data_1CK7
# 
_entry.id   1CK7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1CK7         pdb_00001ck7 10.2210/pdb1ck7/pdb 
RCSB  RCSB000963   ?            ?                   
WWPDB D_1000000963 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1CK7 
_pdbx_database_status.recvd_initial_deposition_date   1999-04-28 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Morgunova, E.'  1 
'Tuuttila, A.'   2 
'Bergmann, U.'   3 
'Isupov, M.'     4 
'Lindqvist, Y.'  5 
'Schneider, G.'  6 
'Tryggvason, K.' 7 
# 
_citation.id                        primary 
_citation.title                     'Structure of human pro-matrix metalloproteinase-2: activation mechanism revealed.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            284 
_citation.page_first                1667 
_citation.page_last                 1670 
_citation.year                      1999 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10356396 
_citation.pdbx_database_id_DOI      10.1126/science.284.5420.1667 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Morgunova, E.'  1 ? 
primary 'Tuuttila, A.'   2 ? 
primary 'Bergmann, U.'   3 ? 
primary 'Isupov, M.'     4 ? 
primary 'Lindqvist, Y.'  5 ? 
primary 'Schneider, G.'  6 ? 
primary 'Tryggvason, K.' 7 ? 
# 
_cell.entry_id           1CK7 
_cell.length_a           121.320 
_cell.length_b           121.320 
_cell.length_c           345.110 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1CK7 
_symmetry.space_group_name_H-M             'I 41 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                98 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN (GELATINASE A)' 70995.406 1   3.4.24.24 E404A FULL-LENGTH ? 
2 non-polymer syn 'ZINC ION'               65.409    2   ?         ?     ?           ? 
3 non-polymer syn 'CALCIUM ION'            40.078    3   ?         ?     ?           ? 
4 non-polymer syn 'CHLORIDE ION'           35.453    1   ?         ?     ?           ? 
5 non-polymer syn 'SODIUM ION'             22.990    1   ?         ?     ?           ? 
6 non-polymer syn 'SULFATE ION'            96.063    2   ?         ?     ?           ? 
7 water       nat water                    18.015    104 ?         ?     ?           ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'MMP-2,72KD TYPE IV COLLAGENASE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVAN
YNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDG
LLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDG
KYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPC
VFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHAFGHAMGLEHSQDPGALMAPIYTYTK
NFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLV
ATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFW
RYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVAN
YNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDG
LLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDG
KYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPC
VFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHAFGHAMGLEHSQDPGALMAPIYTYTK
NFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLV
ATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFW
RYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PRO n 
1 3   SER n 
1 4   PRO n 
1 5   ILE n 
1 6   ILE n 
1 7   LYS n 
1 8   PHE n 
1 9   PRO n 
1 10  GLY n 
1 11  ASP n 
1 12  VAL n 
1 13  ALA n 
1 14  PRO n 
1 15  LYS n 
1 16  THR n 
1 17  ASP n 
1 18  LYS n 
1 19  GLU n 
1 20  LEU n 
1 21  ALA n 
1 22  VAL n 
1 23  GLN n 
1 24  TYR n 
1 25  LEU n 
1 26  ASN n 
1 27  THR n 
1 28  PHE n 
1 29  TYR n 
1 30  GLY n 
1 31  CYS n 
1 32  PRO n 
1 33  LYS n 
1 34  GLU n 
1 35  SER n 
1 36  CYS n 
1 37  ASN n 
1 38  LEU n 
1 39  PHE n 
1 40  VAL n 
1 41  LEU n 
1 42  LYS n 
1 43  ASP n 
1 44  THR n 
1 45  LEU n 
1 46  LYS n 
1 47  LYS n 
1 48  MET n 
1 49  GLN n 
1 50  LYS n 
1 51  PHE n 
1 52  PHE n 
1 53  GLY n 
1 54  LEU n 
1 55  PRO n 
1 56  GLN n 
1 57  THR n 
1 58  GLY n 
1 59  ASP n 
1 60  LEU n 
1 61  ASP n 
1 62  GLN n 
1 63  ASN n 
1 64  THR n 
1 65  ILE n 
1 66  GLU n 
1 67  THR n 
1 68  MET n 
1 69  ARG n 
1 70  LYS n 
1 71  PRO n 
1 72  ARG n 
1 73  CYS n 
1 74  GLY n 
1 75  ASN n 
1 76  PRO n 
1 77  ASP n 
1 78  VAL n 
1 79  ALA n 
1 80  ASN n 
1 81  TYR n 
1 82  ASN n 
1 83  PHE n 
1 84  PHE n 
1 85  PRO n 
1 86  ARG n 
1 87  LYS n 
1 88  PRO n 
1 89  LYS n 
1 90  TRP n 
1 91  ASP n 
1 92  LYS n 
1 93  ASN n 
1 94  GLN n 
1 95  ILE n 
1 96  THR n 
1 97  TYR n 
1 98  ARG n 
1 99  ILE n 
1 100 ILE n 
1 101 GLY n 
1 102 TYR n 
1 103 THR n 
1 104 PRO n 
1 105 ASP n 
1 106 LEU n 
1 107 ASP n 
1 108 PRO n 
1 109 GLU n 
1 110 THR n 
1 111 VAL n 
1 112 ASP n 
1 113 ASP n 
1 114 ALA n 
1 115 PHE n 
1 116 ALA n 
1 117 ARG n 
1 118 ALA n 
1 119 PHE n 
1 120 GLN n 
1 121 VAL n 
1 122 TRP n 
1 123 SER n 
1 124 ASP n 
1 125 VAL n 
1 126 THR n 
1 127 PRO n 
1 128 LEU n 
1 129 ARG n 
1 130 PHE n 
1 131 SER n 
1 132 ARG n 
1 133 ILE n 
1 134 HIS n 
1 135 ASP n 
1 136 GLY n 
1 137 GLU n 
1 138 ALA n 
1 139 ASP n 
1 140 ILE n 
1 141 MET n 
1 142 ILE n 
1 143 ASN n 
1 144 PHE n 
1 145 GLY n 
1 146 ARG n 
1 147 TRP n 
1 148 GLU n 
1 149 HIS n 
1 150 GLY n 
1 151 ASP n 
1 152 GLY n 
1 153 TYR n 
1 154 PRO n 
1 155 PHE n 
1 156 ASP n 
1 157 GLY n 
1 158 LYS n 
1 159 ASP n 
1 160 GLY n 
1 161 LEU n 
1 162 LEU n 
1 163 ALA n 
1 164 HIS n 
1 165 ALA n 
1 166 PHE n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 THR n 
1 171 GLY n 
1 172 VAL n 
1 173 GLY n 
1 174 GLY n 
1 175 ASP n 
1 176 SER n 
1 177 HIS n 
1 178 PHE n 
1 179 ASP n 
1 180 ASP n 
1 181 ASP n 
1 182 GLU n 
1 183 LEU n 
1 184 TRP n 
1 185 THR n 
1 186 LEU n 
1 187 GLY n 
1 188 GLU n 
1 189 GLY n 
1 190 GLN n 
1 191 VAL n 
1 192 VAL n 
1 193 ARG n 
1 194 VAL n 
1 195 LYS n 
1 196 TYR n 
1 197 GLY n 
1 198 ASN n 
1 199 ALA n 
1 200 ASP n 
1 201 GLY n 
1 202 GLU n 
1 203 TYR n 
1 204 CYS n 
1 205 LYS n 
1 206 PHE n 
1 207 PRO n 
1 208 PHE n 
1 209 LEU n 
1 210 PHE n 
1 211 ASN n 
1 212 GLY n 
1 213 LYS n 
1 214 GLU n 
1 215 TYR n 
1 216 ASN n 
1 217 SER n 
1 218 CYS n 
1 219 THR n 
1 220 ASP n 
1 221 THR n 
1 222 GLY n 
1 223 ARG n 
1 224 SER n 
1 225 ASP n 
1 226 GLY n 
1 227 PHE n 
1 228 LEU n 
1 229 TRP n 
1 230 CYS n 
1 231 SER n 
1 232 THR n 
1 233 THR n 
1 234 TYR n 
1 235 ASN n 
1 236 PHE n 
1 237 GLU n 
1 238 LYS n 
1 239 ASP n 
1 240 GLY n 
1 241 LYS n 
1 242 TYR n 
1 243 GLY n 
1 244 PHE n 
1 245 CYS n 
1 246 PRO n 
1 247 HIS n 
1 248 GLU n 
1 249 ALA n 
1 250 LEU n 
1 251 PHE n 
1 252 THR n 
1 253 MET n 
1 254 GLY n 
1 255 GLY n 
1 256 ASN n 
1 257 ALA n 
1 258 GLU n 
1 259 GLY n 
1 260 GLN n 
1 261 PRO n 
1 262 CYS n 
1 263 LYS n 
1 264 PHE n 
1 265 PRO n 
1 266 PHE n 
1 267 ARG n 
1 268 PHE n 
1 269 GLN n 
1 270 GLY n 
1 271 THR n 
1 272 SER n 
1 273 TYR n 
1 274 ASP n 
1 275 SER n 
1 276 CYS n 
1 277 THR n 
1 278 THR n 
1 279 GLU n 
1 280 GLY n 
1 281 ARG n 
1 282 THR n 
1 283 ASP n 
1 284 GLY n 
1 285 TYR n 
1 286 ARG n 
1 287 TRP n 
1 288 CYS n 
1 289 GLY n 
1 290 THR n 
1 291 THR n 
1 292 GLU n 
1 293 ASP n 
1 294 TYR n 
1 295 ASP n 
1 296 ARG n 
1 297 ASP n 
1 298 LYS n 
1 299 LYS n 
1 300 TYR n 
1 301 GLY n 
1 302 PHE n 
1 303 CYS n 
1 304 PRO n 
1 305 GLU n 
1 306 THR n 
1 307 ALA n 
1 308 MET n 
1 309 SER n 
1 310 THR n 
1 311 VAL n 
1 312 GLY n 
1 313 GLY n 
1 314 ASN n 
1 315 SER n 
1 316 GLU n 
1 317 GLY n 
1 318 ALA n 
1 319 PRO n 
1 320 CYS n 
1 321 VAL n 
1 322 PHE n 
1 323 PRO n 
1 324 PHE n 
1 325 THR n 
1 326 PHE n 
1 327 LEU n 
1 328 GLY n 
1 329 ASN n 
1 330 LYS n 
1 331 TYR n 
1 332 GLU n 
1 333 SER n 
1 334 CYS n 
1 335 THR n 
1 336 SER n 
1 337 ALA n 
1 338 GLY n 
1 339 ARG n 
1 340 SER n 
1 341 ASP n 
1 342 GLY n 
1 343 LYS n 
1 344 MET n 
1 345 TRP n 
1 346 CYS n 
1 347 ALA n 
1 348 THR n 
1 349 THR n 
1 350 ALA n 
1 351 ASN n 
1 352 TYR n 
1 353 ASP n 
1 354 ASP n 
1 355 ASP n 
1 356 ARG n 
1 357 LYS n 
1 358 TRP n 
1 359 GLY n 
1 360 PHE n 
1 361 CYS n 
1 362 PRO n 
1 363 ASP n 
1 364 GLN n 
1 365 GLY n 
1 366 TYR n 
1 367 SER n 
1 368 LEU n 
1 369 PHE n 
1 370 LEU n 
1 371 VAL n 
1 372 ALA n 
1 373 ALA n 
1 374 HIS n 
1 375 ALA n 
1 376 PHE n 
1 377 GLY n 
1 378 HIS n 
1 379 ALA n 
1 380 MET n 
1 381 GLY n 
1 382 LEU n 
1 383 GLU n 
1 384 HIS n 
1 385 SER n 
1 386 GLN n 
1 387 ASP n 
1 388 PRO n 
1 389 GLY n 
1 390 ALA n 
1 391 LEU n 
1 392 MET n 
1 393 ALA n 
1 394 PRO n 
1 395 ILE n 
1 396 TYR n 
1 397 THR n 
1 398 TYR n 
1 399 THR n 
1 400 LYS n 
1 401 ASN n 
1 402 PHE n 
1 403 ARG n 
1 404 LEU n 
1 405 SER n 
1 406 GLN n 
1 407 ASP n 
1 408 ASP n 
1 409 ILE n 
1 410 LYS n 
1 411 GLY n 
1 412 ILE n 
1 413 GLN n 
1 414 GLU n 
1 415 LEU n 
1 416 TYR n 
1 417 GLY n 
1 418 ALA n 
1 419 SER n 
1 420 PRO n 
1 421 ASP n 
1 422 ILE n 
1 423 ASP n 
1 424 LEU n 
1 425 GLY n 
1 426 THR n 
1 427 GLY n 
1 428 PRO n 
1 429 THR n 
1 430 PRO n 
1 431 THR n 
1 432 LEU n 
1 433 GLY n 
1 434 PRO n 
1 435 VAL n 
1 436 THR n 
1 437 PRO n 
1 438 GLU n 
1 439 ILE n 
1 440 CYS n 
1 441 LYS n 
1 442 GLN n 
1 443 ASP n 
1 444 ILE n 
1 445 VAL n 
1 446 PHE n 
1 447 ASP n 
1 448 GLY n 
1 449 ILE n 
1 450 ALA n 
1 451 GLN n 
1 452 ILE n 
1 453 ARG n 
1 454 GLY n 
1 455 GLU n 
1 456 ILE n 
1 457 PHE n 
1 458 PHE n 
1 459 PHE n 
1 460 LYS n 
1 461 ASP n 
1 462 ARG n 
1 463 PHE n 
1 464 ILE n 
1 465 TRP n 
1 466 ARG n 
1 467 THR n 
1 468 VAL n 
1 469 THR n 
1 470 PRO n 
1 471 ARG n 
1 472 ASP n 
1 473 LYS n 
1 474 PRO n 
1 475 MET n 
1 476 GLY n 
1 477 PRO n 
1 478 LEU n 
1 479 LEU n 
1 480 VAL n 
1 481 ALA n 
1 482 THR n 
1 483 PHE n 
1 484 TRP n 
1 485 PRO n 
1 486 GLU n 
1 487 LEU n 
1 488 PRO n 
1 489 GLU n 
1 490 LYS n 
1 491 ILE n 
1 492 ASP n 
1 493 ALA n 
1 494 VAL n 
1 495 TYR n 
1 496 GLU n 
1 497 ALA n 
1 498 PRO n 
1 499 GLN n 
1 500 GLU n 
1 501 GLU n 
1 502 LYS n 
1 503 ALA n 
1 504 VAL n 
1 505 PHE n 
1 506 PHE n 
1 507 ALA n 
1 508 GLY n 
1 509 ASN n 
1 510 GLU n 
1 511 TYR n 
1 512 TRP n 
1 513 ILE n 
1 514 TYR n 
1 515 SER n 
1 516 ALA n 
1 517 SER n 
1 518 THR n 
1 519 LEU n 
1 520 GLU n 
1 521 ARG n 
1 522 GLY n 
1 523 TYR n 
1 524 PRO n 
1 525 LYS n 
1 526 PRO n 
1 527 LEU n 
1 528 THR n 
1 529 SER n 
1 530 LEU n 
1 531 GLY n 
1 532 LEU n 
1 533 PRO n 
1 534 PRO n 
1 535 ASP n 
1 536 VAL n 
1 537 GLN n 
1 538 ARG n 
1 539 VAL n 
1 540 ASP n 
1 541 ALA n 
1 542 ALA n 
1 543 PHE n 
1 544 ASN n 
1 545 TRP n 
1 546 SER n 
1 547 LYS n 
1 548 ASN n 
1 549 LYS n 
1 550 LYS n 
1 551 THR n 
1 552 TYR n 
1 553 ILE n 
1 554 PHE n 
1 555 ALA n 
1 556 GLY n 
1 557 ASP n 
1 558 LYS n 
1 559 PHE n 
1 560 TRP n 
1 561 ARG n 
1 562 TYR n 
1 563 ASN n 
1 564 GLU n 
1 565 VAL n 
1 566 LYS n 
1 567 LYS n 
1 568 LYS n 
1 569 MET n 
1 570 ASP n 
1 571 PRO n 
1 572 GLY n 
1 573 PHE n 
1 574 PRO n 
1 575 LYS n 
1 576 LEU n 
1 577 ILE n 
1 578 ALA n 
1 579 ASP n 
1 580 ALA n 
1 581 TRP n 
1 582 ASN n 
1 583 ALA n 
1 584 ILE n 
1 585 PRO n 
1 586 ASP n 
1 587 ASN n 
1 588 LEU n 
1 589 ASP n 
1 590 ALA n 
1 591 VAL n 
1 592 VAL n 
1 593 ASP n 
1 594 LEU n 
1 595 GLN n 
1 596 GLY n 
1 597 GLY n 
1 598 GLY n 
1 599 HIS n 
1 600 SER n 
1 601 TYR n 
1 602 PHE n 
1 603 PHE n 
1 604 LYS n 
1 605 GLY n 
1 606 ALA n 
1 607 TYR n 
1 608 TYR n 
1 609 LEU n 
1 610 LYS n 
1 611 LEU n 
1 612 GLU n 
1 613 ASN n 
1 614 GLN n 
1 615 SER n 
1 616 LEU n 
1 617 LYS n 
1 618 SER n 
1 619 VAL n 
1 620 LYS n 
1 621 PHE n 
1 622 GLY n 
1 623 SER n 
1 624 ILE n 
1 625 LYS n 
1 626 SER n 
1 627 ASP n 
1 628 TRP n 
1 629 LEU n 
1 630 GLY n 
1 631 CYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'cabbage looper' 
_entity_src_gen.pdbx_host_org_scientific_name      'Trichoplusia ni' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7111 
_entity_src_gen.host_org_genus                     Trichoplusia 
_entity_src_gen.pdbx_host_org_gene                 CLG4 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'HIGH 5' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          VIRUS 
_entity_src_gen.pdbx_host_org_vector               BACULOVIRUS 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PVL1393 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MMP2_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P08253 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1CK7 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 631 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P08253 
_struct_ref_seq.db_align_beg                  30 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  660 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       30 
_struct_ref_seq.pdbx_auth_seq_align_end       660 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1CK7 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      375 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P08253 
_struct_ref_seq_dif.db_mon_id                    GLU 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          404 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            404 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'    ? 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          1CK7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.49 
_exptl_crystal.density_percent_sol   72 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.8 
_exptl_crystal_grow.pdbx_details    'pH 7.8' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   1997-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97984 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE BM02' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM02 
_diffrn_source.pdbx_wavelength             0.97984 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1CK7 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             34 
_reflns.d_resolution_high            2.8 
_reflns.number_obs                   32057 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.117 
_reflns.pdbx_netI_over_sigmaI        20.9 
_reflns.B_iso_Wilson_estimate        105 
_reflns.pdbx_redundancy              10.2 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.8 
_reflns_shell.d_res_low              2.98 
_reflns_shell.percent_possible_all   95.4 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.403 
_reflns_shell.meanI_over_sigI_obs    2.0 
_reflns_shell.pdbx_redundancy        10.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1CK7 
_refine.ls_number_reflns_obs                     30959 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             34 
_refine.ls_d_res_high                            2.8 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.286 
_refine.ls_R_factor_R_free                       0.327 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5 
_refine.ls_number_reflns_R_free                  1660 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               63.5 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;NO ELECTRON DENSITY WAS OBSERVED FOR THE N-TERMINAL RESIDUE
ALA 30 AND FOR RESIDUES ASP 450  - THR 460. PRESUMABLY THEY
ARE DISORDERED.  THESE RESIDUES ARE PART OF A FLEXIBLE
LINKAGE BETWEEN CATALYTIC CORE AND C-TERMINAL HEMOPEXIN
PARTS OF MMP-2.

RESIDUES 108 - 116 WERE MODELED INTO POOR ELECTRON DENSITY.
THE SIDE CHAIN ORIENTATIONS WERE TAKEN FROM THE ROTAMER
LIBRARY.  THESE RESIDUES ARE IN THE LOOP WHICH CONECTS
PROPEPTIDE AND CATALYTIC DOMAIN.

THE ELECTRON DENSITY FOR THE SURFACE LOOP 649 - 652 IS
WEAK, AND THE INDIVIDUAL B-FACTORS ARE RATHER HIGH.
;
_refine.pdbx_starting_model                      'PDB ENTRY 1GEN, PDB ENTRY 1FBL' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4930 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         17 
_refine_hist.number_atoms_solvent             104 
_refine_hist.number_atoms_total               5051 
_refine_hist.d_res_high                       2.8 
_refine_hist.d_res_low                        34 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.012 ? ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           0.024 ? ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         1.7   ? ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1CK7 
_struct.title                     'GELATINASE A (FULL-LENGTH)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1CK7 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE (METALLOPROTEASE), FULL-LENGTH, METALLOPROTEINASE, GELATINASE A, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 6 ? 
J N N 6 ? 
K N N 7 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  H1  THR A 16  ? TYR A 29  ? THR A 45  TYR A 58  1 ? 14 
HELX_P HELX_P2  H2  LEU A 38  ? PHE A 52  ? LEU A 67  PHE A 81  1 ? 15 
HELX_P HELX_P3  H3  GLN A 62  ? THR A 67  ? GLN A 91  THR A 96  1 ? 6  
HELX_P HELX_P4  H4  PRO A 108 ? SER A 123 ? PRO A 137 SER A 152 1 ? 16 
HELX_P HELX_P5  H5  PHE A 236 ? ASP A 239 ? PHE A 265 ASP A 268 1 ? 4  
HELX_P HELX_P6  H6  TYR A 294 ? ASP A 297 ? TYR A 323 ASP A 326 1 ? 4  
HELX_P HELX_P7  H7  ASN A 351 ? ASP A 355 ? ASN A 380 ASP A 384 1 ? 5  
HELX_P HELX_P8  H8  LEU A 368 ? MET A 380 ? LEU A 397 MET A 409 1 ? 13 
HELX_P HELX_P9  H10 ALA A 481 ? PHE A 483 ? ALA A 510 PHE A 512 5 ? 3  
HELX_P HELX_P10 H11 THR A 528 ? LEU A 530 ? THR A 557 LEU A 559 5 ? 3  
HELX_P HELX_P11 H12 ILE A 624 ? ASP A 627 ? ILE A 653 ASP A 656 1 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ? ? A CYS 31  SG  ? ? ? 1_555 A CYS 36  SG ? ? A CYS 60  A CYS 65  1_555 ? ? ? ? ? ? ? 2.779 ? ? 
disulf2  disulf ? ? A CYS 262 SG  ? ? ? 1_555 A CYS 288 SG ? ? A CYS 291 A CYS 317 1_555 ? ? ? ? ? ? ? 2.221 ? ? 
disulf3  disulf ? ? A CYS 276 SG  ? ? ? 1_555 A CYS 303 SG ? ? A CYS 305 A CYS 332 1_555 ? ? ? ? ? ? ? 2.288 ? ? 
disulf4  disulf ? ? A CYS 320 SG  ? ? ? 1_555 A CYS 346 SG ? ? A CYS 349 A CYS 375 1_555 ? ? ? ? ? ? ? 2.191 ? ? 
disulf5  disulf ? ? A CYS 334 SG  ? ? ? 1_555 A CYS 361 SG ? ? A CYS 363 A CYS 390 1_555 ? ? ? ? ? ? ? 2.387 ? ? 
disulf6  disulf ? ? A CYS 440 SG  ? ? ? 1_555 A CYS 631 SG ? ? A CYS 469 A CYS 660 1_555 ? ? ? ? ? ? ? 2.580 ? ? 
metalc1  metalc ? ? A CYS 73  SG  ? ? ? 1_555 B ZN  .   ZN ? ? A CYS 102 A ZN  990 1_555 ? ? ? ? ? ? ? 2.504 ? ? 
metalc2  metalc ? ? A GLU 137 OE1 ? ? ? 1_555 E CA  .   CA ? ? A GLU 166 A CA  993 1_555 ? ? ? ? ? ? ? 3.219 ? ? 
metalc3  metalc ? ? A ALA 138 O   ? ? ? 1_555 E CA  .   CA ? ? A ALA 167 A CA  993 1_555 ? ? ? ? ? ? ? 2.889 ? ? 
metalc4  metalc ? ? A ASP 139 O   ? ? ? 1_555 E CA  .   CA ? ? A ASP 168 A CA  993 1_555 ? ? ? ? ? ? ? 2.903 ? ? 
metalc5  metalc ? ? A HIS 149 NE2 ? ? ? 1_555 C ZN  .   ZN ? ? A HIS 178 A ZN  991 1_555 ? ? ? ? ? ? ? 2.164 ? ? 
metalc6  metalc ? ? A ASP 151 OD2 ? ? ? 1_555 C ZN  .   ZN ? ? A ASP 180 A ZN  991 1_555 ? ? ? ? ? ? ? 2.259 ? ? 
metalc7  metalc ? ? A ASP 156 O   ? ? ? 1_555 D CA  .   CA ? ? A ASP 185 A CA  992 1_555 ? ? ? ? ? ? ? 2.851 ? ? 
metalc8  metalc ? ? A GLY 157 O   ? ? ? 1_555 D CA  .   CA ? ? A GLY 186 A CA  992 1_555 ? ? ? ? ? ? ? 2.414 ? ? 
metalc9  metalc ? ? A ASP 159 O   ? ? ? 1_555 D CA  .   CA ? ? A ASP 188 A CA  992 1_555 ? ? ? ? ? ? ? 2.579 ? ? 
metalc10 metalc ? ? A LEU 161 O   ? ? ? 1_555 D CA  .   CA ? ? A LEU 190 A CA  992 1_555 ? ? ? ? ? ? ? 2.467 ? ? 
metalc11 metalc ? ? A HIS 164 NE2 ? ? ? 1_555 C ZN  .   ZN ? ? A HIS 193 A ZN  991 1_555 ? ? ? ? ? ? ? 2.076 ? ? 
metalc12 metalc ? ? A GLY 171 O   ? ? ? 1_555 E CA  .   CA ? ? A GLY 200 A CA  993 1_555 ? ? ? ? ? ? ? 2.694 ? ? 
metalc13 metalc ? ? A HIS 177 ND1 ? ? ? 1_555 C ZN  .   ZN ? ? A HIS 206 A ZN  991 1_555 ? ? ? ? ? ? ? 2.062 ? ? 
metalc14 metalc ? ? A ASP 179 OD2 ? ? ? 1_555 D CA  .   CA ? ? A ASP 208 A CA  992 1_555 ? ? ? ? ? ? ? 2.582 ? ? 
metalc15 metalc ? ? A GLU 182 OE2 ? ? ? 1_555 D CA  .   CA ? ? A GLU 211 A CA  992 1_555 ? ? ? ? ? ? ? 2.746 ? ? 
metalc16 metalc ? ? A HIS 374 NE2 ? ? ? 1_555 B ZN  .   ZN ? ? A HIS 403 A ZN  990 1_555 ? ? ? ? ? ? ? 2.254 ? ? 
metalc17 metalc ? ? A HIS 378 NE2 ? ? ? 1_555 B ZN  .   ZN ? ? A HIS 407 A ZN  990 1_555 ? ? ? ? ? ? ? 2.238 ? ? 
metalc18 metalc ? ? A HIS 384 NE2 ? ? ? 1_555 B ZN  .   ZN ? ? A HIS 413 A ZN  990 1_555 ? ? ? ? ? ? ? 2.486 ? ? 
metalc19 metalc ? ? A ASP 447 O   ? ? ? 1_555 F CA  .   CA ? ? A ASP 476 A CA  994 1_555 ? ? ? ? ? ? ? 2.544 ? ? 
metalc20 metalc ? ? A ILE 449 O   ? ? ? 1_555 H NA  .   NA ? ? A ILE 478 A NA  996 1_555 ? ? ? ? ? ? ? 2.710 ? ? 
metalc21 metalc ? ? A ASP 492 O   ? ? ? 1_555 F CA  .   CA ? ? A ASP 521 A CA  994 1_555 ? ? ? ? ? ? ? 2.778 ? ? 
metalc22 metalc ? ? A VAL 494 O   ? ? ? 1_555 H NA  .   NA ? ? A VAL 523 A NA  996 1_555 ? ? ? ? ? ? ? 2.898 ? ? 
metalc23 metalc ? ? A ASP 540 O   ? ? ? 1_555 F CA  .   CA ? ? A ASP 569 A CA  994 1_555 ? ? ? ? ? ? ? 2.677 ? ? 
metalc24 metalc ? ? A ALA 542 O   ? ? ? 1_555 H NA  .   NA ? ? A ALA 571 A NA  996 1_555 ? ? ? ? ? ? ? 2.794 ? ? 
metalc25 metalc ? ? A ASP 589 O   ? ? ? 1_555 F CA  .   CA ? ? A ASP 618 A CA  994 1_555 ? ? ? ? ? ? ? 2.716 ? ? 
metalc26 metalc ? ? A VAL 591 O   ? ? ? 1_555 H NA  .   NA ? ? A VAL 620 A NA  996 1_555 ? ? ? ? ? ? ? 2.918 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 206 A . ? PHE 235 A PRO 207 A ? PRO 236 A 1 -2.55  
2 PHE 264 A . ? PHE 293 A PRO 265 A ? PRO 294 A 1 -15.46 
3 PHE 322 A . ? PHE 351 A PRO 323 A ? PRO 352 A 1 -2.41  
4 GLY 476 A . ? GLY 505 A PRO 477 A ? PRO 506 A 1 7.23   
5 TYR 523 A . ? TYR 552 A PRO 524 A ? PRO 553 A 1 6.80   
6 PHE 573 A . ? PHE 602 A PRO 574 A ? PRO 603 A 1 9.20   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
S1  ? 1 ? 
S2  ? 1 ? 
S3  ? 1 ? 
S4  ? 1 ? 
S5  ? 1 ? 
S6  ? 1 ? 
S7  ? 1 ? 
S8  ? 1 ? 
S9  ? 1 ? 
S10 ? 1 ? 
S11 ? 1 ? 
S12 ? 1 ? 
S13 ? 1 ? 
S14 ? 1 ? 
S15 ? 1 ? 
S16 ? 1 ? 
S17 ? 1 ? 
S18 ? 1 ? 
S19 ? 1 ? 
S20 ? 1 ? 
S21 ? 1 ? 
S22 ? 1 ? 
S23 ? 1 ? 
S24 ? 1 ? 
S25 ? 1 ? 
S26 ? 1 ? 
S27 ? 1 ? 
S28 ? 1 ? 
S29 ? 1 ? 
S30 ? 1 ? 
S31 ? 1 ? 
S32 ? 1 ? 
S33 ? 1 ? 
S34 ? 1 ? 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1  1 GLN A 94  ? ILE A 99  ? GLN A 123 ILE A 128 
S2  1 ARG A 129 ? ILE A 133 ? ARG A 158 ILE A 162 
S3  1 ILE A 140 ? GLY A 145 ? ILE A 169 GLY A 174 
S4  1 LEU A 162 ? PHE A 166 ? LEU A 191 PHE A 195 
S5  1 ASP A 175 ? ASP A 180 ? ASP A 204 ASP A 209 
S6  1 LEU A 183 ? THR A 185 ? LEU A 212 THR A 214 
S7  1 PHE A 208 ? PHE A 210 ? PHE A 237 PHE A 239 
S8  1 LYS A 213 ? TYR A 215 ? LYS A 242 TYR A 244 
S9  1 LEU A 228 ? SER A 231 ? LEU A 257 SER A 260 
S10 1 LYS A 241 ? CYS A 245 ? LYS A 270 CYS A 274 
S11 1 PHE A 266 ? PHE A 268 ? PHE A 295 PHE A 297 
S12 1 THR A 271 ? TYR A 273 ? THR A 300 TYR A 302 
S13 1 ARG A 286 ? GLY A 289 ? ARG A 315 GLY A 318 
S14 1 LYS A 299 ? CYS A 303 ? LYS A 328 CYS A 332 
S15 1 PHE A 324 ? GLY A 328 ? PHE A 353 GLY A 357 
S16 1 ASN A 329 ? TYR A 331 ? ASN A 358 TYR A 360 
S17 1 MET A 344 ? ALA A 347 ? MET A 373 ALA A 376 
S18 1 LYS A 357 ? CYS A 361 ? LYS A 386 CYS A 390 
S19 1 GLY A 448 ? ILE A 452 ? GLY A 477 ILE A 481 
S20 1 GLU A 455 ? LYS A 460 ? GLU A 484 LYS A 489 
S21 1 PHE A 463 ? THR A 467 ? PHE A 492 THR A 496 
S22 1 MET A 475 ? VAL A 480 ? MET A 504 VAL A 509 
S23 1 TYR A 495 ? ALA A 497 ? TYR A 524 ALA A 526 
S24 1 LYS A 502 ? ALA A 507 ? LYS A 531 ALA A 536 
S25 1 ASN A 509 ? SER A 515 ? ASN A 538 SER A 544 
S26 1 THR A 518 ? GLU A 520 ? THR A 547 GLU A 549 
S27 1 LYS A 525 ? PRO A 526 ? LYS A 554 PRO A 555 
S28 1 LYS A 549 ? ALA A 555 ? LYS A 578 ALA A 584 
S29 1 ASP A 557 ? GLU A 564 ? ASP A 586 GLU A 593 
S30 1 LYS A 568 ? ASP A 570 ? LYS A 597 ASP A 599 
S31 1 LYS A 575 ? LEU A 576 ? LYS A 604 LEU A 605 
S32 1 ALA A 590 ? VAL A 592 ? ALA A 619 VAL A 621 
S33 1 TYR A 601 ? LYS A 604 ? TYR A 630 LYS A 633 
S34 1 TYR A 607 ? LEU A 609 ? TYR A 636 LEU A 638 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
ZNA Author   ? ?   ?   ? 4 'ZN 990 ACTIVE SITE'                 
ZNS Author   ? ?   ?   ? 4 'ZN 991 STRUCTURAL SITE'             
CAA Author   ? ?   ?   ? 6 'CA 992 CATALYTIC DOMAIN'            
CAB Author   ? ?   ?   ? 6 'CA 993 CATALYTIC DOMAIN'            
CAH Author   ? ?   ?   ? 4 'CA 994 HEMOPEXIN DOMAIN'            
AC1 Software A ZN  990 ? 4 'BINDING SITE FOR RESIDUE ZN A 990'  
AC2 Software A ZN  991 ? 4 'BINDING SITE FOR RESIDUE ZN A 991'  
AC3 Software A CA  992 ? 6 'BINDING SITE FOR RESIDUE CA A 992'  
AC4 Software A CA  993 ? 6 'BINDING SITE FOR RESIDUE CA A 993'  
AC5 Software A CA  994 ? 4 'BINDING SITE FOR RESIDUE CA A 994'  
AC6 Software A CL  995 ? 4 'BINDING SITE FOR RESIDUE CL A 995'  
AC7 Software A NA  996 ? 6 'BINDING SITE FOR RESIDUE NA A 996'  
AC8 Software A SO4 777 ? 7 'BINDING SITE FOR RESIDUE SO4 A 777' 
AC9 Software A SO4 778 ? 4 'BINDING SITE FOR RESIDUE SO4 A 778' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  ZNA 4 CYS A 73  ? CYS A 102  . ? 1_555 ? 
2  ZNA 4 HIS A 374 ? HIS A 403  . ? 1_555 ? 
3  ZNA 4 HIS A 378 ? HIS A 407  . ? 1_555 ? 
4  ZNA 4 HIS A 384 ? HIS A 413  . ? 1_555 ? 
5  ZNS 4 ASP A 151 ? ASP A 180  . ? 1_555 ? 
6  ZNS 4 HIS A 149 ? HIS A 178  . ? 1_555 ? 
7  ZNS 4 HIS A 164 ? HIS A 193  . ? 1_555 ? 
8  ZNS 4 HIS A 177 ? HIS A 206  . ? 1_555 ? 
9  CAA 6 ASP A 156 ? ASP A 185  . ? 1_555 ? 
10 CAA 6 GLY A 157 ? GLY A 186  . ? 1_555 ? 
11 CAA 6 ASP A 159 ? ASP A 188  . ? 1_555 ? 
12 CAA 6 LEU A 161 ? LEU A 190  . ? 1_555 ? 
13 CAA 6 ASP A 179 ? ASP A 208  . ? 1_555 ? 
14 CAA 6 GLU A 182 ? GLU A 211  . ? 1_555 ? 
15 CAB 6 GLU A 137 ? GLU A 166  . ? 1_555 ? 
16 CAB 6 ALA A 138 ? ALA A 167  . ? 1_555 ? 
17 CAB 6 ASP A 139 ? ASP A 168  . ? 1_555 ? 
18 CAB 6 GLY A 171 ? GLY A 200  . ? 1_555 ? 
19 CAB 6 GLY A 173 ? GLY A 202  . ? 1_555 ? 
20 CAB 6 ASP A 175 ? ASP A 204  . ? 1_555 ? 
21 CAH 4 ASP A 447 ? ASP A 476  . ? 1_555 ? 
22 CAH 4 ASP A 492 ? ASP A 521  . ? 1_555 ? 
23 CAH 4 ASP A 540 ? ASP A 569  . ? 1_555 ? 
24 CAH 4 ASP A 589 ? ASP A 618  . ? 1_555 ? 
25 AC1 4 CYS A 73  ? CYS A 102  . ? 1_555 ? 
26 AC1 4 HIS A 374 ? HIS A 403  . ? 1_555 ? 
27 AC1 4 HIS A 378 ? HIS A 407  . ? 1_555 ? 
28 AC1 4 HIS A 384 ? HIS A 413  . ? 1_555 ? 
29 AC2 4 HIS A 149 ? HIS A 178  . ? 1_555 ? 
30 AC2 4 ASP A 151 ? ASP A 180  . ? 1_555 ? 
31 AC2 4 HIS A 164 ? HIS A 193  . ? 1_555 ? 
32 AC2 4 HIS A 177 ? HIS A 206  . ? 1_555 ? 
33 AC3 6 ASP A 156 ? ASP A 185  . ? 1_555 ? 
34 AC3 6 GLY A 157 ? GLY A 186  . ? 1_555 ? 
35 AC3 6 ASP A 159 ? ASP A 188  . ? 1_555 ? 
36 AC3 6 LEU A 161 ? LEU A 190  . ? 1_555 ? 
37 AC3 6 ASP A 179 ? ASP A 208  . ? 1_555 ? 
38 AC3 6 GLU A 182 ? GLU A 211  . ? 1_555 ? 
39 AC4 6 GLU A 137 ? GLU A 166  . ? 1_555 ? 
40 AC4 6 ALA A 138 ? ALA A 167  . ? 1_555 ? 
41 AC4 6 ASP A 139 ? ASP A 168  . ? 1_555 ? 
42 AC4 6 GLY A 171 ? GLY A 200  . ? 1_555 ? 
43 AC4 6 GLY A 173 ? GLY A 202  . ? 1_555 ? 
44 AC4 6 ASP A 175 ? ASP A 204  . ? 1_555 ? 
45 AC5 4 ASP A 447 ? ASP A 476  . ? 1_555 ? 
46 AC5 4 ASP A 492 ? ASP A 521  . ? 1_555 ? 
47 AC5 4 ASP A 540 ? ASP A 569  . ? 1_555 ? 
48 AC5 4 ASP A 589 ? ASP A 618  . ? 1_555 ? 
49 AC6 4 ALA A 493 ? ALA A 522  . ? 1_555 ? 
50 AC6 4 VAL A 494 ? VAL A 523  . ? 1_555 ? 
51 AC6 4 ALA A 542 ? ALA A 571  . ? 1_555 ? 
52 AC6 4 NA  H .   ? NA  A 996  . ? 1_555 ? 
53 AC7 6 ILE A 449 ? ILE A 478  . ? 1_555 ? 
54 AC7 6 ALA A 450 ? ALA A 479  . ? 1_555 ? 
55 AC7 6 VAL A 494 ? VAL A 523  . ? 1_555 ? 
56 AC7 6 ALA A 542 ? ALA A 571  . ? 1_555 ? 
57 AC7 6 VAL A 591 ? VAL A 620  . ? 1_555 ? 
58 AC7 6 CL  G .   ? CL  A 995  . ? 1_555 ? 
59 AC8 7 GLN A 23  ? GLN A 52   . ? 1_555 ? 
60 AC8 7 TYR A 24  ? TYR A 53   . ? 1_555 ? 
61 AC8 7 THR A 27  ? THR A 56   . ? 1_555 ? 
62 AC8 7 PHE A 28  ? PHE A 57   . ? 1_555 ? 
63 AC8 7 ASP A 156 ? ASP A 185  . ? 1_555 ? 
64 AC8 7 LEU A 161 ? LEU A 190  . ? 1_555 ? 
65 AC8 7 HOH K .   ? HOH A 1097 . ? 1_555 ? 
66 AC9 4 GLN A 269 ? GLN A 298  . ? 1_555 ? 
67 AC9 4 GLY A 270 ? GLY A 299  . ? 1_555 ? 
68 AC9 4 THR A 271 ? THR A 300  . ? 1_555 ? 
69 AC9 4 THR A 278 ? THR A 307  . ? 5_555 ? 
# 
_database_PDB_matrix.entry_id          1CK7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1CK7 
_atom_sites.fract_transf_matrix[1][1]   0.008243 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008243 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002898 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
CL 
N  
NA 
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 2   ? 57.961  123.391 157.329 1.00 57.02  ? 31   PRO A N   1 
ATOM   2    C  CA  . PRO A 1 2   ? 56.495  123.536 157.089 1.00 58.75  ? 31   PRO A CA  1 
ATOM   3    C  C   . PRO A 1 2   ? 55.884  122.189 156.710 1.00 67.15  ? 31   PRO A C   1 
ATOM   4    O  O   . PRO A 1 2   ? 56.577  121.306 156.146 1.00 68.00  ? 31   PRO A O   1 
ATOM   5    C  CB  . PRO A 1 2   ? 56.382  124.419 155.849 1.00 53.45  ? 31   PRO A CB  1 
ATOM   6    C  CG  . PRO A 1 2   ? 57.769  124.812 155.489 1.00 54.36  ? 31   PRO A CG  1 
ATOM   7    C  CD  . PRO A 1 2   ? 58.666  123.704 156.034 1.00 55.44  ? 31   PRO A CD  1 
ATOM   8    N  N   . SER A 1 3   ? 54.631  121.944 156.982 1.00 74.08  ? 32   SER A N   1 
ATOM   9    C  CA  . SER A 1 3   ? 53.835  120.846 156.522 1.00 81.01  ? 32   SER A CA  1 
ATOM   10   C  C   . SER A 1 3   ? 52.475  120.906 157.226 1.00 84.76  ? 32   SER A C   1 
ATOM   11   O  O   . SER A 1 3   ? 52.423  120.583 158.420 1.00 87.53  ? 32   SER A O   1 
ATOM   12   C  CB  . SER A 1 3   ? 54.459  119.465 156.740 1.00 102.70 ? 32   SER A CB  1 
ATOM   13   O  OG  . SER A 1 3   ? 55.844  119.534 157.057 1.00 110.02 ? 32   SER A OG  1 
ATOM   14   N  N   . PRO A 1 4   ? 51.447  121.422 156.597 1.00 83.43  ? 33   PRO A N   1 
ATOM   15   C  CA  . PRO A 1 4   ? 50.125  121.332 157.228 1.00 80.67  ? 33   PRO A CA  1 
ATOM   16   C  C   . PRO A 1 4   ? 49.431  120.072 156.711 1.00 76.64  ? 33   PRO A C   1 
ATOM   17   O  O   . PRO A 1 4   ? 49.553  119.680 155.553 1.00 78.18  ? 33   PRO A O   1 
ATOM   18   C  CB  . PRO A 1 4   ? 49.428  122.576 156.751 1.00 81.56  ? 33   PRO A CB  1 
ATOM   19   C  CG  . PRO A 1 4   ? 50.189  123.103 155.601 1.00 83.47  ? 33   PRO A CG  1 
ATOM   20   C  CD  . PRO A 1 4   ? 51.358  122.168 155.327 1.00 83.70  ? 33   PRO A CD  1 
ATOM   21   N  N   . ILE A 1 5   ? 48.637  119.436 157.538 1.00 70.58  ? 34   ILE A N   1 
ATOM   22   C  CA  . ILE A 1 5   ? 47.916  118.246 157.102 1.00 65.92  ? 34   ILE A CA  1 
ATOM   23   C  C   . ILE A 1 5   ? 46.543  118.586 156.553 1.00 64.15  ? 34   ILE A C   1 
ATOM   24   O  O   . ILE A 1 5   ? 45.826  119.444 157.090 1.00 64.82  ? 34   ILE A O   1 
ATOM   25   C  CB  . ILE A 1 5   ? 47.662  117.388 158.343 1.00 61.35  ? 34   ILE A CB  1 
ATOM   26   C  CG1 . ILE A 1 5   ? 48.328  116.020 158.158 1.00 61.97  ? 34   ILE A CG1 1 
ATOM   27   C  CG2 . ILE A 1 5   ? 46.195  117.290 158.683 1.00 67.06  ? 34   ILE A CG2 1 
ATOM   28   C  CD1 . ILE A 1 5   ? 49.269  115.873 159.348 1.00 67.93  ? 34   ILE A CD1 1 
ATOM   29   N  N   . ILE A 1 6   ? 46.100  117.826 155.548 1.00 59.67  ? 35   ILE A N   1 
ATOM   30   C  CA  . ILE A 1 6   ? 44.755  118.103 155.069 1.00 56.77  ? 35   ILE A CA  1 
ATOM   31   C  C   . ILE A 1 6   ? 44.147  116.774 154.596 1.00 55.79  ? 35   ILE A C   1 
ATOM   32   O  O   . ILE A 1 6   ? 44.943  115.861 154.458 1.00 58.14  ? 35   ILE A O   1 
ATOM   33   C  CB  . ILE A 1 6   ? 44.623  119.142 153.965 1.00 47.60  ? 35   ILE A CB  1 
ATOM   34   C  CG1 . ILE A 1 6   ? 44.519  118.520 152.576 1.00 47.52  ? 35   ILE A CG1 1 
ATOM   35   C  CG2 . ILE A 1 6   ? 45.661  120.230 153.991 1.00 38.44  ? 35   ILE A CG2 1 
ATOM   36   C  CD1 . ILE A 1 6   ? 45.232  119.264 151.476 1.00 47.14  ? 35   ILE A CD1 1 
ATOM   37   N  N   . LYS A 1 7   ? 42.859  116.782 154.396 1.00 52.65  ? 36   LYS A N   1 
ATOM   38   C  CA  . LYS A 1 7   ? 42.071  115.705 153.824 1.00 51.03  ? 36   LYS A CA  1 
ATOM   39   C  C   . LYS A 1 7   ? 41.834  116.091 152.354 1.00 48.28  ? 36   LYS A C   1 
ATOM   40   O  O   . LYS A 1 7   ? 41.518  117.248 152.084 1.00 50.08  ? 36   LYS A O   1 
ATOM   41   C  CB  . LYS A 1 7   ? 40.753  115.514 154.554 1.00 69.26  ? 36   LYS A CB  1 
ATOM   42   C  CG  . LYS A 1 7   ? 39.660  114.641 153.995 1.00 81.19  ? 36   LYS A CG  1 
ATOM   43   C  CD  . LYS A 1 7   ? 38.367  114.691 154.807 1.00 86.74  ? 36   LYS A CD  1 
ATOM   44   C  CE  . LYS A 1 7   ? 37.787  113.317 155.094 1.00 97.71  ? 36   LYS A CE  1 
ATOM   45   N  NZ  . LYS A 1 7   ? 36.629  113.320 156.036 1.00 98.75  ? 36   LYS A NZ  1 
ATOM   46   N  N   . PHE A 1 8   ? 42.123  115.170 151.454 1.00 45.21  ? 37   PHE A N   1 
ATOM   47   C  CA  . PHE A 1 8   ? 41.953  115.395 150.025 1.00 42.13  ? 37   PHE A CA  1 
ATOM   48   C  C   . PHE A 1 8   ? 40.576  114.956 149.567 1.00 42.27  ? 37   PHE A C   1 
ATOM   49   O  O   . PHE A 1 8   ? 40.030  113.907 149.947 1.00 42.92  ? 37   PHE A O   1 
ATOM   50   C  CB  . PHE A 1 8   ? 43.065  114.685 149.241 1.00 22.59  ? 37   PHE A CB  1 
ATOM   51   C  CG  . PHE A 1 8   ? 44.370  115.426 149.312 1.00 13.38  ? 37   PHE A CG  1 
ATOM   52   C  CD1 . PHE A 1 8   ? 45.189  115.261 150.402 1.00 24.06  ? 37   PHE A CD1 1 
ATOM   53   C  CD2 . PHE A 1 8   ? 44.774  116.309 148.331 1.00 24.73  ? 37   PHE A CD2 1 
ATOM   54   C  CE1 . PHE A 1 8   ? 46.397  115.938 150.512 1.00 24.72  ? 37   PHE A CE1 1 
ATOM   55   C  CE2 . PHE A 1 8   ? 45.991  116.982 148.415 1.00 31.98  ? 37   PHE A CE2 1 
ATOM   56   C  CZ  . PHE A 1 8   ? 46.806  116.793 149.503 1.00 29.19  ? 37   PHE A CZ  1 
ATOM   57   N  N   . PRO A 1 9   ? 39.932  115.799 148.767 1.00 41.59  ? 38   PRO A N   1 
ATOM   58   C  CA  . PRO A 1 9   ? 38.615  115.492 148.248 1.00 38.92  ? 38   PRO A CA  1 
ATOM   59   C  C   . PRO A 1 9   ? 38.601  114.081 147.661 1.00 38.29  ? 38   PRO A C   1 
ATOM   60   O  O   . PRO A 1 9   ? 39.442  113.796 146.818 1.00 36.36  ? 38   PRO A O   1 
ATOM   61   C  CB  . PRO A 1 9   ? 38.363  116.544 147.181 1.00 38.06  ? 38   PRO A CB  1 
ATOM   62   C  CG  . PRO A 1 9   ? 39.645  117.243 146.956 1.00 40.44  ? 38   PRO A CG  1 
ATOM   63   C  CD  . PRO A 1 9   ? 40.468  117.064 148.214 1.00 41.69  ? 38   PRO A CD  1 
ATOM   64   N  N   . GLY A 1 10  ? 37.694  113.236 148.106 1.00 40.43  ? 39   GLY A N   1 
ATOM   65   C  CA  . GLY A 1 10  ? 37.429  111.912 147.623 1.00 42.16  ? 39   GLY A CA  1 
ATOM   66   C  C   . GLY A 1 10  ? 38.535  110.919 147.875 1.00 46.90  ? 39   GLY A C   1 
ATOM   67   O  O   . GLY A 1 10  ? 38.913  110.142 146.991 1.00 48.12  ? 39   GLY A O   1 
ATOM   68   N  N   . ASP A 1 11  ? 39.107  110.944 149.076 1.00 50.94  ? 40   ASP A N   1 
ATOM   69   C  CA  . ASP A 1 11  ? 40.210  110.028 149.366 1.00 55.12  ? 40   ASP A CA  1 
ATOM   70   C  C   . ASP A 1 11  ? 39.715  108.869 150.207 1.00 60.40  ? 40   ASP A C   1 
ATOM   71   O  O   . ASP A 1 11  ? 38.679  109.054 150.846 1.00 61.59  ? 40   ASP A O   1 
ATOM   72   C  CB  . ASP A 1 11  ? 41.312  110.820 150.059 1.00 42.81  ? 40   ASP A CB  1 
ATOM   73   C  CG  . ASP A 1 11  ? 42.617  110.048 150.032 1.00 49.46  ? 40   ASP A CG  1 
ATOM   74   O  OD1 . ASP A 1 11  ? 42.677  108.965 149.410 1.00 62.58  ? 40   ASP A OD1 1 
ATOM   75   O  OD2 . ASP A 1 11  ? 43.559  110.545 150.658 1.00 48.85  ? 40   ASP A OD2 1 
ATOM   76   N  N   . VAL A 1 12  ? 40.357  107.702 150.203 1.00 64.72  ? 41   VAL A N   1 
ATOM   77   C  CA  . VAL A 1 12  ? 39.884  106.586 151.022 1.00 68.65  ? 41   VAL A CA  1 
ATOM   78   C  C   . VAL A 1 12  ? 40.439  106.712 152.439 1.00 71.32  ? 41   VAL A C   1 
ATOM   79   O  O   . VAL A 1 12  ? 41.632  106.572 152.686 1.00 71.01  ? 41   VAL A O   1 
ATOM   80   C  CB  . VAL A 1 12  ? 40.170  105.197 150.449 1.00 74.61  ? 41   VAL A CB  1 
ATOM   81   C  CG1 . VAL A 1 12  ? 39.206  104.855 149.316 1.00 73.04  ? 41   VAL A CG1 1 
ATOM   82   C  CG2 . VAL A 1 12  ? 41.613  105.031 149.996 1.00 79.27  ? 41   VAL A CG2 1 
ATOM   83   N  N   . ALA A 1 13  ? 39.560  107.032 153.392 1.00 74.68  ? 42   ALA A N   1 
ATOM   84   C  CA  . ALA A 1 13  ? 40.009  107.165 154.775 1.00 77.71  ? 42   ALA A CA  1 
ATOM   85   C  C   . ALA A 1 13  ? 40.789  105.900 155.125 1.00 81.26  ? 42   ALA A C   1 
ATOM   86   O  O   . ALA A 1 13  ? 40.533  104.830 154.573 1.00 82.99  ? 42   ALA A O   1 
ATOM   87   C  CB  . ALA A 1 13  ? 38.881  107.393 155.744 1.00 78.72  ? 42   ALA A CB  1 
ATOM   88   N  N   . PRO A 1 14  ? 41.779  106.070 155.976 1.00 82.54  ? 43   PRO A N   1 
ATOM   89   C  CA  . PRO A 1 14  ? 42.647  104.965 156.362 1.00 83.09  ? 43   PRO A CA  1 
ATOM   90   C  C   . PRO A 1 14  ? 42.001  104.147 157.463 1.00 84.43  ? 43   PRO A C   1 
ATOM   91   O  O   . PRO A 1 14  ? 41.141  104.627 158.216 1.00 84.66  ? 43   PRO A O   1 
ATOM   92   C  CB  . PRO A 1 14  ? 43.904  105.697 156.808 1.00 82.29  ? 43   PRO A CB  1 
ATOM   93   C  CG  . PRO A 1 14  ? 43.413  106.985 157.378 1.00 81.91  ? 43   PRO A CG  1 
ATOM   94   C  CD  . PRO A 1 14  ? 42.133  107.324 156.680 1.00 81.92  ? 43   PRO A CD  1 
ATOM   95   N  N   . LYS A 1 15  ? 42.389  102.869 157.526 1.00 84.22  ? 44   LYS A N   1 
ATOM   96   C  CA  . LYS A 1 15  ? 41.831  102.012 158.573 1.00 83.41  ? 44   LYS A CA  1 
ATOM   97   C  C   . LYS A 1 15  ? 42.678  102.169 159.829 1.00 82.08  ? 44   LYS A C   1 
ATOM   98   O  O   . LYS A 1 15  ? 43.905  102.153 159.757 1.00 84.29  ? 44   LYS A O   1 
ATOM   99   C  CB  . LYS A 1 15  ? 41.766  100.559 158.140 1.00 91.27  ? 44   LYS A CB  1 
ATOM   100  C  CG  . LYS A 1 15  ? 40.907  100.294 156.916 1.00 101.38 ? 44   LYS A CG  1 
ATOM   101  C  CD  . LYS A 1 15  ? 39.431  100.482 157.223 1.00 112.13 ? 44   LYS A CD  1 
ATOM   102  C  CE  . LYS A 1 15  ? 38.560  100.288 155.994 1.00 116.49 ? 44   LYS A CE  1 
ATOM   103  N  NZ  . LYS A 1 15  ? 37.119  100.537 156.274 1.00 120.14 ? 44   LYS A NZ  1 
ATOM   104  N  N   . THR A 1 16  ? 42.024  102.341 160.961 1.00 78.24  ? 45   THR A N   1 
ATOM   105  C  CA  . THR A 1 16  ? 42.738  102.429 162.226 1.00 73.50  ? 45   THR A CA  1 
ATOM   106  C  C   . THR A 1 16  ? 43.267  101.052 162.629 1.00 70.31  ? 45   THR A C   1 
ATOM   107  O  O   . THR A 1 16  ? 42.647  100.028 162.336 1.00 69.00  ? 45   THR A O   1 
ATOM   108  C  CB  . THR A 1 16  ? 41.760  102.916 163.310 1.00 77.63  ? 45   THR A CB  1 
ATOM   109  O  OG1 . THR A 1 16  ? 41.122  101.775 163.905 1.00 85.94  ? 45   THR A OG1 1 
ATOM   110  C  CG2 . THR A 1 16  ? 40.692  103.785 162.668 1.00 76.94  ? 45   THR A CG2 1 
ATOM   111  N  N   . ASP A 1 17  ? 44.350  101.054 163.380 1.00 67.58  ? 46   ASP A N   1 
ATOM   112  C  CA  . ASP A 1 17  ? 45.057  99.891  163.859 1.00 64.21  ? 46   ASP A CA  1 
ATOM   113  C  C   . ASP A 1 17  ? 44.165  98.737  164.261 1.00 62.94  ? 46   ASP A C   1 
ATOM   114  O  O   . ASP A 1 17  ? 44.429  97.588  163.880 1.00 63.44  ? 46   ASP A O   1 
ATOM   115  C  CB  . ASP A 1 17  ? 45.976  100.291 165.016 1.00 63.08  ? 46   ASP A CB  1 
ATOM   116  C  CG  . ASP A 1 17  ? 46.982  101.354 164.622 1.00 63.93  ? 46   ASP A CG  1 
ATOM   117  O  OD1 . ASP A 1 17  ? 47.257  101.492 163.413 1.00 66.11  ? 46   ASP A OD1 1 
ATOM   118  O  OD2 . ASP A 1 17  ? 47.515  102.053 165.512 1.00 62.79  ? 46   ASP A OD2 1 
ATOM   119  N  N   . LYS A 1 18  ? 43.136  99.009  165.054 1.00 61.91  ? 47   LYS A N   1 
ATOM   120  C  CA  . LYS A 1 18  ? 42.203  97.957  165.474 1.00 60.41  ? 47   LYS A CA  1 
ATOM   121  C  C   . LYS A 1 18  ? 41.509  97.369  164.244 1.00 58.64  ? 47   LYS A C   1 
ATOM   122  O  O   . LYS A 1 18  ? 41.656  96.194  163.899 1.00 56.99  ? 47   LYS A O   1 
ATOM   123  C  CB  . LYS A 1 18  ? 41.165  98.519  166.442 1.00 65.12  ? 47   LYS A CB  1 
ATOM   124  C  CG  . LYS A 1 18  ? 41.156  97.878  167.811 1.00 74.65  ? 47   LYS A CG  1 
ATOM   125  C  CD  . LYS A 1 18  ? 42.508  97.983  168.517 1.00 79.43  ? 47   LYS A CD  1 
ATOM   126  C  CE  . LYS A 1 18  ? 42.796  96.754  169.363 1.00 79.90  ? 47   LYS A CE  1 
ATOM   127  N  NZ  . LYS A 1 18  ? 43.300  97.071  170.721 1.00 78.11  ? 47   LYS A NZ  1 
ATOM   128  N  N   . GLU A 1 19  ? 40.870  98.289  163.510 1.00 56.29  ? 48   GLU A N   1 
ATOM   129  C  CA  . GLU A 1 19  ? 40.193  97.928  162.273 1.00 52.66  ? 48   GLU A CA  1 
ATOM   130  C  C   . GLU A 1 19  ? 41.131  97.096  161.405 1.00 49.03  ? 48   GLU A C   1 
ATOM   131  O  O   . GLU A 1 19  ? 40.685  96.088  160.876 1.00 48.64  ? 48   GLU A O   1 
ATOM   132  C  CB  . GLU A 1 19  ? 39.725  99.174  161.525 1.00 59.02  ? 48   GLU A CB  1 
ATOM   133  C  CG  . GLU A 1 19  ? 38.703  99.996  162.298 1.00 68.59  ? 48   GLU A CG  1 
ATOM   134  C  CD  . GLU A 1 19  ? 38.243  101.259 161.604 1.00 69.21  ? 48   GLU A CD  1 
ATOM   135  O  OE1 . GLU A 1 19  ? 38.703  101.538 160.476 1.00 73.86  ? 48   GLU A OE1 1 
ATOM   136  O  OE2 . GLU A 1 19  ? 37.414  102.001 162.178 1.00 63.04  ? 48   GLU A OE2 1 
ATOM   137  N  N   . LEU A 1 20  ? 42.395  97.497  161.328 1.00 45.48  ? 49   LEU A N   1 
ATOM   138  C  CA  . LEU A 1 20  ? 43.390  96.803  160.545 1.00 43.69  ? 49   LEU A CA  1 
ATOM   139  C  C   . LEU A 1 20  ? 43.667  95.413  161.105 1.00 44.05  ? 49   LEU A C   1 
ATOM   140  O  O   . LEU A 1 20  ? 43.672  94.405  160.391 1.00 43.93  ? 49   LEU A O   1 
ATOM   141  C  CB  . LEU A 1 20  ? 44.695  97.604  160.439 1.00 44.05  ? 49   LEU A CB  1 
ATOM   142  C  CG  . LEU A 1 20  ? 45.940  96.841  159.969 1.00 51.26  ? 49   LEU A CG  1 
ATOM   143  C  CD1 . LEU A 1 20  ? 45.818  96.346  158.535 1.00 46.91  ? 49   LEU A CD1 1 
ATOM   144  C  CD2 . LEU A 1 20  ? 47.223  97.641  160.136 1.00 47.38  ? 49   LEU A CD2 1 
ATOM   145  N  N   . ALA A 1 21  ? 43.889  95.386  162.413 1.00 43.14  ? 50   ALA A N   1 
ATOM   146  C  CA  . ALA A 1 21  ? 44.232  94.140  163.096 1.00 42.43  ? 50   ALA A CA  1 
ATOM   147  C  C   . ALA A 1 21  ? 43.195  93.049  162.826 1.00 42.91  ? 50   ALA A C   1 
ATOM   148  O  O   . ALA A 1 21  ? 43.493  92.032  162.186 1.00 42.46  ? 50   ALA A O   1 
ATOM   149  C  CB  . ALA A 1 21  ? 44.355  94.492  164.565 1.00 37.37  ? 50   ALA A CB  1 
ATOM   150  N  N   . VAL A 1 22  ? 41.965  93.308  163.252 1.00 42.61  ? 51   VAL A N   1 
ATOM   151  C  CA  . VAL A 1 22  ? 40.807  92.467  163.043 1.00 42.48  ? 51   VAL A CA  1 
ATOM   152  C  C   . VAL A 1 22  ? 40.717  91.953  161.607 1.00 44.76  ? 51   VAL A C   1 
ATOM   153  O  O   . VAL A 1 22  ? 40.481  90.778  161.340 1.00 46.38  ? 51   VAL A O   1 
ATOM   154  C  CB  . VAL A 1 22  ? 39.501  93.270  163.247 1.00 31.47  ? 51   VAL A CB  1 
ATOM   155  C  CG1 . VAL A 1 22  ? 38.316  92.337  163.142 1.00 27.98  ? 51   VAL A CG1 1 
ATOM   156  C  CG2 . VAL A 1 22  ? 39.530  94.077  164.517 1.00 32.65  ? 51   VAL A CG2 1 
ATOM   157  N  N   . GLN A 1 23  ? 40.853  92.888  160.657 1.00 42.78  ? 52   GLN A N   1 
ATOM   158  C  CA  . GLN A 1 23  ? 40.815  92.453  159.262 1.00 42.01  ? 52   GLN A CA  1 
ATOM   159  C  C   . GLN A 1 23  ? 41.950  91.467  158.981 1.00 40.77  ? 52   GLN A C   1 
ATOM   160  O  O   . GLN A 1 23  ? 41.785  90.480  158.250 1.00 37.57  ? 52   GLN A O   1 
ATOM   161  C  CB  . GLN A 1 23  ? 40.874  93.691  158.382 1.00 59.63  ? 52   GLN A CB  1 
ATOM   162  C  CG  . GLN A 1 23  ? 40.035  93.664  157.124 1.00 76.08  ? 52   GLN A CG  1 
ATOM   163  C  CD  . GLN A 1 23  ? 40.034  94.966  156.346 1.00 87.51  ? 52   GLN A CD  1 
ATOM   164  O  OE1 . GLN A 1 23  ? 40.171  96.068  156.891 1.00 90.37  ? 52   GLN A OE1 1 
ATOM   165  N  NE2 . GLN A 1 23  ? 39.869  94.880  155.022 1.00 88.21  ? 52   GLN A NE2 1 
ATOM   166  N  N   . TYR A 1 24  ? 43.139  91.720  159.553 1.00 37.83  ? 53   TYR A N   1 
ATOM   167  C  CA  . TYR A 1 24  ? 44.285  90.860  159.262 1.00 37.61  ? 53   TYR A CA  1 
ATOM   168  C  C   . TYR A 1 24  ? 44.052  89.467  159.854 1.00 37.71  ? 53   TYR A C   1 
ATOM   169  O  O   . TYR A 1 24  ? 44.257  88.411  159.248 1.00 37.02  ? 53   TYR A O   1 
ATOM   170  C  CB  . TYR A 1 24  ? 45.544  91.498  159.844 1.00 38.93  ? 53   TYR A CB  1 
ATOM   171  C  CG  . TYR A 1 24  ? 46.861  91.095  159.217 1.00 40.37  ? 53   TYR A CG  1 
ATOM   172  C  CD1 . TYR A 1 24  ? 47.606  89.999  159.649 1.00 43.92  ? 53   TYR A CD1 1 
ATOM   173  C  CD2 . TYR A 1 24  ? 47.383  91.837  158.181 1.00 37.95  ? 53   TYR A CD2 1 
ATOM   174  C  CE1 . TYR A 1 24  ? 48.815  89.661  159.063 1.00 45.22  ? 53   TYR A CE1 1 
ATOM   175  C  CE2 . TYR A 1 24  ? 48.577  91.514  157.592 1.00 41.12  ? 53   TYR A CE2 1 
ATOM   176  C  CZ  . TYR A 1 24  ? 49.298  90.422  158.027 1.00 43.77  ? 53   TYR A CZ  1 
ATOM   177  O  OH  . TYR A 1 24  ? 50.472  90.091  157.415 1.00 43.65  ? 53   TYR A OH  1 
ATOM   178  N  N   . LEU A 1 25  ? 43.621  89.534  161.117 1.00 34.96  ? 54   LEU A N   1 
ATOM   179  C  CA  . LEU A 1 25  ? 43.361  88.348  161.901 1.00 33.16  ? 54   LEU A CA  1 
ATOM   180  C  C   . LEU A 1 25  ? 42.243  87.525  161.282 1.00 35.51  ? 54   LEU A C   1 
ATOM   181  O  O   . LEU A 1 25  ? 42.402  86.311  161.057 1.00 36.60  ? 54   LEU A O   1 
ATOM   182  C  CB  . LEU A 1 25  ? 43.081  88.802  163.330 1.00 27.20  ? 54   LEU A CB  1 
ATOM   183  C  CG  . LEU A 1 25  ? 44.324  89.429  163.999 1.00 38.83  ? 54   LEU A CG  1 
ATOM   184  C  CD1 . LEU A 1 25  ? 44.069  89.657  165.474 1.00 32.81  ? 54   LEU A CD1 1 
ATOM   185  C  CD2 . LEU A 1 25  ? 45.551  88.554  163.766 1.00 28.86  ? 54   LEU A CD2 1 
ATOM   186  N  N   . ASN A 1 26  ? 41.194  88.213  160.861 1.00 33.13  ? 55   ASN A N   1 
ATOM   187  C  CA  . ASN A 1 26  ? 40.054  87.650  160.162 1.00 31.73  ? 55   ASN A CA  1 
ATOM   188  C  C   . ASN A 1 26  ? 40.427  87.073  158.811 1.00 32.54  ? 55   ASN A C   1 
ATOM   189  O  O   . ASN A 1 26  ? 39.847  86.110  158.316 1.00 34.01  ? 55   ASN A O   1 
ATOM   190  C  CB  . ASN A 1 26  ? 39.010  88.763  160.006 1.00 41.13  ? 55   ASN A CB  1 
ATOM   191  C  CG  . ASN A 1 26  ? 37.789  88.432  159.195 1.00 52.32  ? 55   ASN A CG  1 
ATOM   192  O  OD1 . ASN A 1 26  ? 37.695  87.435  158.472 1.00 53.11  ? 55   ASN A OD1 1 
ATOM   193  N  ND2 . ASN A 1 26  ? 36.766  89.300  159.277 1.00 58.07  ? 55   ASN A ND2 1 
ATOM   194  N  N   . THR A 1 27  ? 41.360  87.706  158.119 1.00 35.64  ? 56   THR A N   1 
ATOM   195  C  CA  . THR A 1 27  ? 41.668  87.322  156.745 1.00 37.66  ? 56   THR A CA  1 
ATOM   196  C  C   . THR A 1 27  ? 42.684  86.204  156.737 1.00 40.21  ? 56   THR A C   1 
ATOM   197  O  O   . THR A 1 27  ? 42.560  85.250  155.981 1.00 43.95  ? 56   THR A O   1 
ATOM   198  C  CB  . THR A 1 27  ? 42.214  88.542  155.965 1.00 35.47  ? 56   THR A CB  1 
ATOM   199  O  OG1 . THR A 1 27  ? 41.233  89.606  156.005 1.00 32.38  ? 56   THR A OG1 1 
ATOM   200  C  CG2 . THR A 1 27  ? 42.506  88.225  154.505 1.00 13.85  ? 56   THR A CG2 1 
ATOM   201  N  N   . PHE A 1 28  ? 43.716  86.357  157.552 1.00 41.76  ? 57   PHE A N   1 
ATOM   202  C  CA  . PHE A 1 28  ? 44.821  85.408  157.509 1.00 47.46  ? 57   PHE A CA  1 
ATOM   203  C  C   . PHE A 1 28  ? 44.880  84.459  158.690 1.00 53.61  ? 57   PHE A C   1 
ATOM   204  O  O   . PHE A 1 28  ? 45.724  83.552  158.762 1.00 52.47  ? 57   PHE A O   1 
ATOM   205  C  CB  . PHE A 1 28  ? 46.093  86.270  157.489 1.00 42.51  ? 57   PHE A CB  1 
ATOM   206  C  CG  . PHE A 1 28  ? 46.135  87.223  156.328 1.00 37.24  ? 57   PHE A CG  1 
ATOM   207  C  CD1 . PHE A 1 28  ? 46.232  86.761  155.037 1.00 39.27  ? 57   PHE A CD1 1 
ATOM   208  C  CD2 . PHE A 1 28  ? 46.112  88.587  156.551 1.00 30.11  ? 57   PHE A CD2 1 
ATOM   209  C  CE1 . PHE A 1 28  ? 46.286  87.641  153.973 1.00 31.62  ? 57   PHE A CE1 1 
ATOM   210  C  CE2 . PHE A 1 28  ? 46.156  89.463  155.489 1.00 21.95  ? 57   PHE A CE2 1 
ATOM   211  C  CZ  . PHE A 1 28  ? 46.242  88.984  154.210 1.00 24.45  ? 57   PHE A CZ  1 
ATOM   212  N  N   . TYR A 1 29  ? 44.047  84.689  159.720 1.00 57.25  ? 58   TYR A N   1 
ATOM   213  C  CA  . TYR A 1 29  ? 44.211  83.860  160.906 1.00 60.27  ? 58   TYR A CA  1 
ATOM   214  C  C   . TYR A 1 29  ? 43.008  83.050  161.268 1.00 63.63  ? 58   TYR A C   1 
ATOM   215  O  O   . TYR A 1 29  ? 43.120  82.012  161.950 1.00 66.64  ? 58   TYR A O   1 
ATOM   216  C  CB  . TYR A 1 29  ? 44.751  84.743  162.053 1.00 62.23  ? 58   TYR A CB  1 
ATOM   217  C  CG  . TYR A 1 29  ? 46.244  84.965  161.772 1.00 63.47  ? 58   TYR A CG  1 
ATOM   218  C  CD1 . TYR A 1 29  ? 47.096  83.872  161.792 1.00 63.11  ? 58   TYR A CD1 1 
ATOM   219  C  CD2 . TYR A 1 29  ? 46.753  86.201  161.440 1.00 64.76  ? 58   TYR A CD2 1 
ATOM   220  C  CE1 . TYR A 1 29  ? 48.438  84.004  161.518 1.00 62.64  ? 58   TYR A CE1 1 
ATOM   221  C  CE2 . TYR A 1 29  ? 48.097  86.349  161.151 1.00 65.48  ? 58   TYR A CE2 1 
ATOM   222  C  CZ  . TYR A 1 29  ? 48.929  85.251  161.200 1.00 63.85  ? 58   TYR A CZ  1 
ATOM   223  O  OH  . TYR A 1 29  ? 50.263  85.391  160.926 1.00 62.68  ? 58   TYR A OH  1 
ATOM   224  N  N   . GLY A 1 30  ? 41.834  83.402  160.743 1.00 63.34  ? 59   GLY A N   1 
ATOM   225  C  CA  . GLY A 1 30  ? 40.679  82.573  161.048 1.00 65.42  ? 59   GLY A CA  1 
ATOM   226  C  C   . GLY A 1 30  ? 39.788  83.223  162.075 1.00 69.07  ? 59   GLY A C   1 
ATOM   227  O  O   . GLY A 1 30  ? 38.582  82.917  162.144 1.00 70.81  ? 59   GLY A O   1 
ATOM   228  N  N   . CYS A 1 31  ? 40.311  84.148  162.886 1.00 70.55  ? 60   CYS A N   1 
ATOM   229  C  CA  . CYS A 1 31  ? 39.355  84.650  163.913 1.00 72.90  ? 60   CYS A CA  1 
ATOM   230  C  C   . CYS A 1 31  ? 38.152  85.219  163.198 1.00 75.57  ? 60   CYS A C   1 
ATOM   231  O  O   . CYS A 1 31  ? 38.266  86.076  162.345 1.00 75.59  ? 60   CYS A O   1 
ATOM   232  C  CB  . CYS A 1 31  ? 40.047  85.409  164.955 1.00 63.33  ? 60   CYS A CB  1 
ATOM   233  S  SG  . CYS A 1 31  ? 39.641  86.957  165.655 1.00 64.38  ? 60   CYS A SG  1 
ATOM   234  N  N   . PRO A 1 32  ? 36.992  84.602  163.406 1.00 79.57  ? 61   PRO A N   1 
ATOM   235  C  CA  . PRO A 1 32  ? 35.721  85.003  162.852 1.00 82.31  ? 61   PRO A CA  1 
ATOM   236  C  C   . PRO A 1 32  ? 35.363  86.427  163.242 1.00 86.12  ? 61   PRO A C   1 
ATOM   237  O  O   . PRO A 1 32  ? 35.718  86.975  164.278 1.00 87.40  ? 61   PRO A O   1 
ATOM   238  C  CB  . PRO A 1 32  ? 34.708  84.019  163.400 1.00 81.58  ? 61   PRO A CB  1 
ATOM   239  C  CG  . PRO A 1 32  ? 35.496  82.952  164.052 1.00 81.45  ? 61   PRO A CG  1 
ATOM   240  C  CD  . PRO A 1 32  ? 36.831  83.525  164.418 1.00 80.81  ? 61   PRO A CD  1 
ATOM   241  N  N   . LYS A 1 33  ? 34.621  87.072  162.369 1.00 90.60  ? 62   LYS A N   1 
ATOM   242  C  CA  . LYS A 1 33  ? 34.214  88.459  162.478 1.00 95.87  ? 62   LYS A CA  1 
ATOM   243  C  C   . LYS A 1 33  ? 33.352  88.736  163.711 1.00 99.60  ? 62   LYS A C   1 
ATOM   244  O  O   . LYS A 1 33  ? 33.176  89.862  164.185 1.00 99.46  ? 62   LYS A O   1 
ATOM   245  C  CB  . LYS A 1 33  ? 33.425  88.823  161.216 1.00 103.73 ? 62   LYS A CB  1 
ATOM   246  C  CG  . LYS A 1 33  ? 33.925  88.243  159.908 1.00 103.65 ? 62   LYS A CG  1 
ATOM   247  C  CD  . LYS A 1 33  ? 33.077  87.029  159.533 1.00 103.57 ? 62   LYS A CD  1 
ATOM   248  C  CE  . LYS A 1 33  ? 33.556  86.340  158.280 1.00 101.84 ? 62   LYS A CE  1 
ATOM   249  N  NZ  . LYS A 1 33  ? 34.432  85.181  158.581 1.00 101.57 ? 62   LYS A NZ  1 
ATOM   250  N  N   . GLU A 1 34  ? 32.733  87.660  164.165 1.00 102.87 ? 63   GLU A N   1 
ATOM   251  C  CA  . GLU A 1 34  ? 31.848  87.581  165.291 1.00 105.83 ? 63   GLU A CA  1 
ATOM   252  C  C   . GLU A 1 34  ? 32.581  87.422  166.615 1.00 106.41 ? 63   GLU A C   1 
ATOM   253  O  O   . GLU A 1 34  ? 32.224  88.042  167.611 1.00 106.97 ? 63   GLU A O   1 
ATOM   254  C  CB  . GLU A 1 34  ? 30.928  86.351  165.104 1.00 114.86 ? 63   GLU A CB  1 
ATOM   255  C  CG  . GLU A 1 34  ? 29.782  86.370  166.109 1.00 124.91 ? 63   GLU A CG  1 
ATOM   256  C  CD  . GLU A 1 34  ? 28.733  87.398  165.715 1.00 129.45 ? 63   GLU A CD  1 
ATOM   257  O  OE1 . GLU A 1 34  ? 28.999  88.182  164.779 1.00 130.74 ? 63   GLU A OE1 1 
ATOM   258  O  OE2 . GLU A 1 34  ? 27.656  87.408  166.342 1.00 134.22 ? 63   GLU A OE2 1 
ATOM   259  N  N   . SER A 1 35  ? 33.623  86.592  166.607 1.00 106.55 ? 64   SER A N   1 
ATOM   260  C  CA  . SER A 1 35  ? 34.383  86.337  167.809 1.00 107.35 ? 64   SER A CA  1 
ATOM   261  C  C   . SER A 1 35  ? 35.363  87.438  168.158 1.00 108.24 ? 64   SER A C   1 
ATOM   262  O  O   . SER A 1 35  ? 35.844  87.452  169.295 1.00 108.83 ? 64   SER A O   1 
ATOM   263  C  CB  . SER A 1 35  ? 35.132  85.011  167.760 1.00 107.30 ? 64   SER A CB  1 
ATOM   264  O  OG  . SER A 1 35  ? 35.765  84.792  166.532 1.00 105.73 ? 64   SER A OG  1 
ATOM   265  N  N   . CYS A 1 36  ? 35.700  88.339  167.242 1.00 109.30 ? 65   CYS A N   1 
ATOM   266  C  CA  . CYS A 1 36  ? 36.659  89.362  167.656 1.00 112.06 ? 65   CYS A CA  1 
ATOM   267  C  C   . CYS A 1 36  ? 36.149  90.196  168.816 1.00 116.61 ? 65   CYS A C   1 
ATOM   268  O  O   . CYS A 1 36  ? 35.030  90.676  168.789 1.00 116.31 ? 65   CYS A O   1 
ATOM   269  C  CB  . CYS A 1 36  ? 37.219  90.140  166.499 1.00 96.21  ? 65   CYS A CB  1 
ATOM   270  S  SG  . CYS A 1 36  ? 38.961  89.596  166.198 1.00 85.12  ? 65   CYS A SG  1 
ATOM   271  N  N   . ASN A 1 37  ? 36.886  90.147  169.906 1.00 122.05 ? 66   ASN A N   1 
ATOM   272  C  CA  . ASN A 1 37  ? 36.730  90.798  171.177 1.00 127.86 ? 66   ASN A CA  1 
ATOM   273  C  C   . ASN A 1 37  ? 38.099  90.897  171.850 1.00 131.59 ? 66   ASN A C   1 
ATOM   274  O  O   . ASN A 1 37  ? 39.103  90.459  171.279 1.00 133.49 ? 66   ASN A O   1 
ATOM   275  C  CB  . ASN A 1 37  ? 35.737  90.106  172.108 1.00 136.04 ? 66   ASN A CB  1 
ATOM   276  C  CG  . ASN A 1 37  ? 36.246  88.777  172.617 1.00 138.58 ? 66   ASN A CG  1 
ATOM   277  O  OD1 . ASN A 1 37  ? 37.160  88.211  172.019 1.00 141.63 ? 66   ASN A OD1 1 
ATOM   278  N  ND2 . ASN A 1 37  ? 35.721  88.231  173.694 1.00 139.82 ? 66   ASN A ND2 1 
ATOM   279  N  N   . LEU A 1 38  ? 38.201  91.484  173.032 1.00 133.66 ? 67   LEU A N   1 
ATOM   280  C  CA  . LEU A 1 38  ? 39.538  91.645  173.601 1.00 135.58 ? 67   LEU A CA  1 
ATOM   281  C  C   . LEU A 1 38  ? 40.278  90.328  173.725 1.00 135.49 ? 67   LEU A C   1 
ATOM   282  O  O   . LEU A 1 38  ? 41.463  90.248  173.407 1.00 137.24 ? 67   LEU A O   1 
ATOM   283  C  CB  . LEU A 1 38  ? 39.490  92.361  174.944 1.00 146.57 ? 67   LEU A CB  1 
ATOM   284  C  CG  . LEU A 1 38  ? 39.636  93.886  174.870 1.00 150.10 ? 67   LEU A CG  1 
ATOM   285  C  CD1 . LEU A 1 38  ? 40.003  94.327  173.464 1.00 153.02 ? 67   LEU A CD1 1 
ATOM   286  C  CD2 . LEU A 1 38  ? 38.345  94.557  175.315 1.00 153.04 ? 67   LEU A CD2 1 
ATOM   287  N  N   . PHE A 1 39  ? 39.564  89.316  174.213 1.00 133.50 ? 68   PHE A N   1 
ATOM   288  C  CA  . PHE A 1 39  ? 40.184  88.028  174.447 1.00 130.80 ? 68   PHE A CA  1 
ATOM   289  C  C   . PHE A 1 39  ? 40.685  87.391  173.166 1.00 127.26 ? 68   PHE A C   1 
ATOM   290  O  O   . PHE A 1 39  ? 41.823  86.929  173.059 1.00 127.41 ? 68   PHE A O   1 
ATOM   291  C  CB  . PHE A 1 39  ? 39.230  87.078  175.186 1.00 143.03 ? 68   PHE A CB  1 
ATOM   292  C  CG  . PHE A 1 39  ? 40.027  85.949  175.797 1.00 149.93 ? 68   PHE A CG  1 
ATOM   293  C  CD1 . PHE A 1 39  ? 40.580  86.074  177.052 1.00 154.06 ? 68   PHE A CD1 1 
ATOM   294  C  CD2 . PHE A 1 39  ? 40.243  84.785  175.085 1.00 154.08 ? 68   PHE A CD2 1 
ATOM   295  C  CE1 . PHE A 1 39  ? 41.321  85.045  177.603 1.00 156.35 ? 68   PHE A CE1 1 
ATOM   296  C  CE2 . PHE A 1 39  ? 40.984  83.754  175.626 1.00 156.73 ? 68   PHE A CE2 1 
ATOM   297  C  CZ  . PHE A 1 39  ? 41.525  83.883  176.889 1.00 157.15 ? 68   PHE A CZ  1 
ATOM   298  N  N   . VAL A 1 40  ? 39.827  87.401  172.152 1.00 123.13 ? 69   VAL A N   1 
ATOM   299  C  CA  . VAL A 1 40  ? 40.203  86.795  170.884 1.00 118.50 ? 69   VAL A CA  1 
ATOM   300  C  C   . VAL A 1 40  ? 41.316  87.589  170.213 1.00 115.50 ? 69   VAL A C   1 
ATOM   301  O  O   . VAL A 1 40  ? 42.171  87.002  169.554 1.00 115.51 ? 69   VAL A O   1 
ATOM   302  C  CB  . VAL A 1 40  ? 39.003  86.717  169.922 1.00 116.59 ? 69   VAL A CB  1 
ATOM   303  C  CG1 . VAL A 1 40  ? 37.867  85.921  170.519 1.00 111.43 ? 69   VAL A CG1 1 
ATOM   304  C  CG2 . VAL A 1 40  ? 38.610  88.132  169.544 1.00 122.22 ? 69   VAL A CG2 1 
ATOM   305  N  N   . LEU A 1 41  ? 41.303  88.914  170.356 1.00 112.61 ? 70   LEU A N   1 
ATOM   306  C  CA  . LEU A 1 41  ? 42.307  89.743  169.714 1.00 110.00 ? 70   LEU A CA  1 
ATOM   307  C  C   . LEU A 1 41  ? 43.689  89.414  170.257 1.00 108.60 ? 70   LEU A C   1 
ATOM   308  O  O   . LEU A 1 41  ? 44.601  89.242  169.458 1.00 109.04 ? 70   LEU A O   1 
ATOM   309  C  CB  . LEU A 1 41  ? 42.006  91.232  169.834 1.00 107.12 ? 70   LEU A CB  1 
ATOM   310  C  CG  . LEU A 1 41  ? 42.840  92.178  168.960 1.00 103.49 ? 70   LEU A CG  1 
ATOM   311  C  CD1 . LEU A 1 41  ? 42.474  92.027  167.496 1.00 102.19 ? 70   LEU A CD1 1 
ATOM   312  C  CD2 . LEU A 1 41  ? 42.689  93.612  169.421 1.00 101.91 ? 70   LEU A CD2 1 
ATOM   313  N  N   . LYS A 1 42  ? 43.835  89.296  171.568 1.00 107.33 ? 71   LYS A N   1 
ATOM   314  C  CA  . LYS A 1 42  ? 45.141  88.988  172.133 1.00 107.37 ? 71   LYS A CA  1 
ATOM   315  C  C   . LYS A 1 42  ? 45.644  87.630  171.663 1.00 107.46 ? 71   LYS A C   1 
ATOM   316  O  O   . LYS A 1 42  ? 46.685  87.512  171.026 1.00 110.06 ? 71   LYS A O   1 
ATOM   317  C  CB  . LYS A 1 42  ? 45.098  88.986  173.656 1.00 113.29 ? 71   LYS A CB  1 
ATOM   318  C  CG  . LYS A 1 42  ? 44.307  90.139  174.243 1.00 119.63 ? 71   LYS A CG  1 
ATOM   319  C  CD  . LYS A 1 42  ? 45.080  91.438  174.152 1.00 124.05 ? 71   LYS A CD  1 
ATOM   320  C  CE  . LYS A 1 42  ? 44.293  92.610  174.712 1.00 129.28 ? 71   LYS A CE  1 
ATOM   321  N  NZ  . LYS A 1 42  ? 45.113  93.859  174.643 1.00 130.20 ? 71   LYS A NZ  1 
ATOM   322  N  N   . ASP A 1 43  ? 44.887  86.604  172.023 1.00 104.95 ? 72   ASP A N   1 
ATOM   323  C  CA  . ASP A 1 43  ? 45.259  85.241  171.689 1.00 102.35 ? 72   ASP A CA  1 
ATOM   324  C  C   . ASP A 1 43  ? 45.626  85.106  170.223 1.00 99.10  ? 72   ASP A C   1 
ATOM   325  O  O   . ASP A 1 43  ? 46.769  84.800  169.885 1.00 99.90  ? 72   ASP A O   1 
ATOM   326  C  CB  . ASP A 1 43  ? 44.124  84.287  172.062 1.00 109.60 ? 72   ASP A CB  1 
ATOM   327  C  CG  . ASP A 1 43  ? 44.538  82.833  171.953 1.00 113.29 ? 72   ASP A CG  1 
ATOM   328  O  OD1 . ASP A 1 43  ? 45.491  82.534  171.201 1.00 116.47 ? 72   ASP A OD1 1 
ATOM   329  O  OD2 . ASP A 1 43  ? 43.914  81.990  172.618 1.00 115.27 ? 72   ASP A OD2 1 
ATOM   330  N  N   . THR A 1 44  ? 44.638  85.335  169.355 1.00 95.15  ? 73   THR A N   1 
ATOM   331  C  CA  . THR A 1 44  ? 44.880  85.204  167.917 1.00 89.31  ? 73   THR A CA  1 
ATOM   332  C  C   . THR A 1 44  ? 46.078  86.073  167.534 1.00 83.26  ? 73   THR A C   1 
ATOM   333  O  O   . THR A 1 44  ? 47.009  85.637  166.867 1.00 82.26  ? 73   THR A O   1 
ATOM   334  C  CB  . THR A 1 44  ? 43.664  85.573  167.063 1.00 87.83  ? 73   THR A CB  1 
ATOM   335  O  OG1 . THR A 1 44  ? 43.315  86.941  167.309 1.00 97.38  ? 73   THR A OG1 1 
ATOM   336  C  CG2 . THR A 1 44  ? 42.456  84.709  167.356 1.00 84.07  ? 73   THR A CG2 1 
ATOM   337  N  N   . LEU A 1 45  ? 46.073  87.302  168.044 1.00 77.96  ? 74   LEU A N   1 
ATOM   338  C  CA  . LEU A 1 45  ? 47.154  88.233  167.793 1.00 73.27  ? 74   LEU A CA  1 
ATOM   339  C  C   . LEU A 1 45  ? 48.502  87.533  167.938 1.00 71.64  ? 74   LEU A C   1 
ATOM   340  O  O   . LEU A 1 45  ? 49.321  87.557  167.025 1.00 71.79  ? 74   LEU A O   1 
ATOM   341  C  CB  . LEU A 1 45  ? 47.122  89.420  168.747 1.00 64.67  ? 74   LEU A CB  1 
ATOM   342  C  CG  . LEU A 1 45  ? 47.041  90.800  168.086 1.00 64.13  ? 74   LEU A CG  1 
ATOM   343  C  CD1 . LEU A 1 45  ? 46.138  91.743  168.845 1.00 64.39  ? 74   LEU A CD1 1 
ATOM   344  C  CD2 . LEU A 1 45  ? 48.441  91.370  167.964 1.00 68.19  ? 74   LEU A CD2 1 
ATOM   345  N  N   . LYS A 1 46  ? 48.689  86.934  169.106 1.00 69.64  ? 75   LYS A N   1 
ATOM   346  C  CA  . LYS A 1 46  ? 49.898  86.198  169.448 1.00 65.83  ? 75   LYS A CA  1 
ATOM   347  C  C   . LYS A 1 46  ? 50.248  85.160  168.398 1.00 62.97  ? 75   LYS A C   1 
ATOM   348  O  O   . LYS A 1 46  ? 51.393  84.979  167.989 1.00 63.20  ? 75   LYS A O   1 
ATOM   349  C  CB  . LYS A 1 46  ? 49.745  85.525  170.812 1.00 70.18  ? 75   LYS A CB  1 
ATOM   350  C  CG  . LYS A 1 46  ? 49.563  86.464  171.990 1.00 76.84  ? 75   LYS A CG  1 
ATOM   351  C  CD  . LYS A 1 46  ? 49.817  85.778  173.319 1.00 78.92  ? 75   LYS A CD  1 
ATOM   352  C  CE  . LYS A 1 46  ? 48.776  86.063  174.374 1.00 82.63  ? 75   LYS A CE  1 
ATOM   353  N  NZ  . LYS A 1 46  ? 48.328  84.840  175.112 1.00 84.14  ? 75   LYS A NZ  1 
ATOM   354  N  N   . LYS A 1 47  ? 49.256  84.437  167.894 1.00 61.73  ? 76   LYS A N   1 
ATOM   355  C  CA  . LYS A 1 47  ? 49.518  83.422  166.871 1.00 59.96  ? 76   LYS A CA  1 
ATOM   356  C  C   . LYS A 1 47  ? 50.138  84.062  165.637 1.00 58.17  ? 76   LYS A C   1 
ATOM   357  O  O   . LYS A 1 47  ? 51.004  83.468  164.997 1.00 57.01  ? 76   LYS A O   1 
ATOM   358  C  CB  . LYS A 1 47  ? 48.238  82.657  166.538 1.00 65.36  ? 76   LYS A CB  1 
ATOM   359  C  CG  . LYS A 1 47  ? 47.359  82.376  167.754 1.00 68.12  ? 76   LYS A CG  1 
ATOM   360  C  CD  . LYS A 1 47  ? 45.906  82.175  167.344 1.00 70.40  ? 76   LYS A CD  1 
ATOM   361  C  CE  . LYS A 1 47  ? 45.349  80.869  167.871 1.00 78.90  ? 76   LYS A CE  1 
ATOM   362  N  NZ  . LYS A 1 47  ? 43.958  80.977  168.390 1.00 79.97  ? 76   LYS A NZ  1 
ATOM   363  N  N   . MET A 1 48  ? 49.705  85.280  165.313 1.00 56.59  ? 77   MET A N   1 
ATOM   364  C  CA  . MET A 1 48  ? 50.228  86.029  164.183 1.00 54.23  ? 77   MET A CA  1 
ATOM   365  C  C   . MET A 1 48  ? 51.655  86.486  164.501 1.00 53.41  ? 77   MET A C   1 
ATOM   366  O  O   . MET A 1 48  ? 52.575  86.368  163.704 1.00 53.61  ? 77   MET A O   1 
ATOM   367  C  CB  . MET A 1 48  ? 49.395  87.300  163.933 1.00 58.22  ? 77   MET A CB  1 
ATOM   368  C  CG  . MET A 1 48  ? 50.049  88.207  162.889 1.00 53.33  ? 77   MET A CG  1 
ATOM   369  S  SD  . MET A 1 48  ? 50.708  89.707  163.623 1.00 58.16  ? 77   MET A SD  1 
ATOM   370  C  CE  . MET A 1 48  ? 51.415  90.510  162.199 1.00 61.36  ? 77   MET A CE  1 
ATOM   371  N  N   . GLN A 1 49  ? 51.767  87.030  165.715 1.00 51.62  ? 78   GLN A N   1 
ATOM   372  C  CA  . GLN A 1 49  ? 53.054  87.494  166.210 1.00 48.83  ? 78   GLN A CA  1 
ATOM   373  C  C   . GLN A 1 49  ? 54.063  86.357  166.207 1.00 49.50  ? 78   GLN A C   1 
ATOM   374  O  O   . GLN A 1 49  ? 55.200  86.527  165.773 1.00 51.22  ? 78   GLN A O   1 
ATOM   375  C  CB  . GLN A 1 49  ? 52.910  88.067  167.605 1.00 33.18  ? 78   GLN A CB  1 
ATOM   376  C  CG  . GLN A 1 49  ? 52.481  89.525  167.594 1.00 38.97  ? 78   GLN A CG  1 
ATOM   377  C  CD  . GLN A 1 49  ? 51.688  89.889  168.835 1.00 42.52  ? 78   GLN A CD  1 
ATOM   378  O  OE1 . GLN A 1 49  ? 51.137  88.975  169.455 1.00 41.14  ? 78   GLN A OE1 1 
ATOM   379  N  NE2 . GLN A 1 49  ? 51.628  91.179  169.177 1.00 39.60  ? 78   GLN A NE2 1 
ATOM   380  N  N   . LYS A 1 50  ? 53.619  85.192  166.649 1.00 50.10  ? 79   LYS A N   1 
ATOM   381  C  CA  . LYS A 1 50  ? 54.472  84.009  166.632 1.00 53.89  ? 79   LYS A CA  1 
ATOM   382  C  C   . LYS A 1 50  ? 54.957  83.717  165.217 1.00 55.86  ? 79   LYS A C   1 
ATOM   383  O  O   . LYS A 1 50  ? 56.125  83.466  164.938 1.00 57.56  ? 79   LYS A O   1 
ATOM   384  C  CB  . LYS A 1 50  ? 53.680  82.811  167.171 1.00 61.69  ? 79   LYS A CB  1 
ATOM   385  C  CG  . LYS A 1 50  ? 54.242  81.460  166.747 1.00 68.99  ? 79   LYS A CG  1 
ATOM   386  C  CD  . LYS A 1 50  ? 53.925  80.374  167.766 1.00 69.66  ? 79   LYS A CD  1 
ATOM   387  C  CE  . LYS A 1 50  ? 54.861  79.189  167.578 1.00 67.84  ? 79   LYS A CE  1 
ATOM   388  N  NZ  . LYS A 1 50  ? 54.079  77.917  167.458 1.00 72.43  ? 79   LYS A NZ  1 
ATOM   389  N  N   . PHE A 1 51  ? 54.009  83.728  164.283 1.00 57.44  ? 80   PHE A N   1 
ATOM   390  C  CA  . PHE A 1 51  ? 54.340  83.418  162.899 1.00 58.00  ? 80   PHE A CA  1 
ATOM   391  C  C   . PHE A 1 51  ? 55.344  84.408  162.354 1.00 60.28  ? 80   PHE A C   1 
ATOM   392  O  O   . PHE A 1 51  ? 56.280  83.995  161.666 1.00 61.04  ? 80   PHE A O   1 
ATOM   393  C  CB  . PHE A 1 51  ? 53.072  83.350  162.062 1.00 50.44  ? 80   PHE A CB  1 
ATOM   394  C  CG  . PHE A 1 51  ? 53.292  82.968  160.632 1.00 49.41  ? 80   PHE A CG  1 
ATOM   395  C  CD1 . PHE A 1 51  ? 53.807  83.877  159.735 1.00 46.36  ? 80   PHE A CD1 1 
ATOM   396  C  CD2 . PHE A 1 51  ? 52.972  81.715  160.152 1.00 51.01  ? 80   PHE A CD2 1 
ATOM   397  C  CE1 . PHE A 1 51  ? 54.003  83.552  158.411 1.00 48.86  ? 80   PHE A CE1 1 
ATOM   398  C  CE2 . PHE A 1 51  ? 53.166  81.378  158.826 1.00 47.15  ? 80   PHE A CE2 1 
ATOM   399  C  CZ  . PHE A 1 51  ? 53.688  82.289  157.942 1.00 46.01  ? 80   PHE A CZ  1 
ATOM   400  N  N   . PHE A 1 52  ? 55.232  85.686  162.715 1.00 61.83  ? 81   PHE A N   1 
ATOM   401  C  CA  . PHE A 1 52  ? 56.109  86.696  162.132 1.00 63.67  ? 81   PHE A CA  1 
ATOM   402  C  C   . PHE A 1 52  ? 57.312  87.066  162.956 1.00 65.88  ? 81   PHE A C   1 
ATOM   403  O  O   . PHE A 1 52  ? 58.084  87.977  162.606 1.00 65.06  ? 81   PHE A O   1 
ATOM   404  C  CB  . PHE A 1 52  ? 55.275  87.939  161.762 1.00 59.11  ? 81   PHE A CB  1 
ATOM   405  C  CG  . PHE A 1 52  ? 54.327  87.679  160.623 1.00 57.07  ? 81   PHE A CG  1 
ATOM   406  C  CD1 . PHE A 1 52  ? 54.801  87.462  159.346 1.00 44.23  ? 81   PHE A CD1 1 
ATOM   407  C  CD2 . PHE A 1 52  ? 52.952  87.641  160.851 1.00 56.78  ? 81   PHE A CD2 1 
ATOM   408  C  CE1 . PHE A 1 52  ? 53.940  87.200  158.295 1.00 46.04  ? 81   PHE A CE1 1 
ATOM   409  C  CE2 . PHE A 1 52  ? 52.094  87.390  159.802 1.00 56.42  ? 81   PHE A CE2 1 
ATOM   410  C  CZ  . PHE A 1 52  ? 52.585  87.169  158.528 1.00 51.03  ? 81   PHE A CZ  1 
ATOM   411  N  N   . GLY A 1 53  ? 57.538  86.393  164.085 1.00 68.07  ? 82   GLY A N   1 
ATOM   412  C  CA  . GLY A 1 53  ? 58.723  86.686  164.877 1.00 71.83  ? 82   GLY A CA  1 
ATOM   413  C  C   . GLY A 1 53  ? 58.541  87.786  165.888 1.00 74.91  ? 82   GLY A C   1 
ATOM   414  O  O   . GLY A 1 53  ? 59.504  88.220  166.547 1.00 77.40  ? 82   GLY A O   1 
ATOM   415  N  N   . LEU A 1 54  ? 57.319  88.293  166.059 1.00 75.16  ? 83   LEU A N   1 
ATOM   416  C  CA  . LEU A 1 54  ? 57.196  89.316  167.105 1.00 76.82  ? 83   LEU A CA  1 
ATOM   417  C  C   . LEU A 1 54  ? 57.126  88.600  168.445 1.00 77.43  ? 83   LEU A C   1 
ATOM   418  O  O   . LEU A 1 54  ? 57.010  87.376  168.511 1.00 77.93  ? 83   LEU A O   1 
ATOM   419  C  CB  . LEU A 1 54  ? 55.960  90.184  166.879 1.00 84.07  ? 83   LEU A CB  1 
ATOM   420  C  CG  . LEU A 1 54  ? 55.605  90.402  165.403 1.00 84.71  ? 83   LEU A CG  1 
ATOM   421  C  CD1 . LEU A 1 54  ? 54.264  91.099  165.280 1.00 92.23  ? 83   LEU A CD1 1 
