data_1CKB
# 
_entry.id   1CKB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1CKB         
WWPDB D_1000172358 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1CKB 
_pdbx_database_status.recvd_initial_deposition_date   1995-01-24 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wu, X.'      1 
'Kuriyan, J.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for the specific interaction of lysine-containing proline-rich peptides with the N-terminal SH3 domain of c-Crk.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            3 
_citation.page_first                215 
_citation.page_last                 226 
_citation.year                      1995 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   7735837 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(01)00151-4' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wu, X.'       1 
primary 'Knudsen, B.'  2 
primary 'Feller, S.M.' 3 
primary 'Zheng, J.'    4 
primary 'Sali, A.'     5 
primary 'Cowburn, D.'  6 
primary 'Hanafusa, H.' 7 
primary 'Kuriyan, J.'  8 
# 
_cell.entry_id           1CKB 
_cell.length_a           47.400 
_cell.length_b           47.400 
_cell.length_c           29.500 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1CKB 
_symmetry.space_group_name_H-M             'P 41' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                76 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'C-CRK N-TERMINAL SH3 DOMAIN'                           6814.538 1  ? ? ? ? 
2 polymer man 'SOS PEPTIDE (PRO-PRO-PRO-VAL-PRO-PRO-ARG-ARG-ARG-ARG)' 1231.495 1  ? ? ? ? 
3 water   nat water                                                   18.015   68 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKY 
AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKY A ? 
2 'polypeptide(L)' no no PPPVPPRRRR                                                PPPVPPRRRR B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  GLU n 
1 3  TYR n 
1 4  VAL n 
1 5  ARG n 
1 6  ALA n 
1 7  LEU n 
1 8  PHE n 
1 9  ASP n 
1 10 PHE n 
1 11 ASN n 
1 12 GLY n 
1 13 ASN n 
1 14 ASP n 
1 15 GLU n 
1 16 GLU n 
1 17 ASP n 
1 18 LEU n 
1 19 PRO n 
1 20 PHE n 
1 21 LYS n 
1 22 LYS n 
1 23 GLY n 
1 24 ASP n 
1 25 ILE n 
1 26 LEU n 
1 27 ARG n 
1 28 ILE n 
1 29 ARG n 
1 30 ASP n 
1 31 LYS n 
1 32 PRO n 
1 33 GLU n 
1 34 GLU n 
1 35 GLN n 
1 36 TRP n 
1 37 TRP n 
1 38 ASN n 
1 39 ALA n 
1 40 GLU n 
1 41 ASP n 
1 42 SER n 
1 43 GLU n 
1 44 GLY n 
1 45 LYS n 
1 46 ARG n 
1 47 GLY n 
1 48 MET n 
1 49 ILE n 
1 50 PRO n 
1 51 VAL n 
1 52 PRO n 
1 53 TYR n 
1 54 VAL n 
1 55 GLU n 
1 56 LYS n 
1 57 TYR n 
2 1  PRO n 
2 2  PRO n 
2 3  PRO n 
2 4  VAL n 
2 5  PRO n 
2 6  PRO n 
2 7  ARG n 
2 8  ARG n 
2 9  ARG n 
2 10 ARG n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'house mouse' Mus  'PCR PRODUCT' ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia 'PCR PRODUCT' ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human         Homo ?             ? ? ? ? ? ? 'Homo sapiens' 9606  ? ? ? ? ? ? ? ? ?                  ?   ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP CRK_MOUSE 1 Q64010 1 
;MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPP
GVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVARSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILR
IRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPDEDFS
;
? 
2 PDB 1CKB      2 1CKB   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1CKB A 1 ? 57 ? Q64010 134 ? 190 ? 134 190 
2 2 1CKB B 1 ? 10 ? 1CKB   1   ? 10  ? 1   10  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1CKB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.06 
_exptl_crystal.density_percent_sol   40.21 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IIC' 
_diffrn_detector.pdbx_collection_date   1994-11-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      ? 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1CKB 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            ? 
_reflns.number_obs                   5289 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.1 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1CKB 
_refine.ls_number_reflns_obs                     4616 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6.0 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1830000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1830000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               10.1 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        537 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             204 
_refine_hist.number_atoms_total               741 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        6.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.011 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1CKB 
_struct.title                     
'STRUCTURAL BASIS FOR THE SPECIFIC INTERACTION OF LYSINE-CONTAINING PROLINE-RICH PEPTIDES WITH THE N-TERMINAL SH3 DOMAIN OF C-CRK' 
_struct.pdbx_descriptor           
'C-CRK (N-TERMINAL SH3 DOMAIN) (C-CRKSH3-N) COMPLEXED WITH SOS PEPTIDE (PRO-PRO-PRO-VAL-PRO-PRO-ARG-ARG-ARG-ARG)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1CKB 
_struct_keywords.pdbx_keywords   'COMPLEX (ONCOGENE PROTEIN/PEPTIDE)' 
_struct_keywords.text            'COMPLEX (ONCOGENE PROTEIN-PEPTIDE), COMPLEX (ONCOGENE PROTEIN-PEPTIDE) complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       VAL 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        51 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       TYR 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        53 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        VAL 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         184 
_struct_conf.end_auth_comp_id        TYR 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         186 
_struct_conf.pdbx_PDB_helix_class    5 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 54 ? LYS A 56 ? VAL A 187 LYS A 189 
A 2 TYR A 3  ? ALA A 6  ? TYR A 136 ALA A 139 
A 3 ILE A 25 ? ASP A 30 ? ILE A 158 ASP A 163 
A 4 TRP A 36 ? GLU A 40 ? TRP A 169 GLU A 173 
A 5 ARG A 46 ? PRO A 50 ? ARG A 179 PRO A 183 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU A 55 ? O GLU A 188 N ARG A 5  ? N ARG A 138 
A 2 3 O VAL A 4  ? O VAL A 137 N LEU A 26 ? N LEU A 159 
A 3 4 O ARG A 27 ? O ARG A 160 N GLU A 40 ? N GLU A 173 
A 4 5 O TRP A 37 ? O TRP A 170 N ILE A 49 ? N ILE A 182 
# 
_database_PDB_matrix.entry_id          1CKB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1CKB 
_atom_sites.fract_transf_matrix[1][1]   0.021097 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021097 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.033898 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . ALA A 1 1  ? 95.934  127.424 21.911 1.00 19.24 ? 134 ALA A N   1 
ATOM   2   C CA  . ALA A 1 1  ? 96.764  127.821 20.744 1.00 19.78 ? 134 ALA A CA  1 
ATOM   3   C C   . ALA A 1 1  ? 98.231  127.722 21.157 1.00 19.38 ? 134 ALA A C   1 
ATOM   4   O O   . ALA A 1 1  ? 98.534  127.662 22.357 1.00 21.22 ? 134 ALA A O   1 
ATOM   5   C CB  . ALA A 1 1  ? 96.432  129.238 20.343 1.00 18.62 ? 134 ALA A CB  1 
ATOM   6   N N   . GLU A 1 2  ? 99.129  127.660 20.182 1.00 15.51 ? 135 GLU A N   1 
ATOM   7   C CA  . GLU A 1 2  ? 100.547 127.592 20.480 1.00 11.18 ? 135 GLU A CA  1 
ATOM   8   C C   . GLU A 1 2  ? 101.093 128.983 20.227 1.00 10.59 ? 135 GLU A C   1 
ATOM   9   O O   . GLU A 1 2  ? 101.007 129.474 19.111 1.00 9.22  ? 135 GLU A O   1 
ATOM   10  C CB  . GLU A 1 2  ? 101.250 126.590 19.561 1.00 10.30 ? 135 GLU A CB  1 
ATOM   11  C CG  . GLU A 1 2  ? 102.749 126.462 19.849 1.00 10.72 ? 135 GLU A CG  1 
ATOM   12  C CD  . GLU A 1 2  ? 103.445 125.432 18.976 1.00 11.67 ? 135 GLU A CD  1 
ATOM   13  O OE1 . GLU A 1 2  ? 102.775 124.703 18.229 1.00 9.42  ? 135 GLU A OE1 1 
