 
HETATM 3409 O  O     . HOH G 7 .   ? -27.477 33.382 41.675 1.00 14.87 ? 520 HOH A O     1 
HETATM 3410 O  O     . HOH G 7 .   ? -29.189 55.683 48.900 1.00 19.52 ? 521 HOH A O     1 
HETATM 3411 O  O     . HOH G 7 .   ? -17.104 31.035 30.588 1.00 17.63 ? 522 HOH A O     1 
HETATM 3412 O  O     . HOH G 7 .   ? 8.898   54.811 65.319 1.00 27.66 ? 523 HOH A O     1 
HETATM 3413 O  O     . HOH G 7 .   ? -26.948 42.290 44.251 1.00 10.32 ? 524 HOH A O     1 
HETATM 3414 O  O     . HOH G 7 .   ? 3.713   52.782 71.931 1.00 60.80 ? 526 HOH A O     1 
HETATM 3415 O  O     . HOH G 7 .   ? -11.258 56.374 36.845 1.00 36.53 ? 527 HOH A O     1 
HETATM 3416 O  O     . HOH G 7 .   ? -14.181 49.940 74.737 1.00 33.51 ? 528 HOH A O     1 
HETATM 3417 O  O     . HOH G 7 .   ? -24.529 43.593 45.299 1.00 5.01  ? 529 HOH A O     1 
HETATM 3418 O  O     . HOH G 7 .   ? 6.436   47.920 59.185 1.00 26.00 ? 530 HOH A O     1 
HETATM 3419 O  O     . HOH G 7 .   ? -3.550  45.963 59.696 1.00 17.86 ? 531 HOH A O     1 
HETATM 3420 O  O     . HOH G 7 .   ? -4.130  57.542 64.483 1.00 29.44 ? 532 HOH A O     1 
HETATM 3421 O  O     . HOH G 7 .   ? -28.835 49.719 44.530 1.00 5.01  ? 533 HOH A O     1 
HETATM 3422 O  O     . HOH G 7 .   ? 3.733   42.051 75.074 1.00 58.67 ? 534 HOH A O     1 
HETATM 3423 O  O     . HOH G 7 .   ? -22.101 40.041 51.683 1.00 16.08 ? 535 HOH A O     1 
HETATM 3424 O  O     . HOH G 7 .   ? -23.745 56.907 52.915 1.00 5.01  ? 536 HOH A O     1 
HETATM 3425 O  O     . HOH G 7 .   ? -22.040 47.050 60.721 1.00 5.89  ? 537 HOH A O     1 
HETATM 3426 O  O     . HOH G 7 .   ? 12.394  35.488 63.977 1.00 33.28 ? 538 HOH A O     1 
HETATM 3427 O  O     . HOH G 7 .   ? 4.370   45.980 28.367 1.00 25.60 ? 539 HOH A O     1 
HETATM 3428 O  O     . HOH G 7 .   ? -5.389  35.210 65.668 1.00 29.44 ? 540 HOH A O     1 
HETATM 3429 O  O     . HOH G 7 .   ? -22.986 40.305 47.776 1.00 30.43 ? 541 HOH A O     1 
HETATM 3430 O  O     . HOH G 7 .   ? 20.790  41.481 57.496 1.00 51.10 ? 542 HOH A O     1 
HETATM 3431 O  O     . HOH G 7 .   ? -29.369 51.029 41.879 1.00 10.91 ? 543 HOH A O     1 
HETATM 3432 O  O     . HOH G 7 .   ? -9.821  19.259 40.288 1.00 59.12 ? 544 HOH A O     1 
HETATM 3433 O  O     . HOH G 7 .   ? -12.395 46.763 63.603 1.00 8.53  ? 545 HOH A O     1 
HETATM 3434 O  O     . HOH G 7 .   ? -13.052 55.868 56.714 1.00 5.01  ? 546 HOH A O     1 
HETATM 3435 O  O     . HOH G 7 .   ? -16.549 20.707 52.848 1.00 34.65 ? 547 HOH A O     1 
HETATM 3436 O  O     . HOH G 7 .   ? -8.824  37.938 67.945 1.00 25.40 ? 549 HOH A O     1 
HETATM 3437 O  O     . HOH G 7 .   ? -11.709 44.420 64.790 1.00 5.19  ? 550 HOH A O     1 
HETATM 3438 O  O     . HOH G 7 .   ? -13.589 62.915 51.674 1.00 43.43 ? 551 HOH A O     1 
HETATM 3439 O  O     . HOH G 7 .   ? -35.686 42.102 35.729 1.00 22.47 ? 552 HOH A O     1 
HETATM 3440 O  O     . HOH G 7 .   ? -14.228 42.028 44.764 1.00 5.01  ? 553 HOH A O     1 
HETATM 3441 O  O     . HOH G 7 .   ? -9.223  59.857 61.469 1.00 25.17 ? 554 HOH A O     1 
HETATM 3442 O  O     . HOH G 7 .   ? -4.418  40.991 34.036 1.00 8.00  ? 555 HOH A O     1 
HETATM 3443 O  O     . HOH G 7 .   ? -24.875 41.595 50.631 1.00 35.13 ? 556 HOH A O     1 
HETATM 3444 O  O     . HOH G 7 .   ? -17.955 53.893 66.286 1.00 24.25 ? 557 HOH A O     1 
HETATM 3445 O  O     . HOH G 7 .   ? -20.833 42.357 50.578 1.00 29.31 ? 558 HOH A O     1 
HETATM 3446 O  O     . HOH G 7 .   ? -18.899 17.849 45.981 1.00 32.26 ? 559 HOH A O     1 
HETATM 3447 O  O     . HOH G 7 .   ? -10.467 47.242 83.119 1.00 31.65 ? 560 HOH A O     1 
HETATM 3448 O  O     . HOH G 7 .   ? -1.179  48.613 54.331 1.00 16.23 ? 561 HOH A O     1 
HETATM 3449 O  O     . HOH G 7 .   ? -16.256 36.211 27.570 1.00 39.98 ? 562 HOH A O     1 
HETATM 3450 O  O     . HOH G 7 .   ? -30.560 33.805 34.623 1.00 41.41 ? 563 HOH A O     1 
HETATM 3451 O  O     . HOH G 7 .   ? -14.230 57.546 66.137 1.00 26.63 ? 564 HOH A O     1 
HETATM 3452 O  O     . HOH G 7 .   ? -9.334  38.541 31.066 1.00 15.00 ? 565 HOH A O     1 
HETATM 3453 O  O     . HOH G 7 .   ? -23.286 44.762 51.522 1.00 23.18 ? 566 HOH A O     1 
HETATM 3454 O  O     . HOH G 7 .   ? 6.512   49.317 72.366 1.00 13.54 ? 567 HOH A O     1 
HETATM 3455 O  O     . HOH G 7 .   ? 5.785   51.872 72.200 1.00 36.54 ? 568 HOH A O     1 
HETATM 3456 O  O     . HOH G 7 .   ? -19.227 59.273 63.787 1.00 48.88 ? 569 HOH A O     1 
HETATM 3457 O  O     . HOH G 7 .   ? -6.604  56.116 24.242 1.00 54.11 ? 570 HOH A O     1 
HETATM 3458 O  O     . HOH G 7 .   ? 8.437   51.622 70.771 1.00 25.38 ? 571 HOH A O     1 
HETATM 3459 O  O     . HOH G 7 .   ? -19.029 26.803 33.260 1.00 28.13 ? 572 HOH A O     1 
HETATM 3460 O  O     . HOH G 7 .   ? -37.753 61.048 38.095 1.00 44.89 ? 573 HOH A O     1 
HETATM 3461 O  O     . HOH G 7 .   ? -23.139 56.130 36.318 1.00 24.28 ? 574 HOH A O     1 
HETATM 3462 O  O     . HOH G 7 .   ? -18.704 50.383 39.768 1.00 17.95 ? 575 HOH A O     1 
HETATM 3463 O  O     . HOH G 7 .   ? -27.665 50.937 23.947 1.00 26.72 ? 576 HOH A O     1 
HETATM 3464 O  O     . HOH G 7 .   ? -2.170  50.242 63.071 1.00 8.83  ? 577 HOH A O     1 
HETATM 3465 O  O     . HOH G 7 .   ? -2.308  62.480 55.338 1.00 37.37 ? 578 HOH A O     1 
HETATM 3466 O  O     . HOH G 7 .   ? 14.794  50.027 47.343 1.00 34.60 ? 579 HOH A O     1 
HETATM 3467 O  O     . HOH G 7 .   ? -5.588  44.401 59.438 1.00 19.74 ? 580 HOH A O     1 
HETATM 3468 O  O     . HOH G 7 .   ? -29.560 47.688 43.291 1.00 28.55 ? 581 HOH A O     1 
HETATM 3469 O  O     . HOH G 7 .   ? -1.743  25.216 35.388 1.00 25.69 ? 582 HOH A O     1 
HETATM 3470 O  O     . HOH G 7 .   ? -18.534 57.843 39.208 1.00 30.02 ? 583 HOH A O     1 
HETATM 3471 O  O     . HOH G 7 .   ? -11.032 54.859 34.300 1.00 56.29 ? 584 HOH A O     1 
HETATM 3472 O  O     . HOH G 7 .   ? 3.261   54.926 67.421 1.00 36.18 ? 585 HOH A O     1 
HETATM 3473 O  O     . HOH G 7 .   ? 10.916  44.214 34.767 1.00 38.24 ? 586 HOH A O     1 
HETATM 3474 O  O     . HOH G 7 .   ? 1.665   54.697 40.868 1.00 44.34 ? 587 HOH A O     1 
HETATM 3475 O  O     . HOH G 7 .   ? -2.371  62.428 43.145 1.00 45.18 ? 588 HOH A O     1 
HETATM 3476 O  O     . HOH G 7 .   ? -22.628 22.527 45.491 1.00 16.70 ? 589 HOH A O     1 
HETATM 3477 O  O     . HOH G 7 .   ? -30.120 45.806 26.077 1.00 51.04 ? 590 HOH A O     1 
HETATM 3478 O  O     . HOH G 7 .   ? -21.686 56.453 30.231 1.00 42.84 ? 591 HOH A O     1 
HETATM 3479 O  O     . HOH G 7 .   ? -21.373 59.972 54.750 1.00 14.64 ? 592 HOH A O     1 
HETATM 3480 O  O     . HOH G 7 .   ? -7.897  40.299 67.277 1.00 33.58 ? 593 HOH A O     1 
HETATM 3481 O  O     . HOH G 7 .   ? 3.818   26.148 43.640 1.00 23.25 ? 594 HOH A O     1 
HETATM 3482 O  O     . HOH G 7 .   ? -17.359 59.527 40.814 1.00 17.63 ? 595 HOH A O     1 
HETATM 3483 O  O     . HOH G 7 .   ? -17.980 67.430 54.977 1.00 50.88 ? 596 HOH A O     1 
HETATM 3484 O  O     . HOH G 7 .   ? -16.011 62.237 50.341 1.00 32.39 ? 597 HOH A O     1 
HETATM 3485 O  O     . HOH G 7 .   ? 25.364  41.922 51.963 1.00 31.51 ? 598 HOH A O     1 
HETATM 3486 O  O     . HOH G 7 .   ? -44.223 49.413 31.404 1.00 41.34 ? 599 HOH A O     1 
HETATM 3487 O  O     . HOH G 7 .   ? -23.778 22.056 43.121 1.00 19.71 ? 600 HOH A O     1 
HETATM 3488 O  O     . HOH G 7 .   ? -6.563  23.522 35.017 1.00 39.83 ? 601 HOH A O     1 
HETATM 3489 O  O     . HOH G 7 .   ? -14.927 46.272 70.728 1.00 12.62 ? 602 HOH A O     1 
HETATM 3490 O  O     . HOH G 7 .   ? -10.232 38.334 24.176 1.00 25.23 ? 603 HOH A O     1 
HETATM 3491 O  O     . HOH G 7 .   ? -18.611 61.354 48.463 1.00 27.24 ? 604 HOH A O     1 
HETATM 3492 O  O     . HOH G 7 .   ? 1.807   46.918 40.777 1.00 17.29 ? 605 HOH A O     1 
HETATM 3493 O  O     . HOH G 7 .   ? 20.765  49.287 57.606 1.00 37.85 ? 606 HOH A O     1 