ATOM   422  C  CD2 . LEU A 1 54  ? 56.702  91.178  164.708 1.00 80.62  ? 83   LEU A CD2 1 
ATOM   423  N  N   . PRO A 1 55  ? 57.222  89.389  169.493 1.00 77.99  ? 84   PRO A N   1 
ATOM   424  C  CA  . PRO A 1 55  ? 57.008  88.882  170.834 1.00 79.40  ? 84   PRO A CA  1 
ATOM   425  C  C   . PRO A 1 55  ? 55.595  88.321  170.914 1.00 79.56  ? 84   PRO A C   1 
ATOM   426  O  O   . PRO A 1 55  ? 54.678  88.776  170.247 1.00 78.96  ? 84   PRO A O   1 
ATOM   427  C  CB  . PRO A 1 55  ? 57.102  90.123  171.719 1.00 79.56  ? 84   PRO A CB  1 
ATOM   428  C  CG  . PRO A 1 55  ? 57.819  91.128  170.884 1.00 79.15  ? 84   PRO A CG  1 
ATOM   429  C  CD  . PRO A 1 55  ? 57.324  90.868  169.479 1.00 78.42  ? 84   PRO A CD  1 
ATOM   430  N  N   . GLN A 1 56  ? 55.388  87.316  171.744 1.00 81.08  ? 85   GLN A N   1 
ATOM   431  C  CA  . GLN A 1 56  ? 53.988  86.858  171.850 1.00 82.54  ? 85   GLN A CA  1 
ATOM   432  C  C   . GLN A 1 56  ? 53.279  87.698  172.892 1.00 83.34  ? 85   GLN A C   1 
ATOM   433  O  O   . GLN A 1 56  ? 53.610  87.727  174.070 1.00 85.23  ? 85   GLN A O   1 
ATOM   434  C  CB  . GLN A 1 56  ? 53.969  85.364  172.064 1.00 84.06  ? 85   GLN A CB  1 
ATOM   435  C  CG  . GLN A 1 56  ? 54.391  84.606  170.803 1.00 79.48  ? 85   GLN A CG  1 
ATOM   436  C  CD  . GLN A 1 56  ? 54.344  83.113  171.051 1.00 87.20  ? 85   GLN A CD  1 
ATOM   437  O  OE1 . GLN A 1 56  ? 53.861  82.684  172.103 1.00 93.14  ? 85   GLN A OE1 1 
ATOM   438  N  NE2 . GLN A 1 56  ? 54.847  82.356  170.089 1.00 88.75  ? 85   GLN A NE2 1 
ATOM   439  N  N   . THR A 1 57  ? 52.381  88.550  172.429 1.00 83.49  ? 86   THR A N   1 
ATOM   440  C  CA  . THR A 1 57  ? 51.617  89.435  173.299 1.00 84.25  ? 86   THR A CA  1 
ATOM   441  C  C   . THR A 1 57  ? 50.312  89.773  172.600 1.00 84.86  ? 86   THR A C   1 
ATOM   442  O  O   . THR A 1 57  ? 50.272  89.706  171.374 1.00 85.46  ? 86   THR A O   1 
ATOM   443  C  CB  . THR A 1 57  ? 52.382  90.729  173.620 1.00 80.03  ? 86   THR A CB  1 
ATOM   444  O  OG1 . THR A 1 57  ? 51.624  91.446  174.606 1.00 84.20  ? 86   THR A OG1 1 
ATOM   445  C  CG2 . THR A 1 57  ? 52.533  91.592  172.389 1.00 76.95  ? 86   THR A CG2 1 
ATOM   446  N  N   . GLY A 1 58  ? 49.240  90.049  173.313 1.00 85.98  ? 87   GLY A N   1 
ATOM   447  C  CA  . GLY A 1 58  ? 47.975  90.293  172.607 1.00 87.69  ? 87   GLY A CA  1 
ATOM   448  C  C   . GLY A 1 58  ? 47.903  91.747  172.177 1.00 88.20  ? 87   GLY A C   1 
ATOM   449  O  O   . GLY A 1 58  ? 47.052  92.179  171.413 1.00 90.39  ? 87   GLY A O   1 
ATOM   450  N  N   . ASP A 1 59  ? 48.765  92.533  172.797 1.00 87.60  ? 88   ASP A N   1 
ATOM   451  C  CA  . ASP A 1 59  ? 48.870  93.950  172.478 1.00 86.20  ? 88   ASP A CA  1 
ATOM   452  C  C   . ASP A 1 59  ? 49.329  94.107  171.033 1.00 84.43  ? 88   ASP A C   1 
ATOM   453  O  O   . ASP A 1 59  ? 50.049  93.242  170.538 1.00 83.93  ? 88   ASP A O   1 
ATOM   454  C  CB  . ASP A 1 59  ? 49.923  94.563  173.404 1.00 93.76  ? 88   ASP A CB  1 
ATOM   455  C  CG  . ASP A 1 59  ? 49.496  94.421  174.852 1.00 102.26 ? 88   ASP A CG  1 
ATOM   456  O  OD1 . ASP A 1 59  ? 48.296  94.161  175.092 1.00 107.94 ? 88   ASP A OD1 1 
ATOM   457  O  OD2 . ASP A 1 59  ? 50.370  94.571  175.723 1.00 108.46 ? 88   ASP A OD2 1 
ATOM   458  N  N   . LEU A 1 60  ? 48.917  95.209  170.436 1.00 83.23  ? 89   LEU A N   1 
ATOM   459  C  CA  . LEU A 1 60  ? 49.321  95.562  169.081 1.00 82.70  ? 89   LEU A CA  1 
ATOM   460  C  C   . LEU A 1 60  ? 50.591  96.396  169.107 1.00 82.18  ? 89   LEU A C   1 
ATOM   461  O  O   . LEU A 1 60  ? 50.561  97.585  169.370 1.00 80.62  ? 89   LEU A O   1 
ATOM   462  C  CB  . LEU A 1 60  ? 48.148  96.227  168.352 1.00 79.81  ? 89   LEU A CB  1 
ATOM   463  C  CG  . LEU A 1 60  ? 46.989  95.258  168.053 1.00 79.57  ? 89   LEU A CG  1 
ATOM   464  C  CD1 . LEU A 1 60  ? 45.680  95.971  167.810 1.00 78.59  ? 89   LEU A CD1 1 
ATOM   465  C  CD2 . LEU A 1 60  ? 47.318  94.325  166.895 1.00 82.30  ? 89   LEU A CD2 1 
ATOM   466  N  N   . ASP A 1 61  ? 51.740  95.750  168.913 1.00 83.55  ? 90   ASP A N   1 
ATOM   467  C  CA  . ASP A 1 61  ? 53.047  96.340  168.985 1.00 84.63  ? 90   ASP A CA  1 
ATOM   468  C  C   . ASP A 1 61  ? 53.397  97.225  167.797 1.00 85.42  ? 90   ASP A C   1 
ATOM   469  O  O   . ASP A 1 61  ? 53.366  96.818  166.643 1.00 85.62  ? 90   ASP A O   1 
ATOM   470  C  CB  . ASP A 1 61  ? 54.156  95.278  169.064 1.00 85.94  ? 90   ASP A CB  1 
ATOM   471  C  CG  . ASP A 1 61  ? 53.836  94.173  170.035 1.00 90.07  ? 90   ASP A CG  1 
ATOM   472  O  OD1 . ASP A 1 61  ? 52.833  94.319  170.762 1.00 97.64  ? 90   ASP A OD1 1 
ATOM   473  O  OD2 . ASP A 1 61  ? 54.591  93.178  170.065 1.00 88.89  ? 90   ASP A OD2 1 
ATOM   474  N  N   . GLN A 1 62  ? 54.029  98.352  168.090 1.00 85.45  ? 91   GLN A N   1 
ATOM   475  C  CA  . GLN A 1 62  ? 54.499  99.276  167.072 1.00 83.65  ? 91   GLN A CA  1 
ATOM   476  C  C   . GLN A 1 62  ? 55.058  98.518  165.880 1.00 79.86  ? 91   GLN A C   1 
ATOM   477  O  O   . GLN A 1 62  ? 55.029  99.070  164.779 1.00 82.82  ? 91   GLN A O   1 
ATOM   478  C  CB  . GLN A 1 62  ? 55.501  100.267 167.668 1.00 103.50 ? 91   GLN A CB  1 
ATOM   479  C  CG  . GLN A 1 62  ? 55.383  100.517 169.152 1.00 117.22 ? 91   GLN A CG  1 
ATOM   480  C  CD  . GLN A 1 62  ? 55.845  99.463  170.115 1.00 120.35 ? 91   GLN A CD  1 
ATOM   481  O  OE1 . GLN A 1 62  ? 56.471  99.750  171.152 1.00 123.57 ? 91   GLN A OE1 1 
ATOM   482  N  NE2 . GLN A 1 62  ? 55.588  98.177  169.897 1.00 118.39 ? 91   GLN A NE2 1 
ATOM   483  N  N   . ASN A 1 63  ? 55.582  97.307  166.050 1.00 73.76  ? 92   ASN A N   1 
ATOM   484  C  CA  . ASN A 1 63  ? 56.057  96.484  164.982 1.00 69.40  ? 92   ASN A CA  1 
ATOM   485  C  C   . ASN A 1 63  ? 55.004  95.464  164.520 1.00 66.54  ? 92   ASN A C   1 
ATOM   486  O  O   . ASN A 1 63  ? 55.028  95.062  163.356 1.00 67.45  ? 92   ASN A O   1 
ATOM   487  C  CB  . ASN A 1 63  ? 57.340  95.725  165.180 1.00 74.55  ? 92   ASN A CB  1 
ATOM   488  C  CG  . ASN A 1 63  ? 58.108  95.866  166.448 1.00 78.28  ? 92   ASN A CG  1 
ATOM   489  O  OD1 . ASN A 1 63  ? 58.536  94.871  167.049 1.00 82.55  ? 92   ASN A OD1 1 
ATOM   490  N  ND2 . ASN A 1 63  ? 58.352  97.079  166.920 1.00 78.50  ? 92   ASN A ND2 1 
ATOM   491  N  N   . THR A 1 64  ? 54.114  95.032  165.387 1.00 62.67  ? 93   THR A N   1 
ATOM   492  C  CA  . THR A 1 64  ? 53.032  94.124  165.012 1.00 59.03  ? 93   THR A CA  1 
ATOM   493  C  C   . THR A 1 64  ? 52.105  94.776  163.992 1.00 57.68  ? 93   THR A C   1 
ATOM   494  O  O   . THR A 1 64  ? 51.496  94.136  163.140 1.00 59.13  ? 93   THR A O   1 
ATOM   495  C  CB  . THR A 1 64  ? 52.199  93.696  166.233 1.00 55.91  ? 93   THR A CB  1 
ATOM   496  O  OG1 . THR A 1 64  ? 53.000  93.059  167.231 1.00 57.01  ? 93   THR A OG1 1 
ATOM   497  C  CG2 . THR A 1 64  ? 51.110  92.733  165.814 1.00 56.89  ? 93   THR A CG2 1 
ATOM   498  N  N   . ILE A 1 65  ? 51.973  96.097  164.086 1.00 55.95  ? 94   ILE A N   1 
ATOM   499  C  CA  . ILE A 1 65  ? 51.163  96.882  163.172 1.00 53.03  ? 94   ILE A CA  1 
ATOM   500  C  C   . ILE A 1 65  ? 51.938  97.192  161.898 1.00 52.34  ? 94   ILE A C   1 
ATOM   501  O  O   . ILE A 1 65  ? 51.435  97.158  160.777 1.00 53.37  ? 94   ILE A O   1 
ATOM   502  C  CB  . ILE A 1 65  ? 50.771  98.219  163.801 1.00 41.20  ? 94   ILE A CB  1 
ATOM   503  C  CG1 . ILE A 1 65  ? 49.673  98.015  164.842 1.00 42.22  ? 94   ILE A CG1 1 
ATOM   504  C  CG2 . ILE A 1 65  ? 50.258  99.191  162.748 1.00 52.65  ? 94   ILE A CG2 1 
ATOM   505  C  CD1 . ILE A 1 65  ? 49.194  99.367  165.353 1.00 53.91  ? 94   ILE A CD1 1 
ATOM   506  N  N   . GLU A 1 66  ? 53.212  97.516  162.104 1.00 51.21  ? 95   GLU A N   1 
ATOM   507  C  CA  . GLU A 1 66  ? 54.053  97.823  160.941 1.00 53.83  ? 95   GLU A CA  1 
ATOM   508  C  C   . GLU A 1 66  ? 54.179  96.581  160.071 1.00 54.70  ? 95   GLU A C   1 
ATOM   509  O  O   . GLU A 1 66  ? 54.410  96.635  158.864 1.00 56.94  ? 95   GLU A O   1 
ATOM   510  C  CB  . GLU A 1 66  ? 55.393  98.378  161.387 1.00 68.01  ? 95   GLU A CB  1 
ATOM   511  C  CG  . GLU A 1 66  ? 56.620  97.520  161.108 1.00 76.85  ? 95   GLU A CG  1 
ATOM   512  C  CD  . GLU A 1 66  ? 57.875  98.076  161.760 1.00 85.91  ? 95   GLU A CD  1 
ATOM   513  O  OE1 . GLU A 1 66  ? 58.038  97.926  162.992 1.00 88.89  ? 95   GLU A OE1 1 
ATOM   514  O  OE2 . GLU A 1 66  ? 58.712  98.670  161.040 1.00 89.62  ? 95   GLU A OE2 1 
ATOM   515  N  N   . THR A 1 67  ? 54.048  95.418  160.715 1.00 53.08  ? 96   THR A N   1 
ATOM   516  C  CA  . THR A 1 67  ? 54.165  94.165  159.989 1.00 50.54  ? 96   THR A CA  1 
ATOM   517  C  C   . THR A 1 67  ? 52.879  93.870  159.259 1.00 49.17  ? 96   THR A C   1 
ATOM   518  O  O   . THR A 1 67  ? 52.901  93.608  158.056 1.00 49.67  ? 96   THR A O   1 
ATOM   519  C  CB  . THR A 1 67  ? 54.521  93.013  160.943 1.00 46.48  ? 96   THR A CB  1 
ATOM   520  O  OG1 . THR A 1 67  ? 55.774  93.369  161.550 1.00 37.08  ? 96   THR A OG1 1 
ATOM   521  C  CG2 . THR A 1 67  ? 54.618  91.706  160.174 1.00 41.36  ? 96   THR A CG2 1 
ATOM   522  N  N   . MET A 1 68  ? 51.751  94.046  159.958 1.00 47.38  ? 97   MET A N   1 
ATOM   523  C  CA  . MET A 1 68  ? 50.485  93.759  159.267 1.00 47.45  ? 97   MET A CA  1 
ATOM   524  C  C   . MET A 1 68  ? 50.037  94.913  158.401 1.00 46.70  ? 97   MET A C   1 
ATOM   525  O  O   . MET A 1 68  ? 48.915  94.973  157.912 1.00 46.57  ? 97   MET A O   1 
ATOM   526  C  CB  . MET A 1 68  ? 49.408  93.285  160.223 1.00 54.39  ? 97   MET A CB  1 
ATOM   527  C  CG  . MET A 1 68  ? 49.047  94.251  161.329 1.00 49.94  ? 97   MET A CG  1 
ATOM   528  S  SD  . MET A 1 68  ? 47.932  93.601  162.569 1.00 48.45  ? 97   MET A SD  1 
ATOM   529  C  CE  . MET A 1 68  ? 47.595  91.953  162.069 1.00 52.54  ? 97   MET A CE  1 
ATOM   530  N  N   . ARG A 1 69  ? 50.951  95.818  158.085 1.00 47.31  ? 98   ARG A N   1 
ATOM   531  C  CA  . ARG A 1 69  ? 50.712  96.931  157.193 1.00 45.08  ? 98   ARG A CA  1 
ATOM   532  C  C   . ARG A 1 69  ? 51.455  96.761  155.878 1.00 43.52  ? 98   ARG A C   1 
ATOM   533  O  O   . ARG A 1 69  ? 51.272  97.544  154.957 1.00 48.60  ? 98   ARG A O   1 
ATOM   534  C  CB  . ARG A 1 69  ? 51.091  98.232  157.900 1.00 41.48  ? 98   ARG A CB  1 
ATOM   535  C  CG  . ARG A 1 69  ? 49.872  98.972  158.414 1.00 55.11  ? 98   ARG A CG  1 
ATOM   536  C  CD  . ARG A 1 69  ? 49.983  100.477 158.186 1.00 64.68  ? 98   ARG A CD  1 
ATOM   537  N  NE  . ARG A 1 69  ? 50.340  101.144 159.445 1.00 68.89  ? 98   ARG A NE  1 
ATOM   538  C  CZ  . ARG A 1 69  ? 49.439  101.414 160.388 1.00 73.50  ? 98   ARG A CZ  1 
ATOM   539  N  NH1 . ARG A 1 69  ? 48.158  101.098 160.203 1.00 71.41  ? 98   ARG A NH1 1 
ATOM   540  N  NH2 . ARG A 1 69  ? 49.826  102.005 161.515 1.00 73.10  ? 98   ARG A NH2 1 
ATOM   541  N  N   . LYS A 1 70  ? 52.205  95.699  155.709 1.00 38.77  ? 99   LYS A N   1 
ATOM   542  C  CA  . LYS A 1 70  ? 52.981  95.400  154.533 1.00 36.19  ? 99   LYS A CA  1 
ATOM   543  C  C   . LYS A 1 70  ? 52.202  94.565  153.527 1.00 34.88  ? 99   LYS A C   1 
ATOM   544  O  O   . LYS A 1 70  ? 51.668  93.508  153.888 1.00 34.44  ? 99   LYS A O   1 
ATOM   545  C  CB  . LYS A 1 70  ? 54.229  94.555  154.947 1.00 41.48  ? 99   LYS A CB  1 
ATOM   546  C  CG  . LYS A 1 70  ? 54.970  95.170  156.125 1.00 46.69  ? 99   LYS A CG  1 
ATOM   547  C  CD  . LYS A 1 70  ? 56.469  95.263  155.864 1.00 46.51  ? 99   LYS A CD  1 
ATOM   548  C  CE  . LYS A 1 70  ? 57.274  94.819  157.077 1.00 49.86  ? 99   LYS A CE  1 
ATOM   549  N  NZ  . LYS A 1 70  ? 58.223  93.704  156.780 1.00 48.19  ? 99   LYS A NZ  1 
ATOM   550  N  N   . PRO A 1 71  ? 52.198  94.937  152.288 1.00 34.16  ? 100  PRO A N   1 
ATOM   551  C  CA  . PRO A 1 71  ? 51.479  94.126  151.282 1.00 33.96  ? 100  PRO A CA  1 
ATOM   552  C  C   . PRO A 1 71  ? 51.980  92.700  151.358 1.00 36.38  ? 100  PRO A C   1 
ATOM   553  O  O   . PRO A 1 71  ? 53.183  92.527  151.585 1.00 38.26  ? 100  PRO A O   1 
ATOM   554  C  CB  . PRO A 1 71  ? 51.867  94.778  149.973 1.00 32.56  ? 100  PRO A CB  1 
ATOM   555  C  CG  . PRO A 1 71  ? 52.235  96.181  150.304 1.00 30.27  ? 100  PRO A CG  1 
ATOM   556  C  CD  . PRO A 1 71  ? 52.750  96.177  151.704 1.00 32.00  ? 100  PRO A CD  1 
ATOM   557  N  N   . ARG A 1 72  ? 51.036  91.811  151.095 1.00 35.28  ? 101  ARG A N   1 
ATOM   558  C  CA  . ARG A 1 72  ? 51.323  90.419  151.184 1.00 31.53  ? 101  ARG A CA  1 
ATOM   559  C  C   . ARG A 1 72  ? 50.403  89.623  150.288 1.00 31.05  ? 101  ARG A C   1 
ATOM   560  O  O   . ARG A 1 72  ? 49.536  90.222  149.661 1.00 28.82  ? 101  ARG A O   1 
ATOM   561  C  CB  . ARG A 1 72  ? 51.161  89.912  152.620 1.00 35.99  ? 101  ARG A CB  1 
ATOM   562  C  CG  . ARG A 1 72  ? 50.016  90.506  153.397 1.00 28.88  ? 101  ARG A CG  1 
ATOM   563  C  CD  . ARG A 1 72  ? 49.120  89.394  153.928 1.00 36.01  ? 101  ARG A CD  1 
ATOM   564  N  NE  . ARG A 1 72  ? 49.619  88.888  155.212 1.00 37.06  ? 101  ARG A NE  1 
ATOM   565  C  CZ  . ARG A 1 72  ? 49.792  87.583  155.428 1.00 42.72  ? 101  ARG A CZ  1 
ATOM   566  N  NH1 . ARG A 1 72  ? 49.500  86.696  154.479 1.00 35.13  ? 101  ARG A NH1 1 
ATOM   567  N  NH2 . ARG A 1 72  ? 50.249  87.158  156.595 1.00 36.63  ? 101  ARG A NH2 1 
ATOM   568  N  N   . CYS A 1 73  ? 50.590  88.323  150.357 1.00 32.26  ? 102  CYS A N   1 
ATOM   569  C  CA  . CYS A 1 73  ? 49.684  87.426  149.623 1.00 35.34  ? 102  CYS A CA  1 
ATOM   570  C  C   . CYS A 1 73  ? 48.314  87.344  150.256 1.00 36.03  ? 102  CYS A C   1 
ATOM   571  O  O   . CYS A 1 73  ? 48.146  87.738  151.420 1.00 38.54  ? 102  CYS A O   1 
ATOM   572  C  CB  . CYS A 1 73  ? 50.332  86.042  149.641 1.00 32.53  ? 102  CYS A CB  1 
ATOM   573  S  SG  . CYS A 1 73  ? 49.364  84.823  148.805 1.00 38.02  ? 102  CYS A SG  1 
ATOM   574  N  N   . GLY A 1 74  ? 47.303  86.889  149.533 1.00 37.45  ? 103  GLY A N   1 
ATOM   575  C  CA  . GLY A 1 74  ? 45.960  86.862  150.121 1.00 39.80  ? 103  GLY A CA  1 
ATOM   576  C  C   . GLY A 1 74  ? 45.694  85.626  150.958 1.00 41.04  ? 103  GLY A C   1 
ATOM   577  O  O   . GLY A 1 74  ? 44.716  85.646  151.713 1.00 42.74  ? 103  GLY A O   1 
ATOM   578  N  N   . ASN A 1 75  ? 46.489  84.578  150.782 1.00 41.21  ? 104  ASN A N   1 
ATOM   579  C  CA  . ASN A 1 75  ? 46.340  83.318  151.481 1.00 40.19  ? 104  ASN A CA  1 
ATOM   580  C  C   . ASN A 1 75  ? 46.647  83.483  152.968 1.00 41.91  ? 104  ASN A C   1 
ATOM   581  O  O   . ASN A 1 75  ? 47.509  84.283  153.340 1.00 40.46  ? 104  ASN A O   1 
ATOM   582  C  CB  . ASN A 1 75  ? 47.300  82.254  150.955 1.00 32.39  ? 104  ASN A CB  1 
ATOM   583  C  CG  . ASN A 1 75  ? 47.035  81.870  149.529 1.00 47.16  ? 104  ASN A CG  1 
ATOM   584  O  OD1 . ASN A 1 75  ? 46.794  80.703  149.231 1.00 52.46  ? 104  ASN A OD1 1 
ATOM   585  N  ND2 . ASN A 1 75  ? 47.061  82.822  148.606 1.00 54.00  ? 104  ASN A ND2 1 
ATOM   586  N  N   . PRO A 1 76  ? 45.935  82.712  153.771 1.00 44.58  ? 105  PRO A N   1 
ATOM   587  C  CA  . PRO A 1 76  ? 46.090  82.701  155.217 1.00 46.74  ? 105  PRO A CA  1 
ATOM   588  C  C   . PRO A 1 76  ? 47.409  82.056  155.643 1.00 49.09  ? 105  PRO A C   1 
ATOM   589  O  O   . PRO A 1 76  ? 48.075  81.377  154.870 1.00 40.39  ? 105  PRO A O   1 
ATOM   590  C  CB  . PRO A 1 76  ? 44.942  81.828  155.710 1.00 44.83  ? 105  PRO A CB  1 
ATOM   591  C  CG  . PRO A 1 76  ? 43.995  81.736  154.571 1.00 44.07  ? 105  PRO A CG  1 
ATOM   592  C  CD  . PRO A 1 76  ? 44.835  81.810  153.334 1.00 43.47  ? 105  PRO A CD  1 
ATOM   593  N  N   . ASP A 1 77  ? 47.759  82.242  156.910 1.00 58.35  ? 106  ASP A N   1 
ATOM   594  C  CA  . ASP A 1 77  ? 48.965  81.601  157.424 1.00 73.00  ? 106  ASP A CA  1 
ATOM   595  C  C   . ASP A 1 77  ? 48.623  80.281  158.111 1.00 86.69  ? 106  ASP A C   1 
ATOM   596  O  O   . ASP A 1 77  ? 49.437  79.358  158.129 1.00 87.91  ? 106  ASP A O   1 
ATOM   597  C  CB  . ASP A 1 77  ? 49.651  82.553  158.387 1.00 64.47  ? 106  ASP A CB  1 
ATOM   598  C  CG  . ASP A 1 77  ? 49.967  83.891  157.724 1.00 49.66  ? 106  ASP A CG  1 
ATOM   599  O  OD1 . ASP A 1 77  ? 50.182  83.940  156.499 1.00 27.28  ? 106  ASP A OD1 1 
ATOM   600  O  OD2 . ASP A 1 77  ? 49.994  84.874  158.490 1.00 38.74  ? 106  ASP A OD2 1 
ATOM   601  N  N   . VAL A 1 78  ? 47.396  80.196  158.614 1.00 99.31  ? 107  VAL A N   1 
ATOM   602  C  CA  . VAL A 1 78  ? 46.882  79.025  159.271 1.00 112.35 ? 107  VAL A CA  1 
ATOM   603  C  C   . VAL A 1 78  ? 45.762  78.212  158.633 1.00 126.00 ? 107  VAL A C   1 
ATOM   604  O  O   . VAL A 1 78  ? 44.789  78.773  158.126 1.00 127.32 ? 107  VAL A O   1 
ATOM   605  C  CB  . VAL A 1 78  ? 46.524  79.266  160.743 1.00 118.51 ? 107  VAL A CB  1 
ATOM   606  C  CG1 . VAL A 1 78  ? 45.397  80.281  160.858 1.00 122.10 ? 107  VAL A CG1 1 
ATOM   607  C  CG2 . VAL A 1 78  ? 46.145  77.958  161.420 1.00 120.86 ? 107  VAL A CG2 1 
ATOM   608  N  N   . ALA A 1 79  ? 46.034  76.891  158.744 1.00 142.48 ? 108  ALA A N   1 
ATOM   609  C  CA  . ALA A 1 79  ? 45.161  75.778  158.360 1.00 193.28 ? 108  ALA A CA  1 
ATOM   610  C  C   . ALA A 1 79  ? 44.956  75.596  156.862 1.00 205.34 ? 108  ALA A C   1 
ATOM   611  O  O   . ALA A 1 79  ? 44.124  76.263  156.254 1.00 204.44 ? 108  ALA A O   1 
ATOM   612  C  CB  . ALA A 1 79  ? 43.799  75.918  159.015 1.00 183.48 ? 108  ALA A CB  1 
ATOM   613  N  N   . ASN A 1 80  ? 45.692  74.676  156.223 1.00 214.93 ? 109  ASN A N   1 
ATOM   614  C  CA  . ASN A 1 80  ? 45.422  74.435  154.813 1.00 227.35 ? 109  ASN A CA  1 
ATOM   615  C  C   . ASN A 1 80  ? 44.078  73.730  154.684 1.00 237.02 ? 109  ASN A C   1 
ATOM   616  O  O   . ASN A 1 80  ? 44.039  72.503  154.492 1.00 238.78 ? 109  ASN A O   1 
ATOM   617  C  CB  . ASN A 1 80  ? 46.537  73.681  154.093 1.00 228.80 ? 109  ASN A CB  1 
ATOM   618  C  CG  . ASN A 1 80  ? 46.434  73.888  152.585 1.00 230.41 ? 109  ASN A CG  1 
ATOM   619  O  OD1 . ASN A 1 80  ? 47.041  73.164  151.799 1.00 234.26 ? 109  ASN A OD1 1 
ATOM   620  N  ND2 . ASN A 1 80  ? 45.645  74.883  152.178 1.00 227.64 ? 109  ASN A ND2 1 
ATOM   621  N  N   . TYR A 1 81  ? 43.058  74.584  154.825 1.00 244.96 ? 110  TYR A N   1 
ATOM   622  C  CA  . TYR A 1 81  ? 41.639  74.232  154.752 1.00 251.75 ? 110  TYR A CA  1 
ATOM   623  C  C   . TYR A 1 81  ? 40.858  75.377  154.089 1.00 254.20 ? 110  TYR A C   1 
ATOM   624  O  O   . TYR A 1 81  ? 39.858  75.849  154.623 1.00 254.73 ? 110  TYR A O   1 
ATOM   625  C  CB  . TYR A 1 81  ? 41.095  73.929  156.151 1.00 256.36 ? 110  TYR A CB  1 
ATOM   626  C  CG  . TYR A 1 81  ? 41.974  73.006  156.968 1.00 262.63 ? 110  TYR A CG  1 
ATOM   627  C  CD1 . TYR A 1 81  ? 43.086  73.488  157.646 1.00 265.33 ? 110  TYR A CD1 1 
ATOM   628  C  CD2 . TYR A 1 81  ? 41.691  71.650  157.060 1.00 265.19 ? 110  TYR A CD2 1 
ATOM   629  C  CE1 . TYR A 1 81  ? 43.891  72.645  158.391 1.00 267.00 ? 110  TYR A CE1 1 
ATOM   630  C  CE2 . TYR A 1 81  ? 42.489  70.799  157.802 1.00 266.84 ? 110  TYR A CE2 1 
ATOM   631  C  CZ  . TYR A 1 81  ? 43.587  71.302  158.465 1.00 267.40 ? 110  TYR A CZ  1 
ATOM   632  O  OH  . TYR A 1 81  ? 44.384  70.458  159.204 1.00 267.39 ? 110  TYR A OH  1 
ATOM   633  N  N   . ASN A 1 82  ? 41.342  75.838  152.938 1.00 255.92 ? 111  ASN A N   1 
ATOM   634  C  CA  . ASN A 1 82  ? 40.804  76.991  152.214 1.00 257.31 ? 111  ASN A CA  1 
ATOM   635  C  C   . ASN A 1 82  ? 40.313  76.658  150.820 1.00 258.22 ? 111  ASN A C   1 
ATOM   636  O  O   . ASN A 1 82  ? 40.785  77.153  149.792 1.00 258.31 ? 111  ASN A O   1 
ATOM   637  C  CB  . ASN A 1 82  ? 41.874  78.091  152.202 1.00 256.26 ? 111  ASN A CB  1 
ATOM   638  C  CG  . ASN A 1 82  ? 41.723  79.175  151.174 1.00 253.65 ? 111  ASN A CG  1 
ATOM   639  O  OD1 . ASN A 1 82  ? 40.635  79.394  150.634 1.00 255.49 ? 111  ASN A OD1 1 
ATOM   640  N  ND2 . ASN A 1 82  ? 42.803  79.881  150.852 1.00 251.21 ? 111  ASN A ND2 1 
ATOM   641  N  N   . PHE A 1 83  ? 39.322  75.777  150.709 1.00 259.08 ? 112  PHE A N   1 
ATOM   642  C  CA  . PHE A 1 83  ? 38.725  75.369  149.455 1.00 259.77 ? 112  PHE A CA  1 
ATOM   643  C  C   . PHE A 1 83  ? 39.577  74.482  148.585 1.00 260.17 ? 112  PHE A C   1 
ATOM   644  O  O   . PHE A 1 83  ? 39.239  74.200  147.425 1.00 260.67 ? 112  PHE A O   1 
ATOM   645  C  CB  . PHE A 1 83  ? 38.254  76.594  148.639 1.00 258.33 ? 112  PHE A CB  1 
ATOM   646  C  CG  . PHE A 1 83  ? 37.401  76.197  147.463 1.00 258.72 ? 112  PHE A CG  1 
ATOM   647  C  CD1 . PHE A 1 83  ? 37.973  75.880  146.242 1.00 260.76 ? 112  PHE A CD1 1 
ATOM   648  C  CD2 . PHE A 1 83  ? 36.024  76.135  147.576 1.00 257.86 ? 112  PHE A CD2 1 
ATOM   649  C  CE1 . PHE A 1 83  ? 37.211  75.487  145.166 1.00 260.44 ? 112  PHE A CE1 1 
ATOM   650  C  CE2 . PHE A 1 83  ? 35.247  75.761  146.498 1.00 257.79 ? 112  PHE A CE2 1 
ATOM   651  C  CZ  . PHE A 1 83  ? 35.836  75.438  145.293 1.00 258.31 ? 112  PHE A CZ  1 
ATOM   652  N  N   . PHE A 1 84  ? 40.720  73.949  149.007 1.00 259.72 ? 113  PHE A N   1 
ATOM   653  C  CA  . PHE A 1 84  ? 41.434  73.066  148.058 1.00 257.88 ? 113  PHE A CA  1 
ATOM   654  C  C   . PHE A 1 84  ? 41.428  71.657  148.646 1.00 253.82 ? 113  PHE A C   1 
ATOM   655  O  O   . PHE A 1 84  ? 41.072  71.431  149.805 1.00 256.47 ? 113  PHE A O   1 
ATOM   656  C  CB  . PHE A 1 84  ? 42.909  73.576  147.894 1.00 270.92 ? 113  PHE A CB  1 
ATOM   657  C  CG  . PHE A 1 84  ? 43.446  73.364  149.301 1.00 281.49 ? 113  PHE A CG  1 
ATOM   658  C  CD1 . PHE A 1 84  ? 43.252  74.361  150.236 1.00 283.97 ? 113  PHE A CD1 1 
ATOM   659  C  CD2 . PHE A 1 84  ? 43.996  72.153  149.621 1.00 286.59 ? 113  PHE A CD2 1 
ATOM   660  C  CE1 . PHE A 1 84  ? 43.652  74.119  151.529 1.00 286.70 ? 113  PHE A CE1 1 
ATOM   661  C  CE2 . PHE A 1 84  ? 44.399  71.885  150.913 1.00 288.49 ? 113  PHE A CE2 1 
ATOM   662  C  CZ  . PHE A 1 84  ? 44.172  72.880  151.811 1.00 287.83 ? 113  PHE A CZ  1 
ATOM   663  N  N   . PRO A 1 85  ? 41.915  70.703  147.876 1.00 247.51 ? 114  PRO A N   1 
ATOM   664  C  CA  . PRO A 1 85  ? 42.035  69.310  148.263 1.00 242.36 ? 114  PRO A CA  1 
ATOM   665  C  C   . PRO A 1 85  ? 43.026  69.111  149.401 1.00 236.96 ? 114  PRO A C   1 
ATOM   666  O  O   . PRO A 1 85  ? 44.158  69.603  149.308 1.00 237.16 ? 114  PRO A O   1 
ATOM   667  C  CB  . PRO A 1 85  ? 42.555  68.626  147.001 1.00 242.69 ? 114  PRO A CB  1 
ATOM   668  C  CG  . PRO A 1 85  ? 42.176  69.551  145.907 1.00 243.53 ? 114  PRO A CG  1 
ATOM   669  C  CD  . PRO A 1 85  ? 42.339  70.937  146.469 1.00 245.42 ? 114  PRO A CD  1 
ATOM   670  N  N   . ARG A 1 86  ? 42.616  68.439  150.458 1.00 230.23 ? 115  ARG A N   1 
ATOM   671  C  CA  . ARG A 1 86  ? 43.388  68.228  151.668 1.00 221.91 ? 115  ARG A CA  1 
ATOM   672  C  C   . ARG A 1 86  ? 44.699  67.502  151.432 1.00 214.22 ? 115  ARG A C   1 
ATOM   673  O  O   . ARG A 1 86  ? 45.651  67.679  152.204 1.00 216.40 ? 115  ARG A O   1 
ATOM   674  C  CB  . ARG A 1 86  ? 42.516  67.575  152.742 1.00 218.39 ? 115  ARG A CB  1 
ATOM   675  C  CG  . ARG A 1 86  ? 41.099  68.143  152.793 1.00 218.16 ? 115  ARG A CG  1 
ATOM   676  C  CD  . ARG A 1 86  ? 40.992  69.342  153.719 1.00 219.66 ? 115  ARG A CD  1 
ATOM   677  N  NE  . ARG A 1 86  ? 40.003  69.140  154.761 1.00 226.05 ? 115  ARG A NE  1 
ATOM   678  C  CZ  . ARG A 1 86  ? 39.201  70.038  155.303 1.00 231.51 ? 115  ARG A CZ  1 
ATOM   679  N  NH1 . ARG A 1 86  ? 39.214  71.309  154.928 1.00 234.59 ? 115  ARG A NH1 1 
ATOM   680  N  NH2 . ARG A 1 86  ? 38.355  69.652  156.257 1.00 233.09 ? 115  ARG A NH2 1 
ATOM   681  N  N   . LYS A 1 87  ? 44.805  66.765  150.337 1.00 203.39 ? 116  LYS A N   1 
ATOM   682  C  CA  . LYS A 1 87  ? 46.068  66.170  149.888 1.00 187.94 ? 116  LYS A CA  1 
ATOM   683  C  C   . LYS A 1 87  ? 46.800  67.218  149.051 1.00 172.49 ? 116  LYS A C   1 
ATOM   684  O  O   . LYS A 1 87  ? 46.384  67.633  147.966 1.00 173.18 ? 116  LYS A O   1 
ATOM   685  C  CB  . LYS A 1 87  ? 45.837  64.872  149.142 1.00 194.94 ? 116  LYS A CB  1 
ATOM   686  C  CG  . LYS A 1 87  ? 46.285  64.809  147.697 1.00 189.56 ? 116  LYS A CG  1 
ATOM   687  C  CD  . LYS A 1 87  ? 45.204  65.322  146.755 1.00 180.48 ? 116  LYS A CD  1 
ATOM   688  C  CE  . LYS A 1 87  ? 45.669  65.312  145.311 1.00 171.31 ? 116  LYS A CE  1 
ATOM   689  N  NZ  . LYS A 1 87  ? 44.812  66.180  144.456 1.00 161.75 ? 116  LYS A NZ  1 
ATOM   690  N  N   . PRO A 1 88  ? 47.862  67.782  149.606 1.00 157.60 ? 117  PRO A N   1 
ATOM   691  C  CA  . PRO A 1 88  ? 48.540  68.901  148.977 1.00 146.86 ? 117  PRO A CA  1 
ATOM   692  C  C   . PRO A 1 88  ? 49.467  68.564  147.836 1.00 133.93 ? 117  PRO A C   1 
ATOM   693  O  O   . PRO A 1 88  ? 50.624  68.965  147.828 1.00 114.37 ? 117  PRO A O   1 
ATOM   694  C  CB  . PRO A 1 88  ? 49.290  69.559  150.126 1.00 148.27 ? 117  PRO A CB  1 
ATOM   695  C  CG  . PRO A 1 88  ? 48.677  69.002  151.327 1.00 150.40 ? 117  PRO A CG  1 
ATOM   696  C  CD  . PRO A 1 88  ? 48.420  67.597  150.933 1.00 153.38 ? 117  PRO A CD  1 
ATOM   697  N  N   . LYS A 1 89  ? 49.023  67.857  146.784 1.00 120.01 ? 118  LYS A N   1 
ATOM   698  C  CA  . LYS A 1 89  ? 50.019  67.624  145.762 1.00 108.17 ? 118  LYS A CA  1 
ATOM   699  C  C   . LYS A 1 89  ? 49.594  67.121  144.420 1.00 99.72  ? 118  LYS A C   1 
ATOM   700  O  O   . LYS A 1 89  ? 49.278  65.953  144.219 1.00 99.49  ? 118  LYS A O   1 
ATOM   701  C  CB  . LYS A 1 89  ? 51.127  66.713  146.305 1.00 112.16 ? 118  LYS A CB  1 
ATOM   702  C  CG  . LYS A 1 89  ? 51.018  65.260  145.896 1.00 118.80 ? 118  LYS A CG  1 
ATOM   703  C  CD  . LYS A 1 89  ? 50.971  64.345  147.109 1.00 121.34 ? 118  LYS A CD  1 
ATOM   704  C  CE  . LYS A 1 89  ? 50.024  63.181  146.871 1.00 121.38 ? 118  LYS A CE  1 
ATOM   705  N  NZ  . LYS A 1 89  ? 50.442  61.960  147.613 1.00 123.86 ? 118  LYS A NZ  1 
ATOM   706  N  N   . TRP A 1 90  ? 49.759  67.938  143.381 1.00 93.87  ? 119  TRP A N   1 
ATOM   707  C  CA  . TRP A 1 90  ? 49.484  67.531  142.013 1.00 89.89  ? 119  TRP A CA  1 
ATOM   708  C  C   . TRP A 1 90  ? 49.785  66.057  141.795 1.00 88.23  ? 119  TRP A C   1 
ATOM   709  O  O   . TRP A 1 90  ? 50.834  65.519  142.153 1.00 86.88  ? 119  TRP A O   1 
ATOM   710  C  CB  . TRP A 1 90  ? 50.248  68.385  140.986 1.00 85.72  ? 119  TRP A CB  1 
ATOM   711  C  CG  . TRP A 1 90  ? 49.687  69.773  140.840 1.00 80.59  ? 119  TRP A CG  1 
ATOM   712  C  CD1 . TRP A 1 90  ? 50.289  70.953  141.155 1.00 76.85  ? 119  TRP A CD1 1 
ATOM   713  C  CD2 . TRP A 1 90  ? 48.376  70.103  140.361 1.00 75.94  ? 119  TRP A CD2 1 
ATOM   714  N  NE1 . TRP A 1 90  ? 49.432  71.999  140.897 1.00 75.04  ? 119  TRP A NE1 1 
ATOM   715  C  CE2 . TRP A 1 90  ? 48.253  71.503  140.413 1.00 75.36  ? 119  TRP A CE2 1 
ATOM   716  C  CE3 . TRP A 1 90  ? 47.296  69.348  139.895 1.00 68.80  ? 119  TRP A CE3 1 
ATOM   717  C  CZ2 . TRP A 1 90  ? 47.090  72.161  140.010 1.00 77.05  ? 119  TRP A CZ2 1 
ATOM   718  C  CZ3 . TRP A 1 90  ? 46.154  70.009  139.493 1.00 70.96  ? 119  TRP A CZ3 1 
ATOM   719  C  CH2 . TRP A 1 90  ? 46.053  71.404  139.552 1.00 71.74  ? 119  TRP A CH2 1 
ATOM   720  N  N   . ASP A 1 91  ? 48.821  65.354  141.189 1.00 88.36  ? 120  ASP A N   1 
ATOM   721  C  CA  . ASP A 1 91  ? 48.990  63.908  140.968 1.00 87.20  ? 120  ASP A CA  1 
ATOM   722  C  C   . ASP A 1 91  ? 49.563  63.646  139.585 1.00 84.45  ? 120  ASP A C   1 
ATOM   723  O  O   . ASP A 1 91  ? 49.677  62.528  139.123 1.00 83.25  ? 120  ASP A O   1 
ATOM   724  C  CB  . ASP A 1 91  ? 47.673  63.167  141.167 1.00 98.39  ? 120  ASP A CB  1 
ATOM   725  C  CG  . ASP A 1 91  ? 47.376  62.889  142.632 1.00 106.09 ? 120  ASP A CG  1 
ATOM   726  O  OD1 . ASP A 1 91  ? 48.279  63.065  143.479 1.00 104.85 ? 120  ASP A OD1 1 
ATOM   727  O  OD2 . ASP A 1 91  ? 46.230  62.491  142.946 1.00 111.60 ? 120  ASP A OD2 1 
ATOM   728  N  N   . LYS A 1 92  ? 49.938  64.732  138.916 1.00 82.99  ? 121  LYS A N   1 
ATOM   729  C  CA  . LYS A 1 92  ? 50.572  64.637  137.607 1.00 79.48  ? 121  LYS A CA  1 
ATOM   730  C  C   . LYS A 1 92  ? 51.895  65.403  137.672 1.00 76.26  ? 121  LYS A C   1 
ATOM   731  O  O   . LYS A 1 92  ? 52.145  66.079  138.667 1.00 75.23  ? 121  LYS A O   1 
ATOM   732  C  CB  . LYS A 1 92  ? 49.667  65.158  136.502 1.00 79.43  ? 121  LYS A CB  1 
ATOM   733  C  CG  . LYS A 1 92  ? 48.482  66.000  136.955 1.00 75.30  ? 121  LYS A CG  1 
ATOM   734  C  CD  . LYS A 1 92  ? 48.158  67.116  135.973 1.00 72.52  ? 121  LYS A CD  1 
ATOM   735  C  CE  . LYS A 1 92  ? 46.973  66.743  135.092 1.00 69.96  ? 121  LYS A CE  1 
ATOM   736  N  NZ  . LYS A 1 92  ? 47.193  67.162  133.672 1.00 73.44  ? 121  LYS A NZ  1 
ATOM   737  N  N   . ASN A 1 93  ? 52.707  65.234  136.649 1.00 75.55  ? 122  ASN A N   1 
ATOM   738  C  CA  . ASN A 1 93  ? 54.009  65.865  136.557 1.00 74.97  ? 122  ASN A CA  1 
ATOM   739  C  C   . ASN A 1 93  ? 54.123  66.744  135.319 1.00 73.83  ? 122  ASN A C   1 
ATOM   740  O  O   . ASN A 1 93  ? 55.182  67.309  135.064 1.00 76.42  ? 122  ASN A O   1 
ATOM   741  C  CB  . ASN A 1 93  ? 55.130  64.814  136.525 1.00 71.91  ? 122  ASN A CB  1 
ATOM   742  C  CG  . ASN A 1 93  ? 55.924  64.840  137.814 1.00 75.29  ? 122  ASN A CG  1 
ATOM   743  O  OD1 . ASN A 1 93  ? 55.542  65.534  138.756 1.00 79.15  ? 122  ASN A OD1 1 
ATOM   744  N  ND2 . ASN A 1 93  ? 57.016  64.098  137.880 1.00 79.48  ? 122  ASN A ND2 1 
ATOM   745  N  N   . GLN A 1 94  ? 53.098  66.769  134.508 1.00 70.98  ? 123  GLN A N   1 
ATOM   746  C  CA  . GLN A 1 94  ? 53.016  67.605  133.329 1.00 69.36  ? 123  GLN A CA  1 
ATOM   747  C  C   . GLN A 1 94  ? 51.737  68.444  133.469 1.00 67.70  ? 123  GLN A C   1 
ATOM   748  O  O   . GLN A 1 94  ? 50.625  67.930  133.375 1.00 68.52  ? 123  GLN A O   1 
ATOM   749  C  CB  . GLN A 1 94  ? 53.035  66.796  132.047 1.00 81.78  ? 123  GLN A CB  1 
ATOM   750  C  CG  . GLN A 1 94  ? 53.024  67.643  130.782 1.00 96.84  ? 123  GLN A CG  1 
ATOM   751  C  CD  . GLN A 1 94  ? 52.877  66.822  129.522 1.00 104.25 ? 123  GLN A CD  1 
ATOM   752  O  OE1 . GLN A 1 94  ? 52.757  65.593  129.581 1.00 109.64 ? 123  GLN A OE1 1 
ATOM   753  N  NE2 . GLN A 1 94  ? 52.880  67.490  128.372 1.00 104.59 ? 123  GLN A NE2 1 
ATOM   754  N  N   . ILE A 1 95  ? 51.908  69.693  133.877 1.00 64.29  ? 124  ILE A N   1 
ATOM   755  C  CA  . ILE A 1 95  ? 50.800  70.571  134.190 1.00 60.62  ? 124  ILE A CA  1 
ATOM   756  C  C   . ILE A 1 95  ? 50.523  71.639  133.162 1.00 58.10  ? 124  ILE A C   1 
ATOM   757  O  O   . ILE A 1 95  ? 51.420  72.177  132.521 1.00 58.86  ? 124  ILE A O   1 
ATOM   758  C  CB  . ILE A 1 95  ? 51.062  71.259  135.561 1.00 50.86  ? 124  ILE A CB  1 
ATOM   759  C  CG1 . ILE A 1 95  ? 51.510  70.199  136.548 1.00 46.82  ? 124  ILE A CG1 1 
ATOM   760  C  CG2 . ILE A 1 95  ? 49.820  72.020  135.956 1.00 41.27  ? 124  ILE A CG2 1 
ATOM   761  C  CD1 . ILE A 1 95  ? 50.710  69.995  137.798 1.00 49.55  ? 124  ILE A CD1 1 
ATOM   762  N  N   . THR A 1 96  ? 49.248  71.984  132.976 1.00 56.69  ? 125  THR A N   1 
ATOM   763  C  CA  . THR A 1 96  ? 48.882  73.000  131.996 1.00 54.36  ? 125  THR A CA  1 
ATOM   764  C  C   . THR A 1 96  ? 48.339  74.263  132.659 1.00 51.15  ? 125  THR A C   1 
ATOM   765  O  O   . THR A 1 96  ? 47.776  74.230  133.755 1.00 50.63  ? 125  THR A O   1 
ATOM   766  C  CB  . THR A 1 96  ? 47.785  72.519  131.016 1.00 50.87  ? 125  THR A CB  1 
ATOM   767  O  OG1 . THR A 1 96  ? 46.653  72.069  131.767 1.00 40.22  ? 125  THR A OG1 1 
ATOM   768  C  CG2 . THR A 1 96  ? 48.301  71.436  130.101 1.00 43.80  ? 125  THR A CG2 1 
ATOM   769  N  N   . TYR A 1 97  ? 48.470  75.369  131.919 1.00 48.82  ? 126  TYR A N   1 
ATOM   770  C  CA  . TYR A 1 97  ? 47.885  76.621  132.424 1.00 46.49  ? 126  TYR A CA  1 
ATOM   771  C  C   . TYR A 1 97  ? 47.348  77.465  131.275 1.00 42.61  ? 126  TYR A C   1 
ATOM   772  O  O   . TYR A 1 97  ? 47.727  77.306  130.108 1.00 40.44  ? 126  TYR A O   1 
ATOM   773  C  CB  . TYR A 1 97  ? 48.856  77.430  133.266 1.00 47.16  ? 126  TYR A CB  1 
ATOM   774  C  CG  . TYR A 1 97  ? 50.043  77.920  132.460 1.00 48.70  ? 126  TYR A CG  1 
ATOM   775  C  CD1 . TYR A 1 97  ? 51.100  77.078  132.147 1.00 47.17  ? 126  TYR A CD1 1 
ATOM   776  C  CD2 . TYR A 1 97  ? 50.093  79.227  131.997 1.00 49.60  ? 126  TYR A CD2 1 
ATOM   777  C  CE1 . TYR A 1 97  ? 52.179  77.532  131.411 1.00 46.68  ? 126  TYR A CE1 1 
ATOM   778  C  CE2 . TYR A 1 97  ? 51.173  79.687  131.259 1.00 47.92  ? 126  TYR A CE2 1 
ATOM   779  C  CZ  . TYR A 1 97  ? 52.214  78.834  130.973 1.00 46.18  ? 126  TYR A CZ  1 
ATOM   780  O  OH  . TYR A 1 97  ? 53.291  79.268  130.249 1.00 44.82  ? 126  TYR A OH  1 
ATOM   781  N  N   . ARG A 1 98  ? 46.353  78.260  131.656 1.00 40.29  ? 127  ARG A N   1 
ATOM   782  C  CA  . ARG A 1 98  ? 45.706  79.138  130.673 1.00 38.73  ? 127  ARG A CA  1 
ATOM   783  C  C   . ARG A 1 98  ? 45.660  80.556  131.208 1.00 38.67  ? 127  ARG A C   1 
ATOM   784  O  O   . ARG A 1 98  ? 45.300  80.786  132.375 1.00 40.11  ? 127  ARG A O   1 
ATOM   785  C  CB  . ARG A 1 98  ? 44.285  78.642  130.401 1.00 28.22  ? 127  ARG A CB  1 
ATOM   786  C  CG  . ARG A 1 98  ? 43.542  79.501  129.404 1.00 43.11  ? 127  ARG A CG  1 
ATOM   787  C  CD  . ARG A 1 98  ? 42.630  78.672  128.526 1.00 51.71  ? 127  ARG A CD  1 
ATOM   788  N  NE  . ARG A 1 98  ? 41.687  79.473  127.751 1.00 49.18  ? 127  ARG A NE  1 
ATOM   789  C  CZ  . ARG A 1 98  ? 40.368  79.361  127.903 1.00 45.90  ? 127  ARG A CZ  1 
ATOM   790  N  NH1 . ARG A 1 98  ? 39.898  78.508  128.800 1.00 46.86  ? 127  ARG A NH1 1 
ATOM   791  N  NH2 . ARG A 1 98  ? 39.563  80.109  127.171 1.00 47.78  ? 127  ARG A NH2 1 
ATOM   792  N  N   . ILE A 1 99  ? 46.121  81.514  130.395 1.00 35.94  ? 128  ILE A N   1 
ATOM   793  C  CA  . ILE A 1 99  ? 45.951  82.896  130.879 1.00 30.11  ? 128  ILE A CA  1 
ATOM   794  C  C   . ILE A 1 99  ? 44.600  83.397  130.334 1.00 26.83  ? 128  ILE A C   1 
ATOM   795  O  O   . ILE A 1 99  ? 44.398  83.449  129.103 1.00 23.06  ? 128  ILE A O   1 
ATOM   796  C  CB  . ILE A 1 99  ? 47.039  83.870  130.443 1.00 12.35  ? 128  ILE A CB  1 
ATOM   797  C  CG1 . ILE A 1 99  ? 48.411  83.428  130.930 1.00 12.17  ? 128  ILE A CG1 1 
ATOM   798  C  CG2 . ILE A 1 99  ? 46.665  85.241  130.974 1.00 17.02  ? 128  ILE A CG2 1 
ATOM   799  C  CD1 . ILE A 1 99  ? 49.551  84.152  130.225 1.00 16.26  ? 128  ILE A CD1 1 
ATOM   800  N  N   . ILE A 1 100 ? 43.749  83.620  131.319 1.00 26.38  ? 129  ILE A N   1 
ATOM   801  C  CA  . ILE A 1 100 ? 42.379  84.055  131.066 1.00 27.20  ? 129  ILE A CA  1 
ATOM   802  C  C   . ILE A 1 100 ? 42.277  85.566  131.156 1.00 28.22  ? 129  ILE A C   1 
ATOM   803  O  O   . ILE A 1 100 ? 41.698  86.226  130.310 1.00 31.83  ? 129  ILE A O   1 
ATOM   804  C  CB  . ILE A 1 100 ? 41.420  83.448  132.096 1.00 20.52  ? 129  ILE A CB  1 
ATOM   805  C  CG1 . ILE A 1 100 ? 41.375  81.917  131.887 1.00 17.17  ? 129  ILE A CG1 1 
ATOM   806  C  CG2 . ILE A 1 100 ? 40.034  84.028  131.897 1.00 31.74  ? 129  ILE A CG2 1 
ATOM   807  C  CD1 . ILE A 1 100 ? 41.042  81.279  133.240 1.00 32.20  ? 129  ILE A CD1 1 
ATOM   808  N  N   . GLY A 1 101 ? 42.830  86.090  132.252 1.00 27.08  ? 130  GLY A N   1 
ATOM   809  C  CA  . GLY A 1 101 ? 42.858  87.524  132.408 1.00 25.13  ? 130  GLY A CA  1 
ATOM   810  C  C   . GLY A 1 101 ? 44.218  88.130  132.089 1.00 24.21  ? 130  GLY A C   1 
ATOM   811  O  O   . GLY A 1 101 ? 45.264  87.519  132.289 1.00 24.44  ? 130  GLY A O   1 
ATOM   812  N  N   . TYR A 1 102 ? 44.231  89.385  131.650 1.00 21.75  ? 131  TYR A N   1 
ATOM   813  C  CA  . TYR A 1 102 ? 45.504  90.107  131.521 1.00 19.22  ? 131  TYR A CA  1 
ATOM   814  C  C   . TYR A 1 102 ? 45.392  91.348  132.409 1.00 18.21  ? 131  TYR A C   1 
ATOM   815  O  O   . TYR A 1 102 ? 44.326  91.561  132.989 1.00 21.11  ? 131  TYR A O   1 
ATOM   816  C  CB  . TYR A 1 102 ? 45.733  90.512  130.076 1.00 16.24  ? 131  TYR A CB  1 
ATOM   817  C  CG  . TYR A 1 102 ? 46.433  89.469  129.263 1.00 22.09  ? 131  TYR A CG  1 
ATOM   818  C  CD1 . TYR A 1 102 ? 47.823  89.381  129.321 1.00 20.66  ? 131  TYR A CD1 1 
ATOM   819  C  CD2 . TYR A 1 102 ? 45.757  88.538  128.457 1.00 24.93  ? 131  TYR A CD2 1 
ATOM   820  C  CE1 . TYR A 1 102 ? 48.511  88.442  128.574 1.00 18.23  ? 131  TYR A CE1 1 
ATOM   821  C  CE2 . TYR A 1 102 ? 46.443  87.574  127.713 1.00 18.20  ? 131  TYR A CE2 1 
ATOM   822  C  CZ  . TYR A 1 102 ? 47.817  87.550  127.784 1.00 20.04  ? 131  TYR A CZ  1 
ATOM   823  O  OH  . TYR A 1 102 ? 48.562  86.631  127.071 1.00 27.11  ? 131  TYR A OH  1 
ATOM   824  N  N   . THR A 1 103 ? 46.440  92.110  132.557 1.00 15.24  ? 132  THR A N   1 
ATOM   825  C  CA  . THR A 1 103 ? 46.401  93.395  133.207 1.00 15.52  ? 132  THR A CA  1 
ATOM   826  C  C   . THR A 1 103 ? 46.676  94.478  132.139 1.00 15.55  ? 132  THR A C   1 
ATOM   827  O  O   . THR A 1 103 ? 47.580  94.288  131.326 1.00 18.35  ? 132  THR A O   1 
ATOM   828  C  CB  . THR A 1 103 ? 47.527  93.586  134.231 1.00 17.63  ? 132  THR A CB  1 
ATOM   829  O  OG1 . THR A 1 103 ? 47.577  95.008  134.559 1.00 23.32  ? 132  THR A OG1 1 
ATOM   830  C  CG2 . THR A 1 103 ? 48.830  93.186  133.539 1.00 2.67   ? 132  THR A CG2 1 
ATOM   831  N  N   . PRO A 1 104 ? 46.054  95.629  132.256 1.00 12.69  ? 133  PRO A N   1 
ATOM   832  C  CA  . PRO A 1 104 ? 46.287  96.728  131.350 1.00 13.32  ? 133  PRO A CA  1 
ATOM   833  C  C   . PRO A 1 104 ? 47.603  97.419  131.625 1.00 17.37  ? 133  PRO A C   1 
ATOM   834  O  O   . PRO A 1 104 ? 48.185  98.099  130.761 1.00 20.12  ? 133  PRO A O   1 
ATOM   835  C  CB  . PRO A 1 104 ? 45.082  97.618  131.504 1.00 13.94  ? 133  PRO A CB  1 
ATOM   836  C  CG  . PRO A 1 104 ? 44.343  97.181  132.701 1.00 14.11  ? 133  PRO A CG  1 
ATOM   837  C  CD  . PRO A 1 104 ? 44.971  95.913  133.208 1.00 14.76  ? 133  PRO A CD  1 
ATOM   838  N  N   . ASP A 1 105 ? 48.214  97.156  132.788 1.00 19.13  ? 134  ASP A N   1 
ATOM   839  C  CA  . ASP A 1 105 ? 49.532  97.758  133.041 1.00 16.58  ? 134  ASP A CA  1 
ATOM   840  C  C   . ASP A 1 105 ? 50.630  97.152  132.188 1.00 16.89  ? 134  ASP A C   1 
ATOM   841  O  O   . ASP A 1 105 ? 51.629  97.881  131.952 1.00 20.33  ? 134  ASP A O   1 
ATOM   842  C  CB  . ASP A 1 105 ? 49.845  97.644  134.527 1.00 16.24  ? 134  ASP A CB  1 
ATOM   843  C  CG  . ASP A 1 105 ? 48.762  98.221  135.404 1.00 18.39  ? 134  ASP A CG  1 
ATOM   844  O  OD1 . ASP A 1 105 ? 48.056  99.125  134.900 1.00 34.83  ? 134  ASP A OD1 1 
ATOM   845  O  OD2 . ASP A 1 105 ? 48.566  97.877  136.581 1.00 14.09  ? 134  ASP A OD2 1 
ATOM   846  N  N   . LEU A 1 106 ? 50.540  95.919  131.695 1.00 10.65  ? 135  LEU A N   1 
ATOM   847  C  CA  . LEU A 1 106 ? 51.619  95.400  130.848 1.00 13.42  ? 135  LEU A CA  1 
ATOM   848  C  C   . LEU A 1 106 ? 51.173  94.845  129.514 1.00 17.31  ? 135  LEU A C   1 
ATOM   849  O  O   . LEU A 1 106 ? 50.058  94.331  129.358 1.00 21.73  ? 135  LEU A O   1 
ATOM   850  C  CB  . LEU A 1 106 ? 52.338  94.266  131.586 1.00 21.20  ? 135  LEU A CB  1 
ATOM   851  C  CG  . LEU A 1 106 ? 52.772  94.519  133.032 1.00 21.32  ? 135  LEU A CG  1 
ATOM   852  C  CD1 . LEU A 1 106 ? 52.589  93.223  133.811 1.00 25.16  ? 135  LEU A CD1 1 
ATOM   853  C  CD2 . LEU A 1 106 ? 54.214  94.961  133.143 1.00 20.67  ? 135  LEU A CD2 1 
ATOM   854  N  N   . ASP A 1 107 ? 52.019  94.857  128.495 1.00 19.90  ? 136  ASP A N   1 
ATOM   855  C  CA  . ASP A 1 107 ? 51.727  94.278  127.184 1.00 24.12  ? 136  ASP A CA  1 
ATOM   856  C  C   . ASP A 1 107 ? 51.714  92.758  127.382 1.00 27.09  ? 136  ASP A C   1 
ATOM   857  O  O   . ASP A 1 107 ? 52.298  92.346  128.390 1.00 29.58  ? 136  ASP A O   1 
ATOM   858  C  CB  . ASP A 1 107 ? 52.771  94.623  126.126 1.00 30.84  ? 136  ASP A CB  1 
ATOM   859  C  CG  . ASP A 1 107 ? 54.178  94.250  126.532 1.00 25.83  ? 136  ASP A CG  1 
ATOM   860  O  OD1 . ASP A 1 107 ? 54.740  94.947  127.404 1.00 29.19  ? 136  ASP A OD1 1 
ATOM   861  O  OD2 . ASP A 1 107 ? 54.753  93.291  126.010 1.00 22.64  ? 136  ASP A OD2 1 
ATOM   862  N  N   . PRO A 1 108 ? 50.931  92.028  126.615 1.00 27.78  ? 137  PRO A N   1 
ATOM   863  C  CA  . PRO A 1 108 ? 50.733  90.603  126.859 1.00 26.20  ? 137  PRO A CA  1 
ATOM   864  C  C   . PRO A 1 108 ? 52.080  89.891  126.840 1.00 28.07  ? 137  PRO A C   1 
ATOM   865  O  O   . PRO A 1 108 ? 52.477  89.259  127.837 1.00 27.14  ? 137  PRO A O   1 
ATOM   866  C  CB  . PRO A 1 108 ? 49.809  90.157  125.749 1.00 22.97  ? 137  PRO A CB  1 
ATOM   867  C  CG  . PRO A 1 108 ? 49.875  91.193  124.704 1.00 22.81  ? 137  PRO A CG  1 
ATOM   868  C  CD  . PRO A 1 108 ? 50.137  92.493  125.442 1.00 27.58  ? 137  PRO A CD  1 
ATOM   869  N  N   . GLU A 1 109 ? 52.887  90.120  125.778 1.00 25.28  ? 138  GLU A N   1 
ATOM   870  C  CA  . GLU A 1 109 ? 54.190  89.456  125.820 1.00 27.00  ? 138  GLU A CA  1 
ATOM   871  C  C   . GLU A 1 109 ? 54.853  89.574  127.177 1.00 27.26  ? 138  GLU A C   1 
ATOM   872  O  O   . GLU A 1 109 ? 55.333  88.569  127.744 1.00 30.92  ? 138  GLU A O   1 
ATOM   873  C  CB  . GLU A 1 109 ? 55.119  89.850  124.692 1.00 28.17  ? 138  GLU A CB  1 
ATOM   874  C  CG  . GLU A 1 109 ? 54.636  89.356  123.337 1.00 44.69  ? 138  GLU A CG  1 
ATOM   875  C  CD  . GLU A 1 109 ? 55.409  89.915  122.165 1.00 51.96  ? 138  GLU A CD  1 
ATOM   876  O  OE1 . GLU A 1 109 ? 56.539  90.415  122.337 1.00 49.66  ? 138  GLU A OE1 1 
ATOM   877  O  OE2 . GLU A 1 109 ? 54.859  89.846  121.037 1.00 54.38  ? 138  GLU A OE2 1 
ATOM   878  N  N   . THR A 1 110 ? 54.849  90.759  127.765 1.00 24.76  ? 139  THR A N   1 
ATOM   879  C  CA  . THR A 1 110 ? 55.501  90.922  129.066 1.00 22.93  ? 139  THR A CA  1 
ATOM   880  C  C   . THR A 1 110 ? 54.767  90.163  130.129 1.00 24.58  ? 139  THR A C   1 
ATOM   881  O  O   . THR A 1 110 ? 55.360  89.533  131.001 1.00 28.82  ? 139  THR A O   1 
ATOM   882  C  CB  . THR A 1 110 ? 55.603  92.390  129.454 1.00 16.44  ? 139  THR A CB  1 
ATOM   883  O  OG1 . THR A 1 110 ? 56.244  93.104  128.390 1.00 15.66  ? 139  THR A OG1 1 
ATOM   884  C  CG2 . THR A 1 110 ? 56.374  92.589  130.744 1.00 3.92   ? 139  THR A CG2 1 
ATOM   885  N  N   . VAL A 1 111 ? 53.438  90.182  130.038 1.00 27.98  ? 140  VAL A N   1 
ATOM   886  C  CA  . VAL A 1 111 ? 52.693  89.408  131.045 1.00 29.79  ? 140  VAL A CA  1 
ATOM   887  C  C   . VAL A 1 111 ? 52.914  87.919  130.828 1.00 31.35  ? 140  VAL A C   1 
ATOM   888  O  O   . VAL A 1 111 ? 53.305  87.217  131.780 1.00 35.84  ? 140  VAL A O   1 
ATOM   889  C  CB  . VAL A 1 111 ? 51.213  89.752  131.102 1.00 23.13  ? 140  VAL A CB  1 
ATOM   890  C  CG1 . VAL A 1 111 ? 50.456  88.584  131.719 1.00 22.13  ? 140  VAL A CG1 1 
ATOM   891  C  CG2 . VAL A 1 111 ? 51.002  91.037  131.885 1.00 18.67  ? 140  VAL A CG2 1 
ATOM   892  N  N   . ASP A 1 112 ? 52.841  87.437  129.594 1.00 28.40  ? 141  ASP A N   1 
ATOM   893  C  CA  . ASP A 1 112 ? 53.068  86.001  129.386 1.00 27.35  ? 141  ASP A CA  1 
ATOM   894  C  C   . ASP A 1 112 ? 54.434  85.564  129.931 1.00 28.12  ? 141  ASP A C   1 
ATOM   895  O  O   . ASP A 1 112 ? 54.534  84.564  130.667 1.00 30.08  ? 141  ASP A O   1 
ATOM   896  C  CB  . ASP A 1 112 ? 52.890  85.622  127.926 1.00 6.57   ? 141  ASP A CB  1 
ATOM   897  C  CG  . ASP A 1 112 ? 51.594  86.057  127.303 1.00 16.07  ? 141  ASP A CG  1 
ATOM   898  O  OD1 . ASP A 1 112 ? 50.680  86.488  128.042 1.00 16.71  ? 141  ASP A OD1 1 
ATOM   899  O  OD2 . ASP A 1 112 ? 51.446  85.990  126.066 1.00 19.22  ? 141  ASP A OD2 1 
ATOM   900  N  N   . ASP A 1 113 ? 55.483  86.286  129.592 1.00 25.91  ? 142  ASP A N   1 
ATOM   901  C  CA  . ASP A 1 113 ? 56.869  86.005  129.975 1.00 21.94  ? 142  ASP A CA  1 
ATOM   902  C  C   . ASP A 1 113 ? 57.027  85.958  131.470 1.00 20.24  ? 142  ASP A C   1 
ATOM   903  O  O   . ASP A 1 113 ? 57.454  84.996  132.073 1.00 22.43  ? 142  ASP A O   1 
ATOM   904  C  CB  . ASP A 1 113 ? 57.739  87.128  129.417 1.00 38.23  ? 142  ASP A CB  1 
ATOM   905  C  CG  . ASP A 1 113 ? 59.211  86.953  129.662 1.00 46.29  ? 142  ASP A CG  1 
ATOM   906  O  OD1 . ASP A 1 113 ? 59.573  86.454  130.741 1.00 55.66  ? 142  ASP A OD1 1 
ATOM   907  O  OD2 . ASP A 1 113 ? 59.982  87.333  128.751 1.00 54.19  ? 142  ASP A OD2 1 
ATOM   908  N  N   . ALA A 1 114 ? 56.531  86.985  132.148 1.00 21.98  ? 143  ALA A N   1 
ATOM   909  C  CA  . ALA A 1 114 ? 56.581  86.941  133.624 1.00 20.59  ? 143  ALA A CA  1 
ATOM   910  C  C   . ALA A 1 114 ? 55.985  85.649  134.141 1.00 18.08  ? 143  ALA A C   1 
ATOM   911  O  O   . ALA A 1 114 ? 56.450  84.999  135.068 1.00 14.02  ? 143  ALA A O   1 
ATOM   912  C  CB  . ALA A 1 114 ? 55.813  88.169  134.090 1.00 11.85  ? 143  ALA A CB  1 
ATOM   913  N  N   . PHE A 1 115 ? 54.860  85.203  133.574 1.00 22.02  ? 144  PHE A N   1 
ATOM   914  C  CA  . PHE A 1 115 ? 54.256  83.986  134.145 1.00 27.11  ? 144  PHE A CA  1 
ATOM   915  C  C   . PHE A 1 115 ? 55.176  82.802  133.925 1.00 32.25  ? 144  PHE A C   1 
ATOM   916  O  O   . PHE A 1 115 ? 55.577  82.116  134.879 1.00 34.81  ? 144  PHE A O   1 
ATOM   917  C  CB  . PHE A 1 115 ? 52.859  83.789  133.584 1.00 23.56  ? 144  PHE A CB  1 
ATOM   918  C  CG  . PHE A 1 115 ? 51.848  84.733  134.192 1.00 27.21  ? 144  PHE A CG  1 
ATOM   919  C  CD1 . PHE A 1 115 ? 51.956  85.145  135.512 1.00 19.36  ? 144  PHE A CD1 1 
ATOM   920  C  CD2 . PHE A 1 115 ? 50.789  85.200  133.443 1.00 31.29  ? 144  PHE A CD2 1 
ATOM   921  C  CE1 . PHE A 1 115 ? 51.011  86.004  136.048 1.00 29.24  ? 144  PHE A CE1 1 
ATOM   922  C  CE2 . PHE A 1 115 ? 49.839  86.062  133.986 1.00 34.70  ? 144  PHE A CE2 1 
ATOM   923  C  CZ  . PHE A 1 115 ? 49.947  86.471  135.303 1.00 28.00  ? 144  PHE A CZ  1 
ATOM   924  N  N   . ALA A 1 116 ? 55.651  82.670  132.686 1.00 32.65  ? 145  ALA A N   1 
ATOM   925  C  CA  . ALA A 1 116 ? 56.550  81.576  132.333 1.00 31.26  ? 145  ALA A CA  1 
ATOM   926  C  C   . ALA A 1 116 ? 57.802  81.632  133.180 1.00 35.44  ? 145  ALA A C   1 
ATOM   927  O  O   . ALA A 1 116 ? 58.206  80.665  133.840 1.00 41.72  ? 145  ALA A O   1 
ATOM   928  C  CB  . ALA A 1 116 ? 56.863  81.664  130.864 1.00 22.41  ? 145  ALA A CB  1 
ATOM   929  N  N   . ARG A 1 117 ? 58.428  82.801  133.261 1.00 35.71  ? 146  ARG A N   1 
ATOM   930  C  CA  . ARG A 1 117 ? 59.605  82.904  134.141 1.00 36.66  ? 146  ARG A CA  1 
ATOM   931  C  C   . ARG A 1 117 ? 59.263  82.407  135.536 1.00 37.82  ? 146  ARG A C   1 
ATOM   932  O  O   . ARG A 1 117 ? 60.013  81.657  136.173 1.00 40.88  ? 146  ARG A O   1 
ATOM   933  C  CB  . ARG A 1 117 ? 60.134  84.329  134.164 1.00 29.90  ? 146  ARG A CB  1 
ATOM   934  C  CG  . ARG A 1 117 ? 60.851  84.694  132.843 1.00 34.24  ? 146  ARG A CG  1 
ATOM   935  C  CD  . ARG A 1 117 ? 61.963  85.727  133.095 1.00 36.65  ? 146  ARG A CD  1 
ATOM   936  N  NE  . ARG A 1 117 ? 61.506  86.665  134.137 1.00 43.43  ? 146  ARG A NE  1 
ATOM   937  C  CZ  . ARG A 1 117 ? 60.626  87.626  133.833 1.00 36.30  ? 146  ARG A CZ  1 
ATOM   938  N  NH1 . ARG A 1 117 ? 60.221  87.746  132.583 1.00 35.18  ? 146  ARG A NH1 1 
ATOM   939  N  NH2 . ARG A 1 117 ? 60.195  88.447  134.772 1.00 38.96  ? 146  ARG A NH2 1 
ATOM   940  N  N   . ALA A 1 118 ? 58.058  82.733  135.974 1.00 36.62  ? 147  ALA A N   1 
ATOM   941  C  CA  . ALA A 1 118 ? 57.621  82.330  137.302 1.00 39.07  ? 147  ALA A CA  1 
ATOM   942  C  C   . ALA A 1 118 ? 57.446  80.829  137.406 1.00 39.87  ? 147  ALA A C   1 
ATOM   943  O  O   . ALA A 1 118 ? 57.788  80.260  138.450 1.00 41.87  ? 147  ALA A O   1 
ATOM   944  C  CB  . ALA A 1 118 ? 56.342  83.064  137.685 1.00 45.83  ? 147  ALA A CB  1 
ATOM   945  N  N   . PHE A 1 119 ? 56.948  80.174  136.356 1.00 38.60  ? 148  PHE A N   1 
ATOM   946  C  CA  . PHE A 1 119 ? 56.795  78.718  136.432 1.00 39.31  ? 148  PHE A CA  1 
ATOM   947  C  C   . PHE A 1 119 ? 58.187  78.081  136.478 1.00 41.46  ? 148  PHE A C   1 
ATOM   948  O  O   . PHE A 1 119 ? 58.451  77.218  137.317 1.00 42.92  ? 148  PHE A O   1 
ATOM   949  C  CB  . PHE A 1 119 ? 55.961  78.083  135.329 1.00 31.72  ? 148  PHE A CB  1 
ATOM   950  C  CG  . PHE A 1 119 ? 54.462  78.225  135.516 1.00 37.61  ? 148  PHE A CG  1 
ATOM   951  C  CD1 . PHE A 1 119 ? 53.899  77.988  136.756 1.00 37.03  ? 148  PHE A CD1 1 
ATOM   952  C  CD2 . PHE A 1 119 ? 53.613  78.613  134.484 1.00 31.39  ? 148  PHE A CD2 1 
ATOM   953  C  CE1 . PHE A 1 119 ? 52.536  78.143  136.950 1.00 42.06  ? 148  PHE A CE1 1 
ATOM   954  C  CE2 . PHE A 1 119 ? 52.260  78.762  134.665 1.00 34.97  ? 148  PHE A CE2 1 
ATOM   955  C  CZ  . PHE A 1 119 ? 51.710  78.524  135.910 1.00 38.45  ? 148  PHE A CZ  1 
ATOM   956  N  N   . GLN A 1 120 ? 59.092  78.652  135.682 1.00 42.57  ? 149  GLN A N   1 
ATOM   957  C  CA  . GLN A 1 120 ? 60.460  78.178  135.596 1.00 42.02  ? 149  GLN A CA  1 
ATOM   958  C  C   . GLN A 1 120 ? 61.091  78.132  136.973 1.00 40.97  ? 149  GLN A C   1 
ATOM   959  O  O   . GLN A 1 120 ? 61.716  77.144  137.346 1.00 41.30  ? 149  GLN A O   1 
ATOM   960  C  CB  . GLN A 1 120 ? 61.301  78.971  134.627 1.00 55.93  ? 149  GLN A CB  1 
ATOM   961  C  CG  . GLN A 1 120 ? 60.911  78.789  133.175 1.00 70.27  ? 149  GLN A CG  1 
ATOM   962  C  CD  . GLN A 1 120 ? 61.658  79.703  132.223 1.00 86.47  ? 149  GLN A CD  1 
ATOM   963  O  OE1 . GLN A 1 120 ? 62.672  80.345  132.533 1.00 91.48  ? 149  GLN A OE1 1 
ATOM   964  N  NE2 . GLN A 1 120 ? 61.120  79.761  131.001 1.00 85.29  ? 149  GLN A NE2 1 
ATOM   965  N  N   . VAL A 1 121 ? 60.747  79.088  137.820 1.00 40.50  ? 150  VAL A N   1 
ATOM   966  C  CA  . VAL A 1 121 ? 61.213  79.060  139.204 1.00 39.74  ? 150  VAL A CA  1 
ATOM   967  C  C   . VAL A 1 121 ? 61.037  77.674  139.796 1.00 40.71  ? 150  VAL A C   1 
ATOM   968  O  O   . VAL A 1 121 ? 61.878  77.204  140.553 1.00 41.39  ? 150  VAL A O   1 
ATOM   969  C  CB  . VAL A 1 121 ? 60.420  80.074  140.039 1.00 33.22  ? 150  VAL A CB  1 
ATOM   970  C  CG1 . VAL A 1 121 ? 60.848  80.104  141.482 1.00 33.87  ? 150  VAL A CG1 1 
ATOM   971  C  CG2 . VAL A 1 121 ? 60.640  81.452  139.394 1.00 47.54  ? 150  VAL A CG2 1 
ATOM   972  N  N   . TRP A 1 122 ? 59.931  77.038  139.424 1.00 39.95  ? 151  TRP A N   1 
ATOM   973  C  CA  . TRP A 1 122 ? 59.670  75.704  139.954 1.00 39.69  ? 151  TRP A CA  1 
ATOM   974  C  C   . TRP A 1 122 ? 60.161  74.604  139.052 1.00 43.29  ? 151  TRP A C   1 
ATOM   975  O  O   . TRP A 1 122 ? 60.870  73.681  139.523 1.00 44.19  ? 151  TRP A O   1 
ATOM   976  C  CB  . TRP A 1 122 ? 58.210  75.681  140.304 1.00 30.88  ? 151  TRP A CB  1 
ATOM   977  C  CG  . TRP A 1 122 ? 57.746  76.781  141.211 1.00 27.21  ? 151  TRP A CG  1 
ATOM   978  C  CD1 . TRP A 1 122 ? 56.909  77.810  140.911 1.00 30.63  ? 151  TRP A CD1 1 
ATOM   979  C  CD2 . TRP A 1 122 ? 58.068  76.929  142.596 1.00 27.08  ? 151  TRP A CD2 1 
ATOM   980  N  NE1 . TRP A 1 122 ? 56.684  78.595  142.027 1.00 28.14  ? 151  TRP A NE1 1 
ATOM   981  C  CE2 . TRP A 1 122 ? 57.395  78.079  143.069 1.00 29.73  ? 151  TRP A CE2 1 
ATOM   982  C  CE3 . TRP A 1 122 ? 58.859  76.214  143.480 1.00 26.02  ? 151  TRP A CE3 1 
ATOM   983  C  CZ2 . TRP A 1 122 ? 57.492  78.514  144.387 1.00 35.42  ? 151  TRP A CZ2 1 
ATOM   984  C  CZ3 . TRP A 1 122 ? 58.951  76.644  144.794 1.00 24.67  ? 151  TRP A CZ3 1 
ATOM   985  C  CH2 . TRP A 1 122 ? 58.279  77.779  145.239 1.00 29.83  ? 151  TRP A CH2 1 
ATOM   986  N  N   . SER A 1 123 ? 60.012  74.633  137.730 1.00 44.73  ? 152  SER A N   1 
ATOM   987  C  CA  . SER A 1 123 ? 60.595  73.592  136.886 1.00 46.43  ? 152  SER A CA  1 
ATOM   988  C  C   . SER A 1 123 ? 62.079  73.365  137.165 1.00 49.35  ? 152  SER A C   1 
ATOM   989  O  O   . SER A 1 123 ? 62.624  72.256  137.047 1.00 49.93  ? 152  SER A O   1 
ATOM   990  C  CB  . SER A 1 123 ? 60.461  73.961  135.406 1.00 47.56  ? 152  SER A CB  1 
ATOM   991  O  OG  . SER A 1 123 ? 59.205  74.493  135.079 1.00 56.12  ? 152  SER A OG  1 
ATOM   992  N  N   . ASP A 1 124 ? 62.835  74.424  137.423 1.00 51.93  ? 153  ASP A N   1 
ATOM   993  C  CA  . ASP A 1 124 ? 64.264  74.282  137.632 1.00 56.25  ? 153  ASP A CA  1 
ATOM   994  C  C   . ASP A 1 124 ? 64.638  73.323  138.751 1.00 58.80  ? 153  ASP A C   1 
ATOM   995  O  O   . ASP A 1 124 ? 65.650  72.602  138.636 1.00 59.92  ? 153  ASP A O   1 
ATOM   996  C  CB  . ASP A 1 124 ? 64.948  75.636  137.805 1.00 61.42  ? 153  ASP A CB  1 
ATOM   997  C  CG  . ASP A 1 124 ? 65.075  76.427  136.517 1.00 63.33  ? 153  ASP A CG  1 
ATOM   998  O  OD1 . ASP A 1 124 ? 64.710  75.862  135.459 1.00 58.04  ? 153  ASP A OD1 1 
ATOM   999  O  OD2 . ASP A 1 124 ? 65.520  77.603  136.572 1.00 63.11  ? 153  ASP A OD2 1 
ATOM   1000 N  N   . VAL A 1 125 ? 63.918  73.284  139.860 1.00 58.73  ? 154  VAL A N   1 
ATOM   1001 C  CA  . VAL A 1 125 ? 64.264  72.397  140.966 1.00 59.00  ? 154  VAL A CA  1 
ATOM   1002 C  C   . VAL A 1 125 ? 63.315  71.204  141.089 1.00 58.78  ? 154  VAL A C   1 
ATOM   1003 O  O   . VAL A 1 125 ? 63.166  70.606  142.180 1.00 58.49  ? 154  VAL A O   1 
ATOM   1004 C  CB  . VAL A 1 125 ? 64.264  73.143  142.318 1.00 58.16  ? 154  VAL A CB  1 
ATOM   1005 C  CG1 . VAL A 1 125 ? 65.364  74.164  142.422 1.00 50.93  ? 154  VAL A CG1 1 
ATOM   1006 C  CG2 . VAL A 1 125 ? 62.900  73.768  142.587 1.00 57.72  ? 154  VAL A CG2 1 
ATOM   1007 N  N   . THR A 1 126 ? 62.600  70.837  140.028 1.00 55.84  ? 155  THR A N   1 
ATOM   1008 C  CA  . THR A 1 126 ? 61.692  69.713  140.076 1.00 54.86  ? 155  THR A CA  1 
ATOM   1009 C  C   . THR A 1 126 ? 61.476  69.155  138.665 1.00 56.25  ? 155  THR A C   1 
ATOM   1010 O  O   . THR A 1 126 ? 61.860  69.736  137.658 1.00 55.31  ? 155  THR A O   1 
ATOM   1011 C  CB  . THR A 1 126 ? 60.310  70.007  140.673 1.00 63.45  ? 155  THR A CB  1 
ATOM   1012 O  OG1 . THR A 1 126 ? 59.547  70.882  139.829 1.00 60.69  ? 155  THR A OG1 1 
ATOM   1013 C  CG2 . THR A 1 126 ? 60.313  70.559  142.080 1.00 65.11  ? 155  THR A CG2 1 
ATOM   1014 N  N   . PRO A 1 127 ? 60.739  68.062  138.608 1.00 58.85  ? 156  PRO A N   1 
ATOM   1015 C  CA  . PRO A 1 127 ? 60.373  67.418  137.360 1.00 60.85  ? 156  PRO A CA  1 
ATOM   1016 C  C   . PRO A 1 127 ? 58.992  67.845  136.881 1.00 62.32  ? 156  PRO A C   1 
ATOM   1017 O  O   . PRO A 1 127 ? 58.308  67.059  136.207 1.00 65.21  ? 156  PRO A O   1 
ATOM   1018 C  CB  . PRO A 1 127 ? 60.391  65.944  137.761 1.00 60.29  ? 156  PRO A CB  1 
ATOM   1019 C  CG  . PRO A 1 127 ? 60.018  65.910  139.195 1.00 59.50  ? 156  PRO A CG  1 
ATOM   1020 C  CD  . PRO A 1 127 ? 60.220  67.281  139.762 1.00 59.25  ? 156  PRO A CD  1 
ATOM   1021 N  N   . LEU A 1 128 ? 58.576  69.053  137.269 1.00 60.17  ? 157  LEU A N   1 
ATOM   1022 C  CA  . LEU A 1 128 ? 57.252  69.551  136.877 1.00 57.32  ? 157  LEU A CA  1 
ATOM   1023 C  C   . LEU A 1 128 ? 57.403  70.357  135.604 1.00 56.83  ? 157  LEU A C   1 
ATOM   1024 O  O   . LEU A 1 128 ? 58.360  71.134  135.484 1.00 57.83  ? 157  LEU A O   1 
ATOM   1025 C  CB  . LEU A 1 128 ? 56.624  70.409  137.966 1.00 35.51  ? 157  LEU A CB  1 
ATOM   1026 C  CG  . LEU A 1 128 ? 56.145  69.669  139.206 1.00 54.38  ? 157  LEU A CG  1 
ATOM   1027 C  CD1 . LEU A 1 128 ? 56.503  70.464  140.445 1.00 53.61  ? 157  LEU A CD1 1 
ATOM   1028 C  CD2 . LEU A 1 128 ? 54.655  69.370  139.138 1.00 54.35  ? 157  LEU A CD2 1 
ATOM   1029 N  N   . ARG A 1 129 ? 56.594  70.063  134.589 1.00 55.45  ? 158  ARG A N   1 
ATOM   1030 C  CA  . ARG A 1 129 ? 56.764  70.864  133.361 1.00 55.63  ? 158  ARG A CA  1 
ATOM   1031 C  C   . ARG A 1 129 ? 55.416  71.428  132.923 1.00 52.94  ? 158  ARG A C   1 
ATOM   1032 O  O   . ARG A 1 129 ? 54.465  70.671  132.719 1.00 50.39  ? 158  ARG A O   1 
ATOM   1033 C  CB  . ARG A 1 129 ? 57.535  70.111  132.311 1.00 72.29  ? 158  ARG A CB  1 
ATOM   1034 C  CG  . ARG A 1 129 ? 58.685  69.255  132.786 1.00 84.66  ? 158  ARG A CG  1 
ATOM   1035 C  CD  . ARG A 1 129 ? 59.857  70.046  133.348 1.00 93.75  ? 158  ARG A CD  1 
ATOM   1036 N  NE  . ARG A 1 129 ? 60.965  69.172  133.703 1.00 105.84 ? 158  ARG A NE  1 
ATOM   1037 C  CZ  . ARG A 1 129 ? 62.245  69.500  133.713 1.00 113.94 ? 158  ARG A CZ  1 
ATOM   1038 N  NH1 . ARG A 1 129 ? 62.636  70.728  133.398 1.00 116.35 ? 158  ARG A NH1 1 
ATOM   1039 N  NH2 . ARG A 1 129 ? 63.176  68.614  134.041 1.00 118.96 ? 158  ARG A NH2 1 
ATOM   1040 N  N   . PHE A 1 130 ? 55.362  72.779  132.845 1.00 49.36  ? 159  PHE A N   1 
ATOM   1041 C  CA  . PHE A 1 130 ? 54.085  73.450  132.590 1.00 43.64  ? 159  PHE A CA  1 
ATOM   1042 C  C   . PHE A 1 130 ? 53.848  73.817  131.142 1.00 39.64  ? 159  PHE A C   1 
ATOM   1043 O  O   . PHE A 1 130 ? 54.747  74.121  130.365 1.00 40.10  ? 159  PHE A O   1 
ATOM   1044 C  CB  . PHE A 1 130 ? 54.008  74.641  133.513 1.00 37.01  ? 159  PHE A CB  1 
ATOM   1045 C  CG  . PHE A 1 130 ? 54.160  74.371  134.969 1.00 26.74  ? 159  PHE A CG  1 
ATOM   1046 C  CD1 . PHE A 1 130 ? 55.417  74.388  135.555 1.00 16.77  ? 159  PHE A CD1 1 
ATOM   1047 C  CD2 . PHE A 1 130 ? 53.045  74.149  135.765 1.00 14.96  ? 159  PHE A CD2 1 
ATOM   1048 C  CE1 . PHE A 1 130 ? 55.565  74.190  136.911 1.00 12.57  ? 159  PHE A CE1 1 
ATOM   1049 C  CE2 . PHE A 1 130 ? 53.189  73.932  137.130 1.00 22.87  ? 159  PHE A CE2 1 
ATOM   1050 C  CZ  . PHE A 1 130 ? 54.438  73.963  137.704 1.00 21.13  ? 159  PHE A CZ  1 
ATOM   1051 N  N   . SER A 1 131 ? 52.616  73.647  130.665 1.00 38.65  ? 160  SER A N   1 
ATOM   1052 C  CA  . SER A 1 131 ? 52.356  73.990  129.259 1.00 40.26  ? 160  SER A CA  1 
ATOM   1053 C  C   . SER A 1 131 ? 51.122  74.883  129.143 1.00 40.67  ? 160  SER A C   1 
ATOM   1054 O  O   . SER A 1 131 ? 50.129  74.768  129.884 1.00 39.59  ? 160  SER A O   1 
ATOM   1055 C  CB  . SER A 1 131 ? 52.278  72.759  128.385 1.00 38.21  ? 160  SER A CB  1 
ATOM   1056 O  OG  . SER A 1 131 ? 53.023  71.707  128.991 1.00 49.93  ? 160  SER A OG  1 
ATOM   1057 N  N   . ARG A 1 132 ? 51.247  75.866  128.235 1.00 38.56  ? 161  ARG A N   1 
ATOM   1058 C  CA  . ARG A 1 132 ? 50.214  76.895  128.177 1.00 40.15  ? 161  ARG A CA  1 
ATOM   1059 C  C   . ARG A 1 132 ? 49.142  76.516  127.178 1.00 40.31  ? 161  ARG A C   1 
ATOM   1060 O  O   . ARG A 1 132 ? 49.535  76.389  126.022 1.00 41.20  ? 161  ARG A O   1 
ATOM   1061 C  CB  . ARG A 1 132 ? 50.850  78.236  127.809 1.00 43.28  ? 161  ARG A CB  1 
ATOM   1062 C  CG  . ARG A 1 132 ? 49.975  79.450  128.022 1.00 47.45  ? 161  ARG A CG  1 
ATOM   1063 C  CD  . ARG A 1 132 ? 49.965  80.345  126.795 1.00 52.81  ? 161  ARG A CD  1 
ATOM   1064 N  NE  . ARG A 1 132 ? 49.338  81.646  127.025 1.00 48.91  ? 161  ARG A NE  1 
ATOM   1065 C  CZ  . ARG A 1 132 ? 49.764  82.767  126.452 1.00 43.53  ? 161  ARG A CZ  1 
ATOM   1066 N  NH1 . ARG A 1 132 ? 50.801  82.776  125.626 1.00 29.97  ? 161  ARG A NH1 1 
ATOM   1067 N  NH2 . ARG A 1 132 ? 49.121  83.906  126.706 1.00 48.80  ? 161  ARG A NH2 1 
ATOM   1068 N  N   . ILE A 1 133 ? 47.896  76.339  127.597 1.00 39.94  ? 162  ILE A N   1 
ATOM   1069 C  CA  . ILE A 1 133 ? 46.850  75.990  126.621 1.00 43.27  ? 162  ILE A CA  1 
ATOM   1070 C  C   . ILE A 1 133 ? 45.944  77.189  126.392 1.00 46.09  ? 162  ILE A C   1 
ATOM   1071 O  O   . ILE A 1 133 ? 45.660  77.912  127.359 1.00 49.55  ? 162  ILE A O   1 
ATOM   1072 C  CB  . ILE A 1 133 ? 45.977  74.803  127.100 1.00 42.92  ? 162  ILE A CB  1 
ATOM   1073 C  CG1 . ILE A 1 133 ? 45.394  75.102  128.484 1.00 47.02  ? 162  ILE A CG1 1 
ATOM   1074 C  CG2 . ILE A 1 133 ? 46.849  73.565  127.162 1.00 39.59  ? 162  ILE A CG2 1 
ATOM   1075 C  CD1 . ILE A 1 133 ? 44.097  74.465  128.860 1.00 37.40  ? 162  ILE A CD1 1 
ATOM   1076 N  N   . HIS A 1 134 ? 45.442  77.399  125.193 1.00 46.59  ? 163  HIS A N   1 
ATOM   1077 C  CA  . HIS A 1 134 ? 44.557  78.511  124.911 1.00 49.11  ? 163  HIS A CA  1 
ATOM   1078 C  C   . HIS A 1 134 ? 43.080  78.236  124.941 1.00 53.53  ? 163  HIS A C   1 
ATOM   1079 O  O   . HIS A 1 134 ? 42.320  79.207  125.017 1.00 56.80  ? 163  HIS A O   1 
ATOM   1080 C  CB  . HIS A 1 134 ? 44.939  79.085  123.535 1.00 42.25  ? 163  HIS A CB  1 
ATOM   1081 C  CG  . HIS A 1 134 ? 46.402  79.453  123.633 1.00 49.83  ? 163  HIS A CG  1 
ATOM   1082 N  ND1 . HIS A 1 134 ? 47.367  78.646  123.091 1.00 52.64  ? 163  HIS A ND1 1 
ATOM   1083 C  CD2 . HIS A 1 134 ? 47.042  80.487  124.223 1.00 46.31  ? 163  HIS A CD2 1 
ATOM   1084 C  CE1 . HIS A 1 134 ? 48.556  79.175  123.324 1.00 48.94  ? 163  HIS A CE1 1 
ATOM   1085 N  NE2 . HIS A 1 134 ? 48.383  80.294  124.007 1.00 46.52  ? 163  HIS A NE2 1 
ATOM   1086 N  N   . ASP A 1 135 ? 42.610  76.994  124.948 1.00 56.58  ? 164  ASP A N   1 
ATOM   1087 C  CA  . ASP A 1 135 ? 41.184  76.732  125.078 1.00 60.06  ? 164  ASP A CA  1 
ATOM   1088 C  C   . ASP A 1 135 ? 40.820  75.856  126.271 1.00 60.37  ? 164  ASP A C   1 
ATOM   1089 O  O   . ASP A 1 135 ? 41.701  75.412  127.002 1.00 62.98  ? 164  ASP A O   1 
ATOM   1090 C  CB  . ASP A 1 135 ? 40.601  76.123  123.796 1.00 71.79  ? 164  ASP A CB  1 
ATOM   1091 C  CG  . ASP A 1 135 ? 39.080  76.268  123.880 1.00 85.47  ? 164  ASP A CG  1 
ATOM   1092 O  OD1 . ASP A 1 135 ? 38.444  75.446  124.566 1.00 94.15  ? 164  ASP A OD1 1 
ATOM   1093 O  OD2 . ASP A 1 135 ? 38.547  77.225  123.295 1.00 93.30  ? 164  ASP A OD2 1 
ATOM   1094 N  N   . GLY A 1 136 ? 39.545  75.673  126.593 1.00 57.64  ? 165  GLY A N   1 
ATOM   1095 C  CA  . GLY A 1 136 ? 39.051  74.819  127.638 1.00 53.85  ? 165  GLY A CA  1 
ATOM   1096 C  C   . GLY A 1 136 ? 39.713  74.978  128.975 1.00 51.51  ? 165  GLY A C   1 
ATOM   1097 O  O   . GLY A 1 136 ? 40.523  75.893  129.149 1.00 54.05  ? 165  GLY A O   1 
ATOM   1098 N  N   . GLU A 1 137 ? 39.407  74.116  129.942 1.00 48.03  ? 166  GLU A N   1 
ATOM   1099 C  CA  . GLU A 1 137 ? 39.943  74.243  131.290 1.00 43.19  ? 166  GLU A CA  1 
ATOM   1100 C  C   . GLU A 1 137 ? 41.366  73.768  131.447 1.00 40.11  ? 166  GLU A C   1 
ATOM   1101 O  O   . GLU A 1 137 ? 41.825  72.832  130.809 1.00 40.34  ? 166  GLU A O   1 
ATOM   1102 C  CB  . GLU A 1 137 ? 39.023  73.537  132.281 1.00 39.95  ? 166  GLU A CB  1 
ATOM   1103 C  CG  . GLU A 1 137 ? 38.150  74.551  133.033 1.00 47.75  ? 166  GLU A CG  1 
ATOM   1104 C  CD  . GLU A 1 137 ? 38.882  74.927  134.321 1.00 58.53  ? 166  GLU A CD  1 
ATOM   1105 O  OE1 . GLU A 1 137 ? 39.766  74.108  134.684 1.00 58.50  ? 166  GLU A OE1 1 
ATOM   1106 O  OE2 . GLU A 1 137 ? 38.562  75.989  134.898 1.00 55.18  ? 166  GLU A OE2 1 
ATOM   1107 N  N   . ALA A 1 138 ? 42.155  74.482  132.237 1.00 38.77  ? 167  ALA A N   1 
ATOM   1108 C  CA  . ALA A 1 138 ? 43.557  74.142  132.441 1.00 37.72  ? 167  ALA A CA  1 
ATOM   1109 C  C   . ALA A 1 138 ? 43.746  73.806  133.920 1.00 35.19  ? 167  ALA A C   1 
ATOM   1110 O  O   . ALA A 1 138 ? 42.849  73.994  134.714 1.00 34.07  ? 167  ALA A O   1 
ATOM   1111 C  CB  . ALA A 1 138 ? 44.534  75.246  132.045 1.00 31.09  ? 167  ALA A CB  1 
ATOM   1112 N  N   . ASP A 1 139 ? 44.914  73.276  134.248 1.00 34.26  ? 168  ASP A N   1 
ATOM   1113 C  CA  . ASP A 1 139 ? 45.100  72.848  135.628 1.00 33.49  ? 168  ASP A CA  1 
ATOM   1114 C  C   . ASP A 1 139 ? 45.095  74.084  136.493 1.00 33.49  ? 168  ASP A C   1 
ATOM   1115 O  O   . ASP A 1 139 ? 44.499  74.121  137.558 1.00 33.55  ? 168  ASP A O   1 
ATOM   1116 C  CB  . ASP A 1 139 ? 46.414  72.063  135.740 1.00 49.62  ? 168  ASP A CB  1 
ATOM   1117 C  CG  . ASP A 1 139 ? 46.206  70.646  135.206 1.00 56.77  ? 168  ASP A CG  1 
ATOM   1118 O  OD1 . ASP A 1 139 ? 46.092  70.481  133.979 1.00 58.15  ? 168  ASP A OD1 1 
ATOM   1119 O  OD2 . ASP A 1 139 ? 46.141  69.727  136.043 1.00 62.79  ? 168  ASP A OD2 1 
ATOM   1120 N  N   . ILE A 1 140 ? 45.862  75.048  135.989 1.00 36.24  ? 169  ILE A N   1 
ATOM   1121 C  CA  . ILE A 1 140 ? 46.000  76.345  136.634 1.00 35.35  ? 169  ILE A CA  1 
ATOM   1122 C  C   . ILE A 1 140 ? 45.533  77.428  135.654 1.00 34.38  ? 169  ILE A C   1 
ATOM   1123 O  O   . ILE A 1 140 ? 46.112  77.570  134.572 1.00 33.67  ? 169  ILE A O   1 
ATOM   1124 C  CB  . ILE A 1 140 ? 47.467  76.632  136.980 1.00 39.43  ? 169  ILE A CB  1 
ATOM   1125 C  CG1 . ILE A 1 140 ? 48.057  75.529  137.826 1.00 32.07  ? 169  ILE A CG1 1 
ATOM   1126 C  CG2 . ILE A 1 140 ? 47.536  77.980  137.702 1.00 49.36  ? 169  ILE A CG2 1 
ATOM   1127 C  CD1 . ILE A 1 140 ? 49.451  75.774  138.360 1.00 36.19  ? 169  ILE A CD1 1 
ATOM   1128 N  N   . MET A 1 141 ? 44.401  78.009  136.003 1.00 34.52  ? 170  MET A N   1 
ATOM   1129 C  CA  . MET A 1 141 ? 43.869  79.161  135.252 1.00 33.82  ? 170  MET A CA  1 
ATOM   1130 C  C   . MET A 1 141 ? 44.386  80.407  136.009 1.00 32.16  ? 170  MET A C   1 
ATOM   1131 O  O   . MET A 1 141 ? 44.448  80.391  137.248 1.00 31.10  ? 170  MET A O   1 
ATOM   1132 C  CB  . MET A 1 141 ? 42.357  79.177  135.222 1.00 33.98  ? 170  MET A CB  1 
ATOM   1133 C  CG  . MET A 1 141 ? 41.623  77.963  134.723 1.00 9.81   ? 170  MET A CG  1 
ATOM   1134 S  SD  . MET A 1 141 ? 41.946  77.630  132.974 1.00 29.72  ? 170  MET A SD  1 
ATOM   1135 C  CE  . MET A 1 141 ? 40.363  78.114  132.244 1.00 6.32   ? 170  MET A CE  1 
ATOM   1136 N  N   . ILE A 1 142 ? 44.889  81.360  135.262 1.00 33.15  ? 171  ILE A N   1 
ATOM   1137 C  CA  . ILE A 1 142 ? 45.406  82.652  135.756 1.00 28.19  ? 171  ILE A CA  1 
ATOM   1138 C  C   . ILE A 1 142 ? 44.502  83.802  135.326 1.00 22.90  ? 171  ILE A C   1 
ATOM   1139 O  O   . ILE A 1 142 ? 44.172  83.940  134.139 1.00 23.45  ? 171  ILE A O   1 
ATOM   1140 C  CB  . ILE A 1 142 ? 46.800  82.922  135.149 1.00 31.68  ? 171  ILE A CB  1 
ATOM   1141 C  CG1 . ILE A 1 142 ? 47.754  81.757  135.438 1.00 26.69  ? 171  ILE A CG1 1 
ATOM   1142 C  CG2 . ILE A 1 142 ? 47.367  84.250  135.661 1.00 19.86  ? 171  ILE A CG2 1 
ATOM   1143 C  CD1 . ILE A 1 142 ? 48.889  81.604  134.452 1.00 21.78  ? 171  ILE A CD1 1 
ATOM   1144 N  N   . ASN A 1 143 ? 44.016  84.596  136.255 1.00 21.40  ? 172  ASN A N   1 
ATOM   1145 C  CA  . ASN A 1 143 ? 43.195  85.752  135.898 1.00 21.02  ? 172  ASN A CA  1 
ATOM   1146 C  C   . ASN A 1 143 ? 43.624  87.008  136.640 1.00 20.65  ? 172  ASN A C   1 
ATOM   1147 O  O   . ASN A 1 143 ? 44.311  86.974  137.666 1.00 24.57  ? 172  ASN A O   1 
ATOM   1148 C  CB  . ASN A 1 143 ? 41.705  85.524  136.295 1.00 14.62  ? 172  ASN A CB  1 