ATOM   14  O OE2 . GLU A 1 2  ? 104.676 125.352 19.046 1.00 12.46 ? 135 GLU A OE2 1 
ATOM   15  N N   . TYR A 1 3  ? 101.644 129.614 21.257 1.00 10.70 ? 136 TYR A N   1 
ATOM   16  C CA  . TYR A 1 3  ? 102.209 130.963 21.129 1.00 9.55  ? 136 TYR A CA  1 
ATOM   17  C C   . TYR A 1 3  ? 103.664 130.984 21.535 1.00 8.20  ? 136 TYR A C   1 
ATOM   18  O O   . TYR A 1 3  ? 104.076 130.271 22.462 1.00 7.47  ? 136 TYR A O   1 
ATOM   19  C CB  . TYR A 1 3  ? 101.488 131.970 22.036 1.00 12.38 ? 136 TYR A CB  1 
ATOM   20  C CG  . TYR A 1 3  ? 100.059 132.238 21.661 1.00 14.86 ? 136 TYR A CG  1 
ATOM   21  C CD1 . TYR A 1 3  ? 99.756  133.044 20.569 1.00 11.24 ? 136 TYR A CD1 1 
ATOM   22  C CD2 . TYR A 1 3  ? 99.006  131.672 22.382 1.00 15.59 ? 136 TYR A CD2 1 
ATOM   23  C CE1 . TYR A 1 3  ? 98.453  133.269 20.182 1.00 14.79 ? 136 TYR A CE1 1 
ATOM   24  C CE2 . TYR A 1 3  ? 97.683  131.898 21.998 1.00 19.31 ? 136 TYR A CE2 1 
ATOM   25  C CZ  . TYR A 1 3  ? 97.426  132.705 20.887 1.00 15.82 ? 136 TYR A CZ  1 
ATOM   26  O OH  . TYR A 1 3  ? 96.148  132.905 20.433 1.00 21.77 ? 136 TYR A OH  1 
ATOM   27  N N   . VAL A 1 4  ? 104.414 131.873 20.890 1.00 11.25 ? 137 VAL A N   1 
ATOM   28  C CA  . VAL A 1 4  ? 105.825 132.078 21.176 1.00 6.44  ? 137 VAL A CA  1 
ATOM   29  C C   . VAL A 1 4  ? 106.066 133.584 21.361 1.00 7.89  ? 137 VAL A C   1 
ATOM   30  O O   . VAL A 1 4  ? 105.246 134.400 20.936 1.00 5.67  ? 137 VAL A O   1 
ATOM   31  C CB  . VAL A 1 4  ? 106.747 131.487 20.063 1.00 6.64  ? 137 VAL A CB  1 
ATOM   32  C CG1 . VAL A 1 4  ? 106.424 130.011 19.843 1.00 7.10  ? 137 VAL A CG1 1 
ATOM   33  C CG2 . VAL A 1 4  ? 106.628 132.268 18.764 1.00 4.43  ? 137 VAL A CG2 1 
ATOM   34  N N   . ARG A 1 5  ? 107.127 133.933 22.086 1.00 6.89  ? 138 ARG A N   1 
ATOM   35  C CA  . ARG A 1 5  ? 107.486 135.326 22.302 1.00 8.59  ? 138 ARG A CA  1 
ATOM   36  C C   . ARG A 1 5  ? 108.818 135.601 21.601 1.00 8.33  ? 138 ARG A C   1 
ATOM   37  O O   . ARG A 1 5  ? 109.758 134.816 21.708 1.00 9.59  ? 138 ARG A O   1 
ATOM   38  C CB  . ARG A 1 5  ? 107.597 135.636 23.801 1.00 5.17  ? 138 ARG A CB  1 
ATOM   39  C CG  . ARG A 1 5  ? 108.043 137.049 24.092 1.00 15.13 ? 138 ARG A CG  1 
ATOM   40  C CD  . ARG A 1 5  ? 108.308 137.266 25.567 1.00 16.99 ? 138 ARG A CD  1 
ATOM   41  N NE  . ARG A 1 5  ? 107.086 137.325 26.380 1.00 19.80 ? 138 ARG A NE  1 
ATOM   42  C CZ  . ARG A 1 5  ? 106.707 136.383 27.240 1.00 15.69 ? 138 ARG A CZ  1 
ATOM   43  N NH1 . ARG A 1 5  ? 107.434 135.282 27.398 1.00 12.82 ? 138 ARG A NH1 1 
ATOM   44  N NH2 . ARG A 1 5  ? 105.653 136.588 28.013 1.00 17.92 ? 138 ARG A NH2 1 
ATOM   45  N N   . ALA A 1 6  ? 108.874 136.685 20.833 1.00 6.46  ? 139 ALA A N   1 
ATOM   46  C CA  . ALA A 1 6  ? 110.084 137.062 20.120 1.00 7.27  ? 139 ALA A CA  1 
ATOM   47  C C   . ALA A 1 6  ? 111.178 137.505 21.105 1.00 5.34  ? 139 ALA A C   1 
ATOM   48  O O   . ALA A 1 6  ? 110.975 138.400 21.929 1.00 7.46  ? 139 ALA A O   1 
ATOM   49  C CB  . ALA A 1 6  ? 109.773 138.169 19.123 1.00 4.57  ? 139 ALA A CB  1 
ATOM   50  N N   . LEU A 1 7  ? 112.326 136.840 21.043 1.00 9.08  ? 140 LEU A N   1 
ATOM   51  C CA  . LEU A 1 7  ? 113.474 137.134 21.914 1.00 8.58  ? 140 LEU A CA  1 
ATOM   52  C C   . LEU A 1 7  ? 114.353 138.231 21.349 1.00 6.09  ? 140 LEU A C   1 
ATOM   53  O O   . LEU A 1 7  ? 115.093 138.894 22.098 1.00 6.64  ? 140 LEU A O   1 
ATOM   54  C CB  . LEU A 1 7  ? 114.330 135.874 22.108 1.00 5.99  ? 140 LEU A CB  1 
ATOM   55  C CG  . LEU A 1 7  ? 113.621 134.737 22.833 1.00 12.07 ? 140 LEU A CG  1 
ATOM   56  C CD1 . LEU A 1 7  ? 114.481 133.488 22.811 1.00 9.75  ? 140 LEU A CD1 1 
ATOM   57  C CD2 . LEU A 1 7  ? 113.300 135.189 24.245 1.00 11.39 ? 140 LEU A CD2 1 
ATOM   58  N N   . PHE A 1 8  ? 114.258 138.411 20.033 1.00 4.59  ? 141 PHE A N   1 
ATOM   59  C CA  . PHE A 1 8  ? 115.033 139.403 19.275 1.00 6.02  ? 141 PHE A CA  1 
ATOM   60  C C   . PHE A 1 8  ? 114.190 139.877 18.109 1.00 5.01  ? 141 PHE A C   1 
ATOM   61  O O   . PHE A 1 8  ? 113.215 139.229 17.759 1.00 6.58  ? 141 PHE A O   1 
ATOM   62  C CB  . PHE A 1 8  ? 116.306 138.748 18.667 1.00 9.76  ? 141 PHE A CB  1 
ATOM   63  C CG  . PHE A 1 8  ? 117.174 138.035 19.666 1.00 7.65  ? 141 PHE A CG  1 
ATOM   64  C CD1 . PHE A 1 8  ? 116.956 136.699 19.962 1.00 15.98 ? 141 PHE A CD1 1 
ATOM   65  C CD2 . PHE A 1 8  ? 118.192 138.707 20.321 1.00 15.03 ? 141 PHE A CD2 1 
ATOM   66  C CE1 . PHE A 1 8  ? 117.735 136.044 20.911 1.00 15.62 ? 141 PHE A CE1 1 
ATOM   67  C CE2 . PHE A 1 8  ? 118.977 138.057 21.269 1.00 16.20 ? 141 PHE A CE2 1 
ATOM   68  C CZ  . PHE A 1 8  ? 118.742 136.727 21.556 1.00 13.12 ? 141 PHE A CZ  1 
ATOM   69  N N   . ASP A 1 9  ? 114.563 141.006 17.514 1.00 9.36  ? 142 ASP A N   1 
ATOM   70  C CA  . ASP A 1 9  ? 113.873 141.524 16.323 1.00 9.03  ? 142 ASP A CA  1 
ATOM   71  C C   . ASP A 1 9  ? 114.297 140.614 15.165 1.00 8.31  ? 142 ASP A C   1 
ATOM   72  O O   . ASP A 1 9  ? 115.414 140.097 15.158 1.00 8.90  ? 142 ASP A O   1 
ATOM   73  C CB  . ASP A 1 9  ? 114.356 142.932 15.936 1.00 9.27  ? 142 ASP A CB  1 
ATOM   74  C CG  . ASP A 1 9  ? 114.084 143.990 16.993 1.00 12.58 ? 142 ASP A CG  1 
ATOM   75  O OD1 . ASP A 1 9  ? 113.162 143.855 17.814 1.00 8.21  ? 142 ASP A OD1 1 
ATOM   76  O OD2 . ASP A 1 9  ? 114.792 145.007 16.962 1.00 11.16 ? 142 ASP A OD2 1 
ATOM   77  N N   . PHE A 1 10 ? 113.444 140.464 14.165 1.00 6.86  ? 143 PHE A N   1 
ATOM   78  C CA  . PHE A 1 10 ? 113.784 139.652 13.008 1.00 4.71  ? 143 PHE A CA  1 
ATOM   79  C C   . PHE A 1 10 ? 113.264 140.486 11.855 1.00 8.20  ? 143 PHE A C   1 
ATOM   80  O O   . PHE A 1 10 ? 112.081 140.827 11.795 1.00 7.91  ? 143 PHE A O   1 
ATOM   81  C CB  . PHE A 1 10 ? 113.111 138.256 13.062 1.00 7.48  ? 143 PHE A CB  1 
ATOM   82  C CG  . PHE A 1 10 ? 113.254 137.444 11.787 1.00 9.89  ? 143 PHE A CG  1 
ATOM   83  C CD1 . PHE A 1 10 ? 114.517 137.093 11.295 1.00 10.27 ? 143 PHE A CD1 1 
ATOM   84  C CD2 . PHE A 1 10 ? 112.126 137.050 11.066 1.00 8.21  ? 143 PHE A CD2 1 
ATOM   85  C CE1 . PHE A 1 10 ? 114.645 136.357 10.096 1.00 8.83  ? 143 PHE A CE1 1 
ATOM   86  C CE2 . PHE A 1 10 ? 112.242 136.309 9.862  1.00 10.63 ? 143 PHE A CE2 1 
ATOM   87  C CZ  . PHE A 1 10 ? 113.511 135.973 9.385  1.00 11.18 ? 143 PHE A CZ  1 
ATOM   88  N N   . ASN A 1 11 ? 114.169 140.885 10.977 1.00 7.49  ? 144 ASN A N   1 
ATOM   89  C CA  . ASN A 1 11 ? 113.781 141.724 9.858  1.00 10.46 ? 144 ASN A CA  1 
ATOM   90  C C   . ASN A 1 11 ? 113.188 140.957 8.686  1.00 11.80 ? 144 ASN A C   1 
ATOM   91  O O   . ASN A 1 11 ? 112.430 141.520 7.907  1.00 15.04 ? 144 ASN A O   1 
ATOM   92  C CB  . ASN A 1 11 ? 114.983 142.543 9.386  1.00 12.75 ? 144 ASN A CB  1 
ATOM   93  C CG  . ASN A 1 11 ? 115.396 143.579 10.386 1.00 15.73 ? 144 ASN A CG  1 
ATOM   94  O OD1 . ASN A 1 11 ? 114.586 144.026 11.200 1.00 16.22 ? 144 ASN A OD1 1 
ATOM   95  N ND2 . ASN A 1 11 ? 116.662 143.958 10.355 1.00 15.84 ? 144 ASN A ND2 1 
ATOM   96  N N   . GLY A 1 12 ? 113.514 139.674 8.568  1.00 10.44 ? 145 GLY A N   1 
ATOM   97  C CA  . GLY A 1 12 ? 113.006 138.903 7.452  1.00 11.62 ? 145 GLY A CA  1 
ATOM   98  C C   . GLY A 1 12 ? 114.029 139.002 6.338  1.00 16.80 ? 145 GLY A C   1 
ATOM   99  O O   . GLY A 1 12 ? 114.640 140.056 6.132  1.00 15.07 ? 145 GLY A O   1 
ATOM   100 N N   . ASN A 1 13 ? 114.243 137.894 5.641  1.00 18.58 ? 146 ASN A N   1 
ATOM   101 C CA  . ASN A 1 13 ? 115.219 137.837 4.555  1.00 24.59 ? 146 ASN A CA  1 
ATOM   102 C C   . ASN A 1 13 ? 114.518 137.507 3.252  1.00 23.11 ? 146 ASN A C   1 
ATOM   103 O O   . ASN A 1 13 ? 114.680 138.200 2.253  1.00 29.20 ? 146 ASN A O   1 
ATOM   104 C CB  . ASN A 1 13 ? 116.292 136.788 4.868  1.00 30.88 ? 146 ASN A CB  1 
ATOM   105 C CG  . ASN A 1 13 ? 117.015 137.066 6.188  1.00 35.40 ? 146 ASN A CG  1 
ATOM   106 O OD1 . ASN A 1 13 ? 117.549 138.147 6.394  1.00 43.40 ? 146 ASN A OD1 1 