HETATM 3494 O  O     . HOH G 7 .   ? -37.186 45.982 33.588 1.00 50.03 ? 607 HOH A O     1 
HETATM 3495 O  O     . HOH G 7 .   ? -31.217 40.758 37.896 1.00 14.24 ? 608 HOH A O     1 
HETATM 3496 O  O     . HOH G 7 .   ? -19.401 16.735 39.122 1.00 25.53 ? 609 HOH A O     1 
HETATM 3497 O  O     . HOH G 7 .   ? -22.673 36.618 40.799 1.00 8.45  ? 610 HOH A O     1 
HETATM 3498 O  O     . HOH G 7 .   ? -13.150 25.369 40.280 1.00 5.41  ? 611 HOH A O     1 
HETATM 3499 O  O     . HOH G 7 .   ? -33.140 57.358 27.009 1.00 38.46 ? 612 HOH A O     1 
HETATM 3500 O  O     . HOH G 7 .   ? -33.259 56.187 51.819 1.00 20.45 ? 613 HOH A O     1 
HETATM 3501 O  O     . HOH G 7 .   ? -39.201 68.177 45.709 1.00 47.98 ? 614 HOH A O     1 
HETATM 3502 O  O     . HOH G 7 .   ? -15.678 35.892 58.261 1.00 12.39 ? 615 HOH A O     1 
HETATM 3503 O  O     . HOH G 7 .   ? -33.804 70.878 55.180 1.00 45.98 ? 616 HOH A O     1 
HETATM 3504 O  O     . HOH G 7 .   ? -26.267 57.732 35.807 1.00 16.79 ? 617 HOH A O     1 
HETATM 3505 O  O     . HOH G 7 .   ? -13.463 42.430 63.643 1.00 5.01  ? 618 HOH A O     1 
HETATM 3506 O  O     . HOH G 7 .   ? -16.341 57.126 36.960 1.00 46.92 ? 619 HOH A O     1 
HETATM 3507 O  O     . HOH G 7 .   ? -5.444  39.900 66.652 1.00 15.39 ? 620 HOH A O     1 
HETATM 3508 O  O     . HOH G 7 .   ? -0.131  31.151 38.881 1.00 28.51 ? 621 HOH A O     1 
HETATM 3509 O  O     . HOH G 7 .   ? 4.647   27.394 52.578 1.00 48.70 ? 622 HOH A O     1 
HETATM 3510 O  O     . HOH G 7 .   ? -11.592 57.664 64.330 1.00 32.68 ? 623 HOH A O     1 
HETATM 3511 O  O     . HOH G 7 .   ? -8.055  51.856 31.955 1.00 36.75 ? 624 HOH A O     1 
HETATM 3512 O  O     . HOH G 7 .   ? 13.001  33.510 55.399 1.00 46.84 ? 625 HOH A O     1 
HETATM 3513 O  O     . HOH G 7 .   ? 9.654   47.893 38.171 1.00 64.44 ? 626 HOH A O     1 
HETATM 3514 O  O     . HOH G 7 .   ? 12.832  42.798 36.810 1.00 56.94 ? 627 HOH A O     1 
HETATM 3515 O  O     . HOH G 7 .   ? 11.786  50.323 45.460 1.00 37.19 ? 628 HOH A O     1 
HETATM 3516 O  O     . HOH G 7 .   ? -47.134 51.558 34.836 1.00 39.58 ? 630 HOH A O     1 
HETATM 3517 O  O     . HOH G 7 .   ? -45.105 51.802 30.074 1.00 44.97 ? 631 HOH A O     1 
HETATM 3518 O  O     . HOH G 7 .   ? -40.020 46.700 26.954 1.00 65.53 ? 632 HOH A O     1 
HETATM 3519 O  O     . HOH G 7 .   ? -37.400 43.101 33.473 1.00 23.14 ? 633 HOH A O     1 
HETATM 3520 O  O     . HOH G 7 .   ? -24.432 22.683 37.141 1.00 26.27 ? 635 HOH A O     1 
HETATM 3521 O  O     . HOH G 7 .   ? -42.786 55.640 37.924 1.00 28.66 ? 636 HOH A O     1 
HETATM 3522 O  O     . HOH G 7 .   ? -37.281 46.510 26.477 1.00 41.85 ? 637 HOH A O     1 
HETATM 3523 O  O     . HOH G 7 .   ? -44.083 57.703 40.364 1.00 36.63 ? 638 HOH A O     1 
HETATM 3524 O  O     . HOH G 7 .   ? -39.297 51.418 44.106 1.00 39.17 ? 639 HOH A O     1 
HETATM 3525 O  O     . HOH G 7 .   ? -32.827 42.918 38.803 1.00 43.96 ? 640 HOH A O     1 
HETATM 3526 O  O     . HOH G 7 .   ? -37.286 49.820 49.172 1.00 17.86 ? 641 HOH A O     1 
HETATM 3527 O  O     . HOH G 7 .   ? -19.448 21.776 33.754 1.00 42.94 ? 642 HOH A O     1 
HETATM 3528 O  O     . HOH G 7 .   ? -23.701 29.211 32.675 1.00 35.19 ? 643 HOH A O     1 
HETATM 3529 O  O     . HOH G 7 .   ? -26.260 32.619 31.377 1.00 17.69 ? 644 HOH A O     1 
HETATM 3530 O  O     . HOH G 7 .   ? -32.689 44.951 26.889 1.00 43.88 ? 645 HOH A O     1 
HETATM 3531 O  O     . HOH G 7 .   ? -38.457 53.446 48.124 1.00 22.03 ? 646 HOH A O     1 
HETATM 3532 O  O     . HOH G 7 .   ? -41.945 58.120 43.447 1.00 20.19 ? 647 HOH A O     1 
HETATM 3533 O  O     . HOH G 7 .   ? -37.967 54.142 45.298 1.00 41.52 ? 648 HOH A O     1 
HETATM 3534 O  O     . HOH G 7 .   ? -35.981 57.266 27.205 1.00 44.54 ? 649 HOH A O     1 
HETATM 3535 O  O     . HOH G 7 .   ? -26.888 42.883 24.260 1.00 27.60 ? 650 HOH A O     1 
HETATM 3536 O  O     . HOH G 7 .   ? -38.338 60.146 29.737 1.00 48.35 ? 651 HOH A O     1 
HETATM 3537 O  O     . HOH G 7 .   ? -16.494 18.646 49.885 1.00 52.48 ? 652 HOH A O     1 
HETATM 3538 O  O     . HOH G 7 .   ? -36.012 59.484 51.485 1.00 52.26 ? 653 HOH A O     1 
HETATM 3539 O  O     . HOH G 7 .   ? -37.963 61.042 50.525 1.00 45.53 ? 654 HOH A O     1 
HETATM 3540 O  O     . HOH G 7 .   ? -12.646 19.119 40.127 1.00 52.62 ? 655 HOH A O     1 
HETATM 3541 O  O     . HOH G 7 .   ? -18.928 29.474 29.313 1.00 43.95 ? 656 HOH A O     1 
HETATM 3542 O  O     . HOH G 7 .   ? -36.439 64.960 33.279 1.00 29.95 ? 657 HOH A O     1 
HETATM 3543 O  O     . HOH G 7 .   ? -38.831 64.655 43.414 1.00 30.40 ? 658 HOH A O     1 
HETATM 3544 O  O     . HOH G 7 .   ? -31.133 52.913 42.261 1.00 14.44 ? 659 HOH A O     1 
HETATM 3545 O  O     . HOH G 7 .   ? -13.129 22.865 41.346 1.00 11.18 ? 660 HOH A O     1 
HETATM 3546 O  O     . HOH G 7 .   ? -30.472 51.575 24.139 1.00 44.75 ? 661 HOH A O     1 
HETATM 3547 O  O     . HOH G 7 .   ? -38.367 65.073 35.541 1.00 35.21 ? 662 HOH A O     1 
HETATM 3548 O  O     . HOH G 7 .   ? -11.262 23.321 50.660 1.00 50.72 ? 663 HOH A O     1 
HETATM 3549 O  O     . HOH G 7 .   ? -13.016 23.568 44.616 1.00 25.99 ? 664 HOH A O     1 
HETATM 3550 O  O     . HOH G 7 .   ? -10.024 20.738 35.738 1.00 46.46 ? 665 HOH A O     1 
HETATM 3551 O  O     . HOH G 7 .   ? -38.728 71.459 46.252 1.00 39.07 ? 666 HOH A O     1 
HETATM 3552 O  O     . HOH G 7 .   ? -16.477 32.806 50.853 1.00 17.62 ? 667 HOH A O     1 
HETATM 3553 O  O     . HOH G 7 .   ? -35.193 65.973 38.151 1.00 49.05 ? 668 HOH A O     1 
HETATM 3554 O  O     . HOH G 7 .   ? -8.053  21.355 47.227 1.00 46.75 ? 669 HOH A O     1 
HETATM 3555 O  O     . HOH G 7 .   ? -8.342  21.732 43.933 1.00 31.39 ? 670 HOH A O     1 
HETATM 3556 O  O     . HOH G 7 .   ? -13.302 25.947 30.770 1.00 41.47 ? 671 HOH A O     1 
HETATM 3557 O  O     . HOH G 7 .   ? -12.871 29.787 46.448 1.00 33.79 ? 672 HOH A O     1 
HETATM 3558 O  O     . HOH G 7 .   ? -17.507 38.977 27.961 1.00 19.55 ? 673 HOH A O     1 
HETATM 3559 O  O     . HOH G 7 .   ? -25.040 50.486 24.048 1.00 24.94 ? 674 HOH A O     1 
HETATM 3560 O  O     . HOH G 7 .   ? -35.395 67.182 31.068 1.00 49.39 ? 675 HOH A O     1 
HETATM 3561 O  O     . HOH G 7 .   ? -7.459  21.162 37.815 1.00 31.00 ? 676 HOH A O     1 
HETATM 3562 O  O     . HOH G 7 .   ? -19.717 40.517 48.910 1.00 40.19 ? 677 HOH A O     1 
HETATM 3563 O  O     . HOH G 7 .   ? -32.405 66.297 61.120 1.00 39.20 ? 678 HOH A O     1 
HETATM 3564 O  O     . HOH G 7 .   ? -25.577 55.424 33.473 1.00 19.73 ? 679 HOH A O     1 
HETATM 3565 O  O     . HOH G 7 .   ? -30.470 64.314 28.673 1.00 40.42 ? 680 HOH A O     1 
HETATM 3566 O  O     . HOH G 7 .   ? -30.214 66.552 30.101 1.00 43.61 ? 681 HOH A O     1 
HETATM 3567 O  O     . HOH G 7 .   ? -5.290  22.817 42.911 1.00 16.37 ? 682 HOH A O     1 
HETATM 3568 O  O     . HOH G 7 .   ? -3.281  25.010 52.223 1.00 32.04 ? 683 HOH A O     1 
HETATM 3569 O  O     . HOH G 7 .   ? -23.906 55.854 31.452 1.00 14.57 ? 685 HOH A O     1 
HETATM 3570 O  O     . HOH G 7 .   ? -5.910  26.590 52.652 1.00 23.56 ? 686 HOH A O     1 
HETATM 3571 O  O     . HOH G 7 .   ? -11.877 35.729 27.916 1.00 23.93 ? 687 HOH A O     1 
HETATM 3572 O  O     . HOH G 7 .   ? -26.080 59.987 34.326 1.00 39.45 ? 688 HOH A O     1 
HETATM 3573 O  O     . HOH G 7 .   ? -27.120 63.953 36.080 1.00 37.50 ? 689 HOH A O     1 
HETATM 3574 O  O     . HOH G 7 .   ? -6.447  29.626 30.890 1.00 48.57 ? 690 HOH A O     1 
HETATM 3575 O  O     . HOH G 7 .   ? -17.110 48.836 24.964 1.00 25.39 ? 691 HOH A O     1 
HETATM 3576 O  O     . HOH G 7 .   ? -19.127 52.168 50.712 1.00 21.92 ? 692 HOH A O     1 
HETATM 3577 O  O     . HOH G 7 .   ? -21.763 57.662 38.341 1.00 50.21 ? 693 HOH A O     1 
HETATM 3578 O  O     . HOH G 7 .   ? -22.013 58.748 51.883 1.00 20.78 ? 694 HOH A O     1 