ATOM   1149 C  CG  . ASN A 1 143 ? 40.894  86.301  135.274 1.00 28.16  ? 172  ASN A CG  1 
ATOM   1150 O  OD1 . ASN A 1 143 ? 40.176  85.711  134.477 1.00 46.57  ? 172  ASN A OD1 1 
ATOM   1151 N  ND2 . ASN A 1 143 ? 41.056  87.606  135.248 1.00 29.42  ? 172  ASN A ND2 1 
ATOM   1152 N  N   . PHE A 1 144 ? 43.044  88.142  136.269 1.00 17.73  ? 173  PHE A N   1 
ATOM   1153 C  CA  . PHE A 1 144 ? 43.282  89.345  137.081 1.00 13.06  ? 173  PHE A CA  1 
ATOM   1154 C  C   . PHE A 1 144 ? 41.911  89.854  137.493 1.00 16.48  ? 173  PHE A C   1 
ATOM   1155 O  O   . PHE A 1 144 ? 41.052  90.103  136.630 1.00 19.15  ? 173  PHE A O   1 
ATOM   1156 C  CB  . PHE A 1 144 ? 43.948  90.389  136.208 1.00 9.86   ? 173  PHE A CB  1 
ATOM   1157 C  CG  . PHE A 1 144 ? 45.419  90.166  136.027 1.00 8.08   ? 173  PHE A CG  1 
ATOM   1158 C  CD1 . PHE A 1 144 ? 45.893  89.338  135.024 1.00 11.34  ? 173  PHE A CD1 1 
ATOM   1159 C  CD2 . PHE A 1 144 ? 46.312  90.760  136.878 1.00 9.13   ? 173  PHE A CD2 1 
ATOM   1160 C  CE1 . PHE A 1 144 ? 47.245  89.118  134.870 1.00 24.07  ? 173  PHE A CE1 1 
ATOM   1161 C  CE2 . PHE A 1 144 ? 47.667  90.552  136.723 1.00 26.02  ? 173  PHE A CE2 1 
ATOM   1162 C  CZ  . PHE A 1 144 ? 48.150  89.728  135.711 1.00 24.23  ? 173  PHE A CZ  1 
ATOM   1163 N  N   . GLY A 1 145 ? 41.648  90.002  138.787 1.00 14.19  ? 174  GLY A N   1 
ATOM   1164 C  CA  . GLY A 1 145 ? 40.322  90.530  139.073 1.00 16.43  ? 174  GLY A CA  1 
ATOM   1165 C  C   . GLY A 1 145 ? 40.326  91.577  140.169 1.00 18.08  ? 174  GLY A C   1 
ATOM   1166 O  O   . GLY A 1 145 ? 41.326  91.954  140.735 1.00 17.73  ? 174  GLY A O   1 
ATOM   1167 N  N   . ARG A 1 146 ? 39.123  91.935  140.591 1.00 21.48  ? 175  ARG A N   1 
ATOM   1168 C  CA  . ARG A 1 146 ? 38.913  92.948  141.602 1.00 23.75  ? 175  ARG A CA  1 
ATOM   1169 C  C   . ARG A 1 146 ? 38.384  92.449  142.913 1.00 27.68  ? 175  ARG A C   1 
ATOM   1170 O  O   . ARG A 1 146 ? 38.344  91.253  143.187 1.00 39.25  ? 175  ARG A O   1 
ATOM   1171 C  CB  . ARG A 1 146 ? 37.726  93.795  141.033 1.00 41.28  ? 175  ARG A CB  1 
ATOM   1172 C  CG  . ARG A 1 146 ? 38.436  94.662  139.945 1.00 13.46  ? 175  ARG A CG  1 
ATOM   1173 C  CD  . ARG A 1 146 ? 37.664  95.972  139.903 1.00 16.21  ? 175  ARG A CD  1 
ATOM   1174 N  NE  . ARG A 1 146 ? 38.450  97.016  140.478 1.00 4.01   ? 175  ARG A NE  1 
ATOM   1175 C  CZ  . ARG A 1 146 ? 37.951  98.161  140.935 1.00 16.06  ? 175  ARG A CZ  1 
ATOM   1176 N  NH1 . ARG A 1 146 ? 36.648  98.438  140.910 1.00 5.39   ? 175  ARG A NH1 1 
ATOM   1177 N  NH2 . ARG A 1 146 ? 38.831  99.000  141.447 1.00 10.38  ? 175  ARG A NH2 1 
ATOM   1178 N  N   . TRP A 1 147 ? 37.856  93.385  143.673 1.00 21.97  ? 176  TRP A N   1 
ATOM   1179 C  CA  . TRP A 1 147 ? 37.412  93.015  145.000 1.00 23.15  ? 176  TRP A CA  1 
ATOM   1180 C  C   . TRP A 1 147 ? 36.736  91.662  145.003 1.00 26.23  ? 176  TRP A C   1 
ATOM   1181 O  O   . TRP A 1 147 ? 37.253  90.631  145.437 1.00 29.56  ? 176  TRP A O   1 
ATOM   1182 C  CB  . TRP A 1 147 ? 36.510  94.105  145.572 1.00 20.13  ? 176  TRP A CB  1 
ATOM   1183 C  CG  . TRP A 1 147 ? 37.112  95.466  145.575 1.00 14.86  ? 176  TRP A CG  1 
ATOM   1184 C  CD1 . TRP A 1 147 ? 37.507  96.162  144.470 1.00 14.07  ? 176  TRP A CD1 1 
ATOM   1185 C  CD2 . TRP A 1 147 ? 37.417  96.297  146.732 1.00 14.03  ? 176  TRP A CD2 1 
ATOM   1186 N  NE1 . TRP A 1 147 ? 38.018  97.384  144.833 1.00 20.44  ? 176  TRP A NE1 1 
ATOM   1187 C  CE2 . TRP A 1 147 ? 37.976  97.486  146.215 1.00 7.61   ? 176  TRP A CE2 1 
ATOM   1188 C  CE3 . TRP A 1 147 ? 37.268  96.171  148.074 1.00 4.07   ? 176  TRP A CE3 1 
ATOM   1189 C  CZ2 . TRP A 1 147 ? 38.368  98.523  147.022 1.00 13.15  ? 176  TRP A CZ2 1 
ATOM   1190 C  CZ3 . TRP A 1 147 ? 37.683  97.210  148.905 1.00 2.08   ? 176  TRP A CZ3 1 
ATOM   1191 C  CH2 . TRP A 1 147 ? 38.201  98.377  148.365 1.00 15.15  ? 176  TRP A CH2 1 
ATOM   1192 N  N   . GLU A 1 148 ? 35.504  91.609  144.540 1.00 26.40  ? 177  GLU A N   1 
ATOM   1193 C  CA  . GLU A 1 148 ? 34.814  90.301  144.539 1.00 24.34  ? 177  GLU A CA  1 
ATOM   1194 C  C   . GLU A 1 148 ? 35.007  89.658  143.196 1.00 25.98  ? 177  GLU A C   1 
ATOM   1195 O  O   . GLU A 1 148 ? 34.399  90.189  142.269 1.00 25.87  ? 177  GLU A O   1 
ATOM   1196 C  CB  . GLU A 1 148 ? 33.373  90.693  144.832 1.00 29.21  ? 177  GLU A CB  1 
ATOM   1197 C  CG  . GLU A 1 148 ? 32.462  89.563  145.200 1.00 30.48  ? 177  GLU A CG  1 
ATOM   1198 C  CD  . GLU A 1 148 ? 33.174  88.372  145.787 1.00 38.60  ? 177  GLU A CD  1 
ATOM   1199 O  OE1 . GLU A 1 148 ? 33.528  88.384  146.993 1.00 37.95  ? 177  GLU A OE1 1 
ATOM   1200 O  OE2 . GLU A 1 148 ? 33.388  87.371  145.057 1.00 30.19  ? 177  GLU A OE2 1 
ATOM   1201 N  N   . HIS A 1 149 ? 35.925  88.696  143.063 1.00 27.91  ? 178  HIS A N   1 
ATOM   1202 C  CA  . HIS A 1 149 ? 36.154  88.206  141.726 1.00 28.76  ? 178  HIS A CA  1 
ATOM   1203 C  C   . HIS A 1 149 ? 35.405  86.937  141.353 1.00 29.05  ? 178  HIS A C   1 
ATOM   1204 O  O   . HIS A 1 149 ? 35.601  86.486  140.221 1.00 29.01  ? 178  HIS A O   1 
ATOM   1205 C  CB  . HIS A 1 149 ? 37.621  88.132  141.297 1.00 35.13  ? 178  HIS A CB  1 
ATOM   1206 C  CG  . HIS A 1 149 ? 38.556  87.693  142.372 1.00 25.25  ? 178  HIS A CG  1 
ATOM   1207 N  ND1 . HIS A 1 149 ? 38.653  88.376  143.563 1.00 20.74  ? 178  HIS A ND1 1 
ATOM   1208 C  CD2 . HIS A 1 149 ? 39.389  86.635  142.423 1.00 24.28  ? 178  HIS A CD2 1 
ATOM   1209 C  CE1 . HIS A 1 149 ? 39.553  87.743  144.323 1.00 41.82  ? 178  HIS A CE1 1 
ATOM   1210 N  NE2 . HIS A 1 149 ? 39.999  86.707  143.655 1.00 32.96  ? 178  HIS A NE2 1 
ATOM   1211 N  N   . GLY A 1 150 ? 34.617  86.363  142.261 1.00 30.44  ? 179  GLY A N   1 
ATOM   1212 C  CA  . GLY A 1 150 ? 33.746  85.264  142.021 1.00 30.33  ? 179  GLY A CA  1 
ATOM   1213 C  C   . GLY A 1 150 ? 33.956  83.942  142.698 1.00 32.77  ? 179  GLY A C   1 
ATOM   1214 O  O   . GLY A 1 150 ? 33.173  82.996  142.450 1.00 36.72  ? 179  GLY A O   1 
ATOM   1215 N  N   . ASP A 1 151 ? 34.923  83.777  143.578 1.00 29.93  ? 180  ASP A N   1 
ATOM   1216 C  CA  . ASP A 1 151 ? 35.173  82.526  144.252 1.00 33.23  ? 180  ASP A CA  1 
ATOM   1217 C  C   . ASP A 1 151 ? 35.035  82.733  145.760 1.00 34.27  ? 180  ASP A C   1 
ATOM   1218 O  O   . ASP A 1 151 ? 35.107  81.777  146.540 1.00 42.91  ? 180  ASP A O   1 
ATOM   1219 C  CB  . ASP A 1 151 ? 36.588  82.023  143.958 1.00 42.96  ? 180  ASP A CB  1 
ATOM   1220 C  CG  . ASP A 1 151 ? 37.511  83.232  144.182 1.00 37.16  ? 180  ASP A CG  1 
ATOM   1221 O  OD1 . ASP A 1 151 ? 37.103  84.181  144.871 1.00 35.10  ? 180  ASP A OD1 1 
ATOM   1222 O  OD2 . ASP A 1 151 ? 38.601  83.183  143.612 1.00 22.97  ? 180  ASP A OD2 1 
ATOM   1223 N  N   . GLY A 1 152 ? 34.749  83.964  146.119 1.00 28.18  ? 181  GLY A N   1 
ATOM   1224 C  CA  . GLY A 1 152 ? 34.257  84.243  147.447 1.00 31.51  ? 181  GLY A CA  1 
ATOM   1225 C  C   . GLY A 1 152 ? 35.263  84.807  148.388 1.00 38.25  ? 181  GLY A C   1 
ATOM   1226 O  O   . GLY A 1 152 ? 35.134  84.912  149.609 1.00 40.20  ? 181  GLY A O   1 
ATOM   1227 N  N   . TYR A 1 153 ? 36.351  85.270  147.797 1.00 43.30  ? 182  TYR A N   1 
ATOM   1228 C  CA  . TYR A 1 153 ? 37.499  85.759  148.603 1.00 43.94  ? 182  TYR A CA  1 
ATOM   1229 C  C   . TYR A 1 153 ? 37.831  87.155  148.183 1.00 41.02  ? 182  TYR A C   1 
ATOM   1230 O  O   . TYR A 1 153 ? 38.672  87.424  147.323 1.00 42.27  ? 182  TYR A O   1 
ATOM   1231 C  CB  . TYR A 1 153 ? 38.517  84.644  148.263 1.00 53.97  ? 182  TYR A CB  1 
ATOM   1232 C  CG  . TYR A 1 153 ? 38.251  83.387  149.087 1.00 66.30  ? 182  TYR A CG  1 
ATOM   1233 C  CD1 . TYR A 1 153 ? 38.006  83.546  150.451 1.00 72.62  ? 182  TYR A CD1 1 
ATOM   1234 C  CD2 . TYR A 1 153 ? 38.244  82.120  148.542 1.00 70.75  ? 182  TYR A CD2 1 
ATOM   1235 C  CE1 . TYR A 1 153 ? 37.777  82.456  151.254 1.00 75.65  ? 182  TYR A CE1 1 
ATOM   1236 C  CE2 . TYR A 1 153 ? 38.012  81.014  149.336 1.00 74.47  ? 182  TYR A CE2 1 
ATOM   1237 C  CZ  . TYR A 1 153 ? 37.786  81.203  150.680 1.00 77.21  ? 182  TYR A CZ  1 
ATOM   1238 O  OH  . TYR A 1 153 ? 37.568  80.083  151.438 1.00 80.06  ? 182  TYR A OH  1 
ATOM   1239 N  N   . PRO A 1 154 ? 37.098  88.158  148.685 1.00 36.86  ? 183  PRO A N   1 
ATOM   1240 C  CA  . PRO A 1 154 ? 37.090  89.498  148.157 1.00 33.91  ? 183  PRO A CA  1 
ATOM   1241 C  C   . PRO A 1 154 ? 38.442  90.156  148.160 1.00 36.19  ? 183  PRO A C   1 
ATOM   1242 O  O   . PRO A 1 154 ? 39.107  90.167  149.201 1.00 38.79  ? 183  PRO A O   1 
ATOM   1243 C  CB  . PRO A 1 154 ? 36.080  90.222  149.024 1.00 35.04  ? 183  PRO A CB  1 
ATOM   1244 C  CG  . PRO A 1 154 ? 35.173  89.162  149.552 1.00 39.21  ? 183  PRO A CG  1 
ATOM   1245 C  CD  . PRO A 1 154 ? 36.038  87.955  149.689 1.00 39.66  ? 183  PRO A CD  1 
ATOM   1246 N  N   . PHE A 1 155 ? 38.962  90.768  147.092 1.00 33.69  ? 184  PHE A N   1 
ATOM   1247 C  CA  . PHE A 1 155 ? 40.202  91.550  147.218 1.00 28.40  ? 184  PHE A CA  1 
ATOM   1248 C  C   . PHE A 1 155 ? 39.896  92.942  147.742 1.00 28.60  ? 184  PHE A C   1 
ATOM   1249 O  O   . PHE A 1 155 ? 38.865  93.536  147.404 1.00 40.65  ? 184  PHE A O   1 
ATOM   1250 C  CB  . PHE A 1 155 ? 40.910  91.734  145.879 1.00 10.48  ? 184  PHE A CB  1 
ATOM   1251 C  CG  . PHE A 1 155 ? 41.665  90.565  145.329 1.00 19.51  ? 184  PHE A CG  1 
ATOM   1252 C  CD1 . PHE A 1 155 ? 42.255  89.678  146.202 1.00 21.02  ? 184  PHE A CD1 1 
ATOM   1253 C  CD2 . PHE A 1 155 ? 41.840  90.288  143.979 1.00 14.21  ? 184  PHE A CD2 1 
ATOM   1254 C  CE1 . PHE A 1 155 ? 42.971  88.580  145.767 1.00 2.00   ? 184  PHE A CE1 1 
ATOM   1255 C  CE2 . PHE A 1 155 ? 42.540  89.194  143.508 1.00 6.38   ? 184  PHE A CE2 1 
ATOM   1256 C  CZ  . PHE A 1 155 ? 43.124  88.318  144.411 1.00 16.08  ? 184  PHE A CZ  1 
ATOM   1257 N  N   . ASP A 1 156 ? 40.804  93.630  148.386 1.00 21.63  ? 185  ASP A N   1 
ATOM   1258 C  CA  . ASP A 1 156 ? 40.421  95.047  148.652 1.00 26.79  ? 185  ASP A CA  1 
ATOM   1259 C  C   . ASP A 1 156 ? 41.479  95.914  147.979 1.00 29.02  ? 185  ASP A C   1 
ATOM   1260 O  O   . ASP A 1 156 ? 42.653  95.541  148.157 1.00 37.83  ? 185  ASP A O   1 
ATOM   1261 C  CB  . ASP A 1 156 ? 40.462  95.352  150.126 1.00 38.51  ? 185  ASP A CB  1 
ATOM   1262 C  CG  . ASP A 1 156 ? 41.797  94.925  150.721 1.00 46.33  ? 185  ASP A CG  1 
ATOM   1263 O  OD1 . ASP A 1 156 ? 42.863  94.710  150.044 1.00 26.65  ? 185  ASP A OD1 1 
ATOM   1264 O  OD2 . ASP A 1 156 ? 41.774  94.763  151.978 1.00 56.45  ? 185  ASP A OD2 1 
ATOM   1265 N  N   . GLY A 1 157 ? 41.051  96.665  147.037 1.00 25.75  ? 186  GLY A N   1 
ATOM   1266 C  CA  . GLY A 1 157 ? 41.782  97.611  146.270 1.00 26.06  ? 186  GLY A CA  1 
ATOM   1267 C  C   . GLY A 1 157 ? 43.267  97.741  146.360 1.00 24.68  ? 186  GLY A C   1 
ATOM   1268 O  O   . GLY A 1 157 ? 44.059  96.850  146.584 1.00 22.57  ? 186  GLY A O   1 
ATOM   1269 N  N   . LYS A 1 158 ? 43.874  98.878  146.037 1.00 26.66  ? 187  LYS A N   1 
ATOM   1270 C  CA  . LYS A 1 158 ? 45.309  99.040  145.939 1.00 26.54  ? 187  LYS A CA  1 
ATOM   1271 C  C   . LYS A 1 158 ? 46.093  98.630  147.179 1.00 27.02  ? 187  LYS A C   1 
ATOM   1272 O  O   . LYS A 1 158 ? 45.666  98.893  148.309 1.00 26.11  ? 187  LYS A O   1 
ATOM   1273 C  CB  . LYS A 1 158 ? 45.561  100.525 145.623 1.00 10.54  ? 187  LYS A CB  1 
ATOM   1274 C  CG  . LYS A 1 158 ? 46.966  100.885 145.277 1.00 27.22  ? 187  LYS A CG  1 
ATOM   1275 C  CD  . LYS A 1 158 ? 47.180  101.747 144.042 1.00 16.96  ? 187  LYS A CD  1 
ATOM   1276 C  CE  . LYS A 1 158 ? 48.656  101.814 143.685 1.00 19.24  ? 187  LYS A CE  1 
ATOM   1277 N  NZ  . LYS A 1 158 ? 48.949  102.131 142.266 1.00 30.04  ? 187  LYS A NZ  1 
ATOM   1278 N  N   . ASP A 1 159 ? 47.288  98.073  146.930 1.00 22.68  ? 188  ASP A N   1 
ATOM   1279 C  CA  . ASP A 1 159 ? 48.184  97.670  148.016 1.00 20.89  ? 188  ASP A CA  1 
ATOM   1280 C  C   . ASP A 1 159 ? 47.582  96.603  148.907 1.00 19.82  ? 188  ASP A C   1 
ATOM   1281 O  O   . ASP A 1 159 ? 46.626  95.977  148.451 1.00 20.73  ? 188  ASP A O   1 
ATOM   1282 C  CB  . ASP A 1 159 ? 48.539  98.919  148.811 1.00 13.48  ? 188  ASP A CB  1 
ATOM   1283 C  CG  . ASP A 1 159 ? 49.414  99.888  148.065 1.00 21.09  ? 188  ASP A CG  1 
ATOM   1284 O  OD1 . ASP A 1 159 ? 50.349  99.533  147.302 1.00 28.41  ? 188  ASP A OD1 1 
ATOM   1285 O  OD2 . ASP A 1 159 ? 49.165  101.095 148.259 1.00 33.14  ? 188  ASP A OD2 1 
ATOM   1286 N  N   . GLY A 1 160 ? 48.026  96.361  150.135 1.00 19.14  ? 189  GLY A N   1 
ATOM   1287 C  CA  . GLY A 1 160 ? 47.405  95.279  150.927 1.00 21.13  ? 189  GLY A CA  1 
ATOM   1288 C  C   . GLY A 1 160 ? 47.534  93.915  150.240 1.00 22.37  ? 189  GLY A C   1 
ATOM   1289 O  O   . GLY A 1 160 ? 48.674  93.522  149.900 1.00 24.59  ? 189  GLY A O   1 
ATOM   1290 N  N   . LEU A 1 161 ? 46.423  93.175  150.090 1.00 16.66  ? 190  LEU A N   1 
ATOM   1291 C  CA  . LEU A 1 161 ? 46.518  91.847  149.497 1.00 14.53  ? 190  LEU A CA  1 
ATOM   1292 C  C   . LEU A 1 161 ? 46.954  91.888  148.053 1.00 16.96  ? 190  LEU A C   1 
ATOM   1293 O  O   . LEU A 1 161 ? 46.354  92.615  147.295 1.00 18.46  ? 190  LEU A O   1 
ATOM   1294 C  CB  . LEU A 1 161 ? 45.222  91.062  149.628 1.00 12.66  ? 190  LEU A CB  1 
ATOM   1295 C  CG  . LEU A 1 161 ? 44.362  91.253  150.873 1.00 18.47  ? 190  LEU A CG  1 
ATOM   1296 C  CD1 . LEU A 1 161 ? 43.174  90.318  150.829 1.00 6.60   ? 190  LEU A CD1 1 
ATOM   1297 C  CD2 . LEU A 1 161 ? 45.095  91.105  152.178 1.00 17.79  ? 190  LEU A CD2 1 
ATOM   1298 N  N   . LEU A 1 162 ? 47.951  91.146  147.548 1.00 17.61  ? 191  LEU A N   1 
ATOM   1299 C  CA  . LEU A 1 162 ? 48.311  91.302  146.133 1.00 14.19  ? 191  LEU A CA  1 
ATOM   1300 C  C   . LEU A 1 162 ? 47.703  90.258  145.226 1.00 18.18  ? 191  LEU A C   1 
ATOM   1301 O  O   . LEU A 1 162 ? 47.409  90.495  144.042 1.00 17.93  ? 191  LEU A O   1 
ATOM   1302 C  CB  . LEU A 1 162 ? 49.821  91.318  145.983 1.00 7.65   ? 191  LEU A CB  1 
ATOM   1303 C  CG  . LEU A 1 162 ? 50.621  92.171  146.966 1.00 20.21  ? 191  LEU A CG  1 
ATOM   1304 C  CD1 . LEU A 1 162 ? 52.078  92.330  146.508 1.00 28.07  ? 191  LEU A CD1 1 
ATOM   1305 C  CD2 . LEU A 1 162 ? 50.030  93.563  147.095 1.00 20.90  ? 191  LEU A CD2 1 
ATOM   1306 N  N   . ALA A 1 163 ? 47.576  89.022  145.730 1.00 23.34  ? 192  ALA A N   1 
ATOM   1307 C  CA  . ALA A 1 163 ? 47.086  87.884  144.936 1.00 23.05  ? 192  ALA A CA  1 
ATOM   1308 C  C   . ALA A 1 163 ? 46.776  86.688  145.843 1.00 22.48  ? 192  ALA A C   1 
ATOM   1309 O  O   . ALA A 1 163 ? 47.088  86.713  147.038 1.00 22.11  ? 192  ALA A O   1 
ATOM   1310 C  CB  . ALA A 1 163 ? 48.084  87.492  143.862 1.00 9.66   ? 192  ALA A CB  1 
ATOM   1311 N  N   . HIS A 1 164 ? 46.127  85.683  145.277 1.00 21.97  ? 193  HIS A N   1 
ATOM   1312 C  CA  . HIS A 1 164 ? 45.786  84.472  146.015 1.00 23.21  ? 193  HIS A CA  1 
ATOM   1313 C  C   . HIS A 1 164 ? 45.672  83.315  145.025 1.00 25.97  ? 193  HIS A C   1 
ATOM   1314 O  O   . HIS A 1 164 ? 45.127  83.450  143.932 1.00 27.94  ? 193  HIS A O   1 
ATOM   1315 C  CB  . HIS A 1 164 ? 44.605  84.546  146.921 1.00 18.69  ? 193  HIS A CB  1 
ATOM   1316 C  CG  . HIS A 1 164 ? 43.231  84.885  146.480 1.00 16.11  ? 193  HIS A CG  1 
ATOM   1317 N  ND1 . HIS A 1 164 ? 42.387  85.628  147.321 1.00 27.19  ? 193  HIS A ND1 1 
ATOM   1318 C  CD2 . HIS A 1 164 ? 42.548  84.609  145.353 1.00 6.91   ? 193  HIS A CD2 1 
ATOM   1319 C  CE1 . HIS A 1 164 ? 41.200  85.790  146.716 1.00 25.43  ? 193  HIS A CE1 1 
ATOM   1320 N  NE2 . HIS A 1 164 ? 41.290  85.196  145.560 1.00 15.84  ? 193  HIS A NE2 1 
ATOM   1321 N  N   . ALA A 1 165 ? 46.253  82.176  145.404 1.00 28.26  ? 194  ALA A N   1 
ATOM   1322 C  CA  . ALA A 1 165 ? 46.163  81.015  144.490 1.00 30.74  ? 194  ALA A CA  1 
ATOM   1323 C  C   . ALA A 1 165 ? 45.580  79.843  145.285 1.00 29.55  ? 194  ALA A C   1 
ATOM   1324 O  O   . ALA A 1 165 ? 45.732  79.875  146.509 1.00 29.05  ? 194  ALA A O   1 
ATOM   1325 C  CB  . ALA A 1 165 ? 47.488  80.674  143.860 1.00 38.60  ? 194  ALA A CB  1 
ATOM   1326 N  N   . PHE A 1 166 ? 44.857  78.964  144.632 1.00 30.11  ? 195  PHE A N   1 
ATOM   1327 C  CA  . PHE A 1 166 ? 44.202  77.824  145.277 1.00 34.44  ? 195  PHE A CA  1 
ATOM   1328 C  C   . PHE A 1 166 ? 45.023  76.540  145.109 1.00 33.70  ? 195  PHE A C   1 
ATOM   1329 O  O   . PHE A 1 166 ? 45.412  76.256  143.971 1.00 32.33  ? 195  PHE A O   1 
ATOM   1330 C  CB  . PHE A 1 166 ? 42.815  77.536  144.642 1.00 40.10  ? 195  PHE A CB  1 
ATOM   1331 C  CG  . PHE A 1 166 ? 41.731  78.491  145.003 1.00 41.65  ? 195  PHE A CG  1 
ATOM   1332 C  CD1 . PHE A 1 166 ? 41.087  78.432  146.228 1.00 46.10  ? 195  PHE A CD1 1 
ATOM   1333 C  CD2 . PHE A 1 166 ? 41.348  79.497  144.120 1.00 51.06  ? 195  PHE A CD2 1 
ATOM   1334 C  CE1 . PHE A 1 166 ? 40.087  79.341  146.561 1.00 48.21  ? 195  PHE A CE1 1 
ATOM   1335 C  CE2 . PHE A 1 166 ? 40.351  80.406  144.444 1.00 39.19  ? 195  PHE A CE2 1 
ATOM   1336 C  CZ  . PHE A 1 166 ? 39.722  80.330  145.673 1.00 38.61  ? 195  PHE A CZ  1 
ATOM   1337 N  N   . ALA A 1 167 ? 45.091  75.692  146.122 1.00 35.85  ? 196  ALA A N   1 
ATOM   1338 C  CA  . ALA A 1 167 ? 45.835  74.439  146.046 1.00 37.97  ? 196  ALA A CA  1 
ATOM   1339 C  C   . ALA A 1 167 ? 45.376  73.441  145.003 1.00 41.12  ? 196  ALA A C   1 
ATOM   1340 O  O   . ALA A 1 167 ? 44.277  73.449  144.442 1.00 41.60  ? 196  ALA A O   1 
ATOM   1341 C  CB  . ALA A 1 167 ? 45.928  73.769  147.394 1.00 23.96  ? 196  ALA A CB  1 
ATOM   1342 N  N   . PRO A 1 168 ? 46.299  72.528  144.668 1.00 43.96  ? 197  PRO A N   1 
ATOM   1343 C  CA  . PRO A 1 168 ? 46.061  71.617  143.538 1.00 43.63  ? 197  PRO A CA  1 
ATOM   1344 C  C   . PRO A 1 168 ? 44.807  70.842  143.867 1.00 47.11  ? 197  PRO A C   1 
ATOM   1345 O  O   . PRO A 1 168 ? 44.571  70.488  145.028 1.00 46.83  ? 197  PRO A O   1 
ATOM   1346 C  CB  . PRO A 1 168 ? 47.306  70.813  143.407 1.00 40.98  ? 197  PRO A CB  1 
ATOM   1347 C  CG  . PRO A 1 168 ? 48.352  71.518  144.176 1.00 40.60  ? 197  PRO A CG  1 
ATOM   1348 C  CD  . PRO A 1 168 ? 47.678  72.408  145.179 1.00 42.50  ? 197  PRO A CD  1 
ATOM   1349 N  N   . GLY A 1 169 ? 43.940  70.747  142.866 1.00 48.92  ? 198  GLY A N   1 
ATOM   1350 C  CA  . GLY A 1 169 ? 42.667  70.093  143.113 1.00 50.70  ? 198  GLY A CA  1 
ATOM   1351 C  C   . GLY A 1 169 ? 41.794  70.199  141.874 1.00 53.22  ? 198  GLY A C   1 
ATOM   1352 O  O   . GLY A 1 169 ? 42.311  70.356  140.778 1.00 51.35  ? 198  GLY A O   1 
ATOM   1353 N  N   . THR A 1 170 ? 40.500  70.081  142.140 1.00 57.03  ? 199  THR A N   1 
ATOM   1354 C  CA  . THR A 1 170 ? 39.515  70.101  141.052 1.00 59.26  ? 199  THR A CA  1 
ATOM   1355 C  C   . THR A 1 170 ? 38.946  71.507  140.939 1.00 57.81  ? 199  THR A C   1 
ATOM   1356 O  O   . THR A 1 170 ? 39.038  72.265  141.910 1.00 58.85  ? 199  THR A O   1 
ATOM   1357 C  CB  . THR A 1 170 ? 38.418  69.057  141.317 1.00 66.61  ? 199  THR A CB  1 
ATOM   1358 O  OG1 . THR A 1 170 ? 39.071  67.823  141.689 1.00 63.25  ? 199  THR A OG1 1 
ATOM   1359 C  CG2 . THR A 1 170 ? 37.575  68.818  140.080 1.00 73.02  ? 199  THR A CG2 1 
ATOM   1360 N  N   . GLY A 1 171 ? 38.506  71.870  139.745 1.00 54.99  ? 200  GLY A N   1 
ATOM   1361 C  CA  . GLY A 1 171 ? 37.909  73.165  139.509 1.00 51.15  ? 200  GLY A CA  1 
ATOM   1362 C  C   . GLY A 1 171 ? 38.764  74.352  139.827 1.00 46.54  ? 200  GLY A C   1 
ATOM   1363 O  O   . GLY A 1 171 ? 39.627  74.771  139.071 1.00 47.10  ? 200  GLY A O   1 
ATOM   1364 N  N   . VAL A 1 172 ? 38.542  75.000  140.949 1.00 43.27  ? 201  VAL A N   1 
ATOM   1365 C  CA  . VAL A 1 172 ? 39.274  76.213  141.291 1.00 40.17  ? 201  VAL A CA  1 
ATOM   1366 C  C   . VAL A 1 172 ? 40.674  75.935  141.782 1.00 42.97  ? 201  VAL A C   1 
ATOM   1367 O  O   . VAL A 1 172 ? 41.525  76.852  141.876 1.00 45.79  ? 201  VAL A O   1 
ATOM   1368 C  CB  . VAL A 1 172 ? 38.414  76.944  142.324 1.00 29.08  ? 201  VAL A CB  1 
ATOM   1369 C  CG1 . VAL A 1 172 ? 39.199  77.444  143.501 1.00 35.08  ? 201  VAL A CG1 1 
ATOM   1370 C  CG2 . VAL A 1 172 ? 37.656  78.050  141.604 1.00 44.35  ? 201  VAL A CG2 1 
ATOM   1371 N  N   . GLY A 1 173 ? 40.992  74.655  141.990 1.00 39.41  ? 202  GLY A N   1 
ATOM   1372 C  CA  . GLY A 1 173 ? 42.291  74.198  142.425 1.00 34.56  ? 202  GLY A CA  1 
ATOM   1373 C  C   . GLY A 1 173 ? 43.418  74.488  141.442 1.00 32.53  ? 202  GLY A C   1 
ATOM   1374 O  O   . GLY A 1 173 ? 43.332  74.191  140.251 1.00 27.54  ? 202  GLY A O   1 
ATOM   1375 N  N   . GLY A 1 174 ? 44.455  75.116  141.992 1.00 35.60  ? 203  GLY A N   1 
ATOM   1376 C  CA  . GLY A 1 174 ? 45.681  75.487  141.303 1.00 38.12  ? 203  GLY A CA  1 
ATOM   1377 C  C   . GLY A 1 174 ? 45.628  76.890  140.700 1.00 38.63  ? 203  GLY A C   1 
ATOM   1378 O  O   . GLY A 1 174 ? 46.598  77.494  140.246 1.00 36.35  ? 203  GLY A O   1 
ATOM   1379 N  N   . ASP A 1 175 ? 44.401  77.404  140.670 1.00 39.66  ? 204  ASP A N   1 
ATOM   1380 C  CA  . ASP A 1 175 ? 44.056  78.651  140.011 1.00 36.27  ? 204  ASP A CA  1 
ATOM   1381 C  C   . ASP A 1 175 ? 44.646  79.852  140.712 1.00 34.57  ? 204  ASP A C   1 
ATOM   1382 O  O   . ASP A 1 175 ? 44.516  79.971  141.939 1.00 34.63  ? 204  ASP A O   1 
ATOM   1383 C  CB  . ASP A 1 175 ? 42.522  78.719  140.018 1.00 43.41  ? 204  ASP A CB  1 
ATOM   1384 C  CG  . ASP A 1 175 ? 41.938  78.077  138.772 1.00 37.94  ? 204  ASP A CG  1 
ATOM   1385 O  OD1 . ASP A 1 175 ? 42.747  77.666  137.913 1.00 36.53  ? 204  ASP A OD1 1 
ATOM   1386 O  OD2 . ASP A 1 175 ? 40.691  78.042  138.699 1.00 37.43  ? 204  ASP A OD2 1 
ATOM   1387 N  N   . SER A 1 176 ? 45.278  80.720  139.925 1.00 33.88  ? 205  SER A N   1 
ATOM   1388 C  CA  . SER A 1 176 ? 45.944  81.908  140.475 1.00 29.13  ? 205  SER A CA  1 
ATOM   1389 C  C   . SER A 1 176 ? 45.300  83.215  140.038 1.00 27.97  ? 205  SER A C   1 
ATOM   1390 O  O   . SER A 1 176 ? 44.993  83.510  138.879 1.00 26.20  ? 205  SER A O   1 
ATOM   1391 C  CB  . SER A 1 176 ? 47.403  81.880  140.054 1.00 12.03  ? 205  SER A CB  1 
ATOM   1392 O  OG  . SER A 1 176 ? 47.993  80.621  140.363 1.00 24.47  ? 205  SER A OG  1 
ATOM   1393 N  N   . HIS A 1 177 ? 45.044  84.027  141.055 1.00 26.48  ? 206  HIS A N   1 
ATOM   1394 C  CA  . HIS A 1 177 ? 44.433  85.330  140.936 1.00 25.01  ? 206  HIS A CA  1 
ATOM   1395 C  C   . HIS A 1 177 ? 45.317  86.470  141.409 1.00 22.66  ? 206  HIS A C   1 
ATOM   1396 O  O   . HIS A 1 177 ? 45.845  86.427  142.540 1.00 22.00  ? 206  HIS A O   1 
ATOM   1397 C  CB  . HIS A 1 177 ? 43.158  85.316  141.858 1.00 32.51  ? 206  HIS A CB  1 
ATOM   1398 C  CG  . HIS A 1 177 ? 42.155  84.353  141.278 1.00 37.89  ? 206  HIS A CG  1 
ATOM   1399 N  ND1 . HIS A 1 177 ? 40.988  84.035  141.917 1.00 4.96   ? 206  HIS A ND1 1 
ATOM   1400 C  CD2 . HIS A 1 177 ? 42.145  83.630  140.117 1.00 31.49  ? 206  HIS A CD2 1 
ATOM   1401 C  CE1 . HIS A 1 177 ? 40.277  83.212  141.202 1.00 15.04  ? 206  HIS A CE1 1 
ATOM   1402 N  NE2 . HIS A 1 177 ? 40.983  82.915  140.094 1.00 32.92  ? 206  HIS A NE2 1 
ATOM   1403 N  N   . PHE A 1 178 ? 45.401  87.509  140.571 1.00 20.41  ? 207  PHE A N   1 
ATOM   1404 C  CA  . PHE A 1 178 ? 46.172  88.703  140.966 1.00 18.73  ? 207  PHE A CA  1 
ATOM   1405 C  C   . PHE A 1 178 ? 45.215  89.896  140.990 1.00 18.26  ? 207  PHE A C   1 
ATOM   1406 O  O   . PHE A 1 178 ? 44.382  89.980  140.093 1.00 16.34  ? 207  PHE A O   1 
ATOM   1407 C  CB  . PHE A 1 178 ? 47.314  88.948  139.985 1.00 12.37  ? 207  PHE A CB  1 
ATOM   1408 C  CG  . PHE A 1 178 ? 48.129  87.703  139.768 1.00 22.76  ? 207  PHE A CG  1 
ATOM   1409 C  CD1 . PHE A 1 178 ? 47.648  86.673  138.966 1.00 28.12  ? 207  PHE A CD1 1 
ATOM   1410 C  CD2 . PHE A 1 178 ? 49.338  87.547  140.418 1.00 20.70  ? 207  PHE A CD2 1 
ATOM   1411 C  CE1 . PHE A 1 178 ? 48.387  85.510  138.805 1.00 28.51  ? 207  PHE A CE1 1 
ATOM   1412 C  CE2 . PHE A 1 178 ? 50.065  86.382  140.250 1.00 30.36  ? 207  PHE A CE2 1 
ATOM   1413 C  CZ  . PHE A 1 178 ? 49.594  85.357  139.443 1.00 22.96  ? 207  PHE A CZ  1 
ATOM   1414 N  N   . ASP A 1 179 ? 45.342  90.689  142.043 1.00 17.93  ? 208  ASP A N   1 
ATOM   1415 C  CA  . ASP A 1 179 ? 44.559  91.877  142.246 1.00 16.95  ? 208  ASP A CA  1 
ATOM   1416 C  C   . ASP A 1 179 ? 44.752  92.912  141.137 1.00 19.90  ? 208  ASP A C   1 
ATOM   1417 O  O   . ASP A 1 179 ? 45.864  93.438  140.890 1.00 20.11  ? 208  ASP A O   1 
ATOM   1418 C  CB  . ASP A 1 179 ? 44.926  92.567  143.581 1.00 8.86   ? 208  ASP A CB  1 
ATOM   1419 C  CG  . ASP A 1 179 ? 43.794  93.534  143.883 1.00 24.11  ? 208  ASP A CG  1 
ATOM   1420 O  OD1 . ASP A 1 179 ? 43.187  94.076  142.932 1.00 27.56  ? 208  ASP A OD1 1 
ATOM   1421 O  OD2 . ASP A 1 179 ? 43.485  93.733  145.056 1.00 26.70  ? 208  ASP A OD2 1 
ATOM   1422 N  N   . ASP A 1 180 ? 43.623  93.209  140.469 1.00 17.50  ? 209  ASP A N   1 
ATOM   1423 C  CA  . ASP A 1 180 ? 43.701  94.161  139.385 1.00 18.94  ? 209  ASP A CA  1 
ATOM   1424 C  C   . ASP A 1 180 ? 43.829  95.599  139.868 1.00 21.94  ? 209  ASP A C   1 
ATOM   1425 O  O   . ASP A 1 180 ? 44.104  96.456  139.025 1.00 27.38  ? 209  ASP A O   1 
ATOM   1426 C  CB  . ASP A 1 180 ? 42.574  94.174  138.381 1.00 6.96   ? 209  ASP A CB  1 
ATOM   1427 C  CG  . ASP A 1 180 ? 43.067  94.422  136.979 1.00 11.20  ? 209  ASP A CG  1 
ATOM   1428 O  OD1 . ASP A 1 180 ? 44.261  94.754  136.763 1.00 32.70  ? 209  ASP A OD1 1 
ATOM   1429 O  OD2 . ASP A 1 180 ? 42.241  94.294  136.075 1.00 27.74  ? 209  ASP A OD2 1 
ATOM   1430 N  N   . ASP A 1 181 ? 43.569  95.885  141.131 1.00 19.00  ? 210  ASP A N   1 
ATOM   1431 C  CA  . ASP A 1 181 ? 43.751  97.262  141.550 1.00 13.29  ? 210  ASP A CA  1 
ATOM   1432 C  C   . ASP A 1 181 ? 45.202  97.509  141.862 1.00 17.54  ? 210  ASP A C   1 
ATOM   1433 O  O   . ASP A 1 181 ? 45.589  98.637  142.196 1.00 26.92  ? 210  ASP A O   1 
ATOM   1434 C  CB  . ASP A 1 181 ? 42.853  97.638  142.691 1.00 5.90   ? 210  ASP A CB  1 
ATOM   1435 C  CG  . ASP A 1 181 ? 41.399  97.543  142.270 1.00 16.53  ? 210  ASP A CG  1 
ATOM   1436 O  OD1 . ASP A 1 181 ? 41.152  97.746  141.070 1.00 19.17  ? 210  ASP A OD1 1 
ATOM   1437 O  OD2 . ASP A 1 181 ? 40.542  97.276  143.133 1.00 35.63  ? 210  ASP A OD2 1 
ATOM   1438 N  N   . GLU A 1 182 ? 46.117  96.593  141.611 1.00 16.47  ? 211  GLU A N   1 
ATOM   1439 C  CA  . GLU A 1 182 ? 47.507  96.991  141.861 1.00 17.39  ? 211  GLU A CA  1 
ATOM   1440 C  C   . GLU A 1 182 ? 48.095  97.518  140.574 1.00 18.14  ? 211  GLU A C   1 
ATOM   1441 O  O   . GLU A 1 182 ? 47.586  97.209  139.513 1.00 16.00  ? 211  GLU A O   1 
ATOM   1442 C  CB  . GLU A 1 182 ? 48.357  95.786  142.279 1.00 14.75  ? 211  GLU A CB  1 
ATOM   1443 C  CG  . GLU A 1 182 ? 47.939  95.196  143.585 1.00 2.59   ? 211  GLU A CG  1 
ATOM   1444 C  CD  . GLU A 1 182 ? 47.865  96.223  144.682 1.00 24.48  ? 211  GLU A CD  1 
ATOM   1445 O  OE1 . GLU A 1 182 ? 48.473  97.313  144.496 1.00 33.04  ? 211  GLU A OE1 1 
ATOM   1446 O  OE2 . GLU A 1 182 ? 47.189  95.908  145.689 1.00 26.04  ? 211  GLU A OE2 1 
ATOM   1447 N  N   . LEU A 1 183 ? 49.289  98.136  140.678 1.00 20.68  ? 212  LEU A N   1 
ATOM   1448 C  CA  . LEU A 1 183 ? 49.820  98.382  139.318 1.00 26.22  ? 212  LEU A CA  1 
ATOM   1449 C  C   . LEU A 1 183 ? 50.950  97.399  139.055 1.00 31.93  ? 212  LEU A C   1 
ATOM   1450 O  O   . LEU A 1 183 ? 51.940  97.494  139.785 1.00 31.20  ? 212  LEU A O   1 
ATOM   1451 C  CB  . LEU A 1 183 ? 50.216  99.818  139.256 1.00 32.77  ? 212  LEU A CB  1 
ATOM   1452 C  CG  . LEU A 1 183 ? 51.581  100.126 138.672 1.00 16.83  ? 212  LEU A CG  1 
ATOM   1453 C  CD1 . LEU A 1 183 ? 51.513  100.354 137.174 1.00 23.73  ? 212  LEU A CD1 1 
ATOM   1454 C  CD2 . LEU A 1 183 ? 52.128  101.347 139.352 1.00 12.87  ? 212  LEU A CD2 1 
ATOM   1455 N  N   . TRP A 1 184 ? 50.811  96.481  138.078 1.00 32.12  ? 213  TRP A N   1 
ATOM   1456 C  CA  . TRP A 1 184 ? 51.795  95.432  137.928 1.00 30.80  ? 213  TRP A CA  1 
ATOM   1457 C  C   . TRP A 1 184 ? 53.005  95.884  137.190 1.00 32.26  ? 213  TRP A C   1 
ATOM   1458 O  O   . TRP A 1 184 ? 52.952  95.981  135.973 1.00 37.40  ? 213  TRP A O   1 
ATOM   1459 C  CB  . TRP A 1 184 ? 51.160  94.162  137.317 1.00 32.00  ? 213  TRP A CB  1 
ATOM   1460 C  CG  . TRP A 1 184 ? 50.179  93.634  138.349 1.00 31.49  ? 213  TRP A CG  1 
ATOM   1461 C  CD1 . TRP A 1 184 ? 48.852  93.890  138.319 1.00 13.47  ? 213  TRP A CD1 1 
ATOM   1462 C  CD2 . TRP A 1 184 ? 50.420  92.859  139.535 1.00 22.57  ? 213  TRP A CD2 1 
ATOM   1463 N  NE1 . TRP A 1 184 ? 48.224  93.322  139.417 1.00 19.31  ? 213  TRP A NE1 1 
ATOM   1464 C  CE2 . TRP A 1 184 ? 49.173  92.685  140.170 1.00 26.75  ? 213  TRP A CE2 1 
ATOM   1465 C  CE3 . TRP A 1 184 ? 51.549  92.309  140.134 1.00 17.03  ? 213  TRP A CE3 1 
ATOM   1466 C  CZ2 . TRP A 1 184 ? 49.004  91.991  141.367 1.00 22.43  ? 213  TRP A CZ2 1 
ATOM   1467 C  CZ3 . TRP A 1 184 ? 51.382  91.607  141.305 1.00 33.22  ? 213  TRP A CZ3 1 
ATOM   1468 C  CH2 . TRP A 1 184 ? 50.125  91.456  141.910 1.00 29.60  ? 213  TRP A CH2 1 
ATOM   1469 N  N   . THR A 1 185 ? 54.057  96.181  137.918 1.00 32.39  ? 214  THR A N   1 
ATOM   1470 C  CA  . THR A 1 185 ? 55.306  96.600  137.247 1.00 32.16  ? 214  THR A CA  1 
ATOM   1471 C  C   . THR A 1 185 ? 56.254  95.424  137.251 1.00 32.69  ? 214  THR A C   1 
ATOM   1472 O  O   . THR A 1 185 ? 55.985  94.343  137.779 1.00 31.03  ? 214  THR A O   1 
ATOM   1473 C  CB  . THR A 1 185 ? 55.913  97.780  137.999 1.00 20.93  ? 214  THR A CB  1 
ATOM   1474 O  OG1 . THR A 1 185 ? 56.097  97.365  139.351 1.00 36.63  ? 214  THR A OG1 1 
ATOM   1475 C  CG2 . THR A 1 185 ? 54.944  98.971  138.027 1.00 43.95  ? 214  THR A CG2 1 
ATOM   1476 N  N   . LEU A 1 186 ? 57.461  95.581  136.727 1.00 34.61  ? 215  LEU A N   1 
ATOM   1477 C  CA  . LEU A 1 186 ? 58.396  94.453  136.777 1.00 32.07  ? 215  LEU A CA  1 
ATOM   1478 C  C   . LEU A 1 186 ? 59.072  94.443  138.143 1.00 31.91  ? 215  LEU A C   1 
ATOM   1479 O  O   . LEU A 1 186 ? 60.056  93.758  138.304 1.00 28.43  ? 215  LEU A O   1 
ATOM   1480 C  CB  . LEU A 1 186 ? 59.502  94.603  135.749 1.00 34.00  ? 215  LEU A CB  1 
ATOM   1481 C  CG  . LEU A 1 186 ? 59.286  93.791  134.469 1.00 29.96  ? 215  LEU A CG  1 
ATOM   1482 C  CD1 . LEU A 1 186 ? 60.640  93.423  133.890 1.00 37.60  ? 215  LEU A CD1 1 
ATOM   1483 C  CD2 . LEU A 1 186 ? 58.440  92.586  134.813 1.00 22.33  ? 215  LEU A CD2 1 
ATOM   1484 N  N   . GLY A 1 187 ? 58.576  95.289  139.031 1.00 33.02  ? 216  GLY A N   1 
ATOM   1485 C  CA  . GLY A 1 187 ? 59.048  95.327  140.409 1.00 32.49  ? 216  GLY A CA  1 
ATOM   1486 C  C   . GLY A 1 187 ? 59.693  96.687  140.646 1.00 33.75  ? 216  GLY A C   1 
ATOM   1487 O  O   . GLY A 1 187 ? 59.728  97.251  141.729 1.00 31.52  ? 216  GLY A O   1 
ATOM   1488 N  N   . GLU A 1 188 ? 60.206  97.282  139.560 1.00 34.86  ? 217  GLU A N   1 
ATOM   1489 C  CA  . GLU A 1 188 ? 61.018  98.475  139.758 1.00 38.64  ? 217  GLU A CA  1 
ATOM   1490 C  C   . GLU A 1 188 ? 60.380  99.709  139.158 1.00 39.28  ? 217  GLU A C   1 
ATOM   1491 O  O   . GLU A 1 188 ? 60.968  100.791 138.922 1.00 40.10  ? 217  GLU A O   1 
ATOM   1492 C  CB  . GLU A 1 188 ? 62.480  98.359  139.348 1.00 38.22  ? 217  GLU A CB  1 
ATOM   1493 C  CG  . GLU A 1 188 ? 63.071  97.014  139.037 1.00 42.74  ? 217  GLU A CG  1 
ATOM   1494 C  CD  . GLU A 1 188 ? 64.589  97.029  139.133 1.00 48.65  ? 217  GLU A CD  1 
ATOM   1495 O  OE1 . GLU A 1 188 ? 65.059  97.987  139.774 1.00 38.73  ? 217  GLU A OE1 1 
ATOM   1496 O  OE2 . GLU A 1 188 ? 65.241  96.116  138.588 1.00 58.89  ? 217  GLU A OE2 1 
ATOM   1497 N  N   . GLY A 1 189 ? 59.043  99.734  139.057 1.00 35.42  ? 218  GLY A N   1 
ATOM   1498 C  CA  . GLY A 1 189 ? 58.516  101.019 138.550 1.00 29.93  ? 218  GLY A CA  1 
ATOM   1499 C  C   . GLY A 1 189 ? 57.623  100.848 137.370 1.00 27.80  ? 218  GLY A C   1 
ATOM   1500 O  O   . GLY A 1 189 ? 57.452  99.788  136.757 1.00 31.38  ? 218  GLY A O   1 
ATOM   1501 N  N   . GLN A 1 190 ? 56.864  101.868 136.932 1.00 24.70  ? 219  GLN A N   1 
ATOM   1502 C  CA  . GLN A 1 190 ? 55.935  101.458 135.867 1.00 19.86  ? 219  GLN A CA  1 
ATOM   1503 C  C   . GLN A 1 190 ? 56.672  100.903 134.657 1.00 19.24  ? 219  GLN A C   1 
ATOM   1504 O  O   . GLN A 1 190 ? 57.642  101.497 134.226 1.00 21.16  ? 219  GLN A O   1 
ATOM   1505 C  CB  . GLN A 1 190 ? 55.006  102.576 135.513 1.00 22.22  ? 219  GLN A CB  1 
ATOM   1506 C  CG  . GLN A 1 190 ? 54.448  102.569 134.108 1.00 22.43  ? 219  GLN A CG  1 
ATOM   1507 C  CD  . GLN A 1 190 ? 53.220  103.455 133.968 1.00 31.11  ? 219  GLN A CD  1 
ATOM   1508 O  OE1 . GLN A 1 190 ? 53.141  104.587 134.460 1.00 26.73  ? 219  GLN A OE1 1 
ATOM   1509 N  NE2 . GLN A 1 190 ? 52.214  102.918 133.276 1.00 18.15  ? 219  GLN A NE2 1 
ATOM   1510 N  N   . VAL A 1 191 ? 56.200  99.804  134.074 1.00 19.98  ? 220  VAL A N   1 
ATOM   1511 C  CA  . VAL A 1 191 ? 56.741  99.248  132.883 1.00 18.58  ? 220  VAL A CA  1 
ATOM   1512 C  C   . VAL A 1 191 ? 55.800  99.538  131.693 1.00 18.44  ? 220  VAL A C   1 
ATOM   1513 O  O   . VAL A 1 191 ? 54.689  99.009  131.591 1.00 25.73  ? 220  VAL A O   1 
ATOM   1514 C  CB  . VAL A 1 191 ? 56.976  97.709  132.862 1.00 10.57  ? 220  VAL A CB  1 
ATOM   1515 C  CG1 . VAL A 1 191 ? 57.476  97.286  131.349 1.00 2.00   ? 220  VAL A CG1 1 
ATOM   1516 C  CG2 . VAL A 1 191 ? 58.071  97.299  133.844 1.00 15.69  ? 220  VAL A CG2 1 
ATOM   1517 N  N   . VAL A 1 192 ? 56.264  100.292 130.742 1.00 13.63  ? 221  VAL A N   1 
ATOM   1518 C  CA  . VAL A 1 192 ? 55.542  100.577 129.548 1.00 11.74  ? 221  VAL A CA  1 
ATOM   1519 C  C   . VAL A 1 192 ? 56.311  100.155 128.308 1.00 14.84  ? 221  VAL A C   1 
ATOM   1520 O  O   . VAL A 1 192 ? 57.524  100.247 128.171 1.00 19.95  ? 221  VAL A O   1 
ATOM   1521 C  CB  . VAL A 1 192 ? 55.323  102.109 129.402 1.00 8.05   ? 221  VAL A CB  1 
ATOM   1522 C  CG1 . VAL A 1 192 ? 54.517  102.391 128.152 1.00 6.70   ? 221  VAL A CG1 1 
ATOM   1523 C  CG2 . VAL A 1 192 ? 54.596  102.686 130.596 1.00 5.11   ? 221  VAL A CG2 1 
ATOM   1524 N  N   . ARG A 1 193 ? 55.568  99.632  127.339 1.00 15.38  ? 222  ARG A N   1 
ATOM   1525 C  CA  . ARG A 1 193 ? 56.294  99.133  126.161 1.00 13.98  ? 222  ARG A CA  1 
ATOM   1526 C  C   . ARG A 1 193 ? 55.908  100.041 125.016 1.00 14.97  ? 222  ARG A C   1 
ATOM   1527 O  O   . ARG A 1 193 ? 54.751  100.099 124.639 1.00 17.54  ? 222  ARG A O   1 
ATOM   1528 C  CB  . ARG A 1 193 ? 55.920  97.712  125.830 1.00 17.57  ? 222  ARG A CB  1 
ATOM   1529 C  CG  . ARG A 1 193 ? 56.652  97.173  124.601 1.00 7.33   ? 222  ARG A CG  1 
ATOM   1530 C  CD  . ARG A 1 193 ? 56.953  95.693  124.833 1.00 12.02  ? 222  ARG A CD  1 
ATOM   1531 N  NE  . ARG A 1 193 ? 57.674  95.148  123.675 1.00 31.54  ? 222  ARG A NE  1 
ATOM   1532 C  CZ  . ARG A 1 193 ? 57.448  93.930  123.186 1.00 43.01  ? 222  ARG A CZ  1 
ATOM   1533 N  NH1 . ARG A 1 193 ? 56.550  93.081  123.664 1.00 41.34  ? 222  ARG A NH1 1 
ATOM   1534 N  NH2 . ARG A 1 193 ? 58.158  93.559  122.138 1.00 47.56  ? 222  ARG A NH2 1 
ATOM   1535 N  N   . VAL A 1 194 ? 56.903  100.743 124.591 1.00 14.93  ? 223  VAL A N   1 
ATOM   1536 C  CA  . VAL A 1 194 ? 56.743  101.720 123.536 1.00 16.98  ? 223  VAL A CA  1 
ATOM   1537 C  C   . VAL A 1 194 ? 56.131  101.189 122.276 1.00 20.91  ? 223  VAL A C   1 
ATOM   1538 O  O   . VAL A 1 194 ? 56.288  100.060 121.823 1.00 22.54  ? 223  VAL A O   1 
ATOM   1539 C  CB  . VAL A 1 194 ? 58.161  102.291 123.331 1.00 20.49  ? 223  VAL A CB  1 
ATOM   1540 C  CG1 . VAL A 1 194 ? 58.133  103.330 122.264 1.00 36.09  ? 223  VAL A CG1 1 
ATOM   1541 C  CG2 . VAL A 1 194 ? 58.566  102.952 124.661 1.00 25.43  ? 223  VAL A CG2 1 
ATOM   1542 N  N   . LYS A 1 195 ? 55.372  102.063 121.621 1.00 24.74  ? 224  LYS A N   1 
ATOM   1543 C  CA  . LYS A 1 195 ? 54.537  101.730 120.513 1.00 27.62  ? 224  LYS A CA  1 
ATOM   1544 C  C   . LYS A 1 195 ? 55.110  102.007 119.170 1.00 30.19  ? 224  LYS A C   1 
ATOM   1545 O  O   . LYS A 1 195 ? 54.843  101.172 118.282 1.00 39.50  ? 224  LYS A O   1 
ATOM   1546 C  CB  . LYS A 1 195 ? 53.141  102.382 120.637 1.00 46.59  ? 224  LYS A CB  1 
ATOM   1547 C  CG  . LYS A 1 195 ? 52.016  101.354 120.552 1.00 40.70  ? 224  LYS A CG  1 
ATOM   1548 C  CD  . LYS A 1 195 ? 52.496  100.256 119.589 1.00 25.27  ? 224  LYS A CD  1 
ATOM   1549 C  CE  . LYS A 1 195 ? 53.245  99.213  120.374 1.00 16.88  ? 224  LYS A CE  1 
ATOM   1550 N  NZ  . LYS A 1 195 ? 53.994  98.274  119.478 1.00 37.37  ? 224  LYS A NZ  1 
ATOM   1551 N  N   . TYR A 1 196 ? 55.715  103.123 118.817 1.00 26.53  ? 225  TYR A N   1 
ATOM   1552 C  CA  . TYR A 1 196 ? 56.210  103.178 117.420 1.00 31.18  ? 225  TYR A CA  1 
ATOM   1553 C  C   . TYR A 1 196 ? 57.482  103.998 117.423 1.00 38.49  ? 225  TYR A C   1 
ATOM   1554 O  O   . TYR A 1 196 ? 57.805  104.606 118.430 1.00 45.62  ? 225  TYR A O   1 
ATOM   1555 C  CB  . TYR A 1 196 ? 55.255  103.871 116.457 1.00 35.63  ? 225  TYR A CB  1 
ATOM   1556 C  CG  . TYR A 1 196 ? 54.020  103.072 116.099 1.00 39.75  ? 225  TYR A CG  1 
ATOM   1557 C  CD1 . TYR A 1 196 ? 54.136  101.958 115.278 1.00 36.58  ? 225  TYR A CD1 1 
ATOM   1558 C  CD2 . TYR A 1 196 ? 52.768  103.393 116.618 1.00 39.01  ? 225  TYR A CD2 1 
ATOM   1559 C  CE1 . TYR A 1 196 ? 53.027  101.215 114.975 1.00 34.87  ? 225  TYR A CE1 1 
ATOM   1560 C  CE2 . TYR A 1 196 ? 51.661  102.637 116.311 1.00 40.27  ? 225  TYR A CE2 1 
ATOM   1561 C  CZ  . TYR A 1 196 ? 51.796  101.541 115.483 1.00 38.94  ? 225  TYR A CZ  1 
ATOM   1562 O  OH  . TYR A 1 196 ? 50.654  100.810 115.193 1.00 39.91  ? 225  TYR A OH  1 
ATOM   1563 N  N   . GLY A 1 197 ? 58.100  104.236 116.281 1.00 40.99  ? 226  GLY A N   1 
ATOM   1564 C  CA  . GLY A 1 197 ? 59.298  105.081 116.249 1.00 38.22  ? 226  GLY A CA  1 
ATOM   1565 C  C   . GLY A 1 197 ? 60.534  104.200 116.373 1.00 43.83  ? 226  GLY A C   1 
ATOM   1566 O  O   . GLY A 1 197 ? 60.486  102.937 116.350 1.00 49.46  ? 226  GLY A O   1 
ATOM   1567 N  N   . ASN A 1 198 ? 61.646  104.899 116.644 1.00 38.65  ? 227  ASN A N   1 
ATOM   1568 C  CA  . ASN A 1 198 ? 62.916  104.186 116.702 1.00 36.96  ? 227  ASN A CA  1 
ATOM   1569 C  C   . ASN A 1 198 ? 63.160  103.388 117.949 1.00 35.14  ? 227  ASN A C   1 
ATOM   1570 O  O   . ASN A 1 198 ? 64.252  102.832 118.117 1.00 41.43  ? 227  ASN A O   1 
ATOM   1571 C  CB  . ASN A 1 198 ? 64.033  105.213 116.475 1.00 41.17  ? 227  ASN A CB  1 
ATOM   1572 C  CG  . ASN A 1 198 ? 63.938  106.292 117.528 1.00 41.65  ? 227  ASN A CG  1 
ATOM   1573 O  OD1 . ASN A 1 198 ? 63.020  106.224 118.346 1.00 52.59  ? 227  ASN A OD1 1 
ATOM   1574 N  ND2 . ASN A 1 198 ? 64.852  107.229 117.516 1.00 40.71  ? 227  ASN A ND2 1 
ATOM   1575 N  N   . ALA A 1 199 ? 62.199  103.212 118.789 1.00 32.71  ? 228  ALA A N   1 
ATOM   1576 C  CA  . ALA A 1 199 ? 62.286  102.434 120.010 1.00 31.68  ? 228  ALA A CA  1 
ATOM   1577 C  C   . ALA A 1 199 ? 61.048  101.551 120.105 1.00 32.93  ? 228  ALA A C   1 
ATOM   1578 O  O   . ALA A 1 199 ? 60.640  101.196 121.205 1.00 36.81  ? 228  ALA A O   1 
ATOM   1579 C  CB  . ALA A 1 199 ? 62.451  103.431 121.149 1.00 29.96  ? 228  ALA A CB  1 
ATOM   1580 N  N   . ASP A 1 200 ? 60.460  101.181 118.976 1.00 30.89  ? 229  ASP A N   1 
ATOM   1581 C  CA  . ASP A 1 200 ? 59.224  100.402 119.015 1.00 36.80  ? 229  ASP A CA  1 
ATOM   1582 C  C   . ASP A 1 200 ? 59.220  99.229  119.963 1.00 36.78  ? 229  ASP A C   1 
ATOM   1583 O  O   . ASP A 1 200 ? 58.320  98.939  120.794 1.00 43.71  ? 229  ASP A O   1 
ATOM   1584 C  CB  . ASP A 1 200 ? 58.954  99.954  117.573 1.00 36.82  ? 229  ASP A CB  1 
ATOM   1585 C  CG  . ASP A 1 200 ? 57.691  99.108  117.561 1.00 42.60  ? 229  ASP A CG  1 
ATOM   1586 O  OD1 . ASP A 1 200 ? 57.727  97.889  117.750 1.00 49.49  ? 229  ASP A OD1 1 
ATOM   1587 O  OD2 . ASP A 1 200 ? 56.641  99.757  117.384 1.00 40.62  ? 229  ASP A OD2 1 
ATOM   1588 N  N   . GLY A 1 201 ? 60.258  98.429  120.064 1.00 29.71  ? 230  GLY A N   1 
ATOM   1589 C  CA  . GLY A 1 201 ? 60.168  97.366  121.049 1.00 33.24  ? 230  GLY A CA  1 
ATOM   1590 C  C   . GLY A 1 201 ? 60.409  97.641  122.499 1.00 37.06  ? 230  GLY A C   1 
ATOM   1591 O  O   . GLY A 1 201 ? 60.070  96.814  123.380 1.00 37.24  ? 230  GLY A O   1 
ATOM   1592 N  N   . GLU A 1 202 ? 61.151  98.701  122.865 1.00 38.07  ? 231  GLU A N   1 
ATOM   1593 C  CA  . GLU A 1 202 ? 61.653  98.903  124.197 1.00 36.80  ? 231  GLU A CA  1 
ATOM   1594 C  C   . GLU A 1 202 ? 60.655  99.490  125.180 1.00 34.97  ? 231  GLU A C   1 
ATOM   1595 O  O   . GLU A 1 202 ? 59.638  100.062 124.818 1.00 37.36  ? 231  GLU A O   1 
ATOM   1596 C  CB  . GLU A 1 202 ? 62.910  99.771  124.285 1.00 49.66  ? 231  GLU A CB  1 
ATOM   1597 C  CG  . GLU A 1 202 ? 64.167  99.103  123.751 1.00 58.55  ? 231  GLU A CG  1 
ATOM   1598 C  CD  . GLU A 1 202 ? 64.297  99.359  122.257 1.00 68.31  ? 231  GLU A CD  1 
ATOM   1599 O  OE1 . GLU A 1 202 ? 63.509  100.186 121.743 1.00 73.28  ? 231  GLU A OE1 1 
ATOM   1600 O  OE2 . GLU A 1 202 ? 65.155  98.748  121.595 1.00 77.19  ? 231  GLU A OE2 1 
ATOM   1601 N  N   . TYR A 1 203 ? 61.094  99.451  126.426 1.00 29.59  ? 232  TYR A N   1 
ATOM   1602 C  CA  . TYR A 1 203 ? 60.276  99.946  127.527 1.00 25.07  ? 232  TYR A CA  1 
ATOM   1603 C  C   . TYR A 1 203 ? 60.525  101.398 127.799 1.00 26.13  ? 232  TYR A C   1 
ATOM   1604 O  O   . TYR A 1 203 ? 61.623  101.906 127.537 1.00 29.06  ? 232  TYR A O   1 
ATOM   1605 C  CB  . TYR A 1 203 ? 60.587  99.062  128.713 1.00 23.67  ? 232  TYR A CB  1 
ATOM   1606 C  CG  . TYR A 1 203 ? 60.004  97.674  128.662 1.00 30.17  ? 232  TYR A CG  1 
ATOM   1607 C  CD1 . TYR A 1 203 ? 58.701  97.386  128.237 1.00 29.72  ? 232  TYR A CD1 1 
ATOM   1608 C  CD2 . TYR A 1 203 ? 60.765  96.602  129.134 1.00 32.11  ? 232  TYR A CD2 1 
ATOM   1609 C  CE1 . TYR A 1 203 ? 58.235  96.088  128.272 1.00 32.21  ? 232  TYR A CE1 1 
ATOM   1610 C  CE2 . TYR A 1 203 ? 60.304  95.298  129.174 1.00 28.92  ? 232  TYR A CE2 1 
ATOM   1611 C  CZ  . TYR A 1 203 ? 59.028  95.048  128.735 1.00 31.55  ? 232  TYR A CZ  1 
ATOM   1612 O  OH  . TYR A 1 203 ? 58.520  93.772  128.742 1.00 33.06  ? 232  TYR A OH  1 
ATOM   1613 N  N   . CYS A 1 204 ? 59.548  102.173 128.320 1.00 27.48  ? 233  CYS A N   1 
ATOM   1614 C  CA  . CYS A 1 204 ? 59.972  103.600 128.517 1.00 23.51  ? 233  CYS A CA  1 
ATOM   1615 C  C   . CYS A 1 204 ? 61.086  103.567 129.568 1.00 21.01  ? 233  CYS A C   1 
ATOM   1616 O  O   . CYS A 1 204 ? 61.214  102.592 130.319 1.00 20.05  ? 233  CYS A O   1 
ATOM   1617 C  CB  . CYS A 1 204 ? 58.890  104.546 128.909 1.00 5.69   ? 233  CYS A CB  1 
ATOM   1618 S  SG  . CYS A 1 204 ? 57.288  104.499 128.203 1.00 36.71  ? 233  CYS A SG  1 
ATOM   1619 N  N   . LYS A 1 205 ? 61.908  104.602 129.687 1.00 18.41  ? 234  LYS A N   1 
ATOM   1620 C  CA  . LYS A 1 205 ? 62.898  104.571 130.772 1.00 18.20  ? 234  LYS A CA  1 
ATOM   1621 C  C   . LYS A 1 205 ? 62.560  105.617 131.808 1.00 22.13  ? 234  LYS A C   1 
ATOM   1622 O  O   . LYS A 1 205 ? 62.786  106.813 131.545 1.00 28.47  ? 234  LYS A O   1 
ATOM   1623 C  CB  . LYS A 1 205 ? 64.278  104.851 130.224 1.00 24.71  ? 234  LYS A CB  1 
ATOM   1624 C  CG  . LYS A 1 205 ? 65.453  104.722 131.139 1.00 18.40  ? 234  LYS A CG  1 
ATOM   1625 C  CD  . LYS A 1 205 ? 65.338  103.683 132.181 1.00 24.37  ? 234  LYS A CD  1 
ATOM   1626 C  CE  . LYS A 1 205 ? 66.552  102.802 132.370 1.00 33.94  ? 234  LYS A CE  1 
ATOM   1627 N  NZ  . LYS A 1 205 ? 66.682  102.503 133.852 1.00 50.30  ? 234  LYS A NZ  1 
ATOM   1628 N  N   . PHE A 1 206 ? 61.964  105.216 132.930 1.00 17.98  ? 235  PHE A N   1 
ATOM   1629 C  CA  . PHE A 1 206 ? 61.564  106.252 133.864 1.00 15.23  ? 235  PHE A CA  1 
ATOM   1630 C  C   . PHE A 1 206 ? 62.516  106.334 135.035 1.00 18.20  ? 235  PHE A C   1 
ATOM   1631 O  O   . PHE A 1 206 ? 62.701  105.309 135.673 1.00 20.68  ? 235  PHE A O   1 
ATOM   1632 C  CB  . PHE A 1 206 ? 60.142  106.132 134.354 1.00 15.16  ? 235  PHE A CB  1 
ATOM   1633 C  CG  . PHE A 1 206 ? 59.033  106.050 133.372 1.00 10.73  ? 235  PHE A CG  1 
ATOM   1634 C  CD1 . PHE A 1 206 ? 58.700  107.116 132.570 1.00 10.78  ? 235  PHE A CD1 1 
ATOM   1635 C  CD2 . PHE A 1 206 ? 58.284  104.869 133.248 1.00 12.37  ? 235  PHE A CD2 1 
ATOM   1636 C  CE1 . PHE A 1 206 ? 57.669  107.042 131.663 1.00 9.27   ? 235  PHE A CE1 1 
ATOM   1637 C  CE2 . PHE A 1 206 ? 57.263  104.790 132.325 1.00 26.44  ? 235  PHE A CE2 1 
ATOM   1638 C  CZ  . PHE A 1 206 ? 56.928  105.886 131.537 1.00 23.04  ? 235  PHE A CZ  1 
ATOM   1639 N  N   . PRO A 1 207 ? 62.978  107.508 135.411 1.00 17.09  ? 236  PRO A N   1 
ATOM   1640 C  CA  . PRO A 1 207 ? 62.731  108.781 134.807 1.00 15.65  ? 236  PRO A CA  1 
ATOM   1641 C  C   . PRO A 1 207 ? 63.538  109.030 133.557 1.00 14.45  ? 236  PRO A C   1 
ATOM   1642 O  O   . PRO A 1 207 ? 64.615  108.472 133.518 1.00 16.62  ? 236  PRO A O   1 
ATOM   1643 C  CB  . PRO A 1 207 ? 63.251  109.770 135.863 1.00 17.15  ? 236  PRO A CB  1 
ATOM   1644 C  CG  . PRO A 1 207 ? 64.445  109.036 136.365 1.00 16.18  ? 236  PRO A CG  1 
ATOM   1645 C  CD  . PRO A 1 207 ? 63.833  107.667 136.597 1.00 17.01  ? 236  PRO A CD  1 
ATOM   1646 N  N   . PHE A 1 208 ? 63.119  109.953 132.711 1.00 16.85  ? 237  PHE A N   1 
ATOM   1647 C  CA  . PHE A 1 208 ? 63.949  110.385 131.569 1.00 18.04  ? 237  PHE A CA  1 
ATOM   1648 C  C   . PHE A 1 208 ? 63.992  111.903 131.506 1.00 17.01  ? 237  PHE A C   1 
ATOM   1649 O  O   . PHE A 1 208 ? 63.134  112.589 132.065 1.00 21.71  ? 237  PHE A O   1 
ATOM   1650 C  CB  . PHE A 1 208 ? 63.458  109.792 130.284 1.00 17.63  ? 237  PHE A CB  1 
ATOM   1651 C  CG  . PHE A 1 208 ? 62.148  110.343 129.792 1.00 14.95  ? 237  PHE A CG  1 
ATOM   1652 C  CD1 . PHE A 1 208 ? 62.087  111.586 129.197 1.00 11.52  ? 237  PHE A CD1 1 
ATOM   1653 C  CD2 . PHE A 1 208 ? 60.985  109.598 129.919 1.00 10.17  ? 237  PHE A CD2 1 
ATOM   1654 C  CE1 . PHE A 1 208 ? 60.882  112.082 128.715 1.00 9.20   ? 237  PHE A CE1 1 
ATOM   1655 C  CE2 . PHE A 1 208 ? 59.766  110.094 129.451 1.00 9.09   ? 237  PHE A CE2 1 
ATOM   1656 C  CZ  . PHE A 1 208 ? 59.726  111.334 128.851 1.00 13.86  ? 237  PHE A CZ  1 
ATOM   1657 N  N   . LEU A 1 209 ? 65.082  112.506 131.059 1.00 16.38  ? 238  LEU A N   1 
ATOM   1658 C  CA  . LEU A 1 209 ? 65.166  113.981 131.173 1.00 11.88  ? 238  LEU A CA  1 
ATOM   1659 C  C   . LEU A 1 209 ? 64.946  114.635 129.823 1.00 13.74  ? 238  LEU A C   1 
ATOM   1660 O  O   . LEU A 1 209 ? 65.614  114.316 128.846 1.00 10.81  ? 238  LEU A O   1 
ATOM   1661 C  CB  . LEU A 1 209 ? 66.507  114.365 131.719 1.00 9.15   ? 238  LEU A CB  1 
ATOM   1662 C  CG  . LEU A 1 209 ? 67.072  115.756 131.650 1.00 16.58  ? 238  LEU A CG  1 
ATOM   1663 C  CD1 . LEU A 1 209 ? 66.624  116.679 132.795 1.00 9.97   ? 238  LEU A CD1 1 
ATOM   1664 C  CD2 . LEU A 1 209 ? 68.593  115.615 131.674 1.00 3.68   ? 238  LEU A CD2 1 
ATOM   1665 N  N   . PHE A 1 210 ? 63.922  115.500 129.823 1.00 14.35  ? 239  PHE A N   1 
ATOM   1666 C  CA  . PHE A 1 210 ? 63.567  116.269 128.654 1.00 11.28  ? 239  PHE A CA  1 
ATOM   1667 C  C   . PHE A 1 210 ? 63.383  117.753 129.018 1.00 17.28  ? 239  PHE A C   1 
ATOM   1668 O  O   . PHE A 1 210 ? 62.565  118.143 129.865 1.00 16.77  ? 239  PHE A O   1 
ATOM   1669 C  CB  . PHE A 1 210 ? 62.256  115.746 128.119 1.00 15.72  ? 239  PHE A CB  1 
ATOM   1670 C  CG  . PHE A 1 210 ? 61.741  116.586 126.980 1.00 25.45  ? 239  PHE A CG  1 
ATOM   1671 C  CD1 . PHE A 1 210 ? 62.258  116.433 125.724 1.00 12.94  ? 239  PHE A CD1 1 
ATOM   1672 C  CD2 . PHE A 1 210 ? 60.740  117.515 127.199 1.00 29.94  ? 239  PHE A CD2 1 
ATOM   1673 C  CE1 . PHE A 1 210 ? 61.771  117.189 124.685 1.00 15.78  ? 239  PHE A CE1 1 
ATOM   1674 C  CE2 . PHE A 1 210 ? 60.236  118.232 126.146 1.00 26.43  ? 239  PHE A CE2 1 
ATOM   1675 C  CZ  . PHE A 1 210 ? 60.774  118.096 124.876 1.00 16.61  ? 239  PHE A CZ  1 
ATOM   1676 N  N   . ASN A 1 211 ? 64.144  118.600 128.304 1.00 16.61  ? 240  ASN A N   1 
ATOM   1677 C  CA  . ASN A 1 211 ? 64.016  120.026 128.560 1.00 10.40  ? 240  ASN A CA  1 
ATOM   1678 C  C   . ASN A 1 211 ? 64.139  120.309 130.030 1.00 13.87  ? 240  ASN A C   1 
ATOM   1679 O  O   . ASN A 1 211 ? 63.361  121.180 130.493 1.00 18.94  ? 240  ASN A O   1 
ATOM   1680 C  CB  . ASN A 1 211 ? 62.654  120.525 128.150 1.00 14.29  ? 240  ASN A CB  1 
ATOM   1681 C  CG  . ASN A 1 211 ? 62.376  120.613 126.689 1.00 30.67  ? 240  ASN A CG  1 
ATOM   1682 O  OD1 . ASN A 1 211 ? 63.270  120.629 125.872 1.00 18.00  ? 240  ASN A OD1 1 
ATOM   1683 N  ND2 . ASN A 1 211 ? 61.112  120.653 126.233 1.00 37.56  ? 240  ASN A ND2 1 
ATOM   1684 N  N   . GLY A 1 212 ? 65.020  119.821 130.875 1.00 16.18  ? 241  GLY A N   1 
ATOM   1685 C  CA  . GLY A 1 212 ? 64.894  120.526 132.190 1.00 17.19  ? 241  GLY A CA  1 
ATOM   1686 C  C   . GLY A 1 212 ? 63.919  119.856 133.120 1.00 18.96  ? 241  GLY A C   1 
ATOM   1687 O  O   . GLY A 1 212 ? 64.035  120.238 134.308 1.00 17.93  ? 241  GLY A O   1 
ATOM   1688 N  N   . LYS A 1 213 ? 63.156  118.853 132.702 1.00 18.09  ? 242  LYS A N   1 
ATOM   1689 C  CA  . LYS A 1 213 ? 62.259  118.182 133.666 1.00 16.75  ? 242  LYS A CA  1 
ATOM   1690 C  C   . LYS A 1 213 ? 62.491  116.691 133.533 1.00 19.32  ? 242  LYS A C   1 
ATOM   1691 O  O   . LYS A 1 213 ? 62.705  116.152 132.421 1.00 23.49  ? 242  LYS A O   1 
ATOM   1692 C  CB  . LYS A 1 213 ? 60.845  118.622 133.397 1.00 20.35  ? 242  LYS A CB  1 
ATOM   1693 C  CG  . LYS A 1 213 ? 59.720  118.584 134.399 1.00 40.68  ? 242  LYS A CG  1 
ATOM   1694 C  CD  . LYS A 1 213 ? 58.387  118.376 133.702 1.00 51.54  ? 242  LYS A CD  1 
ATOM   1695 C  CE  . LYS A 1 213 ? 57.427  117.424 134.380 1.00 61.05  ? 242  LYS A CE  1 
ATOM   1696 N  NZ  . LYS A 1 213 ? 56.019  117.785 133.932 1.00 74.64  ? 242  LYS A NZ  1 
ATOM   1697 N  N   . GLU A 1 214 ? 62.500  115.973 134.653 1.00 16.12  ? 243  GLU A N   1 
ATOM   1698 C  CA  . GLU A 1 214 ? 62.534  114.502 134.473 1.00 17.43  ? 243  GLU A CA  1 
ATOM   1699 C  C   . GLU A 1 214 ? 61.052  114.018 134.448 1.00 17.88  ? 243  GLU A C   1 
ATOM   1700 O  O   . GLU A 1 214 ? 60.215  114.589 135.120 1.00 17.81  ? 243  GLU A O   1 
ATOM   1701 C  CB  . GLU A 1 214 ? 63.274  113.857 135.594 1.00 7.12   ? 243  GLU A CB  1 
ATOM   1702 C  CG  . GLU A 1 214 ? 64.767  113.847 135.630 1.00 14.62  ? 243  GLU A CG  1 
ATOM   1703 C  CD  . GLU A 1 214 ? 65.346  113.476 136.977 1.00 26.19  ? 243  GLU A CD  1 
ATOM   1704 O  OE1 . GLU A 1 214 ? 64.599  113.325 137.973 1.00 18.40  ? 243  GLU A OE1 1 
ATOM   1705 O  OE2 . GLU A 1 214 ? 66.589  113.317 137.048 1.00 42.75  ? 243  GLU A OE2 1 
ATOM   1706 N  N   . TYR A 1 215 ? 60.716  113.051 133.630 1.00 15.53  ? 244  TYR A N   1 
ATOM   1707 C  CA  . TYR A 1 215 ? 59.409  112.467 133.530 1.00 18.70  ? 244  TYR A CA  1 
ATOM   1708 C  C   . TYR A 1 215 ? 59.401  111.072 134.132 1.00 19.70  ? 244  TYR A C   1 
ATOM   1709 O  O   . TYR A 1 215 ? 60.390  110.339 134.122 1.00 16.40  ? 244  TYR A O   1 
ATOM   1710 C  CB  . TYR A 1 215 ? 58.921  112.447 132.064 1.00 20.89  ? 244  TYR A CB  1 
ATOM   1711 C  CG  . TYR A 1 215 ? 58.776  113.894 131.565 1.00 18.99  ? 244  TYR A CG  1 
ATOM   1712 C  CD1 . TYR A 1 215 ? 59.896  114.543 131.078 1.00 19.11  ? 244  TYR A CD1 1 
ATOM   1713 C  CD2 . TYR A 1 215 ? 57.580  114.586 131.609 1.00 16.66  ? 244  TYR A CD2 1 
ATOM   1714 C  CE1 . TYR A 1 215 ? 59.828  115.851 130.630 1.00 19.46  ? 244  TYR A CE1 1 
ATOM   1715 C  CE2 . TYR A 1 215 ? 57.506  115.907 131.189 1.00 16.69  ? 244  TYR A CE2 1 
ATOM   1716 C  CZ  . TYR A 1 215 ? 58.625  116.519 130.703 1.00 19.22  ? 244  TYR A CZ  1 
ATOM   1717 O  OH  . TYR A 1 215 ? 58.562  117.825 130.280 1.00 25.55  ? 244  TYR A OH  1 
ATOM   1718 N  N   . ASN A 1 216 ? 58.352  110.765 134.910 1.00 20.88  ? 245  ASN A N   1 
ATOM   1719 C  CA  . ASN A 1 216 ? 58.344  109.461 135.571 1.00 20.76  ? 245  ASN A CA  1 
ATOM   1720 C  C   . ASN A 1 216 ? 57.121  108.649 135.138 1.00 19.43  ? 245  ASN A C   1 
ATOM   1721 O  O   . ASN A 1 216 ? 56.753  107.695 135.792 1.00 18.52  ? 245  ASN A O   1 
ATOM   1722 C  CB  . ASN A 1 216 ? 58.376  109.609 137.083 1.00 20.21  ? 245  ASN A CB  1 
ATOM   1723 C  CG  . ASN A 1 216 ? 59.843  109.845 137.477 1.00 20.62  ? 245  ASN A CG  1 
ATOM   1724 O  OD1 . ASN A 1 216 ? 60.655  108.908 137.580 1.00 41.66  ? 245  ASN A OD1 1 
ATOM   1725 N  ND2 . ASN A 1 216 ? 60.119  111.116 137.674 1.00 26.65  ? 245  ASN A ND2 1 
ATOM   1726 N  N   . SER A 1 217 ? 56.606  109.115 134.028 1.00 16.59  ? 246  SER A N   1 
ATOM   1727 C  CA  . SER A 1 217 ? 55.492  108.587 133.314 1.00 15.23  ? 246  SER A CA  1 
ATOM   1728 C  C   . SER A 1 217 ? 55.494  109.221 131.915 1.00 18.16  ? 246  SER A C   1 
ATOM   1729 O  O   . SER A 1 217 ? 56.473  109.914 131.609 1.00 21.84  ? 246  SER A O   1 
ATOM   1730 C  CB  . SER A 1 217 ? 54.213  108.890 134.069 1.00 2.86   ? 246  SER A CB  1 
ATOM   1731 O  OG  . SER A 1 217 ? 53.706  110.156 133.715 1.00 19.34  ? 246  SER A OG  1 
ATOM   1732 N  N   . CYS A 1 218 ? 54.660  108.728 131.014 1.00 17.97  ? 247  CYS A N   1 
ATOM   1733 C  CA  . CYS A 1 218 ? 54.775  109.175 129.627 1.00 17.23  ? 247  CYS A CA  1 
ATOM   1734 C  C   . CYS A 1 218 ? 54.079  110.528 129.560 1.00 18.33  ? 247  CYS A C   1 
ATOM   1735 O  O   . CYS A 1 218 ? 53.323  110.790 130.490 1.00 20.68  ? 247  CYS A O   1 
ATOM   1736 C  CB  . CYS A 1 218 ? 54.224  108.169 128.670 1.00 4.15   ? 247  CYS A CB  1 
ATOM   1737 S  SG  . CYS A 1 218 ? 54.639  106.449 128.819 1.00 21.76  ? 247  CYS A SG  1 
ATOM   1738 N  N   . THR A 1 219 ? 54.468  111.389 128.636 1.00 17.75  ? 248  THR A N   1 
ATOM   1739 C  CA  . THR A 1 219 ? 54.000  112.747 128.546 1.00 14.63  ? 248  THR A CA  1 
ATOM   1740 C  C   . THR A 1 219 ? 53.734  113.143 127.097 1.00 18.18  ? 248  THR A C   1 
ATOM   1741 O  O   . THR A 1 219 ? 54.316  112.618 126.144 1.00 19.48  ? 248  THR A O   1 
ATOM   1742 C  CB  . THR A 1 219 ? 55.008  113.790 129.057 1.00 14.68  ? 248  THR A CB  1 
ATOM   1743 O  OG1 . THR A 1 219 ? 54.428  115.081 129.032 1.00 22.92  ? 248  THR A OG1 1 
ATOM   1744 C  CG2 . THR A 1 219 ? 56.241  113.837 128.128 1.00 24.11  ? 248  THR A CG2 1 
ATOM   1745 N  N   . ASP A 1 220 ? 52.841  114.135 127.009 1.00 16.55  ? 249  ASP A N   1 
ATOM   1746 C  CA  . ASP A 1 220 ? 52.626  114.740 125.697 1.00 16.54  ? 249  ASP A CA  1 
ATOM   1747 C  C   . ASP A 1 220 ? 53.318  116.103 125.705 1.00 19.15  ? 249  ASP A C   1 
ATOM   1748 O  O   . ASP A 1 220 ? 53.161  116.950 124.848 1.00 20.46  ? 249  ASP A O   1 
ATOM   1749 C  CB  . ASP A 1 220 ? 51.157  114.838 125.426 1.00 22.03  ? 249  ASP A CB  1 
ATOM   1750 C  CG  . ASP A 1 220 ? 50.514  116.064 126.045 1.00 26.72  ? 249  ASP A CG  1 
ATOM   1751 O  OD1 . ASP A 1 220 ? 50.689  116.266 127.257 1.00 30.53  ? 249  ASP A OD1 1 
ATOM   1752 O  OD2 . ASP A 1 220 ? 49.839  116.774 125.271 1.00 36.82  ? 249  ASP A OD2 1 
ATOM   1753 N  N   . THR A 1 221 ? 54.110  116.319 126.763 1.00 19.60  ? 250  THR A N   1 
ATOM   1754 C  CA  . THR A 1 221 ? 54.898  117.535 126.818 1.00 22.00  ? 250  THR A CA  1 
ATOM   1755 C  C   . THR A 1 221 ? 55.727  117.570 125.529 1.00 25.76  ? 250  THR A C   1 
ATOM   1756 O  O   . THR A 1 221 ? 56.068  116.483 125.040 1.00 25.17  ? 250  THR A O   1 
ATOM   1757 C  CB  . THR A 1 221 ? 55.830  117.530 128.040 1.00 16.32  ? 250  THR A CB  1 
ATOM   1758 O  OG1 . THR A 1 221 ? 55.118  118.077 129.161 1.00 31.04  ? 250  THR A OG1 1 
ATOM   1759 C  CG2 . THR A 1 221 ? 56.985  118.470 127.734 1.00 14.09  ? 250  THR A CG2 1 
ATOM   1760 N  N   . GLY A 1 222 ? 55.869  118.728 124.914 1.00 28.00  ? 251  GLY A N   1 
ATOM   1761 C  CA  . GLY A 1 222 ? 56.599  118.864 123.663 1.00 31.03  ? 251  GLY A CA  1 
ATOM   1762 C  C   . GLY A 1 222 ? 55.739  118.562 122.458 1.00 35.51  ? 251  GLY A C   1 
ATOM   1763 O  O   . GLY A 1 222 ? 55.963  119.034 121.347 1.00 38.16  ? 251  GLY A O   1 
ATOM   1764 N  N   . ARG A 1 223 ? 54.773  117.655 122.584 1.00 36.76  ? 252  ARG A N   1 
ATOM   1765 C  CA  . ARG A 1 223 ? 53.957  117.293 121.441 1.00 37.02  ? 252  ARG A CA  1 
ATOM   1766 C  C   . ARG A 1 223 ? 52.886  118.343 121.185 1.00 40.02  ? 252  ARG A C   1 
ATOM   1767 O  O   . ARG A 1 223 ? 52.402  119.014 122.094 1.00 40.54  ? 252  ARG A O   1 
ATOM   1768 C  CB  . ARG A 1 223 ? 53.222  115.979 121.750 1.00 29.95  ? 252  ARG A CB  1 
ATOM   1769 C  CG  . ARG A 1 223 ? 54.136  114.798 121.857 1.00 36.56  ? 252  ARG A CG  1 
ATOM   1770 C  CD  . ARG A 1 223 ? 54.888  114.523 120.576 1.00 27.79  ? 252  ARG A CD  1 
ATOM   1771 N  NE  . ARG A 1 223 ? 53.918  114.234 119.523 1.00 29.42  ? 252  ARG A NE  1 
ATOM   1772 C  CZ  . ARG A 1 223 ? 54.272  113.537 118.441 1.00 31.65  ? 252  ARG A CZ  1 
ATOM   1773 N  NH1 . ARG A 1 223 ? 55.535  113.108 118.357 1.00 9.94   ? 252  ARG A NH1 1 
ATOM   1774 N  NH2 . ARG A 1 223 ? 53.319  113.342 117.541 1.00 21.77  ? 252  ARG A NH2 1 
ATOM   1775 N  N   . SER A 1 224 ? 52.389  118.305 119.960 1.00 43.42  ? 253  SER A N   1 
ATOM   1776 C  CA  . SER A 1 224 ? 51.242  119.180 119.628 1.00 46.00  ? 253  SER A CA  1 
ATOM   1777 C  C   . SER A 1 224 ? 49.960  118.353 119.477 1.00 44.87  ? 253  SER A C   1 
ATOM   1778 O  O   . SER A 1 224 ? 48.883  118.887 119.758 1.00 47.13  ? 253  SER A O   1 
ATOM   1779 C  CB  . SER A 1 224 ? 51.604  119.860 118.286 1.00 48.46  ? 253  SER A CB  1 
ATOM   1780 O  OG  . SER A 1 224 ? 52.522  118.946 117.639 1.00 63.32  ? 253  SER A OG  1 
ATOM   1781 N  N   . ASP A 1 225 ? 50.062  117.090 119.054 1.00 39.88  ? 254  ASP A N   1 
ATOM   1782 C  CA  . ASP A 1 225 ? 48.958  116.241 118.715 1.00 37.24  ? 254  ASP A CA  1 
ATOM   1783 C  C   . ASP A 1 225 ? 48.375  115.409 119.833 1.00 35.75  ? 254  ASP A C   1 
ATOM   1784 O  O   . ASP A 1 225 ? 47.655  114.436 119.607 1.00 38.59  ? 254  ASP A O   1 
ATOM   1785 C  CB  . ASP A 1 225 ? 49.303  115.272 117.573 1.00 33.23  ? 254  ASP A CB  1 
ATOM   1786 C  CG  . ASP A 1 225 ? 50.682  114.681 117.732 1.00 30.18  ? 254  ASP A CG  1 
ATOM   1787 O  OD1 . ASP A 1 225 ? 51.202  114.687 118.851 1.00 19.53  ? 254  ASP A OD1 1 
ATOM   1788 O  OD2 . ASP A 1 225 ? 51.246  114.197 116.726 1.00 33.53  ? 254  ASP A OD2 1 
ATOM   1789 N  N   . GLY A 1 226 ? 48.728  115.725 121.058 1.00 33.47  ? 255  GLY A N   1 
ATOM   1790 C  CA  . GLY A 1 226 ? 48.158  115.056 122.197 1.00 27.63  ? 255  GLY A CA  1 
ATOM   1791 C  C   . GLY A 1 226 ? 48.707  113.660 122.389 1.00 24.41  ? 255  GLY A C   1 
ATOM   1792 O  O   . GLY A 1 226 ? 48.346  113.032 123.405 1.00 25.85  ? 255  GLY A O   1 
ATOM   1793 N  N   . PHE A 1 227 ? 49.590  113.194 121.524 1.00 20.89  ? 256  PHE A N   1 
ATOM   1794 C  CA  . PHE A 1 227 ? 50.063  111.815 121.736 1.00 23.09  ? 256  PHE A CA  1 
ATOM   1795 C  C   . PHE A 1 227 ? 50.988  111.695 122.931 1.00 22.68  ? 256  PHE A C   1 
ATOM   1796 O  O   . PHE A 1 227 ? 51.695  112.658 123.223 1.00 26.82  ? 256  PHE A O   1 
ATOM   1797 C  CB  . PHE A 1 227 ? 50.762  111.339 120.457 1.00 14.96  ? 256  PHE A CB  1 
ATOM   1798 C  CG  . PHE A 1 227 ? 49.729  110.888 119.447 1.00 18.35  ? 256  PHE A CG  1 
ATOM   1799 C  CD1 . PHE A 1 227 ? 49.242  109.598 119.470 1.00 21.10  ? 256  PHE A CD1 1 
ATOM   1800 C  CD2 . PHE A 1 227 ? 49.246  111.783 118.515 1.00 23.63  ? 256  PHE A CD2 1 
ATOM   1801 C  CE1 . PHE A 1 227 ? 48.298  109.183 118.552 1.00 9.41   ? 256  PHE A CE1 1 
ATOM   1802 C  CE2 . PHE A 1 227 ? 48.302  111.379 117.590 1.00 20.89  ? 256  PHE A CE2 1 
ATOM   1803 C  CZ  . PHE A 1 227 ? 47.854  110.078 117.618 1.00 10.77  ? 256  PHE A CZ  1 
ATOM   1804 N  N   . LEU A 1 228 ? 50.984  110.574 123.631 1.00 17.32  ? 257  LEU A N   1 
ATOM   1805 C  CA  . LEU A 1 228 ? 51.925  110.326 124.709 1.00 15.55  ? 257  LEU A CA  1 
ATOM   1806 C  C   . LEU A 1 228 ? 53.251  109.749 124.217 1.00 15.33  ? 257  LEU A C   1 
ATOM   1807 O  O   . LEU A 1 228 ? 53.277  109.052 123.207 1.00 12.02  ? 257  LEU A O   1 
ATOM   1808 C  CB  . LEU A 1 228 ? 51.266  109.249 125.584 1.00 23.65  ? 257  LEU A CB  1 
ATOM   1809 C  CG  . LEU A 1 228 ? 50.618  109.738 126.868 1.00 23.15  ? 257  LEU A CG  1 
ATOM   1810 C  CD1 . LEU A 1 228 ? 50.058  111.132 126.757 1.00 19.50  ? 257  LEU A CD1 1 
ATOM   1811 C  CD2 . LEU A 1 228 ? 49.576  108.768 127.368 1.00 12.05  ? 257  LEU A CD2 1 
ATOM   1812 N  N   . TRP A 1 229 ? 54.366  109.971 124.923 1.00 19.58  ? 258  TRP A N   1 
ATOM   1813 C  CA  . TRP A 1 229 ? 55.649  109.389 124.519 1.00 19.69  ? 258  TRP A CA  1 
ATOM   1814 C  C   . TRP A 1 229 ? 56.579  109.299 125.729 1.00 20.13  ? 258  TRP A C   1 
ATOM   1815 O  O   . TRP A 1 229 ? 56.188  109.845 126.748 1.00 18.11  ? 258  TRP A O   1 
ATOM   1816 C  CB  . TRP A 1 229 ? 56.353  110.161 123.420 1.00 5.48   ? 258  TRP A CB  1 
ATOM   1817 C  CG  . TRP A 1 229 ? 56.859  111.506 123.815 1.00 7.37   ? 258  TRP A CG  1 
ATOM   1818 C  CD1 . TRP A 1 229 ? 56.131  112.660 123.818 1.00 17.03  ? 258  TRP A CD1 1 
ATOM   1819 C  CD2 . TRP A 1 229 ? 58.180  111.892 124.217 1.00 2.09   ? 258  TRP A CD2 1 
ATOM   1820 N  NE1 . TRP A 1 229 ? 56.913  113.721 124.218 1.00 7.11   ? 258  TRP A NE1 1 
ATOM   1821 C  CE2 . TRP A 1 229 ? 58.174  113.268 124.478 1.00 4.80   ? 258  TRP A CE2 1 
ATOM   1822 C  CE3 . TRP A 1 229 ? 59.373  111.201 124.433 1.00 9.61   ? 258  TRP A CE3 1 
ATOM   1823 C  CZ2 . TRP A 1 229 ? 59.285  113.991 124.913 1.00 9.55   ? 258  TRP A CZ2 1 
ATOM   1824 C  CZ3 . TRP A 1 229 ? 60.463  111.916 124.852 1.00 12.87  ? 258  TRP A CZ3 1 
ATOM   1825 C  CH2 . TRP A 1 229 ? 60.430  113.278 125.086 1.00 7.72   ? 258  TRP A CH2 1 
ATOM   1826 N  N   . CYS A 1 230 ? 57.685  108.589 125.588 1.00 22.18  ? 259  CYS A N   1 
ATOM   1827 C  CA  . CYS A 1 230 ? 58.725  108.485 126.610 1.00 24.10  ? 259  CYS A CA  1 
ATOM   1828 C  C   . CYS A 1 230 ? 60.044  108.175 125.895 1.00 28.14  ? 259  CYS A C   1 
ATOM   1829 O  O   . CYS A 1 230 ? 59.924  107.638 124.785 1.00 32.30  ? 259  CYS A O   1 
ATOM   1830 C  CB  . CYS A 1 230 ? 58.438  107.250 127.493 1.00 16.46  ? 259  CYS A CB  1 
ATOM   1831 S  SG  . CYS A 1 230 ? 58.437  105.732 126.519 1.00 39.13  ? 259  CYS A SG  1 
ATOM   1832 N  N   . SER A 1 231 ? 61.216  108.315 126.506 1.00 26.88  ? 260  SER A N   1 
ATOM   1833 C  CA  . SER A 1 231 ? 62.385  107.779 125.800 1.00 26.95  ? 260  SER A CA  1 
ATOM   1834 C  C   . SER A 1 231 ? 62.809  106.452 126.418 1.00 27.46  ? 260  SER A C   1 
ATOM   1835 O  O   . SER A 1 231 ? 62.446  106.219 127.561 1.00 28.56  ? 260  SER A O   1 
ATOM   1836 C  CB  . SER A 1 231 ? 63.554  108.750 125.812 1.00 28.43  ? 260  SER A CB  1 
ATOM   1837 O  OG  . SER A 1 231 ? 64.047  108.992 127.084 1.00 20.48  ? 260  SER A OG  1 
ATOM   1838 N  N   . THR A 1 232 ? 63.602  105.649 125.738 1.00 30.14  ? 261  THR A N   1 
ATOM   1839 C  CA  . THR A 1 232 ? 64.232  104.424 126.146 1.00 28.51  ? 261  THR A CA  1 
ATOM   1840 C  C   . THR A 1 232 ? 65.336  104.633 127.183 1.00 29.13  ? 261  THR A C   1 
ATOM   1841 O  O   . THR A 1 232 ? 65.809  103.680 127.822 1.00 33.48  ? 261  THR A O   1 
ATOM   1842 C  CB  . THR A 1 232 ? 65.088  103.863 124.949 1.00 37.54  ? 261  THR A CB  1 
ATOM   1843 O  OG1 . THR A 1 232 ? 64.252  104.029 123.812 1.00 44.37  ? 261  THR A OG1 1 
ATOM   1844 C  CG2 . THR A 1 232 ? 65.485  102.415 125.204 1.00 46.99  ? 261  THR A CG2 1 
ATOM   1845 N  N   . THR A 1 233 ? 65.940  105.805 127.133 1.00 26.42  ? 262  THR A N   1 
ATOM   1846 C  CA  . THR A 1 233 ? 67.150  106.096 127.902 1.00 20.99  ? 262  THR A CA  1 
ATOM   1847 C  C   . THR A 1 233 ? 66.885  107.335 128.724 1.00 20.39  ? 262  THR A C   1 
ATOM   1848 O  O   . THR A 1 233 ? 65.995  108.096 128.323 1.00 23.81  ? 262  THR A O   1 
ATOM   1849 C  CB  . THR A 1 233 ? 68.285  106.451 126.909 1.00 17.40  ? 262  THR A CB  1 
ATOM   1850 O  OG1 . THR A 1 233 ? 68.045  107.746 126.301 1.00 19.63  ? 262  THR A OG1 1 
ATOM   1851 C  CG2 . THR A 1 233 ? 68.290  105.429 125.806 1.00 7.30   ? 262  THR A CG2 1 
ATOM   1852 N  N   . TYR A 1 234 ? 67.781  107.619 129.651 1.00 18.99  ? 263  TYR A N   1 
ATOM   1853 C  CA  . TYR A 1 234 ? 67.571  108.787 130.485 1.00 19.21  ? 263  TYR A CA  1 
ATOM   1854 C  C   . TYR A 1 234 ? 67.799  110.076 129.717 1.00 21.20  ? 263  TYR A C   1 
ATOM   1855 O  O   . TYR A 1 234 ? 67.093  111.071 129.898 1.00 21.16  ? 263  TYR A O   1 
ATOM   1856 C  CB  . TYR A 1 234 ? 68.459  108.774 131.701 1.00 14.35  ? 263  TYR A CB  1 
ATOM   1857 C  CG  . TYR A 1 234 ? 68.305  109.951 132.626 1.00 17.19  ? 263  TYR A CG  1 
ATOM   1858 C  CD1 . TYR A 1 234 ? 67.397  110.011 133.665 1.00 17.28  ? 263  TYR A CD1 1 
ATOM   1859 C  CD2 . TYR A 1 234 ? 69.115  111.074 132.417 1.00 19.42  ? 263  TYR A CD2 1 
ATOM   1860 C  CE1 . TYR A 1 234 ? 67.322  111.135 134.498 1.00 18.49  ? 263  TYR A CE1 1 
ATOM   1861 C  CE2 . TYR A 1 234 ? 69.035  112.199 133.225 1.00 17.36  ? 263  TYR A CE2 1 
ATOM   1862 C  CZ  . TYR A 1 234 ? 68.138  112.220 134.270 1.00 19.12  ? 263  TYR A CZ  1 
ATOM   1863 O  OH  . TYR A 1 234 ? 68.064  113.336 135.045 1.00 22.66  ? 263  TYR A OH  1 
ATOM   1864 N  N   . ASN A 1 235 ? 68.883  110.057 128.972 1.00 22.38  ? 264  ASN A N   1 
ATOM   1865 C  CA  . ASN A 1 235 ? 69.254  111.330 128.315 1.00 24.18  ? 264  ASN A CA  1 
ATOM   1866 C  C   . ASN A 1 235 ? 68.662  111.472 126.942 1.00 26.88  ? 264  ASN A C   1 
ATOM   1867 O  O   . ASN A 1 235 ? 69.194  111.060 125.910 1.00 30.06  ? 264  ASN A O   1 
ATOM   1868 C  CB  . ASN A 1 235 ? 70.775  111.378 128.292 1.00 23.45  ? 264  ASN A CB  1 
ATOM   1869 C  CG  . ASN A 1 235 ? 71.211  112.822 128.397 1.00 30.58  ? 264  ASN A CG  1 
ATOM   1870 O  OD1 . ASN A 1 235 ? 71.958  113.157 129.311 1.00 50.29  ? 264  ASN A OD1 1 
ATOM   1871 N  ND2 . ASN A 1 235 ? 70.723  113.620 127.472 1.00 22.17  ? 264  ASN A ND2 1 
ATOM   1872 N  N   . PHE A 1 236 ? 67.462  112.061 126.879 1.00 28.06  ? 265  PHE A N   1 
ATOM   1873 C  CA  . PHE A 1 236 ? 66.757  112.103 125.610 1.00 25.91  ? 265  PHE A CA  1 
ATOM   1874 C  C   . PHE A 1 236 ? 67.464  113.005 124.617 1.00 28.08  ? 265  PHE A C   1 
ATOM   1875 O  O   . PHE A 1 236 ? 67.495  112.660 123.446 1.00 30.42  ? 265  PHE A O   1 