ATOM   107 N ND2 . ASN A 1 13 ? 116.993 136.110 7.099  1.00 40.90 ? 146 ASN A ND2 1 
ATOM   108 N N   . ASP A 1 14 ? 113.744 136.434 3.267  1.00 20.23 ? 147 ASP A N   1 
ATOM   109 C CA  . ASP A 1 14 ? 112.983 136.030 2.107  1.00 17.64 ? 147 ASP A CA  1 
ATOM   110 C C   . ASP A 1 14 ? 111.603 136.637 2.198  1.00 16.38 ? 147 ASP A C   1 
ATOM   111 O O   . ASP A 1 14 ? 111.144 136.985 3.279  1.00 15.31 ? 147 ASP A O   1 
ATOM   112 C CB  . ASP A 1 14 ? 112.897 134.510 2.029  1.00 22.08 ? 147 ASP A CB  1 
ATOM   113 C CG  . ASP A 1 14 ? 114.177 133.892 1.497  1.00 30.70 ? 147 ASP A CG  1 
ATOM   114 O OD1 . ASP A 1 14 ? 115.113 134.653 1.134  1.00 27.87 ? 147 ASP A OD1 1 
ATOM   115 O OD2 . ASP A 1 14 ? 114.232 132.643 1.414  1.00 32.82 ? 147 ASP A OD2 1 
ATOM   116 N N   . GLU A 1 15 ? 110.946 136.770 1.059  1.00 12.05 ? 148 GLU A N   1 
ATOM   117 C CA  . GLU A 1 15 ? 109.617 137.345 1.018  1.00 9.31  ? 148 GLU A CA  1 
ATOM   118 C C   . GLU A 1 15 ? 108.588 136.550 1.809  1.00 11.13 ? 148 GLU A C   1 
ATOM   119 O O   . GLU A 1 15 ? 107.568 137.108 2.199  1.00 13.92 ? 148 GLU A O   1 
ATOM   120 C CB  . GLU A 1 15 ? 109.171 137.501 -0.427 1.00 9.70  ? 148 GLU A CB  1 
ATOM   121 C CG  . GLU A 1 15 ? 109.891 138.601 -1.161 1.00 15.33 ? 148 GLU A CG  1 
ATOM   122 C CD  . GLU A 1 15 ? 109.564 139.965 -0.587 1.00 24.00 ? 148 GLU A CD  1 
ATOM   123 O OE1 . GLU A 1 15 ? 108.463 140.473 -0.873 1.00 25.17 ? 148 GLU A OE1 1 
ATOM   124 O OE2 . GLU A 1 15 ? 110.399 140.517 0.168  1.00 29.73 ? 148 GLU A OE2 1 
ATOM   125 N N   . GLU A 1 16 ? 108.825 135.250 2.014  1.00 10.65 ? 149 GLU A N   1 
ATOM   126 C CA  . GLU A 1 16 ? 107.907 134.401 2.792  1.00 10.55 ? 149 GLU A CA  1 
ATOM   127 C C   . GLU A 1 16 ? 108.053 134.609 4.310  1.00 10.33 ? 149 GLU A C   1 
ATOM   128 O O   . GLU A 1 16 ? 107.263 134.086 5.089  1.00 10.15 ? 149 GLU A O   1 
ATOM   129 C CB  . GLU A 1 16 ? 108.169 132.914 2.511  1.00 10.74 ? 149 GLU A CB  1 
ATOM   130 C CG  . GLU A 1 16 ? 109.508 132.422 3.071  1.00 20.75 ? 149 GLU A CG  1 
ATOM   131 C CD  . GLU A 1 16 ? 109.769 130.940 2.822  1.00 31.10 ? 149 GLU A CD  1 
ATOM   132 O OE1 . GLU A 1 16 ? 108.886 130.116 3.153  1.00 31.48 ? 149 GLU A OE1 1 
ATOM   133 O OE2 . GLU A 1 16 ? 110.854 130.598 2.290  1.00 33.74 ? 149 GLU A OE2 1 
ATOM   134 N N   . ASP A 1 17 ? 109.101 135.297 4.732  1.00 6.36  ? 150 ASP A N   1 
ATOM   135 C CA  . ASP A 1 17 ? 109.342 135.514 6.150  1.00 6.72  ? 150 ASP A CA  1 
ATOM   136 C C   . ASP A 1 17 ? 108.404 136.495 6.826  1.00 8.08  ? 150 ASP A C   1 
ATOM   137 O O   . ASP A 1 17 ? 107.961 137.470 6.213  1.00 10.70 ? 150 ASP A O   1 
ATOM   138 C CB  . ASP A 1 17 ? 110.784 136.001 6.353  1.00 7.76  ? 150 ASP A CB  1 
ATOM   139 C CG  . ASP A 1 17 ? 111.807 134.948 5.993  1.00 8.49  ? 150 ASP A CG  1 
ATOM   140 O OD1 . ASP A 1 17 ? 111.376 133.809 5.785  1.00 11.25 ? 150 ASP A OD1 1 
ATOM   141 O OD2 . ASP A 1 17 ? 113.016 135.246 5.924  1.00 9.38  ? 150 ASP A OD2 1 
ATOM   142 N N   . LEU A 1 18 ? 108.174 136.282 8.118  1.00 11.00 ? 151 LEU A N   1 
ATOM   143 C CA  . LEU A 1 18 ? 107.323 137.175 8.910  1.00 9.51  ? 151 LEU A CA  1 
ATOM   144 C C   . LEU A 1 18 ? 108.237 138.024 9.796  1.00 6.74  ? 151 LEU A C   1 
ATOM   145 O O   . LEU A 1 18 ? 108.829 137.517 10.754 1.00 4.07  ? 151 LEU A O   1 
ATOM   146 C CB  . LEU A 1 18 ? 106.340 136.395 9.792  1.00 3.98  ? 151 LEU A CB  1 
ATOM   147 C CG  . LEU A 1 18 ? 105.432 137.212 10.727 1.00 2.00  ? 151 LEU A CG  1 
ATOM   148 C CD1 . LEU A 1 18 ? 104.567 138.191 9.919  1.00 5.89  ? 151 LEU A CD1 1 
ATOM   149 C CD2 . LEU A 1 18 ? 104.534 136.266 11.545 1.00 5.65  ? 151 LEU A CD2 1 
ATOM   150 N N   . PRO A 1 19 ? 108.422 139.303 9.437  1.00 6.70  ? 152 PRO A N   1 
ATOM   151 C CA  . PRO A 1 19 ? 109.275 140.193 10.234 1.00 5.21  ? 152 PRO A CA  1 
ATOM   152 C C   . PRO A 1 19 ? 108.585 140.427 11.574 1.00 4.48  ? 152 PRO A C   1 
ATOM   153 O O   . PRO A 1 19 ? 107.358 140.405 11.645 1.00 6.21  ? 152 PRO A O   1 
ATOM   154 C CB  . PRO A 1 19 ? 109.283 141.491 9.406  1.00 4.46  ? 152 PRO A CB  1 
ATOM   155 C CG  . PRO A 1 19 ? 108.992 141.036 8.003  1.00 5.68  ? 152 PRO A CG  1 
ATOM   156 C CD  . PRO A 1 19 ? 107.935 139.984 8.225  1.00 6.89  ? 152 PRO A CD  1 
ATOM   157 N N   . PHE A 1 20 ? 109.352 140.632 12.639 1.00 5.09  ? 153 PHE A N   1 
ATOM   158 C CA  . PHE A 1 20 ? 108.786 140.890 13.955 1.00 5.03  ? 153 PHE A CA  1 
ATOM   159 C C   . PHE A 1 20 ? 109.800 141.584 14.848 1.00 6.74  ? 153 PHE A C   1 
ATOM   160 O O   . PHE A 1 20 ? 110.987 141.672 14.512 1.00 4.38  ? 153 PHE A O   1 
ATOM   161 C CB  . PHE A 1 20 ? 108.238 139.613 14.633 1.00 4.01  ? 153 PHE A CB  1 
ATOM   162 C CG  . PHE A 1 20 ? 109.237 138.484 14.770 1.00 2.06  ? 153 PHE A CG  1 
ATOM   163 C CD1 . PHE A 1 20 ? 110.199 138.489 15.770 1.00 4.42  ? 153 PHE A CD1 1 
ATOM   164 C CD2 . PHE A 1 20 ? 109.184 137.385 13.907 1.00 5.34  ? 153 PHE A CD2 1 
ATOM   165 C CE1 . PHE A 1 20 ? 111.095 137.425 15.916 1.00 3.51  ? 153 PHE A CE1 1 
ATOM   166 C CE2 . PHE A 1 20 ? 110.069 136.319 14.041 1.00 5.35  ? 153 PHE A CE2 1 
ATOM   167 C CZ  . PHE A 1 20 ? 111.036 136.335 15.052 1.00 2.32  ? 153 PHE A CZ  1 
ATOM   168 N N   . LYS A 1 21 ? 109.328 142.095 15.982 1.00 7.12  ? 154 LYS A N   1 
ATOM   169 C CA  . LYS A 1 21 ? 110.198 142.790 16.939 1.00 8.60  ? 154 LYS A CA  1 
ATOM   170 C C   . LYS A 1 21 ? 110.231 142.050 18.279 1.00 5.61  ? 154 LYS A C   1 
ATOM   171 O O   . LYS A 1 21 ? 109.259 141.411 18.673 1.00 3.55  ? 154 LYS A O   1 
ATOM   172 C CB  . LYS A 1 21 ? 109.704 144.226 17.174 1.00 5.97  ? 154 LYS A CB  1 
ATOM   173 C CG  . LYS A 1 21 ? 109.708 145.127 15.949 1.00 6.17  ? 154 LYS A CG  1 
ATOM   174 C CD  . LYS A 1 21 ? 111.117 145.481 15.536 1.00 8.13  ? 154 LYS A CD  1 
ATOM   175 C CE  . LYS A 1 21 ? 111.068 146.350 14.299 1.00 10.67 ? 154 LYS A CE  1 
ATOM   176 N NZ  . LYS A 1 21 ? 112.436 146.701 13.864 1.00 14.54 ? 154 LYS A NZ  1 
ATOM   177 N N   . LYS A 1 22 ? 111.348 142.154 18.983 1.00 4.84  ? 155 LYS A N   1 
ATOM   178 C CA  . LYS A 1 22 ? 111.468 141.518 20.273 1.00 7.31  ? 155 LYS A CA  1 
ATOM   179 C C   . LYS A 1 22 ? 110.223 141.873 21.100 1.00 9.29  ? 155 LYS A C   1 
ATOM   180 O O   . LYS A 1 22 ? 109.775 143.036 21.110 1.00 11.73 ? 155 LYS A O   1 
ATOM   181 C CB  . LYS A 1 22 ? 112.729 142.018 20.986 1.00 8.58  ? 155 LYS A CB  1 
ATOM   182 C CG  . LYS A 1 22 ? 112.873 141.561 22.416 1.00 4.90  ? 155 LYS A CG  1 
ATOM   183 C CD  . LYS A 1 22 ? 114.255 141.951 22.945 1.00 9.87  ? 155 LYS A CD  1 
ATOM   184 C CE  . LYS A 1 22 ? 114.387 141.591 24.422 1.00 12.14 ? 155 LYS A CE  1 
ATOM   185 N NZ  . LYS A 1 22 ? 115.782 141.764 24.900 1.00 19.14 ? 155 LYS A NZ  1 
ATOM   186 N N   . GLY A 1 23 ? 109.651 140.867 21.755 1.00 5.29  ? 156 GLY A N   1 
ATOM   187 C CA  . GLY A 1 23 ? 108.481 141.090 22.564 1.00 7.60  ? 156 GLY A CA  1 
ATOM   188 C C   . GLY A 1 23 ? 107.176 140.713 21.894 1.00 6.97  ? 156 GLY A C   1 
ATOM   189 O O   . GLY A 1 23 ? 106.184 140.478 22.578 1.00 8.05  ? 156 GLY A O   1 
ATOM   190 N N   . ASP A 1 24 ? 107.154 140.635 20.571 1.00 7.28  ? 157 ASP A N   1 
ATOM   191 C CA  . ASP A 1 24 ? 105.915 140.284 19.891 1.00 7.77  ? 157 ASP A CA  1 
ATOM   192 C C   . ASP A 1 24 ? 105.473 138.883 20.268 1.00 7.64  ? 157 ASP A C   1 
ATOM   193 O O   . ASP A 1 24 ? 106.305 138.027 20.463 1.00 4.83  ? 157 ASP A O   1 
ATOM   194 C CB  . ASP A 1 24 ? 106.077 140.315 18.361 1.00 10.11 ? 157 ASP A CB  1 
ATOM   195 C CG  . ASP A 1 24 ? 106.143 141.725 17.789 1.00 9.42  ? 157 ASP A CG  1 
ATOM   196 O OD1 . ASP A 1 24 ? 105.812 142.703 18.495 1.00 7.06  ? 157 ASP A OD1 1 
ATOM   197 O OD2 . ASP A 1 24 ? 106.518 141.852 16.605 1.00 8.07  ? 157 ASP A OD2 1 
ATOM   198 N N   . ILE A 1 25 ? 104.165 138.678 20.394 1.00 3.02  ? 158 ILE A N   1 
ATOM   199 C CA  . ILE A 1 25 ? 103.611 137.355 20.672 1.00 7.11  ? 158 ILE A CA  1 