HETATM 3579 O  O     . HOH G 7 .   ? -22.248 57.724 58.291 1.00 22.52 ? 695 HOH A O     1 
HETATM 3580 O  O     . HOH G 7 .   ? -13.662 44.878 22.456 1.00 42.04 ? 696 HOH A O     1 
HETATM 3581 O  O     . HOH G 7 .   ? -20.056 55.645 50.133 1.00 9.50  ? 697 HOH A O     1 
HETATM 3582 O  O     . HOH G 7 .   ? -21.025 60.170 37.635 1.00 55.27 ? 698 HOH A O     1 
HETATM 3583 O  O     . HOH G 7 .   ? -21.654 60.265 64.725 1.00 39.25 ? 699 HOH A O     1 
HETATM 3584 O  O     . HOH G 7 .   ? -1.579  28.208 58.595 1.00 25.10 ? 700 HOH A O     1 
HETATM 3585 O  O     . HOH G 7 .   ? -11.679 42.070 71.892 1.00 30.18 ? 701 HOH A O     1 
HETATM 3586 O  O     . HOH G 7 .   ? -18.223 55.945 47.174 1.00 9.46  ? 702 HOH A O     1 
HETATM 3587 O  O     . HOH G 7 .   ? -18.201 57.130 71.806 1.00 33.04 ? 703 HOH A O     1 
HETATM 3588 O  O     . HOH G 7 .   ? -27.891 74.921 50.451 1.00 52.19 ? 704 HOH A O     1 
HETATM 3589 O  O     . HOH G 7 .   ? -5.351  32.904 64.305 1.00 29.88 ? 705 HOH A O     1 
HETATM 3590 O  O     . HOH G 7 .   ? -10.378 44.532 73.530 1.00 15.58 ? 706 HOH A O     1 
HETATM 3591 O  O     . HOH G 7 .   ? -13.597 47.351 73.172 1.00 32.73 ? 707 HOH A O     1 
HETATM 3592 O  O     . HOH G 7 .   ? -9.725  44.253 43.619 1.00 13.92 ? 708 HOH A O     1 
HETATM 3593 O  O     . HOH G 7 .   ? -2.814  33.537 27.285 1.00 69.42 ? 709 HOH A O     1 
HETATM 3594 O  O     . HOH G 7 .   ? -11.561 50.211 74.964 1.00 31.83 ? 710 HOH A O     1 
HETATM 3595 O  O     . HOH G 7 .   ? -1.488  34.648 30.095 1.00 11.91 ? 711 HOH A O     1 
HETATM 3596 O  O     . HOH G 7 .   ? -17.738 62.356 43.824 1.00 25.74 ? 712 HOH A O     1 
HETATM 3597 O  O     . HOH G 7 .   ? -4.143  41.020 26.464 1.00 25.51 ? 713 HOH A O     1 
HETATM 3598 O  O     . HOH G 7 .   ? -9.752  49.910 77.643 1.00 28.90 ? 714 HOH A O     1 
HETATM 3599 O  O     . HOH G 7 .   ? -19.391 66.957 63.460 1.00 56.27 ? 715 HOH A O     1 
HETATM 3600 O  O     . HOH G 7 .   ? -19.784 70.239 55.408 1.00 44.58 ? 716 HOH A O     1 
HETATM 3601 O  O     . HOH G 7 .   ? -11.853 56.458 28.617 1.00 40.71 ? 717 HOH A O     1 
HETATM 3602 O  O     . HOH G 7 .   ? 2.493   33.404 37.232 1.00 36.25 ? 718 HOH A O     1 
HETATM 3603 O  O     . HOH G 7 .   ? -14.294 61.629 61.766 1.00 45.57 ? 719 HOH A O     1 
HETATM 3604 O  O     . HOH G 7 .   ? 6.274   29.378 51.514 1.00 45.49 ? 720 HOH A O     1 
HETATM 3605 O  O     . HOH G 7 .   ? -7.759  52.640 53.369 1.00 5.01  ? 722 HOH A O     1 
HETATM 3606 O  O     . HOH G 7 .   ? -11.730 60.094 62.676 1.00 30.75 ? 723 HOH A O     1 
HETATM 3607 O  O     . HOH G 7 .   ? 3.139   35.319 33.829 1.00 24.31 ? 724 HOH A O     1 
HETATM 3608 O  O     . HOH G 7 .   ? -8.051  54.755 34.993 1.00 28.28 ? 725 HOH A O     1 
HETATM 3609 O  O     . HOH G 7 .   ? -12.859 62.837 57.101 1.00 33.10 ? 726 HOH A O     1 
HETATM 3610 O  O     . HOH G 7 .   ? -5.712  52.744 31.313 1.00 37.92 ? 727 HOH A O     1 
HETATM 3611 O  O     . HOH G 7 .   ? -6.516  54.219 26.718 1.00 28.32 ? 728 HOH A O     1 
HETATM 3612 O  O     . HOH G 7 .   ? -9.181  58.272 65.224 1.00 29.10 ? 729 HOH A O     1 
HETATM 3613 O  O     . HOH G 7 .   ? 8.018   29.992 59.371 1.00 39.25 ? 730 HOH A O     1 
HETATM 3614 O  O     . HOH G 7 .   ? -10.499 61.414 54.933 1.00 34.90 ? 731 HOH A O     1 
HETATM 3615 O  O     . HOH G 7 .   ? -10.822 62.500 52.463 1.00 36.53 ? 732 HOH A O     1 
HETATM 3616 O  O     . HOH G 7 .   ? -3.307  53.367 32.024 1.00 39.34 ? 733 HOH A O     1 
HETATM 3617 O  O     . HOH G 7 .   ? 0.162   47.190 32.095 1.00 25.73 ? 734 HOH A O     1 
HETATM 3618 O  O     . HOH G 7 .   ? -6.660  57.887 64.437 1.00 27.67 ? 735 HOH A O     1 
HETATM 3619 O  O     . HOH G 7 .   ? -4.508  61.968 53.452 1.00 58.78 ? 736 HOH A O     1 
HETATM 3620 O  O     . HOH G 7 .   ? 10.674  32.961 56.391 1.00 53.57 ? 737 HOH A O     1 
HETATM 3621 O  O     . HOH G 7 .   ? 0.838   49.932 47.530 1.00 32.26 ? 738 HOH A O     1 
HETATM 3622 O  O     . HOH G 7 .   ? -2.625  55.491 68.449 1.00 33.28 ? 739 HOH A O     1 
HETATM 3623 O  O     . HOH G 7 .   ? -6.769  62.877 52.214 1.00 38.79 ? 740 HOH A O     1 
HETATM 3624 O  O     . HOH G 7 .   ? 0.974   55.613 69.572 1.00 53.64 ? 741 HOH A O     1 
HETATM 3625 O  O     . HOH G 7 .   ? -3.887  63.835 50.967 1.00 52.64 ? 742 HOH A O     1 
HETATM 3626 O  O     . HOH G 7 .   ? 6.588   46.717 26.924 1.00 34.13 ? 743 HOH A O     1 
HETATM 3627 O  O     . HOH G 7 .   ? 14.695  36.716 63.405 1.00 53.15 ? 744 HOH A O     1 
HETATM 3628 O  O     . HOH G 7 .   ? 11.564  40.878 66.865 1.00 33.48 ? 745 HOH A O     1 
HETATM 3629 O  O     . HOH G 7 .   ? 1.923   58.813 57.479 1.00 29.53 ? 746 HOH A O     1 
HETATM 3630 O  O     . HOH G 7 .   ? 8.312   48.132 35.731 1.00 20.91 ? 747 HOH A O     1 
HETATM 3631 O  O     . HOH G 7 .   ? 7.337   52.378 45.059 1.00 41.83 ? 748 HOH A O     1 
HETATM 3632 O  O     . HOH G 7 .   ? 2.961   68.491 49.670 1.00 35.31 ? 749 HOH A O     1 
HETATM 3633 O  O     . HOH G 7 .   ? 11.877  44.972 70.756 1.00 30.21 ? 750 HOH A O     1 
HETATM 3634 O  O     . HOH G 7 .   ? -4.272  56.612 39.644 1.00 31.23 ? 751 HOH A O     1 
HETATM 3635 O  O     . HOH G 7 .   ? 7.005   53.915 69.865 1.00 59.85 ? 752 HOH A O     1 
HETATM 3636 O  O     . HOH G 7 .   ? 15.544  42.249 60.910 1.00 15.13 ? 753 HOH A O     1 
HETATM 3637 O  O     . HOH G 7 .   ? 5.015   59.646 64.264 1.00 38.21 ? 754 HOH A O     1 
HETATM 3638 O  O     . HOH G 7 .   ? 6.179   59.571 45.185 1.00 32.07 ? 755 HOH A O     1 
HETATM 3639 O  O     . HOH G 7 .   ? 17.428  40.695 62.376 1.00 16.88 ? 756 HOH A O     1 
HETATM 3640 O  O     . HOH G 7 .   ? 15.141  47.792 56.193 1.00 21.20 ? 757 HOH A O     1 
HETATM 3641 O  O     . HOH G 7 .   ? 19.538  42.635 48.839 1.00 44.05 ? 758 HOH A O     1 
HETATM 3642 O  O     . HOH G 7 .   ? 14.093  52.486 50.094 1.00 36.58 ? 759 HOH A O     1 
HETATM 3643 O  O     . HOH G 7 .   ? 13.508  53.469 61.536 1.00 47.49 ? 760 HOH A O     1 
HETATM 3644 O  O     . HOH G 7 .   ? 18.767  44.761 44.426 1.00 45.01 ? 761 HOH A O     1 
HETATM 3645 O  O     . HOH G 7 .   ? 17.127  48.430 65.459 1.00 73.01 ? 762 HOH A O     1 
HETATM 3646 O  O     . HOH G 7 .   ? 15.573  54.590 60.220 1.00 24.37 ? 763 HOH A O     1 
HETATM 3647 O  O     . HOH G 7 .   ? 22.270  45.608 56.278 1.00 49.74 ? 764 HOH A O     1 
HETATM 3648 O  O     . HOH G 7 .   ? 19.415  51.100 49.232 1.00 41.47 ? 765 HOH A O     1 
HETATM 3649 O  O     . HOH G 7 .   ? 16.830  54.989 54.805 1.00 39.14 ? 766 HOH A O     1 
HETATM 3650 O  O     . HOH G 7 .   ? 23.447  48.316 57.852 1.00 28.38 ? 767 HOH A O     1 
HETATM 3651 O  O     . HOH G 7 .   ? -42.879 48.060 36.128 1.00 47.70 ? 768 HOH A O     1 
HETATM 3652 O  O     . HOH G 7 .   ? -26.222 24.262 34.719 1.00 54.58 ? 769 HOH A O     1 
HETATM 3653 O  O     . HOH G 7 .   ? -23.837 19.186 42.487 1.00 39.39 ? 770 HOH A O     1 
HETATM 3654 O  O     . HOH G 7 .   ? -27.677 30.311 31.581 1.00 32.79 ? 771 HOH A O     1 
HETATM 3655 O  O     . HOH G 7 .   ? -35.421 42.732 38.280 1.00 26.64 ? 772 HOH A O     1 
HETATM 3656 O  O     . HOH G 7 .   ? -37.396 47.971 41.437 1.00 57.42 ? 773 HOH A O     1 
HETATM 3657 O  O     . HOH G 7 .   ? -32.989 39.123 36.638 1.00 9.73  ? 774 HOH A O     1 
HETATM 3658 O  O     . HOH G 7 .   ? -39.581 57.464 29.734 1.00 40.96 ? 775 HOH A O     1 
HETATM 3659 O  O     . HOH G 7 .   ? -31.942 46.618 20.814 1.00 44.66 ? 777 HOH A O     1 
HETATM 3660 O  O     . HOH G 7 .   ? -14.904 22.027 45.531 1.00 38.12 ? 778 HOH A O     1 
HETATM 3661 O  O     . HOH G 7 .   ? -38.488 64.199 31.457 1.00 32.61 ? 779 HOH A O     1 
HETATM 3662 O  O     . HOH G 7 .   ? -13.172 23.182 31.349 1.00 38.26 ? 780 HOH A O     1 
HETATM 3663 O  O     . HOH G 7 .   ? -31.056 57.393 50.522 1.00 45.08 ? 781 HOH A O     1 