ATOM   1876 C  CB  . PHE A 1 236 ? 65.329  112.611 125.788 1.00 11.97  ? 265  PHE A CB  1 
ATOM   1877 C  CG  . PHE A 1 236 ? 64.580  112.415 124.496 1.00 24.29  ? 265  PHE A CG  1 
ATOM   1878 C  CD1 . PHE A 1 236 ? 64.129  111.144 124.167 1.00 35.76  ? 265  PHE A CD1 1 
ATOM   1879 C  CD2 . PHE A 1 236 ? 64.357  113.460 123.638 1.00 8.79   ? 265  PHE A CD2 1 
ATOM   1880 C  CE1 . PHE A 1 236 ? 63.448  110.929 122.980 1.00 38.88  ? 265  PHE A CE1 1 
ATOM   1881 C  CE2 . PHE A 1 236 ? 63.687  113.261 122.448 1.00 20.66  ? 265  PHE A CE2 1 
ATOM   1882 C  CZ  . PHE A 1 236 ? 63.225  111.996 122.132 1.00 40.52  ? 265  PHE A CZ  1 
ATOM   1883 N  N   . GLU A 1 237 ? 67.955  114.120 125.128 1.00 28.16  ? 266  GLU A N   1 
ATOM   1884 C  CA  . GLU A 1 237 ? 68.687  115.085 124.331 1.00 30.22  ? 266  GLU A CA  1 
ATOM   1885 C  C   . GLU A 1 237 ? 69.864  114.434 123.608 1.00 31.88  ? 266  GLU A C   1 
ATOM   1886 O  O   . GLU A 1 237 ? 70.062  114.636 122.403 1.00 31.74  ? 266  GLU A O   1 
ATOM   1887 C  CB  . GLU A 1 237 ? 69.214  116.131 125.293 1.00 48.94  ? 266  GLU A CB  1 
ATOM   1888 C  CG  . GLU A 1 237 ? 69.005  117.569 124.852 1.00 65.77  ? 266  GLU A CG  1 
ATOM   1889 C  CD  . GLU A 1 237 ? 69.690  118.468 125.890 1.00 72.33  ? 266  GLU A CD  1 
ATOM   1890 O  OE1 . GLU A 1 237 ? 69.038  118.661 126.939 1.00 82.13  ? 266  GLU A OE1 1 
ATOM   1891 O  OE2 . GLU A 1 237 ? 70.824  118.895 125.622 1.00 71.60  ? 266  GLU A OE2 1 
ATOM   1892 N  N   . LYS A 1 238 ? 70.621  113.612 124.337 1.00 32.09  ? 267  LYS A N   1 
ATOM   1893 C  CA  . LYS A 1 238 ? 71.801  112.983 123.721 1.00 33.22  ? 267  LYS A CA  1 
ATOM   1894 C  C   . LYS A 1 238 ? 71.450  111.715 122.965 1.00 33.44  ? 267  LYS A C   1 
ATOM   1895 O  O   . LYS A 1 238 ? 71.760  111.611 121.768 1.00 36.08  ? 267  LYS A O   1 
ATOM   1896 C  CB  . LYS A 1 238 ? 72.885  112.764 124.765 1.00 38.01  ? 267  LYS A CB  1 
ATOM   1897 C  CG  . LYS A 1 238 ? 73.612  111.443 124.739 1.00 56.02  ? 267  LYS A CG  1 
ATOM   1898 C  CD  . LYS A 1 238 ? 74.758  111.435 123.737 1.00 64.23  ? 267  LYS A CD  1 
ATOM   1899 C  CE  . LYS A 1 238 ? 76.090  111.795 124.401 1.00 57.32  ? 267  LYS A CE  1 
ATOM   1900 N  NZ  . LYS A 1 238 ? 76.477  113.197 124.052 1.00 59.50  ? 267  LYS A NZ  1 
ATOM   1901 N  N   . ASP A 1 239 ? 70.831  110.730 123.604 1.00 28.65  ? 268  ASP A N   1 
ATOM   1902 C  CA  . ASP A 1 239 ? 70.488  109.474 122.961 1.00 22.31  ? 268  ASP A CA  1 
ATOM   1903 C  C   . ASP A 1 239 ? 69.422  109.649 121.909 1.00 24.00  ? 268  ASP A C   1 
ATOM   1904 O  O   . ASP A 1 239 ? 69.540  109.007 120.860 1.00 23.05  ? 268  ASP A O   1 
ATOM   1905 C  CB  . ASP A 1 239 ? 70.055  108.478 124.041 1.00 16.56  ? 268  ASP A CB  1 
ATOM   1906 C  CG  . ASP A 1 239 ? 71.169  108.312 125.064 1.00 32.48  ? 268  ASP A CG  1 
ATOM   1907 O  OD1 . ASP A 1 239 ? 72.341  108.512 124.649 1.00 38.20  ? 268  ASP A OD1 1 
ATOM   1908 O  OD2 . ASP A 1 239 ? 70.915  108.007 126.254 1.00 30.13  ? 268  ASP A OD2 1 
ATOM   1909 N  N   . GLY A 1 240 ? 68.338  110.384 122.172 1.00 25.17  ? 269  GLY A N   1 
ATOM   1910 C  CA  . GLY A 1 240 ? 67.292  110.669 121.219 1.00 25.41  ? 269  GLY A CA  1 
ATOM   1911 C  C   . GLY A 1 240 ? 66.392  109.557 120.724 1.00 23.75  ? 269  GLY A C   1 
ATOM   1912 O  O   . GLY A 1 240 ? 65.721  109.663 119.672 1.00 23.54  ? 269  GLY A O   1 
ATOM   1913 N  N   . LYS A 1 241 ? 66.223  108.497 121.509 1.00 21.16  ? 270  LYS A N   1 
ATOM   1914 C  CA  . LYS A 1 241 ? 65.333  107.415 121.090 1.00 23.44  ? 270  LYS A CA  1 
ATOM   1915 C  C   . LYS A 1 241 ? 64.061  107.441 121.949 1.00 23.82  ? 270  LYS A C   1 
ATOM   1916 O  O   . LYS A 1 241 ? 64.127  107.475 123.182 1.00 23.73  ? 270  LYS A O   1 
ATOM   1917 C  CB  . LYS A 1 241 ? 66.003  106.054 121.279 1.00 36.16  ? 270  LYS A CB  1 
ATOM   1918 C  CG  . LYS A 1 241 ? 67.218  105.771 120.407 1.00 31.36  ? 270  LYS A CG  1 
ATOM   1919 C  CD  . LYS A 1 241 ? 68.451  105.555 121.288 1.00 41.45  ? 270  LYS A CD  1 
ATOM   1920 C  CE  . LYS A 1 241 ? 69.726  105.574 120.463 1.00 65.59  ? 270  LYS A CE  1 
ATOM   1921 N  NZ  . LYS A 1 241 ? 70.913  106.238 121.095 1.00 61.30  ? 270  LYS A NZ  1 
ATOM   1922 N  N   . TYR A 1 242 ? 62.941  107.337 121.248 1.00 18.78  ? 271  TYR A N   1 
ATOM   1923 C  CA  . TYR A 1 242 ? 61.663  107.353 121.910 1.00 16.34  ? 271  TYR A CA  1 
ATOM   1924 C  C   . TYR A 1 242 ? 60.700  106.441 121.153 1.00 22.49  ? 271  TYR A C   1 
ATOM   1925 O  O   . TYR A 1 242 ? 60.978  106.063 120.023 1.00 25.05  ? 271  TYR A O   1 
ATOM   1926 C  CB  . TYR A 1 242 ? 61.143  108.793 121.627 1.00 14.35  ? 271  TYR A CB  1 
ATOM   1927 C  CG  . TYR A 1 242 ? 60.783  108.989 120.168 1.00 7.85   ? 271  TYR A CG  1 
ATOM   1928 C  CD1 . TYR A 1 242 ? 61.752  109.064 119.201 1.00 7.13   ? 271  TYR A CD1 1 
ATOM   1929 C  CD2 . TYR A 1 242 ? 59.461  109.103 119.786 1.00 7.23   ? 271  TYR A CD2 1 
ATOM   1930 C  CE1 . TYR A 1 242 ? 61.431  109.256 117.866 1.00 11.10  ? 271  TYR A CE1 1 
ATOM   1931 C  CE2 . TYR A 1 242 ? 59.106  109.316 118.466 1.00 13.19  ? 271  TYR A CE2 1 
ATOM   1932 C  CZ  . TYR A 1 242 ? 60.103  109.391 117.506 1.00 18.67  ? 271  TYR A CZ  1 
ATOM   1933 O  OH  . TYR A 1 242 ? 59.773  109.576 116.170 1.00 23.57  ? 271  TYR A OH  1 
ATOM   1934 N  N   . GLY A 1 243 ? 59.488  106.327 121.654 1.00 26.07  ? 272  GLY A N   1 
ATOM   1935 C  CA  . GLY A 1 243 ? 58.340  105.806 120.981 1.00 25.41  ? 272  GLY A CA  1 
ATOM   1936 C  C   . GLY A 1 243 ? 57.054  106.340 121.608 1.00 25.55  ? 272  GLY A C   1 
ATOM   1937 O  O   . GLY A 1 243 ? 57.098  106.931 122.696 1.00 27.16  ? 272  GLY A O   1 
ATOM   1938 N  N   . PHE A 1 244 ? 55.918  106.012 121.006 1.00 25.90  ? 273  PHE A N   1 
ATOM   1939 C  CA  . PHE A 1 244 ? 54.654  106.496 121.590 1.00 25.79  ? 273  PHE A CA  1 
ATOM   1940 C  C   . PHE A 1 244 ? 54.141  105.520 122.625 1.00 23.90  ? 273  PHE A C   1 
ATOM   1941 O  O   . PHE A 1 244 ? 54.376  104.346 122.398 1.00 25.37  ? 273  PHE A O   1 
ATOM   1942 C  CB  . PHE A 1 244 ? 53.623  106.650 120.442 1.00 25.65  ? 273  PHE A CB  1 
ATOM   1943 C  CG  . PHE A 1 244 ? 54.162  107.774 119.584 1.00 21.10  ? 273  PHE A CG  1 
ATOM   1944 C  CD1 . PHE A 1 244 ? 55.112  107.540 118.619 1.00 17.07  ? 273  PHE A CD1 1 
ATOM   1945 C  CD2 . PHE A 1 244 ? 53.748  109.061 119.852 1.00 29.77  ? 273  PHE A CD2 1 
ATOM   1946 C  CE1 . PHE A 1 244 ? 55.605  108.623 117.906 1.00 23.43  ? 273  PHE A CE1 1 
ATOM   1947 C  CE2 . PHE A 1 244 ? 54.256  110.134 119.128 1.00 25.82  ? 273  PHE A CE2 1 
ATOM   1948 C  CZ  . PHE A 1 244 ? 55.197  109.900 118.156 1.00 12.77  ? 273  PHE A CZ  1 
ATOM   1949 N  N   . CYS A 1 245 ? 53.637  106.002 123.744 1.00 20.97  ? 274  CYS A N   1 
ATOM   1950 C  CA  . CYS A 1 245 ? 53.106  105.108 124.750 1.00 19.09  ? 274  CYS A CA  1 
ATOM   1951 C  C   . CYS A 1 245 ? 51.628  104.818 124.457 1.00 19.76  ? 274  CYS A C   1 
ATOM   1952 O  O   . CYS A 1 245 ? 50.820  105.645 124.038 1.00 19.67  ? 274  CYS A O   1 
ATOM   1953 C  CB  . CYS A 1 245 ? 53.299  105.636 126.166 1.00 7.53   ? 274  CYS A CB  1 
ATOM   1954 S  SG  . CYS A 1 245 ? 54.811  106.490 126.471 1.00 17.00  ? 274  CYS A SG  1 
ATOM   1955 N  N   . PRO A 1 246 ? 51.257  103.550 124.602 1.00 15.51  ? 275  PRO A N   1 
ATOM   1956 C  CA  . PRO A 1 246 ? 49.949  103.088 124.312 1.00 14.60  ? 275  PRO A CA  1 
ATOM   1957 C  C   . PRO A 1 246 ? 48.854  103.680 125.192 1.00 19.54  ? 275  PRO A C   1 
ATOM   1958 O  O   . PRO A 1 246 ? 48.904  103.433 126.410 1.00 22.63  ? 275  PRO A O   1 
ATOM   1959 C  CB  . PRO A 1 246 ? 50.011  101.590 124.646 1.00 12.56  ? 275  PRO A CB  1 
ATOM   1960 C  CG  . PRO A 1 246 ? 51.135  101.497 125.602 1.00 16.22  ? 275  PRO A CG  1 
ATOM   1961 C  CD  . PRO A 1 246 ? 52.176  102.475 125.074 1.00 13.90  ? 275  PRO A CD  1 
ATOM   1962 N  N   . HIS A 1 247 ? 47.779  104.118 124.545 1.00 18.43  ? 276  HIS A N   1 
ATOM   1963 C  CA  . HIS A 1 247 ? 46.590  104.607 125.244 1.00 18.93  ? 276  HIS A CA  1 
ATOM   1964 C  C   . HIS A 1 247 ? 45.431  104.616 124.258 1.00 19.97  ? 276  HIS A C   1 
ATOM   1965 O  O   . HIS A 1 247 ? 45.482  105.134 123.132 1.00 19.26  ? 276  HIS A O   1 
ATOM   1966 C  CB  . HIS A 1 247 ? 46.855  105.964 125.873 1.00 23.38  ? 276  HIS A CB  1 
ATOM   1967 C  CG  . HIS A 1 247 ? 45.820  106.370 126.868 1.00 35.01  ? 276  HIS A CG  1 
ATOM   1968 N  ND1 . HIS A 1 247 ? 44.595  106.902 126.577 1.00 23.32  ? 276  HIS A ND1 1 
ATOM   1969 C  CD2 . HIS A 1 247 ? 45.876  106.275 128.219 1.00 47.30  ? 276  HIS A CD2 1 
ATOM   1970 C  CE1 . HIS A 1 247 ? 43.962  107.141 127.699 1.00 32.36  ? 276  HIS A CE1 1 
ATOM   1971 N  NE2 . HIS A 1 247 ? 44.694  106.754 128.726 1.00 33.56  ? 276  HIS A NE2 1 
ATOM   1972 N  N   . GLU A 1 248 ? 44.342  103.928 124.613 1.00 19.50  ? 277  GLU A N   1 
ATOM   1973 C  CA  . GLU A 1 248 ? 43.282  103.718 123.621 1.00 14.84  ? 277  GLU A CA  1 
ATOM   1974 C  C   . GLU A 1 248 ? 42.508  104.987 123.350 1.00 15.96  ? 277  GLU A C   1 
ATOM   1975 O  O   . GLU A 1 248 ? 41.594  104.937 122.546 1.00 18.76  ? 277  GLU A O   1 
ATOM   1976 C  CB  . GLU A 1 248 ? 42.352  102.647 124.104 1.00 3.96   ? 277  GLU A CB  1 
ATOM   1977 C  CG  . GLU A 1 248 ? 41.981  102.849 125.581 1.00 5.97   ? 277  GLU A CG  1 
ATOM   1978 C  CD  . GLU A 1 248 ? 42.922  102.093 126.486 1.00 15.33  ? 277  GLU A CD  1 
ATOM   1979 O  OE1 . GLU A 1 248 ? 43.962  101.627 125.952 1.00 29.44  ? 277  GLU A OE1 1 
ATOM   1980 O  OE2 . GLU A 1 248 ? 42.565  101.995 127.678 1.00 13.97  ? 277  GLU A OE2 1 
ATOM   1981 N  N   . ALA A 1 249 ? 42.822  106.081 124.024 1.00 16.72  ? 278  ALA A N   1 
ATOM   1982 C  CA  . ALA A 1 249 ? 42.152  107.350 123.727 1.00 16.19  ? 278  ALA A CA  1 
ATOM   1983 C  C   . ALA A 1 249 ? 42.886  107.926 122.510 1.00 16.79  ? 278  ALA A C   1 
ATOM   1984 O  O   . ALA A 1 249 ? 42.356  108.809 121.853 1.00 21.99  ? 278  ALA A O   1 
ATOM   1985 C  CB  . ALA A 1 249 ? 42.288  108.337 124.885 1.00 3.70   ? 278  ALA A CB  1 
ATOM   1986 N  N   . LEU A 1 250 ? 44.111  107.485 122.266 1.00 15.88  ? 279  LEU A N   1 
ATOM   1987 C  CA  . LEU A 1 250 ? 44.892  108.130 121.199 1.00 17.62  ? 279  LEU A CA  1 
ATOM   1988 C  C   . LEU A 1 250 ? 44.918  107.264 119.931 1.00 18.57  ? 279  LEU A C   1 
ATOM   1989 O  O   . LEU A 1 250 ? 44.885  107.819 118.834 1.00 20.93  ? 279  LEU A O   1 
ATOM   1990 C  CB  . LEU A 1 250 ? 46.351  108.284 121.615 1.00 12.91  ? 279  LEU A CB  1 
ATOM   1991 C  CG  . LEU A 1 250 ? 46.593  108.969 122.960 1.00 9.56   ? 279  LEU A CG  1 
ATOM   1992 C  CD1 . LEU A 1 250 ? 48.084  109.129 123.253 1.00 32.07  ? 279  LEU A CD1 1 
ATOM   1993 C  CD2 . LEU A 1 250 ? 45.993  110.349 122.848 1.00 9.49   ? 279  LEU A CD2 1 
ATOM   1994 N  N   . PHE A 1 251 ? 45.083  105.971 120.171 1.00 14.99  ? 280  PHE A N   1 
ATOM   1995 C  CA  . PHE A 1 251 ? 45.206  104.977 119.133 1.00 14.66  ? 280  PHE A CA  1 
ATOM   1996 C  C   . PHE A 1 251 ? 44.932  103.570 119.644 1.00 19.44  ? 280  PHE A C   1 
ATOM   1997 O  O   . PHE A 1 251 ? 44.735  103.342 120.844 1.00 23.68  ? 280  PHE A O   1 
ATOM   1998 C  CB  . PHE A 1 251 ? 46.566  105.012 118.491 1.00 13.96  ? 280  PHE A CB  1 
ATOM   1999 C  CG  . PHE A 1 251 ? 47.790  104.590 119.196 1.00 17.23  ? 280  PHE A CG  1 
ATOM   2000 C  CD1 . PHE A 1 251 ? 48.320  105.352 120.225 1.00 30.32  ? 280  PHE A CD1 1 
ATOM   2001 C  CD2 . PHE A 1 251 ? 48.488  103.448 118.847 1.00 22.09  ? 280  PHE A CD2 1 
ATOM   2002 C  CE1 . PHE A 1 251 ? 49.471  104.985 120.896 1.00 22.78  ? 280  PHE A CE1 1 
ATOM   2003 C  CE2 . PHE A 1 251 ? 49.634  103.071 119.507 1.00 21.84  ? 280  PHE A CE2 1 
ATOM   2004 C  CZ  . PHE A 1 251 ? 50.139  103.835 120.536 1.00 20.85  ? 280  PHE A CZ  1 
ATOM   2005 N  N   . THR A 1 252 ? 44.877  102.609 118.735 1.00 19.71  ? 281  THR A N   1 
ATOM   2006 C  CA  . THR A 1 252 ? 44.634  101.207 119.044 1.00 18.78  ? 281  THR A CA  1 
ATOM   2007 C  C   . THR A 1 252 ? 45.467  100.365 118.062 1.00 19.90  ? 281  THR A C   1 
ATOM   2008 O  O   . THR A 1 252 ? 45.878  100.838 117.014 1.00 23.27  ? 281  THR A O   1 
ATOM   2009 C  CB  . THR A 1 252 ? 43.182  100.743 118.868 1.00 8.81   ? 281  THR A CB  1 
ATOM   2010 O  OG1 . THR A 1 252 ? 42.880  100.708 117.455 1.00 24.19  ? 281  THR A OG1 1 
ATOM   2011 C  CG2 . THR A 1 252 ? 42.188  101.679 119.522 1.00 11.79  ? 281  THR A CG2 1 
ATOM   2012 N  N   . MET A 1 253 ? 45.553  99.099  118.318 1.00 18.95  ? 282  MET A N   1 
ATOM   2013 C  CA  . MET A 1 253 ? 46.411  98.184  117.578 1.00 19.68  ? 282  MET A CA  1 
ATOM   2014 C  C   . MET A 1 253 ? 45.559  97.157  116.823 1.00 25.43  ? 282  MET A C   1 
ATOM   2015 O  O   . MET A 1 253 ? 44.557  96.588  117.306 1.00 25.38  ? 282  MET A O   1 
ATOM   2016 C  CB  . MET A 1 253 ? 47.272  97.500  118.630 1.00 2.63   ? 282  MET A CB  1 
ATOM   2017 C  CG  . MET A 1 253 ? 48.756  97.463  118.524 1.00 26.77  ? 282  MET A CG  1 
ATOM   2018 S  SD  . MET A 1 253 ? 49.448  99.032  118.006 1.00 35.92  ? 282  MET A SD  1 
ATOM   2019 C  CE  . MET A 1 253 ? 49.164  99.969  119.522 1.00 36.05  ? 282  MET A CE  1 
ATOM   2020 N  N   . GLY A 1 254 ? 45.981  96.864  115.596 1.00 26.04  ? 283  GLY A N   1 
ATOM   2021 C  CA  . GLY A 1 254 ? 45.329  95.902  114.718 1.00 29.09  ? 283  GLY A CA  1 
ATOM   2022 C  C   . GLY A 1 254 ? 43.815  96.078  114.706 1.00 31.37  ? 283  GLY A C   1 
ATOM   2023 O  O   . GLY A 1 254 ? 43.384  97.209  114.962 1.00 34.50  ? 283  GLY A O   1 
ATOM   2024 N  N   . GLY A 1 255 ? 43.065  94.982  114.523 1.00 30.20  ? 284  GLY A N   1 
ATOM   2025 C  CA  . GLY A 1 255 ? 41.598  95.148  114.428 1.00 28.69  ? 284  GLY A CA  1 
ATOM   2026 C  C   . GLY A 1 255 ? 41.448  95.710  113.001 1.00 31.10  ? 284  GLY A C   1 
ATOM   2027 O  O   . GLY A 1 255 ? 42.390  95.430  112.261 1.00 34.24  ? 284  GLY A O   1 
ATOM   2028 N  N   . ASN A 1 256 ? 40.440  96.471  112.664 1.00 30.64  ? 285  ASN A N   1 
ATOM   2029 C  CA  . ASN A 1 256 ? 40.246  96.964  111.305 1.00 26.10  ? 285  ASN A CA  1 
ATOM   2030 C  C   . ASN A 1 256 ? 40.169  98.482  111.292 1.00 27.96  ? 285  ASN A C   1 
ATOM   2031 O  O   . ASN A 1 256 ? 40.039  99.129  110.255 1.00 29.16  ? 285  ASN A O   1 
ATOM   2032 C  CB  . ASN A 1 256 ? 38.973  96.362  110.746 1.00 25.54  ? 285  ASN A CB  1 
ATOM   2033 C  CG  . ASN A 1 256 ? 37.720  96.553  111.560 1.00 39.94  ? 285  ASN A CG  1 
ATOM   2034 O  OD1 . ASN A 1 256 ? 37.689  97.265  112.559 1.00 52.62  ? 285  ASN A OD1 1 
ATOM   2035 N  ND2 . ASN A 1 256 ? 36.620  95.917  111.163 1.00 43.13  ? 285  ASN A ND2 1 
ATOM   2036 N  N   . ALA A 1 257 ? 40.233  99.086  112.473 1.00 27.35  ? 286  ALA A N   1 
ATOM   2037 C  CA  . ALA A 1 257 ? 40.120  100.519 112.628 1.00 27.49  ? 286  ALA A CA  1 
ATOM   2038 C  C   . ALA A 1 257 ? 41.354  101.280 112.192 1.00 29.67  ? 286  ALA A C   1 
ATOM   2039 O  O   . ALA A 1 257 ? 41.330  102.516 112.154 1.00 31.02  ? 286  ALA A O   1 
ATOM   2040 C  CB  . ALA A 1 257 ? 39.782  100.851 114.068 1.00 37.80  ? 286  ALA A CB  1 
ATOM   2041 N  N   . GLU A 1 258 ? 42.458  100.594 111.924 1.00 32.08  ? 287  GLU A N   1 
ATOM   2042 C  CA  . GLU A 1 258 ? 43.640  101.232 111.348 1.00 32.89  ? 287  GLU A CA  1 
ATOM   2043 C  C   . GLU A 1 258 ? 44.246  102.315 112.228 1.00 33.36  ? 287  GLU A C   1 
ATOM   2044 O  O   . GLU A 1 258 ? 44.632  103.417 111.861 1.00 34.05  ? 287  GLU A O   1 
ATOM   2045 C  CB  . GLU A 1 258 ? 43.324  101.738 109.942 1.00 39.40  ? 287  GLU A CB  1 
ATOM   2046 C  CG  . GLU A 1 258 ? 42.839  100.717 108.956 1.00 51.57  ? 287  GLU A CG  1 
ATOM   2047 C  CD  . GLU A 1 258 ? 42.850  101.147 107.509 1.00 59.29  ? 287  GLU A CD  1 
ATOM   2048 O  OE1 . GLU A 1 258 ? 43.074  102.343 107.241 1.00 60.82  ? 287  GLU A OE1 1 
ATOM   2049 O  OE2 . GLU A 1 258 ? 42.625  100.275 106.627 1.00 70.02  ? 287  GLU A OE2 1 
ATOM   2050 N  N   . GLY A 1 259 ? 44.367  101.991 113.500 1.00 34.37  ? 288  GLY A N   1 
ATOM   2051 C  CA  . GLY A 1 259 ? 45.122  102.573 114.563 1.00 29.79  ? 288  GLY A CA  1 
ATOM   2052 C  C   . GLY A 1 259 ? 44.374  103.671 115.279 1.00 26.99  ? 288  GLY A C   1 
ATOM   2053 O  O   . GLY A 1 259 ? 44.916  104.358 116.142 1.00 30.71  ? 288  GLY A O   1 
ATOM   2054 N  N   . GLN A 1 260 ? 43.133  103.874 114.829 1.00 20.39  ? 289  GLN A N   1 
ATOM   2055 C  CA  . GLN A 1 260 ? 42.356  104.942 115.424 1.00 18.75  ? 289  GLN A CA  1 
ATOM   2056 C  C   . GLN A 1 260 ? 41.925  104.535 116.836 1.00 21.06  ? 289  GLN A C   1 
ATOM   2057 O  O   . GLN A 1 260 ? 41.889  103.369 117.232 1.00 22.36  ? 289  GLN A O   1 
ATOM   2058 C  CB  . GLN A 1 260 ? 41.095  105.231 114.630 1.00 13.73  ? 289  GLN A CB  1 
ATOM   2059 C  CG  . GLN A 1 260 ? 41.388  105.619 113.184 1.00 23.57  ? 289  GLN A CG  1 
ATOM   2060 C  CD  . GLN A 1 260 ? 41.541  107.138 113.153 1.00 28.75  ? 289  GLN A CD  1 
ATOM   2061 O  OE1 . GLN A 1 260 ? 40.646  107.837 113.615 1.00 34.76  ? 289  GLN A OE1 1 
ATOM   2062 N  NE2 . GLN A 1 260 ? 42.642  107.630 112.638 1.00 29.03  ? 289  GLN A NE2 1 
ATOM   2063 N  N   . PRO A 1 261 ? 41.534  105.594 117.536 1.00 17.69  ? 290  PRO A N   1 
ATOM   2064 C  CA  . PRO A 1 261 ? 41.218  105.504 118.937 1.00 14.06  ? 290  PRO A CA  1 
ATOM   2065 C  C   . PRO A 1 261 ? 39.905  104.829 119.179 1.00 16.37  ? 290  PRO A C   1 
ATOM   2066 O  O   . PRO A 1 261 ? 38.935  105.032 118.429 1.00 21.07  ? 290  PRO A O   1 
ATOM   2067 C  CB  . PRO A 1 261 ? 41.114  106.971 119.375 1.00 12.14  ? 290  PRO A CB  1 
ATOM   2068 C  CG  . PRO A 1 261 ? 41.468  107.826 118.243 1.00 9.14   ? 290  PRO A CG  1 
ATOM   2069 C  CD  . PRO A 1 261 ? 41.635  106.988 117.020 1.00 12.54  ? 290  PRO A CD  1 
ATOM   2070 N  N   . CYS A 1 262 ? 39.751  104.224 120.344 1.00 16.48  ? 291  CYS A N   1 
ATOM   2071 C  CA  . CYS A 1 262 ? 38.435  103.629 120.655 1.00 13.56  ? 291  CYS A CA  1 
ATOM   2072 C  C   . CYS A 1 262 ? 37.401  104.714 120.548 1.00 13.28  ? 291  CYS A C   1 
ATOM   2073 O  O   . CYS A 1 262 ? 37.767  105.886 120.636 1.00 14.27  ? 291  CYS A O   1 
ATOM   2074 C  CB  . CYS A 1 262 ? 38.571  103.131 122.116 1.00 13.94  ? 291  CYS A CB  1 
ATOM   2075 S  SG  . CYS A 1 262 ? 39.737  101.787 122.205 1.00 19.64  ? 291  CYS A SG  1 
ATOM   2076 N  N   . LYS A 1 263 ? 36.105  104.448 120.509 1.00 16.29  ? 292  LYS A N   1 
ATOM   2077 C  CA  . LYS A 1 263 ? 35.162  105.607 120.597 1.00 15.14  ? 292  LYS A CA  1 
ATOM   2078 C  C   . LYS A 1 263 ? 34.381  105.364 121.878 1.00 17.85  ? 292  LYS A C   1 
ATOM   2079 O  O   . LYS A 1 263 ? 33.811  104.251 122.050 1.00 22.99  ? 292  LYS A O   1 
ATOM   2080 C  CB  . LYS A 1 263 ? 34.179  105.606 119.443 1.00 25.59  ? 292  LYS A CB  1 
ATOM   2081 C  CG  . LYS A 1 263 ? 33.098  106.671 119.587 1.00 30.28  ? 292  LYS A CG  1 
ATOM   2082 C  CD  . LYS A 1 263 ? 33.766  108.030 119.476 1.00 33.22  ? 292  LYS A CD  1 
ATOM   2083 C  CE  . LYS A 1 263 ? 32.928  109.071 120.196 1.00 32.53  ? 292  LYS A CE  1 
ATOM   2084 N  NZ  . LYS A 1 263 ? 33.471  110.439 120.030 1.00 51.20  ? 292  LYS A NZ  1 
ATOM   2085 N  N   . PHE A 1 264 ? 34.410  106.287 122.816 1.00 13.30  ? 293  PHE A N   1 
ATOM   2086 C  CA  . PHE A 1 264 ? 33.760  105.928 124.101 1.00 11.47  ? 293  PHE A CA  1 
ATOM   2087 C  C   . PHE A 1 264 ? 32.493  106.671 124.290 1.00 15.47  ? 293  PHE A C   1 
ATOM   2088 O  O   . PHE A 1 264 ? 32.640  107.924 124.200 1.00 17.32  ? 293  PHE A O   1 
ATOM   2089 C  CB  . PHE A 1 264 ? 34.825  106.253 125.167 1.00 10.33  ? 293  PHE A CB  1 
ATOM   2090 C  CG  . PHE A 1 264 ? 35.812  105.127 125.295 1.00 13.14  ? 293  PHE A CG  1 
ATOM   2091 C  CD1 . PHE A 1 264 ? 35.325  103.851 125.258 1.00 5.97   ? 293  PHE A CD1 1 
ATOM   2092 C  CD2 . PHE A 1 264 ? 37.184  105.306 125.434 1.00 10.79  ? 293  PHE A CD2 1 
ATOM   2093 C  CE1 . PHE A 1 264 ? 36.159  102.760 125.377 1.00 8.94   ? 293  PHE A CE1 1 
ATOM   2094 C  CE2 . PHE A 1 264 ? 38.037  104.238 125.535 1.00 2.00   ? 293  PHE A CE2 1 
ATOM   2095 C  CZ  . PHE A 1 264 ? 37.511  102.943 125.501 1.00 22.92  ? 293  PHE A CZ  1 
ATOM   2096 N  N   . PRO A 1 265 ? 31.341  106.189 124.668 1.00 14.80  ? 294  PRO A N   1 
ATOM   2097 C  CA  . PRO A 1 265 ? 30.911  104.819 124.708 1.00 13.18  ? 294  PRO A CA  1 
ATOM   2098 C  C   . PRO A 1 265 ? 30.643  104.340 123.278 1.00 15.79  ? 294  PRO A C   1 
ATOM   2099 O  O   . PRO A 1 265 ? 30.649  105.186 122.375 1.00 19.02  ? 294  PRO A O   1 
ATOM   2100 C  CB  . PRO A 1 265 ? 29.632  104.840 125.496 1.00 12.88  ? 294  PRO A CB  1 
ATOM   2101 C  CG  . PRO A 1 265 ? 29.112  106.199 125.439 1.00 11.89  ? 294  PRO A CG  1 
ATOM   2102 C  CD  . PRO A 1 265 ? 30.102  107.030 124.695 1.00 11.56  ? 294  PRO A CD  1 
ATOM   2103 N  N   . PHE A 1 266 ? 30.567  103.043 123.139 1.00 15.55  ? 295  PHE A N   1 
ATOM   2104 C  CA  . PHE A 1 266 ? 30.405  102.294 121.911 1.00 13.59  ? 295  PHE A CA  1 
ATOM   2105 C  C   . PHE A 1 266 ? 29.455  101.138 122.216 1.00 12.62  ? 295  PHE A C   1 
ATOM   2106 O  O   . PHE A 1 266 ? 29.570  100.519 123.259 1.00 13.21  ? 295  PHE A O   1 
ATOM   2107 C  CB  . PHE A 1 266 ? 31.732  101.817 121.362 1.00 9.55   ? 295  PHE A CB  1 
ATOM   2108 C  CG  . PHE A 1 266 ? 32.347  100.605 121.970 1.00 12.56  ? 295  PHE A CG  1 
ATOM   2109 C  CD1 . PHE A 1 266 ? 31.984  99.329  121.577 1.00 11.90  ? 295  PHE A CD1 1 
ATOM   2110 C  CD2 . PHE A 1 266 ? 33.299  100.767 122.959 1.00 12.98  ? 295  PHE A CD2 1 
ATOM   2111 C  CE1 . PHE A 1 266 ? 32.571  98.227  122.172 1.00 16.88  ? 295  PHE A CE1 1 
ATOM   2112 C  CE2 . PHE A 1 266 ? 33.898  99.652  123.541 1.00 15.68  ? 295  PHE A CE2 1 
ATOM   2113 C  CZ  . PHE A 1 266 ? 33.522  98.391  123.156 1.00 10.02  ? 295  PHE A CZ  1 
ATOM   2114 N  N   . ARG A 1 267 ? 28.399  101.046 121.421 1.00 16.33  ? 296  ARG A N   1 
ATOM   2115 C  CA  . ARG A 1 267 ? 27.336  100.066 121.720 1.00 17.41  ? 296  ARG A CA  1 
ATOM   2116 C  C   . ARG A 1 267 ? 27.742  98.705  121.194 1.00 16.10  ? 296  ARG A C   1 
ATOM   2117 O  O   . ARG A 1 267 ? 28.145  98.570  120.049 1.00 17.11  ? 296  ARG A O   1 
ATOM   2118 C  CB  . ARG A 1 267 ? 26.039  100.549 121.066 1.00 13.87  ? 296  ARG A CB  1 
ATOM   2119 C  CG  . ARG A 1 267 ? 24.978  99.495  120.943 1.00 18.39  ? 296  ARG A CG  1 
ATOM   2120 C  CD  . ARG A 1 267 ? 23.684  99.819  121.635 1.00 23.82  ? 296  ARG A CD  1 
ATOM   2121 N  NE  . ARG A 1 267 ? 22.732  98.691  121.491 1.00 41.72  ? 296  ARG A NE  1 
ATOM   2122 C  CZ  . ARG A 1 267 ? 21.441  98.881  121.204 1.00 40.23  ? 296  ARG A CZ  1 
ATOM   2123 N  NH1 . ARG A 1 267 ? 20.981  100.125 121.047 1.00 45.55  ? 296  ARG A NH1 1 
ATOM   2124 N  NH2 . ARG A 1 267 ? 20.635  97.842  121.081 1.00 31.42  ? 296  ARG A NH2 1 
ATOM   2125 N  N   . PHE A 1 268 ? 27.761  97.678  122.039 1.00 15.36  ? 297  PHE A N   1 
ATOM   2126 C  CA  . PHE A 1 268 ? 28.113  96.392  121.502 1.00 16.73  ? 297  PHE A CA  1 
ATOM   2127 C  C   . PHE A 1 268 ? 26.869  95.561  121.318 1.00 22.52  ? 297  PHE A C   1 
ATOM   2128 O  O   . PHE A 1 268 ? 26.569  95.156  120.175 1.00 27.09  ? 297  PHE A O   1 
ATOM   2129 C  CB  . PHE A 1 268 ? 29.098  95.538  122.220 1.00 18.94  ? 297  PHE A CB  1 
ATOM   2130 C  CG  . PHE A 1 268 ? 29.210  94.159  121.610 1.00 31.82  ? 297  PHE A CG  1 
ATOM   2131 C  CD1 . PHE A 1 268 ? 29.160  93.934  120.245 1.00 20.29  ? 297  PHE A CD1 1 
ATOM   2132 C  CD2 . PHE A 1 268 ? 29.375  93.075  122.461 1.00 31.43  ? 297  PHE A CD2 1 
ATOM   2133 C  CE1 . PHE A 1 268 ? 29.241  92.641  119.730 1.00 25.10  ? 297  PHE A CE1 1 
ATOM   2134 C  CE2 . PHE A 1 268 ? 29.468  91.799  121.949 1.00 25.93  ? 297  PHE A CE2 1 
ATOM   2135 C  CZ  . PHE A 1 268 ? 29.412  91.565  120.593 1.00 24.80  ? 297  PHE A CZ  1 
ATOM   2136 N  N   . GLN A 1 269 ? 26.189  95.147  122.385 1.00 21.59  ? 298  GLN A N   1 
ATOM   2137 C  CA  . GLN A 1 269 ? 24.982  94.409  121.829 1.00 24.04  ? 298  GLN A CA  1 
ATOM   2138 C  C   . GLN A 1 269 ? 23.795  94.964  122.547 1.00 25.55  ? 298  GLN A C   1 
ATOM   2139 O  O   . GLN A 1 269 ? 22.901  95.438  121.893 1.00 31.75  ? 298  GLN A O   1 
ATOM   2140 C  CB  . GLN A 1 269 ? 25.157  92.934  121.875 1.00 32.18  ? 298  GLN A CB  1 
ATOM   2141 C  CG  . GLN A 1 269 ? 25.851  92.357  120.628 1.00 36.49  ? 298  GLN A CG  1 
ATOM   2142 C  CD  . GLN A 1 269 ? 24.816  91.515  119.921 1.00 38.11  ? 298  GLN A CD  1 
ATOM   2143 O  OE1 . GLN A 1 269 ? 23.890  91.143  120.648 1.00 35.10  ? 298  GLN A OE1 1 
ATOM   2144 N  NE2 . GLN A 1 269 ? 25.009  91.264  118.650 1.00 61.20  ? 298  GLN A NE2 1 
ATOM   2145 N  N   . GLY A 1 270 ? 23.840  94.901  123.854 1.00 25.05  ? 299  GLY A N   1 
ATOM   2146 C  CA  . GLY A 1 270 ? 22.830  95.402  124.767 1.00 18.77  ? 299  GLY A CA  1 
ATOM   2147 C  C   . GLY A 1 270 ? 23.509  96.340  125.756 1.00 18.08  ? 299  GLY A C   1 
ATOM   2148 O  O   . GLY A 1 270 ? 22.959  96.795  126.746 1.00 20.44  ? 299  GLY A O   1 
ATOM   2149 N  N   . THR A 1 271 ? 24.827  96.530  125.551 1.00 14.58  ? 300  THR A N   1 
ATOM   2150 C  CA  . THR A 1 271 ? 25.552  97.388  126.445 1.00 12.41  ? 300  THR A CA  1 
ATOM   2151 C  C   . THR A 1 271 ? 26.306  98.506  125.774 1.00 15.38  ? 300  THR A C   1 
ATOM   2152 O  O   . THR A 1 271 ? 26.737  98.372  124.627 1.00 13.89  ? 300  THR A O   1 
ATOM   2153 C  CB  . THR A 1 271 ? 26.563  96.554  127.262 1.00 18.11  ? 300  THR A CB  1 
ATOM   2154 O  OG1 . THR A 1 271 ? 25.746  95.654  128.040 1.00 16.64  ? 300  THR A OG1 1 
ATOM   2155 C  CG2 . THR A 1 271 ? 27.363  97.446  128.172 1.00 18.48  ? 300  THR A CG2 1 
ATOM   2156 N  N   . SER A 1 272 ? 26.454  99.616  126.543 1.00 15.44  ? 301  SER A N   1 
ATOM   2157 C  CA  . SER A 1 272 ? 27.324  100.671 125.974 1.00 16.30  ? 301  SER A CA  1 
ATOM   2158 C  C   . SER A 1 272 ? 28.630  100.574 126.769 1.00 13.62  ? 301  SER A C   1 
ATOM   2159 O  O   . SER A 1 272 ? 28.481  100.551 128.005 1.00 12.98  ? 301  SER A O   1 
ATOM   2160 C  CB  . SER A 1 272 ? 26.730  102.071 126.122 1.00 20.02  ? 301  SER A CB  1 
ATOM   2161 O  OG  . SER A 1 272 ? 25.524  102.124 125.367 1.00 47.25  ? 301  SER A OG  1 
ATOM   2162 N  N   . TYR A 1 273 ? 29.733  100.400 126.059 1.00 8.79   ? 302  TYR A N   1 
ATOM   2163 C  CA  . TYR A 1 273 ? 31.001  100.317 126.790 1.00 10.62  ? 302  TYR A CA  1 
ATOM   2164 C  C   . TYR A 1 273 ? 31.756  101.627 126.857 1.00 9.93   ? 302  TYR A C   1 
ATOM   2165 O  O   . TYR A 1 273 ? 31.922  102.248 125.832 1.00 10.24  ? 302  TYR A O   1 
ATOM   2166 C  CB  . TYR A 1 273 ? 31.860  99.242  126.143 1.00 12.88  ? 302  TYR A CB  1 
ATOM   2167 C  CG  . TYR A 1 273 ? 31.103  97.917  126.274 1.00 18.38  ? 302  TYR A CG  1 
ATOM   2168 C  CD1 . TYR A 1 273 ? 31.256  97.150  127.418 1.00 16.47  ? 302  TYR A CD1 1 
ATOM   2169 C  CD2 . TYR A 1 273 ? 30.260  97.459  125.269 1.00 18.89  ? 302  TYR A CD2 1 
ATOM   2170 C  CE1 . TYR A 1 273 ? 30.610  95.945  127.546 1.00 19.29  ? 302  TYR A CE1 1 
ATOM   2171 C  CE2 . TYR A 1 273 ? 29.609  96.250  125.436 1.00 20.94  ? 302  TYR A CE2 1 
ATOM   2172 C  CZ  . TYR A 1 273 ? 29.772  95.490  126.560 1.00 21.69  ? 302  TYR A CZ  1 
ATOM   2173 O  OH  . TYR A 1 273 ? 29.123  94.273  126.724 1.00 25.67  ? 302  TYR A OH  1 
ATOM   2174 N  N   . ASP A 1 274 ? 32.205  102.020 128.033 1.00 11.13  ? 303  ASP A N   1 
ATOM   2175 C  CA  . ASP A 1 274 ? 32.962  103.237 128.284 1.00 10.02  ? 303  ASP A CA  1 
ATOM   2176 C  C   . ASP A 1 274 ? 34.453  102.952 128.410 1.00 12.79  ? 303  ASP A C   1 
ATOM   2177 O  O   . ASP A 1 274 ? 35.222  103.872 128.655 1.00 19.43  ? 303  ASP A O   1 
ATOM   2178 C  CB  . ASP A 1 274 ? 32.422  103.887 129.551 1.00 12.07  ? 303  ASP A CB  1 
ATOM   2179 C  CG  . ASP A 1 274 ? 32.741  105.348 129.749 1.00 32.96  ? 303  ASP A CG  1 
ATOM   2180 O  OD1 . ASP A 1 274 ? 32.312  106.175 128.908 1.00 33.06  ? 303  ASP A OD1 1 
ATOM   2181 O  OD2 . ASP A 1 274 ? 33.435  105.675 130.763 1.00 42.99  ? 303  ASP A OD2 1 
ATOM   2182 N  N   . SER A 1 275 ? 34.949  101.810 127.995 1.00 10.91  ? 304  SER A N   1 
ATOM   2183 C  CA  . SER A 1 275 ? 36.299  101.351 128.098 1.00 12.46  ? 304  SER A CA  1 
ATOM   2184 C  C   . SER A 1 275 ? 36.419  100.085 127.223 1.00 15.97  ? 304  SER A C   1 
ATOM   2185 O  O   . SER A 1 275 ? 35.374  99.728  126.710 1.00 16.40  ? 304  SER A O   1 
ATOM   2186 C  CB  . SER A 1 275 ? 36.537  100.837 129.550 1.00 10.69  ? 304  SER A CB  1 
ATOM   2187 O  OG  . SER A 1 275 ? 35.821  99.604  129.640 1.00 14.95  ? 304  SER A OG  1 
ATOM   2188 N  N   . CYS A 1 276 ? 37.623  99.568  127.037 1.00 15.71  ? 305  CYS A N   1 
ATOM   2189 C  CA  . CYS A 1 276 ? 37.701  98.347  126.207 1.00 11.73  ? 305  CYS A CA  1 
ATOM   2190 C  C   . CYS A 1 276 ? 37.183  97.235  127.113 1.00 17.42  ? 305  CYS A C   1 
ATOM   2191 O  O   . CYS A 1 276 ? 37.309  97.522  128.322 1.00 21.65  ? 305  CYS A O   1 
ATOM   2192 C  CB  . CYS A 1 276 ? 39.165  98.130  125.880 1.00 13.08  ? 305  CYS A CB  1 
ATOM   2193 S  SG  . CYS A 1 276 ? 39.994  99.634  125.366 1.00 22.12  ? 305  CYS A SG  1 
ATOM   2194 N  N   . THR A 1 277 ? 36.689  96.133  126.586 1.00 15.67  ? 306  THR A N   1 
ATOM   2195 C  CA  . THR A 1 277 ? 36.204  94.955  127.269 1.00 12.21  ? 306  THR A CA  1 
ATOM   2196 C  C   . THR A 1 277 ? 36.862  93.719  126.631 1.00 13.67  ? 306  THR A C   1 
ATOM   2197 O  O   . THR A 1 277 ? 37.530  93.851  125.613 1.00 10.78  ? 306  THR A O   1 
ATOM   2198 C  CB  . THR A 1 277 ? 34.685  94.737  127.116 1.00 11.27  ? 306  THR A CB  1 
ATOM   2199 O  OG1 . THR A 1 277 ? 34.294  95.462  125.939 1.00 27.51  ? 306  THR A OG1 1 
ATOM   2200 C  CG2 . THR A 1 277 ? 33.912  95.196  128.320 1.00 20.91  ? 306  THR A CG2 1 
ATOM   2201 N  N   . THR A 1 278 ? 36.629  92.570  127.221 1.00 19.12  ? 307  THR A N   1 
ATOM   2202 C  CA  . THR A 1 278 ? 37.068  91.285  126.691 1.00 22.27  ? 307  THR A CA  1 
ATOM   2203 C  C   . THR A 1 278 ? 35.787  90.485  126.382 1.00 30.07  ? 307  THR A C   1 
ATOM   2204 O  O   . THR A 1 278 ? 35.827  89.345  125.958 1.00 33.10  ? 307  THR A O   1 
ATOM   2205 C  CB  . THR A 1 278 ? 37.881  90.493  127.698 1.00 12.45  ? 307  THR A CB  1 
ATOM   2206 O  OG1 . THR A 1 278 ? 37.175  90.424  128.950 1.00 27.94  ? 307  THR A OG1 1 
ATOM   2207 C  CG2 . THR A 1 278 ? 39.229  91.152  127.935 1.00 34.63  ? 307  THR A CG2 1 
ATOM   2208 N  N   . GLU A 1 279 ? 34.636  91.181  126.555 1.00 31.11  ? 308  GLU A N   1 
ATOM   2209 C  CA  . GLU A 1 279 ? 33.376  90.520  126.201 1.00 31.54  ? 308  GLU A CA  1 
ATOM   2210 C  C   . GLU A 1 279 ? 33.429  90.108  124.727 1.00 30.30  ? 308  GLU A C   1 
ATOM   2211 O  O   . GLU A 1 279 ? 33.840  90.953  123.950 1.00 29.95  ? 308  GLU A O   1 
ATOM   2212 C  CB  . GLU A 1 279 ? 32.180  91.420  126.433 1.00 33.64  ? 308  GLU A CB  1 
ATOM   2213 C  CG  . GLU A 1 279 ? 30.792  90.875  126.189 1.00 5.80   ? 308  GLU A CG  1 
ATOM   2214 C  CD  . GLU A 1 279 ? 30.172  90.314  127.445 1.00 45.30  ? 308  GLU A CD  1 
ATOM   2215 O  OE1 . GLU A 1 279 ? 30.659  89.276  127.952 1.00 58.34  ? 308  GLU A OE1 1 
ATOM   2216 O  OE2 . GLU A 1 279 ? 29.193  90.898  127.973 1.00 67.23  ? 308  GLU A OE2 1 
ATOM   2217 N  N   . GLY A 1 280 ? 33.047  88.884  124.425 1.00 29.46  ? 309  GLY A N   1 
ATOM   2218 C  CA  . GLY A 1 280 ? 32.962  88.411  123.053 1.00 29.07  ? 309  GLY A CA  1 
ATOM   2219 C  C   . GLY A 1 280 ? 34.237  87.668  122.707 1.00 31.77  ? 309  GLY A C   1 
ATOM   2220 O  O   . GLY A 1 280 ? 34.445  87.259  121.565 1.00 36.43  ? 309  GLY A O   1 
ATOM   2221 N  N   . ARG A 1 281 ? 35.115  87.522  123.694 1.00 30.30  ? 310  ARG A N   1 
ATOM   2222 C  CA  . ARG A 1 281 ? 36.467  87.054  123.402 1.00 29.43  ? 310  ARG A CA  1 
ATOM   2223 C  C   . ARG A 1 281 ? 36.957  86.017  124.398 1.00 28.67  ? 310  ARG A C   1 
ATOM   2224 O  O   . ARG A 1 281 ? 36.548  86.098  125.556 1.00 25.87  ? 310  ARG A O   1 
ATOM   2225 C  CB  . ARG A 1 281 ? 37.429  88.270  123.506 1.00 27.61  ? 310  ARG A CB  1 
ATOM   2226 C  CG  . ARG A 1 281 ? 37.252  89.291  122.422 1.00 31.03  ? 310  ARG A CG  1 
ATOM   2227 C  CD  . ARG A 1 281 ? 38.531  89.927  121.995 1.00 35.67  ? 310  ARG A CD  1 
ATOM   2228 N  NE  . ARG A 1 281 ? 39.535  89.054  121.414 1.00 29.35  ? 310  ARG A NE  1 
ATOM   2229 C  CZ  . ARG A 1 281 ? 39.651  88.956  120.085 1.00 28.92  ? 310  ARG A CZ  1 
ATOM   2230 N  NH1 . ARG A 1 281 ? 38.811  89.632  119.319 1.00 28.23  ? 310  ARG A NH1 1 
ATOM   2231 N  NH2 . ARG A 1 281 ? 40.594  88.189  119.581 1.00 29.90  ? 310  ARG A NH2 1 
ATOM   2232 N  N   . THR A 1 282 ? 37.927  85.203  123.940 1.00 29.56  ? 311  THR A N   1 
ATOM   2233 C  CA  . THR A 1 282 ? 38.470  84.144  124.764 1.00 28.28  ? 311  THR A CA  1 
ATOM   2234 C  C   . THR A 1 282 ? 39.929  84.343  125.133 1.00 30.71  ? 311  THR A C   1 
ATOM   2235 O  O   . THR A 1 282 ? 40.356  83.810  126.152 1.00 34.80  ? 311  THR A O   1 
ATOM   2236 C  CB  . THR A 1 282 ? 38.414  82.766  124.099 1.00 36.94  ? 311  THR A CB  1 
ATOM   2237 O  OG1 . THR A 1 282 ? 37.430  82.730  123.053 1.00 55.70  ? 311  THR A OG1 1 
ATOM   2238 C  CG2 . THR A 1 282 ? 38.101  81.754  125.191 1.00 49.75  ? 311  THR A CG2 1 
ATOM   2239 N  N   . ASP A 1 283 ? 40.652  85.041  124.265 1.00 26.56  ? 312  ASP A N   1 
ATOM   2240 C  CA  . ASP A 1 283 ? 42.047  85.303  124.427 1.00 21.73  ? 312  ASP A CA  1 
ATOM   2241 C  C   . ASP A 1 283 ? 42.317  86.260  125.569 1.00 26.47  ? 312  ASP A C   1 
ATOM   2242 O  O   . ASP A 1 283 ? 43.473  86.481  125.960 1.00 32.71  ? 312  ASP A O   1 
ATOM   2243 C  CB  . ASP A 1 283 ? 42.620  85.823  123.121 1.00 25.56  ? 312  ASP A CB  1 
ATOM   2244 C  CG  . ASP A 1 283 ? 41.714  86.592  122.208 1.00 27.55  ? 312  ASP A CG  1 
ATOM   2245 O  OD1 . ASP A 1 283 ? 41.408  87.781  122.426 1.00 39.34  ? 312  ASP A OD1 1 
ATOM   2246 O  OD2 . ASP A 1 283 ? 41.261  86.043  121.190 1.00 51.51  ? 312  ASP A OD2 1 
ATOM   2247 N  N   . GLY A 1 284 ? 41.326  86.971  126.059 1.00 27.00  ? 313  GLY A N   1 
ATOM   2248 C  CA  . GLY A 1 284 ? 41.442  87.925  127.167 1.00 23.07  ? 313  GLY A CA  1 
ATOM   2249 C  C   . GLY A 1 284 ? 42.030  89.242  126.650 1.00 22.78  ? 313  GLY A C   1 
ATOM   2250 O  O   . GLY A 1 284 ? 42.680  89.998  127.389 1.00 22.39  ? 313  GLY A O   1 
ATOM   2251 N  N   . TYR A 1 285 ? 41.864  89.489  125.352 1.00 17.56  ? 314  TYR A N   1 
ATOM   2252 C  CA  . TYR A 1 285 ? 42.394  90.751  124.857 1.00 20.31  ? 314  TYR A CA  1 
ATOM   2253 C  C   . TYR A 1 285 ? 41.440  91.906  125.003 1.00 20.84  ? 314  TYR A C   1 
ATOM   2254 O  O   . TYR A 1 285 ? 40.330  91.743  124.522 1.00 20.87  ? 314  TYR A O   1 
ATOM   2255 C  CB  . TYR A 1 285 ? 42.794  90.536  123.390 1.00 23.87  ? 314  TYR A CB  1 
ATOM   2256 C  CG  . TYR A 1 285 ? 44.014  89.615  123.411 1.00 32.39  ? 314  TYR A CG  1 
ATOM   2257 C  CD1 . TYR A 1 285 ? 44.683  89.412  124.615 1.00 37.75  ? 314  TYR A CD1 1 
ATOM   2258 C  CD2 . TYR A 1 285 ? 44.478  88.982  122.276 1.00 33.58  ? 314  TYR A CD2 1 
ATOM   2259 C  CE1 . TYR A 1 285 ? 45.809  88.615  124.672 1.00 42.98  ? 314  TYR A CE1 1 
ATOM   2260 C  CE2 . TYR A 1 285 ? 45.597  88.175  122.337 1.00 38.02  ? 314  TYR A CE2 1 
ATOM   2261 C  CZ  . TYR A 1 285 ? 46.266  88.001  123.526 1.00 44.54  ? 314  TYR A CZ  1 
ATOM   2262 O  OH  . TYR A 1 285 ? 47.382  87.180  123.597 1.00 49.17  ? 314  TYR A OH  1 
ATOM   2263 N  N   . ARG A 1 286 ? 41.843  93.056  125.581 1.00 20.50  ? 315  ARG A N   1 
ATOM   2264 C  CA  . ARG A 1 286 ? 40.851  94.148  125.667 1.00 16.61  ? 315  ARG A CA  1 
ATOM   2265 C  C   . ARG A 1 286 ? 40.583  94.613  124.225 1.00 19.77  ? 315  ARG A C   1 
ATOM   2266 O  O   . ARG A 1 286 ? 41.491  94.513  123.379 1.00 21.47  ? 315  ARG A O   1 
ATOM   2267 C  CB  . ARG A 1 286 ? 41.289  95.290  126.490 1.00 4.41   ? 315  ARG A CB  1 
ATOM   2268 C  CG  . ARG A 1 286 ? 41.617  95.269  127.947 1.00 2.76   ? 315  ARG A CG  1 
ATOM   2269 C  CD  . ARG A 1 286 ? 41.341  96.619  128.578 1.00 19.38  ? 315  ARG A CD  1 
ATOM   2270 N  NE  . ARG A 1 286 ? 42.264  97.705  128.465 1.00 22.01  ? 315  ARG A NE  1 
ATOM   2271 C  CZ  . ARG A 1 286 ? 43.541  97.654  128.144 1.00 11.31  ? 315  ARG A CZ  1 
ATOM   2272 N  NH1 . ARG A 1 286 ? 44.078  96.468  127.862 1.00 29.27  ? 315  ARG A NH1 1 
ATOM   2273 N  NH2 . ARG A 1 286 ? 44.306  98.732  128.106 1.00 23.66  ? 315  ARG A NH2 1 
ATOM   2274 N  N   . TRP A 1 287 ? 39.370  95.087  123.970 1.00 19.37  ? 316  TRP A N   1 
ATOM   2275 C  CA  . TRP A 1 287 ? 39.099  95.599  122.604 1.00 21.13  ? 316  TRP A CA  1 
ATOM   2276 C  C   . TRP A 1 287 ? 38.043  96.692  122.675 1.00 22.28  ? 316  TRP A C   1 
ATOM   2277 O  O   . TRP A 1 287 ? 37.412  96.891  123.718 1.00 21.99  ? 316  TRP A O   1 
ATOM   2278 C  CB  . TRP A 1 287 ? 38.626  94.454  121.715 1.00 13.12  ? 316  TRP A CB  1 
ATOM   2279 C  CG  . TRP A 1 287 ? 37.216  93.990  121.990 1.00 12.08  ? 316  TRP A CG  1 
ATOM   2280 C  CD1 . TRP A 1 287 ? 36.808  93.089  122.909 1.00 7.10   ? 316  TRP A CD1 1 
ATOM   2281 C  CD2 . TRP A 1 287 ? 36.019  94.448  121.325 1.00 15.66  ? 316  TRP A CD2 1 
ATOM   2282 N  NE1 . TRP A 1 287 ? 35.421  92.962  122.875 1.00 22.24  ? 316  TRP A NE1 1 
ATOM   2283 C  CE2 . TRP A 1 287 ? 34.923  93.780  121.900 1.00 12.40  ? 316  TRP A CE2 1 
ATOM   2284 C  CE3 . TRP A 1 287 ? 35.759  95.364  120.313 1.00 17.14  ? 316  TRP A CE3 1 
ATOM   2285 C  CZ2 . TRP A 1 287 ? 33.636  93.998  121.475 1.00 16.91  ? 316  TRP A CZ2 1 
ATOM   2286 C  CZ3 . TRP A 1 287 ? 34.467  95.578  119.892 1.00 15.32  ? 316  TRP A CZ3 1 
ATOM   2287 C  CH2 . TRP A 1 287 ? 33.400  94.897  120.472 1.00 12.62  ? 316  TRP A CH2 1 
ATOM   2288 N  N   . CYS A 1 288 ? 37.730  97.358  121.562 1.00 21.36  ? 317  CYS A N   1 
ATOM   2289 C  CA  . CYS A 1 288 ? 36.697  98.386  121.663 1.00 20.28  ? 317  CYS A CA  1 
ATOM   2290 C  C   . CYS A 1 288 ? 36.207  98.812  120.297 1.00 19.61  ? 317  CYS A C   1 
ATOM   2291 O  O   . CYS A 1 288 ? 36.920  98.811  119.309 1.00 20.89  ? 317  CYS A O   1 
ATOM   2292 C  CB  . CYS A 1 288 ? 37.377  99.645  122.306 1.00 13.72  ? 317  CYS A CB  1 
ATOM   2293 S  SG  . CYS A 1 288 ? 38.539  100.305 121.065 1.00 22.80  ? 317  CYS A SG  1 
ATOM   2294 N  N   . GLY A 1 289 ? 34.956  99.289  120.241 1.00 18.79  ? 318  GLY A N   1 
ATOM   2295 C  CA  . GLY A 1 289 ? 34.549  99.815  118.936 1.00 16.44  ? 318  GLY A CA  1 
ATOM   2296 C  C   . GLY A 1 289 ? 35.244  101.178 118.806 1.00 17.83  ? 318  GLY A C   1 
ATOM   2297 O  O   . GLY A 1 289 ? 35.355  102.040 119.688 1.00 15.26  ? 318  GLY A O   1 
ATOM   2298 N  N   . THR A 1 290 ? 35.625  101.415 117.578 1.00 19.54  ? 319  THR A N   1 
ATOM   2299 C  CA  . THR A 1 290 ? 36.320  102.643 117.177 1.00 15.69  ? 319  THR A CA  1 
ATOM   2300 C  C   . THR A 1 290 ? 35.324  103.643 116.662 1.00 16.73  ? 319  THR A C   1 
ATOM   2301 O  O   . THR A 1 290 ? 35.573  104.772 116.227 1.00 19.67  ? 319  THR A O   1 
ATOM   2302 C  CB  . THR A 1 290 ? 37.295  102.139 116.101 1.00 8.97   ? 319  THR A CB  1 
ATOM   2303 O  OG1 . THR A 1 290 ? 38.569  102.627 116.396 1.00 6.22   ? 319  THR A OG1 1 
ATOM   2304 C  CG2 . THR A 1 290 ? 36.800  102.430 114.707 1.00 18.86  ? 319  THR A CG2 1 
ATOM   2305 N  N   . THR A 1 291 ? 34.073  103.250 116.716 1.00 14.85  ? 320  THR A N   1 
ATOM   2306 C  CA  . THR A 1 291 ? 32.973  104.120 116.250 1.00 15.77  ? 320  THR A CA  1 
ATOM   2307 C  C   . THR A 1 291 ? 31.897  103.863 117.319 1.00 15.68  ? 320  THR A C   1 
ATOM   2308 O  O   . THR A 1 291 ? 32.031  102.851 118.024 1.00 15.96  ? 320  THR A O   1 
ATOM   2309 C  CB  . THR A 1 291 ? 32.479  103.693 114.875 1.00 20.47  ? 320  THR A CB  1 
ATOM   2310 O  OG1 . THR A 1 291 ? 31.423  104.547 114.457 1.00 45.28  ? 320  THR A OG1 1 
ATOM   2311 C  CG2 . THR A 1 291 ? 31.817  102.276 114.940 1.00 26.27  ? 320  THR A CG2 1 
ATOM   2312 N  N   . GLU A 1 292 ? 30.944  104.707 117.534 1.00 15.29  ? 321  GLU A N   1 
ATOM   2313 C  CA  . GLU A 1 292 ? 29.984  104.474 118.615 1.00 22.87  ? 321  GLU A CA  1 
ATOM   2314 C  C   . GLU A 1 292 ? 29.034  103.313 118.439 1.00 24.47  ? 321  GLU A C   1 
ATOM   2315 O  O   . GLU A 1 292 ? 28.273  103.025 119.379 1.00 28.30  ? 321  GLU A O   1 
ATOM   2316 C  CB  . GLU A 1 292 ? 29.094  105.745 118.750 1.00 26.85  ? 321  GLU A CB  1 
ATOM   2317 C  CG  . GLU A 1 292 ? 29.086  106.495 117.426 1.00 27.82  ? 321  GLU A CG  1 
ATOM   2318 C  CD  . GLU A 1 292 ? 27.749  107.134 117.153 1.00 43.75  ? 321  GLU A CD  1 
ATOM   2319 O  OE1 . GLU A 1 292 ? 27.165  107.615 118.154 1.00 56.43  ? 321  GLU A OE1 1 
ATOM   2320 O  OE2 . GLU A 1 292 ? 27.289  107.166 115.989 1.00 50.45  ? 321  GLU A OE2 1 
ATOM   2321 N  N   . ASP A 1 293 ? 28.888  102.717 117.267 1.00 22.87  ? 322  ASP A N   1 
ATOM   2322 C  CA  . ASP A 1 293 ? 27.955  101.586 117.160 1.00 20.29  ? 322  ASP A CA  1 
ATOM   2323 C  C   . ASP A 1 293 ? 28.746  100.436 116.563 1.00 17.78  ? 322  ASP A C   1 
ATOM   2324 O  O   . ASP A 1 293 ? 28.936  100.396 115.362 1.00 19.53  ? 322  ASP A O   1 
ATOM   2325 C  CB  . ASP A 1 293 ? 26.745  101.910 116.297 1.00 20.63  ? 322  ASP A CB  1 
ATOM   2326 C  CG  . ASP A 1 293 ? 25.638  100.887 116.530 1.00 14.51  ? 322  ASP A CG  1 
ATOM   2327 O  OD1 . ASP A 1 293 ? 25.971  99.681  116.590 1.00 23.34  ? 322  ASP A OD1 1 
ATOM   2328 O  OD2 . ASP A 1 293 ? 24.494  101.342 116.655 1.00 33.69  ? 322  ASP A OD2 1 
ATOM   2329 N  N   . TYR A 1 294 ? 29.359  99.635  117.430 1.00 15.98  ? 323  TYR A N   1 
ATOM   2330 C  CA  . TYR A 1 294 ? 30.273  98.664  116.874 1.00 17.15  ? 323  TYR A CA  1 
ATOM   2331 C  C   . TYR A 1 294 ? 29.491  97.695  115.995 1.00 22.89  ? 323  TYR A C   1 
ATOM   2332 O  O   . TYR A 1 294 ? 30.043  97.202  114.997 1.00 26.55  ? 323  TYR A O   1 
ATOM   2333 C  CB  . TYR A 1 294 ? 31.042  97.889  117.926 1.00 16.44  ? 323  TYR A CB  1 
ATOM   2334 C  CG  . TYR A 1 294 ? 31.619  96.630  117.283 1.00 18.88  ? 323  TYR A CG  1 
ATOM   2335 C  CD1 . TYR A 1 294 ? 32.742  96.705  116.471 1.00 21.73  ? 323  TYR A CD1 1 
ATOM   2336 C  CD2 . TYR A 1 294 ? 30.993  95.407  117.468 1.00 14.30  ? 323  TYR A CD2 1 
ATOM   2337 C  CE1 . TYR A 1 294 ? 33.250  95.566  115.873 1.00 27.00  ? 323  TYR A CE1 1 
ATOM   2338 C  CE2 . TYR A 1 294 ? 31.509  94.279  116.875 1.00 14.35  ? 323  TYR A CE2 1 
ATOM   2339 C  CZ  . TYR A 1 294 ? 32.609  94.332  116.077 1.00 22.64  ? 323  TYR A CZ  1 
ATOM   2340 O  OH  . TYR A 1 294 ? 33.144  93.200  115.474 1.00 22.27  ? 323  TYR A OH  1 
ATOM   2341 N  N   . ASP A 1 295 ? 28.222  97.430  116.351 1.00 19.79  ? 324  ASP A N   1 
ATOM   2342 C  CA  . ASP A 1 295 ? 27.520  96.478  115.476 1.00 18.82  ? 324  ASP A CA  1 
ATOM   2343 C  C   . ASP A 1 295 ? 27.294  97.162  114.130 1.00 19.32  ? 324  ASP A C   1 
ATOM   2344 O  O   . ASP A 1 295 ? 27.551  96.616  113.074 1.00 21.23  ? 324  ASP A O   1 
ATOM   2345 C  CB  . ASP A 1 295 ? 26.204  96.032  116.055 1.00 21.27  ? 324  ASP A CB  1 
ATOM   2346 C  CG  . ASP A 1 295 ? 26.314  95.616  117.502 1.00 15.85  ? 324  ASP A CG  1 
ATOM   2347 O  OD1 . ASP A 1 295 ? 27.313  94.984  117.880 1.00 14.05  ? 324  ASP A OD1 1 
ATOM   2348 O  OD2 . ASP A 1 295 ? 25.408  95.900  118.303 1.00 22.99  ? 324  ASP A OD2 1 
ATOM   2349 N  N   . ARG A 1 296 ? 26.736  98.348  114.233 1.00 19.47  ? 325  ARG A N   1 
ATOM   2350 C  CA  . ARG A 1 296 ? 26.372  99.082  113.018 1.00 23.77  ? 325  ARG A CA  1 
ATOM   2351 C  C   . ARG A 1 296 ? 27.579  99.295  112.122 1.00 23.44  ? 325  ARG A C   1 
ATOM   2352 O  O   . ARG A 1 296 ? 27.511  99.026  110.913 1.00 26.77  ? 325  ARG A O   1 
ATOM   2353 C  CB  . ARG A 1 296 ? 25.661  100.379 113.434 1.00 20.62  ? 325  ARG A CB  1 
ATOM   2354 C  CG  . ARG A 1 296 ? 24.874  101.050 112.349 1.00 17.92  ? 325  ARG A CG  1 
ATOM   2355 C  CD  . ARG A 1 296 ? 24.790  102.542 112.574 1.00 28.64  ? 325  ARG A CD  1 
ATOM   2356 N  NE  . ARG A 1 296 ? 26.135  103.103 112.777 1.00 29.67  ? 325  ARG A NE  1 
ATOM   2357 C  CZ  . ARG A 1 296 ? 26.249  104.284 113.415 1.00 36.27  ? 325  ARG A CZ  1 
ATOM   2358 N  NH1 . ARG A 1 296 ? 25.135  104.880 113.823 1.00 28.62  ? 325  ARG A NH1 1 
ATOM   2359 N  NH2 . ARG A 1 296 ? 27.436  104.832 113.635 1.00 41.00  ? 325  ARG A NH2 1 
ATOM   2360 N  N   . ASP A 1 297 ? 28.744  99.703  112.614 1.00 20.40  ? 326  ASP A N   1 
ATOM   2361 C  CA  . ASP A 1 297 ? 29.864  99.943  111.706 1.00 20.40  ? 326  ASP A CA  1 
ATOM   2362 C  C   . ASP A 1 297 ? 30.904  98.852  111.733 1.00 22.54  ? 326  ASP A C   1 
ATOM   2363 O  O   . ASP A 1 297 ? 31.759  98.757  110.842 1.00 23.83  ? 326  ASP A O   1 
ATOM   2364 C  CB  . ASP A 1 297 ? 30.511  101.287 112.058 1.00 25.80  ? 326  ASP A CB  1 
ATOM   2365 C  CG  . ASP A 1 297 ? 29.440  102.288 112.474 1.00 36.07  ? 326  ASP A CG  1 
ATOM   2366 O  OD1 . ASP A 1 297 ? 28.607  102.635 111.615 1.00 35.56  ? 326  ASP A OD1 1 
ATOM   2367 O  OD2 . ASP A 1 297 ? 29.408  102.715 113.642 1.00 36.71  ? 326  ASP A OD2 1 
ATOM   2368 N  N   . LYS A 1 298 ? 30.902  98.036  112.784 1.00 22.81  ? 327  LYS A N   1 
ATOM   2369 C  CA  . LYS A 1 298 ? 31.929  97.006  112.923 1.00 23.65  ? 327  LYS A CA  1 
ATOM   2370 C  C   . LYS A 1 298 ? 33.363  97.493  112.803 1.00 24.12  ? 327  LYS A C   1 
ATOM   2371 O  O   . LYS A 1 298 ? 34.230  96.678  112.473 1.00 29.38  ? 327  LYS A O   1 
ATOM   2372 C  CB  . LYS A 1 298 ? 31.619  95.864  111.964 1.00 16.68  ? 327  LYS A CB  1 
ATOM   2373 C  CG  . LYS A 1 298 ? 30.239  95.243  112.161 1.00 28.22  ? 327  LYS A CG  1 
ATOM   2374 C  CD  . LYS A 1 298 ? 29.641  94.716  110.867 1.00 25.51  ? 327  LYS A CD  1 
ATOM   2375 C  CE  . LYS A 1 298 ? 28.622  95.667  110.265 1.00 38.39  ? 327  LYS A CE  1 
ATOM   2376 N  NZ  . LYS A 1 298 ? 27.258  95.068  110.231 1.00 34.36  ? 327  LYS A NZ  1 
ATOM   2377 N  N   . LYS A 1 299 ? 33.788  98.644  113.288 1.00 18.67  ? 328  LYS A N   1 
ATOM   2378 C  CA  . LYS A 1 299 ? 35.165  99.097  113.316 1.00 17.11  ? 328  LYS A CA  1 
ATOM   2379 C  C   . LYS A 1 299 ? 35.800  98.947  114.715 1.00 18.13  ? 328  LYS A C   1 
ATOM   2380 O  O   . LYS A 1 299 ? 35.371  99.624  115.652 1.00 16.51  ? 328  LYS A O   1 
ATOM   2381 C  CB  . LYS A 1 299 ? 35.120  100.565 112.946 1.00 26.45  ? 328  LYS A CB  1 
ATOM   2382 C  CG  . LYS A 1 299 ? 35.702  100.967 111.624 1.00 31.55  ? 328  LYS A CG  1 
ATOM   2383 C  CD  . LYS A 1 299 ? 35.409  100.011 110.496 1.00 33.80  ? 328  LYS A CD  1 
ATOM   2384 C  CE  . LYS A 1 299 ? 35.688  100.683 109.149 1.00 37.08  ? 328  LYS A CE  1 
ATOM   2385 N  NZ  . LYS A 1 299 ? 36.976  100.188 108.569 1.00 49.22  ? 328  LYS A NZ  1 
ATOM   2386 N  N   . TYR A 1 300 ? 36.771  98.065  114.912 1.00 14.94  ? 329  TYR A N   1 
ATOM   2387 C  CA  . TYR A 1 300 ? 37.334  97.654  116.153 1.00 14.04  ? 329  TYR A CA  1 
ATOM   2388 C  C   . TYR A 1 300 ? 38.859  97.693  116.065 1.00 18.81  ? 329  TYR A C   1 
ATOM   2389 O  O   . TYR A 1 300 ? 39.333  97.648  114.923 1.00 22.47  ? 329  TYR A O   1 
ATOM   2390 C  CB  . TYR A 1 300 ? 36.890  96.234  116.562 1.00 15.72  ? 329  TYR A CB  1 
ATOM   2391 C  CG  . TYR A 1 300 ? 37.600  95.104  115.849 1.00 21.21  ? 329  TYR A CG  1 
ATOM   2392 C  CD1 . TYR A 1 300 ? 37.388  94.938  114.490 1.00 23.92  ? 329  TYR A CD1 1 
ATOM   2393 C  CD2 . TYR A 1 300 ? 38.463  94.219  116.494 1.00 21.26  ? 329  TYR A CD2 1 
ATOM   2394 C  CE1 . TYR A 1 300 ? 37.996  93.924  113.789 1.00 26.35  ? 329  TYR A CE1 1 
ATOM   2395 C  CE2 . TYR A 1 300 ? 39.071  93.213  115.802 1.00 26.46  ? 329  TYR A CE2 1 
ATOM   2396 C  CZ  . TYR A 1 300 ? 38.832  93.064  114.452 1.00 30.75  ? 329  TYR A CZ  1 
ATOM   2397 O  OH  . TYR A 1 300 ? 39.468  92.061  113.747 1.00 37.78  ? 329  TYR A OH  1 
ATOM   2398 N  N   . GLY A 1 301 ? 39.531  97.812  117.197 1.00 16.10  ? 330  GLY A N   1 
ATOM   2399 C  CA  . GLY A 1 301 ? 40.984  97.893  117.340 1.00 10.46  ? 330  GLY A CA  1 
ATOM   2400 C  C   . GLY A 1 301 ? 41.197  97.276  118.739 1.00 15.69  ? 330  GLY A C   1 
ATOM   2401 O  O   . GLY A 1 301 ? 40.145  97.225  119.387 1.00 17.51  ? 330  GLY A O   1 
ATOM   2402 N  N   . PHE A 1 302 ? 42.363  96.777  119.085 1.00 19.68  ? 331  PHE A N   1 
ATOM   2403 C  CA  . PHE A 1 302 ? 42.660  96.147  120.362 1.00 17.47  ? 331  PHE A CA  1 
ATOM   2404 C  C   . PHE A 1 302 ? 43.441  97.165  121.214 1.00 19.60  ? 331  PHE A C   1 
ATOM   2405 O  O   . PHE A 1 302 ? 44.052  98.071  120.648 1.00 17.85  ? 331  PHE A O   1 
ATOM   2406 C  CB  . PHE A 1 302 ? 43.485  94.875  120.215 1.00 11.46  ? 331  PHE A CB  1 
ATOM   2407 C  CG  . PHE A 1 302 ? 42.771  93.744  119.520 1.00 24.02  ? 331  PHE A CG  1 
ATOM   2408 C  CD1 . PHE A 1 302 ? 42.694  93.629  118.138 1.00 16.00  ? 331  PHE A CD1 1 
ATOM   2409 C  CD2 . PHE A 1 302 ? 42.141  92.762  120.271 1.00 26.14  ? 331  PHE A CD2 1 
ATOM   2410 C  CE1 . PHE A 1 302 ? 42.033  92.581  117.539 1.00 19.61  ? 331  PHE A CE1 1 
ATOM   2411 C  CE2 . PHE A 1 302 ? 41.447  91.717  119.686 1.00 11.56  ? 331  PHE A CE2 1 
ATOM   2412 C  CZ  . PHE A 1 302 ? 41.387  91.624  118.316 1.00 22.70  ? 331  PHE A CZ  1 
ATOM   2413 N  N   . CYS A 1 303 ? 43.386  96.939  122.521 1.00 20.25  ? 332  CYS A N   1 
ATOM   2414 C  CA  . CYS A 1 303 ? 43.898  97.794  123.566 1.00 14.35  ? 332  CYS A CA  1 
ATOM   2415 C  C   . CYS A 1 303 ? 44.877  97.028  124.448 1.00 17.34  ? 332  CYS A C   1 
ATOM   2416 O  O   . CYS A 1 303 ? 44.542  96.773  125.590 1.00 21.07  ? 332  CYS A O   1 
ATOM   2417 C  CB  . CYS A 1 303 ? 42.727  98.216  124.467 1.00 8.93   ? 332  CYS A CB  1 
ATOM   2418 S  SG  . CYS A 1 303 ? 41.330  99.046  123.604 1.00 17.52  ? 332  CYS A SG  1 
ATOM   2419 N  N   . PRO A 1 304 ? 46.070  96.723  123.972 1.00 15.64  ? 333  PRO A N   1 
ATOM   2420 C  CA  . PRO A 1 304 ? 46.977  95.842  124.612 1.00 14.32  ? 333  PRO A CA  1 
ATOM   2421 C  C   . PRO A 1 304 ? 47.588  96.286  125.906 1.00 14.79  ? 333  PRO A C   1 
ATOM   2422 O  O   . PRO A 1 304 ? 48.200  95.446  126.603 1.00 18.26  ? 333  PRO A O   1 
ATOM   2423 C  CB  . PRO A 1 304 ? 48.114  95.709  123.577 1.00 16.76  ? 333  PRO A CB  1 
ATOM   2424 C  CG  . PRO A 1 304 ? 47.400  95.882  122.269 1.00 16.86  ? 333  PRO A CG  1 
ATOM   2425 C  CD  . PRO A 1 304 ? 46.468  97.023  122.548 1.00 15.93  ? 333  PRO A CD  1 
ATOM   2426 N  N   . GLU A 1 305 ? 47.734  97.595  126.017 1.00 13.31  ? 334  GLU A N   1 
ATOM   2427 C  CA  . GLU A 1 305 ? 48.436  98.184  127.160 1.00 10.38  ? 334  GLU A CA  1 
ATOM   2428 C  C   . GLU A 1 305 ? 47.962  99.625  127.295 1.00 14.14  ? 334  GLU A C   1 
ATOM   2429 O  O   . GLU A 1 305 ? 47.479  100.210 126.310 1.00 18.21  ? 334  GLU A O   1 
ATOM   2430 C  CB  . GLU A 1 305 ? 49.956  98.206  126.991 1.00 7.45   ? 334  GLU A CB  1 
ATOM   2431 C  CG  . GLU A 1 305 ? 50.676  98.316  128.328 1.00 15.83  ? 334  GLU A CG  1 
ATOM   2432 C  CD  . GLU A 1 305 ? 52.186  98.408  128.242 1.00 16.71  ? 334  GLU A CD  1 
ATOM   2433 O  OE1 . GLU A 1 305 ? 52.735  98.418  127.120 1.00 11.32  ? 334  GLU A OE1 1 
ATOM   2434 O  OE2 . GLU A 1 305 ? 52.817  98.466  129.341 1.00 8.47   ? 334  GLU A OE2 1 
ATOM   2435 N  N   . THR A 1 306 ? 48.008  100.094 128.536 1.00 10.39  ? 335  THR A N   1 
ATOM   2436 C  CA  . THR A 1 306 ? 47.521  101.451 128.740 1.00 9.55   ? 335  THR A CA  1 
ATOM   2437 C  C   . THR A 1 306 ? 48.505  102.146 129.650 1.00 13.42  ? 335  THR A C   1 
ATOM   2438 O  O   . THR A 1 306 ? 48.577  101.647 130.764 1.00 17.11  ? 335  THR A O   1 
ATOM   2439 C  CB  . THR A 1 306 ? 46.134  101.419 129.397 1.00 16.92  ? 335  THR A CB  1 
ATOM   2440 O  OG1 . THR A 1 306 ? 45.155  101.047 128.398 1.00 23.74  ? 335  THR A OG1 1 
ATOM   2441 C  CG2 . THR A 1 306 ? 45.723  102.784 129.897 1.00 24.82  ? 335  THR A CG2 1 
ATOM   2442 N  N   . ALA A 1 307 ? 49.220  103.158 129.180 1.00 12.75  ? 336  ALA A N   1 
ATOM   2443 C  CA  . ALA A 1 307 ? 50.135  103.902 130.043 1.00 8.31   ? 336  ALA A CA  1 
ATOM   2444 C  C   . ALA A 1 307 ? 49.375  104.700 131.098 1.00 9.72   ? 336  ALA A C   1 
ATOM   2445 O  O   . ALA A 1 307 ? 48.515  105.492 130.723 1.00 12.52  ? 336  ALA A O   1 
ATOM   2446 C  CB  . ALA A 1 307 ? 50.850  104.924 129.184 1.00 2.00   ? 336  ALA A CB  1 
ATOM   2447 N  N   . MET A 1 308 ? 49.754  104.616 132.334 1.00 10.39  ? 337  MET A N   1 
ATOM   2448 C  CA  . MET A 1 308 ? 49.088  105.333 133.415 1.00 8.31   ? 337  MET A CA  1 
ATOM   2449 C  C   . MET A 1 308 ? 49.866  106.566 133.834 1.00 14.43  ? 337  MET A C   1 
ATOM   2450 O  O   . MET A 1 308 ? 51.093  106.645 133.644 1.00 19.71  ? 337  MET A O   1 
ATOM   2451 C  CB  . MET A 1 308 ? 49.035  104.412 134.624 1.00 14.69  ? 337  MET A CB  1 
ATOM   2452 C  CG  . MET A 1 308 ? 48.103  104.825 135.708 1.00 38.72  ? 337  MET A CG  1 
ATOM   2453 S  SD  . MET A 1 308 ? 46.991  103.474 136.137 1.00 83.74  ? 337  MET A SD  1 
ATOM   2454 C  CE  . MET A 1 308 ? 46.275  102.965 134.586 1.00 55.76  ? 337  MET A CE  1 
ATOM   2455 N  N   . SER A 1 309 ? 49.158  107.542 134.375 1.00 12.59  ? 338  SER A N   1 
ATOM   2456 C  CA  . SER A 1 309 ? 49.755  108.783 134.822 1.00 13.06  ? 338  SER A CA  1 
ATOM   2457 C  C   . SER A 1 309 ? 49.374  109.121 136.269 1.00 17.54  ? 338  SER A C   1 
ATOM   2458 O  O   . SER A 1 309 ? 50.198  109.491 137.105 1.00 19.00  ? 338  SER A O   1 
ATOM   2459 C  CB  . SER A 1 309 ? 49.419  109.939 133.906 1.00 14.60  ? 338  SER A CB  1 
ATOM   2460 O  OG  . SER A 1 309 ? 48.909  109.590 132.653 1.00 26.88  ? 338  SER A OG  1 
ATOM   2461 N  N   . THR A 1 310 ? 48.106  108.955 136.598 1.00 16.41  ? 339  THR A N   1 
ATOM   2462 C  CA  . THR A 1 310 ? 47.492  109.176 137.868 1.00 8.20   ? 339  THR A CA  1 
ATOM   2463 C  C   . THR A 1 310 ? 46.690  107.944 138.256 1.00 6.75   ? 339  THR A C   1 
ATOM   2464 O  O   . THR A 1 310 ? 45.958  107.358 137.453 1.00 8.78   ? 339  THR A O   1 
ATOM   2465 C  CB  . THR A 1 310 ? 46.503  110.371 137.764 1.00 14.93  ? 339  THR A CB  1 
ATOM   2466 O  OG1 . THR A 1 310 ? 47.183  111.455 138.388 1.00 12.14  ? 339  THR A OG1 1 
ATOM   2467 C  CG2 . THR A 1 310 ? 45.170  110.142 138.468 1.00 23.04  ? 339  THR A CG2 1 
ATOM   2468 N  N   . VAL A 1 311 ? 46.749  107.694 139.562 1.00 5.64   ? 340  VAL A N   1 
ATOM   2469 C  CA  . VAL A 1 311 ? 45.959  106.576 140.069 1.00 8.30   ? 340  VAL A CA  1 
ATOM   2470 C  C   . VAL A 1 311 ? 45.090  107.126 141.191 1.00 8.75   ? 340  VAL A C   1 
ATOM   2471 O  O   . VAL A 1 311 ? 45.613  107.987 141.905 1.00 13.64  ? 340  VAL A O   1 
ATOM   2472 C  CB  . VAL A 1 311 ? 46.816  105.419 140.599 1.00 22.33  ? 340  VAL A CB  1 
ATOM   2473 C  CG1 . VAL A 1 311 ? 45.887  104.201 140.750 1.00 18.45  ? 340  VAL A CG1 1 
ATOM   2474 C  CG2 . VAL A 1 311 ? 47.981  105.092 139.654 1.00 22.81  ? 340  VAL A CG2 1 
ATOM   2475 N  N   . GLY A 1 312 ? 43.852  106.722 141.285 1.00 4.42   ? 341  GLY A N   1 
ATOM   2476 C  CA  . GLY A 1 312 ? 42.931  107.187 142.267 1.00 8.49   ? 341  GLY A CA  1 
ATOM   2477 C  C   . GLY A 1 312 ? 42.694  108.675 142.287 1.00 15.58  ? 341  GLY A C   1 
ATOM   2478 O  O   . GLY A 1 312 ? 42.888  109.348 141.281 1.00 23.43  ? 341  GLY A O   1 
ATOM   2479 N  N   . GLY A 1 313 ? 42.437  109.238 143.471 1.00 17.22  ? 342  GLY A N   1 
ATOM   2480 C  CA  . GLY A 1 313 ? 42.220  110.678 143.608 1.00 14.57  ? 342  GLY A CA  1 
ATOM   2481 C  C   . GLY A 1 313 ? 40.914  110.991 142.876 1.00 16.07  ? 342  GLY A C   1 
ATOM   2482 O  O   . GLY A 1 313 ? 40.028  110.128 142.823 1.00 21.24  ? 342  GLY A O   1 
ATOM   2483 N  N   . ASN A 1 314 ? 40.700  112.164 142.313 1.00 12.53  ? 343  ASN A N   1 
ATOM   2484 C  CA  . ASN A 1 314 ? 39.471  112.424 141.610 1.00 13.73  ? 343  ASN A CA  1 
ATOM   2485 C  C   . ASN A 1 314 ? 39.670  112.688 140.130 1.00 17.69  ? 343  ASN A C   1 
ATOM   2486 O  O   . ASN A 1 314 ? 38.731  113.141 139.455 1.00 25.86  ? 343  ASN A O   1 
ATOM   2487 C  CB  . ASN A 1 314 ? 38.785  113.678 142.172 1.00 2.45   ? 343  ASN A CB  1 
ATOM   2488 C  CG  . ASN A 1 314 ? 39.812  114.736 142.477 1.00 24.92  ? 343  ASN A CG  1 
ATOM   2489 O  OD1 . ASN A 1 314 ? 39.567  115.548 143.360 1.00 31.25  ? 343  ASN A OD1 1 
ATOM   2490 N  ND2 . ASN A 1 314 ? 40.935  114.734 141.761 1.00 33.72  ? 343  ASN A ND2 1 
ATOM   2491 N  N   . SER A 1 315 ? 40.854  112.697 139.592 1.00 16.44  ? 344  SER A N   1 
ATOM   2492 C  CA  . SER A 1 315 ? 41.057  113.158 138.226 1.00 15.36  ? 344  SER A CA  1 
ATOM   2493 C  C   . SER A 1 315 ? 40.889  112.051 137.205 1.00 19.93  ? 344  SER A C   1 
ATOM   2494 O  O   . SER A 1 315 ? 41.190  112.253 136.011 1.00 19.61  ? 344  SER A O   1 
ATOM   2495 C  CB  . SER A 1 315 ? 42.480  113.732 138.157 1.00 13.33  ? 344  SER A CB  1 
ATOM   2496 O  OG  . SER A 1 315 ? 42.614  114.788 139.126 1.00 20.21  ? 344  SER A OG  1 
ATOM   2497 N  N   . GLU A 1 316 ? 40.538  110.868 137.692 1.00 19.67  ? 345  GLU A N   1 
ATOM   2498 C  CA  . GLU A 1 316 ? 40.297  109.729 136.820 1.00 17.96  ? 345  GLU A CA  1 
ATOM   2499 C  C   . GLU A 1 316 ? 41.512  109.428 135.993 1.00 20.02  ? 345  GLU A C   1 
ATOM   2500 O  O   . GLU A 1 316 ? 41.350  109.135 134.833 1.00 22.98  ? 345  GLU A O   1 
ATOM   2501 C  CB  . GLU A 1 316 ? 39.141  110.008 135.890 1.00 23.63  ? 345  GLU A CB  1 
ATOM   2502 C  CG  . GLU A 1 316 ? 37.775  109.736 136.524 1.00 22.77  ? 345  GLU A CG  1 
ATOM   2503 C  CD  . GLU A 1 316 ? 36.766  110.767 136.052 1.00 34.02  ? 345  GLU A CD  1 
ATOM   2504 O  OE1 . GLU A 1 316 ? 36.639  110.863 134.794 1.00 32.48  ? 345  GLU A OE1 1 
ATOM   2505 O  OE2 . GLU A 1 316 ? 36.177  111.425 136.947 1.00 46.36  ? 345  GLU A OE2 1 
ATOM   2506 N  N   . GLY A 1 317 ? 42.685  109.585 136.598 1.00 24.92  ? 346  GLY A N   1 
ATOM   2507 C  CA  . GLY A 1 317 ? 43.902  109.179 135.865 1.00 24.99  ? 346  GLY A CA  1 
ATOM   2508 C  C   . GLY A 1 317 ? 44.400  110.292 134.973 1.00 22.82  ? 346  GLY A C   1 
ATOM   2509 O  O   . GLY A 1 317 ? 45.291  110.045 134.162 1.00 25.92  ? 346  GLY A O   1 
ATOM   2510 N  N   . ALA A 1 318 ? 43.892  111.500 135.196 1.00 19.21  ? 347  ALA A N   1 
ATOM   2511 C  CA  . ALA A 1 318 ? 44.384  112.599 134.347 1.00 18.18  ? 347  ALA A CA  1 
ATOM   2512 C  C   . ALA A 1 318 ? 45.873  112.734 134.657 1.00 19.06  ? 347  ALA A C   1 
ATOM   2513 O  O   . ALA A 1 318 ? 46.259  112.305 135.755 1.00 22.86  ? 347  ALA A O   1 
ATOM   2514 C  CB  . ALA A 1 318 ? 43.669  113.878 134.726 1.00 26.40  ? 347  ALA A CB  1 
ATOM   2515 N  N   . PRO A 1 319 ? 46.635  113.299 133.755 1.00 16.42  ? 348  PRO A N   1 
ATOM   2516 C  CA  . PRO A 1 319 ? 48.076  113.474 133.905 1.00 15.29  ? 348  PRO A CA  1 
ATOM   2517 C  C   . PRO A 1 319 ? 48.400  114.572 134.887 1.00 14.99  ? 348  PRO A C   1 
ATOM   2518 O  O   . PRO A 1 319 ? 47.587  115.461 135.072 1.00 18.32  ? 348  PRO A O   1 
ATOM   2519 C  CB  . PRO A 1 319 ? 48.584  113.853 132.519 1.00 12.94  ? 348  PRO A CB  1 
ATOM   2520 C  CG  . PRO A 1 319 ? 47.446  113.533 131.601 1.00 15.56  ? 348  PRO A CG  1 
ATOM   2521 C  CD  . PRO A 1 319 ? 46.177  113.696 132.404 1.00 14.34  ? 348  PRO A CD  1 
ATOM   2522 N  N   . CYS A 1 320 ? 49.614  114.609 135.473 1.00 16.18  ? 349  CYS A N   1 
ATOM   2523 C  CA  . CYS A 1 320 ? 49.835  115.713 136.388 1.00 16.95  ? 349  CYS A CA  1 
ATOM   2524 C  C   . CYS A 1 320 ? 50.112  116.977 135.574 1.00 19.84  ? 349  CYS A C   1 
ATOM   2525 O  O   . CYS A 1 320 ? 50.364  116.892 134.379 1.00 19.28  ? 349  CYS A O   1 
ATOM   2526 C  CB  . CYS A 1 320 ? 50.956  115.536 137.386 1.00 11.97  ? 349  CYS A CB  1 
ATOM   2527 S  SG  . CYS A 1 320 ? 51.007  113.964 138.190 1.00 13.22  ? 349  CYS A SG  1 
ATOM   2528 N  N   . VAL A 1 321 ? 50.115  118.089 136.316 1.00 20.17  ? 350  VAL A N   1 
ATOM   2529 C  CA  . VAL A 1 321 ? 50.419  119.385 135.715 1.00 18.35  ? 350  VAL A CA  1 
ATOM   2530 C  C   . VAL A 1 321 ? 51.540  120.015 136.516 1.00 21.18  ? 350  VAL A C   1 
ATOM   2531 O  O   . VAL A 1 321 ? 51.524  120.114 137.746 1.00 22.39  ? 350  VAL A O   1 
ATOM   2532 C  CB  . VAL A 1 321 ? 49.207  120.327 135.728 1.00 27.40  ? 350  VAL A CB  1 
ATOM   2533 C  CG1 . VAL A 1 321 ? 49.646  121.742 135.442 1.00 19.63  ? 350  VAL A CG1 1 
ATOM   2534 C  CG2 . VAL A 1 321 ? 48.106  119.868 134.792 1.00 22.50  ? 350  VAL A CG2 1 
ATOM   2535 N  N   . PHE A 1 322 ? 52.552  120.430 135.763 1.00 21.75  ? 351  PHE A N   1 
ATOM   2536 C  CA  . PHE A 1 322 ? 53.756  120.972 136.413 1.00 17.80  ? 351  PHE A CA  1 
ATOM   2537 C  C   . PHE A 1 322 ? 54.111  122.259 135.711 1.00 19.67  ? 351  PHE A C   1 
ATOM   2538 O  O   . PHE A 1 322 ? 54.089  122.268 134.465 1.00 17.51  ? 351  PHE A O   1 
ATOM   2539 C  CB  . PHE A 1 322 ? 54.876  119.903 136.278 1.00 12.41  ? 351  PHE A CB  1 
ATOM   2540 C  CG  . PHE A 1 322 ? 54.737  118.684 137.130 1.00 6.50   ? 351  PHE A CG  1 
ATOM   2541 C  CD1 . PHE A 1 322 ? 54.559  118.778 138.505 1.00 21.70  ? 351  PHE A CD1 1 
ATOM   2542 C  CD2 . PHE A 1 322 ? 54.708  117.414 136.621 1.00 21.87  ? 351  PHE A CD2 1 
ATOM   2543 C  CE1 . PHE A 1 322 ? 54.430  117.688 139.325 1.00 14.58  ? 351  PHE A CE1 1 
ATOM   2544 C  CE2 . PHE A 1 322 ? 54.553  116.282 137.413 1.00 10.20  ? 351  PHE A CE2 1 
ATOM   2545 C  CZ  . PHE A 1 322 ? 54.424  116.406 138.773 1.00 11.78  ? 351  PHE A CZ  1 
ATOM   2546 N  N   . PRO A 1 323 ? 54.414  123.307 136.451 1.00 18.92  ? 352  PRO A N   1 
ATOM   2547 C  CA  . PRO A 1 323 ? 54.379  123.314 137.892 1.00 18.12  ? 352  PRO A CA  1 
ATOM   2548 C  C   . PRO A 1 323 ? 52.933  123.480 138.347 1.00 18.08  ? 352  PRO A C   1 
ATOM   2549 O  O   . PRO A 1 323 ? 52.179  124.062 137.569 1.00 20.36  ? 352  PRO A O   1 
ATOM   2550 C  CB  . PRO A 1 323 ? 55.169  124.569 138.258 1.00 14.50  ? 352  PRO A CB  1 
ATOM   2551 C  CG  . PRO A 1 323 ? 54.830  125.511 137.169 1.00 11.30  ? 352  PRO A CG  1 
ATOM   2552 C  CD  . PRO A 1 323 ? 54.747  124.657 135.949 1.00 14.31  ? 352  PRO A CD  1 
ATOM   2553 N  N   . PHE A 1 324 ? 52.637  123.060 139.563 1.00 18.04  ? 353  PHE A N   1 
ATOM   2554 C  CA  . PHE A 1 324 ? 51.292  123.163 140.115 1.00 16.63  ? 353  PHE A CA  1 
ATOM   2555 C  C   . PHE A 1 324 ? 51.348  123.839 141.461 1.00 16.83  ? 353  PHE A C   1 
ATOM   2556 O  O   . PHE A 1 324 ? 52.407  123.875 142.104 1.00 16.02  ? 353  PHE A O   1 
ATOM   2557 C  CB  . PHE A 1 324 ? 50.522  121.847 140.145 1.00 6.85   ? 353  PHE A CB  1 
ATOM   2558 C  CG  . PHE A 1 324 ? 50.873  120.892 141.224 1.00 11.79  ? 353  PHE A CG  1 
ATOM   2559 C  CD1 . PHE A 1 324 ? 50.468  121.106 142.540 1.00 10.86  ? 353  PHE A CD1 1 
ATOM   2560 C  CD2 . PHE A 1 324 ? 51.642  119.772 140.919 1.00 11.32  ? 353  PHE A CD2 1 
ATOM   2561 C  CE1 . PHE A 1 324 ? 50.844  120.208 143.533 1.00 15.84  ? 353  PHE A CE1 1 
ATOM   2562 C  CE2 . PHE A 1 324 ? 52.005  118.878 141.915 1.00 17.44  ? 353  PHE A CE2 1 
ATOM   2563 C  CZ  . PHE A 1 324 ? 51.616  119.107 143.213 1.00 15.26  ? 353  PHE A CZ  1 
ATOM   2564 N  N   . THR A 1 325 ? 50.286  124.618 141.780 1.00 17.04  ? 354  THR A N   1 
ATOM   2565 C  CA  . THR A 1 325 ? 50.490  125.351 143.058 1.00 19.93  ? 354  THR A CA  1 
ATOM   2566 C  C   . THR A 1 325 ? 49.567  124.715 144.062 1.00 22.43  ? 354  THR A C   1 
ATOM   2567 O  O   . THR A 1 325 ? 48.481  124.261 143.703 1.00 25.09  ? 354  THR A O   1 
ATOM   2568 C  CB  . THR A 1 325 ? 50.354  126.855 142.899 1.00 19.12  ? 354  THR A CB  1 
ATOM   2569 O  OG1 . THR A 1 325 ? 48.991  127.260 143.019 1.00 47.37  ? 354  THR A OG1 1 
ATOM   2570 C  CG2 . THR A 1 325 ? 50.808  127.249 141.486 1.00 23.12  ? 354  THR A CG2 1 
ATOM   2571 N  N   . PHE A 1 326 ? 50.119  124.388 145.219 1.00 24.46  ? 355  PHE A N   1 
ATOM   2572 C  CA  . PHE A 1 326 ? 49.314  123.726 146.242 1.00 25.66  ? 355  PHE A CA  1 
ATOM   2573 C  C   . PHE A 1 326 ? 49.619  124.473 147.544 1.00 27.86  ? 355  PHE A C   1 
ATOM   2574 O  O   . PHE A 1 326 ? 50.795  124.716 147.785 1.00 28.49  ? 355  PHE A O   1 
ATOM   2575 C  CB  . PHE A 1 326 ? 49.670  122.265 146.413 1.00 23.53  ? 355  PHE A CB  1 
ATOM   2576 C  CG  . PHE A 1 326 ? 49.088  121.716 147.694 1.00 27.23  ? 355  PHE A CG  1 
ATOM   2577 C  CD1 . PHE A 1 326 ? 47.729  121.421 147.771 1.00 26.69  ? 355  PHE A CD1 1 
ATOM   2578 C  CD2 . PHE A 1 326 ? 49.899  121.489 148.786 1.00 16.10  ? 355  PHE A CD2 1 
ATOM   2579 C  CE1 . PHE A 1 326 ? 47.175  120.911 148.935 1.00 20.68  ? 355  PHE A CE1 1 
ATOM   2580 C  CE2 . PHE A 1 326 ? 49.355  120.979 149.949 1.00 21.25  ? 355  PHE A CE2 1 
ATOM   2581 C  CZ  . PHE A 1 326 ? 47.997  120.710 150.029 1.00 25.43  ? 355  PHE A CZ  1 
ATOM   2582 N  N   . LEU A 1 327 ? 48.582  124.942 148.202 1.00 30.48  ? 356  LEU A N   1 
ATOM   2583 C  CA  . LEU A 1 327 ? 48.743  125.744 149.406 1.00 31.52  ? 356  LEU A CA  1 
ATOM   2584 C  C   . LEU A 1 327 ? 49.766  126.845 149.237 1.00 32.12  ? 356  LEU A C   1 
ATOM   2585 O  O   . LEU A 1 327 ? 50.623  127.098 150.091 1.00 35.32  ? 356  LEU A O   1 
ATOM   2586 C  CB  . LEU A 1 327 ? 49.052  124.894 150.634 1.00 22.78  ? 356  LEU A CB  1 
ATOM   2587 C  CG  . LEU A 1 327 ? 47.933  123.967 151.128 1.00 24.51  ? 356  LEU A CG  1 
ATOM   2588 C  CD1 . LEU A 1 327 ? 48.284  123.500 152.542 1.00 34.81  ? 356  LEU A CD1 1 
ATOM   2589 C  CD2 . LEU A 1 327 ? 46.622  124.705 151.115 1.00 26.17  ? 356  LEU A CD2 1 
ATOM   2590 N  N   . GLY A 1 328 ? 49.688  127.619 148.161 1.00 30.90  ? 357  GLY A N   1 
ATOM   2591 C  CA  . GLY A 1 328 ? 50.557  128.785 148.060 1.00 28.53  ? 357  GLY A CA  1 
ATOM   2592 C  C   . GLY A 1 328 ? 51.994  128.448 147.762 1.00 26.82  ? 357  GLY A C   1 
ATOM   2593 O  O   . GLY A 1 328 ? 52.859  129.346 147.723 1.00 28.60  ? 357  GLY A O   1 
ATOM   2594 N  N   . ASN A 1 329 ? 52.288  127.188 147.428 1.00 22.76  ? 358  ASN A N   1 
ATOM   2595 C  CA  . ASN A 1 329 ? 53.680  126.911 147.026 1.00 21.10  ? 358  ASN A CA  1 
ATOM   2596 C  C   . ASN A 1 329 ? 53.679  126.182 145.691 1.00 22.06  ? 358  ASN A C   1 
ATOM   2597 O  O   . ASN A 1 329 ? 52.662  125.572 145.334 1.00 24.76  ? 358  ASN A O   1 
ATOM   2598 C  CB  . ASN A 1 329 ? 54.504  126.209 148.047 1.00 17.58  ? 358  ASN A CB  1 
ATOM   2599 C  CG  . ASN A 1 329 ? 54.087  126.205 149.489 1.00 41.78  ? 358  ASN A CG  1 
ATOM   2600 O  OD1 . ASN A 1 329 ? 54.320  127.193 150.193 1.00 47.34  ? 358  ASN A OD1 1 
ATOM   2601 N  ND2 . ASN A 1 329 ? 53.470  125.106 149.967 1.00 43.85  ? 358  ASN A ND2 1 
ATOM   2602 N  N   . LYS A 1 330 ? 54.767  126.313 144.922 1.00 22.91  ? 359  LYS A N   1 