ATOM   200 C C   . ILE A 1 25 ? 103.104 136.840 19.328 1.00 7.00  ? 158 ILE A C   1 
ATOM   201 O O   . ILE A 1 25 ? 102.366 137.547 18.612 1.00 8.56  ? 158 ILE A O   1 
ATOM   202 C CB  . ILE A 1 25 ? 102.463 137.393 21.730 1.00 11.79 ? 158 ILE A CB  1 
ATOM   203 C CG1 . ILE A 1 25 ? 102.981 137.964 23.067 1.00 10.30 ? 158 ILE A CG1 1 
ATOM   204 C CG2 . ILE A 1 25 ? 101.914 135.973 21.972 1.00 8.59  ? 158 ILE A CG2 1 
ATOM   205 C CD1 . ILE A 1 25 ? 104.144 137.192 23.665 1.00 9.65  ? 158 ILE A CD1 1 
ATOM   206 N N   . LEU A 1 26 ? 103.601 135.672 18.926 1.00 6.55  ? 159 LEU A N   1 
ATOM   207 C CA  . LEU A 1 26 ? 103.222 135.060 17.648 1.00 6.75  ? 159 LEU A CA  1 
ATOM   208 C C   . LEU A 1 26 ? 102.529 133.711 17.843 1.00 4.35  ? 159 LEU A C   1 
ATOM   209 O O   . LEU A 1 26 ? 102.875 132.957 18.749 1.00 5.14  ? 159 LEU A O   1 
ATOM   210 C CB  . LEU A 1 26 ? 104.469 134.863 16.784 1.00 9.09  ? 159 LEU A CB  1 
ATOM   211 C CG  . LEU A 1 26 ? 105.351 136.103 16.599 1.00 10.29 ? 159 LEU A CG  1 
ATOM   212 C CD1 . LEU A 1 26 ? 106.813 135.717 16.485 1.00 12.15 ? 159 LEU A CD1 1 
ATOM   213 C CD2 . LEU A 1 26 ? 104.896 136.875 15.390 1.00 14.85 ? 159 LEU A CD2 1 
ATOM   214 N N   . ARG A 1 27 ? 101.573 133.391 16.980 1.00 4.51  ? 160 ARG A N   1 
ATOM   215 C CA  . ARG A 1 27 ? 100.899 132.106 17.091 1.00 7.43  ? 160 ARG A CA  1 
ATOM   216 C C   . ARG A 1 27 ? 101.451 131.156 16.043 1.00 6.07  ? 160 ARG A C   1 
ATOM   217 O O   . ARG A 1 27 ? 101.544 131.513 14.878 1.00 3.90  ? 160 ARG A O   1 
ATOM   218 C CB  . ARG A 1 27 ? 99.375  132.238 16.935 1.00 9.23  ? 160 ARG A CB  1 
ATOM   219 C CG  . ARG A 1 27 ? 98.615  130.985 17.419 1.00 9.88  ? 160 ARG A CG  1 
ATOM   220 C CD  . ARG A 1 27 ? 97.102  131.096 17.267 1.00 4.31  ? 160 ARG A CD  1 
ATOM   221 N NE  . ARG A 1 27 ? 96.704  131.399 15.891 1.00 6.99  ? 160 ARG A NE  1 
ATOM   222 C CZ  . ARG A 1 27 ? 96.578  130.495 14.935 1.00 4.09  ? 160 ARG A CZ  1 
ATOM   223 N NH1 . ARG A 1 27 ? 96.815  129.210 15.207 1.00 3.94  ? 160 ARG A NH1 1 
ATOM   224 N NH2 . ARG A 1 27 ? 96.298  130.885 13.694 1.00 5.29  ? 160 ARG A NH2 1 
ATOM   225 N N   . ILE A 1 28 ? 101.816 129.944 16.463 1.00 6.34  ? 161 ILE A N   1 
ATOM   226 C CA  . ILE A 1 28 ? 102.357 128.948 15.534 1.00 7.17  ? 161 ILE A CA  1 
ATOM   227 C C   . ILE A 1 28 ? 101.222 128.220 14.798 1.00 7.92  ? 161 ILE A C   1 
ATOM   228 O O   . ILE A 1 28 ? 100.278 127.702 15.417 1.00 4.31  ? 161 ILE A O   1 
ATOM   229 C CB  . ILE A 1 28 ? 103.293 127.926 16.256 1.00 5.71  ? 161 ILE A CB  1 
ATOM   230 C CG1 . ILE A 1 28 ? 104.349 128.664 17.091 1.00 3.52  ? 161 ILE A CG1 1 
ATOM   231 C CG2 . ILE A 1 28 ? 103.975 126.999 15.238 1.00 4.88  ? 161 ILE A CG2 1 
ATOM   232 C CD1 . ILE A 1 28 ? 105.247 129.622 16.282 1.00 5.42  ? 161 ILE A CD1 1 
ATOM   233 N N   . ARG A 1 29 ? 101.300 128.235 13.471 1.00 4.15  ? 162 ARG A N   1 
ATOM   234 C CA  . ARG A 1 29 ? 100.304 127.593 12.630 1.00 5.45  ? 162 ARG A CA  1 
ATOM   235 C C   . ARG A 1 29 ? 100.789 126.254 12.058 1.00 8.66  ? 162 ARG A C   1 
ATOM   236 O O   . ARG A 1 29 ? 99.995  125.318 11.855 1.00 9.85  ? 162 ARG A O   1 
ATOM   237 C CB  . ARG A 1 29 ? 99.937  128.510 11.451 1.00 5.85  ? 162 ARG A CB  1 
ATOM   238 C CG  . ARG A 1 29 ? 99.360  129.861 11.840 1.00 2.00  ? 162 ARG A CG  1 
ATOM   239 C CD  . ARG A 1 29 ? 98.998  130.673 10.599 1.00 3.25  ? 162 ARG A CD  1 
ATOM   240 N NE  . ARG A 1 29 ? 97.915  130.041 9.856  1.00 4.01  ? 162 ARG A NE  1 
ATOM   241 C CZ  . ARG A 1 29 ? 98.045  129.493 8.654  1.00 4.20  ? 162 ARG A CZ  1 
ATOM   242 N NH1 . ARG A 1 29 ? 99.212  129.513 8.021  1.00 5.48  ? 162 ARG A NH1 1 
ATOM   243 N NH2 . ARG A 1 29 ? 97.021  128.862 8.114  1.00 4.74  ? 162 ARG A NH2 1 
ATOM   244 N N   . ASP A 1 30 ? 102.090 126.144 11.807 1.00 8.60  ? 163 ASP A N   1 
ATOM   245 C CA  . ASP A 1 30 ? 102.603 124.926 11.206 1.00 10.74 ? 163 ASP A CA  1 
ATOM   246 C C   . ASP A 1 30 ? 104.126 124.871 11.382 1.00 11.25 ? 163 ASP A C   1 
ATOM   247 O O   . ASP A 1 30 ? 104.762 125.910 11.563 1.00 6.37  ? 163 ASP A O   1 
ATOM   248 C CB  . ASP A 1 30 ? 102.248 124.970 9.709  1.00 16.81 ? 163 ASP A CB  1 
ATOM   249 C CG  . ASP A 1 30 ? 102.424 123.641 9.013  1.00 20.85 ? 163 ASP A CG  1 
ATOM   250 O OD1 . ASP A 1 30 ? 102.070 122.592 9.601  1.00 24.18 ? 163 ASP A OD1 1 
ATOM   251 O OD2 . ASP A 1 30 ? 102.898 123.660 7.855  1.00 23.87 ? 163 ASP A OD2 1 
ATOM   252 N N   . LYS A 1 31 ? 104.697 123.664 11.321 1.00 6.02  ? 164 LYS A N   1 
ATOM   253 C CA  . LYS A 1 31 ? 106.140 123.474 11.465 1.00 5.06  ? 164 LYS A CA  1 
ATOM   254 C C   . LYS A 1 31 ? 106.596 122.609 10.295 1.00 7.89  ? 164 LYS A C   1 
ATOM   255 O O   . LYS A 1 31 ? 106.763 121.393 10.431 1.00 9.16  ? 164 LYS A O   1 
ATOM   256 C CB  . LYS A 1 31 ? 106.456 122.765 12.790 1.00 8.32  ? 164 LYS A CB  1 
ATOM   257 C CG  . LYS A 1 31 ? 105.859 123.455 14.004 1.00 7.88  ? 164 LYS A CG  1 
ATOM   258 C CD  . LYS A 1 31 ? 106.268 122.780 15.314 1.00 12.16 ? 164 LYS A CD  1 
ATOM   259 C CE  . LYS A 1 31 ? 105.634 123.534 16.489 1.00 16.77 ? 164 LYS A CE  1 
ATOM   260 N NZ  . LYS A 1 31 ? 106.184 123.194 17.834 1.00 25.08 ? 164 LYS A NZ  1 
ATOM   261 N N   . PRO A 1 32 ? 106.751 123.212 9.109  1.00 7.06  ? 165 PRO A N   1 
ATOM   262 C CA  . PRO A 1 32 ? 107.183 122.425 7.952  1.00 5.48  ? 165 PRO A CA  1 
ATOM   263 C C   . PRO A 1 32 ? 108.651 122.029 8.048  1.00 13.16 ? 165 PRO A C   1 
ATOM   264 O O   . PRO A 1 32 ? 109.118 121.141 7.329  1.00 15.22 ? 165 PRO A O   1 
ATOM   265 C CB  . PRO A 1 32 ? 106.910 123.373 6.787  1.00 6.97  ? 165 PRO A CB  1 
ATOM   266 C CG  . PRO A 1 32 ? 107.092 124.740 7.388  1.00 8.94  ? 165 PRO A CG  1 
ATOM   267 C CD  . PRO A 1 32 ? 106.466 124.613 8.741  1.00 4.53  ? 165 PRO A CD  1 
ATOM   268 N N   . GLU A 1 33 ? 109.377 122.691 8.946  1.00 12.26 ? 166 GLU A N   1 
ATOM   269 C CA  . GLU A 1 33 ? 110.788 122.433 9.163  1.00 14.98 ? 166 GLU A CA  1 
ATOM   270 C C   . GLU A 1 33 ? 111.025 122.488 10.659 1.00 14.57 ? 166 GLU A C   1 
ATOM   271 O O   . GLU A 1 33 ? 110.217 123.034 11.398 1.00 16.09 ? 166 GLU A O   1 
ATOM   272 C CB  . GLU A 1 33 ? 111.582 123.548 8.537  1.00 19.89 ? 166 GLU A CB  1 
ATOM   273 C CG  . GLU A 1 33 ? 112.648 123.092 7.641  1.00 29.07 ? 166 GLU A CG  1 
ATOM   274 C CD  . GLU A 1 33 ? 113.447 124.257 7.171  1.00 28.36 ? 166 GLU A CD  1 
ATOM   275 O OE1 . GLU A 1 33 ? 112.928 124.995 6.312  1.00 35.01 ? 166 GLU A OE1 1 
ATOM   276 O OE2 . GLU A 1 33 ? 114.562 124.459 7.689  1.00 33.95 ? 166 GLU A OE2 1 
ATOM   277 N N   . GLU A 1 34 ? 112.174 122.005 11.103 1.00 12.50 ? 167 GLU A N   1 
ATOM   278 C CA  . GLU A 1 34 ? 112.478 122.022 12.519 1.00 11.92 ? 167 GLU A CA  1 
ATOM   279 C C   . GLU A 1 34 ? 112.770 123.424 13.057 1.00 12.27 ? 167 GLU A C   1 
ATOM   280 O O   . GLU A 1 34 ? 112.306 123.777 14.144 1.00 11.03 ? 167 GLU A O   1 
ATOM   281 C CB  . GLU A 1 34 ? 113.675 121.108 12.817 1.00 21.43 ? 167 GLU A CB  1 
ATOM   282 C CG  . GLU A 1 34 ? 114.008 121.026 14.294 1.00 29.10 ? 167 GLU A CG  1 
ATOM   283 C CD  . GLU A 1 34 ? 115.220 120.178 14.571 1.00 38.82 ? 167 GLU A CD  1 
ATOM   284 O OE1 . GLU A 1 34 ? 115.134 118.933 14.384 1.00 39.25 ? 167 GLU A OE1 1 
ATOM   285 O OE2 . GLU A 1 34 ? 116.253 120.765 14.974 1.00 41.87 ? 167 GLU A OE2 1 
ATOM   286 N N   . GLN A 1 35 ? 113.565 124.194 12.312 1.00 10.90 ? 168 GLN A N   1 
ATOM   287 C CA  . GLN A 1 35 ? 113.968 125.552 12.709 1.00 11.30 ? 168 GLN A CA  1 
ATOM   288 C C   . GLN A 1 35 ? 113.232 126.713 12.028 1.00 8.92  ? 168 GLN A C   1 
ATOM   289 O O   . GLN A 1 35 ? 113.588 127.874 12.253 1.00 9.62  ? 168 GLN A O   1 
ATOM   290 C CB  . GLN A 1 35 ? 115.484 125.777 12.520 1.00 10.17 ? 168 GLN A CB  1 
ATOM   291 C CG  . GLN A 1 35 ? 116.405 124.935 13.410 1.00 24.14 ? 168 GLN A CG  1 
ATOM   292 C CD  . GLN A 1 35 ? 116.060 124.974 14.895 1.00 29.89 ? 168 GLN A CD  1 