HETATM 3664 O  O     . HOH G 7 .   ? -37.443 66.101 29.828 1.00 42.59 ? 782 HOH A O     1 
HETATM 3665 O  O     . HOH G 7 .   ? -27.114 62.604 56.258 1.00 40.49 ? 783 HOH A O     1 
HETATM 3666 O  O     . HOH G 7 .   ? -8.935  22.910 34.112 1.00 60.31 ? 784 HOH A O     1 
HETATM 3667 O  O     . HOH G 7 .   ? -24.180 48.850 61.439 1.00 40.04 ? 785 HOH A O     1 
HETATM 3668 O  O     . HOH G 7 .   ? -12.523 28.447 30.716 1.00 39.60 ? 786 HOH A O     1 
HETATM 3669 O  O     . HOH G 7 .   ? -28.296 64.212 58.601 1.00 41.35 ? 787 HOH A O     1 
HETATM 3670 O  O     . HOH G 7 .   ? -4.974  25.783 34.550 1.00 55.87 ? 788 HOH A O     1 
HETATM 3671 O  O     . HOH G 7 .   ? -5.042  24.132 47.992 1.00 46.50 ? 789 HOH A O     1 
HETATM 3672 O  O     . HOH G 7 .   ? -10.320 36.026 25.244 1.00 30.31 ? 790 HOH A O     1 
HETATM 3673 O  O     . HOH G 7 .   ? -1.119  22.305 39.389 1.00 56.03 ? 791 HOH A O     1 
HETATM 3674 O  O     . HOH G 7 .   ? -4.645  28.062 31.968 1.00 45.37 ? 792 HOH A O     1 
HETATM 3675 O  O     . HOH G 7 .   ? -17.506 51.531 25.519 1.00 31.55 ? 793 HOH A O     1 
HETATM 3676 O  O     . HOH G 7 .   ? -10.811 41.216 18.960 1.00 58.88 ? 794 HOH A O     1 
HETATM 3677 O  O     . HOH G 7 .   ? -22.879 62.893 34.006 1.00 48.88 ? 795 HOH A O     1 
HETATM 3678 O  O     . HOH G 7 .   ? -26.492 67.322 44.523 1.00 32.52 ? 797 HOH A O     1 
HETATM 3679 O  O     . HOH G 7 .   ? -17.667 56.576 30.249 1.00 40.03 ? 798 HOH A O     1 
HETATM 3680 O  O     . HOH G 7 .   ? -22.178 65.581 61.475 1.00 41.57 ? 799 HOH A O     1 
HETATM 3681 O  O     . HOH G 7 .   ? -25.735 70.273 44.184 1.00 41.64 ? 800 HOH A O     1 
HETATM 3682 O  O     . HOH G 7 .   ? -6.197  37.771 68.148 1.00 47.36 ? 801 HOH A O     1 
HETATM 3683 O  O     . HOH G 7 .   ? 3.864   25.219 39.925 1.00 47.30 ? 802 HOH A O     1 
HETATM 3684 O  O     . HOH G 7 .   ? -3.292  52.472 75.767 1.00 42.65 ? 804 HOH A O     1 
HETATM 3685 O  O     . HOH G 7 .   ? -13.112 55.524 39.915 1.00 40.40 ? 805 HOH A O     1 
HETATM 3686 O  O     . HOH G 7 .   ? -15.175 57.091 28.023 1.00 42.33 ? 806 HOH A O     1 
HETATM 3687 O  O     . HOH G 7 .   ? -10.069 53.137 73.680 1.00 38.52 ? 807 HOH A O     1 
HETATM 3688 O  O     . HOH G 7 .   ? 6.694   30.131 41.141 1.00 44.36 ? 808 HOH A O     1 
HETATM 3689 O  O     . HOH G 7 .   ? -7.891  50.173 62.281 1.00 24.19 ? 809 HOH A O     1 
HETATM 3690 O  O     . HOH G 7 .   ? -11.422 62.386 42.184 1.00 68.61 ? 810 HOH A O     1 
HETATM 3691 O  O     . HOH G 7 .   ? 6.068   27.810 42.666 1.00 28.80 ? 811 HOH A O     1 
HETATM 3692 O  O     . HOH G 7 .   ? 3.003   30.747 65.698 1.00 45.08 ? 812 HOH A O     1 
HETATM 3693 O  O     . HOH G 7 .   ? -9.578  53.843 55.671 1.00 31.88 ? 814 HOH A O     1 
HETATM 3694 O  O     . HOH G 7 .   ? -10.730 56.975 39.568 1.00 36.26 ? 815 HOH A O     1 
HETATM 3695 O  O     . HOH G 7 .   ? 5.089   34.458 37.708 1.00 46.10 ? 816 HOH A O     1 
HETATM 3696 O  O     . HOH G 7 .   ? 6.157   31.261 33.401 1.00 52.61 ? 818 HOH A O     1 
HETATM 3697 O  O     . HOH G 7 .   ? 1.880   37.812 70.493 1.00 39.51 ? 819 HOH A O     1 
HETATM 3698 O  O     . HOH G 7 .   ? -9.639  57.758 29.850 1.00 49.92 ? 820 HOH A O     1 
HETATM 3699 O  O     . HOH G 7 .   ? -5.871  53.722 67.887 1.00 28.64 ? 821 HOH A O     1 
HETATM 3700 O  O     . HOH G 7 .   ? 8.276   32.262 40.675 1.00 33.03 ? 822 HOH A O     1 
HETATM 3701 O  O     . HOH G 7 .   ? 4.878   39.717 31.022 1.00 41.53 ? 823 HOH A O     1 
HETATM 3702 O  O     . HOH G 7 .   ? -7.046  60.517 59.594 1.00 31.96 ? 824 HOH A O     1 
HETATM 3703 O  O     . HOH G 7 .   ? -7.956  61.636 57.026 1.00 20.94 ? 825 HOH A O     1 
HETATM 3704 O  O     . HOH G 7 .   ? 9.514   36.514 37.783 1.00 48.45 ? 826 HOH A O     1 
HETATM 3705 O  O     . HOH G 7 .   ? 6.331   40.188 71.843 1.00 36.14 ? 827 HOH A O     1 
HETATM 3706 O  O     . HOH G 7 .   ? 11.633  33.645 40.807 1.00 55.18 ? 828 HOH A O     1 
HETATM 3707 O  O     . HOH G 7 .   ? 10.676  36.310 70.300 1.00 41.69 ? 829 HOH A O     1 
HETATM 3708 O  O     . HOH G 7 .   ? 14.673  31.774 53.691 1.00 46.61 ? 830 HOH A O     1 
HETATM 3709 O  O     . HOH G 7 .   ? 0.406   58.292 69.000 1.00 40.34 ? 831 HOH A O     1 
HETATM 3710 O  O     . HOH G 7 .   ? 10.981  38.762 71.253 1.00 30.42 ? 832 HOH A O     1 
HETATM 3711 O  O     . HOH G 7 .   ? -0.053  59.630 58.892 1.00 29.92 ? 833 HOH A O     1 
HETATM 3712 O  O     . HOH G 7 .   ? -1.055  61.987 57.803 1.00 44.59 ? 834 HOH A O     1 
HETATM 3713 O  O     . HOH G 7 .   ? 15.534  34.177 61.351 1.00 56.46 ? 835 HOH A O     1 
HETATM 3714 O  O     . HOH G 7 .   ? 1.186   59.936 55.014 1.00 20.18 ? 836 HOH A O     1 
HETATM 3715 O  O     . HOH G 7 .   ? 2.100   59.312 43.127 1.00 39.90 ? 837 HOH A O     1 
HETATM 3716 O  O     . HOH G 7 .   ? 10.513  46.248 30.397 1.00 48.65 ? 838 HOH A O     1 
HETATM 3717 O  O     . HOH G 7 .   ? 5.642   51.618 38.129 1.00 43.26 ? 839 HOH A O     1 
HETATM 3718 O  O     . HOH G 7 .   ? 11.359  48.002 72.300 1.00 29.65 ? 840 HOH A O     1 
HETATM 3719 O  O     . HOH G 7 .   ? 4.223   61.037 43.776 1.00 57.84 ? 842 HOH A O     1 
HETATM 3720 O  O     . HOH G 7 .   ? 11.235  52.594 46.696 1.00 29.43 ? 843 HOH A O     1 
HETATM 3721 O  O     . HOH G 7 .   ? 5.748   65.485 52.019 1.00 49.61 ? 844 HOH A O     1 
HETATM 3722 O  O     . HOH G 7 .   ? 20.428  40.702 62.410 1.00 38.05 ? 845 HOH A O     1 
HETATM 3723 O  O     . HOH G 7 .   ? 17.201  44.741 68.064 1.00 56.85 ? 846 HOH A O     1 
HETATM 3724 O  O     . HOH G 7 .   ? 16.499  54.311 49.366 1.00 38.92 ? 847 HOH A O     1 
HETATM 3725 O  O     . HOH G 7 .   ? 17.200  55.264 65.260 1.00 46.25 ? 848 HOH A O     1 
HETATM 3726 O  O     . HOH G 7 .   ? 15.752  57.331 55.648 1.00 42.57 ? 849 HOH A O     1 
HETATM 3727 O  O     . HOH G 7 .   ? 22.483  45.821 47.655 1.00 23.14 ? 850 HOH A O     1 
HETATM 3728 O  O     . HOH G 7 .   ? 21.234  48.358 61.791 1.00 43.76 ? 851 HOH A O     1 
HETATM 3729 O  O     . HOH G 7 .   ? -42.605 52.803 29.992 1.00 24.52 ? 852 HOH A O     1 
HETATM 3730 O  O     . HOH G 7 .   ? -22.480 22.053 35.384 1.00 54.14 ? 853 HOH A O     1 
HETATM 3731 O  O     . HOH G 7 .   ? 3.006   28.865 60.964 1.00 31.35 ? 854 HOH A O     1 
HETATM 3732 O  O     . HOH G 7 .   ? -4.250  52.230 51.990 1.00 23.59 ? 855 HOH A O     1 
HETATM 3733 O  O     . HOH G 7 .   ? -5.218  54.793 29.140 1.00 28.23 ? 856 HOH A O     1 
HETATM 3734 O  O     . HOH G 7 .   ? -42.333 51.157 38.773 1.00 39.68 ? 857 HOH A O     1 
HETATM 3735 O  O     . HOH G 7 .   ? -25.640 36.081 38.129 1.00 32.76 ? 858 HOH A O     1 
HETATM 3736 O  O     . HOH G 7 .   ? 2.464   30.855 37.530 1.00 35.61 ? 859 HOH A O     1 
HETATM 3737 O  O     . HOH G 7 .   ? 4.851   31.909 38.028 1.00 25.45 ? 860 HOH A O     1 
HETATM 3738 O  O     . HOH G 7 .   ? 4.173   29.726 40.250 1.00 40.26 ? 861 HOH A O     1 
HETATM 3739 O  O     . HOH G 7 .   ? 8.213   33.120 53.890 1.00 45.21 ? 862 HOH A O     1 
HETATM 3740 O  O     . HOH G 7 .   ? -2.242  52.040 42.975 1.00 29.81 ? 863 HOH A O     1 
HETATM 3741 O  O     . HOH G 7 .   ? -0.503  53.530 44.260 1.00 26.47 ? 864 HOH A O     1 
HETATM 3742 O  O     . HOH G 7 .   ? -0.783  55.426 41.617 1.00 33.62 ? 865 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   1   GLY GLY A . n 
A 1 2   ASN 2   2   2   ASN ASN A . n 
A 1 3   ASN 3   3   3   ASN ASN A . n 
A 1 4   VAL 4   4   4   VAL VAL A . n 
A 1 5   VAL 5   5   5   VAL VAL A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   GLY 8   8   8   GLY GLY A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  GLN 10  10  10  GLN GLN A . n 
A 1 11  TRP 11  11  11  TRP TRP A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  ASP 13  13  13  ASP ASP A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  TYR 29  29  29  TYR TYR A . n 