ATOM   2603 C  CA  . LYS A 1 330 ? 54.768  125.640 143.615 1.00 24.96  ? 359  LYS A CA  1 
ATOM   2604 C  C   . LYS A 1 330 ? 55.539  124.319 143.785 1.00 25.83  ? 359  LYS A C   1 
ATOM   2605 O  O   . LYS A 1 330 ? 56.556  124.407 144.470 1.00 27.24  ? 359  LYS A O   1 
ATOM   2606 C  CB  . LYS A 1 330 ? 55.443  126.420 142.500 1.00 23.86  ? 359  LYS A CB  1 
ATOM   2607 C  CG  . LYS A 1 330 ? 56.711  125.767 141.936 1.00 12.67  ? 359  LYS A CG  1 
ATOM   2608 C  CD  . LYS A 1 330 ? 57.254  126.503 140.715 1.00 9.83   ? 359  LYS A CD  1 
ATOM   2609 C  CE  . LYS A 1 330 ? 58.674  126.938 140.830 1.00 25.63  ? 359  LYS A CE  1 
ATOM   2610 N  NZ  . LYS A 1 330 ? 59.177  127.769 139.706 1.00 33.96  ? 359  LYS A NZ  1 
ATOM   2611 N  N   . TYR A 1 331 ? 55.010  123.276 143.204 1.00 25.43  ? 360  TYR A N   1 
ATOM   2612 C  CA  . TYR A 1 331 ? 55.499  121.918 143.101 1.00 20.83  ? 360  TYR A CA  1 
ATOM   2613 C  C   . TYR A 1 331 ? 55.718  121.590 141.612 1.00 24.51  ? 360  TYR A C   1 
ATOM   2614 O  O   . TYR A 1 331 ? 54.900  121.893 140.730 1.00 22.42  ? 360  TYR A O   1 
ATOM   2615 C  CB  . TYR A 1 331 ? 54.493  120.956 143.734 1.00 20.01  ? 360  TYR A CB  1 
ATOM   2616 C  CG  . TYR A 1 331 ? 54.241  121.296 145.195 1.00 18.99  ? 360  TYR A CG  1 
ATOM   2617 C  CD1 . TYR A 1 331 ? 53.242  122.220 145.501 1.00 21.29  ? 360  TYR A CD1 1 
ATOM   2618 C  CD2 . TYR A 1 331 ? 54.959  120.719 146.239 1.00 13.02  ? 360  TYR A CD2 1 
ATOM   2619 C  CE1 . TYR A 1 331 ? 52.969  122.588 146.799 1.00 22.76  ? 360  TYR A CE1 1 
ATOM   2620 C  CE2 . TYR A 1 331 ? 54.698  121.057 147.549 1.00 15.06  ? 360  TYR A CE2 1 
ATOM   2621 C  CZ  . TYR A 1 331 ? 53.714  121.992 147.813 1.00 24.95  ? 360  TYR A CZ  1 
ATOM   2622 O  OH  . TYR A 1 331 ? 53.432  122.403 149.105 1.00 30.73  ? 360  TYR A OH  1 
ATOM   2623 N  N   . GLU A 1 332 ? 56.919  121.087 141.291 1.00 24.86  ? 361  GLU A N   1 
ATOM   2624 C  CA  . GLU A 1 332 ? 57.324  120.717 139.954 1.00 23.10  ? 361  GLU A CA  1 
ATOM   2625 C  C   . GLU A 1 332 ? 57.513  119.194 139.835 1.00 24.82  ? 361  GLU A C   1 
ATOM   2626 O  O   . GLU A 1 332 ? 57.872  118.688 138.773 1.00 27.84  ? 361  GLU A O   1 
ATOM   2627 C  CB  . GLU A 1 332 ? 58.690  121.335 139.671 1.00 36.50  ? 361  GLU A CB  1 
ATOM   2628 C  CG  . GLU A 1 332 ? 58.746  122.844 139.757 1.00 43.38  ? 361  GLU A CG  1 
ATOM   2629 C  CD  . GLU A 1 332 ? 59.696  123.307 140.842 1.00 48.32  ? 361  GLU A CD  1 
ATOM   2630 O  OE1 . GLU A 1 332 ? 59.622  122.893 142.020 1.00 54.80  ? 361  GLU A OE1 1 
ATOM   2631 O  OE2 . GLU A 1 332 ? 60.575  124.118 140.516 1.00 55.06  ? 361  GLU A OE2 1 
ATOM   2632 N  N   . SER A 1 333 ? 57.201  118.501 140.899 1.00 23.57  ? 362  SER A N   1 
ATOM   2633 C  CA  . SER A 1 333 ? 57.279  117.059 141.009 1.00 26.72  ? 362  SER A CA  1 
ATOM   2634 C  C   . SER A 1 333 ? 56.211  116.628 142.034 1.00 31.75  ? 362  SER A C   1 
ATOM   2635 O  O   . SER A 1 333 ? 55.817  117.536 142.784 1.00 33.40  ? 362  SER A O   1 
ATOM   2636 C  CB  . SER A 1 333 ? 58.634  116.725 141.626 1.00 26.91  ? 362  SER A CB  1 
ATOM   2637 O  OG  . SER A 1 333 ? 59.576  116.396 140.639 1.00 44.72  ? 362  SER A OG  1 
ATOM   2638 N  N   . CYS A 1 334 ? 55.871  115.346 142.084 1.00 30.73  ? 363  CYS A N   1 
ATOM   2639 C  CA  . CYS A 1 334 ? 54.844  114.934 143.051 1.00 34.85  ? 363  CYS A CA  1 
ATOM   2640 C  C   . CYS A 1 334 ? 55.310  115.102 144.482 1.00 35.29  ? 363  CYS A C   1 
ATOM   2641 O  O   . CYS A 1 334 ? 56.425  114.692 144.762 1.00 40.86  ? 363  CYS A O   1 
ATOM   2642 C  CB  . CYS A 1 334 ? 54.510  113.443 142.866 1.00 33.32  ? 363  CYS A CB  1 
ATOM   2643 S  SG  . CYS A 1 334 ? 54.426  112.937 141.143 1.00 26.10  ? 363  CYS A SG  1 
ATOM   2644 N  N   . THR A 1 335 ? 54.536  115.613 145.405 1.00 34.39  ? 364  THR A N   1 
ATOM   2645 C  CA  . THR A 1 335 ? 54.995  115.662 146.776 1.00 37.87  ? 364  THR A CA  1 
ATOM   2646 C  C   . THR A 1 335 ? 53.988  115.014 147.704 1.00 39.45  ? 364  THR A C   1 
ATOM   2647 O  O   . THR A 1 335 ? 52.956  114.544 147.237 1.00 46.14  ? 364  THR A O   1 
ATOM   2648 C  CB  . THR A 1 335 ? 55.262  117.083 147.305 1.00 53.02  ? 364  THR A CB  1 
ATOM   2649 O  OG1 . THR A 1 335 ? 55.869  116.965 148.615 1.00 64.65  ? 364  THR A OG1 1 
ATOM   2650 C  CG2 . THR A 1 335 ? 53.963  117.819 147.434 1.00 31.87  ? 364  THR A CG2 1 
ATOM   2651 N  N   . SER A 1 336 ? 54.272  115.004 148.983 1.00 35.23  ? 365  SER A N   1 
ATOM   2652 C  CA  . SER A 1 336 ? 53.335  114.446 149.942 1.00 32.47  ? 365  SER A CA  1 
ATOM   2653 C  C   . SER A 1 336 ? 52.711  115.561 150.766 1.00 32.61  ? 365  SER A C   1 
ATOM   2654 O  O   . SER A 1 336 ? 52.153  115.360 151.834 1.00 33.12  ? 365  SER A O   1 
ATOM   2655 C  CB  . SER A 1 336 ? 54.095  113.452 150.817 1.00 35.64  ? 365  SER A CB  1 
ATOM   2656 O  OG  . SER A 1 336 ? 54.462  114.073 152.040 1.00 46.47  ? 365  SER A OG  1 
ATOM   2657 N  N   . ALA A 1 337 ? 52.798  116.805 150.309 1.00 33.43  ? 366  ALA A N   1 
ATOM   2658 C  CA  . ALA A 1 337 ? 52.220  117.875 151.122 1.00 35.41  ? 366  ALA A CA  1 
ATOM   2659 C  C   . ALA A 1 337 ? 50.758  117.607 151.438 1.00 38.72  ? 366  ALA A C   1 
ATOM   2660 O  O   . ALA A 1 337 ? 49.919  117.457 150.561 1.00 40.00  ? 366  ALA A O   1 
ATOM   2661 C  CB  . ALA A 1 337 ? 52.392  119.206 150.398 1.00 21.76  ? 366  ALA A CB  1 
ATOM   2662 N  N   . GLY A 1 338 ? 50.409  117.548 152.710 1.00 41.84  ? 367  GLY A N   1 
ATOM   2663 C  CA  . GLY A 1 338 ? 49.071  117.430 153.212 1.00 45.43  ? 367  GLY A CA  1 
ATOM   2664 C  C   . GLY A 1 338 ? 48.679  116.025 153.636 1.00 48.95  ? 367  GLY A C   1 
ATOM   2665 O  O   . GLY A 1 338 ? 47.662  115.901 154.345 1.00 52.30  ? 367  GLY A O   1 
ATOM   2666 N  N   . ARG A 1 339 ? 49.404  115.058 153.095 1.00 48.86  ? 368  ARG A N   1 
ATOM   2667 C  CA  . ARG A 1 339 ? 49.198  113.643 153.373 1.00 49.88  ? 368  ARG A CA  1 
ATOM   2668 C  C   . ARG A 1 339 ? 50.170  113.256 154.503 1.00 50.17  ? 368  ARG A C   1 
ATOM   2669 O  O   . ARG A 1 339 ? 51.350  113.630 154.461 1.00 49.33  ? 368  ARG A O   1 
ATOM   2670 C  CB  . ARG A 1 339 ? 49.421  112.778 152.164 1.00 51.98  ? 368  ARG A CB  1 
ATOM   2671 C  CG  . ARG A 1 339 ? 48.659  112.906 150.879 1.00 56.22  ? 368  ARG A CG  1 
ATOM   2672 C  CD  . ARG A 1 339 ? 48.442  111.454 150.338 1.00 57.56  ? 368  ARG A CD  1 
ATOM   2673 N  NE  . ARG A 1 339 ? 47.513  110.864 151.309 1.00 61.77  ? 368  ARG A NE  1 
ATOM   2674 C  CZ  . ARG A 1 339 ? 46.273  110.583 150.958 1.00 70.24  ? 368  ARG A CZ  1 
ATOM   2675 N  NH1 . ARG A 1 339 ? 45.911  110.789 149.709 1.00 73.39  ? 368  ARG A NH1 1 
ATOM   2676 N  NH2 . ARG A 1 339 ? 45.425  110.090 151.833 1.00 85.65  ? 368  ARG A NH2 1 
ATOM   2677 N  N   . SER A 1 340 ? 49.683  112.516 155.493 1.00 49.61  ? 369  SER A N   1 
ATOM   2678 C  CA  . SER A 1 340 ? 50.564  112.094 156.586 1.00 48.70  ? 369  SER A CA  1 
ATOM   2679 C  C   . SER A 1 340 ? 51.059  110.673 156.366 1.00 49.63  ? 369  SER A C   1 
ATOM   2680 O  O   . SER A 1 340 ? 51.593  110.076 157.296 1.00 53.01  ? 369  SER A O   1 
ATOM   2681 C  CB  . SER A 1 340 ? 49.781  112.068 157.901 1.00 57.44  ? 369  SER A CB  1 
ATOM   2682 O  OG  . SER A 1 340 ? 48.628  111.234 157.741 1.00 67.57  ? 369  SER A OG  1 
ATOM   2683 N  N   . ASP A 1 341 ? 50.777  110.118 155.198 1.00 48.76  ? 370  ASP A N   1 
ATOM   2684 C  CA  . ASP A 1 341 ? 51.116  108.723 154.930 1.00 43.76  ? 370  ASP A CA  1 
ATOM   2685 C  C   . ASP A 1 341 ? 52.245  108.555 153.942 1.00 38.60  ? 370  ASP A C   1 
ATOM   2686 O  O   . ASP A 1 341 ? 52.367  107.474 153.353 1.00 39.94  ? 370  ASP A O   1 
ATOM   2687 C  CB  . ASP A 1 341 ? 49.853  108.017 154.415 1.00 46.31  ? 370  ASP A CB  1 
ATOM   2688 C  CG  . ASP A 1 341 ? 49.424  108.525 153.062 1.00 43.66  ? 370  ASP A CG  1 
ATOM   2689 O  OD1 . ASP A 1 341 ? 50.214  109.163 152.339 1.00 44.46  ? 370  ASP A OD1 1 
ATOM   2690 O  OD2 . ASP A 1 341 ? 48.250  108.275 152.724 1.00 47.03  ? 370  ASP A OD2 1 
ATOM   2691 N  N   . GLY A 1 342 ? 52.978  109.621 153.643 1.00 33.96  ? 371  GLY A N   1 
ATOM   2692 C  CA  . GLY A 1 342 ? 54.089  109.559 152.719 1.00 28.53  ? 371  GLY A CA  1 
ATOM   2693 C  C   . GLY A 1 342 ? 53.731  109.209 151.300 1.00 28.94  ? 371  GLY A C   1 
ATOM   2694 O  O   . GLY A 1 342 ? 54.611  109.202 150.435 1.00 29.36  ? 371  GLY A O   1 
ATOM   2695 N  N   . LYS A 1 343 ? 52.456  108.966 150.974 1.00 29.27  ? 372  LYS A N   1 
ATOM   2696 C  CA  . LYS A 1 343 ? 52.057  108.680 149.603 1.00 24.98  ? 372  LYS A CA  1 
ATOM   2697 C  C   . LYS A 1 343 ? 52.217  109.959 148.778 1.00 26.05  ? 372  LYS A C   1 
ATOM   2698 O  O   . LYS A 1 343 ? 51.829  111.015 149.272 1.00 29.84  ? 372  LYS A O   1 
ATOM   2699 C  CB  . LYS A 1 343 ? 50.609  108.269 149.529 1.00 23.31  ? 372  LYS A CB  1 
ATOM   2700 C  CG  . LYS A 1 343 ? 50.301  106.803 149.824 1.00 22.76  ? 372  LYS A CG  1 
ATOM   2701 C  CD  . LYS A 1 343 ? 48.793  106.705 150.114 1.00 31.83  ? 372  LYS A CD  1 
ATOM   2702 C  CE  . LYS A 1 343 ? 48.099  105.613 149.343 1.00 40.54  ? 372  LYS A CE  1 
ATOM   2703 N  NZ  . LYS A 1 343 ? 47.791  105.988 147.928 1.00 48.26  ? 372  LYS A NZ  1 
ATOM   2704 N  N   . MET A 1 344 ? 52.732  109.833 147.592 1.00 26.61  ? 373  MET A N   1 
ATOM   2705 C  CA  . MET A 1 344 ? 52.975  110.885 146.633 1.00 25.48  ? 373  MET A CA  1 
ATOM   2706 C  C   . MET A 1 344 ? 51.859  111.097 145.626 1.00 27.21  ? 373  MET A C   1 
ATOM   2707 O  O   . MET A 1 344 ? 51.430  110.203 144.897 1.00 29.40  ? 373  MET A O   1 
ATOM   2708 C  CB  . MET A 1 344 ? 54.269  110.527 145.857 1.00 24.78  ? 373  MET A CB  1 
ATOM   2709 C  CG  . MET A 1 344 ? 55.406  110.162 146.821 1.00 18.03  ? 373  MET A CG  1 
ATOM   2710 S  SD  . MET A 1 344 ? 56.230  111.693 147.387 1.00 26.93  ? 373  MET A SD  1 
ATOM   2711 C  CE  . MET A 1 344 ? 57.136  111.978 145.847 1.00 28.77  ? 373  MET A CE  1 
ATOM   2712 N  N   . TRP A 1 345 ? 51.451  112.365 145.508 1.00 29.82  ? 374  TRP A N   1 
ATOM   2713 C  CA  . TRP A 1 345 ? 50.381  112.771 144.592 1.00 26.42  ? 374  TRP A CA  1 
ATOM   2714 C  C   . TRP A 1 345 ? 50.743  114.083 143.886 1.00 24.47  ? 374  TRP A C   1 
ATOM   2715 O  O   . TRP A 1 345 ? 51.679  114.740 144.298 1.00 24.23  ? 374  TRP A O   1 
ATOM   2716 C  CB  . TRP A 1 345 ? 49.166  113.118 145.445 1.00 18.07  ? 374  TRP A CB  1 
ATOM   2717 C  CG  . TRP A 1 345 ? 49.413  114.340 146.284 1.00 11.56  ? 374  TRP A CG  1 
ATOM   2718 C  CD1 . TRP A 1 345 ? 50.061  114.437 147.457 1.00 22.12  ? 374  TRP A CD1 1 
ATOM   2719 C  CD2 . TRP A 1 345 ? 48.917  115.658 146.022 1.00 26.55  ? 374  TRP A CD2 1 
ATOM   2720 N  NE1 . TRP A 1 345 ? 50.040  115.728 147.963 1.00 9.61   ? 374  TRP A NE1 1 
ATOM   2721 C  CE2 . TRP A 1 345 ? 49.313  116.485 147.091 1.00 23.92  ? 374  TRP A CE2 1 
ATOM   2722 C  CE3 . TRP A 1 345 ? 48.183  116.206 144.965 1.00 11.99  ? 374  TRP A CE3 1 
ATOM   2723 C  CZ2 . TRP A 1 345 ? 49.005  117.846 147.161 1.00 20.68  ? 374  TRP A CZ2 1 
ATOM   2724 C  CZ3 . TRP A 1 345 ? 47.901  117.557 145.037 1.00 23.09  ? 374  TRP A CZ3 1 
ATOM   2725 C  CH2 . TRP A 1 345 ? 48.295  118.346 146.129 1.00 19.92  ? 374  TRP A CH2 1 
ATOM   2726 N  N   . CYS A 1 346 ? 49.909  114.491 142.943 1.00 22.28  ? 375  CYS A N   1 
ATOM   2727 C  CA  . CYS A 1 346 ? 50.144  115.771 142.274 1.00 21.16  ? 375  CYS A CA  1 
ATOM   2728 C  C   . CYS A 1 346 ? 48.791  116.338 141.855 1.00 19.48  ? 375  CYS A C   1 
ATOM   2729 O  O   . CYS A 1 346 ? 47.801  115.605 141.804 1.00 15.40  ? 375  CYS A O   1 
ATOM   2730 C  CB  . CYS A 1 346 ? 50.912  115.481 140.949 1.00 11.50  ? 375  CYS A CB  1 
ATOM   2731 S  SG  . CYS A 1 346 ? 49.838  114.356 140.001 1.00 19.35  ? 375  CYS A SG  1 
ATOM   2732 N  N   . ALA A 1 347 ? 48.777  117.643 141.592 1.00 18.69  ? 376  ALA A N   1 
ATOM   2733 C  CA  . ALA A 1 347 ? 47.511  118.181 141.070 1.00 15.49  ? 376  ALA A CA  1 
ATOM   2734 C  C   . ALA A 1 347 ? 47.412  117.814 139.594 1.00 14.64  ? 376  ALA A C   1 
ATOM   2735 O  O   . ALA A 1 347 ? 48.378  117.795 138.849 1.00 13.01  ? 376  ALA A O   1 
ATOM   2736 C  CB  . ALA A 1 347 ? 47.521  119.686 141.169 1.00 10.17  ? 376  ALA A CB  1 
ATOM   2737 N  N   . THR A 1 348 ? 46.186  117.733 139.106 1.00 16.82  ? 377  THR A N   1 
ATOM   2738 C  CA  . THR A 1 348 ? 46.021  117.555 137.669 1.00 15.76  ? 377  THR A CA  1 
ATOM   2739 C  C   . THR A 1 348 ? 45.604  118.887 137.074 1.00 17.66  ? 377  THR A C   1 
ATOM   2740 O  O   . THR A 1 348 ? 44.920  118.869 136.042 1.00 19.91  ? 377  THR A O   1 
ATOM   2741 C  CB  . THR A 1 348 ? 44.950  116.507 137.364 1.00 10.98  ? 377  THR A CB  1 
ATOM   2742 O  OG1 . THR A 1 348 ? 43.812  116.792 138.218 1.00 30.54  ? 377  THR A OG1 1 
ATOM   2743 C  CG2 . THR A 1 348 ? 45.456  115.135 137.776 1.00 17.25  ? 377  THR A CG2 1 
ATOM   2744 N  N   . THR A 1 349 ? 45.885  120.021 137.715 1.00 13.88  ? 378  THR A N   1 
ATOM   2745 C  CA  . THR A 1 349 ? 45.617  121.290 137.027 1.00 16.01  ? 378  THR A CA  1 
ATOM   2746 C  C   . THR A 1 349 ? 46.704  122.294 137.414 1.00 15.71  ? 378  THR A C   1 
ATOM   2747 O  O   . THR A 1 349 ? 47.353  122.073 138.435 1.00 17.88  ? 378  THR A O   1 
ATOM   2748 C  CB  . THR A 1 349 ? 44.292  122.015 137.266 1.00 9.39   ? 378  THR A CB  1 
ATOM   2749 O  OG1 . THR A 1 349 ? 44.167  122.387 138.654 1.00 18.57  ? 378  THR A OG1 1 
ATOM   2750 C  CG2 . THR A 1 349 ? 43.097  121.249 136.804 1.00 20.99  ? 378  THR A CG2 1 
ATOM   2751 N  N   . ALA A 1 350 ? 46.714  123.512 136.867 1.00 12.51  ? 379  ALA A N   1 
ATOM   2752 C  CA  . ALA A 1 350 ? 47.844  124.346 137.312 1.00 14.48  ? 379  ALA A CA  1 
ATOM   2753 C  C   . ALA A 1 350 ? 47.759  124.761 138.765 1.00 17.74  ? 379  ALA A C   1 
ATOM   2754 O  O   . ALA A 1 350 ? 48.790  125.167 139.339 1.00 17.02  ? 379  ALA A O   1 
ATOM   2755 C  CB  . ALA A 1 350 ? 48.071  125.535 136.441 1.00 6.99   ? 379  ALA A CB  1 
ATOM   2756 N  N   . ASN A 1 351 ? 46.571  124.587 139.357 1.00 20.50  ? 380  ASN A N   1 
ATOM   2757 C  CA  . ASN A 1 351 ? 46.398  125.132 140.719 1.00 20.28  ? 380  ASN A CA  1 
ATOM   2758 C  C   . ASN A 1 351 ? 45.498  124.286 141.562 1.00 19.13  ? 380  ASN A C   1 
ATOM   2759 O  O   . ASN A 1 351 ? 44.349  123.996 141.216 1.00 21.98  ? 380  ASN A O   1 
ATOM   2760 C  CB  . ASN A 1 351 ? 45.787  126.550 140.548 1.00 9.31   ? 380  ASN A CB  1 
ATOM   2761 C  CG  . ASN A 1 351 ? 45.730  127.243 141.889 1.00 15.16  ? 380  ASN A CG  1 
ATOM   2762 O  OD1 . ASN A 1 351 ? 45.179  126.662 142.829 1.00 30.18  ? 380  ASN A OD1 1 
ATOM   2763 N  ND2 . ASN A 1 351 ? 46.287  128.435 141.976 1.00 16.01  ? 380  ASN A ND2 1 
ATOM   2764 N  N   . TYR A 1 352 ? 45.968  123.819 142.715 1.00 18.16  ? 381  TYR A N   1 
ATOM   2765 C  CA  . TYR A 1 352 ? 45.073  122.866 143.395 1.00 21.21  ? 381  TYR A CA  1 
ATOM   2766 C  C   . TYR A 1 352 ? 44.054  123.645 144.213 1.00 22.65  ? 381  TYR A C   1 
ATOM   2767 O  O   . TYR A 1 352 ? 42.951  123.150 144.465 1.00 29.48  ? 381  TYR A O   1 
ATOM   2768 C  CB  . TYR A 1 352 ? 45.831  121.863 144.223 1.00 21.29  ? 381  TYR A CB  1 
ATOM   2769 C  CG  . TYR A 1 352 ? 44.966  121.061 145.169 1.00 22.16  ? 381  TYR A CG  1 
ATOM   2770 C  CD1 . TYR A 1 352 ? 44.523  121.632 146.351 1.00 23.45  ? 381  TYR A CD1 1 
ATOM   2771 C  CD2 . TYR A 1 352 ? 44.608  119.751 144.901 1.00 23.79  ? 381  TYR A CD2 1 
ATOM   2772 C  CE1 . TYR A 1 352 ? 43.730  120.911 147.223 1.00 24.90  ? 381  TYR A CE1 1 
ATOM   2773 C  CE2 . TYR A 1 352 ? 43.831  119.006 145.769 1.00 22.44  ? 381  TYR A CE2 1 
ATOM   2774 C  CZ  . TYR A 1 352 ? 43.389  119.601 146.927 1.00 22.92  ? 381  TYR A CZ  1 
ATOM   2775 O  OH  . TYR A 1 352 ? 42.606  118.930 147.829 1.00 23.06  ? 381  TYR A OH  1 
ATOM   2776 N  N   . ASP A 1 353 ? 44.544  124.747 144.706 1.00 20.05  ? 382  ASP A N   1 
ATOM   2777 C  CA  . ASP A 1 353 ? 43.852  125.725 145.526 1.00 21.56  ? 382  ASP A CA  1 
ATOM   2778 C  C   . ASP A 1 353 ? 42.574  126.137 144.802 1.00 21.75  ? 382  ASP A C   1 
ATOM   2779 O  O   . ASP A 1 353 ? 41.457  125.901 145.267 1.00 19.81  ? 382  ASP A O   1 
ATOM   2780 C  CB  . ASP A 1 353 ? 44.756  126.924 145.829 1.00 15.73  ? 382  ASP A CB  1 
ATOM   2781 C  CG  . ASP A 1 353 ? 45.832  126.659 146.866 1.00 33.29  ? 382  ASP A CG  1 
ATOM   2782 O  OD1 . ASP A 1 353 ? 45.915  125.568 147.470 1.00 31.91  ? 382  ASP A OD1 1 
ATOM   2783 O  OD2 . ASP A 1 353 ? 46.666  127.557 147.156 1.00 43.80  ? 382  ASP A OD2 1 
ATOM   2784 N  N   . ASP A 1 354 ? 42.685  126.501 143.526 1.00 21.70  ? 383  ASP A N   1 
ATOM   2785 C  CA  . ASP A 1 354 ? 41.475  126.807 142.790 1.00 21.81  ? 383  ASP A CA  1 
ATOM   2786 C  C   . ASP A 1 354 ? 40.640  125.607 142.387 1.00 23.51  ? 383  ASP A C   1 
ATOM   2787 O  O   . ASP A 1 354 ? 39.423  125.687 142.196 1.00 28.85  ? 383  ASP A O   1 
ATOM   2788 C  CB  . ASP A 1 354 ? 41.841  127.563 141.518 1.00 21.32  ? 383  ASP A CB  1 
ATOM   2789 C  CG  . ASP A 1 354 ? 42.675  128.805 141.689 1.00 13.73  ? 383  ASP A CG  1 
ATOM   2790 O  OD1 . ASP A 1 354 ? 42.705  129.404 142.776 1.00 24.42  ? 383  ASP A OD1 1 
ATOM   2791 O  OD2 . ASP A 1 354 ? 43.289  129.128 140.635 1.00 13.25  ? 383  ASP A OD2 1 
ATOM   2792 N  N   . ASP A 1 355 ? 41.208  124.483 141.976 1.00 23.61  ? 384  ASP A N   1 
ATOM   2793 C  CA  . ASP A 1 355 ? 40.389  123.442 141.356 1.00 22.24  ? 384  ASP A CA  1 
ATOM   2794 C  C   . ASP A 1 355 ? 40.143  122.211 142.211 1.00 21.88  ? 384  ASP A C   1 
ATOM   2795 O  O   . ASP A 1 355 ? 39.163  121.475 142.016 1.00 19.26  ? 384  ASP A O   1 
ATOM   2796 C  CB  . ASP A 1 355 ? 41.085  123.017 140.037 1.00 20.09  ? 384  ASP A CB  1 
ATOM   2797 C  CG  . ASP A 1 355 ? 41.370  124.216 139.150 1.00 27.11  ? 384  ASP A CG  1 
ATOM   2798 O  OD1 . ASP A 1 355 ? 40.442  125.044 138.953 1.00 25.57  ? 384  ASP A OD1 1 
ATOM   2799 O  OD2 . ASP A 1 355 ? 42.517  124.348 138.675 1.00 30.32  ? 384  ASP A OD2 1 
ATOM   2800 N  N   . ARG A 1 356 ? 41.038  121.953 143.160 1.00 21.64  ? 385  ARG A N   1 
ATOM   2801 C  CA  . ARG A 1 356 ? 41.064  120.784 143.991 1.00 18.13  ? 385  ARG A CA  1 
ATOM   2802 C  C   . ARG A 1 356 ? 41.072  119.473 143.227 1.00 18.64  ? 385  ARG A C   1 
ATOM   2803 O  O   . ARG A 1 356 ? 40.502  118.495 143.702 1.00 20.76  ? 385  ARG A O   1 
ATOM   2804 C  CB  . ARG A 1 356 ? 39.869  120.785 144.927 1.00 20.24  ? 385  ARG A CB  1 
ATOM   2805 C  CG  . ARG A 1 356 ? 39.684  122.085 145.632 1.00 39.67  ? 385  ARG A CG  1 
ATOM   2806 C  CD  . ARG A 1 356 ? 40.470  122.385 146.874 1.00 47.16  ? 385  ARG A CD  1 
ATOM   2807 N  NE  . ARG A 1 356 ? 40.325  123.811 147.142 1.00 60.18  ? 385  ARG A NE  1 
ATOM   2808 C  CZ  . ARG A 1 356 ? 40.678  124.589 148.118 1.00 69.12  ? 385  ARG A CZ  1 
ATOM   2809 N  NH1 . ARG A 1 356 ? 41.320  124.150 149.200 1.00 82.33  ? 385  ARG A NH1 1 
ATOM   2810 N  NH2 . ARG A 1 356 ? 40.405  125.896 148.057 1.00 71.29  ? 385  ARG A NH2 1 
ATOM   2811 N  N   . LYS A 1 357 ? 41.756  119.389 142.097 1.00 17.28  ? 386  LYS A N   1 
ATOM   2812 C  CA  . LYS A 1 357 ? 41.841  118.136 141.370 1.00 16.61  ? 386  LYS A CA  1 
ATOM   2813 C  C   . LYS A 1 357 ? 43.252  117.558 141.484 1.00 16.79  ? 386  LYS A C   1 
ATOM   2814 O  O   . LYS A 1 357 ? 44.225  118.220 141.131 1.00 14.81  ? 386  LYS A O   1 
ATOM   2815 C  CB  . LYS A 1 357 ? 41.511  118.374 139.904 1.00 12.97  ? 386  LYS A CB  1 
ATOM   2816 C  CG  . LYS A 1 357 ? 40.165  118.972 139.642 1.00 17.68  ? 386  LYS A CG  1 
ATOM   2817 C  CD  . LYS A 1 357 ? 38.992  118.097 140.049 1.00 19.57  ? 386  LYS A CD  1 
ATOM   2818 C  CE  . LYS A 1 357 ? 38.809  116.899 139.126 1.00 35.92  ? 386  LYS A CE  1 
ATOM   2819 N  NZ  . LYS A 1 357 ? 39.732  115.777 139.529 1.00 51.36  ? 386  LYS A NZ  1 
ATOM   2820 N  N   . TRP A 1 358 ? 43.328  116.297 141.899 1.00 16.03  ? 387  TRP A N   1 
ATOM   2821 C  CA  . TRP A 1 358 ? 44.640  115.684 142.083 1.00 13.57  ? 387  TRP A CA  1 
ATOM   2822 C  C   . TRP A 1 358 ? 44.549  114.184 141.839 1.00 10.91  ? 387  TRP A C   1 
ATOM   2823 O  O   . TRP A 1 358 ? 43.447  113.706 141.602 1.00 9.82   ? 387  TRP A O   1 
ATOM   2824 C  CB  . TRP A 1 358 ? 45.032  115.859 143.572 1.00 27.38  ? 387  TRP A CB  1 
ATOM   2825 C  CG  . TRP A 1 358 ? 44.100  115.043 144.431 1.00 20.74  ? 387  TRP A CG  1 
ATOM   2826 C  CD1 . TRP A 1 358 ? 42.840  115.398 144.801 1.00 16.87  ? 387  TRP A CD1 1 
ATOM   2827 C  CD2 . TRP A 1 358 ? 44.343  113.759 145.002 1.00 17.87  ? 387  TRP A CD2 1 
ATOM   2828 N  NE1 . TRP A 1 358 ? 42.288  114.429 145.598 1.00 10.23  ? 387  TRP A NE1 1 
ATOM   2829 C  CE2 . TRP A 1 358 ? 43.188  113.404 145.727 1.00 8.63   ? 387  TRP A CE2 1 
ATOM   2830 C  CE3 . TRP A 1 358 ? 45.437  112.879 144.992 1.00 33.70  ? 387  TRP A CE3 1 
ATOM   2831 C  CZ2 . TRP A 1 358 ? 43.081  112.203 146.402 1.00 5.66   ? 387  TRP A CZ2 1 
ATOM   2832 C  CZ3 . TRP A 1 358 ? 45.343  111.674 145.681 1.00 28.30  ? 387  TRP A CZ3 1 
ATOM   2833 C  CH2 . TRP A 1 358 ? 44.167  111.364 146.368 1.00 13.47  ? 387  TRP A CH2 1 
ATOM   2834 N  N   . GLY A 1 359 ? 45.673  113.506 142.038 1.00 8.91   ? 388  GLY A N   1 
ATOM   2835 C  CA  . GLY A 1 359 ? 45.755  112.080 141.790 1.00 8.81   ? 388  GLY A CA  1 
ATOM   2836 C  C   . GLY A 1 359 ? 47.060  111.533 142.295 1.00 9.99   ? 388  GLY A C   1 
ATOM   2837 O  O   . GLY A 1 359 ? 47.969  112.310 142.586 1.00 15.73  ? 388  GLY A O   1 
ATOM   2838 N  N   . PHE A 1 360 ? 47.134  110.240 142.549 1.00 10.91  ? 389  PHE A N   1 
ATOM   2839 C  CA  . PHE A 1 360 ? 48.394  109.665 143.058 1.00 10.23  ? 389  PHE A CA  1 
ATOM   2840 C  C   . PHE A 1 360 ? 49.305  109.373 141.890 1.00 10.48  ? 389  PHE A C   1 
ATOM   2841 O  O   . PHE A 1 360 ? 48.718  109.033 140.857 1.00 13.98  ? 389  PHE A O   1 
ATOM   2842 C  CB  . PHE A 1 360 ? 48.063  108.335 143.719 1.00 8.82   ? 389  PHE A CB  1 
ATOM   2843 C  CG  . PHE A 1 360 ? 47.610  108.579 145.125 1.00 12.52  ? 389  PHE A CG  1 
ATOM   2844 C  CD1 . PHE A 1 360 ? 48.502  109.181 146.009 1.00 23.08  ? 389  PHE A CD1 1 
ATOM   2845 C  CD2 . PHE A 1 360 ? 46.349  108.250 145.512 1.00 9.90   ? 389  PHE A CD2 1 
ATOM   2846 C  CE1 . PHE A 1 360 ? 48.108  109.434 147.317 1.00 13.46  ? 389  PHE A CE1 1 
ATOM   2847 C  CE2 . PHE A 1 360 ? 45.955  108.504 146.815 1.00 12.87  ? 389  PHE A CE2 1 
ATOM   2848 C  CZ  . PHE A 1 360 ? 46.834  109.088 147.679 1.00 2.09   ? 389  PHE A CZ  1 
ATOM   2849 N  N   . CYS A 1 361 ? 50.597  109.550 142.033 1.00 11.98  ? 390  CYS A N   1 
ATOM   2850 C  CA  . CYS A 1 361 ? 51.505  109.231 140.929 1.00 13.81  ? 390  CYS A CA  1 
ATOM   2851 C  C   . CYS A 1 361 ? 51.943  107.780 141.002 1.00 17.83  ? 390  CYS A C   1 
ATOM   2852 O  O   . CYS A 1 361 ? 51.852  107.099 142.029 1.00 20.40  ? 390  CYS A O   1 
ATOM   2853 C  CB  . CYS A 1 361 ? 52.703  110.154 140.957 1.00 9.15   ? 390  CYS A CB  1 
ATOM   2854 S  SG  . CYS A 1 361 ? 52.419  111.767 141.692 1.00 23.51  ? 390  CYS A SG  1 
ATOM   2855 N  N   . PRO A 1 362 ? 52.300  107.205 139.877 1.00 19.31  ? 391  PRO A N   1 
ATOM   2856 C  CA  . PRO A 1 362 ? 52.690  105.800 139.865 1.00 23.32  ? 391  PRO A CA  1 
ATOM   2857 C  C   . PRO A 1 362 ? 53.810  105.555 140.866 1.00 24.86  ? 391  PRO A C   1 
ATOM   2858 O  O   . PRO A 1 362 ? 54.664  106.411 141.041 1.00 27.36  ? 391  PRO A O   1 
ATOM   2859 C  CB  . PRO A 1 362 ? 53.106  105.556 138.440 1.00 24.09  ? 391  PRO A CB  1 
ATOM   2860 C  CG  . PRO A 1 362 ? 52.448  106.633 137.654 1.00 23.12  ? 391  PRO A CG  1 
ATOM   2861 C  CD  . PRO A 1 362 ? 52.365  107.819 138.559 1.00 20.68  ? 391  PRO A CD  1 
ATOM   2862 N  N   . ASP A 1 363 ? 53.728  104.474 141.607 1.00 26.03  ? 392  ASP A N   1 
ATOM   2863 C  CA  . ASP A 1 363 ? 54.721  104.060 142.602 1.00 25.85  ? 392  ASP A CA  1 
ATOM   2864 C  C   . ASP A 1 363 ? 55.517  102.879 142.043 1.00 22.21  ? 392  ASP A C   1 
ATOM   2865 O  O   . ASP A 1 363 ? 55.452  102.613 140.846 1.00 20.84  ? 392  ASP A O   1 
ATOM   2866 C  CB  . ASP A 1 363 ? 54.055  103.713 143.928 1.00 31.14  ? 392  ASP A CB  1 
ATOM   2867 C  CG  . ASP A 1 363 ? 53.135  102.512 143.892 1.00 45.61  ? 392  ASP A CG  1 
ATOM   2868 O  OD1 . ASP A 1 363 ? 52.703  102.117 142.778 1.00 45.45  ? 392  ASP A OD1 1 
ATOM   2869 O  OD2 . ASP A 1 363 ? 52.837  101.974 144.984 1.00 51.91  ? 392  ASP A OD2 1 
ATOM   2870 N  N   . GLN A 1 364 ? 56.265  102.152 142.853 1.00 23.32  ? 393  GLN A N   1 
ATOM   2871 C  CA  . GLN A 1 364 ? 57.114  101.090 142.268 1.00 25.01  ? 393  GLN A CA  1 
ATOM   2872 C  C   . GLN A 1 364 ? 56.298  99.917  141.825 1.00 25.43  ? 393  GLN A C   1 
ATOM   2873 O  O   . GLN A 1 364 ? 56.537  99.267  140.813 1.00 24.59  ? 393  GLN A O   1 
ATOM   2874 C  CB  . GLN A 1 364 ? 58.295  100.794 143.186 1.00 27.63  ? 393  GLN A CB  1 
ATOM   2875 C  CG  . GLN A 1 364 ? 59.634  100.857 142.434 1.00 44.83  ? 393  GLN A CG  1 
ATOM   2876 C  CD  . GLN A 1 364 ? 60.228  102.233 142.360 1.00 58.10  ? 393  GLN A CD  1 
ATOM   2877 O  OE1 . GLN A 1 364 ? 59.876  103.067 143.207 1.00 76.78  ? 393  GLN A OE1 1 
ATOM   2878 N  NE2 . GLN A 1 364 ? 61.105  102.540 141.409 1.00 64.36  ? 393  GLN A NE2 1 
ATOM   2879 N  N   . GLY A 1 365 ? 55.071  99.776  142.353 1.00 29.12  ? 394  GLY A N   1 
ATOM   2880 C  CA  . GLY A 1 365 ? 54.226  98.670  141.850 1.00 25.49  ? 394  GLY A CA  1 
ATOM   2881 C  C   . GLY A 1 365 ? 54.727  97.400  142.520 1.00 24.81  ? 394  GLY A C   1 
ATOM   2882 O  O   . GLY A 1 365 ? 55.296  97.458  143.602 1.00 30.24  ? 394  GLY A O   1 
ATOM   2883 N  N   . TYR A 1 366 ? 54.385  96.247  142.014 1.00 21.64  ? 395  TYR A N   1 
ATOM   2884 C  CA  . TYR A 1 366 ? 54.815  94.942  142.458 1.00 16.40  ? 395  TYR A CA  1 
ATOM   2885 C  C   . TYR A 1 366 ? 55.108  94.098  141.194 1.00 18.79  ? 395  TYR A C   1 
ATOM   2886 O  O   . TYR A 1 366 ? 54.284  94.159  140.286 1.00 17.06  ? 395  TYR A O   1 
ATOM   2887 C  CB  . TYR A 1 366 ? 53.754  94.190  143.245 1.00 8.11   ? 395  TYR A CB  1 
ATOM   2888 C  CG  . TYR A 1 366 ? 53.255  94.990  144.418 1.00 10.69  ? 395  TYR A CG  1 
ATOM   2889 C  CD1 . TYR A 1 366 ? 52.172  95.834  144.242 1.00 6.17   ? 395  TYR A CD1 1 
ATOM   2890 C  CD2 . TYR A 1 366 ? 53.842  94.917  145.680 1.00 14.70  ? 395  TYR A CD2 1 
ATOM   2891 C  CE1 . TYR A 1 366 ? 51.667  96.552  145.291 1.00 6.20   ? 395  TYR A CE1 1 
ATOM   2892 C  CE2 . TYR A 1 366 ? 53.347  95.662  146.744 1.00 11.10  ? 395  TYR A CE2 1 
ATOM   2893 C  CZ  . TYR A 1 366 ? 52.255  96.478  146.527 1.00 8.44   ? 395  TYR A CZ  1 
ATOM   2894 O  OH  . TYR A 1 366 ? 51.747  97.251  147.549 1.00 10.45  ? 395  TYR A OH  1 
ATOM   2895 N  N   . SER A 1 367 ? 56.236  93.378  141.205 1.00 18.50  ? 396  SER A N   1 
ATOM   2896 C  CA  . SER A 1 367 ? 56.562  92.510  140.099 1.00 16.51  ? 396  SER A CA  1 
ATOM   2897 C  C   . SER A 1 367 ? 55.506  91.412  139.933 1.00 16.05  ? 396  SER A C   1 
ATOM   2898 O  O   . SER A 1 367 ? 55.109  90.681  140.839 1.00 11.02  ? 396  SER A O   1 
ATOM   2899 C  CB  . SER A 1 367 ? 57.922  91.849  140.415 1.00 23.12  ? 396  SER A CB  1 
ATOM   2900 O  OG  . SER A 1 367 ? 58.104  90.742  139.505 1.00 37.12  ? 396  SER A OG  1 
ATOM   2901 N  N   . LEU A 1 368 ? 55.019  91.241  138.714 1.00 18.67  ? 397  LEU A N   1 
ATOM   2902 C  CA  . LEU A 1 368 ? 54.057  90.138  138.507 1.00 22.84  ? 397  LEU A CA  1 
ATOM   2903 C  C   . LEU A 1 368 ? 54.887  88.853  138.605 1.00 26.23  ? 397  LEU A C   1 
ATOM   2904 O  O   . LEU A 1 368 ? 54.482  87.859  139.201 1.00 26.47  ? 397  LEU A O   1 
ATOM   2905 C  CB  . LEU A 1 368 ? 53.395  90.258  137.158 1.00 27.05  ? 397  LEU A CB  1 
ATOM   2906 C  CG  . LEU A 1 368 ? 52.389  89.209  136.689 1.00 18.74  ? 397  LEU A CG  1 
ATOM   2907 C  CD1 . LEU A 1 368 ? 51.153  89.173  137.578 1.00 6.11   ? 397  LEU A CD1 1 
ATOM   2908 C  CD2 . LEU A 1 368 ? 51.936  89.545  135.263 1.00 11.29  ? 397  LEU A CD2 1 
ATOM   2909 N  N   . PHE A 1 369 ? 56.142  89.015  138.141 1.00 26.92  ? 398  PHE A N   1 
ATOM   2910 C  CA  . PHE A 1 369 ? 57.046  87.861  138.173 1.00 27.27  ? 398  PHE A CA  1 
ATOM   2911 C  C   . PHE A 1 369 ? 57.088  87.324  139.592 1.00 27.54  ? 398  PHE A C   1 
ATOM   2912 O  O   . PHE A 1 369 ? 56.775  86.191  139.858 1.00 31.06  ? 398  PHE A O   1 
ATOM   2913 C  CB  . PHE A 1 369 ? 58.454  88.210  137.748 1.00 25.02  ? 398  PHE A CB  1 
ATOM   2914 C  CG  . PHE A 1 369 ? 59.505  87.237  138.196 1.00 42.36  ? 398  PHE A CG  1 
ATOM   2915 C  CD1 . PHE A 1 369 ? 59.713  86.057  137.505 1.00 47.33  ? 398  PHE A CD1 1 
ATOM   2916 C  CD2 . PHE A 1 369 ? 60.302  87.507  139.302 1.00 44.81  ? 398  PHE A CD2 1 
ATOM   2917 C  CE1 . PHE A 1 369 ? 60.692  85.168  137.914 1.00 42.05  ? 398  PHE A CE1 1 
ATOM   2918 C  CE2 . PHE A 1 369 ? 61.274  86.613  139.716 1.00 34.18  ? 398  PHE A CE2 1 
ATOM   2919 C  CZ  . PHE A 1 369 ? 61.463  85.440  139.026 1.00 21.51  ? 398  PHE A CZ  1 
ATOM   2920 N  N   . LEU A 1 370 ? 57.564  88.150  140.516 1.00 26.47  ? 399  LEU A N   1 
ATOM   2921 C  CA  . LEU A 1 370 ? 57.722  87.576  141.866 1.00 22.45  ? 399  LEU A CA  1 
ATOM   2922 C  C   . LEU A 1 370 ? 56.359  87.106  142.299 1.00 23.54  ? 399  LEU A C   1 
ATOM   2923 O  O   . LEU A 1 370 ? 56.174  85.895  142.379 1.00 28.46  ? 399  LEU A O   1 
ATOM   2924 C  CB  . LEU A 1 370 ? 58.325  88.606  142.790 1.00 15.31  ? 399  LEU A CB  1 
ATOM   2925 C  CG  . LEU A 1 370 ? 59.770  89.028  142.461 1.00 23.01  ? 399  LEU A CG  1 
ATOM   2926 C  CD1 . LEU A 1 370 ? 60.268  89.940  143.580 1.00 25.62  ? 399  LEU A CD1 1 
ATOM   2927 C  CD2 . LEU A 1 370 ? 60.679  87.814  142.350 1.00 17.58  ? 399  LEU A CD2 1 
ATOM   2928 N  N   . VAL A 1 371 ? 55.373  87.984  142.361 1.00 21.36  ? 400  VAL A N   1 
ATOM   2929 C  CA  . VAL A 1 371 ? 54.051  87.629  142.835 1.00 19.90  ? 400  VAL A CA  1 
ATOM   2930 C  C   . VAL A 1 371 ? 53.533  86.373  142.177 1.00 20.61  ? 400  VAL A C   1 
ATOM   2931 O  O   . VAL A 1 371 ? 52.972  85.489  142.813 1.00 18.60  ? 400  VAL A O   1 
ATOM   2932 C  CB  . VAL A 1 371 ? 53.021  88.760  142.727 1.00 31.67  ? 400  VAL A CB  1 
ATOM   2933 C  CG1 . VAL A 1 371 ? 51.718  88.318  143.409 1.00 29.91  ? 400  VAL A CG1 1 
ATOM   2934 C  CG2 . VAL A 1 371 ? 53.554  90.011  143.441 1.00 31.04  ? 400  VAL A CG2 1 
ATOM   2935 N  N   . ALA A 1 372 ? 53.813  86.228  140.887 1.00 23.98  ? 401  ALA A N   1 
ATOM   2936 C  CA  . ALA A 1 372 ? 53.384  84.984  140.238 1.00 28.40  ? 401  ALA A CA  1 
ATOM   2937 C  C   . ALA A 1 372 ? 54.117  83.772  140.809 1.00 32.46  ? 401  ALA A C   1 
ATOM   2938 O  O   . ALA A 1 372 ? 53.513  82.769  141.238 1.00 33.99  ? 401  ALA A O   1 
ATOM   2939 C  CB  . ALA A 1 372 ? 53.634  85.124  138.738 1.00 22.88  ? 401  ALA A CB  1 
ATOM   2940 N  N   . ALA A 1 373 ? 55.456  83.822  140.778 1.00 32.34  ? 402  ALA A N   1 
ATOM   2941 C  CA  . ALA A 1 373 ? 56.260  82.705  141.255 1.00 32.13  ? 402  ALA A CA  1 
ATOM   2942 C  C   . ALA A 1 373 ? 55.787  82.303  142.640 1.00 34.44  ? 402  ALA A C   1 
ATOM   2943 O  O   . ALA A 1 373 ? 55.499  81.115  142.868 1.00 38.83  ? 402  ALA A O   1 
ATOM   2944 C  CB  . ALA A 1 373 ? 57.731  82.997  141.192 1.00 18.75  ? 402  ALA A CB  1 
ATOM   2945 N  N   . HIS A 1 374 ? 55.537  83.255  143.535 1.00 32.65  ? 403  HIS A N   1 
ATOM   2946 C  CA  . HIS A 1 374 ? 55.031  82.853  144.847 1.00 32.01  ? 403  HIS A CA  1 
ATOM   2947 C  C   . HIS A 1 374 ? 53.661  82.202  144.799 1.00 28.39  ? 403  HIS A C   1 
ATOM   2948 O  O   . HIS A 1 374 ? 53.324  81.403  145.634 1.00 29.46  ? 403  HIS A O   1 
ATOM   2949 C  CB  . HIS A 1 374 ? 54.929  84.056  145.766 1.00 23.94  ? 403  HIS A CB  1 
ATOM   2950 C  CG  . HIS A 1 374 ? 54.203  83.804  147.043 1.00 16.32  ? 403  HIS A CG  1 
ATOM   2951 N  ND1 . HIS A 1 374 ? 54.862  83.938  148.263 1.00 21.25  ? 403  HIS A ND1 1 
ATOM   2952 C  CD2 . HIS A 1 374 ? 52.933  83.458  147.332 1.00 21.70  ? 403  HIS A CD2 1 
ATOM   2953 C  CE1 . HIS A 1 374 ? 54.005  83.709  149.253 1.00 17.36  ? 403  HIS A CE1 1 
ATOM   2954 N  NE2 . HIS A 1 374 ? 52.852  83.423  148.701 1.00 19.38  ? 403  HIS A NE2 1 
ATOM   2955 N  N   . ALA A 1 375 ? 52.757  82.771  144.050 1.00 32.39  ? 404  ALA A N   1 
ATOM   2956 C  CA  . ALA A 1 375 ? 51.384  82.257  144.011 1.00 36.02  ? 404  ALA A CA  1 
ATOM   2957 C  C   . ALA A 1 375 ? 51.437  80.843  143.428 1.00 37.24  ? 404  ALA A C   1 
ATOM   2958 O  O   . ALA A 1 375 ? 50.734  79.957  143.875 1.00 39.90  ? 404  ALA A O   1 
ATOM   2959 C  CB  . ALA A 1 375 ? 50.563  83.143  143.080 1.00 32.64  ? 404  ALA A CB  1 
ATOM   2960 N  N   . PHE A 1 376 ? 52.278  80.692  142.418 1.00 36.28  ? 405  PHE A N   1 
ATOM   2961 C  CA  . PHE A 1 376 ? 52.427  79.414  141.743 1.00 36.06  ? 405  PHE A CA  1 
ATOM   2962 C  C   . PHE A 1 376 ? 52.912  78.317  142.661 1.00 37.01  ? 405  PHE A C   1 
ATOM   2963 O  O   . PHE A 1 376 ? 52.582  77.143  142.472 1.00 36.98  ? 405  PHE A O   1 
ATOM   2964 C  CB  . PHE A 1 376 ? 53.374  79.643  140.561 1.00 30.10  ? 405  PHE A CB  1 
ATOM   2965 C  CG  . PHE A 1 376 ? 52.649  80.387  139.466 1.00 23.17  ? 405  PHE A CG  1 
ATOM   2966 C  CD1 . PHE A 1 376 ? 51.281  80.583  139.544 1.00 21.01  ? 405  PHE A CD1 1 
ATOM   2967 C  CD2 . PHE A 1 376 ? 53.347  80.851  138.375 1.00 26.30  ? 405  PHE A CD2 1 
ATOM   2968 C  CE1 . PHE A 1 376 ? 50.628  81.227  138.507 1.00 30.41  ? 405  PHE A CE1 1 
ATOM   2969 C  CE2 . PHE A 1 376 ? 52.695  81.495  137.345 1.00 25.14  ? 405  PHE A CE2 1 
ATOM   2970 C  CZ  . PHE A 1 376 ? 51.337  81.694  137.415 1.00 21.02  ? 405  PHE A CZ  1 
ATOM   2971 N  N   . GLY A 1 377 ? 53.598  78.680  143.729 1.00 38.84  ? 406  GLY A N   1 
ATOM   2972 C  CA  . GLY A 1 377 ? 54.064  77.727  144.743 1.00 40.72  ? 406  GLY A CA  1 
ATOM   2973 C  C   . GLY A 1 377 ? 52.822  77.234  145.496 1.00 41.84  ? 406  GLY A C   1 
ATOM   2974 O  O   . GLY A 1 377 ? 52.686  76.080  145.924 1.00 45.30  ? 406  GLY A O   1 
ATOM   2975 N  N   . HIS A 1 378 ? 51.867  78.165  145.607 1.00 37.63  ? 407  HIS A N   1 
ATOM   2976 C  CA  . HIS A 1 378 ? 50.610  77.765  146.238 1.00 36.71  ? 407  HIS A CA  1 
ATOM   2977 C  C   . HIS A 1 378 ? 49.919  76.711  145.379 1.00 35.04  ? 407  HIS A C   1 
ATOM   2978 O  O   . HIS A 1 378 ? 49.353  75.755  145.872 1.00 36.89  ? 407  HIS A O   1 
ATOM   2979 C  CB  . HIS A 1 378 ? 49.640  78.935  146.371 1.00 28.74  ? 407  HIS A CB  1 
ATOM   2980 C  CG  . HIS A 1 378 ? 49.877  79.651  147.662 1.00 34.80  ? 407  HIS A CG  1 
ATOM   2981 N  ND1 . HIS A 1 378 ? 49.796  78.983  148.855 1.00 39.16  ? 407  HIS A ND1 1 
ATOM   2982 C  CD2 . HIS A 1 378 ? 50.202  80.936  147.947 1.00 36.22  ? 407  HIS A CD2 1 
ATOM   2983 C  CE1 . HIS A 1 378 ? 50.039  79.817  149.845 1.00 32.76  ? 407  HIS A CE1 1 
ATOM   2984 N  NE2 . HIS A 1 378 ? 50.280  80.981  149.306 1.00 31.29  ? 407  HIS A NE2 1 
ATOM   2985 N  N   . ALA A 1 379 ? 49.939  76.972  144.088 1.00 33.53  ? 408  ALA A N   1 
ATOM   2986 C  CA  . ALA A 1 379 ? 49.297  76.114  143.121 1.00 35.17  ? 408  ALA A CA  1 
ATOM   2987 C  C   . ALA A 1 379 ? 49.958  74.747  143.033 1.00 38.21  ? 408  ALA A C   1 
ATOM   2988 O  O   . ALA A 1 379 ? 49.331  73.831  142.489 1.00 40.85  ? 408  ALA A O   1 
ATOM   2989 C  CB  . ALA A 1 379 ? 49.366  76.797  141.762 1.00 35.47  ? 408  ALA A CB  1 
ATOM   2990 N  N   . MET A 1 380 ? 51.228  74.613  143.425 1.00 35.86  ? 409  MET A N   1 
ATOM   2991 C  CA  . MET A 1 380 ? 51.876  73.307  143.375 1.00 33.82  ? 409  MET A CA  1 
ATOM   2992 C  C   . MET A 1 380 ? 51.600  72.492  144.644 1.00 35.83  ? 409  MET A C   1 
ATOM   2993 O  O   . MET A 1 380 ? 51.855  71.274  144.691 1.00 38.35  ? 409  MET A O   1 
ATOM   2994 C  CB  . MET A 1 380 ? 53.370  73.441  143.226 1.00 21.62  ? 409  MET A CB  1 
ATOM   2995 C  CG  . MET A 1 380 ? 53.814  73.547  141.773 1.00 39.65  ? 409  MET A CG  1 
ATOM   2996 S  SD  . MET A 1 380 ? 52.468  73.403  140.617 1.00 30.37  ? 409  MET A SD  1 
ATOM   2997 C  CE  . MET A 1 380 ? 52.393  75.040  139.919 1.00 45.89  ? 409  MET A CE  1 
ATOM   2998 N  N   . GLY A 1 381 ? 51.008  73.157  145.631 1.00 31.05  ? 410  GLY A N   1 
ATOM   2999 C  CA  . GLY A 1 381 ? 50.675  72.455  146.859 1.00 27.44  ? 410  GLY A CA  1 
ATOM   3000 C  C   . GLY A 1 381 ? 51.432  73.054  148.013 1.00 28.94  ? 410  GLY A C   1 
ATOM   3001 O  O   . GLY A 1 381 ? 51.025  72.915  149.163 1.00 32.26  ? 410  GLY A O   1 
ATOM   3002 N  N   . LEU A 1 382 ? 52.427  73.896  147.724 1.00 31.00  ? 411  LEU A N   1 
ATOM   3003 C  CA  . LEU A 1 382 ? 53.159  74.544  148.807 1.00 31.84  ? 411  LEU A CA  1 
ATOM   3004 C  C   . LEU A 1 382 ? 52.326  75.488  149.635 1.00 33.90  ? 411  LEU A C   1 
ATOM   3005 O  O   . LEU A 1 382 ? 51.292  76.018  149.270 1.00 33.70  ? 411  LEU A O   1 
ATOM   3006 C  CB  . LEU A 1 382 ? 54.392  75.250  148.262 1.00 30.62  ? 411  LEU A CB  1 
ATOM   3007 C  CG  . LEU A 1 382 ? 55.506  74.284  147.800 1.00 41.60  ? 411  LEU A CG  1 
ATOM   3008 C  CD1 . LEU A 1 382 ? 56.076  74.725  146.472 1.00 44.46  ? 411  LEU A CD1 1 
ATOM   3009 C  CD2 . LEU A 1 382 ? 56.560  74.188  148.890 1.00 43.56  ? 411  LEU A CD2 1 
ATOM   3010 N  N   . GLU A 1 383 ? 52.805  75.769  150.829 1.00 38.60  ? 412  GLU A N   1 
ATOM   3011 C  CA  . GLU A 1 383 ? 52.059  76.638  151.780 1.00 40.77  ? 412  GLU A CA  1 
ATOM   3012 C  C   . GLU A 1 383 ? 52.976  77.761  152.249 1.00 43.63  ? 412  GLU A C   1 
ATOM   3013 O  O   . GLU A 1 383 ? 54.143  77.831  151.824 1.00 45.52  ? 412  GLU A O   1 
ATOM   3014 C  CB  . GLU A 1 383 ? 51.710  75.711  152.922 1.00 59.98  ? 412  GLU A CB  1 
ATOM   3015 C  CG  . GLU A 1 383 ? 50.689  76.049  153.934 1.00 74.12  ? 412  GLU A CG  1 
ATOM   3016 C  CD  . GLU A 1 383 ? 49.329  76.382  153.347 1.00 84.25  ? 412  GLU A CD  1 
ATOM   3017 O  OE1 . GLU A 1 383 ? 49.118  76.069  152.159 1.00 86.94  ? 412  GLU A OE1 1 
ATOM   3018 O  OE2 . GLU A 1 383 ? 48.526  76.957  154.110 1.00 88.93  ? 412  GLU A OE2 1 
ATOM   3019 N  N   . HIS A 1 384 ? 52.544  78.626  153.160 1.00 44.01  ? 413  HIS A N   1 
ATOM   3020 C  CA  . HIS A 1 384 ? 53.377  79.763  153.523 1.00 46.43  ? 413  HIS A CA  1 
ATOM   3021 C  C   . HIS A 1 384 ? 54.570  79.381  154.388 1.00 48.54  ? 413  HIS A C   1 
ATOM   3022 O  O   . HIS A 1 384 ? 54.352  79.057  155.561 1.00 51.61  ? 413  HIS A O   1 
ATOM   3023 C  CB  . HIS A 1 384 ? 52.574  80.793  154.315 1.00 45.92  ? 413  HIS A CB  1 
ATOM   3024 C  CG  . HIS A 1 384 ? 51.874  81.859  153.563 1.00 54.18  ? 413  HIS A CG  1 
ATOM   3025 N  ND1 . HIS A 1 384 ? 50.736  82.463  154.084 1.00 58.43  ? 413  HIS A ND1 1 
ATOM   3026 C  CD2 . HIS A 1 384 ? 52.084  82.474  152.385 1.00 60.56  ? 413  HIS A CD2 1 
ATOM   3027 C  CE1 . HIS A 1 384 ? 50.283  83.371  153.251 1.00 52.95  ? 413  HIS A CE1 1 
ATOM   3028 N  NE2 . HIS A 1 384 ? 51.077  83.408  152.219 1.00 54.32  ? 413  HIS A NE2 1 
ATOM   3029 N  N   . SER A 1 385 ? 55.811  79.688  153.992 1.00 47.36  ? 414  SER A N   1 
ATOM   3030 C  CA  . SER A 1 385 ? 56.924  79.498  154.904 1.00 44.17  ? 414  SER A CA  1 
ATOM   3031 C  C   . SER A 1 385 ? 57.008  80.655  155.905 1.00 43.33  ? 414  SER A C   1 
ATOM   3032 O  O   . SER A 1 385 ? 56.479  81.739  155.682 1.00 43.99  ? 414  SER A O   1 
ATOM   3033 C  CB  . SER A 1 385 ? 58.270  79.350  154.203 1.00 48.72  ? 414  SER A CB  1 
ATOM   3034 O  OG  . SER A 1 385 ? 59.290  79.877  155.066 1.00 48.63  ? 414  SER A OG  1 
ATOM   3035 N  N   . GLN A 1 386 ? 57.726  80.413  156.986 1.00 42.10  ? 415  GLN A N   1 
ATOM   3036 C  CA  . GLN A 1 386 ? 57.970  81.346  158.070 1.00 39.13  ? 415  GLN A CA  1 
ATOM   3037 C  C   . GLN A 1 386 ? 59.428  81.805  157.960 1.00 39.06  ? 415  GLN A C   1 
ATOM   3038 O  O   . GLN A 1 386 ? 59.993  82.524  158.774 1.00 39.28  ? 415  GLN A O   1 
ATOM   3039 C  CB  . GLN A 1 386 ? 57.722  80.704  159.416 1.00 41.52  ? 415  GLN A CB  1 
ATOM   3040 C  CG  . GLN A 1 386 ? 56.767  81.414  160.348 1.00 52.46  ? 415  GLN A CG  1 
ATOM   3041 C  CD  . GLN A 1 386 ? 56.261  80.481  161.438 1.00 62.02  ? 415  GLN A CD  1 
ATOM   3042 O  OE1 . GLN A 1 386 ? 55.827  79.360  161.157 1.00 68.28  ? 415  GLN A OE1 1 
ATOM   3043 N  NE2 . GLN A 1 386 ? 56.324  80.920  162.686 1.00 62.98  ? 415  GLN A NE2 1 
ATOM   3044 N  N   . ASP A 1 387 ? 60.033  81.404  156.849 1.00 37.95  ? 416  ASP A N   1 
ATOM   3045 C  CA  . ASP A 1 387 ? 61.418  81.789  156.608 1.00 40.11  ? 416  ASP A CA  1 
ATOM   3046 C  C   . ASP A 1 387 ? 61.469  83.094  155.828 1.00 43.53  ? 416  ASP A C   1 
ATOM   3047 O  O   . ASP A 1 387 ? 61.227  83.092  154.614 1.00 45.55  ? 416  ASP A O   1 
ATOM   3048 C  CB  . ASP A 1 387 ? 62.109  80.683  155.815 1.00 44.57  ? 416  ASP A CB  1 
ATOM   3049 C  CG  . ASP A 1 387 ? 63.555  81.004  155.512 1.00 53.18  ? 416  ASP A CG  1 
ATOM   3050 O  OD1 . ASP A 1 387 ? 64.103  81.945  156.127 1.00 48.37  ? 416  ASP A OD1 1 
ATOM   3051 O  OD2 . ASP A 1 387 ? 64.125  80.304  154.641 1.00 59.34  ? 416  ASP A OD2 1 
ATOM   3052 N  N   . PRO A 1 388 ? 61.914  84.166  156.469 1.00 44.16  ? 417  PRO A N   1 
ATOM   3053 C  CA  . PRO A 1 388 ? 62.060  85.468  155.883 1.00 40.95  ? 417  PRO A CA  1 
ATOM   3054 C  C   . PRO A 1 388 ? 62.795  85.464  154.560 1.00 36.64  ? 417  PRO A C   1 
ATOM   3055 O  O   . PRO A 1 388 ? 62.562  86.458  153.859 1.00 40.72  ? 417  PRO A O   1 
ATOM   3056 C  CB  . PRO A 1 388 ? 62.897  86.274  156.871 1.00 43.31  ? 417  PRO A CB  1 
ATOM   3057 C  CG  . PRO A 1 388 ? 62.707  85.618  158.175 1.00 45.30  ? 417  PRO A CG  1 
ATOM   3058 C  CD  . PRO A 1 388 ? 62.288  84.198  157.904 1.00 46.92  ? 417  PRO A CD  1 
ATOM   3059 N  N   . GLY A 1 389 ? 63.615  84.478  154.264 1.00 27.86  ? 418  GLY A N   1 
ATOM   3060 C  CA  . GLY A 1 389 ? 64.348  84.445  153.010 1.00 23.50  ? 418  GLY A CA  1 
ATOM   3061 C  C   . GLY A 1 389 ? 63.661  83.558  151.989 1.00 27.18  ? 418  GLY A C   1 
ATOM   3062 O  O   . GLY A 1 389 ? 64.116  83.451  150.835 1.00 26.90  ? 418  GLY A O   1 
ATOM   3063 N  N   . ALA A 1 390 ? 62.540  82.975  152.400 1.00 29.78  ? 419  ALA A N   1 
ATOM   3064 C  CA  . ALA A 1 390 ? 61.758  82.084  151.553 1.00 32.78  ? 419  ALA A CA  1 
ATOM   3065 C  C   . ALA A 1 390 ? 60.746  82.830  150.669 1.00 34.17  ? 419  ALA A C   1 
ATOM   3066 O  O   . ALA A 1 390 ? 59.902  83.616  151.125 1.00 31.75  ? 419  ALA A O   1 
ATOM   3067 C  CB  . ALA A 1 390 ? 60.968  81.108  152.434 1.00 20.55  ? 419  ALA A CB  1 
ATOM   3068 N  N   . LEU A 1 391 ? 60.721  82.386  149.405 1.00 31.96  ? 420  LEU A N   1 
ATOM   3069 C  CA  . LEU A 1 391 ? 59.752  82.969  148.492 1.00 31.63  ? 420  LEU A CA  1 
ATOM   3070 C  C   . LEU A 1 391 ? 58.343  82.820  149.048 1.00 34.13  ? 420  LEU A C   1 
ATOM   3071 O  O   . LEU A 1 391 ? 57.535  83.779  149.049 1.00 37.30  ? 420  LEU A O   1 
ATOM   3072 C  CB  . LEU A 1 391 ? 59.895  82.327  147.108 1.00 13.74  ? 420  LEU A CB  1 
ATOM   3073 C  CG  . LEU A 1 391 ? 58.684  82.576  146.196 1.00 29.62  ? 420  LEU A CG  1 
ATOM   3074 C  CD1 . LEU A 1 391 ? 58.827  83.953  145.565 1.00 27.00  ? 420  LEU A CD1 1 
ATOM   3075 C  CD2 . LEU A 1 391 ? 58.518  81.515  145.139 1.00 29.29  ? 420  LEU A CD2 1 
ATOM   3076 N  N   . MET A 1 392 ? 58.029  81.647  149.617 1.00 29.27  ? 421  MET A N   1 
ATOM   3077 C  CA  . MET A 1 392 ? 56.669  81.444  150.095 1.00 26.91  ? 421  MET A CA  1 
ATOM   3078 C  C   . MET A 1 392 ? 56.393  82.136  151.411 1.00 27.54  ? 421  MET A C   1 
ATOM   3079 O  O   . MET A 1 392 ? 55.292  81.938  151.958 1.00 27.44  ? 421  MET A O   1 
ATOM   3080 C  CB  . MET A 1 392 ? 56.213  80.002  150.047 1.00 12.35  ? 421  MET A CB  1 
ATOM   3081 C  CG  . MET A 1 392 ? 56.418  79.334  148.683 1.00 33.15  ? 421  MET A CG  1 
ATOM   3082 S  SD  . MET A 1 392 ? 55.064  79.656  147.527 1.00 46.40  ? 421  MET A SD  1 
ATOM   3083 C  CE  . MET A 1 392 ? 53.700  79.764  148.697 1.00 36.61  ? 421  MET A CE  1 
ATOM   3084 N  N   . ALA A 1 393 ? 57.234  83.099  151.817 1.00 27.50  ? 422  ALA A N   1 
ATOM   3085 C  CA  . ALA A 1 393 ? 56.813  83.953  152.951 1.00 30.78  ? 422  ALA A CA  1 
ATOM   3086 C  C   . ALA A 1 393 ? 55.619  84.806  152.496 1.00 34.54  ? 422  ALA A C   1 
ATOM   3087 O  O   . ALA A 1 393 ? 55.471  85.092  151.302 1.00 36.00  ? 422  ALA A O   1 
ATOM   3088 C  CB  . ALA A 1 393 ? 57.947  84.835  153.393 1.00 23.25  ? 422  ALA A CB  1 
ATOM   3089 N  N   . PRO A 1 394 ? 54.718  85.169  153.397 1.00 34.59  ? 423  PRO A N   1 
ATOM   3090 C  CA  . PRO A 1 394 ? 53.517  85.892  153.036 1.00 35.43  ? 423  PRO A CA  1 
ATOM   3091 C  C   . PRO A 1 394 ? 53.814  87.277  152.448 1.00 36.34  ? 423  PRO A C   1 
ATOM   3092 O  O   . PRO A 1 394 ? 53.234  87.731  151.455 1.00 39.06  ? 423  PRO A O   1 
ATOM   3093 C  CB  . PRO A 1 394 ? 52.755  86.020  154.349 1.00 35.27  ? 423  PRO A CB  1 
ATOM   3094 C  CG  . PRO A 1 394 ? 53.499  85.295  155.398 1.00 33.38  ? 423  PRO A CG  1 
ATOM   3095 C  CD  . PRO A 1 394 ? 54.825  84.909  154.843 1.00 34.73  ? 423  PRO A CD  1 
ATOM   3096 N  N   . ILE A 1 395 ? 54.660  88.024  153.133 1.00 32.58  ? 424  ILE A N   1 
ATOM   3097 C  CA  . ILE A 1 395 ? 54.917  89.422  152.868 1.00 29.55  ? 424  ILE A CA  1 
ATOM   3098 C  C   . ILE A 1 395 ? 55.709  89.622  151.603 1.00 32.95  ? 424  ILE A C   1 
ATOM   3099 O  O   . ILE A 1 395 ? 56.680  88.911  151.344 1.00 39.83  ? 424  ILE A O   1 
ATOM   3100 C  CB  . ILE A 1 395 ? 55.784  90.018  154.012 1.00 20.36  ? 424  ILE A CB  1 
ATOM   3101 C  CG1 . ILE A 1 395 ? 55.081  89.770  155.339 1.00 34.43  ? 424  ILE A CG1 1 
ATOM   3102 C  CG2 . ILE A 1 395 ? 56.155  91.435  153.764 1.00 19.54  ? 424  ILE A CG2 1 
ATOM   3103 C  CD1 . ILE A 1 395 ? 54.702  90.920  156.221 1.00 13.48  ? 424  ILE A CD1 1 
ATOM   3104 N  N   . TYR A 1 396 ? 55.376  90.679  150.877 1.00 32.48  ? 425  TYR A N   1 
ATOM   3105 C  CA  . TYR A 1 396 ? 56.074  90.940  149.613 1.00 30.87  ? 425  TYR A CA  1 
ATOM   3106 C  C   . TYR A 1 396 ? 57.349  91.766  149.806 1.00 29.96  ? 425  TYR A C   1 
ATOM   3107 O  O   . TYR A 1 396 ? 57.279  92.821  150.435 1.00 30.65  ? 425  TYR A O   1 
ATOM   3108 C  CB  . TYR A 1 396 ? 55.123  91.707  148.701 1.00 26.46  ? 425  TYR A CB  1 
ATOM   3109 C  CG  . TYR A 1 396 ? 55.818  92.257  147.475 1.00 21.85  ? 425  TYR A CG  1 
ATOM   3110 C  CD1 . TYR A 1 396 ? 56.484  93.473  147.456 1.00 19.71  ? 425  TYR A CD1 1 
ATOM   3111 C  CD2 . TYR A 1 396 ? 55.777  91.512  146.305 1.00 17.57  ? 425  TYR A CD2 1 
ATOM   3112 C  CE1 . TYR A 1 396 ? 57.112  93.965  146.320 1.00 14.82  ? 425  TYR A CE1 1 
ATOM   3113 C  CE2 . TYR A 1 396 ? 56.380  92.001  145.170 1.00 14.44  ? 425  TYR A CE2 1 
ATOM   3114 C  CZ  . TYR A 1 396 ? 57.049  93.200  145.180 1.00 13.52  ? 425  TYR A CZ  1 
ATOM   3115 O  OH  . TYR A 1 396 ? 57.613  93.540  143.986 1.00 17.27  ? 425  TYR A OH  1 
ATOM   3116 N  N   . THR A 1 397 ? 58.441  91.336  149.197 1.00 26.53  ? 426  THR A N   1 
ATOM   3117 C  CA  . THR A 1 397 ? 59.721  92.010  149.254 1.00 25.68  ? 426  THR A CA  1 
ATOM   3118 C  C   . THR A 1 397 ? 60.384  92.000  147.876 1.00 24.95  ? 426  THR A C   1 
ATOM   3119 O  O   . THR A 1 397 ? 60.519  90.985  147.193 1.00 23.96  ? 426  THR A O   1 
ATOM   3120 C  CB  . THR A 1 397 ? 60.708  91.439  150.286 1.00 33.23  ? 426  THR A CB  1 
ATOM   3121 O  OG1 . THR A 1 397 ? 60.214  91.691  151.612 1.00 37.12  ? 426  THR A OG1 1 
ATOM   3122 C  CG2 . THR A 1 397 ? 62.070  92.141  150.165 1.00 39.06  ? 426  THR A CG2 1 
ATOM   3123 N  N   . TYR A 1 398 ? 60.710  93.213  147.414 1.00 25.17  ? 427  TYR A N   1 
ATOM   3124 C  CA  . TYR A 1 398 ? 61.246  93.312  146.059 1.00 24.73  ? 427  TYR A CA  1 
ATOM   3125 C  C   . TYR A 1 398 ? 62.692  92.847  146.089 1.00 28.32  ? 427  TYR A C   1 
ATOM   3126 O  O   . TYR A 1 398 ? 63.478  93.128  146.999 1.00 29.08  ? 427  TYR A O   1 
ATOM   3127 C  CB  . TYR A 1 398 ? 61.123  94.748  145.506 1.00 19.54  ? 427  TYR A CB  1 
ATOM   3128 C  CG  . TYR A 1 398 ? 61.866  94.825  144.176 1.00 13.93  ? 427  TYR A CG  1 
ATOM   3129 C  CD1 . TYR A 1 398 ? 61.480  93.970  143.146 1.00 8.87   ? 427  TYR A CD1 1 
ATOM   3130 C  CD2 . TYR A 1 398 ? 62.920  95.685  143.939 1.00 10.16  ? 427  TYR A CD2 1 
ATOM   3131 C  CE1 . TYR A 1 398 ? 62.094  93.956  141.924 1.00 6.36   ? 427  TYR A CE1 1 
ATOM   3132 C  CE2 . TYR A 1 398 ? 63.545  95.672  142.694 1.00 12.19  ? 427  TYR A CE2 1 
ATOM   3133 C  CZ  . TYR A 1 398 ? 63.155  94.803  141.710 1.00 14.27  ? 427  TYR A CZ  1 
ATOM   3134 O  OH  . TYR A 1 398 ? 63.814  94.742  140.485 1.00 21.63  ? 427  TYR A OH  1 
ATOM   3135 N  N   . THR A 1 399 ? 63.074  91.990  145.151 1.00 31.56  ? 428  THR A N   1 
ATOM   3136 C  CA  . THR A 1 399 ? 64.443  91.484  145.170 1.00 34.61  ? 428  THR A CA  1 
ATOM   3137 C  C   . THR A 1 399 ? 64.953  91.571  143.745 1.00 39.57  ? 428  THR A C   1 
ATOM   3138 O  O   . THR A 1 399 ? 64.487  90.786  142.919 1.00 37.49  ? 428  THR A O   1 
ATOM   3139 C  CB  . THR A 1 399 ? 64.486  90.024  145.654 1.00 38.75  ? 428  THR A CB  1 
ATOM   3140 O  OG1 . THR A 1 399 ? 63.707  89.204  144.774 1.00 44.40  ? 428  THR A OG1 1 
ATOM   3141 C  CG2 . THR A 1 399 ? 63.974  89.870  147.075 1.00 26.35  ? 428  THR A CG2 1 
ATOM   3142 N  N   . LYS A 1 400 ? 65.791  92.568  143.459 1.00 46.29  ? 429  LYS A N   1 
ATOM   3143 C  CA  . LYS A 1 400 ? 66.315  92.688  142.094 1.00 52.00  ? 429  LYS A CA  1 
ATOM   3144 C  C   . LYS A 1 400 ? 66.745  91.298  141.604 1.00 53.77  ? 429  LYS A C   1 
ATOM   3145 O  O   . LYS A 1 400 ? 66.269  90.860  140.554 1.00 54.01  ? 429  LYS A O   1 
ATOM   3146 C  CB  . LYS A 1 400 ? 67.457  93.673  141.927 1.00 66.07  ? 429  LYS A CB  1 
ATOM   3147 C  CG  . LYS A 1 400 ? 67.666  94.686  143.028 1.00 78.39  ? 429  LYS A CG  1 
ATOM   3148 C  CD  . LYS A 1 400 ? 69.131  94.824  143.425 1.00 81.30  ? 429  LYS A CD  1 
ATOM   3149 C  CE  . LYS A 1 400 ? 69.745  96.118  142.941 1.00 89.74  ? 429  LYS A CE  1 
ATOM   3150 N  NZ  . LYS A 1 400 ? 71.236  96.097  142.850 1.00 94.27  ? 429  LYS A NZ  1 
ATOM   3151 N  N   . ASN A 1 401 ? 67.616  90.631  142.357 1.00 55.19  ? 430  ASN A N   1 
ATOM   3152 C  CA  . ASN A 1 401 ? 68.080  89.298  141.945 1.00 58.06  ? 430  ASN A CA  1 
ATOM   3153 C  C   . ASN A 1 401 ? 67.357  88.229  142.740 1.00 60.24  ? 430  ASN A C   1 
ATOM   3154 O  O   . ASN A 1 401 ? 67.656  88.014  143.921 1.00 62.61  ? 430  ASN A O   1 
ATOM   3155 C  CB  . ASN A 1 401 ? 69.588  89.148  142.161 1.00 59.81  ? 430  ASN A CB  1 
ATOM   3156 C  CG  . ASN A 1 401 ? 70.335  90.407  141.762 1.00 67.39  ? 430  ASN A CG  1 
ATOM   3157 O  OD1 . ASN A 1 401 ? 70.710  91.201  142.635 1.00 70.64  ? 430  ASN A OD1 1 
ATOM   3158 N  ND2 . ASN A 1 401 ? 70.518  90.574  140.452 1.00 59.51  ? 430  ASN A ND2 1 
ATOM   3159 N  N   . PHE A 1 402 ? 66.347  87.598  142.139 1.00 59.49  ? 431  PHE A N   1 
ATOM   3160 C  CA  . PHE A 1 402 ? 65.627  86.597  142.926 1.00 58.13  ? 431  PHE A CA  1 
ATOM   3161 C  C   . PHE A 1 402 ? 66.333  85.240  142.836 1.00 57.55  ? 431  PHE A C   1 
ATOM   3162 O  O   . PHE A 1 402 ? 66.793  84.855  141.757 1.00 56.71  ? 431  PHE A O   1 
ATOM   3163 C  CB  . PHE A 1 402 ? 64.180  86.457  142.468 1.00 48.57  ? 431  PHE A CB  1 
ATOM   3164 C  CG  . PHE A 1 402 ? 63.500  85.241  143.044 1.00 38.20  ? 431  PHE A CG  1 
ATOM   3165 C  CD1 . PHE A 1 402 ? 63.185  85.196  144.389 1.00 33.50  ? 431  PHE A CD1 1 
ATOM   3166 C  CD2 . PHE A 1 402 ? 63.225  84.147  142.242 1.00 35.72  ? 431  PHE A CD2 1 
ATOM   3167 C  CE1 . PHE A 1 402 ? 62.587  84.071  144.933 1.00 33.30  ? 431  PHE A CE1 1 
ATOM   3168 C  CE2 . PHE A 1 402 ? 62.609  83.024  142.767 1.00 30.61  ? 431  PHE A CE2 1 
ATOM   3169 C  CZ  . PHE A 1 402 ? 62.295  82.998  144.114 1.00 34.37  ? 431  PHE A CZ  1 
ATOM   3170 N  N   . ARG A 1 403 ? 66.381  84.569  143.985 1.00 56.03  ? 432  ARG A N   1 
ATOM   3171 C  CA  . ARG A 1 403 ? 66.877  83.206  144.068 1.00 55.88  ? 432  ARG A CA  1 
ATOM   3172 C  C   . ARG A 1 403 ? 65.950  82.384  144.989 1.00 52.70  ? 432  ARG A C   1 
ATOM   3173 O  O   . ARG A 1 403 ? 65.814  82.751  146.166 1.00 52.89  ? 432  ARG A O   1 
ATOM   3174 C  CB  . ARG A 1 403 ? 68.287  83.100  144.638 1.00 75.18  ? 432  ARG A CB  1 
ATOM   3175 C  CG  . ARG A 1 403 ? 69.328  84.100  144.249 1.00 82.86  ? 432  ARG A CG  1 
ATOM   3176 C  CD  . ARG A 1 403 ? 70.739  83.674  144.571 1.00 95.17  ? 432  ARG A CD  1 
ATOM   3177 N  NE  . ARG A 1 403 ? 71.116  82.327  144.210 1.00 104.55 ? 432  ARG A NE  1 
ATOM   3178 C  CZ  . ARG A 1 403 ? 70.924  81.647  143.097 1.00 108.71 ? 432  ARG A CZ  1 
ATOM   3179 N  NH1 . ARG A 1 403 ? 70.273  82.168  142.057 1.00 112.62 ? 432  ARG A NH1 1 
ATOM   3180 N  NH2 . ARG A 1 403 ? 71.361  80.394  142.962 1.00 105.86 ? 432  ARG A NH2 1 
ATOM   3181 N  N   . LEU A 1 404 ? 65.380  81.310  144.470 1.00 47.09  ? 433  LEU A N   1 
ATOM   3182 C  CA  . LEU A 1 404 ? 64.592  80.414  145.329 1.00 44.74  ? 433  LEU A CA  1 
ATOM   3183 C  C   . LEU A 1 404 ? 65.414  79.989  146.538 1.00 45.67  ? 433  LEU A C   1 
ATOM   3184 O  O   . LEU A 1 404 ? 66.505  79.433  146.323 1.00 48.40  ? 433  LEU A O   1 
ATOM   3185 C  CB  . LEU A 1 404 ? 64.310  79.148  144.523 1.00 35.15  ? 433  LEU A CB  1 
ATOM   3186 C  CG  . LEU A 1 404 ? 62.880  78.688  144.332 1.00 39.49  ? 433  LEU A CG  1 
ATOM   3187 C  CD1 . LEU A 1 404 ? 62.887  77.184  144.082 1.00 41.68  ? 433  LEU A CD1 1 
ATOM   3188 C  CD2 . LEU A 1 404 ? 61.964  79.076  145.493 1.00 23.88  ? 433  LEU A CD2 1 
ATOM   3189 N  N   . SER A 1 405 ? 64.944  80.123  147.750 1.00 46.40  ? 434  SER A N   1 
ATOM   3190 C  CA  . SER A 1 405 ? 65.678  79.711  148.938 1.00 50.26  ? 434  SER A CA  1 
ATOM   3191 C  C   . SER A 1 405 ? 65.571  78.222  149.241 1.00 55.72  ? 434  SER A C   1 
ATOM   3192 O  O   . SER A 1 405 ? 64.574  77.568  148.913 1.00 58.93  ? 434  SER A O   1 
ATOM   3193 C  CB  . SER A 1 405 ? 65.216  80.500  150.161 1.00 46.01  ? 434  SER A CB  1 
ATOM   3194 O  OG  . SER A 1 405 ? 64.029  79.963  150.723 1.00 36.01  ? 434  SER A OG  1 
ATOM   3195 N  N   . GLN A 1 406 ? 66.559  77.652  149.927 1.00 56.46  ? 435  GLN A N   1 
ATOM   3196 C  CA  . GLN A 1 406 ? 66.613  76.240  150.279 1.00 57.61  ? 435  GLN A CA  1 
ATOM   3197 C  C   . GLN A 1 406 ? 65.258  75.744  150.769 1.00 58.99  ? 435  GLN A C   1 
ATOM   3198 O  O   . GLN A 1 406 ? 64.758  74.713  150.270 1.00 58.37  ? 435  GLN A O   1 
ATOM   3199 C  CB  . GLN A 1 406 ? 67.687  75.992  151.340 1.00 57.41  ? 435  GLN A CB  1 
ATOM   3200 C  CG  . GLN A 1 406 ? 67.623  74.517  151.970 1.00 58.55  ? 435  GLN A CG  1 
ATOM   3201 C  CD  . GLN A 1 406 ? 67.810  73.206  151.051 1.00 54.23  ? 435  GLN A CD  1 
ATOM   3202 O  OE1 . GLN A 1 406 ? 67.714  72.038  151.540 1.00 61.72  ? 435  GLN A OE1 1 
ATOM   3203 N  NE2 . GLN A 1 406 ? 68.088  73.094  149.744 1.00 55.95  ? 435  GLN A NE2 1 
ATOM   3204 N  N   . ASP A 1 407 ? 64.677  76.436  151.730 1.00 58.76  ? 436  ASP A N   1 
ATOM   3205 C  CA  . ASP A 1 407 ? 63.383  76.209  152.348 1.00 57.48  ? 436  ASP A CA  1 
ATOM   3206 C  C   . ASP A 1 407 ? 62.290  75.998  151.306 1.00 55.93  ? 436  ASP A C   1 
ATOM   3207 O  O   . ASP A 1 407 ? 61.459  75.087  151.396 1.00 54.49  ? 436  ASP A O   1 
ATOM   3208 C  CB  . ASP A 1 407 ? 63.049  77.394  153.244 1.00 64.82  ? 436  ASP A CB  1 
ATOM   3209 C  CG  . ASP A 1 407 ? 62.028  77.172  154.323 1.00 70.56  ? 436  ASP A CG  1 
ATOM   3210 O  OD1 . ASP A 1 407 ? 62.182  76.293  155.195 1.00 73.52  ? 436  ASP A OD1 1 
ATOM   3211 O  OD2 . ASP A 1 407 ? 61.023  77.931  154.318 1.00 73.31  ? 436  ASP A OD2 1 
ATOM   3212 N  N   . ASP A 1 408 ? 62.342  76.810  150.257 1.00 56.02  ? 437  ASP A N   1 
ATOM   3213 C  CA  . ASP A 1 408 ? 61.408  76.633  149.150 1.00 58.77  ? 437  ASP A CA  1 
ATOM   3214 C  C   . ASP A 1 408 ? 61.772  75.348  148.405 1.00 59.82  ? 437  ASP A C   1 
ATOM   3215 O  O   . ASP A 1 408 ? 61.013  74.375  148.461 1.00 63.38  ? 437  ASP A O   1 
ATOM   3216 C  CB  . ASP A 1 408 ? 61.350  77.819  148.217 1.00 59.78  ? 437  ASP A CB  1 
ATOM   3217 C  CG  . ASP A 1 408 ? 61.115  79.182  148.807 1.00 59.18  ? 437  ASP A CG  1 
ATOM   3218 O  OD1 . ASP A 1 408 ? 60.381  79.352  149.812 1.00 55.98  ? 437  ASP A OD1 1 
ATOM   3219 O  OD2 . ASP A 1 408 ? 61.691  80.145  148.237 1.00 59.48  ? 437  ASP A OD2 1 
ATOM   3220 N  N   . ILE A 1 409 ? 62.942  75.277  147.788 1.00 58.17  ? 438  ILE A N   1 
ATOM   3221 C  CA  . ILE A 1 409 ? 63.390  74.073  147.107 1.00 57.42  ? 438  ILE A CA  1 
ATOM   3222 C  C   . ILE A 1 409 ? 63.072  72.806  147.908 1.00 56.89  ? 438  ILE A C   1 
ATOM   3223 O  O   . ILE A 1 409 ? 62.615  71.807  147.350 1.00 56.39  ? 438  ILE A O   1 
ATOM   3224 C  CB  . ILE A 1 409 ? 64.918  74.045  146.895 1.00 65.80  ? 438  ILE A CB  1 
ATOM   3225 C  CG1 . ILE A 1 409 ? 65.562  75.369  147.266 1.00 61.11  ? 438  ILE A CG1 1 
ATOM   3226 C  CG2 . ILE A 1 409 ? 65.214  73.578  145.483 1.00 62.86  ? 438  ILE A CG2 1 
ATOM   3227 C  CD1 . ILE A 1 409 ? 65.822  76.352  146.167 1.00 59.43  ? 438  ILE A CD1 1 
ATOM   3228 N  N   . LYS A 1 410 ? 63.372  72.873  149.203 1.00 55.01  ? 439  LYS A N   1 
ATOM   3229 C  CA  . LYS A 1 410 ? 63.057  71.775  150.109 1.00 54.31  ? 439  LYS A CA  1 
ATOM   3230 C  C   . LYS A 1 410 ? 61.620  71.308  149.900 1.00 53.82  ? 439  LYS A C   1 
ATOM   3231 O  O   . LYS A 1 410 ? 61.389  70.262  149.298 1.00 55.63  ? 439  LYS A O   1 
ATOM   3232 C  CB  . LYS A 1 410 ? 63.268  72.188  151.555 1.00 68.82  ? 439  LYS A CB  1 
ATOM   3233 C  CG  . LYS A 1 410 ? 63.626  71.054  152.499 1.00 76.05  ? 439  LYS A CG  1 
ATOM   3234 C  CD  . LYS A 1 410 ? 64.246  71.586  153.786 1.00 82.80  ? 439  LYS A CD  1 
ATOM   3235 C  CE  . LYS A 1 410 ? 63.400  71.210  154.998 1.00 84.25  ? 439  LYS A CE  1 
ATOM   3236 N  NZ  . LYS A 1 410 ? 62.880  72.437  155.689 1.00 88.41  ? 439  LYS A NZ  1 
ATOM   3237 N  N   . GLY A 1 411 ? 60.650  72.117  150.322 1.00 51.36  ? 440  GLY A N   1 
ATOM   3238 C  CA  . GLY A 1 411 ? 59.257  71.784  150.112 1.00 46.06  ? 440  GLY A CA  1 
ATOM   3239 C  C   . GLY A 1 411 ? 58.938  71.388  148.699 1.00 44.77  ? 440  GLY A C   1 
ATOM   3240 O  O   . GLY A 1 411 ? 58.229  70.394  148.474 1.00 43.62  ? 440  GLY A O   1 
ATOM   3241 N  N   . ILE A 1 412 ? 59.352  72.130  147.659 1.00 46.10  ? 441  ILE A N   1 
ATOM   3242 C  CA  . ILE A 1 412 ? 58.845  71.730  146.335 1.00 49.03  ? 441  ILE A CA  1 
ATOM   3243 C  C   . ILE A 1 412 ? 59.365  70.355  145.955 1.00 51.56  ? 441  ILE A C   1 
ATOM   3244 O  O   . ILE A 1 412 ? 58.590  69.563  145.430 1.00 47.94  ? 441  ILE A O   1 
ATOM   3245 C  CB  . ILE A 1 412 ? 59.001  72.754  145.230 1.00 44.83  ? 441  ILE A CB  1 
ATOM   3246 C  CG1 . ILE A 1 412 ? 58.148  72.358  144.014 1.00 41.26  ? 441  ILE A CG1 1 
ATOM   3247 C  CG2 . ILE A 1 412 ? 60.447  72.966  144.820 1.00 43.31  ? 441  ILE A CG2 1 
ATOM   3248 C  CD1 . ILE A 1 412 ? 56.825  73.082  143.899 1.00 36.33  ? 441  ILE A CD1 1 
ATOM   3249 N  N   . GLN A 1 413 ? 60.623  70.085  146.307 1.00 57.62  ? 442  GLN A N   1 
ATOM   3250 C  CA  . GLN A 1 413 ? 61.256  68.769  146.136 1.00 60.15  ? 442  GLN A CA  1 
ATOM   3251 C  C   . GLN A 1 413 ? 60.649  67.772  147.127 1.00 60.64  ? 442  GLN A C   1 
ATOM   3252 O  O   . GLN A 1 413 ? 60.364  66.602  146.844 1.00 58.24  ? 442  GLN A O   1 
ATOM   3253 C  CB  . GLN A 1 413 ? 62.771  68.879  146.265 1.00 67.52  ? 442  GLN A CB  1 
ATOM   3254 C  CG  . GLN A 1 413 ? 63.453  69.813  145.276 1.00 74.56  ? 442  GLN A CG  1 
ATOM   3255 C  CD  . GLN A 1 413 ? 64.868  69.421  144.902 1.00 70.85  ? 442  GLN A CD  1 
ATOM   3256 O  OE1 . GLN A 1 413 ? 65.542  68.666  145.597 1.00 68.64  ? 442  GLN A OE1 1 
ATOM   3257 N  NE2 . GLN A 1 413 ? 65.353  69.938  143.775 1.00 68.82  ? 442  GLN A NE2 1 
ATOM   3258 N  N   . GLU A 1 414 ? 60.205  68.248  148.289 1.00 60.96  ? 443  GLU A N   1 
ATOM   3259 C  CA  . GLU A 1 414 ? 59.463  67.411  149.211 1.00 61.72  ? 443  GLU A CA  1 
ATOM   3260 C  C   . GLU A 1 414 ? 58.153  66.936  148.591 1.00 63.44  ? 443  GLU A C   1 
ATOM   3261 O  O   . GLU A 1 414 ? 57.580  65.961  149.069 1.00 64.12  ? 443  GLU A O   1 
ATOM   3262 C  CB  . GLU A 1 414 ? 59.162  68.204  150.479 1.00 78.60  ? 443  GLU A CB  1 
ATOM   3263 C  CG  . GLU A 1 414 ? 59.309  67.429  151.769 1.00 80.60  ? 443  GLU A CG  1 
ATOM   3264 C  CD  . GLU A 1 414 ? 58.092  67.647  152.658 1.00 87.80  ? 443  GLU A CD  1 
ATOM   3265 O  OE1 . GLU A 1 414 ? 57.011  67.189  152.248 1.00 88.88  ? 443  GLU A OE1 1 
ATOM   3266 O  OE2 . GLU A 1 414 ? 58.267  68.274  153.722 1.00 94.70  ? 443  GLU A OE2 1 
ATOM   3267 N  N   . LEU A 1 415 ? 57.609  67.637  147.607 1.00 65.03  ? 444  LEU A N   1 
ATOM   3268 C  CA  . LEU A 1 415 ? 56.365  67.257  146.967 1.00 65.50  ? 444  LEU A CA  1 
ATOM   3269 C  C   . LEU A 1 415 ? 56.641  66.553  145.648 1.00 66.43  ? 444  LEU A C   1 
ATOM   3270 O  O   . LEU A 1 415 ? 55.864  65.707  145.198 1.00 66.42  ? 444  LEU A O   1 
ATOM   3271 C  CB  . LEU A 1 415 ? 55.456  68.463  146.697 1.00 63.54  ? 444  LEU A CB  1 
ATOM   3272 C  CG  . LEU A 1 415 ? 54.903  69.181  147.921 1.00 57.83  ? 444  LEU A CG  1 
ATOM   3273 C  CD1 . LEU A 1 415 ? 53.949  70.275  147.483 1.00 67.11  ? 444  LEU A CD1 1 
ATOM   3274 C  CD2 . LEU A 1 415 ? 54.235  68.190  148.851 1.00 57.10  ? 444  LEU A CD2 1 
ATOM   3275 N  N   . TYR A 1 416 ? 57.651  67.017  144.934 1.00 69.01  ? 445  TYR A N   1 
ATOM   3276 C  CA  . TYR A 1 416 ? 57.987  66.449  143.626 1.00 72.99  ? 445  TYR A CA  1 
ATOM   3277 C  C   . TYR A 1 416 ? 59.460  66.125  143.569 1.00 74.57  ? 445  TYR A C   1 
ATOM   3278 O  O   . TYR A 1 416 ? 60.130  66.114  144.609 1.00 74.57  ? 445  TYR A O   1 
ATOM   3279 C  CB  . TYR A 1 416 ? 57.481  67.382  142.515 1.00 76.16  ? 445  TYR A CB  1 
ATOM   3280 C  CG  . TYR A 1 416 ? 55.999  67.695  142.666 1.00 79.44  ? 445  TYR A CG  1 
ATOM   3281 C  CD1 . TYR A 1 416 ? 55.050  66.709  142.415 1.00 83.90  ? 445  TYR A CD1 1 
ATOM   3282 C  CD2 . TYR A 1 416 ? 55.549  68.924  143.115 1.00 78.69  ? 445  TYR A CD2 1 
ATOM   3283 C  CE1 . TYR A 1 416 ? 53.694  66.953  142.588 1.00 83.77  ? 445  TYR A CE1 1 
ATOM   3284 C  CE2 . TYR A 1 416 ? 54.205  69.184  143.287 1.00 79.85  ? 445  TYR A CE2 1 
ATOM   3285 C  CZ  . TYR A 1 416 ? 53.286  68.190  143.020 1.00 82.36  ? 445  TYR A CZ  1 
ATOM   3286 O  OH  . TYR A 1 416 ? 51.959  68.486  143.199 1.00 84.74  ? 445  TYR A OH  1 
ATOM   3287 N  N   . GLY A 1 417 ? 60.040  65.791  142.430 1.00 76.69  ? 446  GLY A N   1 
ATOM   3288 C  CA  . GLY A 1 417 ? 61.417  65.369  142.376 1.00 80.85  ? 446  GLY A CA  1 
ATOM   3289 C  C   . GLY A 1 417 ? 62.496  66.391  142.668 1.00 82.10  ? 446  GLY A C   1 
ATOM   3290 O  O   . GLY A 1 417 ? 62.336  67.419  143.325 1.00 83.87  ? 446  GLY A O   1 
ATOM   3291 N  N   . ALA A 1 418 ? 63.689  65.994  142.229 1.00 80.85  ? 447  ALA A N   1 
ATOM   3292 C  CA  . ALA A 1 418 ? 64.896  66.784  142.321 1.00 78.62  ? 447  ALA A CA  1 
ATOM   3293 C  C   . ALA A 1 418 ? 64.965  67.550  140.997 1.00 76.18  ? 447  ALA A C   1 
ATOM   3294 O  O   . ALA A 1 418 ? 65.043  68.760  141.031 1.00 78.29  ? 447  ALA A O   1 
ATOM   3295 C  CB  . ALA A 1 418 ? 66.126  65.899  142.471 1.00 82.94  ? 447  ALA A CB  1 
ATOM   3296 N  N   . SER A 1 419 ? 64.947  66.851  139.909 1.00 72.85  ? 448  SER A N   1 
ATOM   3297 C  CA  . SER A 1 419 ? 64.963  67.284  138.528 1.00 68.51  ? 448  SER A CA  1 
ATOM   3298 C  C   . SER A 1 419 ? 65.527  66.131  137.682 1.00 65.05  ? 448  SER A C   1 
ATOM   3299 O  O   . SER A 1 419 ? 66.448  65.471  138.203 1.00 66.65  ? 448  SER A O   1 
ATOM   3300 C  CB  . SER A 1 419 ? 65.928  68.440  138.185 1.00 69.21  ? 448  SER A CB  1 
ATOM   3301 O  OG  . SER A 1 419 ? 66.418  69.194  139.234 1.00 76.62  ? 448  SER A OG  1 
ATOM   3302 N  N   . PRO A 1 420 ? 65.157  65.979  136.461 1.00 60.43  ? 449  PRO A N   1 
ATOM   3303 C  CA  . PRO A 1 420 ? 66.048  65.214  135.536 1.00 57.54  ? 449  PRO A CA  1 
ATOM   3304 C  C   . PRO A 1 420 ? 67.317  66.102  135.451 1.00 56.99  ? 449  PRO A C   1 
ATOM   3305 O  O   . PRO A 1 420 ? 68.012  66.227  134.462 1.00 59.73  ? 449  PRO A O   1 
ATOM   3306 C  CB  . PRO A 1 420 ? 65.312  65.177  134.215 1.00 55.13  ? 449  PRO A CB  1 
ATOM   3307 C  CG  . PRO A 1 420 ? 63.880  65.450  134.617 1.00 55.90  ? 449  PRO A CG  1 
ATOM   3308 C  CD  . PRO A 1 420 ? 64.034  66.546  135.696 1.00 57.99  ? 449  PRO A CD  1 
ATOM   3309 N  N   . LEU A 1 432 ? 72.852  73.809  146.692 1.00 90.10  ? 461  LEU A N   1 
ATOM   3310 C  CA  . LEU A 1 432 ? 71.484  73.473  146.295 1.00 90.26  ? 461  LEU A CA  1 
ATOM   3311 C  C   . LEU A 1 432 ? 70.477  74.355  147.029 1.00 89.06  ? 461  LEU A C   1 
ATOM   3312 O  O   . LEU A 1 432 ? 69.660  73.931  147.843 1.00 88.81  ? 461  LEU A O   1 
ATOM   3313 C  CB  . LEU A 1 432 ? 71.216  71.986  146.484 1.00 96.38  ? 461  LEU A CB  1 
ATOM   3314 C  CG  . LEU A 1 432 ? 72.139  70.989  145.772 1.00 93.75  ? 461  LEU A CG  1 
ATOM   3315 C  CD1 . LEU A 1 432 ? 71.800  69.552  146.163 1.00 88.76  ? 461  LEU A CD1 1 
ATOM   3316 C  CD2 . LEU A 1 432 ? 72.095  71.155  144.258 1.00 84.08  ? 461  LEU A CD2 1 
ATOM   3317 N  N   . GLY A 1 433 ? 70.557  75.653  146.725 1.00 87.41  ? 462  GLY A N   1 
ATOM   3318 C  CA  . GLY A 1 433 ? 69.699  76.667  147.280 1.00 85.22  ? 462  GLY A CA  1 
ATOM   3319 C  C   . GLY A 1 433 ? 70.298  77.397  148.469 1.00 83.66  ? 462  GLY A C   1 
ATOM   3320 O  O   . GLY A 1 433 ? 70.920  76.818  149.354 1.00 84.43  ? 462  GLY A O   1 
ATOM   3321 N  N   . PRO A 1 434 ? 70.063  78.702  148.512 1.00 82.05  ? 463  PRO A N   1 
ATOM   3322 C  CA  . PRO A 1 434 ? 70.527  79.588  149.552 1.00 80.85  ? 463  PRO A CA  1 
ATOM   3323 C  C   . PRO A 1 434 ? 69.921  79.251  150.903 1.00 79.57  ? 463  PRO A C   1 
ATOM   3324 O  O   . PRO A 1 434 ? 68.750  78.885  150.957 1.00 80.27  ? 463  PRO A O   1 
ATOM   3325 C  CB  . PRO A 1 434 ? 70.028  80.972  149.135 1.00 80.69  ? 463  PRO A CB  1 
ATOM   3326 C  CG  . PRO A 1 434 ? 69.829  80.857  147.666 1.00 81.92  ? 463  PRO A CG  1 
ATOM   3327 C  CD  . PRO A 1 434 ? 69.334  79.445  147.449 1.00 82.56  ? 463  PRO A CD  1 
ATOM   3328 N  N   . VAL A 1 435 ? 70.690  79.434  151.955 1.00 78.28  ? 464  VAL A N   1 
ATOM   3329 C  CA  . VAL A 1 435 ? 70.248  79.156  153.318 1.00 76.11  ? 464  VAL A CA  1 