ATOM   293 O OE1 . GLN A 1 35 ? 115.821 123.924 15.495 1.00 40.01 ? 168 GLN A OE1 1 
ATOM   294 N NE2 . GLN A 1 35 ? 116.049 126.165 15.500 1.00 21.81 ? 168 GLN A NE2 1 
ATOM   295 N N   . TRP A 1 36 ? 112.249 126.409 11.177 1.00 11.00 ? 169 TRP A N   1 
ATOM   296 C CA  . TRP A 1 36 ? 111.459 127.430 10.481 1.00 10.03 ? 169 TRP A CA  1 
ATOM   297 C C   . TRP A 1 36 ? 109.992 127.024 10.571 1.00 11.54 ? 169 TRP A C   1 
ATOM   298 O O   . TRP A 1 36 ? 109.590 125.966 10.082 1.00 9.87  ? 169 TRP A O   1 
ATOM   299 C CB  . TRP A 1 36 ? 111.884 127.584 9.010  1.00 8.57  ? 169 TRP A CB  1 
ATOM   300 C CG  . TRP A 1 36 ? 113.230 128.314 8.807  1.00 6.51  ? 169 TRP A CG  1 
ATOM   301 C CD1 . TRP A 1 36 ? 114.466 127.737 8.671  1.00 9.25  ? 169 TRP A CD1 1 
ATOM   302 C CD2 . TRP A 1 36 ? 113.444 129.741 8.731  1.00 8.95  ? 169 TRP A CD2 1 
ATOM   303 N NE1 . TRP A 1 36 ? 115.435 128.712 8.521  1.00 7.78  ? 169 TRP A NE1 1 
ATOM   304 C CE2 . TRP A 1 36 ? 114.840 129.946 8.547  1.00 7.71  ? 169 TRP A CE2 1 
ATOM   305 C CE3 . TRP A 1 36 ? 112.592 130.863 8.793  1.00 7.76  ? 169 TRP A CE3 1 
ATOM   306 C CZ2 . TRP A 1 36 ? 115.404 131.224 8.423  1.00 4.04  ? 169 TRP A CZ2 1 
ATOM   307 C CZ3 . TRP A 1 36 ? 113.155 132.141 8.669  1.00 5.18  ? 169 TRP A CZ3 1 
ATOM   308 C CH2 . TRP A 1 36 ? 114.550 132.307 8.484  1.00 6.85  ? 169 TRP A CH2 1 
ATOM   309 N N   . TRP A 1 37 ? 109.202 127.854 11.237 1.00 9.39  ? 170 TRP A N   1 
ATOM   310 C CA  . TRP A 1 37 ? 107.793 127.560 11.433 1.00 7.43  ? 170 TRP A CA  1 
ATOM   311 C C   . TRP A 1 37 ? 106.927 128.663 10.837 1.00 9.00  ? 170 TRP A C   1 
ATOM   312 O O   . TRP A 1 37 ? 107.397 129.803 10.681 1.00 6.27  ? 170 TRP A O   1 
ATOM   313 C CB  . TRP A 1 37 ? 107.502 127.483 12.932 1.00 2.39  ? 170 TRP A CB  1 
ATOM   314 C CG  . TRP A 1 37 ? 108.199 126.370 13.696 1.00 4.81  ? 170 TRP A CG  1 
ATOM   315 C CD1 . TRP A 1 37 ? 108.915 125.336 13.170 1.00 4.59  ? 170 TRP A CD1 1 
ATOM   316 C CD2 . TRP A 1 37 ? 108.257 126.212 15.121 1.00 3.75  ? 170 TRP A CD2 1 
ATOM   317 N NE1 . TRP A 1 37 ? 109.425 124.544 14.174 1.00 5.69  ? 170 TRP A NE1 1 
ATOM   318 C CE2 . TRP A 1 37 ? 109.038 125.055 15.384 1.00 2.76  ? 170 TRP A CE2 1 
ATOM   319 C CE3 . TRP A 1 37 ? 107.729 126.938 16.204 1.00 2.42  ? 170 TRP A CE3 1 
ATOM   320 C CZ2 . TRP A 1 37 ? 109.304 124.605 16.676 1.00 2.29  ? 170 TRP A CZ2 1 
ATOM   321 C CZ3 . TRP A 1 37 ? 107.996 126.488 17.495 1.00 3.69  ? 170 TRP A CZ3 1 
ATOM   322 C CH2 . TRP A 1 37 ? 108.779 125.331 17.716 1.00 3.91  ? 170 TRP A CH2 1 
ATOM   323 N N   . ASN A 1 38 ? 105.680 128.335 10.486 1.00 8.02  ? 171 ASN A N   1 
ATOM   324 C CA  . ASN A 1 38 ? 104.781 129.366 9.979  1.00 8.91  ? 171 ASN A CA  1 
ATOM   325 C C   . ASN A 1 38 ? 104.020 129.869 11.194 1.00 9.55  ? 171 ASN A C   1 
ATOM   326 O O   . ASN A 1 38 ? 103.530 129.083 12.008 1.00 7.44  ? 171 ASN A O   1 
ATOM   327 C CB  . ASN A 1 38 ? 103.802 128.876 8.905  1.00 14.71 ? 171 ASN A CB  1 
ATOM   328 C CG  . ASN A 1 38 ? 103.049 130.060 8.216  1.00 26.92 ? 171 ASN A CG  1 
ATOM   329 O OD1 . ASN A 1 38 ? 102.034 130.585 8.730  1.00 20.07 ? 171 ASN A OD1 1 
ATOM   330 N ND2 . ASN A 1 38 ? 103.582 130.509 7.079  1.00 26.54 ? 171 ASN A ND2 1 
ATOM   331 N N   . ALA A 1 39 ? 103.943 131.183 11.324 1.00 9.80  ? 172 ALA A N   1 
ATOM   332 C CA  . ALA A 1 39 ? 103.294 131.809 12.453 1.00 5.85  ? 172 ALA A CA  1 
ATOM   333 C C   . ALA A 1 39 ? 102.434 132.969 11.988 1.00 8.29  ? 172 ALA A C   1 
ATOM   334 O O   . ALA A 1 39 ? 102.501 133.386 10.835 1.00 5.17  ? 172 ALA A O   1 
ATOM   335 C CB  . ALA A 1 39 ? 104.374 132.316 13.436 1.00 9.59  ? 172 ALA A CB  1 
ATOM   336 N N   . GLU A 1 40 ? 101.647 133.510 12.909 1.00 6.82  ? 173 GLU A N   1 
ATOM   337 C CA  . GLU A 1 40 ? 100.777 134.631 12.599 1.00 10.12 ? 173 GLU A CA  1 
ATOM   338 C C   . GLU A 1 40 ? 100.973 135.724 13.650 1.00 7.19  ? 173 GLU A C   1 
ATOM   339 O O   . GLU A 1 40 ? 101.119 135.426 14.850 1.00 11.33 ? 173 GLU A O   1 
ATOM   340 C CB  . GLU A 1 40 ? 99.324  134.165 12.592 1.00 9.28  ? 173 GLU A CB  1 
ATOM   341 C CG  . GLU A 1 40 ? 98.359  135.322 12.628 1.00 20.54 ? 173 GLU A CG  1 
ATOM   342 C CD  . GLU A 1 40 ? 96.923  134.890 12.663 1.00 27.84 ? 173 GLU A CD  1 
ATOM   343 O OE1 . GLU A 1 40 ? 96.365  134.725 11.568 1.00 38.80 ? 173 GLU A OE1 1 
ATOM   344 O OE2 . GLU A 1 40 ? 96.366  134.733 13.754 1.00 34.33 ? 173 GLU A OE2 1 
ATOM   345 N N   . ASP A 1 41 ? 100.975 136.985 13.233 1.00 5.23  ? 174 ASP A N   1 
ATOM   346 C CA  . ASP A 1 41 ? 101.179 138.035 14.211 1.00 3.51  ? 174 ASP A CA  1 
ATOM   347 C C   . ASP A 1 41 ? 99.872  138.627 14.735 1.00 6.16  ? 174 ASP A C   1 
ATOM   348 O O   . ASP A 1 41 ? 98.783  138.198 14.327 1.00 6.31  ? 174 ASP A O   1 
ATOM   349 C CB  . ASP A 1 41 ? 102.153 139.100 13.679 1.00 9.43  ? 174 ASP A CB  1 
ATOM   350 C CG  . ASP A 1 41 ? 101.584 139.938 12.539 1.00 7.29  ? 174 ASP A CG  1 
ATOM   351 O OD1 . ASP A 1 41 ? 100.356 139.993 12.346 1.00 6.61  ? 174 ASP A OD1 1 
ATOM   352 O OD2 . ASP A 1 41 ? 102.406 140.580 11.859 1.00 7.12  ? 174 ASP A OD2 1 
ATOM   353 N N   . SER A 1 42 ? 99.966  139.590 15.652 1.00 6.51  ? 175 SER A N   1 
ATOM   354 C CA  . SER A 1 42 ? 98.763  140.188 16.235 1.00 6.50  ? 175 SER A CA  1 
ATOM   355 C C   . SER A 1 42 ? 97.889  140.878 15.203 1.00 7.94  ? 175 SER A C   1 
ATOM   356 O O   . SER A 1 42 ? 96.713  141.152 15.473 1.00 12.74 ? 175 SER A O   1 
ATOM   357 C CB  . SER A 1 42 ? 99.120  141.153 17.375 1.00 7.60  ? 175 SER A CB  1 
ATOM   358 O OG  . SER A 1 42 ? 99.690  142.347 16.856 1.00 12.05 ? 175 SER A OG  1 
ATOM   359 N N   . GLU A 1 43 ? 98.450  141.197 14.037 1.00 8.27  ? 176 GLU A N   1 
ATOM   360 C CA  . GLU A 1 43 ? 97.655  141.832 12.995 1.00 10.08 ? 176 GLU A CA  1 
ATOM   361 C C   . GLU A 1 43 ? 97.040  140.823 12.017 1.00 10.39 ? 176 GLU A C   1 
ATOM   362 O O   . GLU A 1 43 ? 96.310  141.211 11.089 1.00 10.55 ? 176 GLU A O   1 
ATOM   363 C CB  . GLU A 1 43 ? 98.475  142.872 12.231 1.00 12.35 ? 176 GLU A CB  1 
ATOM   364 C CG  . GLU A 1 43 ? 98.873  144.062 13.043 1.00 12.02 ? 176 GLU A CG  1 
ATOM   365 C CD  . GLU A 1 43 ? 99.503  145.119 12.184 1.00 12.62 ? 176 GLU A CD  1 
ATOM   366 O OE1 . GLU A 1 43 ? 100.481 144.836 11.460 1.00 19.47 ? 176 GLU A OE1 1 
ATOM   367 O OE2 . GLU A 1 43 ? 98.990  146.237 12.211 1.00 22.99 ? 176 GLU A OE2 1 
ATOM   368 N N   . GLY A 1 44 ? 97.303  139.537 12.251 1.00 8.40  ? 177 GLY A N   1 
ATOM   369 C CA  . GLY A 1 44 ? 96.790  138.486 11.381 1.00 6.28  ? 177 GLY A CA  1 
ATOM   370 C C   . GLY A 1 44 ? 97.692  138.140 10.211 1.00 8.42  ? 177 GLY A C   1 
ATOM   371 O O   . GLY A 1 44 ? 97.327  137.304 9.384  1.00 10.38 ? 177 GLY A O   1 
ATOM   372 N N   . LYS A 1 45 ? 98.848  138.802 10.109 1.00 7.91  ? 178 LYS A N   1 
ATOM   373 C CA  . LYS A 1 45 ? 99.791  138.539 9.018  1.00 12.65 ? 178 LYS A CA  1 
ATOM   374 C C   . LYS A 1 45 ? 100.527 137.234 9.275  1.00 10.42 ? 178 LYS A C   1 
ATOM   375 O O   . LYS A 1 45 ? 100.892 136.932 10.414 1.00 7.52  ? 178 LYS A O   1 
ATOM   376 C CB  . LYS A 1 45 ? 100.805 139.667 8.882  1.00 13.31 ? 178 LYS A CB  1 
ATOM   377 C CG  . LYS A 1 45 ? 100.194 141.021 8.559  1.00 23.39 ? 178 LYS A CG  1 
ATOM   378 C CD  . LYS A 1 45 ? 100.964 142.124 9.240  1.00 30.45 ? 178 LYS A CD  1 
ATOM   379 C CE  . LYS A 1 45 ? 102.472 141.964 9.031  1.00 34.21 ? 178 LYS A CE  1 
ATOM   380 N NZ  . LYS A 1 45 ? 103.236 142.684 10.080 1.00 40.04 ? 178 LYS A NZ  1 
ATOM   381 N N   . ARG A 1 46 ? 100.774 136.489 8.203  1.00 8.62  ? 179 ARG A N   1 
ATOM   382 C CA  . ARG A 1 46 ? 101.438 135.198 8.299  1.00 7.66  ? 179 ARG A CA  1 
ATOM   383 C C   . ARG A 1 46 ? 102.780 135.163 7.589  1.00 6.95  ? 179 ARG A C   1 
ATOM   384 O O   . ARG A 1 46 ? 102.989 135.852 6.583  1.00 7.02  ? 179 ARG A O   1 
ATOM   385 C CB  . ARG A 1 46 ? 100.571 134.123 7.661  1.00 7.90  ? 179 ARG A CB  1 