A 1 30  VAL 30  30  30  VAL VAL A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  ARG 32  32  32  ARG ARG A . n 
A 1 33  TYR 33  33  33  TYR TYR A . n 
A 1 34  GLN 34  34  34  GLN GLN A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  HIS 37  37  37  HIS HIS A . n 
A 1 38  ASN 38  38  38  ASN ASN A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  HIS 41  41  41  HIS HIS A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  ASN 46  46  46  ASN ASN A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  HIS 53  53  53  HIS HIS A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  ILE 55  55  55  ILE ILE A . n 
A 1 56  PRO 56  56  56  PRO PRO A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  ILE 59  59  59  ILE ILE A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ARG 61  61  61  ARG ARG A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  ASN 63  63  63  ASN ASN A . n 
A 1 64  VAL 64  64  64  VAL VAL A . n 
A 1 65  THR 65  65  65  THR THR A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  GLY 69  69  69  GLY GLY A . n 
A 1 70  ASN 70  70  70  ASN ASN A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  ALA 77  77  77  ALA ALA A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  MET 80  80  80  MET MET A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  GLU 85  85  85  GLU GLU A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  ASP 88  88  88  ASP ASP A . n 
A 1 89  ARG 89  89  89  ARG ARG A . n 
A 1 90  GLY 90  90  90  GLY GLY A . n 
A 1 91  ILE 91  91  91  ILE ILE A . n 
A 1 92  PRO 92  92  92  PRO PRO A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  ARG 94  94  94  ARG ARG A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  ARG 96  96  96  ARG ARG A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 SER 100 100 100 SER SER A . n 
A 1 101 GLU 101 101 101 GLU GLU A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 CYS 103 103 103 CYS CYS A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 ASP 108 108 108 ASP ASP A . n 
A 1 109 TYR 109 109 109 TYR TYR A . n 
A 1 110 HIS 110 110 110 HIS HIS A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 ASP 114 114 114 ASP ASP A . n 
A 1 115 ASN 115 115 115 ASN ASN A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 ARG 117 117 117 ARG ARG A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 ARG 121 121 121 ARG ARG A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 LYS 124 124 124 LYS LYS A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 ILE 126 126 126 ILE ILE A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 THR 128 128 128 THR THR A . n 
A 1 129 THR 129 129 129 THR THR A . n 
A 1 130 GLY 130 130 130 GLY GLY A . n 
A 1 131 ARG 131 131 131 ARG ARG A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 ILE 133 133 133 ILE ILE A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 PRO 135 135 135 PRO PRO A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 ASP 139 139 139 ASP ASP A . n 
A 1 140 LYS 140 140 140 LYS LYS A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 ALA 142 142 142 ALA ALA A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 ARG 144 144 144 ARG ARG A . n 
A 1 145 GLY 145 145 145 GLY GLY A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 ARG 147 147 147 ARG ARG A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 ASP 153 153 153 ASP ASP A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 PHE 157 157 157 PHE PHE A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 GLU 159 159 159 GLU GLU A . n 
A 1 160 LYS 160 160 160 LYS LYS A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 LYS 162 162 162 LYS LYS A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 MET 165 165 165 MET MET A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 TYR 167 167 167 TYR TYR A . n 
A 1 168 HIS 168 168 168 HIS HIS A . n 
A 1 169 ASN 169 169 169 ASN ASN A . n 
A 1 170 PHE 170 170 170 PHE PHE A . n 
A 1 171 GLN 171 171 171 GLN GLN A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 ASN 174 174 174 ASN ASN A . n 
A 1 175 TYR 175 175 175 TYR TYR A . n 
A 1 176 TYR 176 176 176 TYR TYR A . n 
A 1 177 LYS 177 177 177 LYS LYS A . n 
A 1 178 ALA 178 178 178 ALA ALA A . n 
A 1 179 GLU 179 179 179 GLU GLU A . n 
A 1 180 ALA 180 180 180 ALA ALA A . n 
A 1 181 VAL 181 181 181 VAL VAL A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 TYR 183 183 183 TYR TYR A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 LYS 185 185 185 LYS LYS A . n 
A 1 186 VAL 186 186 186 VAL VAL A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 ASP 188 188 188 ASP ASP A . n 
A 1 189 ASP 189 189 189 ASP ASP A . n 
A 1 190 THR 190 190 190 THR THR A . n 
A 1 191 MET 191 191 191 MET MET A . n 
A 1 192 ALA 192 192 192 ALA ALA A . n 
A 1 193 VAL 193 193 193 VAL VAL A . n 
A 1 194 ALA 194 194 194 ALA ALA A . n 
A 1 195 ASP 195 195 195 ASP ASP A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 SER 199 199 199 SER SER A . n 
A 1 200 MET 200 200 200 MET MET A . n 
A 1 201 VAL 201 201 201 VAL VAL A . n 
A 1 202 VAL 202 202 202 VAL VAL A . n 
A 1 203 ASP 203 203 203 ASP ASP A . n 
A 1 204 VAL 204 204 204 VAL VAL A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 ASP 206 206 206 ASP ASP A . n 
A 1 207 LEU 207 207 207 LEU LEU A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 ASP 209 209 209 ASP ASP A . n 
A 1 210 GLN 210 210 210 GLN GLN A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 ARG 212 212 212 ARG ARG A . n 
A 1 213 GLN 213 213 213 GLN GLN A . n 
A 1 214 ARG 214 214 214 ARG ARG A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 ASP 216 216 216 ASP ASP A . n 
A 1 217 PHE 217 217 217 PHE PHE A . n 
A 1 218 VAL 218 218 218 VAL VAL A . n 
A 1 219 MET 219 219 219 MET MET A . n 
A 1 220 PHE 220 220 220 PHE PHE A . n 
A 1 221 GLU 221 221 221 GLU GLU A . n 
A 1 222 GLY 222 222 222 GLY GLY A . n 
A 1 223 ALA 223 223 223 ALA ALA A . n 
A 1 224 GLN 224 224 224 GLN GLN A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 THR 226 226 226 THR THR A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 ASP 229 229 229 ASP ASP A . n 
A 1 230 ILE 230 230 230 ILE ILE A . n 
A 1 231 ASP 231 231 231 ASP ASP A . n 
A 1 232 HIS 232 232 232 HIS HIS A . n 
A 1 233 GLY 233 233 233 GLY GLY A . n 
A 1 234 THR 234 234 234 THR THR A . n 
A 1 235 TYR 235 235 235 TYR TYR A . n 
A 1 236 PRO 236 236 236 PRO PRO A . n 
A 1 237 TYR 237 237 237 TYR TYR A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 THR 239 239 239 THR THR A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 ASN 242 242 242 ASN ASN A . n 
A 1 243 THR 243 243 243 THR THR A . n 
A 1 244 THR 244 244 244 THR THR A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 GLY 246 246 246 GLY GLY A . n 
A 1 247 GLY 247 247 247 GLY GLY A . n 
A 1 248 VAL 248 248 248 VAL VAL A . n 
A 1 249 ALA 249 249 249 ALA ALA A . n 
A 1 250 THR 250 250 250 THR THR A . n 
A 1 251 GLY 251 251 251 GLY GLY A . n 
A 1 252 SER 252 252 252 SER SER A . n 
A 1 253 GLY 253 253 253 GLY GLY A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 GLY 255 255 255 GLY GLY A . n 
A 1 256 PRO 256 256 256 PRO PRO A . n 
A 1 257 ARG 257 257 257 ARG ARG A . n 
A 1 258 TYR 258 258 258 TYR TYR A . n 
A 1 259 VAL 259 259 259 VAL VAL A . n 
A 1 260 ASP 260 260 260 ASP ASP A . n 
A 1 261 TYR 261 261 261 TYR TYR A . n 
A 1 262 VAL 262 262 262 VAL VAL A . n 
A 1 263 LEU 263 263 263 LEU LEU A . n 
A 1 264 GLY 264 264 264 GLY GLY A . n 
A 1 265 ILE 265 265 265 ILE ILE A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 LYS 267 267 267 LYS LYS A . n 
A 1 268 ALA 268 268 268 ALA ALA A . n 
A 1 269 TYR 269 269 269 TYR TYR A . n 
A 1 270 SER 270 270 270 SER SER A . n 
A 1 271 THR 271 271 271 THR THR A . n 
A 1 272 ARG 272 272 272 ARG ARG A . n 
A 1 273 VAL 273 273 273 VAL VAL A . n 
A 1 274 GLY 274 274 274 GLY GLY A . n 