ATOM   3330 C  C   . VAL A 1 435 ? 70.102  80.456  154.095 1.00 72.55  ? 464  VAL A C   1 
ATOM   3331 O  O   . VAL A 1 435 ? 70.571  81.485  153.625 1.00 71.75  ? 464  VAL A O   1 
ATOM   3332 C  CB  . VAL A 1 435 ? 71.230  78.220  154.045 1.00 84.37  ? 464  VAL A CB  1 
ATOM   3333 C  CG1 . VAL A 1 435 ? 72.610  78.866  154.158 1.00 87.83  ? 464  VAL A CG1 1 
ATOM   3334 C  CG2 . VAL A 1 435 ? 70.693  77.842  155.422 1.00 81.40  ? 464  VAL A CG2 1 
ATOM   3335 N  N   . THR A 1 436 ? 69.473  80.439  155.260 1.00 71.34  ? 465  THR A N   1 
ATOM   3336 C  CA  . THR A 1 436 ? 69.253  81.672  156.009 1.00 71.23  ? 465  THR A CA  1 
ATOM   3337 C  C   . THR A 1 436 ? 69.702  81.611  157.451 1.00 71.38  ? 465  THR A C   1 
ATOM   3338 O  O   . THR A 1 436 ? 69.346  80.757  158.257 1.00 71.30  ? 465  THR A O   1 
ATOM   3339 C  CB  . THR A 1 436 ? 67.797  82.147  155.860 1.00 74.52  ? 465  THR A CB  1 
ATOM   3340 O  OG1 . THR A 1 436 ? 67.281  82.612  157.109 1.00 72.42  ? 465  THR A OG1 1 
ATOM   3341 C  CG2 . THR A 1 436 ? 66.904  81.070  155.273 1.00 71.10  ? 465  THR A CG2 1 
ATOM   3342 N  N   . PRO A 1 437 ? 70.543  82.577  157.835 1.00 71.90  ? 466  PRO A N   1 
ATOM   3343 C  CA  . PRO A 1 437 ? 71.212  82.621  159.095 1.00 73.54  ? 466  PRO A CA  1 
ATOM   3344 C  C   . PRO A 1 437 ? 70.376  82.648  160.350 1.00 76.90  ? 466  PRO A C   1 
ATOM   3345 O  O   . PRO A 1 437 ? 69.452  83.432  160.471 1.00 77.41  ? 466  PRO A O   1 
ATOM   3346 C  CB  . PRO A 1 437 ? 72.041  83.909  159.042 1.00 72.23  ? 466  PRO A CB  1 
ATOM   3347 C  CG  . PRO A 1 437 ? 72.253  84.153  157.601 1.00 71.93  ? 466  PRO A CG  1 
ATOM   3348 C  CD  . PRO A 1 437 ? 71.046  83.614  156.894 1.00 71.60  ? 466  PRO A CD  1 
ATOM   3349 N  N   . GLU A 1 438 ? 70.841  81.907  161.350 1.00 81.25  ? 467  GLU A N   1 
ATOM   3350 C  CA  . GLU A 1 438 ? 70.268  81.892  162.687 1.00 85.53  ? 467  GLU A CA  1 
ATOM   3351 C  C   . GLU A 1 438 ? 71.338  82.345  163.681 1.00 88.80  ? 467  GLU A C   1 
ATOM   3352 O  O   . GLU A 1 438 ? 72.358  81.676  163.787 1.00 89.46  ? 467  GLU A O   1 
ATOM   3353 C  CB  . GLU A 1 438 ? 69.761  80.504  163.047 1.00 90.49  ? 467  GLU A CB  1 
ATOM   3354 C  CG  . GLU A 1 438 ? 68.738  80.512  164.172 1.00 97.40  ? 467  GLU A CG  1 
ATOM   3355 C  CD  . GLU A 1 438 ? 68.013  79.182  164.272 1.00 101.38 ? 467  GLU A CD  1 
ATOM   3356 O  OE1 . GLU A 1 438 ? 68.456  78.216  163.615 1.00 99.81  ? 467  GLU A OE1 1 
ATOM   3357 O  OE2 . GLU A 1 438 ? 67.008  79.131  165.013 1.00 104.92 ? 467  GLU A OE2 1 
ATOM   3358 N  N   . ILE A 1 439 ? 71.159  83.484  164.329 1.00 92.05  ? 468  ILE A N   1 
ATOM   3359 C  CA  . ILE A 1 439 ? 72.213  84.084  165.116 1.00 96.89  ? 468  ILE A CA  1 
ATOM   3360 C  C   . ILE A 1 439 ? 72.631  83.316  166.351 1.00 100.51 ? 468  ILE A C   1 
ATOM   3361 O  O   . ILE A 1 439 ? 73.830  83.170  166.647 1.00 101.43 ? 468  ILE A O   1 
ATOM   3362 C  CB  . ILE A 1 439 ? 71.853  85.530  165.527 1.00 98.17  ? 468  ILE A CB  1 
ATOM   3363 C  CG1 . ILE A 1 439 ? 70.420  85.567  166.055 1.00 93.40  ? 468  ILE A CG1 1 
ATOM   3364 C  CG2 . ILE A 1 439 ? 72.072  86.500  164.388 1.00 98.63  ? 468  ILE A CG2 1 
ATOM   3365 C  CD1 . ILE A 1 439 ? 70.351  86.112  167.468 1.00 94.97  ? 468  ILE A CD1 1 
ATOM   3366 N  N   . CYS A 1 440 ? 71.663  82.920  167.170 1.00 102.52 ? 469  CYS A N   1 
ATOM   3367 C  CA  . CYS A 1 440 ? 71.975  82.281  168.444 1.00 104.58 ? 469  CYS A CA  1 
ATOM   3368 C  C   . CYS A 1 440 ? 72.490  80.860  168.265 1.00 106.23 ? 469  CYS A C   1 
ATOM   3369 O  O   . CYS A 1 440 ? 73.389  80.406  168.962 1.00 105.67 ? 469  CYS A O   1 
ATOM   3370 C  CB  . CYS A 1 440 ? 70.721  82.247  169.319 1.00 108.11 ? 469  CYS A CB  1 
ATOM   3371 S  SG  . CYS A 1 440 ? 70.427  83.687  170.344 1.00 111.70 ? 469  CYS A SG  1 
ATOM   3372 N  N   . LYS A 1 441 ? 71.881  80.131  167.338 1.00 108.18 ? 470  LYS A N   1 
ATOM   3373 C  CA  . LYS A 1 441 ? 72.161  78.722  167.129 1.00 109.04 ? 470  LYS A CA  1 
ATOM   3374 C  C   . LYS A 1 441 ? 73.361  78.465  166.239 1.00 109.20 ? 470  LYS A C   1 
ATOM   3375 O  O   . LYS A 1 441 ? 73.662  77.301  165.951 1.00 109.82 ? 470  LYS A O   1 
ATOM   3376 C  CB  . LYS A 1 441 ? 70.919  78.026  166.559 1.00 111.57 ? 470  LYS A CB  1 
ATOM   3377 C  CG  . LYS A 1 441 ? 70.066  77.289  167.571 1.00 111.71 ? 470  LYS A CG  1 
ATOM   3378 C  CD  . LYS A 1 441 ? 69.189  76.237  166.897 1.00 112.76 ? 470  LYS A CD  1 
ATOM   3379 C  CE  . LYS A 1 441 ? 68.066  75.770  167.805 1.00 112.86 ? 470  LYS A CE  1 
ATOM   3380 N  NZ  . LYS A 1 441 ? 66.879  75.291  167.044 1.00 113.24 ? 470  LYS A NZ  1 
ATOM   3381 N  N   . GLN A 1 442 ? 74.014  79.497  165.733 1.00 109.02 ? 471  GLN A N   1 
ATOM   3382 C  CA  . GLN A 1 442 ? 75.175  79.351  164.869 1.00 109.54 ? 471  GLN A CA  1 
ATOM   3383 C  C   . GLN A 1 442 ? 76.122  80.534  165.090 1.00 109.47 ? 471  GLN A C   1 
ATOM   3384 O  O   . GLN A 1 442 ? 75.669  81.659  165.278 1.00 109.82 ? 471  GLN A O   1 
ATOM   3385 C  CB  . GLN A 1 442 ? 74.826  79.250  163.393 1.00 110.97 ? 471  GLN A CB  1 
ATOM   3386 C  CG  . GLN A 1 442 ? 74.038  78.040  162.945 1.00 118.22 ? 471  GLN A CG  1 
ATOM   3387 C  CD  . GLN A 1 442 ? 74.764  76.722  163.092 1.00 122.60 ? 471  GLN A CD  1 
ATOM   3388 O  OE1 . GLN A 1 442 ? 75.876  76.682  163.624 1.00 127.56 ? 471  GLN A OE1 1 
ATOM   3389 N  NE2 . GLN A 1 442 ? 74.177  75.622  162.629 1.00 121.44 ? 471  GLN A NE2 1 
ATOM   3390 N  N   . ASP A 1 443 ? 77.417  80.255  165.155 1.00 109.05 ? 472  ASP A N   1 
ATOM   3391 C  CA  . ASP A 1 443 ? 78.399  81.340  165.311 1.00 107.46 ? 472  ASP A CA  1 
ATOM   3392 C  C   . ASP A 1 443 ? 78.709  81.852  163.911 1.00 105.07 ? 472  ASP A C   1 
ATOM   3393 O  O   . ASP A 1 443 ? 79.006  81.024  163.038 1.00 106.54 ? 472  ASP A O   1 
ATOM   3394 C  CB  . ASP A 1 443 ? 79.672  80.824  165.983 1.00 116.05 ? 472  ASP A CB  1 
ATOM   3395 C  CG  . ASP A 1 443 ? 79.315  79.979  167.199 1.00 122.53 ? 472  ASP A CG  1 
ATOM   3396 O  OD1 . ASP A 1 443 ? 78.189  80.180  167.713 1.00 123.25 ? 472  ASP A OD1 1 
ATOM   3397 O  OD2 . ASP A 1 443 ? 80.130  79.142  167.623 1.00 125.43 ? 472  ASP A OD2 1 
ATOM   3398 N  N   . ILE A 1 444 ? 78.431  83.127  163.645 1.00 100.28 ? 473  ILE A N   1 
ATOM   3399 C  CA  . ILE A 1 444 ? 78.653  83.633  162.303 1.00 94.19  ? 473  ILE A CA  1 
ATOM   3400 C  C   . ILE A 1 444 ? 79.314  85.014  162.354 1.00 88.59  ? 473  ILE A C   1 
ATOM   3401 O  O   . ILE A 1 444 ? 79.296  85.720  163.346 1.00 86.17  ? 473  ILE A O   1 
ATOM   3402 C  CB  . ILE A 1 444 ? 77.405  83.750  161.421 1.00 93.47  ? 473  ILE A CB  1 
ATOM   3403 C  CG1 . ILE A 1 444 ? 76.462  84.806  162.005 1.00 92.13  ? 473  ILE A CG1 1 
ATOM   3404 C  CG2 . ILE A 1 444 ? 76.690  82.440  161.175 1.00 95.95  ? 473  ILE A CG2 1 
ATOM   3405 C  CD1 . ILE A 1 444 ? 75.247  85.052  161.142 1.00 95.03  ? 473  ILE A CD1 1 
ATOM   3406 N  N   . VAL A 1 445 ? 79.865  85.365  161.199 1.00 85.07  ? 474  VAL A N   1 
ATOM   3407 C  CA  . VAL A 1 445 ? 80.527  86.655  161.072 1.00 82.41  ? 474  VAL A CA  1 
ATOM   3408 C  C   . VAL A 1 445 ? 79.638  87.634  160.321 1.00 79.77  ? 474  VAL A C   1 
ATOM   3409 O  O   . VAL A 1 445 ? 79.258  87.389  159.174 1.00 79.74  ? 474  VAL A O   1 
ATOM   3410 C  CB  . VAL A 1 445 ? 81.884  86.489  160.372 1.00 86.43  ? 474  VAL A CB  1 
ATOM   3411 C  CG1 . VAL A 1 445 ? 82.889  85.868  161.326 1.00 84.30  ? 474  VAL A CG1 1 
ATOM   3412 C  CG2 . VAL A 1 445 ? 81.768  85.610  159.133 1.00 89.79  ? 474  VAL A CG2 1 
ATOM   3413 N  N   . PHE A 1 446 ? 79.281  88.728  160.993 1.00 76.50  ? 475  PHE A N   1 
ATOM   3414 C  CA  . PHE A 1 446 ? 78.407  89.705  160.350 1.00 74.30  ? 475  PHE A CA  1 
ATOM   3415 C  C   . PHE A 1 446 ? 79.174  90.498  159.309 1.00 73.64  ? 475  PHE A C   1 
ATOM   3416 O  O   . PHE A 1 446 ? 80.376  90.729  159.439 1.00 75.39  ? 475  PHE A O   1 
ATOM   3417 C  CB  . PHE A 1 446 ? 77.799  90.617  161.386 1.00 75.58  ? 475  PHE A CB  1 
ATOM   3418 C  CG  . PHE A 1 446 ? 76.795  90.024  162.321 1.00 78.89  ? 475  PHE A CG  1 
ATOM   3419 C  CD1 . PHE A 1 446 ? 75.488  89.773  161.934 1.00 75.73  ? 475  PHE A CD1 1 
ATOM   3420 C  CD2 . PHE A 1 446 ? 77.161  89.739  163.626 1.00 79.55  ? 475  PHE A CD2 1 
ATOM   3421 C  CE1 . PHE A 1 446 ? 74.570  89.247  162.808 1.00 72.54  ? 475  PHE A CE1 1 
ATOM   3422 C  CE2 . PHE A 1 446 ? 76.244  89.210  164.509 1.00 80.79  ? 475  PHE A CE2 1 
ATOM   3423 C  CZ  . PHE A 1 446 ? 74.951  88.965  164.098 1.00 77.13  ? 475  PHE A CZ  1 
ATOM   3424 N  N   . ASP A 1 447 ? 78.515  90.950  158.239 1.00 71.24  ? 476  ASP A N   1 
ATOM   3425 C  CA  . ASP A 1 447 ? 79.224  91.748  157.240 1.00 65.45  ? 476  ASP A CA  1 
ATOM   3426 C  C   . ASP A 1 447 ? 79.419  93.146  157.806 1.00 60.46  ? 476  ASP A C   1 
ATOM   3427 O  O   . ASP A 1 447 ? 80.399  93.794  157.548 1.00 59.21  ? 476  ASP A O   1 
ATOM   3428 C  CB  . ASP A 1 447 ? 78.497  91.855  155.916 1.00 72.08  ? 476  ASP A CB  1 
ATOM   3429 C  CG  . ASP A 1 447 ? 78.008  90.550  155.351 1.00 78.27  ? 476  ASP A CG  1 
ATOM   3430 O  OD1 . ASP A 1 447 ? 77.703  89.630  156.140 1.00 81.27  ? 476  ASP A OD1 1 
ATOM   3431 O  OD2 . ASP A 1 447 ? 77.918  90.411  154.114 1.00 83.19  ? 476  ASP A OD2 1 
ATOM   3432 N  N   . GLY A 1 448 ? 78.474  93.658  158.561 1.00 58.41  ? 477  GLY A N   1 
ATOM   3433 C  CA  . GLY A 1 448 ? 78.659  95.038  159.059 1.00 57.98  ? 477  GLY A CA  1 
ATOM   3434 C  C   . GLY A 1 448 ? 77.708  95.170  160.239 1.00 59.46  ? 477  GLY A C   1 
ATOM   3435 O  O   . GLY A 1 448 ? 76.702  94.464  160.340 1.00 60.37  ? 477  GLY A O   1 
ATOM   3436 N  N   . ILE A 1 449 ? 78.130  95.949  161.204 1.00 60.64  ? 478  ILE A N   1 
ATOM   3437 C  CA  . ILE A 1 449 ? 77.300  96.045  162.416 1.00 63.56  ? 478  ILE A CA  1 
ATOM   3438 C  C   . ILE A 1 449 ? 77.302  97.530  162.710 1.00 67.53  ? 478  ILE A C   1 
ATOM   3439 O  O   . ILE A 1 449 ? 78.365  98.129  162.510 1.00 68.35  ? 478  ILE A O   1 
ATOM   3440 C  CB  . ILE A 1 449 ? 77.901  95.249  163.573 1.00 66.43  ? 478  ILE A CB  1 
ATOM   3441 C  CG1 . ILE A 1 449 ? 77.514  93.764  163.494 1.00 65.11  ? 478  ILE A CG1 1 
ATOM   3442 C  CG2 . ILE A 1 449 ? 77.435  95.823  164.909 1.00 65.51  ? 478  ILE A CG2 1 
ATOM   3443 C  CD1 . ILE A 1 449 ? 78.677  92.822  163.336 1.00 58.18  ? 478  ILE A CD1 1 
ATOM   3444 N  N   . ALA A 1 450 ? 76.144  98.104  162.960 1.00 72.13  ? 479  ALA A N   1 
ATOM   3445 C  CA  . ALA A 1 450 ? 76.135  99.548  163.211 1.00 76.63  ? 479  ALA A CA  1 
ATOM   3446 C  C   . ALA A 1 450 ? 74.798  100.051 163.726 1.00 81.47  ? 479  ALA A C   1 
ATOM   3447 O  O   . ALA A 1 450 ? 73.740  99.525  163.389 1.00 82.38  ? 479  ALA A O   1 
ATOM   3448 C  CB  . ALA A 1 450 ? 76.542  100.304 161.962 1.00 65.95  ? 479  ALA A CB  1 
ATOM   3449 N  N   . GLN A 1 451 ? 74.863  101.077 164.569 1.00 85.96  ? 480  GLN A N   1 
ATOM   3450 C  CA  . GLN A 1 451 ? 73.671  101.760 165.078 1.00 91.00  ? 480  GLN A CA  1 
ATOM   3451 C  C   . GLN A 1 451 ? 73.089  102.593 163.935 1.00 94.15  ? 480  GLN A C   1 
ATOM   3452 O  O   . GLN A 1 451 ? 73.885  103.154 163.181 1.00 95.22  ? 480  GLN A O   1 
ATOM   3453 C  CB  . GLN A 1 451 ? 74.057  102.729 166.205 1.00 98.02  ? 480  GLN A CB  1 
ATOM   3454 C  CG  . GLN A 1 451 ? 73.440  102.431 167.549 1.00 100.86 ? 480  GLN A CG  1 
ATOM   3455 C  CD  . GLN A 1 451 ? 73.450  103.598 168.509 1.00 101.48 ? 480  GLN A CD  1 
ATOM   3456 O  OE1 . GLN A 1 451 ? 73.962  103.504 169.625 1.00 102.48 ? 480  GLN A OE1 1 
ATOM   3457 N  NE2 . GLN A 1 451 ? 72.875  104.725 168.101 1.00 101.82 ? 480  GLN A NE2 1 
ATOM   3458 N  N   . ILE A 1 452 ? 71.785  102.637 163.761 1.00 97.29  ? 481  ILE A N   1 
ATOM   3459 C  CA  . ILE A 1 452 ? 71.206  103.464 162.684 1.00 100.86 ? 481  ILE A CA  1 
ATOM   3460 C  C   . ILE A 1 452 ? 70.380  104.554 163.325 1.00 105.05 ? 481  ILE A C   1 
ATOM   3461 O  O   . ILE A 1 452 ? 70.911  105.230 164.224 1.00 105.44 ? 481  ILE A O   1 
ATOM   3462 C  CB  . ILE A 1 452 ? 70.424  102.661 161.656 1.00 92.45  ? 481  ILE A CB  1 
ATOM   3463 C  CG1 . ILE A 1 452 ? 71.370  101.726 160.892 1.00 91.46  ? 481  ILE A CG1 1 
ATOM   3464 C  CG2 . ILE A 1 452 ? 69.709  103.569 160.660 1.00 90.98  ? 481  ILE A CG2 1 
ATOM   3465 C  CD1 . ILE A 1 452 ? 70.777  101.108 159.653 1.00 96.11  ? 481  ILE A CD1 1 
ATOM   3466 N  N   . ARG A 1 453 ? 69.088  104.684 163.073 1.00 109.59 ? 482  ARG A N   1 
ATOM   3467 C  CA  . ARG A 1 453 ? 68.327  105.729 163.770 1.00 114.37 ? 482  ARG A CA  1 
ATOM   3468 C  C   . ARG A 1 453 ? 68.012  105.305 165.192 1.00 117.17 ? 482  ARG A C   1 
ATOM   3469 O  O   . ARG A 1 453 ? 66.862  105.225 165.605 1.00 118.14 ? 482  ARG A O   1 
ATOM   3470 C  CB  . ARG A 1 453 ? 67.105  106.150 162.962 1.00 125.45 ? 482  ARG A CB  1 
ATOM   3471 C  CG  . ARG A 1 453 ? 67.358  107.383 162.124 1.00 134.44 ? 482  ARG A CG  1 
ATOM   3472 C  CD  . ARG A 1 453 ? 66.356  107.702 161.049 1.00 141.21 ? 482  ARG A CD  1 
ATOM   3473 N  NE  . ARG A 1 453 ? 67.006  108.170 159.830 1.00 146.37 ? 482  ARG A NE  1 
ATOM   3474 C  CZ  . ARG A 1 453 ? 66.588  109.139 159.037 1.00 149.36 ? 482  ARG A CZ  1 
ATOM   3475 N  NH1 . ARG A 1 453 ? 65.475  109.803 159.308 1.00 151.85 ? 482  ARG A NH1 1 
ATOM   3476 N  NH2 . ARG A 1 453 ? 67.281  109.463 157.952 1.00 150.77 ? 482  ARG A NH2 1 
ATOM   3477 N  N   . GLY A 1 454 ? 69.058  105.035 165.965 1.00 118.98 ? 483  GLY A N   1 
ATOM   3478 C  CA  . GLY A 1 454 ? 69.006  104.636 167.343 1.00 120.47 ? 483  GLY A CA  1 
ATOM   3479 C  C   . GLY A 1 454 ? 68.860  103.136 167.539 1.00 120.52 ? 483  GLY A C   1 
ATOM   3480 O  O   . GLY A 1 454 ? 68.695  102.667 168.668 1.00 122.03 ? 483  GLY A O   1 
ATOM   3481 N  N   . GLU A 1 455 ? 68.903  102.371 166.453 1.00 118.28 ? 484  GLU A N   1 
ATOM   3482 C  CA  . GLU A 1 455 ? 68.763  100.920 166.588 1.00 115.76 ? 484  GLU A CA  1 
ATOM   3483 C  C   . GLU A 1 455 ? 70.054  100.231 166.182 1.00 112.31 ? 484  GLU A C   1 
ATOM   3484 O  O   . GLU A 1 455 ? 70.740  100.720 165.282 1.00 113.85 ? 484  GLU A O   1 
ATOM   3485 C  CB  . GLU A 1 455 ? 67.597  100.431 165.731 1.00 129.60 ? 484  GLU A CB  1 
ATOM   3486 C  CG  . GLU A 1 455 ? 66.245  101.032 166.083 1.00 135.80 ? 484  GLU A CG  1 
ATOM   3487 C  CD  . GLU A 1 455 ? 65.139  100.602 165.138 1.00 137.22 ? 484  GLU A CD  1 
ATOM   3488 O  OE1 . GLU A 1 455 ? 65.444  99.928  164.136 1.00 137.16 ? 484  GLU A OE1 1 
ATOM   3489 O  OE2 . GLU A 1 455 ? 63.961  100.937 165.390 1.00 139.80 ? 484  GLU A OE2 1 
ATOM   3490 N  N   . ILE A 1 456 ? 70.408  99.130  166.833 1.00 107.26 ? 485  ILE A N   1 
ATOM   3491 C  CA  . ILE A 1 456 ? 71.619  98.409  166.407 1.00 101.21 ? 485  ILE A CA  1 
ATOM   3492 C  C   . ILE A 1 456 ? 71.261  97.506  165.237 1.00 95.92  ? 485  ILE A C   1 
ATOM   3493 O  O   . ILE A 1 456 ? 70.245  96.806  165.290 1.00 96.82  ? 485  ILE A O   1 
ATOM   3494 C  CB  . ILE A 1 456 ? 72.216  97.597  167.556 1.00 103.88 ? 485  ILE A CB  1 
ATOM   3495 C  CG1 . ILE A 1 456 ? 72.345  98.459  168.813 1.00 105.41 ? 485  ILE A CG1 1 
ATOM   3496 C  CG2 . ILE A 1 456 ? 73.564  97.003  167.172 1.00 104.84 ? 485  ILE A CG2 1 
ATOM   3497 C  CD1 . ILE A 1 456 ? 73.387  99.547  168.718 1.00 107.15 ? 485  ILE A CD1 1 
ATOM   3498 N  N   . PHE A 1 457 ? 72.007  97.566  164.139 1.00 89.99  ? 486  PHE A N   1 
ATOM   3499 C  CA  . PHE A 1 457 ? 71.666  96.757  162.969 1.00 83.03  ? 486  PHE A CA  1 
ATOM   3500 C  C   . PHE A 1 457 ? 72.776  95.773  162.614 1.00 77.77  ? 486  PHE A C   1 
ATOM   3501 O  O   . PHE A 1 457 ? 73.854  96.199  162.199 1.00 77.22  ? 486  PHE A O   1 
ATOM   3502 C  CB  . PHE A 1 457 ? 71.395  97.643  161.760 1.00 84.02  ? 486  PHE A CB  1 
ATOM   3503 C  CG  . PHE A 1 457 ? 69.997  98.176  161.663 1.00 82.45  ? 486  PHE A CG  1 
ATOM   3504 C  CD1 . PHE A 1 457 ? 69.474  99.018  162.620 1.00 82.36  ? 486  PHE A CD1 1 
ATOM   3505 C  CD2 . PHE A 1 457 ? 69.206  97.834  160.582 1.00 84.71  ? 486  PHE A CD2 1 
ATOM   3506 C  CE1 . PHE A 1 457 ? 68.188  99.504  162.516 1.00 85.82  ? 486  PHE A CE1 1 
ATOM   3507 C  CE2 . PHE A 1 457 ? 67.919  98.313  160.465 1.00 86.48  ? 486  PHE A CE2 1 
ATOM   3508 C  CZ  . PHE A 1 457 ? 67.411  99.154  161.434 1.00 87.98  ? 486  PHE A CZ  1 
ATOM   3509 N  N   . PHE A 1 458 ? 72.475  94.482  162.723 1.00 72.70  ? 487  PHE A N   1 
ATOM   3510 C  CA  . PHE A 1 458 ? 73.449  93.434  162.427 1.00 67.14  ? 487  PHE A CA  1 
ATOM   3511 C  C   . PHE A 1 458 ? 73.189  92.836  161.054 1.00 62.84  ? 487  PHE A C   1 
ATOM   3512 O  O   . PHE A 1 458 ? 72.164  92.182  160.839 1.00 63.33  ? 487  PHE A O   1 
ATOM   3513 C  CB  . PHE A 1 458 ? 73.394  92.311  163.477 1.00 70.31  ? 487  PHE A CB  1 
ATOM   3514 C  CG  . PHE A 1 458 ? 73.686  92.773  164.874 1.00 74.64  ? 487  PHE A CG  1 
ATOM   3515 C  CD1 . PHE A 1 458 ? 72.674  93.240  165.701 1.00 69.32  ? 487  PHE A CD1 1 
ATOM   3516 C  CD2 . PHE A 1 458 ? 74.988  92.757  165.359 1.00 77.01  ? 487  PHE A CD2 1 
ATOM   3517 C  CE1 . PHE A 1 458 ? 72.950  93.685  166.978 1.00 67.51  ? 487  PHE A CE1 1 
ATOM   3518 C  CE2 . PHE A 1 458 ? 75.268  93.205  166.637 1.00 76.14  ? 487  PHE A CE2 1 
ATOM   3519 C  CZ  . PHE A 1 458 ? 74.245  93.668  167.449 1.00 71.06  ? 487  PHE A CZ  1 
ATOM   3520 N  N   . PHE A 1 459 ? 74.108  93.036  160.115 1.00 59.10  ? 488  PHE A N   1 
ATOM   3521 C  CA  . PHE A 1 459 ? 73.871  92.529  158.775 1.00 56.14  ? 488  PHE A CA  1 
ATOM   3522 C  C   . PHE A 1 459 ? 74.652  91.253  158.539 1.00 56.22  ? 488  PHE A C   1 
ATOM   3523 O  O   . PHE A 1 459 ? 75.617  90.989  159.222 1.00 58.48  ? 488  PHE A O   1 
ATOM   3524 C  CB  . PHE A 1 459 ? 74.277  93.525  157.692 1.00 46.60  ? 488  PHE A CB  1 
ATOM   3525 C  CG  . PHE A 1 459 ? 73.495  94.815  157.754 1.00 40.38  ? 488  PHE A CG  1 
ATOM   3526 C  CD1 . PHE A 1 459 ? 73.658  95.674  158.819 1.00 41.61  ? 488  PHE A CD1 1 
ATOM   3527 C  CD2 . PHE A 1 459 ? 72.594  95.164  156.763 1.00 35.94  ? 488  PHE A CD2 1 
ATOM   3528 C  CE1 . PHE A 1 459 ? 72.919  96.845  158.884 1.00 47.99  ? 488  PHE A CE1 1 
ATOM   3529 C  CE2 . PHE A 1 459 ? 71.854  96.324  156.819 1.00 37.61  ? 488  PHE A CE2 1 
ATOM   3530 C  CZ  . PHE A 1 459 ? 72.023  97.174  157.888 1.00 44.11  ? 488  PHE A CZ  1 
ATOM   3531 N  N   . LYS A 1 460 ? 74.192  90.547  157.539 1.00 57.13  ? 489  LYS A N   1 
ATOM   3532 C  CA  . LYS A 1 460 ? 74.885  89.337  157.106 1.00 60.93  ? 489  LYS A CA  1 
ATOM   3533 C  C   . LYS A 1 460 ? 74.720  89.253  155.606 1.00 64.56  ? 489  LYS A C   1 
ATOM   3534 O  O   . LYS A 1 460 ? 74.797  90.287  154.916 1.00 69.06  ? 489  LYS A O   1 
ATOM   3535 C  CB  . LYS A 1 460 ? 74.321  88.159  157.857 1.00 69.40  ? 489  LYS A CB  1 
ATOM   3536 C  CG  . LYS A 1 460 ? 74.920  86.825  157.540 1.00 77.39  ? 489  LYS A CG  1 
ATOM   3537 C  CD  . LYS A 1 460 ? 76.338  86.600  157.960 1.00 78.97  ? 489  LYS A CD  1 
ATOM   3538 C  CE  . LYS A 1 460 ? 76.946  85.502  157.083 1.00 79.14  ? 489  LYS A CE  1 
ATOM   3539 N  NZ  . LYS A 1 460 ? 78.429  85.456  157.255 1.00 82.46  ? 489  LYS A NZ  1 
ATOM   3540 N  N   . ASP A 1 461 ? 74.529  88.083  155.056 1.00 65.98  ? 490  ASP A N   1 
ATOM   3541 C  CA  . ASP A 1 461 ? 74.322  87.988  153.613 1.00 68.58  ? 490  ASP A CA  1 
ATOM   3542 C  C   . ASP A 1 461 ? 73.059  88.721  153.184 1.00 69.55  ? 490  ASP A C   1 
ATOM   3543 O  O   . ASP A 1 461 ? 73.025  89.932  152.934 1.00 68.33  ? 490  ASP A O   1 
ATOM   3544 C  CB  . ASP A 1 461 ? 74.278  86.507  153.237 1.00 77.06  ? 490  ASP A CB  1 
ATOM   3545 C  CG  . ASP A 1 461 ? 75.675  85.907  153.241 1.00 74.50  ? 490  ASP A CG  1 
ATOM   3546 O  OD1 . ASP A 1 461 ? 76.561  86.602  152.720 1.00 75.96  ? 490  ASP A OD1 1 
ATOM   3547 O  OD2 . ASP A 1 461 ? 75.845  84.783  153.741 1.00 82.46  ? 490  ASP A OD2 1 
ATOM   3548 N  N   . ARG A 1 462 ? 71.948  87.984  153.033 1.00 67.98  ? 491  ARG A N   1 
ATOM   3549 C  CA  . ARG A 1 462 ? 70.736  88.642  152.548 1.00 59.72  ? 491  ARG A CA  1 
ATOM   3550 C  C   . ARG A 1 462 ? 69.820  89.075  153.652 1.00 55.08  ? 491  ARG A C   1 
ATOM   3551 O  O   . ARG A 1 462 ? 68.632  89.170  153.353 1.00 59.10  ? 491  ARG A O   1 
ATOM   3552 C  CB  . ARG A 1 462 ? 70.024  87.648  151.606 1.00 73.20  ? 491  ARG A CB  1 
ATOM   3553 C  CG  . ARG A 1 462 ? 70.177  88.064  150.163 1.00 82.03  ? 491  ARG A CG  1 
ATOM   3554 C  CD  . ARG A 1 462 ? 69.530  87.085  149.197 1.00 93.00  ? 491  ARG A CD  1 
ATOM   3555 N  NE  . ARG A 1 462 ? 70.225  87.119  147.912 1.00 102.18 ? 491  ARG A NE  1 
ATOM   3556 C  CZ  . ARG A 1 462 ? 69.722  87.575  146.779 1.00 106.01 ? 491  ARG A CZ  1 
ATOM   3557 N  NH1 . ARG A 1 462 ? 68.486  88.052  146.711 1.00 111.99 ? 491  ARG A NH1 1 
ATOM   3558 N  NH2 . ARG A 1 462 ? 70.452  87.560  145.674 1.00 108.11 ? 491  ARG A NH2 1 
ATOM   3559 N  N   . PHE A 1 463 ? 70.186  89.153  154.922 1.00 50.68  ? 492  PHE A N   1 
ATOM   3560 C  CA  . PHE A 1 463 ? 69.299  89.453  156.024 1.00 47.17  ? 492  PHE A CA  1 
ATOM   3561 C  C   . PHE A 1 463 ? 69.904  90.361  157.076 1.00 44.45  ? 492  PHE A C   1 
ATOM   3562 O  O   . PHE A 1 463 ? 71.091  90.629  157.131 1.00 41.61  ? 492  PHE A O   1 
ATOM   3563 C  CB  . PHE A 1 463 ? 68.758  88.188  156.770 1.00 47.20  ? 492  PHE A CB  1 
ATOM   3564 C  CG  . PHE A 1 463 ? 68.458  87.083  155.801 1.00 50.76  ? 492  PHE A CG  1 
ATOM   3565 C  CD1 . PHE A 1 463 ? 69.467  86.260  155.354 1.00 42.08  ? 492  PHE A CD1 1 
ATOM   3566 C  CD2 . PHE A 1 463 ? 67.183  86.935  155.273 1.00 57.65  ? 492  PHE A CD2 1 
ATOM   3567 C  CE1 . PHE A 1 463 ? 69.232  85.274  154.422 1.00 49.23  ? 492  PHE A CE1 1 
ATOM   3568 C  CE2 . PHE A 1 463 ? 66.959  85.947  154.337 1.00 56.96  ? 492  PHE A CE2 1 
ATOM   3569 C  CZ  . PHE A 1 463 ? 67.969  85.108  153.909 1.00 49.11  ? 492  PHE A CZ  1 
ATOM   3570 N  N   . ILE A 1 464 ? 69.069  90.932  157.955 1.00 45.10  ? 493  ILE A N   1 
ATOM   3571 C  CA  . ILE A 1 464 ? 69.562  91.818  158.988 1.00 46.40  ? 493  ILE A CA  1 
ATOM   3572 C  C   . ILE A 1 464 ? 68.759  91.632  160.273 1.00 49.23  ? 493  ILE A C   1 
ATOM   3573 O  O   . ILE A 1 464 ? 67.537  91.519  160.176 1.00 52.68  ? 493  ILE A O   1 
ATOM   3574 C  CB  . ILE A 1 464 ? 69.436  93.298  158.585 1.00 52.68  ? 493  ILE A CB  1 
ATOM   3575 C  CG1 . ILE A 1 464 ? 67.976  93.781  158.657 1.00 45.20  ? 493  ILE A CG1 1 
ATOM   3576 C  CG2 . ILE A 1 464 ? 69.981  93.542  157.193 1.00 52.92  ? 493  ILE A CG2 1 
ATOM   3577 C  CD1 . ILE A 1 464 ? 67.829  94.940  159.634 1.00 49.12  ? 493  ILE A CD1 1 
ATOM   3578 N  N   . TRP A 1 465 ? 69.430  91.633  161.406 1.00 49.64  ? 494  TRP A N   1 
ATOM   3579 C  CA  . TRP A 1 465 ? 68.768  91.572  162.704 1.00 53.50  ? 494  TRP A CA  1 
ATOM   3580 C  C   . TRP A 1 465 ? 68.900  92.975  163.303 1.00 60.57  ? 494  TRP A C   1 
ATOM   3581 O  O   . TRP A 1 465 ? 69.892  93.636  162.947 1.00 59.92  ? 494  TRP A O   1 
ATOM   3582 C  CB  . TRP A 1 465 ? 69.407  90.528  163.606 1.00 48.16  ? 494  TRP A CB  1 
ATOM   3583 C  CG  . TRP A 1 465 ? 69.340  89.120  163.088 1.00 41.41  ? 494  TRP A CG  1 
ATOM   3584 C  CD1 . TRP A 1 465 ? 68.514  88.115  163.504 1.00 40.81  ? 494  TRP A CD1 1 
ATOM   3585 C  CD2 . TRP A 1 465 ? 70.144  88.556  162.045 1.00 28.52  ? 494  TRP A CD2 1 
ATOM   3586 N  NE1 . TRP A 1 465 ? 68.742  86.968  162.776 1.00 33.31  ? 494  TRP A NE1 1 
ATOM   3587 C  CE2 . TRP A 1 465 ? 69.742  87.225  161.874 1.00 28.08  ? 494  TRP A CE2 1 
ATOM   3588 C  CE3 . TRP A 1 465 ? 71.160  89.067  161.234 1.00 35.71  ? 494  TRP A CE3 1 
ATOM   3589 C  CZ2 . TRP A 1 465 ? 70.319  86.389  160.918 1.00 37.07  ? 494  TRP A CZ2 1 
ATOM   3590 C  CZ3 . TRP A 1 465 ? 71.737  88.239  160.290 1.00 42.24  ? 494  TRP A CZ3 1 
ATOM   3591 C  CH2 . TRP A 1 465 ? 71.314  86.909  160.134 1.00 39.94  ? 494  TRP A CH2 1 
ATOM   3592 N  N   . ARG A 1 466 ? 67.946  93.420  164.096 1.00 68.33  ? 495  ARG A N   1 
ATOM   3593 C  CA  . ARG A 1 466 ? 67.964  94.758  164.675 1.00 78.54  ? 495  ARG A CA  1 
ATOM   3594 C  C   . ARG A 1 466 ? 67.400  94.785  166.087 1.00 88.42  ? 495  ARG A C   1 
ATOM   3595 O  O   . ARG A 1 466 ? 66.584  93.934  166.455 1.00 89.98  ? 495  ARG A O   1 
ATOM   3596 C  CB  . ARG A 1 466 ? 67.201  95.725  163.776 1.00 81.39  ? 495  ARG A CB  1 
ATOM   3597 C  CG  . ARG A 1 466 ? 65.703  95.805  163.967 1.00 85.42  ? 495  ARG A CG  1 
ATOM   3598 C  CD  . ARG A 1 466 ? 65.177  97.211  163.709 1.00 91.25  ? 495  ARG A CD  1 
ATOM   3599 N  NE  . ARG A 1 466 ? 63.907  97.221  163.005 1.00 98.22  ? 495  ARG A NE  1 
ATOM   3600 C  CZ  . ARG A 1 466 ? 63.293  98.260  162.458 1.00 101.99 ? 495  ARG A CZ  1 
ATOM   3601 N  NH1 . ARG A 1 466 ? 63.808  99.486  162.500 1.00 104.51 ? 495  ARG A NH1 1 
ATOM   3602 N  NH2 . ARG A 1 466 ? 62.122  98.088  161.845 1.00 100.32 ? 495  ARG A NH2 1 
ATOM   3603 N  N   . THR A 1 467 ? 67.799  95.769  166.888 1.00 96.87  ? 496  THR A N   1 
ATOM   3604 C  CA  . THR A 1 467 ? 67.309  95.907  168.248 1.00 107.28 ? 496  THR A CA  1 
ATOM   3605 C  C   . THR A 1 467 ? 67.474  97.314  168.798 1.00 115.96 ? 496  THR A C   1 
ATOM   3606 O  O   . THR A 1 467 ? 68.456  97.996  168.487 1.00 116.65 ? 496  THR A O   1 
ATOM   3607 C  CB  . THR A 1 467 ? 68.077  94.969  169.209 1.00 109.82 ? 496  THR A CB  1 
ATOM   3608 O  OG1 . THR A 1 467 ? 67.675  95.278  170.555 1.00 114.31 ? 496  THR A OG1 1 
ATOM   3609 C  CG2 . THR A 1 467 ? 69.573  95.204  169.084 1.00 109.37 ? 496  THR A CG2 1 
ATOM   3610 N  N   . VAL A 1 468 ? 66.617  97.713  169.744 1.00 124.07 ? 497  VAL A N   1 
ATOM   3611 C  CA  . VAL A 1 468 ? 66.825  99.043  170.328 1.00 133.36 ? 497  VAL A CA  1 
ATOM   3612 C  C   . VAL A 1 468 ? 67.707  98.984  171.562 1.00 140.27 ? 497  VAL A C   1 
ATOM   3613 O  O   . VAL A 1 468 ? 68.117  100.039 172.055 1.00 140.91 ? 497  VAL A O   1 
ATOM   3614 C  CB  . VAL A 1 468 ? 65.496  99.743  170.633 1.00 139.58 ? 497  VAL A CB  1 
ATOM   3615 C  CG1 . VAL A 1 468 ? 64.659  99.857  169.360 1.00 140.90 ? 497  VAL A CG1 1 
ATOM   3616 C  CG2 . VAL A 1 468 ? 64.726  98.997  171.711 1.00 140.58 ? 497  VAL A CG2 1 
ATOM   3617 N  N   . THR A 1 469 ? 67.970  97.799  172.101 1.00 146.49 ? 498  THR A N   1 
ATOM   3618 C  CA  . THR A 1 469 ? 68.798  97.631  173.293 1.00 153.14 ? 498  THR A CA  1 
ATOM   3619 C  C   . THR A 1 469 ? 69.482  96.267  173.299 1.00 157.77 ? 498  THR A C   1 
ATOM   3620 O  O   . THR A 1 469 ? 68.855  95.245  173.003 1.00 158.39 ? 498  THR A O   1 
ATOM   3621 C  CB  . THR A 1 469 ? 68.008  97.834  174.594 1.00 157.41 ? 498  THR A CB  1 
ATOM   3622 O  OG1 . THR A 1 469 ? 66.699  98.363  174.351 1.00 158.81 ? 498  THR A OG1 1 
ATOM   3623 C  CG2 . THR A 1 469 ? 68.737  98.799  175.526 1.00 157.53 ? 498  THR A CG2 1 
ATOM   3624 N  N   . PRO A 1 470 ? 70.767  96.201  173.636 1.00 160.89 ? 499  PRO A N   1 
ATOM   3625 C  CA  . PRO A 1 470 ? 71.562  94.992  173.603 1.00 162.42 ? 499  PRO A CA  1 
ATOM   3626 C  C   . PRO A 1 470 ? 71.361  94.043  174.767 1.00 163.41 ? 499  PRO A C   1 
ATOM   3627 O  O   . PRO A 1 470 ? 72.115  93.074  174.919 1.00 163.22 ? 499  PRO A O   1 
ATOM   3628 C  CB  . PRO A 1 470 ? 73.010  95.472  173.552 1.00 162.65 ? 499  PRO A CB  1 
ATOM   3629 C  CG  . PRO A 1 470 ? 72.954  96.942  173.379 1.00 162.68 ? 499  PRO A CG  1 
ATOM   3630 C  CD  . PRO A 1 470 ? 71.624  97.384  173.939 1.00 162.13 ? 499  PRO A CD  1 
ATOM   3631 N  N   . ARG A 1 471 ? 70.361  94.293  175.595 1.00 164.67 ? 500  ARG A N   1 
ATOM   3632 C  CA  . ARG A 1 471 ? 70.007  93.433  176.710 1.00 165.68 ? 500  ARG A CA  1 
ATOM   3633 C  C   . ARG A 1 471 ? 68.703  92.689  176.408 1.00 165.52 ? 500  ARG A C   1 
ATOM   3634 O  O   . ARG A 1 471 ? 67.977  92.272  177.308 1.00 166.87 ? 500  ARG A O   1 
ATOM   3635 C  CB  . ARG A 1 471 ? 69.856  94.235  178.000 1.00 171.07 ? 500  ARG A CB  1 
ATOM   3636 C  CG  . ARG A 1 471 ? 71.167  94.562  178.693 1.00 173.82 ? 500  ARG A CG  1 
ATOM   3637 C  CD  . ARG A 1 471 ? 71.006  94.557  180.208 1.00 174.66 ? 500  ARG A CD  1 
ATOM   3638 N  NE  . ARG A 1 471 ? 72.040  93.752  180.847 1.00 175.27 ? 500  ARG A NE  1 
ATOM   3639 C  CZ  . ARG A 1 471 ? 71.808  92.665  181.569 1.00 176.63 ? 500  ARG A CZ  1 
ATOM   3640 N  NH1 . ARG A 1 471 ? 70.568  92.235  181.764 1.00 177.69 ? 500  ARG A NH1 1 
ATOM   3641 N  NH2 . ARG A 1 471 ? 72.826  92.003  182.104 1.00 178.22 ? 500  ARG A NH2 1 
ATOM   3642 N  N   . ASP A 1 472 ? 68.404  92.558  175.119 1.00 163.55 ? 501  ASP A N   1 
ATOM   3643 C  CA  . ASP A 1 472 ? 67.202  91.862  174.684 1.00 160.31 ? 501  ASP A CA  1 
ATOM   3644 C  C   . ASP A 1 472 ? 67.468  91.041  173.427 1.00 156.64 ? 501  ASP A C   1 
ATOM   3645 O  O   . ASP A 1 472 ? 68.378  91.340  172.653 1.00 157.25 ? 501  ASP A O   1 
ATOM   3646 C  CB  . ASP A 1 472 ? 66.034  92.814  174.475 1.00 168.23 ? 501  ASP A CB  1 
ATOM   3647 C  CG  . ASP A 1 472 ? 66.405  94.240  174.147 1.00 172.19 ? 501  ASP A CG  1 
ATOM   3648 O  OD1 . ASP A 1 472 ? 66.707  94.533  172.968 1.00 173.49 ? 501  ASP A OD1 1 
ATOM   3649 O  OD2 . ASP A 1 472 ? 66.394  95.095  175.061 1.00 173.59 ? 501  ASP A OD2 1 
ATOM   3650 N  N   . LYS A 1 473 ? 66.685  89.978  173.246 1.00 152.07 ? 502  LYS A N   1 
ATOM   3651 C  CA  . LYS A 1 473 ? 66.839  89.151  172.045 1.00 146.46 ? 502  LYS A CA  1 
ATOM   3652 C  C   . LYS A 1 473 ? 66.705  90.056  170.821 1.00 141.34 ? 502  LYS A C   1 
ATOM   3653 O  O   . LYS A 1 473 ? 65.974  91.045  170.861 1.00 141.17 ? 502  LYS A O   1 
ATOM   3654 C  CB  . LYS A 1 473 ? 65.791  88.042  172.015 1.00 148.84 ? 502  LYS A CB  1 
ATOM   3655 C  CG  . LYS A 1 473 ? 66.323  86.655  172.335 1.00 150.02 ? 502  LYS A CG  1 
ATOM   3656 C  CD  . LYS A 1 473 ? 66.287  85.739  171.123 1.00 149.23 ? 502  LYS A CD  1 
ATOM   3657 C  CE  . LYS A 1 473 ? 67.684  85.468  170.593 1.00 148.70 ? 502  LYS A CE  1 
ATOM   3658 N  NZ  . LYS A 1 473 ? 67.699  84.365  169.594 1.00 148.58 ? 502  LYS A NZ  1 
ATOM   3659 N  N   . PRO A 1 474 ? 67.439  89.757  169.766 1.00 137.06 ? 503  PRO A N   1 
ATOM   3660 C  CA  . PRO A 1 474 ? 67.436  90.542  168.553 1.00 133.64 ? 503  PRO A CA  1 
ATOM   3661 C  C   . PRO A 1 474 ? 66.270  90.239  167.627 1.00 129.72 ? 503  PRO A C   1 
ATOM   3662 O  O   . PRO A 1 474 ? 65.960  89.093  167.309 1.00 130.25 ? 503  PRO A O   1 
ATOM   3663 C  CB  . PRO A 1 474 ? 68.758  90.202  167.886 1.00 134.26 ? 503  PRO A CB  1 
ATOM   3664 C  CG  . PRO A 1 474 ? 69.275  88.988  168.536 1.00 135.30 ? 503  PRO A CG  1 
ATOM   3665 C  CD  . PRO A 1 474 ? 68.376  88.613  169.669 1.00 136.37 ? 503  PRO A CD  1 
ATOM   3666 N  N   . MET A 1 475 ? 65.638  91.303  167.146 1.00 124.41 ? 504  MET A N   1 
ATOM   3667 C  CA  . MET A 1 475 ? 64.516  91.199  166.216 1.00 117.80 ? 504  MET A CA  1 
ATOM   3668 C  C   . MET A 1 475 ? 65.015  90.763  164.845 1.00 111.53 ? 504  MET A C   1 
ATOM   3669 O  O   . MET A 1 475 ? 65.904  91.417  164.292 1.00 112.51 ? 504  MET A O   1 
ATOM   3670 C  CB  . MET A 1 475 ? 63.837  92.569  166.133 1.00 126.86 ? 504  MET A CB  1 
ATOM   3671 C  CG  . MET A 1 475 ? 62.436  92.586  165.570 1.00 133.27 ? 504  MET A CG  1 
ATOM   3672 S  SD  . MET A 1 475 ? 62.387  92.816  163.779 1.00 137.80 ? 504  MET A SD  1 
ATOM   3673 C  CE  . MET A 1 475 ? 61.902  91.169  163.263 1.00 136.83 ? 504  MET A CE  1 
ATOM   3674 N  N   . GLY A 1 476 ? 64.502  89.667  164.303 1.00 104.07 ? 505  GLY A N   1 
ATOM   3675 C  CA  . GLY A 1 476 ? 64.896  89.210  162.974 1.00 94.89  ? 505  GLY A CA  1 
ATOM   3676 C  C   . GLY A 1 476 ? 65.061  87.722  162.876 1.00 87.32  ? 505  GLY A C   1 
ATOM   3677 O  O   . GLY A 1 476 ? 64.663  87.112  163.865 1.00 88.41  ? 505  GLY A O   1 
ATOM   3678 N  N   . PRO A 1 477 ? 65.493  87.131  161.778 1.00 80.71  ? 506  PRO A N   1 
ATOM   3679 C  CA  . PRO A 1 477 ? 65.992  87.806  160.616 1.00 77.35  ? 506  PRO A CA  1 
ATOM   3680 C  C   . PRO A 1 477 ? 64.906  88.435  159.749 1.00 73.33  ? 506  PRO A C   1 
ATOM   3681 O  O   . PRO A 1 477 ? 63.764  87.992  159.664 1.00 73.00  ? 506  PRO A O   1 
ATOM   3682 C  CB  . PRO A 1 477 ? 66.771  86.784  159.803 1.00 77.02  ? 506  PRO A CB  1 
ATOM   3683 C  CG  . PRO A 1 477 ? 66.288  85.474  160.269 1.00 77.67  ? 506  PRO A CG  1 
ATOM   3684 C  CD  . PRO A 1 477 ? 65.711  85.688  161.625 1.00 79.52  ? 506  PRO A CD  1 
ATOM   3685 N  N   . LEU A 1 478 ? 65.338  89.474  159.040 1.00 67.16  ? 507  LEU A N   1 
ATOM   3686 C  CA  . LEU A 1 478 ? 64.504  90.224  158.118 1.00 58.72  ? 507  LEU A CA  1 
ATOM   3687 C  C   . LEU A 1 478 ? 65.286  90.472  156.838 1.00 54.38  ? 507  LEU A C   1 
ATOM   3688 O  O   . LEU A 1 478 ? 66.444  90.867  156.957 1.00 55.03  ? 507  LEU A O   1 
ATOM   3689 C  CB  . LEU A 1 478 ? 64.186  91.588  158.711 1.00 56.31  ? 507  LEU A CB  1 
ATOM   3690 C  CG  . LEU A 1 478 ? 62.729  92.028  158.680 1.00 66.16  ? 507  LEU A CG  1 
ATOM   3691 C  CD1 . LEU A 1 478 ? 61.873  91.090  157.849 1.00 68.67  ? 507  LEU A CD1 1 
ATOM   3692 C  CD2 . LEU A 1 478 ? 62.209  92.145  160.107 1.00 68.66  ? 507  LEU A CD2 1 
ATOM   3693 N  N   . LEU A 1 479 ? 64.685  90.277  155.686 1.00 52.06  ? 508  LEU A N   1 
ATOM   3694 C  CA  . LEU A 1 479 ? 65.452  90.482  154.445 1.00 50.53  ? 508  LEU A CA  1 
ATOM   3695 C  C   . LEU A 1 479 ? 65.809  91.953  154.334 1.00 51.14  ? 508  LEU A C   1 
ATOM   3696 O  O   . LEU A 1 479 ? 65.003  92.826  154.721 1.00 51.63  ? 508  LEU A O   1 
ATOM   3697 C  CB  . LEU A 1 479 ? 64.674  89.926  153.278 1.00 44.53  ? 508  LEU A CB  1 
ATOM   3698 C  CG  . LEU A 1 479 ? 65.463  89.014  152.331 1.00 49.69  ? 508  LEU A CG  1 
ATOM   3699 C  CD1 . LEU A 1 479 ? 64.521  88.090  151.578 1.00 47.92  ? 508  LEU A CD1 1 
ATOM   3700 C  CD2 . LEU A 1 479 ? 66.296  89.856  151.367 1.00 51.10  ? 508  LEU A CD2 1 
ATOM   3701 N  N   . VAL A 1 480 ? 67.080  92.269  154.007 1.00 48.13  ? 509  VAL A N   1 
ATOM   3702 C  CA  . VAL A 1 480 ? 67.457  93.690  154.050 1.00 45.12  ? 509  VAL A CA  1 
ATOM   3703 C  C   . VAL A 1 480 ? 66.793  94.427  152.901 1.00 42.30  ? 509  VAL A C   1 
ATOM   3704 O  O   . VAL A 1 480 ? 66.550  95.613  152.997 1.00 40.96  ? 509  VAL A O   1 
ATOM   3705 C  CB  . VAL A 1 480 ? 68.959  93.972  154.054 1.00 44.63  ? 509  VAL A CB  1 
ATOM   3706 C  CG1 . VAL A 1 480 ? 69.783  92.797  153.577 1.00 48.02  ? 509  VAL A CG1 1 
ATOM   3707 C  CG2 . VAL A 1 480 ? 69.331  95.160  153.169 1.00 49.38  ? 509  VAL A CG2 1 
ATOM   3708 N  N   . ALA A 1 481 ? 66.466  93.687  151.832 1.00 42.10  ? 510  ALA A N   1 
ATOM   3709 C  CA  . ALA A 1 481 ? 65.805  94.323  150.700 1.00 38.07  ? 510  ALA A CA  1 
ATOM   3710 C  C   . ALA A 1 481 ? 64.533  95.014  151.152 1.00 36.50  ? 510  ALA A C   1 
ATOM   3711 O  O   . ALA A 1 481 ? 64.168  96.012  150.535 1.00 37.63  ? 510  ALA A O   1 
ATOM   3712 C  CB  . ALA A 1 481 ? 65.485  93.373  149.567 1.00 26.33  ? 510  ALA A CB  1 
ATOM   3713 N  N   . THR A 1 482 ? 63.900  94.592  152.247 1.00 34.61  ? 511  THR A N   1 
ATOM   3714 C  CA  . THR A 1 482 ? 62.680  95.272  152.645 1.00 35.42  ? 511  THR A CA  1 
ATOM   3715 C  C   . THR A 1 482 ? 62.937  96.667  153.171 1.00 38.18  ? 511  THR A C   1 
ATOM   3716 O  O   . THR A 1 482 ? 62.004  97.378  153.564 1.00 42.17  ? 511  THR A O   1 
ATOM   3717 C  CB  . THR A 1 482 ? 61.886  94.506  153.705 1.00 27.65  ? 511  THR A CB  1 
ATOM   3718 O  OG1 . THR A 1 482 ? 62.461  94.835  154.965 1.00 25.05  ? 511  THR A OG1 1 
ATOM   3719 C  CG2 . THR A 1 482 ? 61.969  93.018  153.424 1.00 30.68  ? 511  THR A CG2 1 
ATOM   3720 N  N   . PHE A 1 483 ? 64.198  97.053  153.236 1.00 37.60  ? 512  PHE A N   1 
ATOM   3721 C  CA  . PHE A 1 483 ? 64.519  98.424  153.617 1.00 36.90  ? 512  PHE A CA  1 
ATOM   3722 C  C   . PHE A 1 483 ? 65.402  99.028  152.541 1.00 36.22  ? 512  PHE A C   1 
ATOM   3723 O  O   . PHE A 1 483 ? 65.263  100.210 152.264 1.00 37.70  ? 512  PHE A O   1 
ATOM   3724 C  CB  . PHE A 1 483 ? 65.176  98.491  154.977 1.00 47.85  ? 512  PHE A CB  1 
ATOM   3725 C  CG  . PHE A 1 483 ? 64.313  98.028  156.115 1.00 59.16  ? 512  PHE A CG  1 
ATOM   3726 C  CD1 . PHE A 1 483 ? 63.418  98.901  156.707 1.00 68.48  ? 512  PHE A CD1 1 
ATOM   3727 C  CD2 . PHE A 1 483 ? 64.381  96.736  156.592 1.00 67.36  ? 512  PHE A CD2 1 
ATOM   3728 C  CE1 . PHE A 1 483 ? 62.614  98.497  157.749 1.00 73.96  ? 512  PHE A CE1 1 
ATOM   3729 C  CE2 . PHE A 1 483 ? 63.583  96.318  157.639 1.00 73.04  ? 512  PHE A CE2 1 
ATOM   3730 C  CZ  . PHE A 1 483 ? 62.693  97.199  158.221 1.00 76.13  ? 512  PHE A CZ  1 
ATOM   3731 N  N   . TRP A 1 484 ? 66.319  98.264  151.957 1.00 33.62  ? 513  TRP A N   1 
ATOM   3732 C  CA  . TRP A 1 484 ? 67.333  98.808  151.057 1.00 31.36  ? 513  TRP A CA  1 
ATOM   3733 C  C   . TRP A 1 484 ? 67.512  97.932  149.835 1.00 28.98  ? 513  TRP A C   1 
ATOM   3734 O  O   . TRP A 1 484 ? 68.523  97.313  149.484 1.00 33.61  ? 513  TRP A O   1 
ATOM   3735 C  CB  . TRP A 1 484 ? 68.601  99.067  151.893 1.00 32.94  ? 513  TRP A CB  1 
ATOM   3736 C  CG  . TRP A 1 484 ? 68.367  100.071 152.983 1.00 36.43  ? 513  TRP A CG  1 
ATOM   3737 C  CD1 . TRP A 1 484 ? 68.158  101.407 152.774 1.00 54.30  ? 513  TRP A CD1 1 
ATOM   3738 C  CD2 . TRP A 1 484 ? 68.260  99.887  154.383 1.00 38.32  ? 513  TRP A CD2 1 
ATOM   3739 N  NE1 . TRP A 1 484 ? 67.936  102.068 153.958 1.00 53.62  ? 513  TRP A NE1 1 
ATOM   3740 C  CE2 . TRP A 1 484 ? 68.000  101.150 154.963 1.00 36.90  ? 513  TRP A CE2 1 
ATOM   3741 C  CE3 . TRP A 1 484 ? 68.363  98.761  155.219 1.00 44.04  ? 513  TRP A CE3 1 
ATOM   3742 C  CZ2 . TRP A 1 484 ? 67.828  101.338 156.326 1.00 45.30  ? 513  TRP A CZ2 1 
ATOM   3743 C  CZ3 . TRP A 1 484 ? 68.198  98.953  156.585 1.00 46.42  ? 513  TRP A CZ3 1 
ATOM   3744 C  CH2 . TRP A 1 484 ? 67.933  100.227 157.120 1.00 44.98  ? 513  TRP A CH2 1 
ATOM   3745 N  N   . PRO A 1 485 ? 66.489  97.982  148.985 1.00 24.18  ? 514  PRO A N   1 
ATOM   3746 C  CA  . PRO A 1 485 ? 66.368  97.179  147.813 1.00 24.74  ? 514  PRO A CA  1 
ATOM   3747 C  C   . PRO A 1 485 ? 67.418  97.362  146.748 1.00 26.11  ? 514  PRO A C   1 
ATOM   3748 O  O   . PRO A 1 485 ? 67.479  96.527  145.827 1.00 28.05  ? 514  PRO A O   1 
ATOM   3749 C  CB  . PRO A 1 485 ? 65.023  97.553  147.199 1.00 26.07  ? 514  PRO A CB  1 
ATOM   3750 C  CG  . PRO A 1 485 ? 64.314  98.385  148.180 1.00 24.69  ? 514  PRO A CG  1 
ATOM   3751 C  CD  . PRO A 1 485 ? 65.264  98.771  149.263 1.00 25.31  ? 514  PRO A CD  1 
ATOM   3752 N  N   . GLU A 1 486 ? 68.041  98.522  146.749 1.00 27.30  ? 515  GLU A N   1 
ATOM   3753 C  CA  . GLU A 1 486 ? 69.004  98.854  145.719 1.00 30.19  ? 515  GLU A CA  1 
ATOM   3754 C  C   . GLU A 1 486 ? 70.384  98.316  146.093 1.00 33.93  ? 515  GLU A C   1 
ATOM   3755 O  O   . GLU A 1 486 ? 71.222  98.246  145.187 1.00 37.12  ? 515  GLU A O   1 
ATOM   3756 C  CB  . GLU A 1 486 ? 69.084  100.364 145.495 1.00 21.96  ? 515  GLU A CB  1 
ATOM   3757 C  CG  . GLU A 1 486 ? 67.710  100.925 145.113 1.00 27.83  ? 515  GLU A CG  1 
ATOM   3758 C  CD  . GLU A 1 486 ? 67.012  101.398 146.377 1.00 42.14  ? 515  GLU A CD  1 
ATOM   3759 O  OE1 . GLU A 1 486 ? 67.562  101.086 147.456 1.00 39.10  ? 515  GLU A OE1 1 
ATOM   3760 O  OE2 . GLU A 1 486 ? 65.966  102.079 146.292 1.00 47.59  ? 515  GLU A OE2 1 
ATOM   3761 N  N   . LEU A 1 487 ? 70.541  98.039  147.384 1.00 33.26  ? 516  LEU A N   1 
ATOM   3762 C  CA  . LEU A 1 487 ? 71.779  97.434  147.884 1.00 33.07  ? 516  LEU A CA  1 
ATOM   3763 C  C   . LEU A 1 487 ? 71.967  96.042  147.273 1.00 32.97  ? 516  LEU A C   1 
ATOM   3764 O  O   . LEU A 1 487 ? 70.956  95.336  147.214 1.00 30.08  ? 516  LEU A O   1 
ATOM   3765 C  CB  . LEU A 1 487 ? 71.601  97.257  149.398 1.00 24.33  ? 516  LEU A CB  1 
ATOM   3766 C  CG  . LEU A 1 487 ? 72.330  98.243  150.291 1.00 23.19  ? 516  LEU A CG  1 
ATOM   3767 C  CD1 . LEU A 1 487 ? 72.340  99.628  149.701 1.00 24.30  ? 516  LEU A CD1 1 
ATOM   3768 C  CD2 . LEU A 1 487 ? 71.712  98.230  151.670 1.00 20.87  ? 516  LEU A CD2 1 
ATOM   3769 N  N   . PRO A 1 488 ? 73.190  95.617  147.032 1.00 37.65  ? 517  PRO A N   1 
ATOM   3770 C  CA  . PRO A 1 488 ? 73.540  94.277  146.576 1.00 40.39  ? 517  PRO A CA  1 
ATOM   3771 C  C   . PRO A 1 488 ? 73.472  93.179  147.612 1.00 44.61  ? 517  PRO A C   1 
ATOM   3772 O  O   . PRO A 1 488 ? 73.141  93.343  148.795 1.00 44.14  ? 517  PRO A O   1 
ATOM   3773 C  CB  . PRO A 1 488 ? 74.961  94.449  146.058 1.00 41.24  ? 517  PRO A CB  1 
ATOM   3774 C  CG  . PRO A 1 488 ? 75.538  95.611  146.798 1.00 39.72  ? 517  PRO A CG  1 
ATOM   3775 C  CD  . PRO A 1 488 ? 74.398  96.469  147.226 1.00 37.98  ? 517  PRO A CD  1 
ATOM   3776 N  N   . GLU A 1 489 ? 73.776  91.944  147.218 1.00 52.18  ? 518  GLU A N   1 
ATOM   3777 C  CA  . GLU A 1 489 ? 73.693  90.717  148.000 1.00 55.37  ? 518  GLU A CA  1 
ATOM   3778 C  C   . GLU A 1 489 ? 74.299  90.790  149.390 1.00 56.86  ? 518  GLU A C   1 
ATOM   3779 O  O   . GLU A 1 489 ? 73.691  90.235  150.319 1.00 57.05  ? 518  GLU A O   1 
ATOM   3780 C  CB  . GLU A 1 489 ? 74.291  89.527  147.244 1.00 68.33  ? 518  GLU A CB  1 
ATOM   3781 C  CG  . GLU A 1 489 ? 73.932  89.489  145.771 1.00 82.19  ? 518  GLU A CG  1 
ATOM   3782 C  CD  . GLU A 1 489 ? 74.657  90.559  144.970 1.00 92.30  ? 518  GLU A CD  1 
ATOM   3783 O  OE1 . GLU A 1 489 ? 75.866  90.769  145.229 1.00 95.39  ? 518  GLU A OE1 1 
ATOM   3784 O  OE2 . GLU A 1 489 ? 74.006  91.191  144.107 1.00 95.04  ? 518  GLU A OE2 1 
ATOM   3785 N  N   . LYS A 1 490 ? 75.466  91.413  149.558 1.00 56.00  ? 519  LYS A N   1 
ATOM   3786 C  CA  . LYS A 1 490 ? 76.058  91.609  150.868 1.00 54.78  ? 519  LYS A CA  1 
ATOM   3787 C  C   . LYS A 1 490 ? 76.640  93.012  150.988 1.00 53.12  ? 519  LYS A C   1 
ATOM   3788 O  O   . LYS A 1 490 ? 77.222  93.462  150.004 1.00 54.61  ? 519  LYS A O   1 
ATOM   3789 C  CB  . LYS A 1 490 ? 77.176  90.623  151.183 1.00 68.74  ? 519  LYS A CB  1 
ATOM   3790 C  CG  . LYS A 1 490 ? 77.946  89.992  150.073 1.00 71.78  ? 519  LYS A CG  1 
ATOM   3791 C  CD  . LYS A 1 490 ? 79.106  90.822  149.567 1.00 74.03  ? 519  LYS A CD  1 
ATOM   3792 C  CE  . LYS A 1 490 ? 79.100  90.918  148.050 1.00 81.37  ? 519  LYS A CE  1 
ATOM   3793 N  NZ  . LYS A 1 490 ? 78.081  91.883  147.540 1.00 84.22  ? 519  LYS A NZ  1 
ATOM   3794 N  N   . ILE A 1 491 ? 76.579  93.637  152.164 1.00 51.21  ? 520  ILE A N   1 
ATOM   3795 C  CA  . ILE A 1 491 ? 77.258  94.941  152.253 1.00 49.66  ? 520  ILE A CA  1 
ATOM   3796 C  C   . ILE A 1 491 ? 78.668  94.675  152.753 1.00 49.96  ? 520  ILE A C   1 
ATOM   3797 O  O   . ILE A 1 491 ? 78.974  93.534  153.073 1.00 49.22  ? 520  ILE A O   1 
ATOM   3798 C  CB  . ILE A 1 491 ? 76.595  95.990  153.130 1.00 47.82  ? 520  ILE A CB  1 
ATOM   3799 C  CG1 . ILE A 1 491 ? 76.430  95.550  154.581 1.00 48.65  ? 520  ILE A CG1 1 
ATOM   3800 C  CG2 . ILE A 1 491 ? 75.264  96.419  152.532 1.00 49.69  ? 520  ILE A CG2 1 
ATOM   3801 C  CD1 . ILE A 1 491 ? 75.266  94.595  154.797 1.00 61.82  ? 520  ILE A CD1 1 
ATOM   3802 N  N   . ASP A 1 492 ? 79.518  95.688  152.768 1.00 52.32  ? 521  ASP A N   1 
ATOM   3803 C  CA  . ASP A 1 492 ? 80.879  95.511  153.289 1.00 49.17  ? 521  ASP A CA  1 
ATOM   3804 C  C   . ASP A 1 492 ? 80.965  96.313  154.579 1.00 49.88  ? 521  ASP A C   1 
ATOM   3805 O  O   . ASP A 1 492 ? 81.840  96.118  155.385 1.00 52.34  ? 521  ASP A O   1 
ATOM   3806 C  CB  . ASP A 1 492 ? 81.952  96.038  152.362 1.00 36.79  ? 521  ASP A CB  1 
ATOM   3807 C  CG  . ASP A 1 492 ? 82.062  95.225  151.090 1.00 48.58  ? 521  ASP A CG  1 
ATOM   3808 O  OD1 . ASP A 1 492 ? 81.510  94.093  151.039 1.00 41.72  ? 521  ASP A OD1 1 
ATOM   3809 O  OD2 . ASP A 1 492 ? 82.696  95.758  150.152 1.00 48.91  ? 521  ASP A OD2 1 
ATOM   3810 N  N   . ALA A 1 493 ? 80.089  97.299  154.688 1.00 50.09  ? 522  ALA A N   1 
ATOM   3811 C  CA  . ALA A 1 493 ? 80.112  98.109  155.895 1.00 51.92  ? 522  ALA A CA  1 
ATOM   3812 C  C   . ALA A 1 493 ? 78.857  98.983  155.890 1.00 53.62  ? 522  ALA A C   1 
ATOM   3813 O  O   . ALA A 1 493 ? 78.128  98.964  154.917 1.00 54.89  ? 522  ALA A O   1 
ATOM   3814 C  CB  . ALA A 1 493 ? 81.320  98.993  155.993 1.00 53.25  ? 522  ALA A CB  1 
ATOM   3815 N  N   . VAL A 1 494 ? 78.650  99.590  157.032 1.00 56.60  ? 523  VAL A N   1 
ATOM   3816 C  CA  . VAL A 1 494 ? 77.495  100.409 157.296 1.00 64.41  ? 523  VAL A CA  1 
ATOM   3817 C  C   . VAL A 1 494 ? 77.896  101.574 158.204 1.00 69.87  ? 523  VAL A C   1 
ATOM   3818 O  O   . VAL A 1 494 ? 78.952  101.538 158.832 1.00 73.22  ? 523  VAL A O   1 
ATOM   3819 C  CB  . VAL A 1 494 ? 76.340  99.663  157.978 1.00 69.70  ? 523  VAL A CB  1 
ATOM   3820 C  CG1 . VAL A 1 494 ? 75.020  100.365 157.662 1.00 70.41  ? 523  VAL A CG1 1 
ATOM   3821 C  CG2 . VAL A 1 494 ? 76.261  98.197  157.625 1.00 71.11  ? 523  VAL A CG2 1 
ATOM   3822 N  N   . TYR A 1 495 ? 77.067  102.601 158.264 1.00 72.09  ? 524  TYR A N   1 
ATOM   3823 C  CA  . TYR A 1 495 ? 77.378  103.751 159.121 1.00 74.18  ? 524  TYR A CA  1 
ATOM   3824 C  C   . TYR A 1 495 ? 76.189  104.711 159.093 1.00 77.15  ? 524  TYR A C   1 
ATOM   3825 O  O   . TYR A 1 495 ? 75.224  104.529 158.362 1.00 77.65  ? 524  TYR A O   1 
ATOM   3826 C  CB  . TYR A 1 495 ? 78.689  104.386 158.846 1.00 70.62  ? 524  TYR A CB  1 
ATOM   3827 C  CG  . TYR A 1 495 ? 79.068  105.624 158.132 1.00 66.63  ? 524  TYR A CG  1 
ATOM   3828 C  CD1 . TYR A 1 495 ? 79.095  106.878 158.724 1.00 64.99  ? 524  TYR A CD1 1 
ATOM   3829 C  CD2 . TYR A 1 495 ? 79.497  105.613 156.805 1.00 66.28  ? 524  TYR A CD2 1 
ATOM   3830 C  CE1 . TYR A 1 495 ? 79.460  108.033 158.062 1.00 64.36  ? 524  TYR A CE1 1 
ATOM   3831 C  CE2 . TYR A 1 495 ? 79.877  106.751 156.132 1.00 66.01  ? 524  TYR A CE2 1 
ATOM   3832 C  CZ  . TYR A 1 495 ? 79.860  107.975 156.753 1.00 65.41  ? 524  TYR A CZ  1 
ATOM   3833 O  OH  . TYR A 1 495 ? 80.234  109.101 156.063 1.00 67.61  ? 524  TYR A OH  1 
ATOM   3834 N  N   . GLU A 1 496 ? 76.286  105.689 159.974 1.00 80.18  ? 525  GLU A N   1 
ATOM   3835 C  CA  . GLU A 1 496 ? 75.370  106.798 160.056 1.00 86.12  ? 525  GLU A CA  1 
ATOM   3836 C  C   . GLU A 1 496 ? 76.145  108.112 159.881 1.00 90.56  ? 525  GLU A C   1 
ATOM   3837 O  O   . GLU A 1 496 ? 77.289  108.213 160.330 1.00 91.54  ? 525  GLU A O   1 
ATOM   3838 C  CB  . GLU A 1 496 ? 74.611  106.838 161.380 1.00 92.15  ? 525  GLU A CB  1 
ATOM   3839 C  CG  . GLU A 1 496 ? 73.668  108.029 161.532 1.00 95.85  ? 525  GLU A CG  1 
ATOM   3840 C  CD  . GLU A 1 496 ? 72.355  107.655 162.190 1.00 98.27  ? 525  GLU A CD  1 
ATOM   3841 O  OE1 . GLU A 1 496 ? 72.358  107.024 163.266 1.00 97.03  ? 525  GLU A OE1 1 
ATOM   3842 O  OE2 . GLU A 1 496 ? 71.298  107.996 161.622 1.00 102.39 ? 525  GLU A OE2 1 
ATOM   3843 N  N   . ALA A 1 497 ? 75.530  109.103 159.261 1.00 93.77  ? 526  ALA A N   1 
ATOM   3844 C  CA  . ALA A 1 497 ? 76.139  110.425 159.098 1.00 97.82  ? 526  ALA A CA  1 
ATOM   3845 C  C   . ALA A 1 497 ? 75.601  111.366 160.172 1.00 101.23 ? 526  ALA A C   1 
ATOM   3846 O  O   . ALA A 1 497 ? 74.389  111.563 160.268 1.00 102.36 ? 526  ALA A O   1 
ATOM   3847 C  CB  . ALA A 1 497 ? 75.814  110.970 157.715 1.00 98.23  ? 526  ALA A CB  1 
ATOM   3848 N  N   . PRO A 1 498 ? 76.459  111.951 160.987 1.00 103.76 ? 527  PRO A N   1 
ATOM   3849 C  CA  . PRO A 1 498 ? 76.048  112.785 162.091 1.00 105.49 ? 527  PRO A CA  1 
ATOM   3850 C  C   . PRO A 1 498 ? 75.207  113.984 161.716 1.00 107.53 ? 527  PRO A C   1 
ATOM   3851 O  O   . PRO A 1 498 ? 74.411  114.433 162.545 1.00 108.59 ? 527  PRO A O   1 
ATOM   3852 C  CB  . PRO A 1 498 ? 77.348  113.226 162.751 1.00 105.51 ? 527  PRO A CB  1 
ATOM   3853 C  CG  . PRO A 1 498 ? 78.379  112.268 162.283 1.00 105.45 ? 527  PRO A CG  1 
ATOM   3854 C  CD  . PRO A 1 498 ? 77.932  111.755 160.947 1.00 104.79 ? 527  PRO A CD  1 
ATOM   3855 N  N   . GLN A 1 499 ? 75.356  114.533 160.523 1.00 109.17 ? 528  GLN A N   1 
ATOM   3856 C  CA  . GLN A 1 499 ? 74.660  115.746 160.121 1.00 111.38 ? 528  GLN A CA  1 
ATOM   3857 C  C   . GLN A 1 499 ? 73.226  115.526 159.702 1.00 112.12 ? 528  GLN A C   1 
ATOM   3858 O  O   . GLN A 1 499 ? 72.322  116.286 160.087 1.00 114.48 ? 528  GLN A O   1 
ATOM   3859 C  CB  . GLN A 1 499 ? 75.462  116.467 159.036 1.00 118.03 ? 528  GLN A CB  1 
ATOM   3860 C  CG  . GLN A 1 499 ? 74.771  117.564 158.264 1.00 123.17 ? 528  GLN A CG  1 
ATOM   3861 C  CD  . GLN A 1 499 ? 75.691  118.278 157.291 1.00 126.88 ? 528  GLN A CD  1 
ATOM   3862 O  OE1 . GLN A 1 499 ? 76.387  119.235 157.648 1.00 131.90 ? 528  GLN A OE1 1 
ATOM   3863 N  NE2 . GLN A 1 499 ? 75.713  117.833 156.040 1.00 123.87 ? 528  GLN A NE2 1 
ATOM   3864 N  N   . GLU A 1 500 ? 72.959  114.502 158.891 1.00 110.23 ? 529  GLU A N   1 
ATOM   3865 C  CA  . GLU A 1 500 ? 71.578  114.348 158.412 1.00 106.85 ? 529  GLU A CA  1 
ATOM   3866 C  C   . GLU A 1 500 ? 70.892  113.114 158.943 1.00 102.39 ? 529  GLU A C   1 
ATOM   3867 O  O   . GLU A 1 500 ? 69.715  112.870 158.647 1.00 103.27 ? 529  GLU A O   1 
ATOM   3868 C  CB  . GLU A 1 500 ? 71.609  114.396 156.882 1.00 121.23 ? 529  GLU A CB  1 
ATOM   3869 C  CG  . GLU A 1 500 ? 71.915  115.784 156.316 1.00 127.15 ? 529  GLU A CG  1 
ATOM   3870 C  CD  . GLU A 1 500 ? 71.176  116.057 155.021 1.00 131.41 ? 529  GLU A CD  1 
ATOM   3871 O  OE1 . GLU A 1 500 ? 71.481  115.384 154.013 1.00 134.64 ? 529  GLU A OE1 1 
ATOM   3872 O  OE2 . GLU A 1 500 ? 70.289  116.937 154.985 1.00 132.24 ? 529  GLU A OE2 1 
ATOM   3873 N  N   . GLU A 1 501 ? 71.568  112.327 159.775 1.00 96.65  ? 530  GLU A N   1 
ATOM   3874 C  CA  . GLU A 1 501 ? 70.998  111.083 160.304 1.00 88.72  ? 530  GLU A CA  1 
ATOM   3875 C  C   . GLU A 1 501 ? 70.767  110.114 159.150 1.00 80.62  ? 530  GLU A C   1 
ATOM   3876 O  O   . GLU A 1 501 ? 69.755  109.423 159.127 1.00 83.29  ? 530  GLU A O   1 
ATOM   3877 C  CB  . GLU A 1 501 ? 69.720  111.342 161.097 1.00 100.76 ? 530  GLU A CB  1 
ATOM   3878 C  CG  . GLU A 1 501 ? 69.211  110.221 161.978 1.00 110.31 ? 530  GLU A CG  1 
ATOM   3879 C  CD  . GLU A 1 501 ? 67.953  110.507 162.764 1.00 117.25 ? 530  GLU A CD  1 
ATOM   3880 O  OE1 . GLU A 1 501 ? 67.427  111.645 162.712 1.00 118.94 ? 530  GLU A OE1 1 
ATOM   3881 O  OE2 . GLU A 1 501 ? 67.444  109.600 163.473 1.00 120.56 ? 530  GLU A OE2 1 
ATOM   3882 N  N   . LYS A 1 502 ? 71.687  110.043 158.195 1.00 70.84  ? 531  LYS A N   1 
ATOM   3883 C  CA  . LYS A 1 502 ? 71.541  109.189 157.032 1.00 60.74  ? 531  LYS A CA  1 
ATOM   3884 C  C   . LYS A 1 502 ? 72.397  107.927 157.078 1.00 52.37  ? 531  LYS A C   1 
ATOM   3885 O  O   . LYS A 1 502 ? 73.571  108.020 157.418 1.00 49.64  ? 531  LYS A O   1 
ATOM   3886 C  CB  . LYS A 1 502 ? 71.970  109.946 155.765 1.00 57.96  ? 531  LYS A CB  1 
ATOM   3887 C  CG  . LYS A 1 502 ? 71.367  111.317 155.605 1.00 55.12  ? 531  LYS A CG  1 
ATOM   3888 C  CD  . LYS A 1 502 ? 71.451  111.807 154.178 1.00 56.27  ? 531  LYS A CD  1 
ATOM   3889 C  CE  . LYS A 1 502 ? 70.373  112.800 153.820 1.00 53.23  ? 531  LYS A CE  1 
ATOM   3890 N  NZ  . LYS A 1 502 ? 70.429  113.256 152.400 1.00 52.66  ? 531  LYS A NZ  1 
ATOM   3891 N  N   . ALA A 1 503 ? 71.913  106.819 156.531 1.00 46.30  ? 532  ALA A N   1 
ATOM   3892 C  CA  . ALA A 1 503 ? 72.671  105.575 156.512 1.00 40.47  ? 532  ALA A CA  1 
ATOM   3893 C  C   . ALA A 1 503 ? 73.549  105.459 155.275 1.00 38.31  ? 532  ALA A C   1 
ATOM   3894 O  O   . ALA A 1 503 ? 73.110  105.737 154.164 1.00 39.70  ? 532  ALA A O   1 
ATOM   3895 C  CB  . ALA A 1 503 ? 71.761  104.380 156.609 1.00 35.11  ? 532  ALA A CB  1 
ATOM   3896 N  N   . VAL A 1 504 ? 74.815  105.116 155.478 1.00 33.80  ? 533  VAL A N   1 
ATOM   3897 C  CA  . VAL A 1 504 ? 75.774  105.048 154.379 1.00 30.88  ? 533  VAL A CA  1 
ATOM   3898 C  C   . VAL A 1 504 ? 76.299  103.622 154.318 1.00 32.02  ? 533  VAL A C   1 
ATOM   3899 O  O   . VAL A 1 504 ? 76.859  103.194 155.328 1.00 35.48  ? 533  VAL A O   1 
ATOM   3900 C  CB  . VAL A 1 504 ? 76.935  106.026 154.651 1.00 29.10  ? 533  VAL A CB  1 
ATOM   3901 C  CG1 . VAL A 1 504 ? 78.080  105.888 153.679 1.00 19.56  ? 533  VAL A CG1 1 
ATOM   3902 C  CG2 . VAL A 1 504 ? 76.400  107.460 154.580 1.00 32.41  ? 533  VAL A CG2 1 
ATOM   3903 N  N   . PHE A 1 505 ? 76.025  102.918 153.246 1.00 31.03  ? 534  PHE A N   1 
ATOM   3904 C  CA  . PHE A 1 505 ? 76.312  101.509 153.066 1.00 29.64  ? 534  PHE A CA  1 
ATOM   3905 C  C   . PHE A 1 505 ? 77.453  101.317 152.071 1.00 30.77  ? 534  PHE A C   1 
ATOM   3906 O  O   . PHE A 1 505 ? 77.462  101.977 151.029 1.00 31.58  ? 534  PHE A O   1 
ATOM   3907 C  CB  . PHE A 1 505 ? 75.067  100.767 152.545 1.00 28.29  ? 534  PHE A CB  1 
ATOM   3908 C  CG  . PHE A 1 505 ? 74.025  100.489 153.584 1.00 22.52  ? 534  PHE A CG  1 
ATOM   3909 C  CD1 . PHE A 1 505 ? 73.028  101.422 153.823 1.00 26.65  ? 534  PHE A CD1 1 
ATOM   3910 C  CD2 . PHE A 1 505 ? 74.021  99.336  154.331 1.00 30.13  ? 534  PHE A CD2 1 
ATOM   3911 C  CE1 . PHE A 1 505 ? 72.065  101.202 154.785 1.00 28.87  ? 534  PHE A CE1 1 
ATOM   3912 C  CE2 . PHE A 1 505 ? 73.049  99.089  155.293 1.00 36.13  ? 534  PHE A CE2 1 
ATOM   3913 C  CZ  . PHE A 1 505 ? 72.061  100.033 155.526 1.00 31.88  ? 534  PHE A CZ  1 
ATOM   3914 N  N   . PHE A 1 506 ? 78.371  100.402 152.390 1.00 30.62  ? 535  PHE A N   1 
ATOM   3915 C  CA  . PHE A 1 506 ? 79.522  100.165 151.512 1.00 30.69  ? 535  PHE A CA  1 
ATOM   3916 C  C   . PHE A 1 506 ? 79.434  98.776  150.888 1.00 28.35  ? 535  PHE A C   1 
ATOM   3917 O  O   . PHE A 1 506 ? 78.989  97.852  151.557 1.00 26.79  ? 535  PHE A O   1 
ATOM   3918 C  CB  . PHE A 1 506 ? 80.839  100.270 152.300 1.00 32.72  ? 535  PHE A CB  1 
ATOM   3919 C  CG  . PHE A 1 506 ? 81.252  101.673 152.661 1.00 33.09  ? 535  PHE A CG  1 
ATOM   3920 C  CD1 . PHE A 1 506 ? 80.711  102.307 153.763 1.00 37.33  ? 535  PHE A CD1 1 
ATOM   3921 C  CD2 . PHE A 1 506 ? 82.190  102.363 151.904 1.00 28.56  ? 535  PHE A CD2 1 
ATOM   3922 C  CE1 . PHE A 1 506 ? 81.088  103.596 154.109 1.00 35.49  ? 535  PHE A CE1 1 
ATOM   3923 C  CE2 . PHE A 1 506 ? 82.570  103.649 152.230 1.00 34.73  ? 535  PHE A CE2 1 
ATOM   3924 C  CZ  . PHE A 1 506 ? 82.008  104.271 153.334 1.00 33.98  ? 535  PHE A CZ  1 
ATOM   3925 N  N   . ALA A 1 507 ? 79.872  98.626  149.657 1.00 28.36  ? 536  ALA A N   1 
ATOM   3926 C  CA  . ALA A 1 507 ? 79.894  97.289  149.028 1.00 31.29  ? 536  ALA A CA  1 
ATOM   3927 C  C   . ALA A 1 507 ? 80.799  97.328  147.805 1.00 35.61  ? 536  ALA A C   1 
ATOM   3928 O  O   . ALA A 1 507 ? 80.802  98.349  147.082 1.00 36.35  ? 536  ALA A O   1 
ATOM   3929 C  CB  . ALA A 1 507 ? 78.494  96.881  148.747 1.00 27.56  ? 536  ALA A CB  1 
ATOM   3930 N  N   . GLY A 1 508 ? 81.756  96.401  147.640 1.00 35.75  ? 537  GLY A N   1 
ATOM   3931 C  CA  . GLY A 1 508 ? 82.659  96.606  146.480 1.00 38.62  ? 537  GLY A CA  1 
ATOM   3932 C  C   . GLY A 1 508 ? 83.143  98.036  146.369 1.00 41.90  ? 537  GLY A C   1 
ATOM   3933 O  O   . GLY A 1 508 ? 83.613  98.660  147.337 1.00 43.30  ? 537  GLY A O   1 
ATOM   3934 N  N   . ASN A 1 509 ? 83.197  98.625  145.170 1.00 43.19  ? 538  ASN A N   1 
ATOM   3935 C  CA  . ASN A 1 509 ? 83.747  99.977  145.065 1.00 46.34  ? 538  ASN A CA  1 
ATOM   3936 C  C   . ASN A 1 509 ? 82.671  101.056 145.126 1.00 47.71  ? 538  ASN A C   1 
ATOM   3937 O  O   . ASN A 1 509 ? 82.981  102.242 144.866 1.00 50.84  ? 538  ASN A O   1 
ATOM   3938 C  CB  . ASN A 1 509 ? 84.516  100.142 143.751 1.00 52.34  ? 538  ASN A CB  1 
ATOM   3939 C  CG  . ASN A 1 509 ? 83.991  99.134  142.739 1.00 72.56  ? 538  ASN A CG  1 
ATOM   3940 O  OD1 . ASN A 1 509 ? 84.033  97.924  142.978 1.00 79.18  ? 538  ASN A OD1 1 
ATOM   3941 N  ND2 . ASN A 1 509 ? 83.488  99.635  141.625 1.00 80.14  ? 538  ASN A ND2 1 
ATOM   3942 N  N   . GLU A 1 510 ? 81.448  100.711 145.504 1.00 43.01  ? 539  GLU A N   1 
ATOM   3943 C  CA  . GLU A 1 510 ? 80.401  101.711 145.572 1.00 40.79  ? 539  GLU A CA  1 
ATOM   3944 C  C   . GLU A 1 510 ? 79.892  101.878 146.996 1.00 39.84  ? 539  GLU A C   1 
ATOM   3945 O  O   . GLU A 1 510 ? 80.050  101.010 147.840 1.00 42.62  ? 539  GLU A O   1 
ATOM   3946 C  CB  . GLU A 1 510 ? 79.202  101.376 144.689 1.00 38.28  ? 539  GLU A CB  1 
ATOM   3947 C  CG  . GLU A 1 510 ? 79.489  100.588 143.439 1.00 43.85  ? 539  GLU A CG  1 
ATOM   3948 C  CD  . GLU A 1 510 ? 78.286  100.328 142.560 1.00 49.57  ? 539  GLU A CD  1 
ATOM   3949 O  OE1 . GLU A 1 510 ? 77.904  101.197 141.737 1.00 50.90  ? 539  GLU A OE1 1 
ATOM   3950 O  OE2 . GLU A 1 510 ? 77.693  99.226  142.662 1.00 55.60  ? 539  GLU A OE2 1 
ATOM   3951 N  N   . TYR A 1 511 ? 79.183  102.976 147.197 1.00 37.36  ? 540  TYR A N   1 
ATOM   3952 C  CA  . TYR A 1 511 ? 78.496  103.183 148.461 1.00 34.92  ? 540  TYR A CA  1 
ATOM   3953 C  C   . TYR A 1 511 ? 77.189  103.939 148.226 1.00 35.69  ? 540  TYR A C   1 
ATOM   3954 O  O   . TYR A 1 511 ? 76.986  104.610 147.211 1.00 35.51  ? 540  TYR A O   1 
ATOM   3955 C  CB  . TYR A 1 511 ? 79.415  103.897 149.413 1.00 32.80  ? 540  TYR A CB  1 
ATOM   3956 C  CG  . TYR A 1 511 ? 79.721  105.324 149.054 1.00 30.89  ? 540  TYR A CG  1 
ATOM   3957 C  CD1 . TYR A 1 511 ? 80.512  105.627 147.959 1.00 31.69  ? 540  TYR A CD1 1 
ATOM   3958 C  CD2 . TYR A 1 511 ? 79.208  106.361 149.829 1.00 31.36  ? 540  TYR A CD2 1 
ATOM   3959 C  CE1 . TYR A 1 511 ? 80.783  106.960 147.669 1.00 34.89  ? 540  TYR A CE1 1 
ATOM   3960 C  CE2 . TYR A 1 511 ? 79.472  107.683 149.539 1.00 32.00  ? 540  TYR A CE2 1 
ATOM   3961 C  CZ  . TYR A 1 511 ? 80.264  107.974 148.452 1.00 34.77  ? 540  TYR A CZ  1 
ATOM   3962 O  OH  . TYR A 1 511 ? 80.523  109.294 148.135 1.00 36.76  ? 540  TYR A OH  1 
ATOM   3963 N  N   . TRP A 1 512 ? 76.232  103.687 149.108 1.00 34.81  ? 541  TRP A N   1 
ATOM   3964 C  CA  . TRP A 1 512 ? 74.899  104.240 148.973 1.00 35.35  ? 541  TRP A CA  1 
ATOM   3965 C  C   . TRP A 1 512 ? 74.562  105.101 150.180 1.00 37.11  ? 541  TRP A C   1 
ATOM   3966 O  O   . TRP A 1 512 ? 74.861  104.740 151.327 1.00 39.08  ? 541  TRP A O   1 
ATOM   3967 C  CB  . TRP A 1 512 ? 73.882  103.093 148.894 1.00 30.67  ? 541  TRP A CB  1 
ATOM   3968 C  CG  . TRP A 1 512 ? 73.910  102.259 147.667 1.00 29.53  ? 541  TRP A CG  1 
ATOM   3969 C  CD1 . TRP A 1 512 ? 73.005  102.294 146.658 1.00 37.43  ? 541  TRP A CD1 1 
ATOM   3970 C  CD2 . TRP A 1 512 ? 74.846  101.240 147.302 1.00 38.54  ? 541  TRP A CD2 1 
ATOM   3971 N  NE1 . TRP A 1 512 ? 73.323  101.366 145.683 1.00 35.51  ? 541  TRP A NE1 1 
ATOM   3972 C  CE2 . TRP A 1 512 ? 74.449  100.715 146.056 1.00 29.72  ? 541  TRP A CE2 1 
ATOM   3973 C  CE3 . TRP A 1 512 ? 76.001  100.718 147.905 1.00 42.80  ? 541  TRP A CE3 1 
ATOM   3974 C  CZ2 . TRP A 1 512 ? 75.163  99.711  145.395 1.00 32.33  ? 541  TRP A CZ2 1 
ATOM   3975 C  CZ3 . TRP A 1 512 ? 76.704  99.717  147.256 1.00 33.90  ? 541  TRP A CZ3 1 
ATOM   3976 C  CH2 . TRP A 1 512 ? 76.283  99.226  146.010 1.00 32.91  ? 541  TRP A CH2 1 
ATOM   3977 N  N   . ILE A 1 513 ? 73.865  106.225 149.982 1.00 35.72  ? 542  ILE A N   1 
ATOM   3978 C  CA  . ILE A 1 513 ? 73.459  106.940 151.194 1.00 36.68  ? 542  ILE A CA  1 
ATOM   3979 C  C   . ILE A 1 513 ? 71.943  106.896 151.277 1.00 39.05  ? 542  ILE A C   1 
ATOM   3980 O  O   . ILE A 1 513 ? 71.230  107.190 150.301 1.00 43.45  ? 542  ILE A O   1 
ATOM   3981 C  CB  . ILE A 1 513 ? 73.919  108.402 151.232 1.00 37.34  ? 542  ILE A CB  1 
ATOM   3982 C  CG1 . ILE A 1 513 ? 75.269  108.589 150.584 1.00 35.44  ? 542  ILE A CG1 1 
ATOM   3983 C  CG2 . ILE A 1 513 ? 73.901  108.924 152.666 1.00 34.81  ? 542  ILE A CG2 1 
ATOM   3984 C  CD1 . ILE A 1 513 ? 76.474  108.477 151.464 1.00 32.52  ? 542  ILE A CD1 1 
ATOM   3985 N  N   . TYR A 1 514 ? 71.392  106.521 152.431 1.00 35.47  ? 543  TYR A N   1 
ATOM   3986 C  CA  . TYR A 1 514 ? 69.926  106.565 152.437 1.00 33.35  ? 543  TYR A CA  1 
ATOM   3987 C  C   . TYR A 1 514 ? 69.577  107.568 153.523 1.00 37.85  ? 543  TYR A C   1 
ATOM   3988 O  O   . TYR A 1 514 ? 70.388  107.740 154.404 1.00 38.63  ? 543  TYR A O   1 
ATOM   3989 C  CB  . TYR A 1 514 ? 69.260  105.264 152.872 1.00 26.75  ? 543  TYR A CB  1 
ATOM   3990 C  CG  . TYR A 1 514 ? 69.369  104.224 151.786 1.00 23.39  ? 543  TYR A CG  1 
ATOM   3991 C  CD1 . TYR A 1 514 ? 70.548  103.525 151.570 1.00 23.22  ? 543  TYR A CD1 1 
ATOM   3992 C  CD2 . TYR A 1 514 ? 68.275  103.953 150.983 1.00 25.24  ? 543  TYR A CD2 1 
ATOM   3993 C  CE1 . TYR A 1 514 ? 70.644  102.574 150.557 1.00 24.61  ? 543  TYR A CE1 1 
ATOM   3994 C  CE2 . TYR A 1 514 ? 68.346  102.999 149.979 1.00 26.40  ? 543  TYR A CE2 1 
ATOM   3995 C  CZ  . TYR A 1 514 ? 69.535  102.334 149.775 1.00 27.37  ? 543  TYR A CZ  1 
ATOM   3996 O  OH  . TYR A 1 514 ? 69.544  101.418 148.768 1.00 33.40  ? 543  TYR A OH  1 
ATOM   3997 N  N   . SER A 1 515 ? 68.339  107.986 153.402 1.00 44.94  ? 544  SER A N   1 
ATOM   3998 C  CA  . SER A 1 515 ? 67.733  108.725 154.480 1.00 52.85  ? 544  SER A CA  1 
ATOM   3999 C  C   . SER A 1 515 ? 66.298  108.171 154.610 1.00 58.88  ? 544  SER A C   1 
ATOM   4000 O  O   . SER A 1 515 ? 65.532  108.430 153.692 1.00 60.56  ? 544  SER A O   1 
ATOM   4001 C  CB  . SER A 1 515 ? 67.673  110.220 154.313 1.00 55.13  ? 544  SER A CB  1 
ATOM   4002 O  OG  . SER A 1 515 ? 66.592  110.726 155.108 1.00 46.99  ? 544  SER A OG  1 
ATOM   4003 N  N   . ALA A 1 516 ? 66.111  107.367 155.646 1.00 62.57  ? 545  ALA A N   1 
ATOM   4004 C  CA  . ALA A 1 516 ? 64.820  106.824 156.019 1.00 63.21  ? 545  ALA A CA  1 
ATOM   4005 C  C   . ALA A 1 516 ? 64.212  105.950 154.945 1.00 62.87  ? 545  ALA A C   1 
ATOM   4006 O  O   . ALA A 1 516 ? 63.036  106.091 154.576 1.00 66.55  ? 545  ALA A O   1 
ATOM   4007 C  CB  . ALA A 1 516 ? 63.874  107.980 156.376 1.00 72.95  ? 545  ALA A CB  1 
ATOM   4008 N  N   . SER A 1 517 ? 65.009  105.040 154.382 1.00 58.64  ? 546  SER A N   1 
ATOM   4009 C  CA  . SER A 1 517 ? 64.455  104.119 153.385 1.00 54.42  ? 546  SER A CA  1 
ATOM   4010 C  C   . SER A 1 517 ? 64.375  104.701 151.988 1.00 51.00  ? 546  SER A C   1 
ATOM   4011 O  O   . SER A 1 517 ? 63.961  104.060 151.022 1.00 47.73  ? 546  SER A O   1 
ATOM   4012 C  CB  . SER A 1 517 ? 63.065  103.686 153.858 1.00 58.48  ? 546  SER A CB  1 
ATOM   4013 O  OG  . SER A 1 517 ? 62.628  102.549 153.162 1.00 70.77  ? 546  SER A OG  1 
ATOM   4014 N  N   . THR A 1 518 ? 64.765  105.975 151.862 1.00 47.90  ? 547  THR A N   1 
ATOM   4015 C  CA  . THR A 1 518 ? 64.745  106.612 150.560 1.00 44.56  ? 547  THR A CA  1 
ATOM   4016 C  C   . THR A 1 518 ? 66.180  106.626 150.036 1.00 41.12  ? 547  THR A C   1 
ATOM   4017 O  O   . THR A 1 518 ? 67.080  107.117 150.704 1.00 40.97  ? 547  THR A O   1 
ATOM   4018 C  CB  . THR A 1 518 ? 64.190  108.037 150.589 1.00 52.68  ? 547  THR A CB  1 
ATOM   4019 O  OG1 . THR A 1 518 ? 62.810  108.021 150.966 1.00 57.81  ? 547  THR A OG1 1 
ATOM   4020 C  CG2 . THR A 1 518 ? 64.289  108.732 149.237 1.00 48.29  ? 547  THR A CG2 1 
ATOM   4021 N  N   . LEU A 1 519 ? 66.382  105.958 148.914 1.00 38.60  ? 548  LEU A N   1 
ATOM   4022 C  CA  . LEU A 1 519 ? 67.727  105.904 148.362 1.00 38.09  ? 548  LEU A CA  1 
ATOM   4023 C  C   . LEU A 1 519 ? 68.136  107.299 147.911 1.00 39.55  ? 548  LEU A C   1 
ATOM   4024 O  O   . LEU A 1 519 ? 67.422  107.941 147.141 1.00 39.20  ? 548  LEU A O   1 
ATOM   4025 C  CB  . LEU A 1 519 ? 67.834  104.990 147.157 1.00 33.76  ? 548  LEU A CB  1 
ATOM   4026 C  CG  . LEU A 1 519 ? 69.154  105.092 146.371 1.00 12.00  ? 548  LEU A CG  1 
ATOM   4027 C  CD1 . LEU A 1 519 ? 70.322  104.686 147.213 1.00 17.39  ? 548  LEU A CD1 1 
ATOM   4028 C  CD2 . LEU A 1 519 ? 69.085  104.159 145.162 1.00 28.43  ? 548  LEU A CD2 1 
ATOM   4029 N  N   . GLU A 1 520 ? 69.337  107.699 148.341 1.00 39.08  ? 549  GLU A N   1 
ATOM   4030 C  CA  . GLU A 1 520 ? 69.772  109.036 147.935 1.00 33.37  ? 549  GLU A CA  1 
ATOM   4031 C  C   . GLU A 1 520 ? 69.901  109.189 146.432 1.00 30.44  ? 549  GLU A C   1 
ATOM   4032 O  O   . GLU A 1 520 ? 70.366  108.382 145.616 1.00 31.97  ? 549  GLU A O   1 
ATOM   4033 C  CB  . GLU A 1 520 ? 71.070  109.396 148.642 1.00 54.41  ? 549  GLU A CB  1 
ATOM   4034 C  CG  . GLU A 1 520 ? 71.166  110.848 149.061 1.00 62.28  ? 549  GLU A CG  1 
ATOM   4035 C  CD  . GLU A 1 520 ? 70.534  111.070 150.429 1.00 61.66  ? 549  GLU A CD  1 
ATOM   4036 O  OE1 . GLU A 1 520 ? 69.369  110.707 150.651 1.00 56.09  ? 549  GLU A OE1 1 
ATOM   4037 O  OE2 . GLU A 1 520 ? 71.267  111.641 151.258 1.00 67.27  ? 549  GLU A OE2 1 
ATOM   4038 N  N   . ARG A 1 521 ? 69.511  110.392 146.010 1.00 26.73  ? 550  ARG A N   1 
ATOM   4039 C  CA  . ARG A 1 521 ? 69.651  110.750 144.604 1.00 26.41  ? 550  ARG A CA  1 
ATOM   4040 C  C   . ARG A 1 521 ? 71.124  111.002 144.285 1.00 28.31  ? 550  ARG A C   1 
ATOM   4041 O  O   . ARG A 1 521 ? 71.808  111.731 145.020 1.00 30.28  ? 550  ARG A O   1 
ATOM   4042 C  CB  . ARG A 1 521 ? 68.855  112.017 144.308 1.00 23.78  ? 550  ARG A CB  1 
ATOM   4043 C  CG  . ARG A 1 521 ? 69.195  112.651 142.948 1.00 12.14  ? 550  ARG A CG  1 
ATOM   4044 C  CD  . ARG A 1 521 ? 68.022  113.582 142.519 1.00 19.19  ? 550  ARG A CD  1 
ATOM   4045 N  NE  . ARG A 1 521 ? 68.392  114.265 141.297 1.00 18.94  ? 550  ARG A NE  1 
ATOM   4046 C  CZ  . ARG A 1 521 ? 67.815  114.254 140.124 1.00 15.88  ? 550  ARG A CZ  1 
ATOM   4047 N  NH1 . ARG A 1 521 ? 66.694  113.567 139.940 1.00 18.52  ? 550  ARG A NH1 1 
ATOM   4048 N  NH2 . ARG A 1 521 ? 68.356  114.923 139.102 1.00 12.11  ? 550  ARG A NH2 1 
ATOM   4049 N  N   . GLY A 1 522 ? 71.604  110.424 143.183 1.00 26.39  ? 551  GLY A N   1 
ATOM   4050 C  CA  . GLY A 1 522 ? 73.024  110.556 142.871 1.00 23.59  ? 551  GLY A CA  1 
ATOM   4051 C  C   . GLY A 1 522 ? 73.768  109.325 143.357 1.00 23.82  ? 551  GLY A C   1 
ATOM   4052 O  O   . GLY A 1 522 ? 74.923  109.081 143.030 1.00 23.32  ? 551  GLY A O   1 
ATOM   4053 N  N   . TYR A 1 523 ? 73.061  108.475 144.112 1.00 26.72  ? 552  TYR A N   1 
ATOM   4054 C  CA  . TYR A 1 523 ? 73.701  107.256 144.582 1.00 30.10  ? 552  TYR A CA  1 
ATOM   4055 C  C   . TYR A 1 523 ? 73.289  106.029 143.830 1.00 33.46  ? 552  TYR A C   1 
ATOM   4056 O  O   . TYR A 1 523 ? 72.172  106.028 143.327 1.00 36.21  ? 552  TYR A O   1 
ATOM   4057 C  CB  . TYR A 1 523 ? 73.538  107.115 146.095 1.00 30.45  ? 552  TYR A CB  1 