ATOM   386 C CG  . ARG A 1 46 ? 99.222  133.925 8.268  1.00 10.74 ? 179 ARG A CG  1 
ATOM   387 C CD  . ARG A 1 46 ? 98.405  133.060 7.320  1.00 14.53 ? 179 ARG A CD  1 
ATOM   388 N NE  . ARG A 1 46 ? 97.075  132.775 7.845  1.00 14.02 ? 179 ARG A NE  1 
ATOM   389 C CZ  . ARG A 1 46 ? 96.169  131.996 7.249  1.00 14.07 ? 179 ARG A CZ  1 
ATOM   390 N NH1 . ARG A 1 46 ? 96.437  131.408 6.079  1.00 14.71 ? 179 ARG A NH1 1 
ATOM   391 N NH2 . ARG A 1 46 ? 95.005  131.778 7.837  1.00 8.44  ? 179 ARG A NH2 1 
ATOM   392 N N   . GLY A 1 47 ? 103.653 134.286 8.065  1.00 6.86  ? 180 GLY A N   1 
ATOM   393 C CA  . GLY A 1 47 ? 104.942 134.131 7.435  1.00 6.18  ? 180 GLY A CA  1 
ATOM   394 C C   . GLY A 1 47 ? 105.793 133.153 8.182  1.00 5.17  ? 180 GLY A C   1 
ATOM   395 O O   . GLY A 1 47 ? 105.386 132.678 9.233  1.00 5.29  ? 180 GLY A O   1 
ATOM   396 N N   . MET A 1 48 ? 106.989 132.894 7.663  1.00 3.73  ? 181 MET A N   1 
ATOM   397 C CA  . MET A 1 48 ? 107.925 131.962 8.283  1.00 4.88  ? 181 MET A CA  1 
ATOM   398 C C   . MET A 1 48 ? 108.751 132.692 9.311  1.00 5.89  ? 181 MET A C   1 
ATOM   399 O O   . MET A 1 48 ? 109.114 133.857 9.108  1.00 6.32  ? 181 MET A O   1 
ATOM   400 C CB  . MET A 1 48 ? 108.883 131.405 7.230  1.00 6.48  ? 181 MET A CB  1 
ATOM   401 C CG  . MET A 1 48 ? 108.179 130.715 6.120  1.00 11.98 ? 181 MET A CG  1 
ATOM   402 S SD  . MET A 1 48 ? 107.437 129.252 6.850  1.00 46.57 ? 181 MET A SD  1 
ATOM   403 C CE  . MET A 1 48 ? 108.910 128.191 6.848  1.00 27.97 ? 181 MET A CE  1 
ATOM   404 N N   . ILE A 1 49 ? 109.069 132.004 10.402 1.00 6.84  ? 182 ILE A N   1 
ATOM   405 C CA  . ILE A 1 49 ? 109.885 132.589 11.459 1.00 7.04  ? 182 ILE A CA  1 
ATOM   406 C C   . ILE A 1 49 ? 110.974 131.613 11.934 1.00 7.13  ? 182 ILE A C   1 
ATOM   407 O O   . ILE A 1 49 ? 110.771 130.382 11.977 1.00 7.42  ? 182 ILE A O   1 
ATOM   408 C CB  . ILE A 1 49 ? 109.030 133.047 12.688 1.00 4.74  ? 182 ILE A CB  1 
ATOM   409 C CG1 . ILE A 1 49 ? 108.313 131.841 13.335 1.00 8.64  ? 182 ILE A CG1 1 
ATOM   410 C CG2 . ILE A 1 49 ? 108.062 134.138 12.247 1.00 7.31  ? 182 ILE A CG2 1 
ATOM   411 C CD1 . ILE A 1 49 ? 107.938 132.022 14.815 1.00 4.98  ? 182 ILE A CD1 1 
ATOM   412 N N   . PRO A 1 50 ? 112.158 132.149 12.242 1.00 7.97  ? 183 PRO A N   1 
ATOM   413 C CA  . PRO A 1 50 ? 113.277 131.331 12.715 1.00 8.58  ? 183 PRO A CA  1 
ATOM   414 C C   . PRO A 1 50 ? 113.097 130.979 14.211 1.00 8.51  ? 183 PRO A C   1 
ATOM   415 O O   . PRO A 1 50 ? 113.008 131.855 15.086 1.00 6.58  ? 183 PRO A O   1 
ATOM   416 C CB  . PRO A 1 50 ? 114.494 132.236 12.460 1.00 5.75  ? 183 PRO A CB  1 
ATOM   417 C CG  . PRO A 1 50 ? 113.946 133.610 12.724 1.00 8.38  ? 183 PRO A CG  1 
ATOM   418 C CD  . PRO A 1 50 ? 112.532 133.574 12.123 1.00 4.66  ? 183 PRO A CD  1 
ATOM   419 N N   . VAL A 1 51 ? 113.044 129.683 14.487 1.00 7.29  ? 184 VAL A N   1 
ATOM   420 C CA  . VAL A 1 51 ? 112.870 129.176 15.836 1.00 6.03  ? 184 VAL A CA  1 
ATOM   421 C C   . VAL A 1 51 ? 113.851 129.708 16.909 1.00 7.25  ? 184 VAL A C   1 
ATOM   422 O O   . VAL A 1 51 ? 113.468 129.946 18.068 1.00 10.26 ? 184 VAL A O   1 
ATOM   423 C CB  . VAL A 1 51 ? 112.819 127.637 15.801 1.00 8.29  ? 184 VAL A CB  1 
ATOM   424 C CG1 . VAL A 1 51 ? 112.875 127.059 17.224 1.00 6.65  ? 184 VAL A CG1 1 
ATOM   425 C CG2 . VAL A 1 51 ? 111.547 127.194 15.052 1.00 2.00  ? 184 VAL A CG2 1 
ATOM   426 N N   . PRO A 1 52 ? 115.134 129.871 16.560 1.00 9.27  ? 185 PRO A N   1 
ATOM   427 C CA  . PRO A 1 52 ? 116.086 130.384 17.561 1.00 9.77  ? 185 PRO A CA  1 
ATOM   428 C C   . PRO A 1 52 ? 115.754 131.801 18.103 1.00 8.19  ? 185 PRO A C   1 
ATOM   429 O O   . PRO A 1 52 ? 116.211 132.182 19.173 1.00 6.56  ? 185 PRO A O   1 
ATOM   430 C CB  . PRO A 1 52 ? 117.395 130.391 16.782 1.00 7.33  ? 185 PRO A CB  1 
ATOM   431 C CG  . PRO A 1 52 ? 117.229 129.163 15.862 1.00 9.44  ? 185 PRO A CG  1 
ATOM   432 C CD  . PRO A 1 52 ? 115.837 129.408 15.344 1.00 6.71  ? 185 PRO A CD  1 
ATOM   433 N N   . TYR A 1 53 ? 114.928 132.554 17.373 1.00 5.20  ? 186 TYR A N   1 
ATOM   434 C CA  . TYR A 1 53 ? 114.568 133.920 17.751 1.00 6.67  ? 186 TYR A CA  1 
ATOM   435 C C   . TYR A 1 53 ? 113.342 134.014 18.652 1.00 8.61  ? 186 TYR A C   1 
ATOM   436 O O   . TYR A 1 53 ? 112.900 135.122 18.997 1.00 8.42  ? 186 TYR A O   1 
ATOM   437 C CB  . TYR A 1 53 ? 114.299 134.749 16.493 1.00 5.92  ? 186 TYR A CB  1 
ATOM   438 C CG  . TYR A 1 53 ? 115.533 135.232 15.791 1.00 8.33  ? 186 TYR A CG  1 
ATOM   439 C CD1 . TYR A 1 53 ? 116.497 134.326 15.292 1.00 9.57  ? 186 TYR A CD1 1 
ATOM   440 C CD2 . TYR A 1 53 ? 115.788 136.607 15.680 1.00 8.30  ? 186 TYR A CD2 1 
ATOM   441 C CE1 . TYR A 1 53 ? 117.687 134.803 14.703 1.00 3.75  ? 186 TYR A CE1 1 
ATOM   442 C CE2 . TYR A 1 53 ? 116.963 137.091 15.110 1.00 5.25  ? 186 TYR A CE2 1 
ATOM   443 C CZ  . TYR A 1 53 ? 117.904 136.188 14.635 1.00 8.28  ? 186 TYR A CZ  1 
ATOM   444 O OH  . TYR A 1 53 ? 119.071 136.683 14.137 1.00 10.83 ? 186 TYR A OH  1 
ATOM   445 N N   . VAL A 1 54 ? 112.754 132.867 18.975 1.00 8.69  ? 187 VAL A N   1 
ATOM   446 C CA  . VAL A 1 54 ? 111.561 132.840 19.816 1.00 8.81  ? 187 VAL A CA  1 
ATOM   447 C C   . VAL A 1 54 ? 111.656 131.869 20.992 1.00 9.70  ? 187 VAL A C   1 
ATOM   448 O O   . VAL A 1 54 ? 112.465 130.936 20.979 1.00 9.57  ? 187 VAL A O   1 
ATOM   449 C CB  . VAL A 1 54 ? 110.284 132.436 18.998 1.00 6.44  ? 187 VAL A CB  1 
ATOM   450 C CG1 . VAL A 1 54 ? 110.123 133.330 17.768 1.00 10.68 ? 187 VAL A CG1 1 
ATOM   451 C CG2 . VAL A 1 54 ? 110.343 130.968 18.602 1.00 8.15  ? 187 VAL A CG2 1 
ATOM   452 N N   . GLU A 1 55 ? 110.821 132.120 22.000 1.00 6.77  ? 188 GLU A N   1 
ATOM   453 C CA  . GLU A 1 55 ? 110.719 131.266 23.162 1.00 9.10  ? 188 GLU A CA  1 
ATOM   454 C C   . GLU A 1 55 ? 109.223 130.899 23.296 1.00 11.45 ? 188 GLU A C   1 
ATOM   455 O O   . GLU A 1 55 ? 108.331 131.636 22.853 1.00 7.39  ? 188 GLU A O   1 
ATOM   456 C CB  . GLU A 1 55 ? 111.206 131.986 24.419 1.00 7.86  ? 188 GLU A CB  1 
ATOM   457 C CG  . GLU A 1 55 ? 110.320 133.139 24.871 1.00 9.45  ? 188 GLU A CG  1 
ATOM   458 C CD  . GLU A 1 55 ? 110.750 133.754 26.210 1.00 15.99 ? 188 GLU A CD  1 
ATOM   459 O OE1 . GLU A 1 55 ? 111.681 133.228 26.855 1.00 17.18 ? 188 GLU A OE1 1 
ATOM   460 O OE2 . GLU A 1 55 ? 110.160 134.778 26.621 1.00 15.69 ? 188 GLU A OE2 1 
ATOM   461 N N   . LYS A 1 56 ? 108.949 129.731 23.854 1.00 10.80 ? 189 LYS A N   1 
ATOM   462 C CA  . LYS A 1 56 ? 107.575 129.327 24.056 1.00 13.76 ? 189 LYS A CA  1 
ATOM   463 C C   . LYS A 1 56 ? 106.889 130.329 24.993 1.00 16.14 ? 189 LYS A C   1 
ATOM   464 O O   . LYS A 1 56 ? 107.519 130.924 25.881 1.00 13.76 ? 189 LYS A O   1 
ATOM   465 C CB  . LYS A 1 56 ? 107.528 127.951 24.718 1.00 19.15 ? 189 LYS A CB  1 
ATOM   466 C CG  . LYS A 1 56 ? 108.186 126.873 23.936 1.00 21.65 ? 189 LYS A CG  1 
ATOM   467 C CD  . LYS A 1 56 ? 107.977 125.527 24.592 1.00 31.40 ? 189 LYS A CD  1 
ATOM   468 C CE  . LYS A 1 56 ? 108.723 124.470 23.803 1.00 36.17 ? 189 LYS A CE  1 
ATOM   469 N NZ  . LYS A 1 56 ? 108.402 123.070 24.182 1.00 43.34 ? 189 LYS A NZ  1 
ATOM   470 N N   . TYR A 1 57 ? 105.593 130.511 24.796 1.00 13.86 ? 190 TYR A N   1 
ATOM   471 C CA  . TYR A 1 57 ? 104.825 131.404 25.639 1.00 17.53 ? 190 TYR A CA  1 
ATOM   472 C C   . TYR A 1 57 ? 103.760 130.550 26.353 1.00 18.98 ? 190 TYR A C   1 
ATOM   473 C CB  . TYR A 1 57 ? 104.182 132.504 24.780 1.00 22.54 ? 190 TYR A CB  1 
ATOM   474 C CG  . TYR A 1 57 ? 103.225 133.413 25.516 1.00 26.23 ? 190 TYR A CG  1 
ATOM   475 C CD1 . TYR A 1 57 ? 101.891 133.051 25.693 1.00 24.45 ? 190 TYR A CD1 1 
ATOM   476 C CD2 . TYR A 1 57 ? 103.653 134.642 26.031 1.00 29.39 ? 190 TYR A CD2 1 
ATOM   477 C CE1 . TYR A 1 57 ? 101.008 133.889 26.360 1.00 30.07 ? 190 TYR A CE1 1 
ATOM   478 C CE2 . TYR A 1 57 ? 102.776 135.492 26.703 1.00 28.99 ? 190 TYR A CE2 1 