A 1 275 ALA 275 275 275 ALA ALA A . n 
A 1 276 GLY 276 276 276 GLY GLY A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 PHE 278 278 278 PHE PHE A . n 
A 1 279 PRO 279 279 279 PRO PRO A . n 
A 1 280 THR 280 280 280 THR THR A . n 
A 1 281 GLU 281 281 281 GLU GLU A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PHE 283 283 283 PHE PHE A . n 
A 1 284 ASP 284 284 284 ASP ASP A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 THR 286 286 286 THR THR A . n 
A 1 287 GLY 287 287 287 GLY GLY A . n 
A 1 288 GLU 288 288 288 GLU GLU A . n 
A 1 289 PHE 289 289 289 PHE PHE A . n 
A 1 290 LEU 290 290 290 LEU LEU A . n 
A 1 291 CYS 291 291 291 CYS CYS A . n 
A 1 292 LYS 292 292 292 LYS LYS A . n 
A 1 293 GLN 293 293 293 GLN GLN A . n 
A 1 294 GLY 294 294 294 GLY GLY A . n 
A 1 295 ASN 295 295 295 ASN ASN A . n 
A 1 296 GLU 296 296 296 GLU GLU A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 THR 300 300 300 THR THR A . n 
A 1 301 THR 301 301 301 THR THR A . n 
A 1 302 GLY 302 302 302 GLY GLY A . n 
A 1 303 ARG 303 303 303 ARG ARG A . n 
A 1 304 ARG 304 304 304 ARG ARG A . n 
A 1 305 ARG 305 305 305 ARG ARG A . n 
A 1 306 ARG 306 306 306 ARG ARG A . n 
A 1 307 THR 307 307 307 THR THR A . n 
A 1 308 GLY 308 308 308 GLY GLY A . n 
A 1 309 TRP 309 309 309 TRP TRP A . n 
A 1 310 LEU 310 310 310 LEU LEU A . n 
A 1 311 ASP 311 311 311 ASP ASP A . n 
A 1 312 THR 312 312 312 THR THR A . n 
A 1 313 VAL 313 313 313 VAL VAL A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 VAL 315 315 315 VAL VAL A . n 
A 1 316 ARG 316 316 316 ARG ARG A . n 
A 1 317 ARG 317 317 317 ARG ARG A . n 
A 1 318 ALA 318 318 318 ALA ALA A . n 
A 1 319 VAL 319 319 319 VAL VAL A . n 
A 1 320 GLN 320 320 320 GLN GLN A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 ASN 322 322 322 ASN ASN A . n 
A 1 323 SER 323 323 323 SER SER A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 SER 325 325 325 SER SER A . n 
A 1 326 GLY 326 326 326 GLY GLY A . n 
A 1 327 PHE 327 327 327 PHE PHE A . n 
A 1 328 CYS 328 328 328 CYS CYS A . n 
A 1 329 LEU 329 329 329 LEU LEU A . n 
A 1 330 THR 330 330 330 THR THR A . n 
A 1 331 LYS 331 331 331 LYS LYS A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 ASP 333 333 333 ASP ASP A . n 
A 1 334 VAL 334 334 334 VAL VAL A . n 
A 1 335 LEU 335 335 335 LEU LEU A . n 
A 1 336 ASP 336 336 336 ASP ASP A . n 
A 1 337 GLY 337 337 337 GLY GLY A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 LYS 339 339 339 LYS LYS A . n 
A 1 340 GLU 340 340 340 GLU GLU A . n 
A 1 341 VAL 341 341 341 VAL VAL A . n 
A 1 342 LYS 342 342 342 LYS LYS A . n 
A 1 343 LEU 343 343 343 LEU LEU A . n 
A 1 344 CYS 344 344 344 CYS CYS A . n 
A 1 345 VAL 345 345 345 VAL VAL A . n 
A 1 346 ALA 346 346 346 ALA ALA A . n 
A 1 347 TYR 347 347 347 TYR TYR A . n 
A 1 348 ARG 348 348 348 ARG ARG A . n 
A 1 349 MET 349 349 349 MET MET A . n 
A 1 350 PRO 350 350 350 PRO PRO A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 GLY 352 352 352 GLY GLY A . n 
A 1 353 ARG 353 353 353 ARG ARG A . n 
A 1 354 GLU 354 354 354 GLU GLU A . n 
A 1 355 VAL 355 355 355 VAL VAL A . n 
A 1 356 THR 356 356 356 THR THR A . n 
A 1 357 THR 357 357 357 THR THR A . n 
A 1 358 THR 358 358 358 THR THR A . n 
A 1 359 PRO 359 359 359 PRO PRO A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 ALA 362 362 362 ALA ALA A . n 
A 1 363 ASP 363 363 363 ASP ASP A . n 
A 1 364 ASP 364 364 364 ASP ASP A . n 
A 1 365 TRP 365 365 365 TRP TRP A . n 
A 1 366 LYS 366 366 366 LYS LYS A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 VAL 368 368 368 VAL VAL A . n 
A 1 369 GLU 369 369 369 GLU GLU A . n 
A 1 370 PRO 370 370 370 PRO PRO A . n 
A 1 371 ILE 371 371 371 ILE ILE A . n 
A 1 372 TYR 372 372 372 TYR TYR A . n 
A 1 373 GLU 373 373 373 GLU GLU A . n 
A 1 374 THR 374 374 374 THR THR A . n 
A 1 375 MET 375 375 375 MET MET A . n 
A 1 376 PRO 376 376 376 PRO PRO A . n 
A 1 377 GLY 377 377 377 GLY GLY A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 SER 379 379 379 SER SER A . n 
A 1 380 GLU 380 380 380 GLU GLU A . n 
A 1 381 SER 381 381 381 SER SER A . n 
A 1 382 THR 382 382 382 THR THR A . n 
A 1 383 PHE 383 383 383 PHE PHE A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 VAL 385 385 385 VAL VAL A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASP 387 387 387 ASP ASP A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 SER 389 389 389 SER SER A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 PRO 392 392 392 PRO PRO A . n 
A 1 393 GLN 393 393 393 GLN GLN A . n 
A 1 394 ALA 394 394 394 ALA ALA A . n 
A 1 395 ALA 395 395 395 ALA ALA A . n 
A 1 396 LEU 396 396 396 LEU LEU A . n 
A 1 397 ASN 397 397 397 ASN ASN A . n 
A 1 398 TYR 398 398 398 TYR TYR A . n 
A 1 399 ILE 399 399 399 ILE ILE A . n 
A 1 400 LYS 400 400 400 LYS LYS A . n 
A 1 401 ARG 401 401 401 ARG ARG A . n 
A 1 402 ILE 402 402 402 ILE ILE A . n 
A 1 403 GLU 403 403 403 GLU GLU A . n 
A 1 404 GLU 404 404 404 GLU GLU A . n 
A 1 405 LEU 405 405 405 LEU LEU A . n 
A 1 406 THR 406 406 406 THR THR A . n 
A 1 407 GLY 407 407 407 GLY GLY A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 PRO 409 409 409 PRO PRO A . n 
A 1 410 ILE 410 410 410 ILE ILE A . n 
A 1 411 ASP 411 411 411 ASP ASP A . n 
A 1 412 ILE 412 412 412 ILE ILE A . n 
A 1 413 ILE 413 413 413 ILE ILE A . n 
A 1 414 SER 414 414 414 SER SER A . n 
A 1 415 THR 415 415 415 THR THR A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 PRO 417 417 417 PRO PRO A . n 
A 1 418 ASP 418 418 418 ASP ASP A . n 
A 1 419 ARG 419 419 419 ARG ARG A . n 
A 1 420 THR 420 420 420 THR THR A . n 
A 1 421 GLU 421 421 421 GLU GLU A . n 
A 1 422 THR 422 422 422 THR THR A . n 
A 1 423 MET 423 423 423 MET MET A . n 
A 1 424 ILE 424 424 424 ILE ILE A . n 
A 1 425 LEU 425 425 425 LEU LEU A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ASP 427 427 427 ASP ASP A . n 
A 1 428 PRO 428 428 428 PRO PRO A . n 
A 1 429 PHE 429 429 429 PHE PHE A . n 
A 1 430 ASP 430 430 430 ASP ASP A . n 
A 1 431 ALA 431 431 431 ALA ALA A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NO3 1   433 433 NO3 NO3 A . 
C 3 MG  1   434 434 MG  MG  A . 
D 4 GPX 1   432 432 GPX GPX A . 
E 5 HDA 1   437 437 HDA HDA A . 
F 6 IMP 1   440 440 IMP IMP A . 
G 7 HOH 1   500 500 HOH HOH A . 
G 7 HOH 2   501 501 HOH HOH A . 
G 7 HOH 3   502 502 HOH HOH A . 
G 7 HOH 4   503 503 HOH HOH A . 
G 7 HOH 5   504 504 HOH HOH A . 
G 7 HOH 6   505 505 HOH HOH A . 
G 7 HOH 7   506 506 HOH HOH A . 
G 7 HOH 8   507 507 HOH HOH A . 
G 7 HOH 9   508 508 HOH HOH A . 
G 7 HOH 10  509 509 HOH HOH A . 
G 7 HOH 11  510 510 HOH HOH A . 
G 7 HOH 12  511 511 HOH HOH A . 
G 7 HOH 13  512 512 HOH HOH A . 
G 7 HOH 14  513 513 HOH HOH A . 
G 7 HOH 15  514 514 HOH HOH A . 
G 7 HOH 16  515 515 HOH HOH A . 
G 7 HOH 17  516 516 HOH HOH A . 
G 7 HOH 18  517 517 HOH HOH A . 
G 7 HOH 19  518 518 HOH HOH A . 
G 7 HOH 20  519 519 HOH HOH A . 
G 7 HOH 21  520 520 HOH HOH A . 
G 7 HOH 22  521 521 HOH HOH A . 
G 7 HOH 23  522 522 HOH HOH A . 
G 7 HOH 24  523 523 HOH HOH A . 
G 7 HOH 25  524 524 HOH HOH A . 
G 7 HOH 26  526 526 HOH HOH A . 
G 7 HOH 27  527 527 HOH HOH A . 
G 7 HOH 28  528 528 HOH HOH A . 
G 7 HOH 29  529 529 HOH HOH A . 
G 7 HOH 30  530 530 HOH HOH A . 
G 7 HOH 31  531 531 HOH HOH A . 
G 7 HOH 32  532 532 HOH HOH A . 
G 7 HOH 33  533 533 HOH HOH A . 
G 7 HOH 34  534 534 HOH HOH A . 
G 7 HOH 35  535 535 HOH HOH A . 
G 7 HOH 36  536 536 HOH HOH A . 
G 7 HOH 37  537 537 HOH HOH A . 
G 7 HOH 38  538 538 HOH HOH A . 
G 7 HOH 39  539 539 HOH HOH A . 
G 7 HOH 40  540 540 HOH HOH A . 
G 7 HOH 41  541 541 HOH HOH A . 
G 7 HOH 42  542 542 HOH HOH A . 
G 7 HOH 43  543 543 HOH HOH A . 
G 7 HOH 44  544 544 HOH HOH A . 
G 7 HOH 45  545 545 HOH HOH A . 
G 7 HOH 46  546 546 HOH HOH A . 
G 7 HOH 47  547 547 HOH HOH A . 