ATOM   4058 C  CG  . TYR A 1 523 ? 74.358  108.196 146.790 1.00 34.71  ? 552  TYR A CG  1 
ATOM   4059 C  CD1 . TYR A 1 523 ? 75.696  108.011 147.044 1.00 36.48  ? 552  TYR A CD1 1 
ATOM   4060 C  CD2 . TYR A 1 523 ? 73.789  109.405 147.146 1.00 38.33  ? 552  TYR A CD2 1 
ATOM   4061 C  CE1 . TYR A 1 523 ? 76.441  109.002 147.664 1.00 40.27  ? 552  TYR A CE1 1 
ATOM   4062 C  CE2 . TYR A 1 523 ? 74.520  110.406 147.770 1.00 41.52  ? 552  TYR A CE2 1 
ATOM   4063 C  CZ  . TYR A 1 523 ? 75.859  110.199 148.022 1.00 41.37  ? 552  TYR A CZ  1 
ATOM   4064 O  OH  . TYR A 1 523 ? 76.590  111.177 148.646 1.00 41.90  ? 552  TYR A OH  1 
ATOM   4065 N  N   . PRO A 1 524 ? 74.154  105.046 143.709 1.00 34.93  ? 553  PRO A N   1 
ATOM   4066 C  CA  . PRO A 1 524 ? 75.435  104.988 144.362 1.00 38.18  ? 553  PRO A CA  1 
ATOM   4067 C  C   . PRO A 1 524 ? 76.548  105.619 143.558 1.00 40.93  ? 553  PRO A C   1 
ATOM   4068 O  O   . PRO A 1 524 ? 76.434  105.636 142.335 1.00 43.58  ? 553  PRO A O   1 
ATOM   4069 C  CB  . PRO A 1 524 ? 75.740  103.490 144.496 1.00 38.59  ? 553  PRO A CB  1 
ATOM   4070 C  CG  . PRO A 1 524 ? 75.023  102.872 143.350 1.00 37.59  ? 553  PRO A CG  1 
ATOM   4071 C  CD  . PRO A 1 524 ? 73.851  103.752 143.063 1.00 35.49  ? 553  PRO A CD  1 
ATOM   4072 N  N   . LYS A 1 525 ? 77.638  105.997 144.216 1.00 43.16  ? 554  LYS A N   1 
ATOM   4073 C  CA  . LYS A 1 525 ? 78.841  106.445 143.517 1.00 43.56  ? 554  LYS A CA  1 
ATOM   4074 C  C   . LYS A 1 525 ? 80.042  105.581 143.919 1.00 45.83  ? 554  LYS A C   1 
ATOM   4075 O  O   . LYS A 1 525 ? 80.043  104.913 144.960 1.00 45.82  ? 554  LYS A O   1 
ATOM   4076 C  CB  . LYS A 1 525 ? 79.194  107.893 143.807 1.00 36.59  ? 554  LYS A CB  1 
ATOM   4077 C  CG  . LYS A 1 525 ? 78.327  108.573 144.839 1.00 37.04  ? 554  LYS A CG  1 
ATOM   4078 C  CD  . LYS A 1 525 ? 78.246  110.072 144.555 1.00 36.34  ? 554  LYS A CD  1 
ATOM   4079 C  CE  . LYS A 1 525 ? 76.850  110.594 144.887 1.00 39.09  ? 554  LYS A CE  1 
ATOM   4080 N  NZ  . LYS A 1 525 ? 76.795  112.061 144.667 1.00 39.43  ? 554  LYS A NZ  1 
ATOM   4081 N  N   . PRO A 1 526 ? 81.076  105.643 143.093 1.00 46.95  ? 555  PRO A N   1 
ATOM   4082 C  CA  . PRO A 1 526 ? 82.344  104.964 143.377 1.00 45.76  ? 555  PRO A CA  1 
ATOM   4083 C  C   . PRO A 1 526 ? 82.960  105.590 144.625 1.00 44.47  ? 555  PRO A C   1 
ATOM   4084 O  O   . PRO A 1 526 ? 82.799  106.780 144.882 1.00 42.34  ? 555  PRO A O   1 
ATOM   4085 C  CB  . PRO A 1 526 ? 83.188  105.274 142.158 1.00 44.86  ? 555  PRO A CB  1 
ATOM   4086 C  CG  . PRO A 1 526 ? 82.681  106.615 141.740 1.00 45.28  ? 555  PRO A CG  1 
ATOM   4087 C  CD  . PRO A 1 526 ? 81.181  106.506 141.895 1.00 46.16  ? 555  PRO A CD  1 
ATOM   4088 N  N   . LEU A 1 527 ? 83.657  104.774 145.405 1.00 43.74  ? 556  LEU A N   1 
ATOM   4089 C  CA  . LEU A 1 527 ? 84.218  105.253 146.665 1.00 42.83  ? 556  LEU A CA  1 
ATOM   4090 C  C   . LEU A 1 527 ? 85.143  106.424 146.427 1.00 42.34  ? 556  LEU A C   1 
ATOM   4091 O  O   . LEU A 1 527 ? 85.437  107.271 147.275 1.00 42.42  ? 556  LEU A O   1 
ATOM   4092 C  CB  . LEU A 1 527 ? 84.925  104.091 147.362 1.00 51.18  ? 556  LEU A CB  1 
ATOM   4093 C  CG  . LEU A 1 527 ? 84.088  102.856 147.703 1.00 50.62  ? 556  LEU A CG  1 
ATOM   4094 C  CD1 . LEU A 1 527 ? 85.008  101.695 148.079 1.00 47.98  ? 556  LEU A CD1 1 
ATOM   4095 C  CD2 . LEU A 1 527 ? 83.076  103.126 148.799 1.00 40.55  ? 556  LEU A CD2 1 
ATOM   4096 N  N   . THR A 1 528 ? 85.645  106.553 145.200 1.00 41.29  ? 557  THR A N   1 
ATOM   4097 C  CA  . THR A 1 528 ? 86.524  107.697 144.930 1.00 41.50  ? 557  THR A CA  1 
ATOM   4098 C  C   . THR A 1 528 ? 85.808  108.963 145.359 1.00 43.49  ? 557  THR A C   1 
ATOM   4099 O  O   . THR A 1 528 ? 86.325  109.868 146.023 1.00 46.59  ? 557  THR A O   1 
ATOM   4100 C  CB  . THR A 1 528 ? 86.874  107.719 143.436 1.00 37.32  ? 557  THR A CB  1 
ATOM   4101 O  OG1 . THR A 1 528 ? 85.989  108.685 142.843 1.00 55.16  ? 557  THR A OG1 1 
ATOM   4102 C  CG2 . THR A 1 528 ? 86.592  106.373 142.785 1.00 44.68  ? 557  THR A CG2 1 
ATOM   4103 N  N   . SER A 1 529 ? 84.513  109.052 145.070 1.00 44.13  ? 558  SER A N   1 
ATOM   4104 C  CA  . SER A 1 529 ? 83.714  110.191 145.503 1.00 43.43  ? 558  SER A CA  1 
ATOM   4105 C  C   . SER A 1 529 ? 83.801  110.457 146.986 1.00 44.05  ? 558  SER A C   1 
ATOM   4106 O  O   . SER A 1 529 ? 83.646  111.613 147.405 1.00 44.47  ? 558  SER A O   1 
ATOM   4107 C  CB  . SER A 1 529 ? 82.268  110.005 145.051 1.00 37.28  ? 558  SER A CB  1 
ATOM   4108 O  OG  . SER A 1 529 ? 82.164  110.368 143.678 1.00 36.10  ? 558  SER A OG  1 
ATOM   4109 N  N   . LEU A 1 530 ? 84.107  109.482 147.827 1.00 45.09  ? 559  LEU A N   1 
ATOM   4110 C  CA  . LEU A 1 530 ? 84.282  109.739 149.263 1.00 46.95  ? 559  LEU A CA  1 
ATOM   4111 C  C   . LEU A 1 530 ? 85.689  110.318 149.486 1.00 50.00  ? 559  LEU A C   1 
ATOM   4112 O  O   . LEU A 1 530 ? 86.011  110.806 150.567 1.00 48.84  ? 559  LEU A O   1 
ATOM   4113 C  CB  . LEU A 1 530 ? 84.172  108.455 150.056 1.00 40.05  ? 559  LEU A CB  1 
ATOM   4114 C  CG  . LEU A 1 530 ? 83.110  108.238 151.107 1.00 40.79  ? 559  LEU A CG  1 
ATOM   4115 C  CD1 . LEU A 1 530 ? 82.137  109.376 151.271 1.00 30.91  ? 559  LEU A CD1 1 
ATOM   4116 C  CD2 . LEU A 1 530 ? 82.393  106.905 150.829 1.00 40.34  ? 559  LEU A CD2 1 
ATOM   4117 N  N   . GLY A 1 531 ? 86.527  110.163 148.466 1.00 52.49  ? 560  GLY A N   1 
ATOM   4118 C  CA  . GLY A 1 531 ? 87.908  110.597 148.518 1.00 57.10  ? 560  GLY A CA  1 
ATOM   4119 C  C   . GLY A 1 531 ? 88.835  109.461 148.951 1.00 60.81  ? 560  GLY A C   1 
ATOM   4120 O  O   . GLY A 1 531 ? 89.671  109.570 149.849 1.00 61.79  ? 560  GLY A O   1 
ATOM   4121 N  N   . LEU A 1 532 ? 88.651  108.311 148.320 1.00 63.70  ? 561  LEU A N   1 
ATOM   4122 C  CA  . LEU A 1 532 ? 89.512  107.172 148.620 1.00 67.97  ? 561  LEU A CA  1 
ATOM   4123 C  C   . LEU A 1 532 ? 90.318  106.851 147.370 1.00 71.31  ? 561  LEU A C   1 
ATOM   4124 O  O   . LEU A 1 532 ? 89.786  106.920 146.262 1.00 71.43  ? 561  LEU A O   1 
ATOM   4125 C  CB  . LEU A 1 532 ? 88.666  105.974 149.044 1.00 67.20  ? 561  LEU A CB  1 
ATOM   4126 C  CG  . LEU A 1 532 ? 87.966  106.128 150.402 1.00 67.78  ? 561  LEU A CG  1 
ATOM   4127 C  CD1 . LEU A 1 532 ? 86.653  105.376 150.456 1.00 64.30  ? 561  LEU A CD1 1 
ATOM   4128 C  CD2 . LEU A 1 532 ? 88.902  105.641 151.500 1.00 70.41  ? 561  LEU A CD2 1 
ATOM   4129 N  N   . PRO A 1 533 ? 91.595  106.595 147.575 1.00 74.13  ? 562  PRO A N   1 
ATOM   4130 C  CA  . PRO A 1 533 ? 92.491  106.231 146.487 1.00 76.51  ? 562  PRO A CA  1 
ATOM   4131 C  C   . PRO A 1 533 ? 91.896  105.150 145.597 1.00 78.65  ? 562  PRO A C   1 
ATOM   4132 O  O   . PRO A 1 533 ? 91.483  104.085 146.079 1.00 77.45  ? 562  PRO A O   1 
ATOM   4133 C  CB  . PRO A 1 533 ? 93.731  105.720 147.208 1.00 77.05  ? 562  PRO A CB  1 
ATOM   4134 C  CG  . PRO A 1 533 ? 93.369  105.557 148.637 1.00 75.95  ? 562  PRO A CG  1 
ATOM   4135 C  CD  . PRO A 1 533 ? 92.265  106.552 148.896 1.00 74.68  ? 562  PRO A CD  1 
ATOM   4136 N  N   . PRO A 1 534 ? 91.958  105.327 144.300 1.00 81.81  ? 563  PRO A N   1 
ATOM   4137 C  CA  . PRO A 1 534 ? 91.432  104.371 143.344 1.00 85.05  ? 563  PRO A CA  1 
ATOM   4138 C  C   . PRO A 1 534 ? 91.940  102.951 143.485 1.00 87.80  ? 563  PRO A C   1 
ATOM   4139 O  O   . PRO A 1 534 ? 91.389  102.037 142.845 1.00 88.40  ? 563  PRO A O   1 
ATOM   4140 C  CB  . PRO A 1 534 ? 91.760  104.942 141.966 1.00 84.06  ? 563  PRO A CB  1 
ATOM   4141 C  CG  . PRO A 1 534 ? 92.185  106.331 142.170 1.00 83.16  ? 563  PRO A CG  1 
ATOM   4142 C  CD  . PRO A 1 534 ? 92.463  106.548 143.629 1.00 82.54  ? 563  PRO A CD  1 
ATOM   4143 N  N   . ASP A 1 535 ? 92.954  102.697 144.297 1.00 90.19  ? 564  ASP A N   1 
ATOM   4144 C  CA  . ASP A 1 535 ? 93.500  101.362 144.487 1.00 91.90  ? 564  ASP A CA  1 
ATOM   4145 C  C   . ASP A 1 535 ? 92.530  100.456 145.236 1.00 91.82  ? 564  ASP A C   1 
ATOM   4146 O  O   . ASP A 1 535 ? 92.270  99.333  144.802 1.00 92.93  ? 564  ASP A O   1 
ATOM   4147 C  CB  . ASP A 1 535 ? 94.862  101.380 145.157 1.00 100.59 ? 564  ASP A CB  1 
ATOM   4148 C  CG  . ASP A 1 535 ? 94.963  102.176 146.431 1.00 107.40 ? 564  ASP A CG  1 
ATOM   4149 O  OD1 . ASP A 1 535 ? 93.979  102.221 147.204 1.00 112.61 ? 564  ASP A OD1 1 
ATOM   4150 O  OD2 . ASP A 1 535 ? 96.032  102.775 146.699 1.00 107.50 ? 564  ASP A OD2 1 
ATOM   4151 N  N   . VAL A 1 536 ? 91.988  100.929 146.349 1.00 90.60  ? 565  VAL A N   1 
ATOM   4152 C  CA  . VAL A 1 536 ? 91.008  100.166 147.110 1.00 88.69  ? 565  VAL A CA  1 
ATOM   4153 C  C   . VAL A 1 536 ? 89.723  100.015 146.297 1.00 86.51  ? 565  VAL A C   1 
ATOM   4154 O  O   . VAL A 1 536 ? 89.241  100.960 145.674 1.00 85.41  ? 565  VAL A O   1 
ATOM   4155 C  CB  . VAL A 1 536 ? 90.626  100.859 148.434 1.00 85.48  ? 565  VAL A CB  1 
ATOM   4156 C  CG1 . VAL A 1 536 ? 91.104  102.296 148.438 1.00 81.69  ? 565  VAL A CG1 1 
ATOM   4157 C  CG2 . VAL A 1 536 ? 89.120  100.820 148.652 1.00 80.66  ? 565  VAL A CG2 1 
ATOM   4158 N  N   . GLN A 1 537 ? 89.168  98.812  146.323 1.00 84.18  ? 566  GLN A N   1 
ATOM   4159 C  CA  . GLN A 1 537 ? 87.886  98.616  145.639 1.00 81.93  ? 566  GLN A CA  1 
ATOM   4160 C  C   . GLN A 1 537 ? 86.955  97.891  146.612 1.00 78.59  ? 566  GLN A C   1 
ATOM   4161 O  O   . GLN A 1 537 ? 85.977  97.263  146.245 1.00 77.97  ? 566  GLN A O   1 
ATOM   4162 C  CB  . GLN A 1 537 ? 88.090  97.930  144.307 1.00 88.27  ? 566  GLN A CB  1 
ATOM   4163 C  CG  . GLN A 1 537 ? 88.978  98.703  143.350 1.00 89.08  ? 566  GLN A CG  1 
ATOM   4164 C  CD  . GLN A 1 537 ? 88.701  98.466  141.892 1.00 93.95  ? 566  GLN A CD  1 
ATOM   4165 O  OE1 . GLN A 1 537 ? 88.131  97.452  141.492 1.00 97.58  ? 566  GLN A OE1 1 
ATOM   4166 N  NE2 . GLN A 1 537 ? 89.111  99.413  141.049 1.00 97.48  ? 566  GLN A NE2 1 
ATOM   4167 N  N   . ARG A 1 538 ? 87.297  98.091  147.883 1.00 74.64  ? 567  ARG A N   1 
ATOM   4168 C  CA  . ARG A 1 538 ? 86.567  97.511  149.006 1.00 70.36  ? 567  ARG A CA  1 
ATOM   4169 C  C   . ARG A 1 538 ? 86.903  98.256  150.283 1.00 67.06  ? 567  ARG A C   1 
ATOM   4170 O  O   . ARG A 1 538 ? 87.980  98.845  150.347 1.00 66.01  ? 567  ARG A O   1 
ATOM   4171 C  CB  . ARG A 1 538 ? 87.003  96.071  149.146 1.00 78.96  ? 567  ARG A CB  1 
ATOM   4172 C  CG  . ARG A 1 538 ? 86.740  95.293  150.411 1.00 85.17  ? 567  ARG A CG  1 
ATOM   4173 C  CD  . ARG A 1 538 ? 87.378  93.891  150.271 1.00 89.51  ? 567  ARG A CD  1 
ATOM   4174 N  NE  . ARG A 1 538 ? 88.490  93.932  149.319 1.00 96.34  ? 567  ARG A NE  1 
ATOM   4175 C  CZ  . ARG A 1 538 ? 88.408  93.796  148.000 1.00 97.02  ? 567  ARG A CZ  1 
ATOM   4176 N  NH1 . ARG A 1 538 ? 87.227  93.602  147.426 1.00 98.39  ? 567  ARG A NH1 1 
ATOM   4177 N  NH2 . ARG A 1 538 ? 89.498  93.877  147.246 1.00 96.47  ? 567  ARG A NH2 1 
ATOM   4178 N  N   . VAL A 1 539 ? 86.032  98.298  151.268 1.00 65.73  ? 568  VAL A N   1 
ATOM   4179 C  CA  . VAL A 1 539 ? 86.459  98.830  152.564 1.00 65.77  ? 568  VAL A CA  1 
ATOM   4180 C  C   . VAL A 1 539 ? 85.780  97.904  153.569 1.00 67.17  ? 568  VAL A C   1 
ATOM   4181 O  O   . VAL A 1 539 ? 84.632  97.572  153.269 1.00 69.34  ? 568  VAL A O   1 
ATOM   4182 C  CB  . VAL A 1 539 ? 86.145  100.280 152.857 1.00 58.55  ? 568  VAL A CB  1 
ATOM   4183 C  CG1 . VAL A 1 539 ? 86.180  101.159 151.628 1.00 62.50  ? 568  VAL A CG1 1 
ATOM   4184 C  CG2 . VAL A 1 539 ? 84.825  100.430 153.595 1.00 57.38  ? 568  VAL A CG2 1 
ATOM   4185 N  N   . ASP A 1 540 ? 86.451  97.408  154.578 1.00 68.47  ? 569  ASP A N   1 
ATOM   4186 C  CA  . ASP A 1 540 ? 85.810  96.430  155.462 1.00 67.95  ? 569  ASP A CA  1 
ATOM   4187 C  C   . ASP A 1 540 ? 85.342  97.043  156.749 1.00 66.88  ? 569  ASP A C   1 
ATOM   4188 O  O   . ASP A 1 540 ? 84.715  96.350  157.557 1.00 68.48  ? 569  ASP A O   1 
ATOM   4189 C  CB  . ASP A 1 540 ? 86.752  95.244  155.710 1.00 74.61  ? 569  ASP A CB  1 
ATOM   4190 C  CG  . ASP A 1 540 ? 88.208  95.628  155.491 1.00 79.60  ? 569  ASP A CG  1 
ATOM   4191 O  OD1 . ASP A 1 540 ? 88.752  96.319  156.381 1.00 86.81  ? 569  ASP A OD1 1 
ATOM   4192 O  OD2 . ASP A 1 540 ? 88.793  95.268  154.448 1.00 78.00  ? 569  ASP A OD2 1 
ATOM   4193 N  N   . ALA A 1 541 ? 85.507  98.329  157.033 1.00 64.64  ? 570  ALA A N   1 
ATOM   4194 C  CA  . ALA A 1 541 ? 84.943  98.754  158.336 1.00 64.33  ? 570  ALA A CA  1 
ATOM   4195 C  C   . ALA A 1 541 ? 84.504  100.196 158.247 1.00 65.85  ? 570  ALA A C   1 
ATOM   4196 O  O   . ALA A 1 541 ? 84.947  100.902 157.343 1.00 66.94  ? 570  ALA A O   1 
ATOM   4197 C  CB  . ALA A 1 541 ? 85.991  98.549  159.408 1.00 76.53  ? 570  ALA A CB  1 
ATOM   4198 N  N   . ALA A 1 542 ? 83.686  100.663 159.170 1.00 67.73  ? 571  ALA A N   1 
ATOM   4199 C  CA  . ALA A 1 542 ? 83.212  102.042 159.127 1.00 71.12  ? 571  ALA A CA  1 
ATOM   4200 C  C   . ALA A 1 542 ? 82.503  102.411 160.420 1.00 75.63  ? 571  ALA A C   1 
ATOM   4201 O  O   . ALA A 1 542 ? 82.036  101.536 161.141 1.00 76.49  ? 571  ALA A O   1 
ATOM   4202 C  CB  . ALA A 1 542 ? 82.228  102.197 157.975 1.00 71.69  ? 571  ALA A CB  1 
ATOM   4203 N  N   . PHE A 1 543 ? 82.404  103.697 160.693 1.00 80.00  ? 572  PHE A N   1 
ATOM   4204 C  CA  . PHE A 1 543 ? 81.689  104.233 161.832 1.00 85.02  ? 572  PHE A CA  1 
ATOM   4205 C  C   . PHE A 1 543 ? 82.133  105.669 162.132 1.00 86.91  ? 572  PHE A C   1 
ATOM   4206 O  O   . PHE A 1 543 ? 83.186  106.112 161.711 1.00 83.63  ? 572  PHE A O   1 
ATOM   4207 C  CB  . PHE A 1 543 ? 81.797  103.381 163.096 1.00 96.69  ? 572  PHE A CB  1 
ATOM   4208 C  CG  . PHE A 1 543 ? 83.010  103.715 163.925 1.00 102.61 ? 572  PHE A CG  1 
ATOM   4209 C  CD1 . PHE A 1 543 ? 84.272  103.347 163.479 1.00 102.12 ? 572  PHE A CD1 1 
ATOM   4210 C  CD2 . PHE A 1 543 ? 82.904  104.400 165.121 1.00 103.71 ? 572  PHE A CD2 1 
ATOM   4211 C  CE1 . PHE A 1 543 ? 85.400  103.654 164.217 1.00 100.58 ? 572  PHE A CE1 1 
ATOM   4212 C  CE2 . PHE A 1 543 ? 84.031  104.711 165.865 1.00 101.85 ? 572  PHE A CE2 1 
ATOM   4213 C  CZ  . PHE A 1 543 ? 85.280  104.335 165.410 1.00 99.33  ? 572  PHE A CZ  1 
ATOM   4214 N  N   . ASN A 1 544 ? 81.266  106.360 162.847 1.00 92.83  ? 573  ASN A N   1 
ATOM   4215 C  CA  . ASN A 1 544 ? 81.482  107.720 163.273 1.00 100.35 ? 573  ASN A CA  1 
ATOM   4216 C  C   . ASN A 1 544 ? 81.829  107.791 164.760 1.00 106.73 ? 573  ASN A C   1 
ATOM   4217 O  O   . ASN A 1 544 ? 81.512  106.908 165.548 1.00 107.55 ? 573  ASN A O   1 
ATOM   4218 C  CB  . ASN A 1 544 ? 80.224  108.565 163.043 1.00 99.93  ? 573  ASN A CB  1 
ATOM   4219 C  CG  . ASN A 1 544 ? 80.559  110.042 163.009 1.00 100.29 ? 573  ASN A CG  1 
ATOM   4220 O  OD1 . ASN A 1 544 ? 81.057  110.538 162.003 1.00 101.45 ? 573  ASN A OD1 1 
ATOM   4221 N  ND2 . ASN A 1 544 ? 80.282  110.727 164.107 1.00 101.88 ? 573  ASN A ND2 1 
ATOM   4222 N  N   . TRP A 1 545 ? 82.471  108.891 165.131 1.00 112.04 ? 574  TRP A N   1 
ATOM   4223 C  CA  . TRP A 1 545 ? 82.864  109.094 166.526 1.00 116.89 ? 574  TRP A CA  1 
ATOM   4224 C  C   . TRP A 1 545 ? 82.137  110.274 167.143 1.00 119.71 ? 574  TRP A C   1 
ATOM   4225 O  O   . TRP A 1 545 ? 82.030  111.349 166.550 1.00 119.85 ? 574  TRP A O   1 
ATOM   4226 C  CB  . TRP A 1 545 ? 84.378  109.246 166.554 1.00 125.89 ? 574  TRP A CB  1 
ATOM   4227 C  CG  . TRP A 1 545 ? 84.992  108.632 167.772 1.00 132.65 ? 574  TRP A CG  1 
ATOM   4228 C  CD1 . TRP A 1 545 ? 84.363  108.415 168.964 1.00 133.89 ? 574  TRP A CD1 1 
ATOM   4229 C  CD2 . TRP A 1 545 ? 86.337  108.172 167.914 1.00 135.18 ? 574  TRP A CD2 1 
ATOM   4230 N  NE1 . TRP A 1 545 ? 85.240  107.844 169.844 1.00 135.86 ? 574  TRP A NE1 1 
ATOM   4231 C  CE2 . TRP A 1 545 ? 86.455  107.681 169.223 1.00 138.18 ? 574  TRP A CE2 1 
ATOM   4232 C  CE3 . TRP A 1 545 ? 87.451  108.118 167.072 1.00 136.16 ? 574  TRP A CE3 1 
ATOM   4233 C  CZ2 . TRP A 1 545 ? 87.652  107.144 169.697 1.00 140.84 ? 574  TRP A CZ2 1 
ATOM   4234 C  CZ3 . TRP A 1 545 ? 88.637  107.590 167.547 1.00 136.07 ? 574  TRP A CZ3 1 
ATOM   4235 C  CH2 . TRP A 1 545 ? 88.724  107.108 168.857 1.00 138.62 ? 574  TRP A CH2 1 
ATOM   4236 N  N   . SER A 1 546 ? 81.521  110.089 168.311 1.00 121.55 ? 575  SER A N   1 
ATOM   4237 C  CA  . SER A 1 546 ? 80.699  111.144 168.904 1.00 123.03 ? 575  SER A CA  1 
ATOM   4238 C  C   . SER A 1 546 ? 81.525  112.332 169.358 1.00 124.00 ? 575  SER A C   1 
ATOM   4239 O  O   . SER A 1 546 ? 81.089  113.484 169.329 1.00 124.77 ? 575  SER A O   1 
ATOM   4240 C  CB  . SER A 1 546 ? 79.926  110.563 170.096 1.00 125.15 ? 575  SER A CB  1 
ATOM   4241 O  OG  . SER A 1 546 ? 80.700  109.521 170.678 1.00 125.32 ? 575  SER A OG  1 
ATOM   4242 N  N   . LYS A 1 547 ? 82.736  112.057 169.835 1.00 123.72 ? 576  LYS A N   1 
ATOM   4243 C  CA  . LYS A 1 547 ? 83.610  113.125 170.296 1.00 122.97 ? 576  LYS A CA  1 
ATOM   4244 C  C   . LYS A 1 547 ? 84.112  113.991 169.145 1.00 121.14 ? 576  LYS A C   1 
ATOM   4245 O  O   . LYS A 1 547 ? 84.151  115.219 169.225 1.00 121.60 ? 576  LYS A O   1 
ATOM   4246 C  CB  . LYS A 1 547 ? 84.847  112.516 170.990 1.00 127.51 ? 576  LYS A CB  1 
ATOM   4247 C  CG  . LYS A 1 547 ? 85.084  111.076 170.540 1.00 127.00 ? 576  LYS A CG  1 
ATOM   4248 C  CD  . LYS A 1 547 ? 84.982  110.178 171.774 1.00 130.14 ? 576  LYS A CD  1 
ATOM   4249 C  CE  . LYS A 1 547 ? 86.420  109.868 172.219 1.00 131.28 ? 576  LYS A CE  1 
ATOM   4250 N  NZ  . LYS A 1 547 ? 86.709  108.442 171.866 1.00 134.44 ? 576  LYS A NZ  1 
ATOM   4251 N  N   . ASN A 1 548 ? 84.616  113.324 168.108 1.00 118.39 ? 577  ASN A N   1 
ATOM   4252 C  CA  . ASN A 1 548 ? 85.245  114.027 167.007 1.00 114.87 ? 577  ASN A CA  1 
ATOM   4253 C  C   . ASN A 1 548 ? 84.319  114.177 165.809 1.00 112.24 ? 577  ASN A C   1 
ATOM   4254 O  O   . ASN A 1 548 ? 84.586  115.022 164.956 1.00 112.28 ? 577  ASN A O   1 
ATOM   4255 C  CB  . ASN A 1 548 ? 86.540  113.367 166.544 1.00 112.01 ? 577  ASN A CB  1 
ATOM   4256 C  CG  . ASN A 1 548 ? 86.617  111.873 166.716 1.00 112.61 ? 577  ASN A CG  1 
ATOM   4257 O  OD1 . ASN A 1 548 ? 85.874  111.281 167.499 1.00 114.65 ? 577  ASN A OD1 1 
ATOM   4258 N  ND2 . ASN A 1 548 ? 87.543  111.242 165.989 1.00 110.87 ? 577  ASN A ND2 1 
ATOM   4259 N  N   . LYS A 1 549 ? 83.334  113.291 165.707 1.00 109.14 ? 578  LYS A N   1 
ATOM   4260 C  CA  . LYS A 1 549 ? 82.439  113.282 164.561 1.00 105.88 ? 578  LYS A CA  1 
ATOM   4261 C  C   . LYS A 1 549 ? 83.223  112.989 163.289 1.00 103.64 ? 578  LYS A C   1 
ATOM   4262 O  O   . LYS A 1 549 ? 82.864  113.460 162.220 1.00 102.87 ? 578  LYS A O   1 
ATOM   4263 C  CB  . LYS A 1 549 ? 81.699  114.612 164.416 1.00 106.93 ? 578  LYS A CB  1 
ATOM   4264 C  CG  . LYS A 1 549 ? 80.512  114.723 165.358 1.00 108.40 ? 578  LYS A CG  1 
ATOM   4265 C  CD  . LYS A 1 549 ? 79.672  115.944 165.042 1.00 108.87 ? 578  LYS A CD  1 
ATOM   4266 C  CE  . LYS A 1 549 ? 78.333  115.879 165.757 1.00 113.36 ? 578  LYS A CE  1 
ATOM   4267 N  NZ  . LYS A 1 549 ? 78.325  114.936 166.906 1.00 113.28 ? 578  LYS A NZ  1 
ATOM   4268 N  N   . LYS A 1 550 ? 84.296  112.226 163.466 1.00 102.77 ? 579  LYS A N   1 
ATOM   4269 C  CA  . LYS A 1 550 ? 85.171  111.899 162.346 1.00 101.26 ? 579  LYS A CA  1 
ATOM   4270 C  C   . LYS A 1 550 ? 84.938  110.464 161.917 1.00 99.35  ? 579  LYS A C   1 
ATOM   4271 O  O   . LYS A 1 550 ? 84.898  109.562 162.752 1.00 99.40  ? 579  LYS A O   1 
ATOM   4272 C  CB  . LYS A 1 550 ? 86.630  112.204 162.696 1.00 100.70 ? 579  LYS A CB  1 
ATOM   4273 C  CG  . LYS A 1 550 ? 87.236  113.218 161.740 1.00 96.77  ? 579  LYS A CG  1 
ATOM   4274 C  CD  . LYS A 1 550 ? 87.069  114.655 162.143 1.00 95.13  ? 579  LYS A CD  1 
ATOM   4275 C  CE  . LYS A 1 550 ? 88.203  115.525 161.610 1.00 94.00  ? 579  LYS A CE  1 
ATOM   4276 N  NZ  . LYS A 1 550 ? 87.736  116.863 161.165 1.00 90.39  ? 579  LYS A NZ  1 
ATOM   4277 N  N   . THR A 1 551 ? 84.661  110.289 160.627 1.00 97.73  ? 580  THR A N   1 
ATOM   4278 C  CA  . THR A 1 551 ? 84.336  108.958 160.139 1.00 97.11  ? 580  THR A CA  1 
ATOM   4279 C  C   . THR A 1 551 ? 85.568  108.238 159.623 1.00 96.10  ? 580  THR A C   1 
ATOM   4280 O  O   . THR A 1 551 ? 86.192  108.710 158.683 1.00 95.12  ? 580  THR A O   1 
ATOM   4281 C  CB  . THR A 1 551 ? 83.263  109.007 159.038 1.00 98.33  ? 580  THR A CB  1 
ATOM   4282 O  OG1 . THR A 1 551 ? 82.485  110.205 159.176 1.00 95.14  ? 580  THR A OG1 1 
ATOM   4283 C  CG2 . THR A 1 551 ? 82.377  107.776 159.166 1.00 98.81  ? 580  THR A CG2 1 
ATOM   4284 N  N   . TYR A 1 552 ? 85.892  107.115 160.250 1.00 96.74  ? 581  TYR A N   1 
ATOM   4285 C  CA  . TYR A 1 552 ? 87.055  106.345 159.837 1.00 98.39  ? 581  TYR A CA  1 
ATOM   4286 C  C   . TYR A 1 552 ? 86.642  105.161 158.971 1.00 95.32  ? 581  TYR A C   1 
ATOM   4287 O  O   . TYR A 1 552 ? 85.771  104.388 159.363 1.00 95.62  ? 581  TYR A O   1 
ATOM   4288 C  CB  . TYR A 1 552 ? 87.844  105.869 161.058 1.00 105.34 ? 581  TYR A CB  1 
ATOM   4289 C  CG  . TYR A 1 552 ? 88.387  106.937 161.976 1.00 114.12 ? 581  TYR A CG  1 
ATOM   4290 C  CD1 . TYR A 1 552 ? 87.633  107.422 163.037 1.00 116.94 ? 581  TYR A CD1 1 
ATOM   4291 C  CD2 . TYR A 1 552 ? 89.661  107.469 161.809 1.00 118.67 ? 581  TYR A CD2 1 
ATOM   4292 C  CE1 . TYR A 1 552 ? 88.133  108.400 163.878 1.00 119.54 ? 581  TYR A CE1 1 
ATOM   4293 C  CE2 . TYR A 1 552 ? 90.177  108.440 162.648 1.00 120.74 ? 581  TYR A CE2 1 
ATOM   4294 C  CZ  . TYR A 1 552 ? 89.400  108.907 163.688 1.00 121.34 ? 581  TYR A CZ  1 
ATOM   4295 O  OH  . TYR A 1 552 ? 89.872  109.876 164.541 1.00 122.71 ? 581  TYR A OH  1 
ATOM   4296 N  N   . ILE A 1 553 ? 87.255  105.014 157.804 1.00 91.98  ? 582  ILE A N   1 
ATOM   4297 C  CA  . ILE A 1 553 ? 86.984  103.874 156.945 1.00 89.03  ? 582  ILE A CA  1 
ATOM   4298 C  C   . ILE A 1 553 ? 88.193  102.936 156.907 1.00 87.32  ? 582  ILE A C   1 
ATOM   4299 O  O   . ILE A 1 553 ? 89.215  103.263 156.314 1.00 88.12  ? 582  ILE A O   1 
ATOM   4300 C  CB  . ILE A 1 553 ? 86.608  104.218 155.506 1.00 82.25  ? 582  ILE A CB  1 
ATOM   4301 C  CG1 . ILE A 1 553 ? 86.277  105.689 155.307 1.00 80.60  ? 582  ILE A CG1 1 
ATOM   4302 C  CG2 . ILE A 1 553 ? 85.425  103.358 155.073 1.00 83.50  ? 582  ILE A CG2 1 
ATOM   4303 C  CD1 . ILE A 1 553 ? 85.993  106.052 153.862 1.00 79.89  ? 582  ILE A CD1 1 
ATOM   4304 N  N   . PHE A 1 554 ? 88.052  101.765 157.495 1.00 85.57  ? 583  PHE A N   1 
ATOM   4305 C  CA  . PHE A 1 554 ? 89.137  100.807 157.597 1.00 85.80  ? 583  PHE A CA  1 
ATOM   4306 C  C   . PHE A 1 554 ? 89.192  99.839  156.423 1.00 86.81  ? 583  PHE A C   1 
ATOM   4307 O  O   . PHE A 1 554 ? 88.200  99.149  156.182 1.00 85.72  ? 583  PHE A O   1 
ATOM   4308 C  CB  . PHE A 1 554 ? 88.954  99.972  158.869 1.00 83.72  ? 583  PHE A CB  1 
ATOM   4309 C  CG  . PHE A 1 554 ? 88.796  100.716 160.153 1.00 85.62  ? 583  PHE A CG  1 
ATOM   4310 C  CD1 . PHE A 1 554 ? 87.926  101.785 160.299 1.00 83.93  ? 583  PHE A CD1 1 
ATOM   4311 C  CD2 . PHE A 1 554 ? 89.542  100.312 161.259 1.00 85.62  ? 583  PHE A CD2 1 
ATOM   4312 C  CE1 . PHE A 1 554 ? 87.803  102.456 161.500 1.00 82.94  ? 583  PHE A CE1 1 
ATOM   4313 C  CE2 . PHE A 1 554 ? 89.419  100.975 162.464 1.00 86.67  ? 583  PHE A CE2 1 
ATOM   4314 C  CZ  . PHE A 1 554 ? 88.552  102.047 162.584 1.00 86.39  ? 583  PHE A CZ  1 
ATOM   4315 N  N   . ALA A 1 555 ? 90.361  99.648  155.829 1.00 89.61  ? 584  ALA A N   1 
ATOM   4316 C  CA  . ALA A 1 555 ? 90.553  98.662  154.771 1.00 93.33  ? 584  ALA A CA  1 
ATOM   4317 C  C   . ALA A 1 555 ? 91.938  98.020  154.834 1.00 96.27  ? 584  ALA A C   1 
ATOM   4318 O  O   . ALA A 1 555 ? 92.973  98.659  154.659 1.00 95.88  ? 584  ALA A O   1 
ATOM   4319 C  CB  . ALA A 1 555 ? 90.313  99.277  153.404 1.00 92.80  ? 584  ALA A CB  1 
ATOM   4320 N  N   . GLY A 1 556 ? 91.955  96.705  155.046 1.00 99.77  ? 585  GLY A N   1 
ATOM   4321 C  CA  . GLY A 1 556 ? 93.219  95.974  155.171 1.00 103.04 ? 585  GLY A CA  1 
ATOM   4322 C  C   . GLY A 1 556 ? 93.953  96.442  156.430 1.00 104.84 ? 585  GLY A C   1 
ATOM   4323 O  O   . GLY A 1 556 ? 93.404  96.434  157.529 1.00 105.03 ? 585  GLY A O   1 
ATOM   4324 N  N   . ASP A 1 557 ? 95.166  96.926  156.220 1.00 106.58 ? 586  ASP A N   1 
ATOM   4325 C  CA  . ASP A 1 557 ? 96.017  97.410  157.295 1.00 107.86 ? 586  ASP A CA  1 
ATOM   4326 C  C   . ASP A 1 557 ? 96.044  98.928  157.362 1.00 107.36 ? 586  ASP A C   1 
ATOM   4327 O  O   . ASP A 1 557 ? 96.835  99.508  158.108 1.00 108.07 ? 586  ASP A O   1 
ATOM   4328 C  CB  . ASP A 1 557 ? 97.435  96.850  157.117 1.00 117.45 ? 586  ASP A CB  1 
ATOM   4329 C  CG  . ASP A 1 557 ? 97.646  96.310  155.712 1.00 122.69 ? 586  ASP A CG  1 
ATOM   4330 O  OD1 . ASP A 1 557 ? 97.972  97.119  154.816 1.00 125.75 ? 586  ASP A OD1 1 
ATOM   4331 O  OD2 . ASP A 1 557 ? 97.470  95.089  155.518 1.00 124.77 ? 586  ASP A OD2 1 
ATOM   4332 N  N   . LYS A 1 558 ? 95.134  99.591  156.645 1.00 105.79 ? 587  LYS A N   1 
ATOM   4333 C  CA  . LYS A 1 558 ? 95.068  101.041 156.743 1.00 103.53 ? 587  LYS A CA  1 
ATOM   4334 C  C   . LYS A 1 558 ? 93.646  101.525 156.990 1.00 101.62 ? 587  LYS A C   1 
ATOM   4335 O  O   . LYS A 1 558 ? 92.665  100.836 156.740 1.00 103.66 ? 587  LYS A O   1 
ATOM   4336 C  CB  . LYS A 1 558 ? 95.676  101.771 155.568 1.00 107.61 ? 587  LYS A CB  1 
ATOM   4337 C  CG  . LYS A 1 558 ? 95.858  101.060 154.262 1.00 111.35 ? 587  LYS A CG  1 
ATOM   4338 C  CD  . LYS A 1 558 ? 97.292  101.118 153.751 1.00 112.38 ? 587  LYS A CD  1 
ATOM   4339 C  CE  . LYS A 1 558 ? 97.559  99.985  152.770 1.00 114.65 ? 587  LYS A CE  1 
ATOM   4340 N  NZ  . LYS A 1 558 ? 96.631  100.023 151.606 1.00 109.88 ? 587  LYS A NZ  1 
ATOM   4341 N  N   . PHE A 1 559 ? 93.545  102.746 157.507 1.00 98.24  ? 588  PHE A N   1 
ATOM   4342 C  CA  . PHE A 1 559 ? 92.248  103.389 157.671 1.00 93.40  ? 588  PHE A CA  1 
ATOM   4343 C  C   . PHE A 1 559 ? 92.351  104.860 157.277 1.00 89.64  ? 588  PHE A C   1 
ATOM   4344 O  O   . PHE A 1 559 ? 93.447  105.366 157.034 1.00 90.10  ? 588  PHE A O   1 
ATOM   4345 C  CB  . PHE A 1 559 ? 91.684  103.204 159.055 1.00 94.59  ? 588  PHE A CB  1 
ATOM   4346 C  CG  . PHE A 1 559 ? 92.303  104.065 160.110 1.00 101.24 ? 588  PHE A CG  1 
ATOM   4347 C  CD1 . PHE A 1 559 ? 91.878  105.371 160.303 1.00 102.89 ? 588  PHE A CD1 1 
ATOM   4348 C  CD2 . PHE A 1 559 ? 93.311  103.556 160.915 1.00 102.49 ? 588  PHE A CD2 1 
ATOM   4349 C  CE1 . PHE A 1 559 ? 92.448  106.158 161.287 1.00 102.27 ? 588  PHE A CE1 1 
ATOM   4350 C  CE2 . PHE A 1 559 ? 93.879  104.338 161.900 1.00 103.18 ? 588  PHE A CE2 1 
ATOM   4351 C  CZ  . PHE A 1 559 ? 93.442  105.637 162.085 1.00 104.84 ? 588  PHE A CZ  1 
ATOM   4352 N  N   . TRP A 1 560 ? 91.207  105.495 157.068 1.00 85.29  ? 589  TRP A N   1 
ATOM   4353 C  CA  . TRP A 1 560 ? 91.151  106.886 156.661 1.00 80.18  ? 589  TRP A CA  1 
ATOM   4354 C  C   . TRP A 1 560 ? 90.059  107.583 157.505 1.00 77.50  ? 589  TRP A C   1 
ATOM   4355 O  O   . TRP A 1 560 ? 89.156  106.933 157.993 1.00 76.84  ? 589  TRP A O   1 
ATOM   4356 C  CB  . TRP A 1 560 ? 90.761  107.110 155.238 1.00 69.02  ? 589  TRP A CB  1 
ATOM   4357 C  CG  . TRP A 1 560 ? 91.528  106.698 154.060 1.00 64.57  ? 589  TRP A CG  1 
ATOM   4358 C  CD1 . TRP A 1 560 ? 92.079  107.561 153.141 1.00 67.35  ? 589  TRP A CD1 1 
ATOM   4359 C  CD2 . TRP A 1 560 ? 91.809  105.383 153.567 1.00 64.15  ? 589  TRP A CD2 1 
ATOM   4360 N  NE1 . TRP A 1 560 ? 92.695  106.866 152.132 1.00 66.62  ? 589  TRP A NE1 1 
ATOM   4361 C  CE2 . TRP A 1 560 ? 92.543  105.522 152.374 1.00 66.79  ? 589  TRP A CE2 1 
ATOM   4362 C  CE3 . TRP A 1 560 ? 91.515  104.093 154.016 1.00 68.68  ? 589  TRP A CE3 1 
ATOM   4363 C  CZ2 . TRP A 1 560 ? 92.998  104.428 151.634 1.00 68.33  ? 589  TRP A CZ2 1 
ATOM   4364 C  CZ3 . TRP A 1 560 ? 91.969  103.001 153.291 1.00 72.57  ? 589  TRP A CZ3 1 
ATOM   4365 C  CH2 . TRP A 1 560 ? 92.706  103.176 152.104 1.00 71.53  ? 589  TRP A CH2 1 
ATOM   4366 N  N   . ARG A 1 561 ? 90.095  108.896 157.429 1.00 76.53  ? 590  ARG A N   1 
ATOM   4367 C  CA  . ARG A 1 561 ? 89.142  109.732 158.123 1.00 76.60  ? 590  ARG A CA  1 
ATOM   4368 C  C   . ARG A 1 561 ? 88.298  110.539 157.145 1.00 76.57  ? 590  ARG A C   1 
ATOM   4369 O  O   . ARG A 1 561 ? 88.843  111.069 156.183 1.00 75.80  ? 590  ARG A O   1 
ATOM   4370 C  CB  . ARG A 1 561 ? 89.904  110.759 158.975 1.00 83.12  ? 590  ARG A CB  1 
ATOM   4371 C  CG  . ARG A 1 561 ? 88.986  111.469 159.950 1.00 86.78  ? 590  ARG A CG  1 
ATOM   4372 C  CD  . ARG A 1 561 ? 89.511  111.243 161.365 1.00 92.19  ? 590  ARG A CD  1 
ATOM   4373 N  NE  . ARG A 1 561 ? 89.973  112.504 161.927 1.00 97.45  ? 590  ARG A NE  1 
ATOM   4374 C  CZ  . ARG A 1 561 ? 91.165  113.045 161.705 1.00 102.58 ? 590  ARG A CZ  1 
ATOM   4375 N  NH1 . ARG A 1 561 ? 92.051  112.444 160.927 1.00 99.99  ? 590  ARG A NH1 1 
ATOM   4376 N  NH2 . ARG A 1 561 ? 91.487  114.210 162.266 1.00 103.78 ? 590  ARG A NH2 1 
ATOM   4377 N  N   . TYR A 1 562 ? 87.008  110.673 157.432 1.00 76.32  ? 591  TYR A N   1 
ATOM   4378 C  CA  . TYR A 1 562 ? 86.192  111.478 156.524 1.00 76.19  ? 591  TYR A CA  1 
ATOM   4379 C  C   . TYR A 1 562 ? 85.630  112.671 157.285 1.00 77.41  ? 591  TYR A C   1 
ATOM   4380 O  O   . TYR A 1 562 ? 85.194  112.574 158.431 1.00 78.05  ? 591  TYR A O   1 
ATOM   4381 C  CB  . TYR A 1 562 ? 85.083  110.655 155.889 1.00 74.11  ? 591  TYR A CB  1 
ATOM   4382 C  CG  . TYR A 1 562 ? 84.342  111.328 154.755 1.00 69.59  ? 591  TYR A CG  1 
ATOM   4383 C  CD1 . TYR A 1 562 ? 84.951  111.488 153.520 1.00 67.93  ? 591  TYR A CD1 1 
ATOM   4384 C  CD2 . TYR A 1 562 ? 83.038  111.782 154.936 1.00 66.77  ? 591  TYR A CD2 1 
ATOM   4385 C  CE1 . TYR A 1 562 ? 84.256  112.104 152.492 1.00 67.81  ? 591  TYR A CE1 1 
ATOM   4386 C  CE2 . TYR A 1 562 ? 82.349  112.395 153.920 1.00 65.31  ? 591  TYR A CE2 1 
ATOM   4387 C  CZ  . TYR A 1 562 ? 82.972  112.551 152.700 1.00 65.60  ? 591  TYR A CZ  1 
ATOM   4388 O  OH  . TYR A 1 562 ? 82.270  113.168 151.703 1.00 63.92  ? 591  TYR A OH  1 
ATOM   4389 N  N   . ASN A 1 563 ? 85.634  113.805 156.609 1.00 77.94  ? 592  ASN A N   1 
ATOM   4390 C  CA  . ASN A 1 563 ? 85.048  115.009 157.205 1.00 80.10  ? 592  ASN A CA  1 
ATOM   4391 C  C   . ASN A 1 563 ? 83.601  115.120 156.750 1.00 80.50  ? 592  ASN A C   1 
ATOM   4392 O  O   . ASN A 1 563 ? 83.374  115.361 155.562 1.00 80.90  ? 592  ASN A O   1 
ATOM   4393 C  CB  . ASN A 1 563 ? 85.869  116.202 156.709 1.00 93.79  ? 592  ASN A CB  1 
ATOM   4394 C  CG  . ASN A 1 563 ? 86.088  117.275 157.746 1.00 96.34  ? 592  ASN A CG  1 
ATOM   4395 O  OD1 . ASN A 1 563 ? 85.148  117.671 158.437 1.00 97.72  ? 592  ASN A OD1 1 
ATOM   4396 N  ND2 . ASN A 1 563 ? 87.321  117.752 157.857 1.00 98.11  ? 592  ASN A ND2 1 
ATOM   4397 N  N   . GLU A 1 564 ? 82.625  114.890 157.615 1.00 81.27  ? 593  GLU A N   1 
ATOM   4398 C  CA  . GLU A 1 564 ? 81.231  114.986 157.162 1.00 82.51  ? 593  GLU A CA  1 
ATOM   4399 C  C   . GLU A 1 564 ? 80.819  116.439 157.020 1.00 84.75  ? 593  GLU A C   1 
ATOM   4400 O  O   . GLU A 1 564 ? 79.983  116.824 156.205 1.00 85.26  ? 593  GLU A O   1 
ATOM   4401 C  CB  . GLU A 1 564 ? 80.298  114.201 158.070 1.00 74.09  ? 593  GLU A CB  1 
ATOM   4402 C  CG  . GLU A 1 564 ? 79.345  113.281 157.313 1.00 76.83  ? 593  GLU A CG  1 
ATOM   4403 C  CD  . GLU A 1 564 ? 80.005  112.036 156.753 1.00 74.12  ? 593  GLU A CD  1 
ATOM   4404 O  OE1 . GLU A 1 564 ? 81.053  111.618 157.297 1.00 71.91  ? 593  GLU A OE1 1 
ATOM   4405 O  OE2 . GLU A 1 564 ? 79.470  111.471 155.768 1.00 68.69  ? 593  GLU A OE2 1 
ATOM   4406 N  N   . VAL A 1 565 ? 81.478  117.319 157.775 1.00 86.35  ? 594  VAL A N   1 
ATOM   4407 C  CA  . VAL A 1 565 ? 81.161  118.747 157.684 1.00 86.15  ? 594  VAL A CA  1 
ATOM   4408 C  C   . VAL A 1 565 ? 81.728  119.327 156.401 1.00 85.35  ? 594  VAL A C   1 
ATOM   4409 O  O   . VAL A 1 565 ? 81.040  120.043 155.679 1.00 85.19  ? 594  VAL A O   1 
ATOM   4410 C  CB  . VAL A 1 565 ? 81.652  119.518 158.915 1.00 88.26  ? 594  VAL A CB  1 
ATOM   4411 C  CG1 . VAL A 1 565 ? 80.474  119.792 159.853 1.00 85.56  ? 594  VAL A CG1 1 
ATOM   4412 C  CG2 . VAL A 1 565 ? 82.739  118.749 159.663 1.00 88.88  ? 594  VAL A CG2 1 
ATOM   4413 N  N   . LYS A 1 566 ? 82.955  118.935 156.072 1.00 85.83  ? 595  LYS A N   1 
ATOM   4414 C  CA  . LYS A 1 566 ? 83.640  119.465 154.903 1.00 86.38  ? 595  LYS A CA  1 
ATOM   4415 C  C   . LYS A 1 566 ? 83.408  118.627 153.662 1.00 87.17  ? 595  LYS A C   1 
ATOM   4416 O  O   . LYS A 1 566 ? 83.680  119.080 152.551 1.00 88.21  ? 595  LYS A O   1 
ATOM   4417 C  CB  . LYS A 1 566 ? 85.140  119.608 155.173 1.00 87.17  ? 595  LYS A CB  1 
ATOM   4418 C  CG  . LYS A 1 566 ? 85.532  120.905 155.869 1.00 92.88  ? 595  LYS A CG  1 
ATOM   4419 C  CD  . LYS A 1 566 ? 86.866  120.772 156.585 1.00 93.04  ? 595  LYS A CD  1 
ATOM   4420 C  CE  . LYS A 1 566 ? 87.305  122.045 157.270 1.00 92.96  ? 595  LYS A CE  1 
ATOM   4421 N  NZ  . LYS A 1 566 ? 88.737  122.041 157.703 1.00 90.98  ? 595  LYS A NZ  1 
ATOM   4422 N  N   . LYS A 1 567 ? 82.921  117.411 153.825 1.00 87.58  ? 596  LYS A N   1 
ATOM   4423 C  CA  . LYS A 1 567 ? 82.626  116.498 152.735 1.00 87.31  ? 596  LYS A CA  1 
ATOM   4424 C  C   . LYS A 1 567 ? 83.882  116.194 151.924 1.00 88.27  ? 596  LYS A C   1 
ATOM   4425 O  O   . LYS A 1 567 ? 83.842  116.080 150.705 1.00 88.13  ? 596  LYS A O   1 
ATOM   4426 C  CB  . LYS A 1 567 ? 81.520  117.008 151.835 1.00 78.77  ? 596  LYS A CB  1 
ATOM   4427 C  CG  . LYS A 1 567 ? 80.148  117.118 152.429 1.00 78.50  ? 596  LYS A CG  1 
ATOM   4428 C  CD  . LYS A 1 567 ? 79.633  115.869 153.117 1.00 79.93  ? 596  LYS A CD  1 
ATOM   4429 C  CE  . LYS A 1 567 ? 78.147  116.016 153.452 1.00 81.05  ? 596  LYS A CE  1 
ATOM   4430 N  NZ  . LYS A 1 567 ? 77.745  115.216 154.643 1.00 80.74  ? 596  LYS A NZ  1 
ATOM   4431 N  N   . LYS A 1 568 ? 84.980  116.055 152.637 1.00 90.04  ? 597  LYS A N   1 
ATOM   4432 C  CA  . LYS A 1 568 ? 86.286  115.764 152.066 1.00 92.68  ? 597  LYS A CA  1 
ATOM   4433 C  C   . LYS A 1 568 ? 87.039  114.871 153.049 1.00 94.77  ? 597  LYS A C   1 
ATOM   4434 O  O   . LYS A 1 568 ? 86.658  114.776 154.216 1.00 94.70  ? 597  LYS A O   1 
ATOM   4435 C  CB  . LYS A 1 568 ? 87.088  117.051 151.880 1.00 104.79 ? 597  LYS A CB  1 
ATOM   4436 C  CG  . LYS A 1 568 ? 86.946  117.743 150.546 1.00 115.42 ? 597  LYS A CG  1 
ATOM   4437 C  CD  . LYS A 1 568 ? 86.700  119.241 150.718 1.00 122.62 ? 597  LYS A CD  1 
ATOM   4438 C  CE  . LYS A 1 568 ? 86.556  119.928 149.366 1.00 124.75 ? 597  LYS A CE  1 
ATOM   4439 N  NZ  . LYS A 1 568 ? 87.173  121.286 149.372 1.00 125.48 ? 597  LYS A NZ  1 
ATOM   4440 N  N   . MET A 1 569 ? 88.123  114.260 152.594 1.00 97.17  ? 598  MET A N   1 
ATOM   4441 C  CA  . MET A 1 569 ? 88.914  113.488 153.574 1.00 100.79 ? 598  MET A CA  1 
ATOM   4442 C  C   . MET A 1 569 ? 89.842  114.447 154.302 1.00 104.35 ? 598  MET A C   1 
ATOM   4443 O  O   . MET A 1 569 ? 89.856  115.652 154.000 1.00 104.37 ? 598  MET A O   1 
ATOM   4444 C  CB  . MET A 1 569 ? 89.615  112.348 152.862 1.00 95.32  ? 598  MET A CB  1 
ATOM   4445 C  CG  . MET A 1 569 ? 88.650  111.205 152.535 1.00 94.06  ? 598  MET A CG  1 
ATOM   4446 S  SD  . MET A 1 569 ? 88.670  109.940 153.819 1.00 83.18  ? 598  MET A SD  1 
ATOM   4447 C  CE  . MET A 1 569 ? 88.671  108.460 152.818 1.00 88.10  ? 598  MET A CE  1 
ATOM   4448 N  N   . ASP A 1 570 ? 90.555  113.984 155.318 1.00 107.42 ? 599  ASP A N   1 
ATOM   4449 C  CA  . ASP A 1 570 ? 91.439  114.840 156.100 1.00 110.27 ? 599  ASP A CA  1 
ATOM   4450 C  C   . ASP A 1 570 ? 92.869  114.786 155.570 1.00 112.54 ? 599  ASP A C   1 
ATOM   4451 O  O   . ASP A 1 570 ? 93.176  113.920 154.755 1.00 113.75 ? 599  ASP A O   1 
ATOM   4452 C  CB  . ASP A 1 570 ? 91.432  114.421 157.570 1.00 110.84 ? 599  ASP A CB  1 
ATOM   4453 C  CG  . ASP A 1 570 ? 90.573  115.332 158.422 1.00 106.22 ? 599  ASP A CG  1 
ATOM   4454 O  OD1 . ASP A 1 570 ? 90.072  116.328 157.866 1.00 106.40 ? 599  ASP A OD1 1 
ATOM   4455 O  OD2 . ASP A 1 570 ? 90.415  115.041 159.620 1.00 105.51 ? 599  ASP A OD2 1 
ATOM   4456 N  N   . PRO A 1 571 ? 93.720  115.676 156.058 1.00 113.33 ? 600  PRO A N   1 
ATOM   4457 C  CA  . PRO A 1 571 ? 95.099  115.786 155.648 1.00 114.07 ? 600  PRO A CA  1 
ATOM   4458 C  C   . PRO A 1 571 ? 95.877  114.484 155.559 1.00 114.19 ? 600  PRO A C   1 
ATOM   4459 O  O   . PRO A 1 571 ? 96.114  113.792 156.551 1.00 114.02 ? 600  PRO A O   1 
ATOM   4460 C  CB  . PRO A 1 571 ? 95.703  116.714 156.702 1.00 114.33 ? 600  PRO A CB  1 
ATOM   4461 C  CG  . PRO A 1 571 ? 94.566  117.603 157.076 1.00 113.85 ? 600  PRO A CG  1 
ATOM   4462 C  CD  . PRO A 1 571 ? 93.355  116.720 157.054 1.00 113.40 ? 600  PRO A CD  1 
ATOM   4463 N  N   . GLY A 1 572 ? 96.309  114.161 154.347 1.00 113.44 ? 601  GLY A N   1 
ATOM   4464 C  CA  . GLY A 1 572 ? 97.112  113.059 153.964 1.00 112.79 ? 601  GLY A CA  1 
ATOM   4465 C  C   . GLY A 1 572 ? 96.991  111.748 154.695 1.00 112.42 ? 601  GLY A C   1 
ATOM   4466 O  O   . GLY A 1 572 ? 97.848  111.380 155.506 1.00 112.37 ? 601  GLY A O   1 
ATOM   4467 N  N   . PHE A 1 573 ? 95.977  110.953 154.350 1.00 111.86 ? 602  PHE A N   1 
ATOM   4468 C  CA  . PHE A 1 573 ? 95.851  109.587 154.844 1.00 110.92 ? 602  PHE A CA  1 
ATOM   4469 C  C   . PHE A 1 573 ? 96.152  108.629 153.692 1.00 111.30 ? 602  PHE A C   1 
ATOM   4470 O  O   . PHE A 1 573 ? 96.430  109.206 152.645 1.00 110.40 ? 602  PHE A O   1 
ATOM   4471 C  CB  . PHE A 1 573 ? 94.464  109.281 155.383 1.00 100.90 ? 602  PHE A CB  1 
ATOM   4472 C  CG  . PHE A 1 573 ? 94.118  109.900 156.694 1.00 95.15  ? 602  PHE A CG  1 
ATOM   4473 C  CD1 . PHE A 1 573 ? 94.042  111.277 156.817 1.00 99.55  ? 602  PHE A CD1 1 
ATOM   4474 C  CD2 . PHE A 1 573 ? 93.855  109.111 157.799 1.00 91.73  ? 602  PHE A CD2 1 
ATOM   4475 C  CE1 . PHE A 1 573 ? 93.713  111.870 158.024 1.00 100.03 ? 602  PHE A CE1 1 
ATOM   4476 C  CE2 . PHE A 1 573 ? 93.529  109.694 159.007 1.00 94.44  ? 602  PHE A CE2 1 
ATOM   4477 C  CZ  . PHE A 1 573 ? 93.461  111.067 159.114 1.00 97.20  ? 602  PHE A CZ  1 
ATOM   4478 N  N   . PRO A 1 574 ? 96.193  107.337 153.889 1.00 112.85 ? 603  PRO A N   1 
ATOM   4479 C  CA  . PRO A 1 574 ? 95.807  106.619 155.068 1.00 115.02 ? 603  PRO A CA  1 
ATOM   4480 C  C   . PRO A 1 574 ? 96.878  106.489 156.142 1.00 118.17 ? 603  PRO A C   1 
ATOM   4481 O  O   . PRO A 1 574 ? 98.066  106.687 155.926 1.00 118.08 ? 603  PRO A O   1 
ATOM   4482 C  CB  . PRO A 1 574 ? 95.439  105.211 154.578 1.00 113.78 ? 603  PRO A CB  1 
ATOM   4483 C  CG  . PRO A 1 574 ? 96.371  105.017 153.429 1.00 112.47 ? 603  PRO A CG  1 
ATOM   4484 C  CD  . PRO A 1 574 ? 96.453  106.367 152.787 1.00 112.32 ? 603  PRO A CD  1 
ATOM   4485 N  N   . LYS A 1 575 ? 96.418  106.060 157.307 1.00 122.08 ? 604  LYS A N   1 
ATOM   4486 C  CA  . LYS A 1 575 ? 97.220  105.687 158.452 1.00 125.69 ? 604  LYS A CA  1 
ATOM   4487 C  C   . LYS A 1 575 ? 97.084  104.163 158.645 1.00 128.15 ? 604  LYS A C   1 
ATOM   4488 O  O   . LYS A 1 575 ? 96.306  103.533 157.929 1.00 128.11 ? 604  LYS A O   1 
ATOM   4489 C  CB  . LYS A 1 575 ? 96.788  106.393 159.729 1.00 129.90 ? 604  LYS A CB  1 
ATOM   4490 C  CG  . LYS A 1 575 ? 96.976  107.895 159.758 1.00 134.85 ? 604  LYS A CG  1 
ATOM   4491 C  CD  . LYS A 1 575 ? 97.120  108.408 161.184 1.00 138.79 ? 604  LYS A CD  1 
ATOM   4492 C  CE  . LYS A 1 575 ? 98.086  109.576 161.273 1.00 141.00 ? 604  LYS A CE  1 
ATOM   4493 N  NZ  . LYS A 1 575 ? 99.456  109.147 161.680 1.00 143.33 ? 604  LYS A NZ  1 
ATOM   4494 N  N   . LEU A 1 576 ? 97.796  103.627 159.617 1.00 130.59 ? 605  LEU A N   1 
ATOM   4495 C  CA  . LEU A 1 576 ? 97.788  102.197 159.895 1.00 133.46 ? 605  LEU A CA  1 
ATOM   4496 C  C   . LEU A 1 576 ? 96.848  101.831 161.034 1.00 135.72 ? 605  LEU A C   1 
ATOM   4497 O  O   . LEU A 1 576 ? 96.572  102.625 161.932 1.00 135.56 ? 605  LEU A O   1 
ATOM   4498 C  CB  . LEU A 1 576 ? 99.209  101.745 160.217 1.00 134.83 ? 605  LEU A CB  1 
ATOM   4499 C  CG  . LEU A 1 576 ? 99.827  100.591 159.442 1.00 135.13 ? 605  LEU A CG  1 
ATOM   4500 C  CD1 . LEU A 1 576 ? 99.342  99.251  159.986 1.00 135.39 ? 605  LEU A CD1 1 
ATOM   4501 C  CD2 . LEU A 1 576 ? 99.588  100.696 157.948 1.00 131.74 ? 605  LEU A CD2 1 
ATOM   4502 N  N   . ILE A 1 577 ? 96.395  100.577 161.031 1.00 138.34 ? 606  ILE A N   1 
ATOM   4503 C  CA  . ILE A 1 577 ? 95.504  100.085 162.070 1.00 141.84 ? 606  ILE A CA  1 
ATOM   4504 C  C   . ILE A 1 577 ? 96.248  99.921  163.394 1.00 143.79 ? 606  ILE A C   1 
ATOM   4505 O  O   . ILE A 1 577 ? 95.643  99.959  164.460 1.00 144.32 ? 606  ILE A O   1 
ATOM   4506 C  CB  . ILE A 1 577 ? 94.888  98.722  161.716 1.00 148.29 ? 606  ILE A CB  1 
ATOM   4507 C  CG1 . ILE A 1 577 ? 94.345  98.700  160.294 1.00 149.74 ? 606  ILE A CG1 1 
ATOM   4508 C  CG2 . ILE A 1 577 ? 93.808  98.349  162.721 1.00 150.11 ? 606  ILE A CG2 1 
ATOM   4509 C  CD1 . ILE A 1 577 ? 93.188  99.635  160.039 1.00 150.17 ? 606  ILE A CD1 1 
ATOM   4510 N  N   . ALA A 1 578 ? 97.545  99.664  163.290 1.00 145.35 ? 607  ALA A N   1 
ATOM   4511 C  CA  . ALA A 1 578 ? 98.398  99.469  164.453 1.00 146.66 ? 607  ALA A CA  1 
ATOM   4512 C  C   . ALA A 1 578 ? 99.097  100.767 164.842 1.00 147.48 ? 607  ALA A C   1 
ATOM   4513 O  O   . ALA A 1 578 ? 99.229  101.075 166.025 1.00 147.61 ? 607  ALA A O   1 
ATOM   4514 C  CB  . ALA A 1 578 ? 99.407  98.368  164.173 1.00 147.05 ? 607  ALA A CB  1 
ATOM   4515 N  N   . ASP A 1 579 ? 99.488  101.555 163.853 1.00 148.09 ? 608  ASP A N   1 
ATOM   4516 C  CA  . ASP A 1 579 ? 100.144 102.833 164.060 1.00 148.34 ? 608  ASP A CA  1 
ATOM   4517 C  C   . ASP A 1 579 ? 99.227  103.842 164.742 1.00 148.57 ? 608  ASP A C   1 
ATOM   4518 O  O   . ASP A 1 579 ? 99.705  104.756 165.412 1.00 148.72 ? 608  ASP A O   1 
ATOM   4519 C  CB  . ASP A 1 579 ? 100.611 103.420 162.727 1.00 151.12 ? 608  ASP A CB  1 
ATOM   4520 C  CG  . ASP A 1 579 ? 102.075 103.207 162.430 1.00 152.31 ? 608  ASP A CG  1 
ATOM   4521 O  OD1 . ASP A 1 579 ? 102.605 102.139 162.801 1.00 153.57 ? 608  ASP A OD1 1 
ATOM   4522 O  OD2 . ASP A 1 579 ? 102.696 104.108 161.821 1.00 152.82 ? 608  ASP A OD2 1 
ATOM   4523 N  N   . ALA A 1 580 ? 97.918  103.730 164.536 1.00 148.89 ? 609  ALA A N   1 
ATOM   4524 C  CA  . ALA A 1 580 ? 96.988  104.688 165.132 1.00 149.22 ? 609  ALA A CA  1 
ATOM   4525 C  C   . ALA A 1 580 ? 96.153  104.063 166.239 1.00 149.11 ? 609  ALA A C   1 
ATOM   4526 O  O   . ALA A 1 580 ? 95.548  104.764 167.053 1.00 148.71 ? 609  ALA A O   1 
ATOM   4527 C  CB  . ALA A 1 580 ? 96.098  105.286 164.060 1.00 151.64 ? 609  ALA A CB  1 
ATOM   4528 N  N   . TRP A 1 581 ? 96.076  102.736 166.231 1.00 149.32 ? 610  TRP A N   1 
ATOM   4529 C  CA  . TRP A 1 581 ? 95.340  102.013 167.267 1.00 149.67 ? 610  TRP A CA  1 
ATOM   4530 C  C   . TRP A 1 581 ? 96.275  100.969 167.876 1.00 150.35 ? 610  TRP A C   1 
ATOM   4531 O  O   . TRP A 1 581 ? 97.027  100.304 167.164 1.00 150.67 ? 610  TRP A O   1 
ATOM   4532 C  CB  . TRP A 1 581 ? 94.073  101.369 166.748 1.00 142.41 ? 610  TRP A CB  1 
ATOM   4533 C  CG  . TRP A 1 581 ? 93.225  102.205 165.845 1.00 138.98 ? 610  TRP A CG  1 
ATOM   4534 C  CD1 . TRP A 1 581 ? 93.236  102.185 164.477 1.00 136.75 ? 610  TRP A CD1 1 
ATOM   4535 C  CD2 . TRP A 1 581 ? 92.243  103.183 166.214 1.00 134.85 ? 610  TRP A CD2 1 
ATOM   4536 N  NE1 . TRP A 1 581 ? 92.325  103.087 163.984 1.00 131.79 ? 610  TRP A NE1 1 
ATOM   4537 C  CE2 . TRP A 1 581 ? 91.705  103.714 165.026 1.00 129.74 ? 610  TRP A CE2 1 
ATOM   4538 C  CE3 . TRP A 1 581 ? 91.765  103.666 167.435 1.00 134.26 ? 610  TRP A CE3 1 
ATOM   4539 C  CZ2 . TRP A 1 581 ? 90.716  104.693 165.021 1.00 128.22 ? 610  TRP A CZ2 1 
ATOM   4540 C  CZ3 . TRP A 1 581 ? 90.784  104.644 167.425 1.00 131.92 ? 610  TRP A CZ3 1 
ATOM   4541 C  CH2 . TRP A 1 581 ? 90.269  105.145 166.225 1.00 127.96 ? 610  TRP A CH2 1 
ATOM   4542 N  N   . ASN A 1 582 ? 96.270  100.860 169.195 1.00 150.67 ? 611  ASN A N   1 
ATOM   4543 C  CA  . ASN A 1 582 ? 97.211  99.967  169.854 1.00 151.10 ? 611  ASN A CA  1 
ATOM   4544 C  C   . ASN A 1 582 ? 96.917  98.488  169.646 1.00 150.15 ? 611  ASN A C   1 
ATOM   4545 O  O   . ASN A 1 582 ? 97.852  97.707  169.414 1.00 150.93 ? 611  ASN A O   1 
ATOM   4546 C  CB  . ASN A 1 582 ? 97.221  100.253 171.343 1.00 161.78 ? 611  ASN A CB  1 
ATOM   4547 C  CG  . ASN A 1 582 ? 98.408  100.931 171.948 1.00 165.71 ? 611  ASN A CG  1 
ATOM   4548 O  OD1 . ASN A 1 582 ? 99.248  101.541 171.287 1.00 166.91 ? 611  ASN A OD1 1 
ATOM   4549 N  ND2 . ASN A 1 582 ? 98.493  100.835 173.281 1.00 167.16 ? 611  ASN A ND2 1 
ATOM   4550 N  N   . ALA A 1 583 ? 95.668  98.070  169.856 1.00 147.93 ? 612  ALA A N   1 
ATOM   4551 C  CA  . ALA A 1 583 ? 95.362  96.651  169.949 1.00 144.78 ? 612  ALA A CA  1 
ATOM   4552 C  C   . ALA A 1 583 ? 94.511  96.052  168.854 1.00 141.66 ? 612  ALA A C   1 
ATOM   4553 O  O   . ALA A 1 583 ? 94.109  94.885  168.970 1.00 141.86 ? 612  ALA A O   1 
ATOM   4554 C  CB  . ALA A 1 583 ? 94.647  96.425  171.296 1.00 147.21 ? 612  ALA A CB  1 
ATOM   4555 N  N   . ILE A 1 584 ? 94.248  96.783  167.802 1.00 138.30 ? 613  ILE A N   1 
ATOM   4556 C  CA  . ILE A 1 584 ? 93.333  96.443  166.734 1.00 134.26 ? 613  ILE A CA  1 
ATOM   4557 C  C   . ILE A 1 584 ? 93.899  95.622  165.597 1.00 131.76 ? 613  ILE A C   1 
ATOM   4558 O  O   . ILE A 1 584 ? 94.769  96.084  164.848 1.00 132.12 ? 613  ILE A O   1 
ATOM   4559 C  CB  . ILE A 1 584 ? 92.827  97.795  166.145 1.00 128.70 ? 613  ILE A CB  1 
ATOM   4560 C  CG1 . ILE A 1 584 ? 92.360  98.713  167.262 1.00 127.34 ? 613  ILE A CG1 1 
ATOM   4561 C  CG2 . ILE A 1 584 ? 91.779  97.563  165.093 1.00 128.77 ? 613  ILE A CG2 1 
ATOM   4562 C  CD1 . ILE A 1 584 ? 91.219  98.251  168.120 1.00 124.98 ? 613  ILE A CD1 1 
ATOM   4563 N  N   . PRO A 1 585 ? 93.367  94.430  165.364 1.00 129.31 ? 614  PRO A N   1 
ATOM   4564 C  CA  . PRO A 1 585 ? 93.783  93.583  164.261 1.00 127.27 ? 614  PRO A CA  1 
ATOM   4565 C  C   . PRO A 1 585 ? 93.368  94.186  162.927 1.00 125.10 ? 614  PRO A C   1 
ATOM   4566 O  O   . PRO A 1 585 ? 92.284  94.742  162.800 1.00 124.41 ? 614  PRO A O   1 
ATOM   4567 C  CB  . PRO A 1 585 ? 93.045  92.267  164.478 1.00 127.74 ? 614  PRO A CB  1 
ATOM   4568 C  CG  . PRO A 1 585 ? 92.574  92.309  165.883 1.00 128.39 ? 614  PRO A CG  1 
ATOM   4569 C  CD  . PRO A 1 585 ? 92.318  93.772  166.181 1.00 128.97 ? 614  PRO A CD  1 
ATOM   4570 N  N   . ASP A 1 586 ? 94.238  94.071  161.940 1.00 124.15 ? 615  ASP A N   1 
ATOM   4571 C  CA  . ASP A 1 586 ? 93.948  94.569  160.601 1.00 123.07 ? 615  ASP A CA  1 
ATOM   4572 C  C   . ASP A 1 586 ? 93.045  93.580  159.865 1.00 121.04 ? 615  ASP A C   1 
ATOM   4573 O  O   . ASP A 1 586 ? 93.123  92.373  160.094 1.00 120.58 ? 615  ASP A O   1 
ATOM   4574 C  CB  . ASP A 1 586 ? 95.245  94.776  159.819 1.00 127.18 ? 615  ASP A CB  1 
ATOM   4575 C  CG  . ASP A 1 586 ? 96.208  95.728  160.494 1.00 125.13 ? 615  ASP A CG  1 
ATOM   4576 O  OD1 . ASP A 1 586 ? 95.943  96.155  161.636 1.00 124.34 ? 615  ASP A OD1 1 
ATOM   4577 O  OD2 . ASP A 1 586 ? 97.239  96.043  159.865 1.00 127.09 ? 615  ASP A OD2 1 
ATOM   4578 N  N   . ASN A 1 587 ? 92.196  94.100  158.980 1.00 118.96 ? 616  ASN A N   1 
ATOM   4579 C  CA  . ASN A 1 587 ? 91.265  93.237  158.255 1.00 115.75 ? 616  ASN A CA  1 
ATOM   4580 C  C   . ASN A 1 587 ? 90.137  92.792  159.180 1.00 112.97 ? 616  ASN A C   1 
ATOM   4581 O  O   . ASN A 1 587 ? 89.559  91.721  159.027 1.00 113.10 ? 616  ASN A O   1 
ATOM   4582 C  CB  . ASN A 1 587 ? 91.995  92.017  157.689 1.00 114.01 ? 616  ASN A CB  1 
ATOM   4583 C  CG  . ASN A 1 587 ? 92.815  92.411  156.473 1.00 116.14 ? 616  ASN A CG  1 
ATOM   4584 O  OD1 . ASN A 1 587 ? 92.266  93.002  155.543 1.00 118.86 ? 616  ASN A OD1 1 
ATOM   4585 N  ND2 . ASN A 1 587 ? 94.100  92.106  156.491 1.00 117.11 ? 616  ASN A ND2 1 
ATOM   4586 N  N   . LEU A 1 588 ? 89.883  93.637  160.166 1.00 109.91 ? 617  LEU A N   1 
ATOM   4587 C  CA  . LEU A 1 588 ? 88.802  93.398  161.116 1.00 107.12 ? 617  LEU A CA  1 
ATOM   4588 C  C   . LEU A 1 588 ? 87.502  93.812  160.432 1.00 104.88 ? 617  LEU A C   1 
ATOM   4589 O  O   . LEU A 1 588 ? 87.559  94.646  159.525 1.00 104.63 ? 617  LEU A O   1 
ATOM   4590 C  CB  . LEU A 1 588 ? 89.060  94.173  162.393 1.00 106.84 ? 617  LEU A CB  1 
ATOM   4591 C  CG  . LEU A 1 588 ? 89.003  95.698  162.308 1.00 102.83 ? 617  LEU A CG  1 
ATOM   4592 C  CD1 . LEU A 1 588 ? 89.222  96.317  163.676 1.00 103.14 ? 617  LEU A CD1 1 
ATOM   4593 C  CD2 . LEU A 1 588 ? 90.003  96.230  161.299 1.00 105.48 ? 617  LEU A CD2 1 
ATOM   4594 N  N   . ASP A 1 589 ? 86.376  93.209  160.776 1.00 102.90 ? 618  ASP A N   1 
ATOM   4595 C  CA  . ASP A 1 589 ? 85.136  93.470  160.086 1.00 101.32 ? 618  ASP A CA  1 
ATOM   4596 C  C   . ASP A 1 589 ? 84.259  94.546  160.637 1.00 100.78 ? 618  ASP A C   1 
ATOM   4597 O  O   . ASP A 1 589 ? 83.605  95.255  159.831 1.00 100.65 ? 618  ASP A O   1 
ATOM   4598 C  CB  . ASP A 1 589 ? 84.325  92.183  159.876 1.00 99.04  ? 618  ASP A CB  1 
ATOM   4599 C  CG  . ASP A 1 589 ? 84.973  91.006  160.574 1.00 96.27  ? 618  ASP A CG  1 
ATOM   4600 O  OD1 . ASP A 1 589 ? 85.447  91.229  161.704 1.00 98.72  ? 618  ASP A OD1 1 
ATOM   4601 O  OD2 . ASP A 1 589 ? 84.988  89.914  159.986 1.00 95.74  ? 618  ASP A OD2 1 
ATOM   4602 N  N   . ALA A 1 590 ? 84.063  94.804  161.927 1.00 100.83 ? 619  ALA A N   1 
ATOM   4603 C  CA  . ALA A 1 590 ? 83.098  95.916  162.134 1.00 101.54 ? 619  ALA A CA  1 
ATOM   4604 C  C   . ALA A 1 590 ? 83.473  96.796  163.292 1.00 102.31 ? 619  ALA A C   1 
ATOM   4605 O  O   . ALA A 1 590 ? 84.340  96.444  164.087 1.00 102.61 ? 619  ALA A O   1 
ATOM   4606 C  CB  . ALA A 1 590 ? 81.701  95.356  162.232 1.00 102.34 ? 619  ALA A CB  1 
ATOM   4607 N  N   . VAL A 1 591 ? 82.848  97.966  163.349 1.00 103.40 ? 620  VAL A N   1 
ATOM   4608 C  CA  . VAL A 1 591 ? 83.055  98.918  164.416 1.00 106.02 ? 620  VAL A CA  1 
ATOM   4609 C  C   . VAL A 1 591 ? 81.740  99.609  164.764 1.00 109.00 ? 620  VAL A C   1 
ATOM   4610 O  O   . VAL A 1 591 ? 80.976  100.035 163.909 1.00 108.69 ? 620  VAL A O   1 
ATOM   4611 C  CB  . VAL A 1 591 ? 84.101  99.999  164.108 1.00 103.99 ? 620  VAL A CB  1 
ATOM   4612 C  CG1 . VAL A 1 591 ? 84.279  100.877 165.346 1.00 106.70 ? 620  VAL A CG1 1 
ATOM   4613 C  CG2 . VAL A 1 591 ? 85.437  99.415  163.687 1.00 100.08 ? 620  VAL A CG2 1 
ATOM   4614 N  N   . VAL A 1 592 ? 81.476  99.721  166.057 1.00 113.14 ? 621  VAL A N   1 
ATOM   4615 C  CA  . VAL A 1 592 ? 80.226  100.361 166.472 1.00 118.32 ? 621  VAL A CA  1 
ATOM   4616 C  C   . VAL A 1 592 ? 80.460  101.142 167.756 1.00 123.22 ? 621  VAL A C   1 
ATOM   4617 O  O   . VAL A 1 592 ? 81.072  100.614 168.690 1.00 124.04 ? 621  VAL A O   1 
ATOM   4618 C  CB  . VAL A 1 592 ? 79.118  99.312  166.654 1.00 113.92 ? 621  VAL A CB  1 
ATOM   4619 C  CG1 . VAL A 1 592 ? 79.319  98.504  167.924 1.00 114.64 ? 621  VAL A CG1 1 
ATOM   4620 C  CG2 . VAL A 1 592 ? 77.756  99.987  166.662 1.00 116.02 ? 621  VAL A CG2 1 
ATOM   4621 N  N   . ASP A 1 593 ? 80.030  102.396 167.781 1.00 126.88 ? 622  ASP A N   1 
ATOM   4622 C  CA  . ASP A 1 593 ? 80.138  103.216 168.990 1.00 131.62 ? 622  ASP A CA  1 
ATOM   4623 C  C   . ASP A 1 593 ? 78.757  103.744 169.367 1.00 135.45 ? 622  ASP A C   1 
ATOM   4624 O  O   . ASP A 1 593 ? 78.332  104.795 168.889 1.00 135.65 ? 622  ASP A O   1 
ATOM   4625 C  CB  . ASP A 1 593 ? 81.135  104.344 168.814 1.00 132.19 ? 622  ASP A CB  1 
ATOM   4626 C  CG  . ASP A 1 593 ? 81.138  105.406 169.889 1.00 131.43 ? 622  ASP A CG  1 
ATOM   4627 O  OD1 . ASP A 1 593 ? 80.753  105.124 171.043 1.00 131.26 ? 622  ASP A OD1 1 
ATOM   4628 O  OD2 . ASP A 1 593 ? 81.536  106.564 169.608 1.00 128.14 ? 622  ASP A OD2 1 
ATOM   4629 N  N   . LEU A 1 594 ? 78.036  102.989 170.196 1.00 138.90 ? 623  LEU A N   1 
ATOM   4630 C  CA  . LEU A 1 594 ? 76.694  103.415 170.580 1.00 143.03 ? 623  LEU A CA  1 
ATOM   4631 C  C   . LEU A 1 594 ? 76.722  104.846 171.116 1.00 146.58 ? 623  LEU A C   1 
ATOM   4632 O  O   . LEU A 1 594 ? 77.642  105.219 171.839 1.00 147.16 ? 623  LEU A O   1 
ATOM   4633 C  CB  . LEU A 1 594 ? 76.053  102.488 171.589 1.00 143.48 ? 623  LEU A CB  1 
ATOM   4634 C  CG  . LEU A 1 594 ? 76.886  101.419 172.276 1.00 144.40 ? 623  LEU A CG  1 
ATOM   4635 C  CD1 . LEU A 1 594 ? 77.239  100.303 171.305 1.00 143.80 ? 623  LEU A CD1 1 
ATOM   4636 C  CD2 . LEU A 1 594 ? 78.132  101.999 172.927 1.00 144.74 ? 623  LEU A CD2 1 
ATOM   4637 N  N   . GLN A 1 595 ? 75.704  105.630 170.779 1.00 149.61 ? 624  GLN A N   1 
ATOM   4638 C  CA  . GLN A 1 595 ? 75.624  107.010 171.246 1.00 153.00 ? 624  GLN A CA  1 
ATOM   4639 C  C   . GLN A 1 595 ? 75.354  107.087 172.740 1.00 155.48 ? 624  GLN A C   1 
ATOM   4640 O  O   . GLN A 1 595 ? 74.453  106.416 173.250 1.00 156.04 ? 624  GLN A O   1 
ATOM   4641 C  CB  . GLN A 1 595 ? 74.539  107.781 170.479 1.00 154.64 ? 624  GLN A CB  1 
ATOM   4642 C  CG  . GLN A 1 595 ? 73.157  107.701 171.069 1.00 158.69 ? 624  GLN A CG  1 
ATOM   4643 C  CD  . GLN A 1 595 ? 72.301  108.933 170.992 1.00 161.73 ? 624  GLN A CD  1 
ATOM   4644 O  OE1 . GLN A 1 595 ? 72.758  110.069 170.886 1.00 163.62 ? 624  GLN A OE1 1 
ATOM   4645 N  NE2 . GLN A 1 595 ? 70.979  108.739 171.055 1.00 163.61 ? 624  GLN A NE2 1 
ATOM   4646 N  N   . GLY A 1 596 ? 76.118  107.901 173.470 1.00 157.16 ? 625  GLY A N   1 
ATOM   4647 C  CA  . GLY A 1 596 ? 75.837  108.147 174.865 1.00 158.78 ? 625  GLY A CA  1 
ATOM   4648 C  C   . GLY A 1 596 ? 76.572  107.318 175.883 1.00 159.53 ? 625  GLY A C   1 
ATOM   4649 O  O   . GLY A 1 596 ? 76.340  107.462 177.093 1.00 160.74 ? 625  GLY A O   1 
ATOM   4650 N  N   . GLY A 1 597 ? 77.444  106.431 175.447 1.00 158.83 ? 626  GLY A N   1 
ATOM   4651 C  CA  . GLY A 1 597 ? 78.269  105.635 176.363 1.00 157.93 ? 626  GLY A CA  1 
ATOM   4652 C  C   . GLY A 1 597 ? 79.651  105.555 175.696 1.00 157.29 ? 626  GLY A C   1 
ATOM   4653 O  O   . GLY A 1 597 ? 79.771  104.896 174.667 1.00 157.79 ? 626  GLY A O   1 
ATOM   4654 N  N   . GLY A 1 598 ? 80.600  106.330 176.193 1.00 156.05 ? 627  GLY A N   1 
ATOM   4655 C  CA  . GLY A 1 598 ? 81.930  106.385 175.616 1.00 153.88 ? 627  GLY A CA  1 
ATOM   4656 C  C   . GLY A 1 598 ? 82.616  105.023 175.597 1.00 152.03 ? 627  GLY A C   1 
ATOM   4657 O  O   . GLY A 1 598 ? 83.471  104.753 176.438 1.00 152.46 ? 627  GLY A O   1 
ATOM   4658 N  N   . HIS A 1 599 ? 82.348  104.240 174.568 1.00 149.78 ? 628  HIS A N   1 
ATOM   4659 C  CA  . HIS A 1 599 ? 82.940  102.922 174.362 1.00 146.49 ? 628  HIS A CA  1 
ATOM   4660 C  C   . HIS A 1 599 ? 82.857  102.556 172.874 1.00 142.71 ? 628  HIS A C   1 
ATOM   4661 O  O   . HIS A 1 599 ? 81.759  102.583 172.308 1.00 143.82 ? 628  HIS A O   1 
ATOM   4662 C  CB  . HIS A 1 599 ? 82.223  101.872 175.198 1.00 154.75 ? 628  HIS A CB  1 
ATOM   4663 C  CG  . HIS A 1 599 ? 82.965  101.250 176.330 1.00 156.53 ? 628  HIS A CG  1 
ATOM   4664 N  ND1 . HIS A 1 599 ? 83.388  99.935  176.316 1.00 157.54 ? 628  HIS A ND1 1 
ATOM   4665 C  CD2 . HIS A 1 599 ? 83.347  101.742 177.533 1.00 157.16 ? 628  HIS A CD2 1 
ATOM   4666 C  CE1 . HIS A 1 599 ? 84.003  99.656  177.449 1.00 158.07 ? 628  HIS A CE1 1 
ATOM   4667 N  NE2 . HIS A 1 599 ? 83.991  100.736 178.207 1.00 156.86 ? 628  HIS A NE2 1 
ATOM   4668 N  N   . SER A 1 600 ? 83.987  102.260 172.249 1.00 137.32 ? 629  SER A N   1 
ATOM   4669 C  CA  . SER A 1 600 ? 84.059  101.899 170.837 1.00 130.08 ? 629  SER A CA  1 
ATOM   4670 C  C   . SER A 1 600 ? 84.422  100.428 170.650 1.00 124.16 ? 629  SER A C   1 
ATOM   4671 O  O   . SER A 1 600 ? 85.565  100.044 170.907 1.00 124.80 ? 629  SER A O   1 
ATOM   4672 C  CB  . SER A 1 600 ? 85.106  102.757 170.118 1.00 127.13 ? 629  SER A CB  1 
ATOM   4673 O  OG  . SER A 1 600 ? 85.329  103.980 170.782 1.00 125.20 ? 629  SER A OG  1 
ATOM   4674 N  N   . TYR A 1 601 ? 83.494  99.607  170.176 1.00 117.69 ? 630  TYR A N   1 
ATOM   4675 C  CA  . TYR A 1 601 ? 83.763  98.172  170.052 1.00 111.99 ? 630  TYR A CA  1 
ATOM   4676 C  C   . TYR A 1 601 ? 84.109  97.766  168.633 1.00 106.51 ? 630  TYR A C   1 
ATOM   4677 O  O   . TYR A 1 601 ? 83.472  98.175  167.663 1.00 106.77 ? 630  TYR A O   1 
ATOM   4678 C  CB  . TYR A 1 601 ? 82.610  97.353  170.631 1.00 112.68 ? 630  TYR A CB  1 
ATOM   4679 C  CG  . TYR A 1 601 ? 81.889  98.022  171.788 1.00 112.70 ? 630  TYR A CG  1 
ATOM   4680 C  CD1 . TYR A 1 601 ? 81.000  99.071  171.556 1.00 112.83 ? 630  TYR A CD1 1 
ATOM   4681 C  CD2 . TYR A 1 601 ? 82.081  97.615  173.099 1.00 111.85 ? 630  TYR A CD2 1 
ATOM   4682 C  CE1 . TYR A 1 601 ? 80.341  99.697  172.592 1.00 112.72 ? 630  TYR A CE1 1 
ATOM   4683 C  CE2 . TYR A 1 601 ? 81.426  98.237  174.145 1.00 112.10 ? 630  TYR A CE2 1 
ATOM   4684 C  CZ  . TYR A 1 601 ? 80.555  99.277  173.887 1.00 112.94 ? 630  TYR A CZ  1 
ATOM   4685 O  OH  . TYR A 1 601 ? 79.897  99.897  174.927 1.00 113.40 ? 630  TYR A OH  1 
ATOM   4686 N  N   . PHE A 1 602 ? 85.230  97.078  168.473 1.00 100.32 ? 631  PHE A N   1 
ATOM   4687 C  CA  . PHE A 1 602 ? 85.754  96.665  167.179 1.00 94.42  ? 631  PHE A CA  1 
ATOM   4688 C  C   . PHE A 1 602 ? 85.570  95.154  167.044 1.00 90.39  ? 631  PHE A C   1 
ATOM   4689 O  O   . PHE A 1 602 ? 85.977  94.401  167.924 1.00 89.79  ? 631  PHE A O   1 
ATOM   4690 C  CB  . PHE A 1 602 ? 87.228  97.035  167.049 1.00 93.35  ? 631  PHE A CB  1 
ATOM   4691 C  CG  . PHE A 1 602 ? 87.559  98.492  166.976 1.00 94.29  ? 631  PHE A CG  1 
ATOM   4692 C  CD1 . PHE A 1 602 ? 86.792  99.478  167.564 1.00 96.36  ? 631  PHE A CD1 1 
ATOM   4693 C  CD2 . PHE A 1 602 ? 88.695  98.893  166.283 1.00 95.47  ? 631  PHE A CD2 1 
ATOM   4694 C  CE1 . PHE A 1 602 ? 87.120  100.816 167.479 1.00 94.89  ? 631  PHE A CE1 1 
ATOM   4695 C  CE2 . PHE A 1 602 ? 89.039  100.222 166.190 1.00 93.80  ? 631  PHE A CE2 1 
ATOM   4696 C  CZ  . PHE A 1 602 ? 88.253  101.187 166.785 1.00 95.15  ? 631  PHE A CZ  1 
ATOM   4697 N  N   . PHE A 1 603 ? 84.902  94.712  165.988 1.00 87.71  ? 632  PHE A N   1 
ATOM   4698 C  CA  . PHE A 1 603 ? 84.554  93.307  165.835 1.00 85.05  ? 632  PHE A CA  1 
ATOM   4699 C  C   . PHE A 1 603 ? 85.429  92.547  164.853 1.00 83.07  ? 632  PHE A C   1 
ATOM   4700 O  O   . PHE A 1 603 ? 85.742  93.031  163.768 1.00 82.04  ? 632  PHE A O   1 
ATOM   4701 C  CB  . PHE A 1 603 ? 83.091  93.173  165.394 1.00 76.45  ? 632  PHE A CB  1 
ATOM   4702 C  CG  . PHE A 1 603 ? 82.121  94.046  166.127 1.00 67.93  ? 632  PHE A CG  1 
ATOM   4703 C  CD1 . PHE A 1 603 ? 82.205  95.418  166.114 1.00 70.18  ? 632  PHE A CD1 1 
ATOM   4704 C  CD2 . PHE A 1 603 ? 81.085  93.464  166.843 1.00 66.35  ? 632  PHE A CD2 1 
ATOM   4705 C  CE1 . PHE A 1 603 ? 81.305  96.217  166.790 1.00 73.67  ? 632  PHE A CE1 1 
ATOM   4706 C  CE2 . PHE A 1 603 ? 80.189  94.259  167.520 1.00 70.77  ? 632  PHE A CE2 1 
ATOM   4707 C  CZ  . PHE A 1 603 ? 80.283  95.634  167.505 1.00 64.64  ? 632  PHE A CZ  1 
ATOM   4708 N  N   . LYS A 1 604 ? 85.773  91.312  165.213 1.00 82.45  ? 633  LYS A N   1 
ATOM   4709 C  CA  . LYS A 1 604 ? 86.538  90.462  164.304 1.00 83.74  ? 633  LYS A CA  1 
ATOM   4710 C  C   . LYS A 1 604 ? 86.198  89.003  164.568 1.00 85.47  ? 633  LYS A C   1 
ATOM   4711 O  O   . LYS A 1 604 ? 85.793  88.653  165.682 1.00 84.94  ? 633  LYS A O   1 
ATOM   4712 C  CB  . LYS A 1 604 ? 88.028  90.726  164.343 1.00 88.16  ? 633  LYS A CB  1 
ATOM   4713 C  CG  . LYS A 1 604 ? 88.842  89.944  163.321 1.00 89.08  ? 633  LYS A CG  1 
ATOM   4714 C  CD  . LYS A 1 604 ? 88.353  90.198  161.915 1.00 92.49  ? 633  LYS A CD  1 
ATOM   4715 C  CE  . LYS A 1 604 ? 88.552  89.008  160.993 1.00 95.02  ? 633  LYS A CE  1 
ATOM   4716 N  NZ  . LYS A 1 604 ? 88.460  89.423  159.558 1.00 95.20  ? 633  LYS A NZ  1 
ATOM   4717 N  N   . GLY A 1 605 ? 86.221  88.189  163.510 1.00 88.10  ? 634  GLY A N   1 
ATOM   4718 C  CA  . GLY A 1 605 ? 85.734  86.804  163.713 1.00 93.00  ? 634  GLY A CA  1 
ATOM   4719 C  C   . GLY A 1 605 ? 84.384  86.906  164.443 1.00 96.53  ? 634  GLY A C   1 
ATOM   4720 O  O   . GLY A 1 605 ? 83.593  87.824  164.179 1.00 96.86  ? 634  GLY A O   1 
ATOM   4721 N  N   . ALA A 1 606 ? 84.111  86.005  165.387 1.00 98.62  ? 635  ALA A N   1 
ATOM   4722 C  CA  . ALA A 1 606 ? 82.832  86.089  166.097 1.00 100.59 ? 635  ALA A CA  1 
ATOM   4723 C  C   . ALA A 1 606 ? 82.949  86.904  167.371 1.00 101.84 ? 635  ALA A C   1 
ATOM   4724 O  O   . ALA A 1 606 ? 81.987  87.031  168.128 1.00 101.47 ? 635  ALA A O   1 
ATOM   4725 C  CB  . ALA A 1 606 ? 82.318  84.686  166.420 1.00 98.95  ? 635  ALA A CB  1 
ATOM   4726 N  N   . TYR A 1 607 ? 84.144  87.416  167.676 1.00 103.22 ? 636  TYR A N   1 
ATOM   4727 C  CA  . TYR A 1 607 ? 84.311  88.050  168.991 1.00 105.78 ? 636  TYR A CA  1 
ATOM   4728 C  C   . TYR A 1 607 ? 84.915  89.437  168.866 1.00 106.28 ? 636  TYR A C   1 
ATOM   4729 O  O   . TYR A 1 607 ? 85.745  89.689  167.991 1.00 105.39 ? 636  TYR A O   1 
ATOM   4730 C  CB  . TYR A 1 607 ? 85.035  87.100  169.925 1.00 108.62 ? 636  TYR A CB  1 
ATOM   4731 C  CG  . TYR A 1 607 ? 85.271  85.665  169.524 1.00 113.70 ? 636  TYR A CG  1 
ATOM   4732 C  CD1 . TYR A 1 607 ? 86.091  85.330  168.454 1.00 116.36 ? 636  TYR A CD1 1 
ATOM   4733 C  CD2 . TYR A 1 607 ? 84.701  84.600  170.218 1.00 116.37 ? 636  TYR A CD2 1 
ATOM   4734 C  CE1 . TYR A 1 607 ? 86.323  84.022  168.083 1.00 119.15 ? 636  TYR A CE1 1 
ATOM   4735 C  CE2 . TYR A 1 607 ? 84.923  83.282  169.860 1.00 118.74 ? 636  TYR A CE2 1 
ATOM   4736 C  CZ  . TYR A 1 607 ? 85.739  82.992  168.790 1.00 121.11 ? 636  TYR A CZ  1 
ATOM   4737 O  OH  . TYR A 1 607 ? 85.964  81.681  168.425 1.00 124.24 ? 636  TYR A OH  1 
ATOM   4738 N  N   . TYR A 1 608 ? 84.463  90.391  169.679 1.00 108.41 ? 637  TYR A N   1 
ATOM   4739 C  CA  . TYR A 1 608 ? 84.852  91.784  169.628 1.00 111.37 ? 637  TYR A CA  1 
ATOM   4740 C  C   . TYR A 1 608 ? 85.810  92.255  170.716 1.00 115.75 ? 637  TYR A C   1 
ATOM   4741 O  O   . TYR A 1 608 ? 86.123  91.532  171.650 1.00 116.70 ? 637  TYR A O   1 
ATOM   4742 C  CB  . TYR A 1 608 ? 83.612  92.679  169.719 1.00 109.17 ? 637  TYR A CB  1 
ATOM   4743 C  CG  . TYR A 1 608 ? 82.947  92.761  171.067 1.00 107.80 ? 637  TYR A CG  1 
ATOM   4744 C  CD1 . TYR A 1 608 ? 82.001  91.820  171.447 1.00 108.47 ? 637  TYR A CD1 1 
ATOM   4745 C  CD2 . TYR A 1 608 ? 83.211  93.782  171.968 1.00 107.26 ? 637  TYR A CD2 1 
ATOM   4746 C  CE1 . TYR A 1 608 ? 81.357  91.885  172.667 1.00 109.52 ? 637  TYR A CE1 1 
ATOM   4747 C  CE2 . TYR A 1 608 ? 82.574  93.855  173.196 1.00 107.93 ? 637  TYR A CE2 1 
ATOM   4748 C  CZ  . TYR A 1 608 ? 81.644  92.902  173.549 1.00 109.46 ? 637  TYR A CZ  1 
ATOM   4749 O  OH  . TYR A 1 608 ? 80.991  92.950  174.762 1.00 110.05 ? 637  TYR A OH  1 
ATOM   4750 N  N   . LEU A 1 609 ? 86.202  93.522  170.644 1.00 120.55 ? 638  LEU A N   1 
ATOM   4751 C  CA  . LEU A 1 609 ? 87.065  94.178  171.616 1.00 126.55 ? 638  LEU A CA  1 
ATOM   4752 C  C   . LEU A 1 609 ? 86.515  95.557  171.957 1.00 131.95 ? 638  LEU A C   1 
ATOM   4753 O  O   . LEU A 1 609 ? 86.065  96.258  171.044 1.00 133.39 ? 638  LEU A O   1 
ATOM   4754 C  CB  . LEU A 1 609 ? 88.474  94.365  171.047 1.00 126.24 ? 638  LEU A CB  1 
ATOM   4755 C  CG  . LEU A 1 609 ? 89.612  93.654  171.777 1.00 126.01 ? 638  LEU A CG  1 
ATOM   4756 C  CD1 . LEU A 1 609 ? 90.902  93.860  171.002 1.00 124.95 ? 638  LEU A CD1 1 
ATOM   4757 C  CD2 . LEU A 1 609 ? 89.788  94.210  173.184 1.00 128.43 ? 638  LEU A CD2 1 
ATOM   4758 N  N   . LYS A 1 610 ? 86.582  95.996  173.214 1.00 136.50 ? 639  LYS A N   1 
ATOM   4759 C  CA  . LYS A 1 610 ? 85.984  97.321  173.461 1.00 142.08 ? 639  LYS A CA  1 
ATOM   4760 C  C   . LYS A 1 610 ? 87.014  98.425  173.593 1.00 145.47 ? 639  LYS A C   1 
ATOM   4761 O  O   . LYS A 1 610 ? 88.172  98.212  173.209 1.00 145.80 ? 639  LYS A O   1 
ATOM   4762 C  CB  . LYS A 1 610 ? 84.979  97.290  174.576 1.00 152.16 ? 639  LYS A CB  1 
ATOM   4763 C  CG  . LYS A 1 610 ? 85.302  96.489  175.811 1.00 160.18 ? 639  LYS A CG  1 
ATOM   4764 C  CD  . LYS A 1 610 ? 84.112  96.492  176.751 1.00 164.98 ? 639  LYS A CD  1 
ATOM   4765 C  CE  . LYS A 1 610 ? 83.856  95.239  177.524 1.00 168.35 ? 639  LYS A CE  1 
ATOM   4766 N  NZ  . LYS A 1 610 ? 83.598  95.515  178.967 1.00 169.61 ? 639  LYS A NZ  1 
ATOM   4767 N  N   . LEU A 1 611 ? 86.592  99.601  174.061 1.00 148.27 ? 640  LEU A N   1 
ATOM   4768 C  CA  . LEU A 1 611 ? 87.480  100.752 174.173 1.00 151.37 ? 640  LEU A CA  1 
ATOM   4769 C  C   . LEU A 1 611 ? 86.854  101.948 174.870 1.00 154.00 ? 640  LEU A C   1 
ATOM   4770 O  O   . LEU A 1 611 ? 85.678  102.222 174.621 1.00 154.09 ? 640  LEU A O   1 
ATOM   4771 C  CB  . LEU A 1 611 ? 87.916  101.171 172.761 1.00 151.95 ? 640  LEU A CB  1 
ATOM   4772 C  CG  . LEU A 1 611 ? 88.894  102.337 172.643 1.00 151.49 ? 640  LEU A CG  1 
ATOM   4773 C  CD1 . LEU A 1 611 ? 90.322  101.813 172.602 1.00 151.33 ? 640  LEU A CD1 1 
ATOM   4774 C  CD2 . LEU A 1 611 ? 88.611  103.151 171.389 1.00 152.12 ? 640  LEU A CD2 1 
ATOM   4775 N  N   . GLU A 1 612 ? 87.595  102.675 175.730 1.00 156.63 ? 641  GLU A N   1 
ATOM   4776 C  CA  . GLU A 1 612 ? 87.042  103.915 176.252 1.00 159.41 ? 641  GLU A CA  1 
ATOM   4777 C  C   . GLU A 1 612 ? 87.483  105.006 175.226 1.00 160.67 ? 641  GLU A C   1 
ATOM   4778 O  O   . GLU A 1 612 ? 88.591  105.048 174.731 1.00 160.74 ? 641  GLU A O   1 
ATOM   4779 C  CB  . GLU A 1 612 ? 87.356  104.516 177.582 1.00 164.94 ? 641  GLU A CB  1 
ATOM   4780 C  CG  . GLU A 1 612 ? 86.892  103.943 178.893 1.00 166.62 ? 641  GLU A CG  1 
ATOM   4781 C  CD  . GLU A 1 612 ? 87.746  104.407 180.065 1.00 167.17 ? 641  GLU A CD  1 
ATOM   4782 O  OE1 . GLU A 1 612 ? 88.363  105.489 179.955 1.00 167.43 ? 641  GLU A OE1 1 
ATOM   4783 O  OE2 . GLU A 1 612 ? 87.798  103.706 181.090 1.00 168.23 ? 641  GLU A OE2 1 
ATOM   4784 N  N   . ASN A 1 613 ? 86.533  105.913 175.120 1.00 161.50 ? 642  ASN A N   1 