ATOM   479 C CZ  . TYR A 1 57 ? 101.456 135.107 26.863 1.00 34.03 ? 190 TYR A CZ  1 
ATOM   480 O OH  . TYR A 1 57 ? 100.580 135.934 27.531 1.00 39.64 ? 190 TYR A OH  1 
ATOM   481 N N   . PRO B 2 1  ? 122.074 139.066 17.857 1.00 21.94 ? 1   PRO B N   1 
ATOM   482 C CA  . PRO B 2 1  ? 121.006 138.068 17.828 1.00 22.13 ? 1   PRO B CA  1 
ATOM   483 C C   . PRO B 2 1  ? 121.607 136.739 17.450 1.00 20.64 ? 1   PRO B C   1 
ATOM   484 O O   . PRO B 2 1  ? 122.737 136.669 16.981 1.00 21.88 ? 1   PRO B O   1 
ATOM   485 C CB  . PRO B 2 1  ? 120.090 138.573 16.703 1.00 16.88 ? 1   PRO B CB  1 
ATOM   486 C CG  . PRO B 2 1  ? 120.369 139.999 16.630 1.00 26.47 ? 1   PRO B CG  1 
ATOM   487 C CD  . PRO B 2 1  ? 121.859 140.063 16.800 1.00 25.78 ? 1   PRO B CD  1 
ATOM   488 N N   . PRO B 2 2  ? 120.847 135.659 17.631 1.00 19.44 ? 2   PRO B N   1 
ATOM   489 C CA  . PRO B 2 2  ? 121.386 134.350 17.282 1.00 15.29 ? 2   PRO B CA  1 
ATOM   490 C C   . PRO B 2 2  ? 121.531 134.108 15.771 1.00 14.92 ? 2   PRO B C   1 
ATOM   491 O O   . PRO B 2 2  ? 121.060 134.902 14.943 1.00 10.19 ? 2   PRO B O   1 
ATOM   492 C CB  . PRO B 2 2  ? 120.398 133.391 17.956 1.00 18.26 ? 2   PRO B CB  1 
ATOM   493 C CG  . PRO B 2 2  ? 119.126 134.179 18.070 1.00 13.21 ? 2   PRO B CG  1 
ATOM   494 C CD  . PRO B 2 2  ? 119.584 135.551 18.379 1.00 17.14 ? 2   PRO B CD  1 
ATOM   495 N N   . PRO B 2 3  ? 122.308 133.078 15.394 1.00 13.41 ? 3   PRO B N   1 
ATOM   496 C CA  . PRO B 2 3  ? 122.458 132.806 13.964 1.00 12.38 ? 3   PRO B CA  1 
ATOM   497 C C   . PRO B 2 3  ? 121.098 132.407 13.390 1.00 10.31 ? 3   PRO B C   1 
ATOM   498 O O   . PRO B 2 3  ? 120.298 131.746 14.060 1.00 10.72 ? 3   PRO B O   1 
ATOM   499 C CB  . PRO B 2 3  ? 123.468 131.645 13.926 1.00 11.76 ? 3   PRO B CB  1 
ATOM   500 C CG  . PRO B 2 3  ? 123.426 131.057 15.272 1.00 18.45 ? 3   PRO B CG  1 
ATOM   501 C CD  . PRO B 2 3  ? 123.198 132.220 16.196 1.00 13.17 ? 3   PRO B CD  1 
ATOM   502 N N   . VAL B 2 4  ? 120.786 132.924 12.213 1.00 10.79 ? 4   VAL B N   1 
ATOM   503 C CA  . VAL B 2 4  ? 119.526 132.587 11.583 1.00 12.55 ? 4   VAL B CA  1 
ATOM   504 C C   . VAL B 2 4  ? 119.834 131.248 10.946 1.00 11.87 ? 4   VAL B C   1 
ATOM   505 O O   . VAL B 2 4  ? 120.745 131.141 10.114 1.00 10.96 ? 4   VAL B O   1 
ATOM   506 C CB  . VAL B 2 4  ? 119.083 133.618 10.514 1.00 10.50 ? 4   VAL B CB  1 
ATOM   507 C CG1 . VAL B 2 4  ? 117.751 133.211 9.938  1.00 11.17 ? 4   VAL B CG1 1 
ATOM   508 C CG2 . VAL B 2 4  ? 118.925 134.982 11.121 1.00 10.64 ? 4   VAL B CG2 1 
ATOM   509 N N   . PRO B 2 5  ? 119.080 130.203 11.332 1.00 14.88 ? 5   PRO B N   1 
ATOM   510 C CA  . PRO B 2 5  ? 119.272 128.840 10.811 1.00 11.20 ? 5   PRO B CA  1 
ATOM   511 C C   . PRO B 2 5  ? 119.065 128.675 9.310  1.00 9.92  ? 5   PRO B C   1 
ATOM   512 O O   . PRO B 2 5  ? 118.280 129.389 8.697  1.00 8.47  ? 5   PRO B O   1 
ATOM   513 C CB  . PRO B 2 5  ? 118.243 128.027 11.594 1.00 12.53 ? 5   PRO B CB  1 
ATOM   514 C CG  . PRO B 2 5  ? 117.119 129.021 11.795 1.00 13.97 ? 5   PRO B CG  1 
ATOM   515 C CD  . PRO B 2 5  ? 117.876 130.283 12.186 1.00 14.90 ? 5   PRO B CD  1 
ATOM   516 N N   . PRO B 2 6  ? 119.776 127.719 8.697  1.00 10.53 ? 6   PRO B N   1 
ATOM   517 C CA  . PRO B 2 6  ? 119.584 127.529 7.261  1.00 14.30 ? 6   PRO B CA  1 
ATOM   518 C C   . PRO B 2 6  ? 118.176 126.950 7.021  1.00 16.62 ? 6   PRO B C   1 
ATOM   519 O O   . PRO B 2 6  ? 117.548 126.402 7.947  1.00 15.13 ? 6   PRO B O   1 
ATOM   520 C CB  . PRO B 2 6  ? 120.684 126.492 6.908  1.00 12.09 ? 6   PRO B CB  1 
ATOM   521 C CG  . PRO B 2 6  ? 120.803 125.678 8.180  1.00 8.89  ? 6   PRO B CG  1 
ATOM   522 C CD  . PRO B 2 6  ? 120.777 126.768 9.237  1.00 11.34 ? 6   PRO B CD  1 
ATOM   523 N N   . ARG B 2 7  ? 117.691 127.090 5.792  1.00 18.26 ? 7   ARG B N   1 
ATOM   524 C CA  . ARG B 2 7  ? 116.396 126.558 5.388  1.00 23.98 ? 7   ARG B CA  1 
ATOM   525 C C   . ARG B 2 7  ? 116.679 125.220 4.702  1.00 27.69 ? 7   ARG B C   1 
ATOM   526 O O   . ARG B 2 7  ? 117.802 124.962 4.265  1.00 29.52 ? 7   ARG B O   1 
ATOM   527 C CB  . ARG B 2 7  ? 115.731 127.507 4.395  1.00 27.27 ? 7   ARG B CB  1 
ATOM   528 C CG  . ARG B 2 7  ? 116.113 128.972 4.608  1.00 36.16 ? 7   ARG B CG  1 
ATOM   529 C CD  . ARG B 2 7  ? 115.327 129.917 3.712  1.00 41.87 ? 7   ARG B CD  1 
ATOM   530 N NE  . ARG B 2 7  ? 114.150 130.432 4.400  1.00 46.45 ? 7   ARG B NE  1 
ATOM   531 C CZ  . ARG B 2 7  ? 113.971 131.708 4.734  1.00 49.31 ? 7   ARG B CZ  1 
ATOM   532 N NH1 . ARG B 2 7  ? 114.868 132.646 4.446  1.00 49.99 ? 7   ARG B NH1 1 
ATOM   533 N NH2 . ARG B 2 7  ? 112.932 132.033 5.460  1.00 53.57 ? 7   ARG B NH2 1 
ATOM   534 N N   . ARG B 2 8  ? 115.673 124.360 4.599  1.00 31.18 ? 8   ARG B N   1 
ATOM   535 C CA  . ARG B 2 8  ? 115.862 123.066 3.946  1.00 31.31 ? 8   ARG B CA  1 
ATOM   536 C C   . ARG B 2 8  ? 114.742 122.747 2.959  1.00 31.01 ? 8   ARG B C   1 
ATOM   537 C CB  . ARG B 2 8  ? 115.994 121.965 4.985  1.00 31.29 ? 8   ARG B CB  1 
HETATM 538 O O   . HOH C 3 .  ? 111.717 139.685 24.767 1.00 12.19 ? 301 HOH A O   1 
HETATM 539 H H1  . HOH C 3 .  ? 112.379 139.264 25.357 1.00 0.00  ? 301 HOH A H1  1 
HETATM 540 H H2  . HOH C 3 .  ? 111.778 139.137 23.977 1.00 0.00  ? 301 HOH A H2  1 
HETATM 541 O O   . HOH C 3 .  ? 97.566  128.541 12.735 1.00 5.99  ? 302 HOH A O   1 
HETATM 542 H H1  . HOH C 3 .  ? 97.821  127.883 13.388 1.00 0.00  ? 302 HOH A H1  1 
HETATM 543 H H2  . HOH C 3 .  ? 96.718  128.186 12.458 1.00 0.00  ? 302 HOH A H2  1 
HETATM 544 O O   . HOH C 3 .  ? 119.858 129.754 4.680  1.00 28.10 ? 304 HOH A O   1 
HETATM 545 H H1  . HOH C 3 .  ? 119.862 130.639 5.081  1.00 0.00  ? 304 HOH A H1  1 
HETATM 546 H H2  . HOH C 3 .  ? 120.504 129.821 3.962  1.00 0.00  ? 304 HOH A H2  1 
HETATM 547 O O   . HOH C 3 .  ? 105.232 128.432 22.823 1.00 14.16 ? 305 HOH A O   1 
HETATM 548 H H1  . HOH C 3 .  ? 104.921 129.244 22.418 1.00 0.00  ? 305 HOH A H1  1 
HETATM 549 H H2  . HOH C 3 .  ? 105.739 128.035 22.081 1.00 0.00  ? 305 HOH A H2  1 
HETATM 550 O O   . HOH C 3 .  ? 117.918 141.056 23.202 1.00 5.33  ? 306 HOH A O   1 
HETATM 551 H H1  . HOH C 3 .  ? 118.379 141.771 22.696 1.00 0.00  ? 306 HOH A H1  1 
HETATM 552 H H2  . HOH C 3 .  ? 117.223 140.831 22.572 1.00 0.00  ? 306 HOH A H2  1 
HETATM 553 O O   . HOH C 3 .  ? 106.738 143.537 10.958 1.00 19.76 ? 307 HOH A O   1 
HETATM 554 H H1  . HOH C 3 .  ? 106.829 142.668 11.384 1.00 0.00  ? 307 HOH A H1  1 
HETATM 555 H H2  . HOH C 3 .  ? 105.861 143.787 11.281 1.00 0.00  ? 307 HOH A H2  1 
HETATM 556 O O   . HOH C 3 .  ? 111.327 134.403 0.095  1.00 22.79 ? 308 HOH A O   1 
HETATM 557 H H1  . HOH C 3 .  ? 111.141 133.617 -0.429 1.00 0.00  ? 308 HOH A H1  1 
HETATM 558 H H2  . HOH C 3 .  ? 111.890 134.925 -0.495 1.00 0.00  ? 308 HOH A H2  1 
HETATM 559 O O   . HOH C 3 .  ? 113.465 124.399 16.770 1.00 25.92 ? 309 HOH A O   1 
HETATM 560 H H1  . HOH C 3 .  ? 114.281 124.534 16.263 1.00 0.00  ? 309 HOH A H1  1 
HETATM 561 H H2  . HOH C 3 .  ? 112.806 124.531 16.083 1.00 0.00  ? 309 HOH A H2  1 
HETATM 562 O O   . HOH C 3 .  ? 103.292 140.680 17.027 1.00 10.26 ? 310 HOH A O   1 
HETATM 563 H H1  . HOH C 3 .  ? 103.240 139.781 17.380 1.00 0.00  ? 310 HOH A H1  1 
HETATM 564 H H2  . HOH C 3 .  ? 104.237 140.766 16.855 1.00 0.00  ? 310 HOH A H2  1 
HETATM 565 O O   . HOH C 3 .  ? 105.730 141.642 13.127 1.00 19.88 ? 311 HOH A O   1 
HETATM 566 H H1  . HOH C 3 .  ? 106.483 141.134 12.794 1.00 0.00  ? 311 HOH A H1  1 
HETATM 567 H H2  . HOH C 3 .  ? 105.116 140.963 13.407 1.00 0.00  ? 311 HOH A H2  1 
HETATM 568 O O   . HOH C 3 .  ? 96.705  141.436 7.869  1.00 19.92 ? 312 HOH A O   1 
HETATM 569 H H1  . HOH C 3 .  ? 95.871  140.949 7.817  1.00 0.00  ? 312 HOH A H1  1 
HETATM 570 H H2  . HOH C 3 .  ? 96.672  141.743 8.784  1.00 0.00  ? 312 HOH A H2  1 
HETATM 571 O O   . HOH C 3 .  ? 97.528  126.180 17.375 1.00 14.78 ? 313 HOH A O   1 