G 7 HOH 48  549 549 HOH HOH A . 
G 7 HOH 49  550 550 HOH HOH A . 
G 7 HOH 50  551 551 HOH HOH A . 
G 7 HOH 51  552 552 HOH HOH A . 
G 7 HOH 52  553 553 HOH HOH A . 
G 7 HOH 53  554 554 HOH HOH A . 
G 7 HOH 54  555 555 HOH HOH A . 
G 7 HOH 55  556 556 HOH HOH A . 
G 7 HOH 56  557 557 HOH HOH A . 
G 7 HOH 57  558 558 HOH HOH A . 
G 7 HOH 58  559 559 HOH HOH A . 
G 7 HOH 59  560 560 HOH HOH A . 
G 7 HOH 60  561 561 HOH HOH A . 
G 7 HOH 61  562 562 HOH HOH A . 
G 7 HOH 62  563 563 HOH HOH A . 
G 7 HOH 63  564 564 HOH HOH A . 
G 7 HOH 64  565 565 HOH HOH A . 
G 7 HOH 65  566 566 HOH HOH A . 
G 7 HOH 66  567 567 HOH HOH A . 
G 7 HOH 67  568 568 HOH HOH A . 
G 7 HOH 68  569 569 HOH HOH A . 
G 7 HOH 69  570 570 HOH HOH A . 
G 7 HOH 70  571 571 HOH HOH A . 
G 7 HOH 71  572 572 HOH HOH A . 
G 7 HOH 72  573 573 HOH HOH A . 
G 7 HOH 73  574 574 HOH HOH A . 
G 7 HOH 74  575 575 HOH HOH A . 
G 7 HOH 75  576 576 HOH HOH A . 
G 7 HOH 76  577 577 HOH HOH A . 
G 7 HOH 77  578 578 HOH HOH A . 
G 7 HOH 78  579 579 HOH HOH A . 
G 7 HOH 79  580 580 HOH HOH A . 
G 7 HOH 80  581 581 HOH HOH A . 
G 7 HOH 81  582 582 HOH HOH A . 
G 7 HOH 82  583 583 HOH HOH A . 
G 7 HOH 83  584 584 HOH HOH A . 
G 7 HOH 84  585 585 HOH HOH A . 
G 7 HOH 85  586 586 HOH HOH A . 
G 7 HOH 86  587 587 HOH HOH A . 
G 7 HOH 87  588 588 HOH HOH A . 
G 7 HOH 88  589 589 HOH HOH A . 
G 7 HOH 89  590 590 HOH HOH A . 
G 7 HOH 90  591 591 HOH HOH A . 
G 7 HOH 91  592 592 HOH HOH A . 
G 7 HOH 92  593 593 HOH HOH A . 
G 7 HOH 93  594 594 HOH HOH A . 
G 7 HOH 94  595 595 HOH HOH A . 
G 7 HOH 95  596 596 HOH HOH A . 
G 7 HOH 96  597 597 HOH HOH A . 
G 7 HOH 97  598 598 HOH HOH A . 
G 7 HOH 98  599 599 HOH HOH A . 
G 7 HOH 99  600 600 HOH HOH A . 
G 7 HOH 100 601 601 HOH HOH A . 
G 7 HOH 101 602 602 HOH HOH A . 
G 7 HOH 102 603 603 HOH HOH A . 
G 7 HOH 103 604 604 HOH HOH A . 
G 7 HOH 104 605 605 HOH HOH A . 
G 7 HOH 105 606 606 HOH HOH A . 
G 7 HOH 106 607 607 HOH HOH A . 
G 7 HOH 107 608 608 HOH HOH A . 
G 7 HOH 108 609 609 HOH HOH A . 
G 7 HOH 109 610 610 HOH HOH A . 
G 7 HOH 110 611 611 HOH HOH A . 
G 7 HOH 111 612 612 HOH HOH A . 
G 7 HOH 112 613 613 HOH HOH A . 
G 7 HOH 113 614 614 HOH HOH A . 
G 7 HOH 114 615 615 HOH HOH A . 
G 7 HOH 115 616 616 HOH HOH A . 
G 7 HOH 116 617 617 HOH HOH A . 
G 7 HOH 117 618 618 HOH HOH A . 
G 7 HOH 118 619 619 HOH HOH A . 
G 7 HOH 119 620 620 HOH HOH A . 
G 7 HOH 120 621 621 HOH HOH A . 
G 7 HOH 121 622 622 HOH HOH A . 
G 7 HOH 122 623 623 HOH HOH A . 
G 7 HOH 123 624 624 HOH HOH A . 
G 7 HOH 124 625 625 HOH HOH A . 
G 7 HOH 125 626 626 HOH HOH A . 
G 7 HOH 126 627 627 HOH HOH A . 
G 7 HOH 127 628 628 HOH HOH A . 
G 7 HOH 128 630 630 HOH HOH A . 
G 7 HOH 129 631 631 HOH HOH A . 
G 7 HOH 130 632 632 HOH HOH A . 
G 7 HOH 131 633 633 HOH HOH A . 
G 7 HOH 132 635 635 HOH HOH A . 
G 7 HOH 133 636 636 HOH HOH A . 
G 7 HOH 134 637 637 HOH HOH A . 
G 7 HOH 135 638 638 HOH HOH A . 
G 7 HOH 136 639 639 HOH HOH A . 
G 7 HOH 137 640 640 HOH HOH A . 
G 7 HOH 138 641 641 HOH HOH A . 
G 7 HOH 139 642 642 HOH HOH A . 
G 7 HOH 140 643 643 HOH HOH A . 
G 7 HOH 141 644 644 HOH HOH A . 
G 7 HOH 142 645 645 HOH HOH A . 
G 7 HOH 143 646 646 HOH HOH A . 
G 7 HOH 144 647 647 HOH HOH A . 
G 7 HOH 145 648 648 HOH HOH A . 
G 7 HOH 146 649 649 HOH HOH A . 
G 7 HOH 147 650 650 HOH HOH A . 
G 7 HOH 148 651 651 HOH HOH A . 
G 7 HOH 149 652 652 HOH HOH A . 
G 7 HOH 150 653 653 HOH HOH A . 
G 7 HOH 151 654 654 HOH HOH A . 
G 7 HOH 152 655 655 HOH HOH A . 
G 7 HOH 153 656 656 HOH HOH A . 
G 7 HOH 154 657 657 HOH HOH A . 
G 7 HOH 155 658 658 HOH HOH A . 
G 7 HOH 156 659 659 HOH HOH A . 
G 7 HOH 157 660 660 HOH HOH A . 
G 7 HOH 158 661 661 HOH HOH A . 
G 7 HOH 159 662 662 HOH HOH A . 
G 7 HOH 160 663 663 HOH HOH A . 
G 7 HOH 161 664 664 HOH HOH A . 
G 7 HOH 162 665 665 HOH HOH A . 
G 7 HOH 163 666 666 HOH HOH A . 
G 7 HOH 164 667 667 HOH HOH A . 
G 7 HOH 165 668 668 HOH HOH A . 
G 7 HOH 166 669 669 HOH HOH A . 
G 7 HOH 167 670 670 HOH HOH A . 
G 7 HOH 168 671 671 HOH HOH A . 
G 7 HOH 169 672 672 HOH HOH A . 
G 7 HOH 170 673 673 HOH HOH A . 
G 7 HOH 171 674 674 HOH HOH A . 
G 7 HOH 172 675 675 HOH HOH A . 
G 7 HOH 173 676 676 HOH HOH A . 
G 7 HOH 174 677 677 HOH HOH A . 
G 7 HOH 175 678 678 HOH HOH A . 
G 7 HOH 176 679 679 HOH HOH A . 
G 7 HOH 177 680 680 HOH HOH A . 
G 7 HOH 178 681 681 HOH HOH A . 
G 7 HOH 179 682 682 HOH HOH A . 
G 7 HOH 180 683 683 HOH HOH A . 
G 7 HOH 181 685 685 HOH HOH A . 
G 7 HOH 182 686 686 HOH HOH A . 
G 7 HOH 183 687 687 HOH HOH A . 
G 7 HOH 184 688 688 HOH HOH A . 
G 7 HOH 185 689 689 HOH HOH A . 
G 7 HOH 186 690 690 HOH HOH A . 
G 7 HOH 187 691 691 HOH HOH A . 
G 7 HOH 188 692 692 HOH HOH A . 
G 7 HOH 189 693 693 HOH HOH A . 
G 7 HOH 190 694 694 HOH HOH A . 
G 7 HOH 191 695 695 HOH HOH A . 
G 7 HOH 192 696 696 HOH HOH A . 
G 7 HOH 193 697 697 HOH HOH A . 
G 7 HOH 194 698 698 HOH HOH A . 
G 7 HOH 195 699 699 HOH HOH A . 
G 7 HOH 196 700 700 HOH HOH A . 
G 7 HOH 197 701 701 HOH HOH A . 
G 7 HOH 198 702 702 HOH HOH A . 
G 7 HOH 199 703 703 HOH HOH A . 
G 7 HOH 200 704 704 HOH HOH A . 
G 7 HOH 201 705 705 HOH HOH A . 
G 7 HOH 202 706 706 HOH HOH A . 
G 7 HOH 203 707 707 HOH HOH A . 
G 7 HOH 204 708 708 HOH HOH A . 
G 7 HOH 205 709 709 HOH HOH A . 
G 7 HOH 206 710 710 HOH HOH A . 
G 7 HOH 207 711 711 HOH HOH A . 
G 7 HOH 208 712 712 HOH HOH A . 
G 7 HOH 209 713 713 HOH HOH A . 
G 7 HOH 210 714 714 HOH HOH A . 
G 7 HOH 211 715 715 HOH HOH A . 
G 7 HOH 212 716 716 HOH HOH A . 
G 7 HOH 213 717 717 HOH HOH A . 
G 7 HOH 214 718 718 HOH HOH A . 
G 7 HOH 215 719 719 HOH HOH A . 
G 7 HOH 216 720 720 HOH HOH A . 
G 7 HOH 217 722 722 HOH HOH A . 
G 7 HOH 218 723 723 HOH HOH A . 
G 7 HOH 219 724 724 HOH HOH A . 
G 7 HOH 220 725 725 HOH HOH A . 
G 7 HOH 221 726 726 HOH HOH A . 
G 7 HOH 222 727 727 HOH HOH A . 
G 7 HOH 223 728 728 HOH HOH A . 
G 7 HOH 224 729 729 HOH HOH A . 
G 7 HOH 225 730 730 HOH HOH A . 
G 7 HOH 226 731 731 HOH HOH A . 
G 7 HOH 227 732 732 HOH HOH A . 
G 7 HOH 228 733 733 HOH HOH A . 
G 7 HOH 229 734 734 HOH HOH A . 
G 7 HOH 230 735 735 HOH HOH A . 
G 7 HOH 231 736 736 HOH HOH A . 
G 7 HOH 232 737 737 HOH HOH A . 
G 7 HOH 233 738 738 HOH HOH A . 
G 7 HOH 234 739 739 HOH HOH A . 
G 7 HOH 235 740 740 HOH HOH A . 
G 7 HOH 236 741 741 HOH HOH A . 
G 7 HOH 237 742 742 HOH HOH A . 
G 7 HOH 238 743 743 HOH HOH A . 
G 7 HOH 239 744 744 HOH HOH A . 
G 7 HOH 240 745 745 HOH HOH A . 
G 7 HOH 241 746 746 HOH HOH A . 