ATOM   4785 C  CA  . ASN A 1 613 ? 86.736  107.028 174.203 1.00 162.56 ? 642  ASN A CA  1 
ATOM   4786 C  C   . ASN A 1 613 ? 87.986  107.785 174.519 1.00 163.43 ? 642  ASN A C   1 
ATOM   4787 O  O   . ASN A 1 613 ? 88.866  107.916 173.638 1.00 164.11 ? 642  ASN A O   1 
ATOM   4788 C  CB  . ASN A 1 613 ? 85.391  107.760 174.158 1.00 163.04 ? 642  ASN A CB  1 
ATOM   4789 C  CG  . ASN A 1 613 ? 84.414  106.831 173.421 1.00 162.72 ? 642  ASN A CG  1 
ATOM   4790 O  OD1 . ASN A 1 613 ? 84.787  105.692 173.121 1.00 163.51 ? 642  ASN A OD1 1 
ATOM   4791 N  ND2 . ASN A 1 613 ? 83.210  107.287 173.153 1.00 162.34 ? 642  ASN A ND2 1 
ATOM   4792 N  N   . GLN A 1 614 ? 88.249  108.154 175.768 1.00 163.32 ? 643  GLN A N   1 
ATOM   4793 C  CA  . GLN A 1 614 ? 89.468  108.901 176.054 1.00 162.97 ? 643  GLN A CA  1 
ATOM   4794 C  C   . GLN A 1 614 ? 90.747  108.109 176.054 1.00 162.51 ? 643  GLN A C   1 
ATOM   4795 O  O   . GLN A 1 614 ? 91.835  108.706 175.956 1.00 162.18 ? 643  GLN A O   1 
ATOM   4796 C  CB  . GLN A 1 614 ? 89.266  109.692 177.359 1.00 165.72 ? 643  GLN A CB  1 
ATOM   4797 C  CG  . GLN A 1 614 ? 88.649  111.049 177.061 1.00 165.87 ? 643  GLN A CG  1 
ATOM   4798 C  CD  . GLN A 1 614 ? 88.252  111.875 178.248 1.00 167.70 ? 643  GLN A CD  1 
ATOM   4799 O  OE1 . GLN A 1 614 ? 88.546  113.076 178.319 1.00 167.50 ? 643  GLN A OE1 1 
ATOM   4800 N  NE2 . GLN A 1 614 ? 87.558  111.293 179.217 1.00 170.60 ? 643  GLN A NE2 1 
ATOM   4801 N  N   . SER A 1 615 ? 90.715  106.779 176.065 1.00 162.51 ? 644  SER A N   1 
ATOM   4802 C  CA  . SER A 1 615 ? 91.978  106.029 176.107 1.00 163.40 ? 644  SER A CA  1 
ATOM   4803 C  C   . SER A 1 615 ? 91.980  104.756 175.306 1.00 164.59 ? 644  SER A C   1 
ATOM   4804 O  O   . SER A 1 615 ? 91.100  103.901 175.470 1.00 165.06 ? 644  SER A O   1 
ATOM   4805 C  CB  . SER A 1 615 ? 92.267  105.729 177.586 1.00 163.11 ? 644  SER A CB  1 
ATOM   4806 O  OG  . SER A 1 615 ? 92.019  104.383 177.911 1.00 164.49 ? 644  SER A OG  1 
ATOM   4807 N  N   . LEU A 1 616 ? 93.000  104.487 174.472 1.00 165.63 ? 645  LEU A N   1 
ATOM   4808 C  CA  . LEU A 1 616 ? 92.975  103.193 173.778 1.00 167.52 ? 645  LEU A CA  1 
ATOM   4809 C  C   . LEU A 1 616 ? 93.238  102.034 174.710 1.00 169.16 ? 645  LEU A C   1 
ATOM   4810 O  O   . LEU A 1 616 ? 92.767  100.907 174.450 1.00 169.63 ? 645  LEU A O   1 
ATOM   4811 C  CB  . LEU A 1 616 ? 93.835  103.120 172.534 1.00 165.80 ? 645  LEU A CB  1 
ATOM   4812 C  CG  . LEU A 1 616 ? 94.438  101.767 172.142 1.00 165.73 ? 645  LEU A CG  1 
ATOM   4813 C  CD1 . LEU A 1 616 ? 95.405  101.310 173.227 1.00 167.00 ? 645  LEU A CD1 1 
ATOM   4814 C  CD2 . LEU A 1 616 ? 93.401  100.704 171.836 1.00 166.00 ? 645  LEU A CD2 1 
ATOM   4815 N  N   . LYS A 1 617 ? 94.007  102.157 175.806 1.00 170.04 ? 646  LYS A N   1 
ATOM   4816 C  CA  . LYS A 1 617 ? 94.104  100.933 176.647 1.00 170.32 ? 646  LYS A CA  1 
ATOM   4817 C  C   . LYS A 1 617 ? 92.690  100.662 177.159 1.00 170.43 ? 646  LYS A C   1 
ATOM   4818 O  O   . LYS A 1 617 ? 92.377  99.592  177.652 1.00 171.01 ? 646  LYS A O   1 
ATOM   4819 C  CB  . LYS A 1 617 ? 95.063  101.063 177.808 1.00 168.95 ? 646  LYS A CB  1 
ATOM   4820 C  CG  . LYS A 1 617 ? 94.745  100.285 179.070 1.00 167.76 ? 646  LYS A CG  1 
ATOM   4821 C  CD  . LYS A 1 617 ? 93.533  100.797 179.823 1.00 164.93 ? 646  LYS A CD  1 
ATOM   4822 C  CE  . LYS A 1 617 ? 92.998  99.806  180.844 1.00 162.88 ? 646  LYS A CE  1 
ATOM   4823 N  NZ  . LYS A 1 617 ? 93.146  100.378 182.220 1.00 161.65 ? 646  LYS A NZ  1 
ATOM   4824 N  N   . SER A 1 618 ? 91.881  101.716 177.214 1.00 169.92 ? 647  SER A N   1 
ATOM   4825 C  CA  . SER A 1 618 ? 90.557  101.601 177.755 1.00 168.42 ? 647  SER A CA  1 
ATOM   4826 C  C   . SER A 1 618 ? 89.746  100.482 177.116 1.00 166.51 ? 647  SER A C   1 
ATOM   4827 O  O   . SER A 1 618 ? 89.324  100.497 175.973 1.00 166.51 ? 647  SER A O   1 
ATOM   4828 C  CB  . SER A 1 618 ? 89.796  102.923 177.643 1.00 171.90 ? 647  SER A CB  1 
ATOM   4829 O  OG  . SER A 1 618 ? 88.481  102.517 177.990 1.00 172.94 ? 647  SER A OG  1 
ATOM   4830 N  N   . VAL A 1 619 ? 89.647  99.390  177.877 1.00 164.48 ? 648  VAL A N   1 
ATOM   4831 C  CA  . VAL A 1 619 ? 89.022  98.186  177.376 1.00 161.59 ? 648  VAL A CA  1 
ATOM   4832 C  C   . VAL A 1 619 ? 88.477  97.341  178.528 1.00 159.69 ? 648  VAL A C   1 
ATOM   4833 O  O   . VAL A 1 619 ? 88.612  97.700  179.687 1.00 159.94 ? 648  VAL A O   1 
ATOM   4834 C  CB  . VAL A 1 619 ? 89.984  97.278  176.596 1.00 158.64 ? 648  VAL A CB  1 
ATOM   4835 C  CG1 . VAL A 1 619 ? 89.687  97.284  175.113 1.00 160.49 ? 648  VAL A CG1 1 
ATOM   4836 C  CG2 . VAL A 1 619 ? 91.442  97.590  176.815 1.00 157.87 ? 648  VAL A CG2 1 
ATOM   4837 N  N   . LYS A 1 620 ? 87.896  96.238  178.155 1.00 158.00 ? 649  LYS A N   1 
ATOM   4838 C  CA  . LYS A 1 620 ? 87.277  95.178  178.939 1.00 156.07 ? 649  LYS A CA  1 
ATOM   4839 C  C   . LYS A 1 620 ? 86.885  94.109  177.918 1.00 154.48 ? 649  LYS A C   1 
ATOM   4840 O  O   . LYS A 1 620 ? 86.417  94.525  176.832 1.00 155.07 ? 649  LYS A O   1 
ATOM   4841 C  CB  . LYS A 1 620 ? 86.109  95.715  179.738 1.00 155.69 ? 649  LYS A CB  1 
ATOM   4842 C  CG  . LYS A 1 620 ? 86.254  96.857  180.702 1.00 154.70 ? 649  LYS A CG  1 
ATOM   4843 C  CD  . LYS A 1 620 ? 85.042  97.773  180.771 1.00 153.85 ? 649  LYS A CD  1 
ATOM   4844 C  CE  . LYS A 1 620 ? 85.177  98.731  181.950 1.00 153.70 ? 649  LYS A CE  1 
ATOM   4845 N  NZ  . LYS A 1 620 ? 84.004  99.635  182.074 1.00 153.30 ? 649  LYS A NZ  1 
ATOM   4846 N  N   . PHE A 1 621 ? 87.090  92.799  177.984 1.00 152.02 ? 650  PHE A N   1 
ATOM   4847 C  CA  . PHE A 1 621 ? 86.745  91.994  176.795 1.00 148.34 ? 650  PHE A CA  1 
ATOM   4848 C  C   . PHE A 1 621 ? 85.311  91.483  176.739 1.00 144.94 ? 650  PHE A C   1 
ATOM   4849 O  O   . PHE A 1 621 ? 84.528  91.662  177.665 1.00 145.22 ? 650  PHE A O   1 
ATOM   4850 C  CB  . PHE A 1 621 ? 87.685  90.812  176.630 1.00 153.71 ? 650  PHE A CB  1 
ATOM   4851 C  CG  . PHE A 1 621 ? 88.986  91.083  175.950 1.00 156.78 ? 650  PHE A CG  1 
ATOM   4852 C  CD1 . PHE A 1 621 ? 89.098  91.119  174.572 1.00 156.83 ? 650  PHE A CD1 1 
ATOM   4853 C  CD2 . PHE A 1 621 ? 90.127  91.283  176.715 1.00 159.85 ? 650  PHE A CD2 1 
ATOM   4854 C  CE1 . PHE A 1 621 ? 90.323  91.350  173.975 1.00 160.35 ? 650  PHE A CE1 1 
ATOM   4855 C  CE2 . PHE A 1 621 ? 91.350  91.524  176.120 1.00 162.01 ? 650  PHE A CE2 1 
ATOM   4856 C  CZ  . PHE A 1 621 ? 91.452  91.562  174.743 1.00 162.05 ? 650  PHE A CZ  1 
ATOM   4857 N  N   . GLY A 1 622 ? 84.989  90.787  175.644 1.00 141.31 ? 651  GLY A N   1 
ATOM   4858 C  CA  . GLY A 1 622 ? 83.685  90.199  175.388 1.00 137.18 ? 651  GLY A CA  1 
ATOM   4859 C  C   . GLY A 1 622 ? 83.597  89.413  174.082 1.00 133.42 ? 651  GLY A C   1 
ATOM   4860 O  O   . GLY A 1 622 ? 84.620  89.208  173.422 1.00 133.42 ? 651  GLY A O   1 
ATOM   4861 N  N   . SER A 1 623 ? 82.413  88.957  173.689 1.00 129.52 ? 652  SER A N   1 
ATOM   4862 C  CA  . SER A 1 623 ? 82.134  88.231  172.453 1.00 124.75 ? 652  SER A CA  1 
ATOM   4863 C  C   . SER A 1 623 ? 80.815  88.709  171.838 1.00 121.30 ? 652  SER A C   1 
ATOM   4864 O  O   . SER A 1 623 ? 80.022  89.340  172.549 1.00 120.73 ? 652  SER A O   1 
ATOM   4865 C  CB  . SER A 1 623 ? 82.068  86.720  172.658 1.00 120.87 ? 652  SER A CB  1 
ATOM   4866 O  OG  . SER A 1 623 ? 80.751  86.212  172.456 1.00 115.83 ? 652  SER A OG  1 
ATOM   4867 N  N   . ILE A 1 624 ? 80.585  88.542  170.538 1.00 118.26 ? 653  ILE A N   1 
ATOM   4868 C  CA  . ILE A 1 624 ? 79.385  89.105  169.918 1.00 114.97 ? 653  ILE A CA  1 
ATOM   4869 C  C   . ILE A 1 624 ? 78.114  88.342  170.243 1.00 113.58 ? 653  ILE A C   1 
ATOM   4870 O  O   . ILE A 1 624 ? 77.106  88.881  170.704 1.00 112.42 ? 653  ILE A O   1 
ATOM   4871 C  CB  . ILE A 1 624 ? 79.520  89.224  168.386 1.00 103.88 ? 653  ILE A CB  1 
ATOM   4872 C  CG1 . ILE A 1 624 ? 80.718  90.087  168.003 1.00 105.56 ? 653  ILE A CG1 1 
ATOM   4873 C  CG2 . ILE A 1 624 ? 78.242  89.821  167.817 1.00 102.96 ? 653  ILE A CG2 1 
ATOM   4874 C  CD1 . ILE A 1 624 ? 81.069  90.122  166.539 1.00 102.81 ? 653  ILE A CD1 1 
ATOM   4875 N  N   . LYS A 1 625 ? 78.131  87.043  169.952 1.00 113.36 ? 654  LYS A N   1 
ATOM   4876 C  CA  . LYS A 1 625 ? 76.947  86.228  170.146 1.00 113.77 ? 654  LYS A CA  1 
ATOM   4877 C  C   . LYS A 1 625 ? 76.447  86.291  171.577 1.00 115.12 ? 654  LYS A C   1 
ATOM   4878 O  O   . LYS A 1 625 ? 75.244  86.329  171.798 1.00 115.06 ? 654  LYS A O   1 
ATOM   4879 C  CB  . LYS A 1 625 ? 77.239  84.784  169.793 1.00 116.66 ? 654  LYS A CB  1 
ATOM   4880 C  CG  . LYS A 1 625 ? 76.167  83.800  170.257 1.00 121.44 ? 654  LYS A CG  1 
ATOM   4881 C  CD  . LYS A 1 625 ? 76.530  82.419  169.706 1.00 125.39 ? 654  LYS A CD  1 
ATOM   4882 C  CE  . LYS A 1 625 ? 77.932  82.480  169.096 1.00 126.71 ? 654  LYS A CE  1 
ATOM   4883 N  NZ  . LYS A 1 625 ? 78.779  81.415  169.715 1.00 128.37 ? 654  LYS A NZ  1 
ATOM   4884 N  N   . SER A 1 626 ? 77.369  86.165  172.525 1.00 117.19 ? 655  SER A N   1 
ATOM   4885 C  CA  . SER A 1 626 ? 76.962  86.137  173.922 1.00 119.06 ? 655  SER A CA  1 
ATOM   4886 C  C   . SER A 1 626 ? 76.832  87.522  174.522 1.00 119.87 ? 655  SER A C   1 
ATOM   4887 O  O   . SER A 1 626 ? 75.811  87.821  175.146 1.00 119.91 ? 655  SER A O   1 
ATOM   4888 C  CB  . SER A 1 626 ? 77.916  85.256  174.731 1.00 122.03 ? 655  SER A CB  1 
ATOM   4889 O  OG  . SER A 1 626 ? 77.211  84.137  175.247 1.00 123.99 ? 655  SER A OG  1 
ATOM   4890 N  N   . ASP A 1 627 ? 77.843  88.370  174.361 1.00 120.71 ? 656  ASP A N   1 
ATOM   4891 C  CA  . ASP A 1 627 ? 77.842  89.689  174.971 1.00 121.19 ? 656  ASP A CA  1 
ATOM   4892 C  C   . ASP A 1 627 ? 76.899  90.657  174.252 1.00 121.18 ? 656  ASP A C   1 
ATOM   4893 O  O   . ASP A 1 627 ? 76.255  91.473  174.916 1.00 121.19 ? 656  ASP A O   1 
ATOM   4894 C  CB  . ASP A 1 627 ? 79.225  90.320  175.036 1.00 126.71 ? 656  ASP A CB  1 
ATOM   4895 C  CG  . ASP A 1 627 ? 80.287  89.600  175.819 1.00 128.20 ? 656  ASP A CG  1 
ATOM   4896 O  OD1 . ASP A 1 627 ? 80.333  88.353  175.777 1.00 129.23 ? 656  ASP A OD1 1 
ATOM   4897 O  OD2 . ASP A 1 627 ? 81.115  90.270  176.485 1.00 126.82 ? 656  ASP A OD2 1 
ATOM   4898 N  N   . TRP A 1 628 ? 76.856  90.579  172.931 1.00 120.89 ? 657  TRP A N   1 
ATOM   4899 C  CA  . TRP A 1 628 ? 76.120  91.505  172.089 1.00 119.42 ? 657  TRP A CA  1 
ATOM   4900 C  C   . TRP A 1 628 ? 74.665  91.143  171.848 1.00 117.95 ? 657  TRP A C   1 
ATOM   4901 O  O   . TRP A 1 628 ? 73.792  92.022  171.862 1.00 116.52 ? 657  TRP A O   1 
ATOM   4902 C  CB  . TRP A 1 628 ? 76.844  91.678  170.739 1.00 115.90 ? 657  TRP A CB  1 
ATOM   4903 C  CG  . TRP A 1 628 ? 77.712  92.900  170.707 1.00 114.95 ? 657  TRP A CG  1 
ATOM   4904 C  CD1 . TRP A 1 628 ? 79.066  92.950  170.823 1.00 116.95 ? 657  TRP A CD1 1 
ATOM   4905 C  CD2 . TRP A 1 628 ? 77.279  94.257  170.558 1.00 113.48 ? 657  TRP A CD2 1 
ATOM   4906 N  NE1 . TRP A 1 628 ? 79.511  94.249  170.760 1.00 117.46 ? 657  TRP A NE1 1 
ATOM   4907 C  CE2 . TRP A 1 628 ? 78.427  95.073  170.593 1.00 116.38 ? 657  TRP A CE2 1 
ATOM   4908 C  CE3 . TRP A 1 628 ? 76.031  94.858  170.394 1.00 114.70 ? 657  TRP A CE3 1 
ATOM   4909 C  CZ2 . TRP A 1 628 ? 78.366  96.460  170.465 1.00 115.23 ? 657  TRP A CZ2 1 
ATOM   4910 C  CZ3 . TRP A 1 628 ? 75.967  96.235  170.271 1.00 115.45 ? 657  TRP A CZ3 1 
ATOM   4911 C  CH2 . TRP A 1 628 ? 77.129  97.017  170.308 1.00 115.92 ? 657  TRP A CH2 1 
ATOM   4912 N  N   . LEU A 1 629 ? 74.402  89.871  171.560 1.00 117.40 ? 658  LEU A N   1 
ATOM   4913 C  CA  . LEU A 1 629 ? 73.048  89.402  171.284 1.00 117.08 ? 658  LEU A CA  1 
ATOM   4914 C  C   . LEU A 1 629 ? 72.522  88.491  172.386 1.00 118.15 ? 658  LEU A C   1 
ATOM   4915 O  O   . LEU A 1 629 ? 73.169  87.506  172.749 1.00 118.47 ? 658  LEU A O   1 
ATOM   4916 C  CB  . LEU A 1 629 ? 73.025  88.662  169.948 1.00 108.41 ? 658  LEU A CB  1 
ATOM   4917 C  CG  . LEU A 1 629 ? 73.988  89.153  168.869 1.00 104.96 ? 658  LEU A CG  1 
ATOM   4918 C  CD1 . LEU A 1 629 ? 74.051  88.157  167.724 1.00 102.41 ? 658  LEU A CD1 1 
ATOM   4919 C  CD2 . LEU A 1 629 ? 73.573  90.534  168.386 1.00 103.76 ? 658  LEU A CD2 1 
ATOM   4920 N  N   . GLY A 1 630 ? 71.331  88.768  172.895 1.00 119.23 ? 659  GLY A N   1 
ATOM   4921 C  CA  . GLY A 1 630 ? 70.709  88.033  173.977 1.00 120.86 ? 659  GLY A CA  1 
ATOM   4922 C  C   . GLY A 1 630 ? 70.473  86.548  173.666 1.00 121.79 ? 659  GLY A C   1 
ATOM   4923 O  O   . GLY A 1 630 ? 69.332  86.157  173.400 1.00 123.87 ? 659  GLY A O   1 
ATOM   4924 N  N   . CYS A 1 631 ? 71.459  85.766  173.858 1.00 120.71 ? 660  CYS A N   1 
ATOM   4925 C  CA  . CYS A 1 631 ? 72.056  84.506  173.629 1.00 119.85 ? 660  CYS A CA  1 
ATOM   4926 C  C   . CYS A 1 631 ? 72.940  84.143  174.840 1.00 119.82 ? 660  CYS A C   1 
ATOM   4927 O  O   . CYS A 1 631 ? 72.923  83.161  175.525 1.00 119.29 ? 660  CYS A O   1 
ATOM   4928 C  CB  . CYS A 1 631 ? 73.081  84.673  172.502 1.00 112.77 ? 660  CYS A CB  1 
ATOM   4929 S  SG  . CYS A 1 631 ? 72.913  84.162  170.844 1.00 106.01 ? 660  CYS A SG  1 
ATOM   4930 O  OXT . CYS A 1 631 ? 74.923  85.161  176.525 1.00 122.14 ? 660  CYS A OXT 1 
HETATM 4931 ZN ZN  . ZN  B 2 .   ? 50.892  83.085  149.761 1.00 35.17  ? 990  ZN  A ZN  1 
HETATM 4932 ZN ZN  . ZN  C 2 .   ? 40.365  84.580  143.806 1.00 28.91  ? 991  ZN  A ZN  1 
HETATM 4933 CA CA  . CA  D 3 .   ? 45.050  94.669  146.884 1.00 23.87  ? 992  CA  A CA  1 
HETATM 4934 CA CA  . CA  E 3 .   ? 41.622  74.406  137.297 1.00 108.66 ? 993  CA  A CA  1 
HETATM 4935 CA CA  . CA  F 3 .   ? 82.852  94.438  157.353 1.00 63.75  ? 994  CA  A CA  1 
HETATM 4936 CL CL  . CL  G 4 .   ? 81.010  98.270  159.456 1.00 58.57  ? 995  CL  A CL  1 
HETATM 4937 NA NA  . NA  H 5 .   ? 79.547  100.289 161.378 1.00 61.09  ? 996  NA  A NA  1 
HETATM 4938 S  S   . SO4 I 6 .   ? 44.128  93.113  155.289 1.00 82.29  ? 777  SO4 A S   1 
HETATM 4939 O  O1  . SO4 I 6 .   ? 43.163  93.630  154.270 1.00 81.96  ? 777  SO4 A O1  1 
HETATM 4940 O  O2  . SO4 I 6 .   ? 43.991  91.618  155.341 1.00 83.29  ? 777  SO4 A O2  1 
HETATM 4941 O  O3  . SO4 I 6 .   ? 45.543  93.460  154.922 1.00 82.69  ? 777  SO4 A O3  1 
HETATM 4942 O  O4  . SO4 I 6 .   ? 43.855  93.709  156.633 1.00 82.24  ? 777  SO4 A O4  1 
HETATM 4943 S  S   . SO4 J 6 .   ? 23.908  92.511  126.469 1.00 41.44  ? 778  SO4 A S   1 
HETATM 4944 O  O1  . SO4 J 6 .   ? 24.553  93.868  126.863 1.00 45.25  ? 778  SO4 A O1  1 
HETATM 4945 O  O2  . SO4 J 6 .   ? 22.702  92.239  127.291 1.00 41.10  ? 778  SO4 A O2  1 
HETATM 4946 O  O3  . SO4 J 6 .   ? 23.673  92.548  125.016 1.00 34.71  ? 778  SO4 A O3  1 
HETATM 4947 O  O4  . SO4 J 6 .   ? 24.920  91.539  126.996 1.00 45.29  ? 778  SO4 A O4  1 
HETATM 4948 O  O   . HOH K 7 .   ? 45.348  75.142  123.346 1.00 26.79  ? 997  HOH A O   1 
HETATM 4949 O  O   . HOH K 7 .   ? 42.059  92.838  134.287 1.00 30.37  ? 998  HOH A O   1 
HETATM 4950 O  O   . HOH K 7 .   ? 36.161  73.908  141.972 1.00 21.31  ? 999  HOH A O   1 
HETATM 4951 O  O   . HOH K 7 .   ? 73.794  112.895 151.318 1.00 28.33  ? 1000 HOH A O   1 
HETATM 4952 O  O   . HOH K 7 .   ? 49.038  79.541  153.274 1.00 27.87  ? 1001 HOH A O   1 
HETATM 4953 O  O   . HOH K 7 .   ? 67.177  70.105  141.654 1.00 35.63  ? 1002 HOH A O   1 
HETATM 4954 O  O   . HOH K 7 .   ? 43.476  70.370  138.002 1.00 29.01  ? 1003 HOH A O   1 
HETATM 4955 O  O   . HOH K 7 .   ? 51.939  80.610  164.572 1.00 35.27  ? 1004 HOH A O   1 
HETATM 4956 O  O   . HOH K 7 .   ? 51.853  91.954  156.242 1.00 27.08  ? 1005 HOH A O   1 
HETATM 4957 O  O   . HOH K 7 .   ? 68.875  84.129  162.978 1.00 33.45  ? 1006 HOH A O   1 
HETATM 4958 O  O   . HOH K 7 .   ? 40.471  67.827  144.631 1.00 31.95  ? 1007 HOH A O   1 
HETATM 4959 O  O   . HOH K 7 .   ? 58.029  115.029 148.945 1.00 31.06  ? 1008 HOH A O   1 
HETATM 4960 O  O   . HOH K 7 .   ? 58.818  96.499  159.291 1.00 36.17  ? 1009 HOH A O   1 
HETATM 4961 O  O   . HOH K 7 .   ? 37.028  78.535  126.031 1.00 28.01  ? 1010 HOH A O   1 
HETATM 4962 O  O   . HOH K 7 .   ? 45.024  98.250  150.461 1.00 28.36  ? 1011 HOH A O   1 
HETATM 4963 O  O   . HOH K 7 .   ? 77.238  87.069  150.514 1.00 26.22  ? 1012 HOH A O   1 
HETATM 4964 O  O   . HOH K 7 .   ? 40.648  81.459  123.037 1.00 28.31  ? 1013 HOH A O   1 
HETATM 4965 O  O   . HOH K 7 .   ? 61.745  81.435  129.828 1.00 24.50  ? 1014 HOH A O   1 
HETATM 4966 O  O   . HOH K 7 .   ? 39.950  91.003  151.782 1.00 21.32  ? 1015 HOH A O   1 
HETATM 4967 O  O   . HOH K 7 .   ? 82.420  113.164 149.718 1.00 33.91  ? 1016 HOH A O   1 
HETATM 4968 O  O   . HOH K 7 .   ? 38.475  93.899  151.031 1.00 23.42  ? 1017 HOH A O   1 
HETATM 4969 O  O   . HOH K 7 .   ? 37.317  84.714  139.492 1.00 27.94  ? 1018 HOH A O   1 
HETATM 4970 O  O   . HOH K 7 .   ? 35.111  113.461 150.184 1.00 23.33  ? 1019 HOH A O   1 
HETATM 4971 O  O   . HOH K 7 .   ? 25.772  99.099  108.254 1.00 33.96  ? 1020 HOH A O   1 
HETATM 4972 O  O   . HOH K 7 .   ? 38.623  87.878  129.630 1.00 26.69  ? 1021 HOH A O   1 
HETATM 4973 O  O   . HOH K 7 .   ? 36.068  91.155  119.377 1.00 17.08  ? 1022 HOH A O   1 
HETATM 4974 O  O   . HOH K 7 .   ? 60.522  90.875  138.619 1.00 20.60  ? 1023 HOH A O   1 
HETATM 4975 O  O   . HOH K 7 .   ? 36.343  91.924  117.180 1.00 17.61  ? 1024 HOH A O   1 
HETATM 4976 O  O   . HOH K 7 .   ? 63.734  93.911  137.184 1.00 28.03  ? 1025 HOH A O   1 
HETATM 4977 O  O   . HOH K 7 .   ? 47.473  93.967  128.848 1.00 27.65  ? 1026 HOH A O   1 
HETATM 4978 O  O   . HOH K 7 .   ? 54.375  96.581  129.418 1.00 23.25  ? 1027 HOH A O   1 
HETATM 4979 O  O   . HOH K 7 .   ? 47.250  98.191  113.905 1.00 28.13  ? 1028 HOH A O   1 
HETATM 4980 O  O   . HOH K 7 .   ? 39.859  98.165  130.451 1.00 23.17  ? 1029 HOH A O   1 
HETATM 4981 O  O   . HOH K 7 .   ? 32.813  100.041 115.645 1.00 30.81  ? 1030 HOH A O   1 
HETATM 4982 O  O   . HOH K 7 .   ? 46.853  100.937 139.986 1.00 31.26  ? 1031 HOH A O   1 
HETATM 4983 O  O   . HOH K 7 .   ? 64.246  101.784 140.277 1.00 29.85  ? 1032 HOH A O   1 
HETATM 4984 O  O   . HOH K 7 .   ? 66.048  101.626 120.419 1.00 34.95  ? 1033 HOH A O   1 
HETATM 4985 O  O   . HOH K 7 .   ? 50.615  104.199 142.499 1.00 19.37  ? 1034 HOH A O   1 
HETATM 4986 O  O   . HOH K 7 .   ? 55.159  105.730 135.958 1.00 11.78  ? 1035 HOH A O   1 
HETATM 4987 O  O   . HOH K 7 .   ? 50.239  105.923 144.408 1.00 28.80  ? 1036 HOH A O   1 
HETATM 4988 O  O   . HOH K 7 .   ? 58.318  105.871 143.570 1.00 28.70  ? 1037 HOH A O   1 
HETATM 4989 O  O   . HOH K 7 .   ? 29.524  108.180 121.176 1.00 31.56  ? 1038 HOH A O   1 
HETATM 4990 O  O   . HOH K 7 .   ? 73.418  108.234 122.185 1.00 36.66  ? 1039 HOH A O   1 
HETATM 4991 O  O   . HOH K 7 .   ? 35.090  108.990 123.243 1.00 27.47  ? 1040 HOH A O   1 
HETATM 4992 O  O   . HOH K 7 .   ? 56.389  112.185 135.842 1.00 32.42  ? 1041 HOH A O   1 
HETATM 4993 O  O   . HOH K 7 .   ? 49.200  129.200 140.178 1.00 16.12  ? 1042 HOH A O   1 
HETATM 4994 O  O   . HOH K 7 .   ? 57.567  113.615 140.722 1.00 27.79  ? 1043 HOH A O   1 
HETATM 4995 O  O   . HOH K 7 .   ? 39.684  115.069 135.366 1.00 16.54  ? 1044 HOH A O   1 
HETATM 4996 O  O   . HOH K 7 .   ? 75.339  115.154 125.011 1.00 28.34  ? 1045 HOH A O   1 
HETATM 4997 O  O   . HOH K 7 .   ? 40.847  123.962 136.500 1.00 23.62  ? 1046 HOH A O   1 
HETATM 4998 O  O   . HOH K 7 .   ? 88.679  119.998 161.016 1.00 33.17  ? 1047 HOH A O   1 
HETATM 4999 O  O   . HOH K 7 .   ? 41.276  120.251 149.528 1.00 30.09  ? 1048 HOH A O   1 
HETATM 5000 O  O   . HOH K 7 .   ? 58.217  120.126 142.936 1.00 33.59  ? 1049 HOH A O   1 
HETATM 5001 O  O   . HOH K 7 .   ? 61.487  87.003  160.732 1.00 41.05  ? 1050 HOH A O   1 
HETATM 5002 O  O   . HOH K 7 .   ? 53.630  100.563 148.886 1.00 23.33  ? 1051 HOH A O   1 
HETATM 5003 O  O   . HOH K 7 .   ? 52.679  122.596 132.205 1.00 36.28  ? 1052 HOH A O   1 
HETATM 5004 O  O   . HOH K 7 .   ? 41.776  107.237 146.313 1.00 28.71  ? 1053 HOH A O   1 
HETATM 5005 O  O   . HOH K 7 .   ? 39.694  100.484 144.869 1.00 28.50  ? 1054 HOH A O   1 
HETATM 5006 O  O   . HOH K 7 .   ? 44.488  102.106 155.410 1.00 32.83  ? 1055 HOH A O   1 
HETATM 5007 O  O   . HOH K 7 .   ? 57.743  92.617  159.365 1.00 29.24  ? 1056 HOH A O   1 
HETATM 5008 O  O   . HOH K 7 .   ? 55.889  78.251  129.862 1.00 21.76  ? 1057 HOH A O   1 
HETATM 5009 O  O   . HOH K 7 .   ? 63.038  81.777  135.417 1.00 18.53  ? 1058 HOH A O   1 
HETATM 5010 O  O   . HOH K 7 .   ? 65.077  77.782  139.511 1.00 30.24  ? 1059 HOH A O   1 
HETATM 5011 O  O   . HOH K 7 .   ? 51.711  100.887 131.579 1.00 25.56  ? 1060 HOH A O   1 
HETATM 5012 O  O   . HOH K 7 .   ? 58.760  101.006 131.384 1.00 23.74  ? 1061 HOH A O   1 
HETATM 5013 O  O   . HOH K 7 .   ? 52.578  98.562  124.836 1.00 7.72   ? 1062 HOH A O   1 
HETATM 5014 O  O   . HOH K 7 .   ? 61.817  121.506 122.951 1.00 26.87  ? 1063 HOH A O   1 
HETATM 5015 O  O   . HOH K 7 .   ? 63.911  120.347 136.711 1.00 28.50  ? 1064 HOH A O   1 
HETATM 5016 O  O   . HOH K 7 .   ? 61.978  117.225 137.645 1.00 21.11  ? 1065 HOH A O   1 
HETATM 5017 O  O   . HOH K 7 .   ? 44.726  114.313 119.239 1.00 32.19  ? 1066 HOH A O   1 
HETATM 5018 O  O   . HOH K 7 .   ? 50.644  107.903 122.903 1.00 9.24   ? 1067 HOH A O   1 
HETATM 5019 O  O   . HOH K 7 .   ? 66.823  108.253 123.820 1.00 18.33  ? 1068 HOH A O   1 
HETATM 5020 O  O   . HOH K 7 .   ? 46.170  101.596 122.560 1.00 38.25  ? 1069 HOH A O   1 
HETATM 5021 O  O   . HOH K 7 .   ? 47.871  101.293 115.006 1.00 21.87  ? 1070 HOH A O   1 
HETATM 5022 O  O   . HOH K 7 .   ? 39.250  101.626 108.069 1.00 37.09  ? 1071 HOH A O   1 
HETATM 5023 O  O   . HOH K 7 .   ? 36.351  96.370  107.590 1.00 36.57  ? 1072 HOH A O   1 
HETATM 5024 O  O   . HOH K 7 .   ? 38.313  107.967 114.450 1.00 33.78  ? 1073 HOH A O   1 
HETATM 5025 O  O   . HOH K 7 .   ? 37.602  106.134 116.544 1.00 29.78  ? 1074 HOH A O   1 
HETATM 5026 O  O   . HOH K 7 .   ? 22.292  89.675  122.382 1.00 14.94  ? 1075 HOH A O   1 
HETATM 5027 O  O   . HOH K 7 .   ? 22.554  100.265 124.873 1.00 17.05  ? 1076 HOH A O   1 
HETATM 5028 O  O   . HOH K 7 .   ? 33.696  90.231  119.269 1.00 24.07  ? 1077 HOH A O   1 
HETATM 5029 O  O   . HOH K 7 .   ? 31.008  107.613 115.760 1.00 13.58  ? 1078 HOH A O   1 
HETATM 5030 O  O   . HOH K 7 .   ? 45.234  116.718 133.687 1.00 22.38  ? 1079 HOH A O   1 
HETATM 5031 O  O   . HOH K 7 .   ? 45.473  123.603 134.384 1.00 17.74  ? 1080 HOH A O   1 
HETATM 5032 O  O   . HOH K 7 .   ? 46.948  129.139 144.484 1.00 20.61  ? 1081 HOH A O   1 
HETATM 5033 O  O   . HOH K 7 .   ? 43.676  121.050 140.911 1.00 18.01  ? 1082 HOH A O   1 
HETATM 5034 O  O   . HOH K 7 .   ? 62.916  90.450  140.846 1.00 29.60  ? 1083 HOH A O   1 
HETATM 5035 O  O   . HOH K 7 .   ? 66.213  92.085  137.375 1.00 32.36  ? 1084 HOH A O   1 
HETATM 5036 O  O   . HOH K 7 .   ? 71.300  93.496  139.519 1.00 32.47  ? 1085 HOH A O   1 
HETATM 5037 O  O   . HOH K 7 .   ? 59.386  97.517  136.569 1.00 25.18  ? 1086 HOH A O   1 
HETATM 5038 O  O   . HOH K 7 .   ? 53.568  98.558  134.551 1.00 12.89  ? 1087 HOH A O   1 
HETATM 5039 O  O   . HOH K 7 .   ? 49.559  94.466  155.327 1.00 27.80  ? 1088 HOH A O   1 
HETATM 5040 O  O   . HOH K 7 .   ? 47.441  100.431 132.933 1.00 25.58  ? 1089 HOH A O   1 
HETATM 5041 O  O   . HOH K 7 .   ? 67.852  115.171 128.147 1.00 19.70  ? 1090 HOH A O   1 
HETATM 5042 O  O   . HOH K 7 .   ? 69.426  113.404 118.796 1.00 32.70  ? 1091 HOH A O   1 
HETATM 5043 O  O   . HOH K 7 .   ? 21.122  93.002  121.751 1.00 21.22  ? 1092 HOH A O   1 
HETATM 5044 O  O   . HOH K 7 .   ? 72.936  78.077  141.161 1.00 39.58  ? 1093 HOH A O   1 
HETATM 5045 O  O   . HOH K 7 .   ? 80.363  86.513  169.286 1.00 34.94  ? 1094 HOH A O   1 
HETATM 5046 O  O   . HOH K 7 .   ? 51.818  119.283 160.777 1.00 38.39  ? 1095 HOH A O   1 
HETATM 5047 O  O   . HOH K 7 .   ? 48.994  105.129 167.389 1.00 41.88  ? 1096 HOH A O   1 
HETATM 5048 O  O   . HOH K 7 .   ? 44.260  95.704  152.575 1.00 32.07  ? 1097 HOH A O   1 
HETATM 5049 O  O   . HOH K 7 .   ? 56.769  106.340 114.663 1.00 26.56  ? 1098 HOH A O   1 
HETATM 5050 O  O   . HOH K 7 .   ? 47.918  76.460  149.984 1.00 38.75  ? 1099 HOH A O   1 
HETATM 5051 O  O   . HOH K 7 .   ? 56.934  71.553  151.862 1.00 34.26  ? 1100 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   30  ?   ?   ?   A . n 
A 1 2   PRO 2   31  31  PRO PRO A . n 
A 1 3   SER 3   32  32  SER SER A . n 
A 1 4   PRO 4   33  33  PRO PRO A . n 
A 1 5   ILE 5   34  34  ILE ILE A . n 
A 1 6   ILE 6   35  35  ILE ILE A . n 
A 1 7   LYS 7   36  36  LYS LYS A . n 
A 1 8   PHE 8   37  37  PHE PHE A . n 
A 1 9   PRO 9   38  38  PRO PRO A . n 
A 1 10  GLY 10  39  39  GLY GLY A . n 
A 1 11  ASP 11  40  40  ASP ASP A . n 
A 1 12  VAL 12  41  41  VAL VAL A . n 
A 1 13  ALA 13  42  42  ALA ALA A . n 
A 1 14  PRO 14  43  43  PRO PRO A . n 
A 1 15  LYS 15  44  44  LYS LYS A . n 
A 1 16  THR 16  45  45  THR THR A . n 
A 1 17  ASP 17  46  46  ASP ASP A . n 
A 1 18  LYS 18  47  47  LYS LYS A . n 
A 1 19  GLU 19  48  48  GLU GLU A . n 
A 1 20  LEU 20  49  49  LEU LEU A . n 
A 1 21  ALA 21  50  50  ALA ALA A . n 
A 1 22  VAL 22  51  51  VAL VAL A . n 
A 1 23  GLN 23  52  52  GLN GLN A . n 
A 1 24  TYR 24  53  53  TYR TYR A . n 
A 1 25  LEU 25  54  54  LEU LEU A . n 
A 1 26  ASN 26  55  55  ASN ASN A . n 
A 1 27  THR 27  56  56  THR THR A . n 
A 1 28  PHE 28  57  57  PHE PHE A . n 
A 1 29  TYR 29  58  58  TYR TYR A . n 
A 1 30  GLY 30  59  59  GLY GLY A . n 
A 1 31  CYS 31  60  60  CYS CYS A . n 
A 1 32  PRO 32  61  61  PRO PRO A . n 
A 1 33  LYS 33  62  62  LYS LYS A . n 
A 1 34  GLU 34  63  63  GLU GLU A . n 
A 1 35  SER 35  64  64  SER SER A . n 
A 1 36  CYS 36  65  65  CYS CYS A . n 
A 1 37  ASN 37  66  66  ASN ASN A . n 
A 1 38  LEU 38  67  67  LEU LEU A . n 
A 1 39  PHE 39  68  68  PHE PHE A . n 
A 1 40  VAL 40  69  69  VAL VAL A . n 
A 1 41  LEU 41  70  70  LEU LEU A . n 
A 1 42  LYS 42  71  71  LYS LYS A . n 
A 1 43  ASP 43  72  72  ASP ASP A . n 
A 1 44  THR 44  73  73  THR THR A . n 
A 1 45  LEU 45  74  74  LEU LEU A . n 
A 1 46  LYS 46  75  75  LYS LYS A . n 
A 1 47  LYS 47  76  76  LYS LYS A . n 
A 1 48  MET 48  77  77  MET MET A . n 
A 1 49  GLN 49  78  78  GLN GLN A . n 
A 1 50  LYS 50  79  79  LYS LYS A . n 
A 1 51  PHE 51  80  80  PHE PHE A . n 
A 1 52  PHE 52  81  81  PHE PHE A . n 
A 1 53  GLY 53  82  82  GLY GLY A . n 
A 1 54  LEU 54  83  83  LEU LEU A . n 
A 1 55  PRO 55  84  84  PRO PRO A . n 
A 1 56  GLN 56  85  85  GLN GLN A . n 
A 1 57  THR 57  86  86  THR THR A . n 
A 1 58  GLY 58  87  87  GLY GLY A . n 
A 1 59  ASP 59  88  88  ASP ASP A . n 
A 1 60  LEU 60  89  89  LEU LEU A . n 
A 1 61  ASP 61  90  90  ASP ASP A . n 
A 1 62  GLN 62  91  91  GLN GLN A . n 
A 1 63  ASN 63  92  92  ASN ASN A . n 
A 1 64  THR 64  93  93  THR THR A . n 
A 1 65  ILE 65  94  94  ILE ILE A . n 
A 1 66  GLU 66  95  95  GLU GLU A . n 
A 1 67  THR 67  96  96  THR THR A . n 
A 1 68  MET 68  97  97  MET MET A . n 
A 1 69  ARG 69  98  98  ARG ARG A . n 
A 1 70  LYS 70  99  99  LYS LYS A . n 
A 1 71  PRO 71  100 100 PRO PRO A . n 
A 1 72  ARG 72  101 101 ARG ARG A . n 
A 1 73  CYS 73  102 102 CYS CYS A . n 
A 1 74  GLY 74  103 103 GLY GLY A . n 
A 1 75  ASN 75  104 104 ASN ASN A . n 
A 1 76  PRO 76  105 105 PRO PRO A . n 
A 1 77  ASP 77  106 106 ASP ASP A . n 
A 1 78  VAL 78  107 107 VAL VAL A . n 
A 1 79  ALA 79  108 108 ALA ALA A . n 
A 1 80  ASN 80  109 109 ASN ASN A . n 
A 1 81  TYR 81  110 110 TYR TYR A . n 
A 1 82  ASN 82  111 111 ASN ASN A . n 
A 1 83  PHE 83  112 112 PHE PHE A . n 
A 1 84  PHE 84  113 113 PHE PHE A . n 
A 1 85  PRO 85  114 114 PRO PRO A . n 
A 1 86  ARG 86  115 115 ARG ARG A . n 
A 1 87  LYS 87  116 116 LYS LYS A . n 
A 1 88  PRO 88  117 117 PRO PRO A . n 
A 1 89  LYS 89  118 118 LYS LYS A . n 
A 1 90  TRP 90  119 119 TRP TRP A . n 
A 1 91  ASP 91  120 120 ASP ASP A . n 
A 1 92  LYS 92  121 121 LYS LYS A . n 
A 1 93  ASN 93  122 122 ASN ASN A . n 
A 1 94  GLN 94  123 123 GLN GLN A . n 
A 1 95  ILE 95  124 124 ILE ILE A . n 
A 1 96  THR 96  125 125 THR THR A . n 
A 1 97  TYR 97  126 126 TYR TYR A . n 
A 1 98  ARG 98  127 127 ARG ARG A . n 
A 1 99  ILE 99  128 128 ILE ILE A . n 
A 1 100 ILE 100 129 129 ILE ILE A . n 
A 1 101 GLY 101 130 130 GLY GLY A . n 
A 1 102 TYR 102 131 131 TYR TYR A . n 
A 1 103 THR 103 132 132 THR THR A . n 
A 1 104 PRO 104 133 133 PRO PRO A . n 
A 1 105 ASP 105 134 134 ASP ASP A . n 
A 1 106 LEU 106 135 135 LEU LEU A . n 
A 1 107 ASP 107 136 136 ASP ASP A . n 
A 1 108 PRO 108 137 137 PRO PRO A . n 
A 1 109 GLU 109 138 138 GLU GLU A . n 
A 1 110 THR 110 139 139 THR THR A . n 
A 1 111 VAL 111 140 140 VAL VAL A . n 
A 1 112 ASP 112 141 141 ASP ASP A . n 
A 1 113 ASP 113 142 142 ASP ASP A . n 
A 1 114 ALA 114 143 143 ALA ALA A . n 
A 1 115 PHE 115 144 144 PHE PHE A . n 
A 1 116 ALA 116 145 145 ALA ALA A . n 
A 1 117 ARG 117 146 146 ARG ARG A . n 
A 1 118 ALA 118 147 147 ALA ALA A . n 
A 1 119 PHE 119 148 148 PHE PHE A . n 
A 1 120 GLN 120 149 149 GLN GLN A . n 
A 1 121 VAL 121 150 150 VAL VAL A . n 
A 1 122 TRP 122 151 151 TRP TRP A . n 
A 1 123 SER 123 152 152 SER SER A . n 
A 1 124 ASP 124 153 153 ASP ASP A . n 
A 1 125 VAL 125 154 154 VAL VAL A . n 
A 1 126 THR 126 155 155 THR THR A . n 
A 1 127 PRO 127 156 156 PRO PRO A . n 
A 1 128 LEU 128 157 157 LEU LEU A . n 
A 1 129 ARG 129 158 158 ARG ARG A . n 
A 1 130 PHE 130 159 159 PHE PHE A . n 
A 1 131 SER 131 160 160 SER SER A . n 
A 1 132 ARG 132 161 161 ARG ARG A . n 
A 1 133 ILE 133 162 162 ILE ILE A . n 
A 1 134 HIS 134 163 163 HIS HIS A . n 
A 1 135 ASP 135 164 164 ASP ASP A . n 
A 1 136 GLY 136 165 165 GLY GLY A . n 
A 1 137 GLU 137 166 166 GLU GLU A . n 
A 1 138 ALA 138 167 167 ALA ALA A . n 
A 1 139 ASP 139 168 168 ASP ASP A . n 
A 1 140 ILE 140 169 169 ILE ILE A . n 
A 1 141 MET 141 170 170 MET MET A . n 
A 1 142 ILE 142 171 171 ILE ILE A . n 
A 1 143 ASN 143 172 172 ASN ASN A . n 
A 1 144 PHE 144 173 173 PHE PHE A . n 
A 1 145 GLY 145 174 174 GLY GLY A . n 
A 1 146 ARG 146 175 175 ARG ARG A . n 
A 1 147 TRP 147 176 176 TRP TRP A . n 
A 1 148 GLU 148 177 177 GLU GLU A . n 
A 1 149 HIS 149 178 178 HIS HIS A . n 
A 1 150 GLY 150 179 179 GLY GLY A . n 
A 1 151 ASP 151 180 180 ASP ASP A . n 
A 1 152 GLY 152 181 181 GLY GLY A . n 
A 1 153 TYR 153 182 182 TYR TYR A . n 
A 1 154 PRO 154 183 183 PRO PRO A . n 
A 1 155 PHE 155 184 184 PHE PHE A . n 
A 1 156 ASP 156 185 185 ASP ASP A . n 
A 1 157 GLY 157 186 186 GLY GLY A . n 
A 1 158 LYS 158 187 187 LYS LYS A . n 
A 1 159 ASP 159 188 188 ASP ASP A . n 
A 1 160 GLY 160 189 189 GLY GLY A . n 
A 1 161 LEU 161 190 190 LEU LEU A . n 
A 1 162 LEU 162 191 191 LEU LEU A . n 
A 1 163 ALA 163 192 192 ALA ALA A . n 
A 1 164 HIS 164 193 193 HIS HIS A . n 
A 1 165 ALA 165 194 194 ALA ALA A . n 
A 1 166 PHE 166 195 195 PHE PHE A . n 
A 1 167 ALA 167 196 196 ALA ALA A . n 
A 1 168 PRO 168 197 197 PRO PRO A . n 
A 1 169 GLY 169 198 198 GLY GLY A . n 
A 1 170 THR 170 199 199 THR THR A . n 
A 1 171 GLY 171 200 200 GLY GLY A . n 
A 1 172 VAL 172 201 201 VAL VAL A . n 
A 1 173 GLY 173 202 202 GLY GLY A . n 
A 1 174 GLY 174 203 203 GLY GLY A . n 
A 1 175 ASP 175 204 204 ASP ASP A . n 
A 1 176 SER 176 205 205 SER SER A . n 
A 1 177 HIS 177 206 206 HIS HIS A . n 
A 1 178 PHE 178 207 207 PHE PHE A . n 
A 1 179 ASP 179 208 208 ASP ASP A . n 
A 1 180 ASP 180 209 209 ASP ASP A . n 
A 1 181 ASP 181 210 210 ASP ASP A . n 
A 1 182 GLU 182 211 211 GLU GLU A . n 
A 1 183 LEU 183 212 212 LEU LEU A . n 
A 1 184 TRP 184 213 213 TRP TRP A . n 
A 1 185 THR 185 214 214 THR THR A . n 
A 1 186 LEU 186 215 215 LEU LEU A . n 
A 1 187 GLY 187 216 216 GLY GLY A . n 
A 1 188 GLU 188 217 217 GLU GLU A . n 
A 1 189 GLY 189 218 218 GLY GLY A . n 
A 1 190 GLN 190 219 219 GLN GLN A . n 
A 1 191 VAL 191 220 220 VAL VAL A . n 
A 1 192 VAL 192 221 221 VAL VAL A . n 
A 1 193 ARG 193 222 222 ARG ARG A . n 
A 1 194 VAL 194 223 223 VAL VAL A . n 
A 1 195 LYS 195 224 224 LYS LYS A . n 
A 1 196 TYR 196 225 225 TYR TYR A . n 
A 1 197 GLY 197 226 226 GLY GLY A . n 
A 1 198 ASN 198 227 227 ASN ASN A . n 
A 1 199 ALA 199 228 228 ALA ALA A . n 
A 1 200 ASP 200 229 229 ASP ASP A . n 
A 1 201 GLY 201 230 230 GLY GLY A . n 
A 1 202 GLU 202 231 231 GLU GLU A . n 
A 1 203 TYR 203 232 232 TYR TYR A . n 
A 1 204 CYS 204 233 233 CYS CYS A . n 
A 1 205 LYS 205 234 234 LYS LYS A . n 
A 1 206 PHE 206 235 235 PHE PHE A . n 
A 1 207 PRO 207 236 236 PRO PRO A . n 
A 1 208 PHE 208 237 237 PHE PHE A . n 
A 1 209 LEU 209 238 238 LEU LEU A . n 
A 1 210 PHE 210 239 239 PHE PHE A . n 
A 1 211 ASN 211 240 240 ASN ASN A . n 
A 1 212 GLY 212 241 241 GLY GLY A . n 
A 1 213 LYS 213 242 242 LYS LYS A . n 
A 1 214 GLU 214 243 243 GLU GLU A . n 
A 1 215 TYR 215 244 244 TYR TYR A . n 
A 1 216 ASN 216 245 245 ASN ASN A . n 
A 1 217 SER 217 246 246 SER SER A . n 
A 1 218 CYS 218 247 247 CYS CYS A . n 
A 1 219 THR 219 248 248 THR THR A . n 
A 1 220 ASP 220 249 249 ASP ASP A . n 
A 1 221 THR 221 250 250 THR THR A . n 
A 1 222 GLY 222 251 251 GLY GLY A . n 
A 1 223 ARG 223 252 252 ARG ARG A . n 
A 1 224 SER 224 253 253 SER SER A . n 
A 1 225 ASP 225 254 254 ASP ASP A . n 
A 1 226 GLY 226 255 255 GLY GLY A . n 
A 1 227 PHE 227 256 256 PHE PHE A . n 
A 1 228 LEU 228 257 257 LEU LEU A . n 
A 1 229 TRP 229 258 258 TRP TRP A . n 
A 1 230 CYS 230 259 259 CYS CYS A . n 
A 1 231 SER 231 260 260 SER SER A . n 
A 1 232 THR 232 261 261 THR THR A . n 
A 1 233 THR 233 262 262 THR THR A . n 
A 1 234 TYR 234 263 263 TYR TYR A . n 
A 1 235 ASN 235 264 264 ASN ASN A . n 
A 1 236 PHE 236 265 265 PHE PHE A . n 
A 1 237 GLU 237 266 266 GLU GLU A . n 
A 1 238 LYS 238 267 267 LYS LYS A . n 
A 1 239 ASP 239 268 268 ASP ASP A . n 
A 1 240 GLY 240 269 269 GLY GLY A . n 
A 1 241 LYS 241 270 270 LYS LYS A . n 
A 1 242 TYR 242 271 271 TYR TYR A . n 
A 1 243 GLY 243 272 272 GLY GLY A . n 
A 1 244 PHE 244 273 273 PHE PHE A . n 
A 1 245 CYS 245 274 274 CYS CYS A . n 
A 1 246 PRO 246 275 275 PRO PRO A . n 
A 1 247 HIS 247 276 276 HIS HIS A . n 
A 1 248 GLU 248 277 277 GLU GLU A . n 
A 1 249 ALA 249 278 278 ALA ALA A . n 
A 1 250 LEU 250 279 279 LEU LEU A . n 
A 1 251 PHE 251 280 280 PHE PHE A . n 
A 1 252 THR 252 281 281 THR THR A . n 
A 1 253 MET 253 282 282 MET MET A . n 
A 1 254 GLY 254 283 283 GLY GLY A . n 
A 1 255 GLY 255 284 284 GLY GLY A . n 
A 1 256 ASN 256 285 285 ASN ASN A . n 
A 1 257 ALA 257 286 286 ALA ALA A . n 
A 1 258 GLU 258 287 287 GLU GLU A . n 
A 1 259 GLY 259 288 288 GLY GLY A . n 
A 1 260 GLN 260 289 289 GLN GLN A . n 
A 1 261 PRO 261 290 290 PRO PRO A . n 
A 1 262 CYS 262 291 291 CYS CYS A . n 
A 1 263 LYS 263 292 292 LYS LYS A . n 
A 1 264 PHE 264 293 293 PHE PHE A . n 
A 1 265 PRO 265 294 294 PRO PRO A . n 
A 1 266 PHE 266 295 295 PHE PHE A . n 
A 1 267 ARG 267 296 296 ARG ARG A . n 
A 1 268 PHE 268 297 297 PHE PHE A . n 
A 1 269 GLN 269 298 298 GLN GLN A . n 
A 1 270 GLY 270 299 299 GLY GLY A . n 
A 1 271 THR 271 300 300 THR THR A . n 
A 1 272 SER 272 301 301 SER SER A . n 
A 1 273 TYR 273 302 302 TYR TYR A . n 
A 1 274 ASP 274 303 303 ASP ASP A . n 
A 1 275 SER 275 304 304 SER SER A . n 
A 1 276 CYS 276 305 305 CYS CYS A . n 
A 1 277 THR 277 306 306 THR THR A . n 
A 1 278 THR 278 307 307 THR THR A . n 
A 1 279 GLU 279 308 308 GLU GLU A . n 
A 1 280 GLY 280 309 309 GLY GLY A . n 
A 1 281 ARG 281 310 310 ARG ARG A . n 
A 1 282 THR 282 311 311 THR THR A . n 
A 1 283 ASP 283 312 312 ASP ASP A . n 
A 1 284 GLY 284 313 313 GLY GLY A . n 
A 1 285 TYR 285 314 314 TYR TYR A . n 
A 1 286 ARG 286 315 315 ARG ARG A . n 
A 1 287 TRP 287 316 316 TRP TRP A . n 
A 1 288 CYS 288 317 317 CYS CYS A . n 
A 1 289 GLY 289 318 318 GLY GLY A . n 
A 1 290 THR 290 319 319 THR THR A . n 
A 1 291 THR 291 320 320 THR THR A . n 
A 1 292 GLU 292 321 321 GLU GLU A . n 
A 1 293 ASP 293 322 322 ASP ASP A . n 
A 1 294 TYR 294 323 323 TYR TYR A . n 
A 1 295 ASP 295 324 324 ASP ASP A . n 
A 1 296 ARG 296 325 325 ARG ARG A . n 
A 1 297 ASP 297 326 326 ASP ASP A . n 
A 1 298 LYS 298 327 327 LYS LYS A . n 
A 1 299 LYS 299 328 328 LYS LYS A . n 
A 1 300 TYR 300 329 329 TYR TYR A . n 
A 1 301 GLY 301 330 330 GLY GLY A . n 
A 1 302 PHE 302 331 331 PHE PHE A . n 
A 1 303 CYS 303 332 332 CYS CYS A . n 
A 1 304 PRO 304 333 333 PRO PRO A . n 
A 1 305 GLU 305 334 334 GLU GLU A . n 
A 1 306 THR 306 335 335 THR THR A . n 
A 1 307 ALA 307 336 336 ALA ALA A . n 
A 1 308 MET 308 337 337 MET MET A . n 
A 1 309 SER 309 338 338 SER SER A . n 
A 1 310 THR 310 339 339 THR THR A . n 
A 1 311 VAL 311 340 340 VAL VAL A . n 
A 1 312 GLY 312 341 341 GLY GLY A . n 
A 1 313 GLY 313 342 342 GLY GLY A . n 
A 1 314 ASN 314 343 343 ASN ASN A . n 
A 1 315 SER 315 344 344 SER SER A . n 
A 1 316 GLU 316 345 345 GLU GLU A . n 
A 1 317 GLY 317 346 346 GLY GLY A . n 
A 1 318 ALA 318 347 347 ALA ALA A . n 
A 1 319 PRO 319 348 348 PRO PRO A . n 
A 1 320 CYS 320 349 349 CYS CYS A . n 
A 1 321 VAL 321 350 350 VAL VAL A . n 
A 1 322 PHE 322 351 351 PHE PHE A . n 
A 1 323 PRO 323 352 352 PRO PRO A . n 
A 1 324 PHE 324 353 353 PHE PHE A . n 
A 1 325 THR 325 354 354 THR THR A . n 
A 1 326 PHE 326 355 355 PHE PHE A . n 
A 1 327 LEU 327 356 356 LEU LEU A . n 
A 1 328 GLY 328 357 357 GLY GLY A . n 
A 1 329 ASN 329 358 358 ASN ASN A . n 
A 1 330 LYS 330 359 359 LYS LYS A . n 
A 1 331 TYR 331 360 360 TYR TYR A . n 
A 1 332 GLU 332 361 361 GLU GLU A . n 
A 1 333 SER 333 362 362 SER SER A . n 
A 1 334 CYS 334 363 363 CYS CYS A . n 
A 1 335 THR 335 364 364 THR THR A . n 
A 1 336 SER 336 365 365 SER SER A . n 
A 1 337 ALA 337 366 366 ALA ALA A . n 
A 1 338 GLY 338 367 367 GLY GLY A . n 
A 1 339 ARG 339 368 368 ARG ARG A . n 
A 1 340 SER 340 369 369 SER SER A . n 
A 1 341 ASP 341 370 370 ASP ASP A . n 
A 1 342 GLY 342 371 371 GLY GLY A . n 
A 1 343 LYS 343 372 372 LYS LYS A . n 
A 1 344 MET 344 373 373 MET MET A . n 
A 1 345 TRP 345 374 374 TRP TRP A . n 
A 1 346 CYS 346 375 375 CYS CYS A . n 
A 1 347 ALA 347 376 376 ALA ALA A . n 
A 1 348 THR 348 377 377 THR THR A . n 
A 1 349 THR 349 378 378 THR THR A . n 
A 1 350 ALA 350 379 379 ALA ALA A . n 
A 1 351 ASN 351 380 380 ASN ASN A . n 
A 1 352 TYR 352 381 381 TYR TYR A . n 
A 1 353 ASP 353 382 382 ASP ASP A . n 
A 1 354 ASP 354 383 383 ASP ASP A . n 
A 1 355 ASP 355 384 384 ASP ASP A . n 
A 1 356 ARG 356 385 385 ARG ARG A . n 
A 1 357 LYS 357 386 386 LYS LYS A . n 
A 1 358 TRP 358 387 387 TRP TRP A . n 
A 1 359 GLY 359 388 388 GLY GLY A . n 
A 1 360 PHE 360 389 389 PHE PHE A . n 
A 1 361 CYS 361 390 390 CYS CYS A . n 
A 1 362 PRO 362 391 391 PRO PRO A . n 
A 1 363 ASP 363 392 392 ASP ASP A . n 
A 1 364 GLN 364 393 393 GLN GLN A . n 
A 1 365 GLY 365 394 394 GLY GLY A . n 
A 1 366 TYR 366 395 395 TYR TYR A . n 
A 1 367 SER 367 396 396 SER SER A . n 
A 1 368 LEU 368 397 397 LEU LEU A . n 
A 1 369 PHE 369 398 398 PHE PHE A . n 
A 1 370 LEU 370 399 399 LEU LEU A . n 
A 1 371 VAL 371 400 400 VAL VAL A . n 
A 1 372 ALA 372 401 401 ALA ALA A . n 
A 1 373 ALA 373 402 402 ALA ALA A . n 
A 1 374 HIS 374 403 403 HIS HIS A . n 
A 1 375 ALA 375 404 404 ALA ALA A . n 
A 1 376 PHE 376 405 405 PHE PHE A . n 
A 1 377 GLY 377 406 406 GLY GLY A . n 
A 1 378 HIS 378 407 407 HIS HIS A . n 
A 1 379 ALA 379 408 408 ALA ALA A . n 
A 1 380 MET 380 409 409 MET MET A . n 
A 1 381 GLY 381 410 410 GLY GLY A . n 
A 1 382 LEU 382 411 411 LEU LEU A . n 
A 1 383 GLU 383 412 412 GLU GLU A . n 
A 1 384 HIS 384 413 413 HIS HIS A . n 
A 1 385 SER 385 414 414 SER SER A . n 
A 1 386 GLN 386 415 415 GLN GLN A . n 
A 1 387 ASP 387 416 416 ASP ASP A . n 
A 1 388 PRO 388 417 417 PRO PRO A . n 
A 1 389 GLY 389 418 418 GLY GLY A . n 
A 1 390 ALA 390 419 419 ALA ALA A . n 
A 1 391 LEU 391 420 420 LEU LEU A . n 
A 1 392 MET 392 421 421 MET MET A . n 
A 1 393 ALA 393 422 422 ALA ALA A . n 
A 1 394 PRO 394 423 423 PRO PRO A . n 
A 1 395 ILE 395 424 424 ILE ILE A . n 
A 1 396 TYR 396 425 425 TYR TYR A . n 
A 1 397 THR 397 426 426 THR THR A . n 
A 1 398 TYR 398 427 427 TYR TYR A . n 
A 1 399 THR 399 428 428 THR THR A . n 
A 1 400 LYS 400 429 429 LYS LYS A . n 
A 1 401 ASN 401 430 430 ASN ASN A . n 
A 1 402 PHE 402 431 431 PHE PHE A . n 
A 1 403 ARG 403 432 432 ARG ARG A . n 
A 1 404 LEU 404 433 433 LEU LEU A . n 
A 1 405 SER 405 434 434 SER SER A . n 
A 1 406 GLN 406 435 435 GLN GLN A . n 
A 1 407 ASP 407 436 436 ASP ASP A . n 
A 1 408 ASP 408 437 437 ASP ASP A . n 
A 1 409 ILE 409 438 438 ILE ILE A . n 
A 1 410 LYS 410 439 439 LYS LYS A . n 
A 1 411 GLY 411 440 440 GLY GLY A . n 
A 1 412 ILE 412 441 441 ILE ILE A . n 
A 1 413 GLN 413 442 442 GLN GLN A . n 
A 1 414 GLU 414 443 443 GLU GLU A . n 
A 1 415 LEU 415 444 444 LEU LEU A . n 
A 1 416 TYR 416 445 445 TYR TYR A . n 
A 1 417 GLY 417 446 446 GLY GLY A . n 
A 1 418 ALA 418 447 447 ALA ALA A . n 
A 1 419 SER 419 448 448 SER SER A . n 
A 1 420 PRO 420 449 449 PRO PRO A . n 
A 1 421 ASP 421 450 ?   ?   ?   A . n 
A 1 422 ILE 422 451 ?   ?   ?   A . n 
A 1 423 ASP 423 452 ?   ?   ?   A . n 
A 1 424 LEU 424 453 ?   ?   ?   A . n 
A 1 425 GLY 425 454 ?   ?   ?   A . n 
A 1 426 THR 426 455 ?   ?   ?   A . n 
A 1 427 GLY 427 456 ?   ?   ?   A . n 
A 1 428 PRO 428 457 ?   ?   ?   A . n 
A 1 429 THR 429 458 ?   ?   ?   A . n 
A 1 430 PRO 430 459 ?   ?   ?   A . n 
A 1 431 THR 431 460 ?   ?   ?   A . n 
A 1 432 LEU 432 461 461 LEU LEU A . n 
A 1 433 GLY 433 462 462 GLY GLY A . n 
A 1 434 PRO 434 463 463 PRO PRO A . n 
A 1 435 VAL 435 464 464 VAL VAL A . n 
A 1 436 THR 436 465 465 THR THR A . n 
A 1 437 PRO 437 466 466 PRO PRO A . n 
A 1 438 GLU 438 467 467 GLU GLU A . n 
A 1 439 ILE 439 468 468 ILE ILE A . n 
A 1 440 CYS 440 469 469 CYS CYS A . n 
A 1 441 LYS 441 470 470 LYS LYS A . n 
A 1 442 GLN 442 471 471 GLN GLN A . n 
A 1 443 ASP 443 472 472 ASP ASP A . n 
A 1 444 ILE 444 473 473 ILE ILE A . n 
A 1 445 VAL 445 474 474 VAL VAL A . n 
A 1 446 PHE 446 475 475 PHE PHE A . n 
A 1 447 ASP 447 476 476 ASP ASP A . n 
A 1 448 GLY 448 477 477 GLY GLY A . n 
A 1 449 ILE 449 478 478 ILE ILE A . n 
A 1 450 ALA 450 479 479 ALA ALA A . n 
A 1 451 GLN 451 480 480 GLN GLN A . n 
A 1 452 ILE 452 481 481 ILE ILE A . n 
A 1 453 ARG 453 482 482 ARG ARG A . n 
A 1 454 GLY 454 483 483 GLY GLY A . n 
A 1 455 GLU 455 484 484 GLU GLU A . n 
A 1 456 ILE 456 485 485 ILE ILE A . n 
A 1 457 PHE 457 486 486 PHE PHE A . n 
A 1 458 PHE 458 487 487 PHE PHE A . n 
A 1 459 PHE 459 488 488 PHE PHE A . n 
A 1 460 LYS 460 489 489 LYS LYS A . n 
A 1 461 ASP 461 490 490 ASP ASP A . n 
A 1 462 ARG 462 491 491 ARG ARG A . n 
A 1 463 PHE 463 492 492 PHE PHE A . n 
A 1 464 ILE 464 493 493 ILE ILE A . n 
A 1 465 TRP 465 494 494 TRP TRP A . n 
A 1 466 ARG 466 495 495 ARG ARG A . n 
A 1 467 THR 467 496 496 THR THR A . n 
A 1 468 VAL 468 497 497 VAL VAL A . n 
A 1 469 THR 469 498 498 THR THR A . n 
A 1 470 PRO 470 499 499 PRO PRO A . n 
A 1 471 ARG 471 500 500 ARG ARG A . n 
A 1 472 ASP 472 501 501 ASP ASP A . n 
A 1 473 LYS 473 502 502 LYS LYS A . n 
A 1 474 PRO 474 503 503 PRO PRO A . n 
A 1 475 MET 475 504 504 MET MET A . n 
A 1 476 GLY 476 505 505 GLY GLY A . n 
A 1 477 PRO 477 506 506 PRO PRO A . n 
A 1 478 LEU 478 507 507 LEU LEU A . n 
A 1 479 LEU 479 508 508 LEU LEU A . n 
A 1 480 VAL 480 509 509 VAL VAL A . n 
A 1 481 ALA 481 510 510 ALA ALA A . n 
A 1 482 THR 482 511 511 THR THR A . n 
A 1 483 PHE 483 512 512 PHE PHE A . n 
A 1 484 TRP 484 513 513 TRP TRP A . n 
A 1 485 PRO 485 514 514 PRO PRO A . n 
A 1 486 GLU 486 515 515 GLU GLU A . n 
A 1 487 LEU 487 516 516 LEU LEU A . n 
A 1 488 PRO 488 517 517 PRO PRO A . n 
A 1 489 GLU 489 518 518 GLU GLU A . n 
A 1 490 LYS 490 519 519 LYS LYS A . n 
A 1 491 ILE 491 520 520 ILE ILE A . n 
A 1 492 ASP 492 521 521 ASP ASP A . n 
A 1 493 ALA 493 522 522 ALA ALA A . n 
A 1 494 VAL 494 523 523 VAL VAL A . n 
A 1 495 TYR 495 524 524 TYR TYR A . n 
A 1 496 GLU 496 525 525 GLU GLU A . n 
A 1 497 ALA 497 526 526 ALA ALA A . n 
A 1 498 PRO 498 527 527 PRO PRO A . n 
A 1 499 GLN 499 528 528 GLN GLN A . n 
A 1 500 GLU 500 529 529 GLU GLU A . n 
A 1 501 GLU 501 530 530 GLU GLU A . n 
A 1 502 LYS 502 531 531 LYS LYS A . n 
A 1 503 ALA 503 532 532 ALA ALA A . n 
A 1 504 VAL 504 533 533 VAL VAL A . n 
A 1 505 PHE 505 534 534 PHE PHE A . n 
A 1 506 PHE 506 535 535 PHE PHE A . n 
A 1 507 ALA 507 536 536 ALA ALA A . n 
A 1 508 GLY 508 537 537 GLY GLY A . n 
A 1 509 ASN 509 538 538 ASN ASN A . n 
A 1 510 GLU 510 539 539 GLU GLU A . n 
A 1 511 TYR 511 540 540 TYR TYR A . n 
A 1 512 TRP 512 541 541 TRP TRP A . n 
A 1 513 ILE 513 542 542 ILE ILE A . n 
A 1 514 TYR 514 543 543 TYR TYR A . n 
A 1 515 SER 515 544 544 SER SER A . n 
A 1 516 ALA 516 545 545 ALA ALA A . n 
A 1 517 SER 517 546 546 SER SER A . n 
A 1 518 THR 518 547 547 THR THR A . n 
A 1 519 LEU 519 548 548 LEU LEU A . n 
A 1 520 GLU 520 549 549 GLU GLU A . n 
A 1 521 ARG 521 550 550 ARG ARG A . n 
A 1 522 GLY 522 551 551 GLY GLY A . n 
A 1 523 TYR 523 552 552 TYR TYR A . n 
A 1 524 PRO 524 553 553 PRO PRO A . n 
A 1 525 LYS 525 554 554 LYS LYS A . n 
A 1 526 PRO 526 555 555 PRO PRO A . n 
A 1 527 LEU 527 556 556 LEU LEU A . n 
A 1 528 THR 528 557 557 THR THR A . n 
A 1 529 SER 529 558 558 SER SER A . n 
A 1 530 LEU 530 559 559 LEU LEU A . n 
A 1 531 GLY 531 560 560 GLY GLY A . n 
A 1 532 LEU 532 561 561 LEU LEU A . n 
A 1 533 PRO 533 562 562 PRO PRO A . n 
A 1 534 PRO 534 563 563 PRO PRO A . n 
A 1 535 ASP 535 564 564 ASP ASP A . n 
A 1 536 VAL 536 565 565 VAL VAL A . n 
A 1 537 GLN 537 566 566 GLN GLN A . n 
A 1 538 ARG 538 567 567 ARG ARG A . n 
A 1 539 VAL 539 568 568 VAL VAL A . n 
A 1 540 ASP 540 569 569 ASP ASP A . n 
A 1 541 ALA 541 570 570 ALA ALA A . n 
A 1 542 ALA 542 571 571 ALA ALA A . n 
A 1 543 PHE 543 572 572 PHE PHE A . n 
A 1 544 ASN 544 573 573 ASN ASN A . n 
A 1 545 TRP 545 574 574 TRP TRP A . n 
A 1 546 SER 546 575 575 SER SER A . n 
A 1 547 LYS 547 576 576 LYS LYS A . n 
A 1 548 ASN 548 577 577 ASN ASN A . n 
A 1 549 LYS 549 578 578 LYS LYS A . n 
A 1 550 LYS 550 579 579 LYS LYS A . n 
A 1 551 THR 551 580 580 THR THR A . n 
A 1 552 TYR 552 581 581 TYR TYR A . n 
A 1 553 ILE 553 582 582 ILE ILE A . n 
A 1 554 PHE 554 583 583 PHE PHE A . n 
A 1 555 ALA 555 584 584 ALA ALA A . n 
A 1 556 GLY 556 585 585 GLY GLY A . n 
A 1 557 ASP 557 586 586 ASP ASP A . n 
A 1 558 LYS 558 587 587 LYS LYS A . n 
A 1 559 PHE 559 588 588 PHE PHE A . n 
A 1 560 TRP 560 589 589 TRP TRP A . n 
A 1 561 ARG 561 590 590 ARG ARG A . n 
A 1 562 TYR 562 591 591 TYR TYR A . n 
A 1 563 ASN 563 592 592 ASN ASN A . n 
A 1 564 GLU 564 593 593 GLU GLU A . n 
A 1 565 VAL 565 594 594 VAL VAL A . n 
A 1 566 LYS 566 595 595 LYS LYS A . n 
A 1 567 LYS 567 596 596 LYS LYS A . n 
A 1 568 LYS 568 597 597 LYS LYS A . n 
A 1 569 MET 569 598 598 MET MET A . n 
A 1 570 ASP 570 599 599 ASP ASP A . n 
A 1 571 PRO 571 600 600 PRO PRO A . n 
A 1 572 GLY 572 601 601 GLY GLY A . n 
A 1 573 PHE 573 602 602 PHE PHE A . n 
A 1 574 PRO 574 603 603 PRO PRO A . n 
A 1 575 LYS 575 604 604 LYS LYS A . n 
A 1 576 LEU 576 605 605 LEU LEU A . n 
A 1 577 ILE 577 606 606 ILE ILE A . n 
A 1 578 ALA 578 607 607 ALA ALA A . n 
A 1 579 ASP 579 608 608 ASP ASP A . n 
A 1 580 ALA 580 609 609 ALA ALA A . n 
A 1 581 TRP 581 610 610 TRP TRP A . n 
A 1 582 ASN 582 611 611 ASN ASN A . n 
A 1 583 ALA 583 612 612 ALA ALA A . n 
A 1 584 ILE 584 613 613 ILE ILE A . n 
A 1 585 PRO 585 614 614 PRO PRO A . n 
A 1 586 ASP 586 615 615 ASP ASP A . n 
A 1 587 ASN 587 616 616 ASN ASN A . n 
A 1 588 LEU 588 617 617 LEU LEU A . n 
A 1 589 ASP 589 618 618 ASP ASP A . n 
A 1 590 ALA 590 619 619 ALA ALA A . n 
A 1 591 VAL 591 620 620 VAL VAL A . n 
A 1 592 VAL 592 621 621 VAL VAL A . n 
A 1 593 ASP 593 622 622 ASP ASP A . n 
A 1 594 LEU 594 623 623 LEU LEU A . n 
A 1 595 GLN 595 624 624 GLN GLN A . n 
A 1 596 GLY 596 625 625 GLY GLY A . n 
A 1 597 GLY 597 626 626 GLY GLY A . n 
A 1 598 GLY 598 627 627 GLY GLY A . n 
A 1 599 HIS 599 628 628 HIS HIS A . n 
A 1 600 SER 600 629 629 SER SER A . n 
A 1 601 TYR 601 630 630 TYR TYR A . n 
A 1 602 PHE 602 631 631 PHE PHE A . n 
A 1 603 PHE 603 632 632 PHE PHE A . n 
A 1 604 LYS 604 633 633 LYS LYS A . n 
A 1 605 GLY 605 634 634 GLY GLY A . n 
A 1 606 ALA 606 635 635 ALA ALA A . n 
A 1 607 TYR 607 636 636 TYR TYR A . n 
A 1 608 TYR 608 637 637 TYR TYR A . n 
A 1 609 LEU 609 638 638 LEU LEU A . n 
A 1 610 LYS 610 639 639 LYS LYS A . n 
A 1 611 LEU 611 640 640 LEU LEU A . n 
A 1 612 GLU 612 641 641 GLU GLU A . n 
A 1 613 ASN 613 642 642 ASN ASN A . n 
A 1 614 GLN 614 643 643 GLN GLN A . n 
A 1 615 SER 615 644 644 SER SER A . n 
A 1 616 LEU 616 645 645 LEU LEU A . n 
A 1 617 LYS 617 646 646 LYS LYS A . n 
A 1 618 SER 618 647 647 SER SER A . n 
A 1 619 VAL 619 648 648 VAL VAL A . n 
A 1 620 LYS 620 649 649 LYS LYS A . n 
A 1 621 PHE 621 650 650 PHE PHE A . n 
A 1 622 GLY 622 651 651 GLY GLY A . n 
A 1 623 SER 623 652 652 SER SER A . n 
A 1 624 ILE 624 653 653 ILE ILE A . n 
A 1 625 LYS 625 654 654 LYS LYS A . n 
A 1 626 SER 626 655 655 SER SER A . n 
A 1 627 ASP 627 656 656 ASP ASP A . n 
A 1 628 TRP 628 657 657 TRP TRP A . n 
A 1 629 LEU 629 658 658 LEU LEU A . n 
A 1 630 GLY 630 659 659 GLY GLY A . n 
A 1 631 CYS 631 660 660 CYS CYS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1   990  990 ZN  ZN  A . 
C 2 ZN  1   991  991 ZN  ZN  A . 
D 3 CA  1   992  992 CA  CA  A . 
E 3 CA  1   993  993 CA  CA  A . 
F 3 CA  1   994  994 CA  CA  A . 
G 4 CL  1   995  995 CL  CL  A . 
H 5 NA  1   996  996 NA  NA  A . 
I 6 SO4 1   777  777 SO4 SO4 A . 
J 6 SO4 1   778  778 SO4 SO4 A . 
K 7 HOH 1   997  1   HOH HOH A . 
K 7 HOH 2   998  2   HOH HOH A . 
K 7 HOH 3   999  3   HOH HOH A . 
K 7 HOH 4   1000 4   HOH HOH A . 
K 7 HOH 5   1001 5   HOH HOH A . 
K 7 HOH 6   1002 6   HOH HOH A . 
K 7 HOH 7   1003 7   HOH HOH A . 
K 7 HOH 8   1004 8   HOH HOH A . 
K 7 HOH 9   1005 9   HOH HOH A . 
K 7 HOH 10  1006 10  HOH HOH A . 
K 7 HOH 11  1007 11  HOH HOH A . 
K 7 HOH 12  1008 12  HOH HOH A . 
K 7 HOH 13  1009 13  HOH HOH A . 
K 7 HOH 14  1010 14  HOH HOH A . 
K 7 HOH 15  1011 15  HOH HOH A . 
K 7 HOH 16  1012 16  HOH HOH A . 
K 7 HOH 17  1013 17  HOH HOH A . 
K 7 HOH 18  1014 18  HOH HOH A . 
K 7 HOH 19  1015 19  HOH HOH A . 
K 7 HOH 20  1016 20  HOH HOH A . 
K 7 HOH 21  1017 21  HOH HOH A . 
K 7 HOH 22  1018 22  HOH HOH A . 
K 7 HOH 23  1019 23  HOH HOH A . 
K 7 HOH 24  1020 24  HOH HOH A . 
K 7 HOH 25  1021 25  HOH HOH A . 
K 7 HOH 26  1022 26  HOH HOH A . 
K 7 HOH 27  1023 27  HOH HOH A . 
K 7 HOH 28  1024 28  HOH HOH A . 
K 7 HOH 29  1025 29  HOH HOH A . 
K 7 HOH 30  1026 30  HOH HOH A . 
K 7 HOH 31  1027 31  HOH HOH A . 
K 7 HOH 32  1028 32  HOH HOH A . 
K 7 HOH 33  1029 33  HOH HOH A . 
K 7 HOH 34  1030 34  HOH HOH A . 
K 7 HOH 35  1031 35  HOH HOH A . 
K 7 HOH 36  1032 36  HOH HOH A . 
K 7 HOH 37  1033 37  HOH HOH A . 
K 7 HOH 38  1034 38  HOH HOH A . 
K 7 HOH 39  1035 39  HOH HOH A . 
K 7 HOH 40  1036 40  HOH HOH A . 
K 7 HOH 41  1037 41  HOH HOH A . 
K 7 HOH 42  1038 42  HOH HOH A . 
K 7 HOH 43  1039 43  HOH HOH A . 
K 7 HOH 44  1040 44  HOH HOH A . 
K 7 HOH 45  1041 45  HOH HOH A . 
K 7 HOH 46  1042 46  HOH HOH A . 
K 7 HOH 47  1043 47  HOH HOH A . 
K 7 HOH 48  1044 48  HOH HOH A . 
K 7 HOH 49  1045 49  HOH HOH A . 
K 7 HOH 50  1046 50  HOH HOH A . 
K 7 HOH 51  1047 51  HOH HOH A . 
K 7 HOH 52  1048 52  HOH HOH A . 
K 7 HOH 53  1049 53  HOH HOH A . 
K 7 HOH 54  1050 54  HOH HOH A . 
K 7 HOH 55  1051 55  HOH HOH A . 
K 7 HOH 56  1052 56  HOH HOH A . 
K 7 HOH 57  1053 57  HOH HOH A . 
K 7 HOH 58  1054 58  HOH HOH A . 
K 7 HOH 59  1055 59  HOH HOH A . 
K 7 HOH 60  1056 60  HOH HOH A . 
K 7 HOH 61  1057 61  HOH HOH A . 
K 7 HOH 62  1058 62  HOH HOH A . 
K 7 HOH 63  1059 63  HOH HOH A . 
K 7 HOH 64  1060 64  HOH HOH A . 
K 7 HOH 65  1061 65  HOH HOH A . 
K 7 HOH 66  1062 66  HOH HOH A . 
K 7 HOH 67  1063 67  HOH HOH A . 
K 7 HOH 68  1064 68  HOH HOH A . 
K 7 HOH 69  1065 69  HOH HOH A . 
K 7 HOH 70  1066 70  HOH HOH A . 
K 7 HOH 71  1067 71  HOH HOH A . 
K 7 HOH 72  1068 72  HOH HOH A . 
K 7 HOH 73  1069 73  HOH HOH A . 
K 7 HOH 74  1070 74  HOH HOH A . 
K 7 HOH 75  1071 75  HOH HOH A . 
K 7 HOH 76  1072 76  HOH HOH A . 
K 7 HOH 77  1073 77  HOH HOH A . 
K 7 HOH 78  1074 78  HOH HOH A . 
K 7 HOH 79  1075 79  HOH HOH A . 
K 7 HOH 80  1076 80  HOH HOH A . 
K 7 HOH 81  1077 81  HOH HOH A . 
K 7 HOH 82  1078 82  HOH HOH A . 
K 7 HOH 83  1079 83  HOH HOH A . 
K 7 HOH 84  1080 84  HOH HOH A . 
K 7 HOH 85  1081 85  HOH HOH A . 
K 7 HOH 86  1082 86  HOH HOH A . 
K 7 HOH 87  1083 87  HOH HOH A . 
K 7 HOH 88  1084 88  HOH HOH A . 
K 7 HOH 89  1085 89  HOH HOH A . 
K 7 HOH 90  1086 90  HOH HOH A . 
K 7 HOH 91  1087 91  HOH HOH A . 
K 7 HOH 92  1088 92  HOH HOH A . 
K 7 HOH 93  1089 93  HOH HOH A . 
K 7 HOH 94  1090 94  HOH HOH A . 
K 7 HOH 95  1091 95  HOH HOH A . 
K 7 HOH 96  1092 96  HOH HOH A . 
K 7 HOH 97  1093 97  HOH HOH A . 
K 7 HOH 98  1094 98  HOH HOH A . 
K 7 HOH 99  1095 99  HOH HOH A . 
K 7 HOH 100 1096 100 HOH HOH A . 
K 7 HOH 101 1097 101 HOH HOH A . 
K 7 HOH 102 1098 102 HOH HOH A . 
K 7 HOH 103 1099 103 HOH HOH A . 
K 7 HOH 104 1100 104 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 73  ? A CYS 102 ? 1_555 ZN ? B ZN . ? A ZN 990 ? 1_555 NE2 ? A HIS 374 ? A HIS 403 ? 1_555 104.3 ? 
2  SG  ? A CYS 73  ? A CYS 102 ? 1_555 ZN ? B ZN . ? A ZN 990 ? 1_555 NE2 ? A HIS 378 ? A HIS 407 ? 1_555 114.1 ? 
3  NE2 ? A HIS 374 ? A HIS 403 ? 1_555 ZN ? B ZN . ? A ZN 990 ? 1_555 NE2 ? A HIS 378 ? A HIS 407 ? 1_555 106.5 ? 
4  SG  ? A CYS 73  ? A CYS 102 ? 1_555 ZN ? B ZN . ? A ZN 990 ? 1_555 NE2 ? A HIS 384 ? A HIS 413 ? 1_555 109.4 ? 
5  NE2 ? A HIS 374 ? A HIS 403 ? 1_555 ZN ? B ZN . ? A ZN 990 ? 1_555 NE2 ? A HIS 384 ? A HIS 413 ? 1_555 112.4 ? 
6  NE2 ? A HIS 378 ? A HIS 407 ? 1_555 ZN ? B ZN . ? A ZN 990 ? 1_555 NE2 ? A HIS 384 ? A HIS 413 ? 1_555 110.1 ? 
7  OE1 ? A GLU 137 ? A GLU 166 ? 1_555 CA ? E CA . ? A CA 993 ? 1_555 O   ? A ALA 138 ? A ALA 167 ? 1_555 60.4  ? 
8  OE1 ? A GLU 137 ? A GLU 166 ? 1_555 CA ? E CA . ? A CA 993 ? 1_555 O   ? A ASP 139 ? A ASP 168 ? 1_555 129.4 ? 
9  O   ? A ALA 138 ? A ALA 167 ? 1_555 CA ? E CA . ? A CA 993 ? 1_555 O   ? A ASP 139 ? A ASP 168 ? 1_555 69.2  ? 
10 OE1 ? A GLU 137 ? A GLU 166 ? 1_555 CA ? E CA . ? A CA 993 ? 1_555 O   ? A GLY 171 ? A GLY 200 ? 1_555 96.9  ? 
11 O   ? A ALA 138 ? A ALA 167 ? 1_555 CA ? E CA . ? A CA 993 ? 1_555 O   ? A GLY 171 ? A GLY 200 ? 1_555 157.3 ? 
12 O   ? A ASP 139 ? A ASP 168 ? 1_555 CA ? E CA . ? A CA 993 ? 1_555 O   ? A GLY 171 ? A GLY 200 ? 1_555 133.5 ? 
13 NE2 ? A HIS 149 ? A HIS 178 ? 1_555 ZN ? C ZN . ? A ZN 991 ? 1_555 OD2 ? A ASP 151 ? A ASP 180 ? 1_555 118.0 ? 
14 NE2 ? A HIS 149 ? A HIS 178 ? 1_555 ZN ? C ZN . ? A ZN 991 ? 1_555 NE2 ? A HIS 164 ? A HIS 193 ? 1_555 80.9  ? 
15 OD2 ? A ASP 151 ? A ASP 180 ? 1_555 ZN ? C ZN . ? A ZN 991 ? 1_555 NE2 ? A HIS 164 ? A HIS 193 ? 1_555 127.2 ? 
16 NE2 ? A HIS 149 ? A HIS 178 ? 1_555 ZN ? C ZN . ? A ZN 991 ? 1_555 ND1 ? A HIS 177 ? A HIS 206 ? 1_555 104.3 ? 
17 OD2 ? A ASP 151 ? A ASP 180 ? 1_555 ZN ? C ZN . ? A ZN 991 ? 1_555 ND1 ? A HIS 177 ? A HIS 206 ? 1_555 89.6  ? 
18 NE2 ? A HIS 164 ? A HIS 193 ? 1_555 ZN ? C ZN . ? A ZN 991 ? 1_555 ND1 ? A HIS 177 ? A HIS 206 ? 1_555 135.9 ? 
19 O   ? A ASP 156 ? A ASP 185 ? 1_555 CA ? D CA . ? A CA 992 ? 1_555 O   ? A GLY 157 ? A GLY 186 ? 1_555 55.5  ? 
20 O   ? A ASP 156 ? A ASP 185 ? 1_555 CA ? D CA . ? A CA 992 ? 1_555 O   ? A ASP 159 ? A ASP 188 ? 1_555 95.0  ? 
21 O   ? A GLY 157 ? A GLY 186 ? 1_555 CA ? D CA . ? A CA 992 ? 1_555 O   ? A ASP 159 ? A ASP 188 ? 1_555 82.4  ? 
22 O   ? A ASP 156 ? A ASP 185 ? 1_555 CA ? D CA . ? A CA 992 ? 1_555 O   ? A LEU 161 ? A LEU 190 ? 1_555 128.7 ? 
23 O   ? A GLY 157 ? A GLY 186 ? 1_555 CA ? D CA . ? A CA 992 ? 1_555 O   ? A LEU 161 ? A LEU 190 ? 1_555 171.7 ? 
24 O   ? A ASP 159 ? A ASP 188 ? 1_555 CA ? D CA . ? A CA 992 ? 1_555 O   ? A LEU 161 ? A LEU 190 ? 1_555 89.9  ? 
25 O   ? A ASP 156 ? A ASP 185 ? 1_555 CA ? D CA . ? A CA 992 ? 1_555 OD2 ? A ASP 179 ? A ASP 208 ? 1_555 85.3  ? 
26 O   ? A GLY 157 ? A GLY 186 ? 1_555 CA ? D CA . ? A CA 992 ? 1_555 OD2 ? A ASP 179 ? A ASP 208 ? 1_555 89.5  ? 
27 O   ? A ASP 159 ? A ASP 188 ? 1_555 CA ? D CA . ? A CA 992 ? 1_555 OD2 ? A ASP 179 ? A ASP 208 ? 1_555 169.9 ? 
28 O   ? A LEU 161 ? A LEU 190 ? 1_555 CA ? D CA . ? A CA 992 ? 1_555 OD2 ? A ASP 179 ? A ASP 208 ? 1_555 97.8  ? 
29 O   ? A ASP 156 ? A ASP 185 ? 1_555 CA ? D CA . ? A CA 992 ? 1_555 OE2 ? A GLU 182 ? A GLU 211 ? 1_555 135.3 ? 
30 O   ? A GLY 157 ? A GLY 186 ? 1_555 CA ? D CA . ? A CA 992 ? 1_555 OE2 ? A GLU 182 ? A GLU 211 ? 1_555 81.8  ? 
31 O   ? A ASP 159 ? A ASP 188 ? 1_555 CA ? D CA . ? A CA 992 ? 1_555 OE2 ? A GLU 182 ? A GLU 211 ? 1_555 63.9  ? 
32 O   ? A LEU 161 ? A LEU 190 ? 1_555 CA ? D CA . ? A CA 992 ? 1_555 OE2 ? A GLU 182 ? A GLU 211 ? 1_555 92.1  ? 
33 OD2 ? A ASP 179 ? A ASP 208 ? 1_555 CA ? D CA . ? A CA 992 ? 1_555 OE2 ? A GLU 182 ? A GLU 211 ? 1_555 109.1 ? 
34 O   ? A ASP 447 ? A ASP 476 ? 1_555 CA ? F CA . ? A CA 994 ? 1_555 O   ? A ASP 492 ? A ASP 521 ? 1_555 81.7  ? 
35 O   ? A ASP 447 ? A ASP 476 ? 1_555 CA ? F CA . ? A CA 994 ? 1_555 O   ? A ASP 540 ? A ASP 569 ? 1_555 147.8 ? 
36 O   ? A ASP 492 ? A ASP 521 ? 1_555 CA ? F CA . ? A CA 994 ? 1_555 O   ? A ASP 540 ? A ASP 569 ? 1_555 82.9  ? 
37 O   ? A ASP 447 ? A ASP 476 ? 1_555 CA ? F CA . ? A CA 994 ? 1_555 O   ? A ASP 589 ? A ASP 618 ? 1_555 105.9 ? 
38 O   ? A ASP 492 ? A ASP 521 ? 1_555 CA ? F CA . ? A CA 994 ? 1_555 O   ? A ASP 589 ? A ASP 618 ? 1_555 124.4 ? 
39 O   ? A ASP 540 ? A ASP 569 ? 1_555 CA ? F CA . ? A CA 994 ? 1_555 O   ? A ASP 589 ? A ASP 618 ? 1_555 61.5  ? 
40 O   ? A ILE 449 ? A ILE 478 ? 1_555 NA ? H NA . ? A NA 996 ? 1_555 O   ? A VAL 494 ? A VAL 523 ? 1_555 128.4 ? 
41 O   ? A ILE 449 ? A ILE 478 ? 1_555 NA ? H NA . ? A NA 996 ? 1_555 O   ? A ALA 542 ? A ALA 571 ? 1_555 141.2 ? 
42 O   ? A VAL 494 ? A VAL 523 ? 1_555 NA ? H NA . ? A NA 996 ? 1_555 O   ? A ALA 542 ? A ALA 571 ? 1_555 85.2  ? 
43 O   ? A ILE 449 ? A ILE 478 ? 1_555 NA ? H NA . ? A NA 996 ? 1_555 O   ? A VAL 591 ? A VAL 620 ? 1_555 77.4  ? 
44 O   ? A VAL 494 ? A VAL 523 ? 1_555 NA ? H NA . ? A NA 996 ? 1_555 O   ? A VAL 591 ? A VAL 620 ? 1_555 154.2 ? 
45 O   ? A ALA 542 ? A ALA 571 ? 1_555 NA ? H NA . ? A NA 996 ? 1_555 O   ? A VAL 591 ? A VAL 620 ? 1_555 71.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-08-25 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-04-04 
5 'Structure model' 1 4 2018-04-11 
6 'Structure model' 1 5 2021-11-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 5 'Structure model' 'Data collection'           
5 6 'Structure model' 'Database references'       
6 6 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' diffrn_source          
2 5 'Structure model' diffrn_source          
3 6 'Structure model' database_2             
4 6 'Structure model' pdbx_struct_conn_angle 
5 6 'Structure model' struct_conn            
6 6 'Structure model' struct_ref_seq_dif     
7 6 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_diffrn_source.type'                         
2  5 'Structure model' '_diffrn_source.pdbx_synchrotron_beamline'    
3  6 'Structure model' '_database_2.pdbx_DOI'                        
4  6 'Structure model' '_database_2.pdbx_database_accession'         
5  6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
6  6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
7  6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
8  6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
9  6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
10 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
11 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
12 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
13 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
14 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
15 6 'Structure model' '_pdbx_struct_conn_angle.value'               
16 6 'Structure model' '_struct_conn.pdbx_dist_value'                
17 6 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
18 6 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
19 6 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
20 6 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
21 6 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
22 6 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
23 6 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
24 6 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
25 6 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
26 6 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
27 6 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
28 6 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
29 6 'Structure model' '_struct_ref_seq_dif.details'                 
30 6 'Structure model' '_struct_site.pdbx_auth_asym_id'              
31 6 'Structure model' '_struct_site.pdbx_auth_comp_id'              
32 6 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
XDS    'data scaling'   .         ? 1 
SCALA  'data scaling'   .         ? 2 
AMoRE  phasing          .         ? 3 
REFMAC refinement       .         ? 4 
XDS    'data reduction' .         ? 5 
CCP4   'data scaling'   '(SCALA)' ? 6 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OH  A TYR 591 ? ? O   A HOH 1016 ? ? 1.99 
2 1 O   A ALA 635 ? ? O   A HOH 1094 ? ? 2.06 
3 1 NE2 A GLN 149 ? ? O   A HOH 1014 ? ? 2.14 
4 1 NZ  A LYS 531 ? ? OE2 A GLU 549  ? ? 2.15 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    ND2 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    ASN 
_pdbx_validate_symm_contact.auth_seq_id_1     240 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    ND2 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    ASN 
_pdbx_validate_symm_contact.auth_seq_id_2     240 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   10_675 
_pdbx_validate_symm_contact.dist              1.61 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            C 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             660 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OXT 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             660 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                2.794 
_pdbx_validate_rmsd_bond.bond_target_value         1.229 
_pdbx_validate_rmsd_bond.bond_deviation            1.565 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.019 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB  A CYS 60  ? ? CA A CYS 60  ? ? C   A CYS 60  ? ? 121.22 111.50 9.72   1.20 N 
2  1 CA  A CYS 60  ? ? CB A CYS 60  ? ? SG  A CYS 60  ? ? 129.43 114.20 15.23  1.10 N 
3  1 CB  A ASP 134 ? ? CG A ASP 134 ? ? OD2 A ASP 134 ? ? 123.95 118.30 5.65   0.90 N 
4  1 NE  A ARG 175 ? ? CZ A ARG 175 ? ? NH2 A ARG 175 ? ? 115.51 120.30 -4.79  0.50 N 
5  1 N   A TYR 182 ? ? CA A TYR 182 ? ? CB  A TYR 182 ? ? 98.74  110.60 -11.86 1.80 N 
6  1 CB  A PHE 184 ? ? CG A PHE 184 ? ? CD2 A PHE 184 ? ? 125.21 120.80 4.41   0.70 N 
7  1 CB  A ASP 185 ? ? CG A ASP 185 ? ? OD1 A ASP 185 ? ? 124.76 118.30 6.46   0.90 N 
8  1 O   A GLY 186 ? ? C  A GLY 186 ? ? N   A LYS 187 ? ? 112.03 122.70 -10.67 1.60 Y 
9  1 CA  A HIS 193 ? ? CB A HIS 193 ? ? CG  A HIS 193 ? ? 124.40 113.60 10.80  1.70 N 
10 1 NE  A ARG 222 ? ? CZ A ARG 222 ? ? NH1 A ARG 222 ? ? 124.65 120.30 4.35   0.50 N 
11 1 NE  A ARG 222 ? ? CZ A ARG 222 ? ? NH2 A ARG 222 ? ? 117.23 120.30 -3.07  0.50 N 
12 1 O   A ASP 229 ? ? C  A ASP 229 ? ? N   A GLY 230 ? ? 111.94 123.20 -11.26 1.70 Y 
13 1 CA  A CYS 233 ? ? CB A CYS 233 ? ? SG  A CYS 233 ? ? 122.77 114.20 8.57   1.10 N 
14 1 C   A ASN 240 ? ? N  A GLY 241 ? ? CA  A GLY 241 ? ? 109.47 122.30 -12.83 2.10 Y 
15 1 CA  A CYS 247 ? ? CB A CYS 247 ? ? SG  A CYS 247 ? ? 120.82 114.20 6.62   1.10 N 
16 1 NH1 A ARG 252 ? ? CZ A ARG 252 ? ? NH2 A ARG 252 ? ? 126.13 119.40 6.73   1.10 N 
17 1 NE  A ARG 252 ? ? CZ A ARG 252 ? ? NH2 A ARG 252 ? ? 115.89 120.30 -4.41  0.50 N 
18 1 C   A PHE 297 ? ? N  A GLN 298 ? ? CA  A GLN 298 ? ? 105.27 121.70 -16.43 2.50 Y 
19 1 CA  A ARG 315 ? ? CB A ARG 315 ? ? CG  A ARG 315 ? ? 126.79 113.40 13.39  2.20 N 
20 1 CB  A ASP 383 ? ? CG A ASP 383 ? ? OD2 A ASP 383 ? ? 112.69 118.30 -5.61  0.90 N 
21 1 CD  A ARG 385 ? ? NE A ARG 385 ? ? CZ  A ARG 385 ? ? 134.25 123.60 10.65  1.40 N 
22 1 CA  A TYR 524 ? ? CB A TYR 524 ? ? CG  A TYR 524 ? ? 132.45 113.40 19.05  1.90 N 
23 1 CA  A TRP 589 ? ? CB A TRP 589 ? ? CG  A TRP 589 ? ? 126.00 113.70 12.30  1.90 N 
24 1 N   A GLU 641 ? ? CA A GLU 641 ? ? CB  A GLU 641 ? ? 125.66 110.60 15.06  1.80 N 
25 1 C   A GLY 659 ? ? N  A CYS 660 ? ? CA  A CYS 660 ? ? 148.28 121.70 26.58  2.50 Y 
26 1 CA  A CYS 660 ? ? CB A CYS 660 ? ? SG  A CYS 660 ? ? 127.09 114.20 12.89  1.10 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 32  ? ? 174.02  99.28   
2  1 GLN A 91  ? ? -38.99  -28.01  
3  1 ALA A 108 ? ? 69.91   98.30   
4  1 TYR A 110 ? ? -144.34 49.97   
5  1 ASN A 111 ? ? -119.74 61.08   
6  1 LYS A 118 ? ? -166.66 113.78  
7  1 TRP A 119 ? ? -32.91  131.03  
8  1 ARG A 175 ? ? -111.34 -162.08 
9  1 TRP A 176 ? ? -39.99  -76.63  
10 1 ASP A 188 ? ? 61.75   -160.45 
11 1 PHE A 297 ? ? -102.58 -67.50  
12 1 GLN A 298 ? ? -130.55 -55.67  
13 1 ASP A 392 ? ? -105.85 -165.48 
14 1 LYS A 439 ? ? -47.47  -71.64  
15 1 TYR A 445 ? ? -129.80 -169.75 
16 1 SER A 448 ? ? 155.99  150.35  
17 1 ILE A 481 ? ? -115.53 -120.83 
18 1 LYS A 489 ? ? -145.62 -141.71 
19 1 ASP A 490 ? ? -62.66  -96.82  
20 1 SER A 546 ? ? 82.57   -2.49   
21 1 PHE A 572 ? ? 161.25  159.56  
22 1 LYS A 639 ? ? -102.94 -167.82 
23 1 LEU A 640 ? ? -173.53 140.04  
24 1 SER A 647 ? ? -52.81  103.14  
25 1 LYS A 649 ? ? -175.37 133.14  
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             ASP 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              185 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   10.60 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 30  ? A ALA 1   
2  1 Y 1 A ASP 450 ? A ASP 421 
3  1 Y 1 A ILE 451 ? A ILE 422 
4  1 Y 1 A ASP 452 ? A ASP 423 
5  1 Y 1 A LEU 453 ? A LEU 424 
6  1 Y 1 A GLY 454 ? A GLY 425 
7  1 Y 1 A THR 455 ? A THR 426 
8  1 Y 1 A GLY 456 ? A GLY 427 
9  1 Y 1 A PRO 457 ? A PRO 428 
10 1 Y 1 A THR 458 ? A THR 429 
11 1 Y 1 A PRO 459 ? A PRO 430 
12 1 Y 1 A THR 460 ? A THR 431 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'     ZN  
3 'CALCIUM ION'  CA  
4 'CHLORIDE ION' CL  
5 'SODIUM ION'   NA  
6 'SULFATE ION'  SO4 
7 water          HOH 
#