G 7 HOH 242 747 747 HOH HOH A . 
G 7 HOH 243 748 748 HOH HOH A . 
G 7 HOH 244 749 749 HOH HOH A . 
G 7 HOH 245 750 750 HOH HOH A . 
G 7 HOH 246 751 751 HOH HOH A . 
G 7 HOH 247 752 752 HOH HOH A . 
G 7 HOH 248 753 753 HOH HOH A . 
G 7 HOH 249 754 754 HOH HOH A . 
G 7 HOH 250 755 755 HOH HOH A . 
G 7 HOH 251 756 756 HOH HOH A . 
G 7 HOH 252 757 757 HOH HOH A . 
G 7 HOH 253 758 758 HOH HOH A . 
G 7 HOH 254 759 759 HOH HOH A . 
G 7 HOH 255 760 760 HOH HOH A . 
G 7 HOH 256 761 761 HOH HOH A . 
G 7 HOH 257 762 762 HOH HOH A . 
G 7 HOH 258 763 763 HOH HOH A . 
G 7 HOH 259 764 764 HOH HOH A . 
G 7 HOH 260 765 765 HOH HOH A . 
G 7 HOH 261 766 766 HOH HOH A . 
G 7 HOH 262 767 767 HOH HOH A . 
G 7 HOH 263 768 768 HOH HOH A . 
G 7 HOH 264 769 769 HOH HOH A . 
G 7 HOH 265 770 770 HOH HOH A . 
G 7 HOH 266 771 771 HOH HOH A . 
G 7 HOH 267 772 772 HOH HOH A . 
G 7 HOH 268 773 773 HOH HOH A . 
G 7 HOH 269 774 774 HOH HOH A . 
G 7 HOH 270 775 775 HOH HOH A . 
G 7 HOH 271 777 777 HOH HOH A . 
G 7 HOH 272 778 778 HOH HOH A . 
G 7 HOH 273 779 779 HOH HOH A . 
G 7 HOH 274 780 780 HOH HOH A . 
G 7 HOH 275 781 781 HOH HOH A . 
G 7 HOH 276 782 782 HOH HOH A . 
G 7 HOH 277 783 783 HOH HOH A . 
G 7 HOH 278 784 784 HOH HOH A . 
G 7 HOH 279 785 785 HOH HOH A . 
G 7 HOH 280 786 786 HOH HOH A . 
G 7 HOH 281 787 787 HOH HOH A . 
G 7 HOH 282 788 788 HOH HOH A . 
G 7 HOH 283 789 789 HOH HOH A . 
G 7 HOH 284 790 790 HOH HOH A . 
G 7 HOH 285 791 791 HOH HOH A . 
G 7 HOH 286 792 792 HOH HOH A . 
G 7 HOH 287 793 793 HOH HOH A . 
G 7 HOH 288 794 794 HOH HOH A . 
G 7 HOH 289 795 795 HOH HOH A . 
G 7 HOH 290 797 797 HOH HOH A . 
G 7 HOH 291 798 798 HOH HOH A . 
G 7 HOH 292 799 799 HOH HOH A . 
G 7 HOH 293 800 800 HOH HOH A . 
G 7 HOH 294 801 801 HOH HOH A . 
G 7 HOH 295 802 802 HOH HOH A . 
G 7 HOH 296 804 804 HOH HOH A . 
G 7 HOH 297 805 805 HOH HOH A . 
G 7 HOH 298 806 806 HOH HOH A . 
G 7 HOH 299 807 807 HOH HOH A . 
G 7 HOH 300 808 808 HOH HOH A . 
G 7 HOH 301 809 809 HOH HOH A . 
G 7 HOH 302 810 810 HOH HOH A . 
G 7 HOH 303 811 811 HOH HOH A . 
G 7 HOH 304 812 812 HOH HOH A . 
G 7 HOH 305 814 814 HOH HOH A . 
G 7 HOH 306 815 815 HOH HOH A . 
G 7 HOH 307 816 816 HOH HOH A . 
G 7 HOH 308 818 818 HOH HOH A . 
G 7 HOH 309 819 819 HOH HOH A . 
G 7 HOH 310 820 820 HOH HOH A . 
G 7 HOH 311 821 821 HOH HOH A . 
G 7 HOH 312 822 822 HOH HOH A . 
G 7 HOH 313 823 823 HOH HOH A . 
G 7 HOH 314 824 824 HOH HOH A . 
G 7 HOH 315 825 825 HOH HOH A . 
G 7 HOH 316 826 826 HOH HOH A . 
G 7 HOH 317 827 827 HOH HOH A . 
G 7 HOH 318 828 828 HOH HOH A . 
G 7 HOH 319 829 829 HOH HOH A . 
G 7 HOH 320 830 830 HOH HOH A . 
G 7 HOH 321 831 831 HOH HOH A . 
G 7 HOH 322 832 832 HOH HOH A . 
G 7 HOH 323 833 833 HOH HOH A . 
G 7 HOH 324 834 834 HOH HOH A . 
G 7 HOH 325 835 835 HOH HOH A . 
G 7 HOH 326 836 836 HOH HOH A . 
G 7 HOH 327 837 837 HOH HOH A . 
G 7 HOH 328 838 838 HOH HOH A . 
G 7 HOH 329 839 839 HOH HOH A . 
G 7 HOH 330 840 840 HOH HOH A . 
G 7 HOH 331 842 842 HOH HOH A . 
G 7 HOH 332 843 843 HOH HOH A . 
G 7 HOH 333 844 844 HOH HOH A . 
G 7 HOH 334 845 845 HOH HOH A . 
G 7 HOH 335 846 846 HOH HOH A . 
G 7 HOH 336 847 847 HOH HOH A . 
G 7 HOH 337 848 848 HOH HOH A . 
G 7 HOH 338 849 849 HOH HOH A . 
G 7 HOH 339 850 850 HOH HOH A . 
G 7 HOH 340 851 851 HOH HOH A . 
G 7 HOH 341 852 852 HOH HOH A . 
G 7 HOH 342 853 853 HOH HOH A . 
G 7 HOH 343 854 854 HOH HOH A . 
G 7 HOH 344 855 855 HOH HOH A . 
G 7 HOH 345 856 856 HOH HOH A . 
G 7 HOH 346 857 857 HOH HOH A . 
G 7 HOH 347 858 858 HOH HOH A . 
G 7 HOH 348 859 859 HOH HOH A . 
G 7 HOH 349 860 860 HOH HOH A . 
G 7 HOH 350 861 861 HOH HOH A . 
G 7 HOH 351 862 862 HOH HOH A . 
G 7 HOH 352 863 863 HOH HOH A . 
G 7 HOH 353 864 864 HOH HOH A . 
G 7 HOH 354 865 865 HOH HOH A . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 software_defined_assembly PISA monomeric 1 
2 software_defined_assembly PQS  dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F,G 
2 1,2 A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z          1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  
1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 6_555 -x,-x+y,-z+2/3 -0.5000000000 -0.8662140575 0.0000000000 0.0000000000 -0.8658367911 
0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 105.6524035922 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 13 ? A ASP 13  ? 1_555 MG ? C MG . ? A MG 434 ? 1_555 O   ? A GLY 40 ? A GLY 40  ? 1_555 163.0 ? 
2  OD1 ? A ASP 13 ? A ASP 13  ? 1_555 MG ? C MG . ? A MG 434 ? 1_555 O2  ? B NO3 .  ? A NO3 433 ? 1_555 91.3  ? 
3  O   ? A GLY 40 ? A GLY 40  ? 1_555 MG ? C MG . ? A MG 434 ? 1_555 O2  ? B NO3 .  ? A NO3 433 ? 1_555 87.0  ? 
4  OD1 ? A ASP 13 ? A ASP 13  ? 1_555 MG ? C MG . ? A MG 434 ? 1_555 O1A ? D GPX .  ? A GPX 432 ? 1_555 101.2 ? 
5  O   ? A GLY 40 ? A GLY 40  ? 1_555 MG ? C MG . ? A MG 434 ? 1_555 O1A ? D GPX .  ? A GPX 432 ? 1_555 85.9  ? 
6  O2  ? B NO3 .  ? A NO3 433 ? 1_555 MG ? C MG . ? A MG 434 ? 1_555 O1A ? D GPX .  ? A GPX 432 ? 1_555 158.3 ? 
7  OD1 ? A ASP 13 ? A ASP 13  ? 1_555 MG ? C MG . ? A MG 434 ? 1_555 O2B ? D GPX .  ? A GPX 432 ? 1_555 101.9 ? 
8  O   ? A GLY 40 ? A GLY 40  ? 1_555 MG ? C MG . ? A MG 434 ? 1_555 O2B ? D GPX .  ? A GPX 432 ? 1_555 94.7  ? 
9  O2  ? B NO3 .  ? A NO3 433 ? 1_555 MG ? C MG . ? A MG 434 ? 1_555 O2B ? D GPX .  ? A GPX 432 ? 1_555 82.3  ? 
10 O1A ? D GPX .  ? A GPX 432 ? 1_555 MG ? C MG . ? A MG 434 ? 1_555 O2B ? D GPX .  ? A GPX 432 ? 1_555 77.9  ? 
11 OD1 ? A ASP 13 ? A ASP 13  ? 1_555 MG ? C MG . ? A MG 434 ? 1_555 O   ? E HDA .  ? A HDA 437 ? 1_555 87.9  ? 
12 O   ? A GLY 40 ? A GLY 40  ? 1_555 MG ? C MG . ? A MG 434 ? 1_555 O   ? E HDA .  ? A HDA 437 ? 1_555 75.5  ? 
13 O2  ? B NO3 .  ? A NO3 433 ? 1_555 MG ? C MG . ? A MG 434 ? 1_555 O   ? E HDA .  ? A HDA 437 ? 1_555 97.1  ? 
14 O1A ? D GPX .  ? A GPX 432 ? 1_555 MG ? C MG . ? A MG 434 ? 1_555 O   ? E HDA .  ? A HDA 437 ? 1_555 100.9 ? 
15 O2B ? D GPX .  ? A GPX 432 ? 1_555 MG ? C MG . ? A MG 434 ? 1_555 O   ? E HDA .  ? A HDA 437 ? 1_555 170.2 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-12-29 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' .   ? 1 
X-PLOR refinement       3.1 ? 2 
X-GEN  'data reduction' .   ? 3 
X-GEN  'data scaling'   .   ? 4 
X-PLOR phasing          .   ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 10  ? ? -119.58 -110.26 
2  1 HIS A 53  ? ? -135.24 -73.26  
3  1 SER A 57  ? ? -73.90  37.82   
4  1 GLN A 224 ? ? 48.17   -141.41 
5  1 SER A 252 ? ? -143.81 -38.69  
6  1 ALA A 268 ? ? -44.95  -19.59  
7  1 PHE A 278 ? ? -154.34 81.82   
8  1 ASP A 284 ? ? -79.63  -156.72 
9  1 ASN A 295 ? ? 30.49   57.45   
10 1 LEU A 360 ? ? -90.33  -83.73  
11 1 LYS A 366 ? ? -32.30  -75.90  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'NITRATE ION'                                         NO3 
3 'MAGNESIUM ION'                                       MG  
4 
;GUANOSINE 5'-DIPHOSPHATE 2':3'-CYCLIC MONOPHOSPHATE
;
GPX 
5 HADACIDIN                                             HDA 
6 'INOSINIC ACID'                                       IMP 
7 water                                                 HOH 
#