HETATM 572 H H1  . HOH C 3 .  ? 96.628  126.159 17.768 1.00 0.00  ? 313 HOH A H1  1 
HETATM 573 H H2  . HOH C 3 .  ? 97.338  125.876 16.480 1.00 0.00  ? 313 HOH A H2  1 
HETATM 574 O O   . HOH C 3 .  ? 94.406  134.259 12.785 1.00 10.65 ? 314 HOH A O   1 
HETATM 575 H H1  . HOH C 3 .  ? 94.036  134.528 11.934 1.00 0.00  ? 314 HOH A H1  1 
HETATM 576 H H2  . HOH C 3 .  ? 95.353  134.307 12.638 1.00 0.00  ? 314 HOH A H2  1 
HETATM 577 O O   . HOH C 3 .  ? 114.310 120.721 10.052 1.00 37.33 ? 315 HOH A O   1 
HETATM 578 H H1  . HOH C 3 .  ? 113.841 120.083 10.609 1.00 0.00  ? 315 HOH A H1  1 
HETATM 579 H H2  . HOH C 3 .  ? 114.209 120.324 9.176  1.00 0.00  ? 315 HOH A H2  1 
HETATM 580 O O   . HOH C 3 .  ? 114.094 141.152 -0.937 1.00 26.28 ? 316 HOH A O   1 
HETATM 581 H H1  . HOH C 3 .  ? 113.668 141.584 -0.190 1.00 0.00  ? 316 HOH A H1  1 
HETATM 582 H H2  . HOH C 3 .  ? 114.495 140.395 -0.495 1.00 0.00  ? 316 HOH A H2  1 
HETATM 583 O O   . HOH C 3 .  ? 117.639 143.039 19.168 1.00 12.49 ? 317 HOH A O   1 
HETATM 584 H H1  . HOH C 3 .  ? 118.522 142.889 18.750 1.00 0.00  ? 317 HOH A H1  1 
HETATM 585 H H2  . HOH C 3 .  ? 117.745 143.950 19.466 1.00 0.00  ? 317 HOH A H2  1 
HETATM 586 O O   . HOH C 3 .  ? 117.708 141.205 11.587 1.00 18.78 ? 318 HOH A O   1 
HETATM 587 H H1  . HOH C 3 .  ? 118.504 141.015 11.071 1.00 0.00  ? 318 HOH A H1  1 
HETATM 588 H H2  . HOH C 3 .  ? 118.053 141.284 12.485 1.00 0.00  ? 318 HOH A H2  1 
HETATM 589 O O   . HOH C 3 .  ? 117.869 134.182 5.951  1.00 16.73 ? 319 HOH A O   1 
HETATM 590 H H1  . HOH C 3 .  ? 118.095 133.235 5.920  1.00 0.00  ? 319 HOH A H1  1 
HETATM 591 H H2  . HOH C 3 .  ? 118.755 134.548 6.007  1.00 0.00  ? 319 HOH A H2  1 
HETATM 592 O O   . HOH C 3 .  ? 96.578  135.116 16.645 1.00 53.63 ? 320 HOH A O   1 
HETATM 593 H H1  . HOH C 3 .  ? 96.848  135.224 15.731 1.00 0.00  ? 320 HOH A H1  1 
HETATM 594 H H2  . HOH C 3 .  ? 95.617  135.063 16.596 1.00 0.00  ? 320 HOH A H2  1 
HETATM 595 O O   . HOH C 3 .  ? 119.668 131.891 6.651  1.00 15.10 ? 321 HOH A O   1 
HETATM 596 H H1  . HOH C 3 .  ? 120.435 132.191 7.148  1.00 0.00  ? 321 HOH A H1  1 
HETATM 597 H H2  . HOH C 3 .  ? 119.207 131.336 7.303  1.00 0.00  ? 321 HOH A H2  1 
HETATM 598 O O   . HOH C 3 .  ? 106.490 127.515 20.764 1.00 10.71 ? 322 HOH A O   1 
HETATM 599 H H1  . HOH C 3 .  ? 107.039 126.727 20.984 1.00 0.00  ? 322 HOH A H1  1 
HETATM 600 H H2  . HOH C 3 .  ? 106.887 127.794 19.936 1.00 0.00  ? 322 HOH A H2  1 
HETATM 601 O O   . HOH C 3 .  ? 106.743 141.403 25.353 1.00 22.19 ? 323 HOH A O   1 
HETATM 602 H H1  . HOH C 3 .  ? 106.344 141.657 24.505 1.00 0.00  ? 323 HOH A H1  1 
HETATM 603 H H2  . HOH C 3 .  ? 107.353 140.720 25.058 1.00 0.00  ? 323 HOH A H2  1 
HETATM 604 O O   . HOH C 3 .  ? 111.219 148.503 23.125 1.00 12.39 ? 324 HOH A O   1 
HETATM 605 H H1  . HOH C 3 .  ? 110.260 148.388 23.046 1.00 0.00  ? 324 HOH A H1  1 
HETATM 606 H H2  . HOH C 3 .  ? 111.473 147.621 23.428 1.00 0.00  ? 324 HOH A H2  1 
HETATM 607 O O   . HOH C 3 .  ? 108.210 125.290 21.112 1.00 16.52 ? 325 HOH A O   1 
HETATM 608 H H1  . HOH C 3 .  ? 108.619 124.735 21.770 1.00 0.00  ? 325 HOH A H1  1 
HETATM 609 H H2  . HOH C 3 .  ? 108.038 124.574 20.465 1.00 0.00  ? 325 HOH A H2  1 
HETATM 610 O O   . HOH C 3 .  ? 122.368 135.243 4.934  1.00 35.62 ? 326 HOH A O   1 
HETATM 611 H H1  . HOH C 3 .  ? 122.564 136.197 4.978  1.00 0.00  ? 326 HOH A H1  1 
HETATM 612 H H2  . HOH C 3 .  ? 122.991 134.904 5.595  1.00 0.00  ? 326 HOH A H2  1 
HETATM 613 O O   . HOH C 3 .  ? 101.688 129.796 23.794 1.00 14.53 ? 327 HOH A O   1 
HETATM 614 H H1  . HOH C 3 .  ? 100.748 129.637 23.931 1.00 0.00  ? 327 HOH A H1  1 
HETATM 615 H H2  . HOH C 3 .  ? 101.998 128.871 23.717 1.00 0.00  ? 327 HOH A H2  1 
HETATM 616 O O   . HOH C 3 .  ? 111.570 122.998 19.127 1.00 19.69 ? 328 HOH A O   1 
HETATM 617 H H1  . HOH C 3 .  ? 111.956 123.703 18.576 1.00 0.00  ? 328 HOH A H1  1 
HETATM 618 H H2  . HOH C 3 .  ? 112.340 122.424 19.205 1.00 0.00  ? 328 HOH A H2  1 
HETATM 619 O O   . HOH C 3 .  ? 101.352 134.733 3.393  1.00 37.72 ? 329 HOH A O   1 
HETATM 620 H H1  . HOH C 3 .  ? 101.734 135.187 4.151  1.00 0.00  ? 329 HOH A H1  1 
HETATM 621 H H2  . HOH C 3 .  ? 100.979 135.428 2.856  1.00 0.00  ? 329 HOH A H2  1 
HETATM 622 O O   . HOH C 3 .  ? 118.093 132.395 21.450 1.00 30.28 ? 330 HOH A O   1 
HETATM 623 H H1  . HOH C 3 .  ? 117.312 131.872 21.280 1.00 0.00  ? 330 HOH A H1  1 
HETATM 624 H H2  . HOH C 3 .  ? 117.988 133.091 20.791 1.00 0.00  ? 330 HOH A H2  1 
HETATM 625 O O   . HOH C 3 .  ? 114.426 129.369 20.460 1.00 13.57 ? 331 HOH A O   1 
HETATM 626 H H1  . HOH C 3 .  ? 114.258 130.156 20.995 1.00 0.00  ? 331 HOH A H1  1 
HETATM 627 H H2  . HOH C 3 .  ? 113.964 129.610 19.656 1.00 0.00  ? 331 HOH A H2  1 
HETATM 628 O O   . HOH C 3 .  ? 105.766 133.386 4.337  1.00 32.65 ? 332 HOH A O   1 
HETATM 629 H H1  . HOH C 3 .  ? 106.257 134.172 4.617  1.00 0.00  ? 332 HOH A H1  1 
HETATM 630 H H2  . HOH C 3 .  ? 106.365 132.931 3.757  1.00 0.00  ? 332 HOH A H2  1 
HETATM 631 O O   . HOH C 3 .  ? 94.817  126.005 18.255 1.00 21.82 ? 333 HOH A O   1 
HETATM 632 H H1  . HOH C 3 .  ? 93.905  126.055 17.900 1.00 0.00  ? 333 HOH A H1  1 
HETATM 633 H H2  . HOH C 3 .  ? 94.780  125.088 18.563 1.00 0.00  ? 333 HOH A H2  1 
HETATM 634 O O   . HOH C 3 .  ? 118.958 142.782 21.614 1.00 24.02 ? 334 HOH A O   1 
HETATM 635 H H1  . HOH C 3 .  ? 119.774 143.199 21.301 1.00 0.00  ? 334 HOH A H1  1 
HETATM 636 H H2  . HOH C 3 .  ? 118.391 142.852 20.831 1.00 0.00  ? 334 HOH A H2  1 
HETATM 637 O O   . HOH C 3 .  ? 112.963 136.921 -1.435 1.00 11.50 ? 335 HOH A O   1 
HETATM 638 H H1  . HOH C 3 .  ? 113.833 136.487 -1.552 1.00 0.00  ? 335 HOH A H1  1 
HETATM 639 H H2  . HOH C 3 .  ? 113.103 137.671 -2.058 1.00 0.00  ? 335 HOH A H2  1 
HETATM 640 O O   . HOH C 3 .  ? 111.533 140.185 4.615  1.00 32.95 ? 336 HOH A O   1 
HETATM 641 H H1  . HOH C 3 .  ? 110.704 140.377 5.058  1.00 0.00  ? 336 HOH A H1  1 
HETATM 642 H H2  . HOH C 3 .  ? 111.418 139.265 4.359  1.00 0.00  ? 336 HOH A H2  1 
HETATM 643 O O   . HOH C 3 .  ? 108.378 145.071 12.569 1.00 17.50 ? 337 HOH A O   1 
HETATM 644 H H1  . HOH C 3 .  ? 107.727 144.562 12.048 1.00 0.00  ? 337 HOH A H1  1 
HETATM 645 H H2  . HOH C 3 .  ? 108.968 145.410 11.876 1.00 0.00  ? 337 HOH A H2  1 
HETATM 646 O O   . HOH C 3 .  ? 113.789 138.917 26.474 1.00 17.09 ? 338 HOH A O   1 
HETATM 647 H H1  . HOH C 3 .  ? 113.955 139.768 26.913 1.00 0.00  ? 338 HOH A H1  1 
HETATM 648 H H2  . HOH C 3 .  ? 114.621 138.817 25.956 1.00 0.00  ? 338 HOH A H2  1 
HETATM 649 O O   . HOH C 3 .  ? 109.076 125.947 4.249  1.00 27.30 ? 339 HOH A O   1 
HETATM 650 H H1  . HOH C 3 .  ? 109.182 125.104 3.800  1.00 0.00  ? 339 HOH A H1  1 
HETATM 651 H H2  . HOH C 3 .  ? 109.607 125.857 5.039  1.00 0.00  ? 339 HOH A H2  1 
HETATM 652 O O   . HOH C 3 .  ? 116.169 138.943 24.962 1.00 17.30 ? 340 HOH A O   1 
HETATM 653 H H1  . HOH C 3 .  ? 116.066 139.583 24.238 1.00 0.00  ? 340 HOH A H1  1 
HETATM 654 H H2  . HOH C 3 .  ? 117.004 138.543 24.702 1.00 0.00  ? 340 HOH A H2  1 
HETATM 655 O O   . HOH C 3 .  ? 107.443 144.682 8.354  1.00 22.74 ? 341 HOH A O   1 
HETATM 656 H H1  . HOH C 3 .  ? 107.400 144.301 9.249  1.00 0.00  ? 341 HOH A H1  1 
HETATM 657 H H2  . HOH C 3 .  ? 108.386 144.822 8.213  1.00 0.00  ? 341 HOH A H2  1 
HETATM 658 O O   . HOH C 3 .  ? 112.492 145.771 9.760  1.00 35.95 ? 342 HOH A O   1 
HETATM 659 H H1  . HOH C 3 .  ? 111.796 145.503 10.387 1.00 0.00  ? 342 HOH A H1  1 
HETATM 660 H H2  . HOH C 3 .  ? 113.282 145.597 10.286 1.00 0.00  ? 342 HOH A H2  1 
HETATM 661 O O   . HOH C 3 .  ? 98.861  128.647 17.379 1.00 15.20 ? 343 HOH A O   1 
HETATM 662 H H1  . HOH C 3 .  ? 98.394  127.802 17.240 1.00 0.00  ? 343 HOH A H1  1 
HETATM 663 H H2  . HOH C 3 .  ? 99.232  128.840 16.506 1.00 0.00  ? 343 HOH A H2  1 
HETATM 664 O O   . HOH C 3 .  ? 108.369 123.182 19.654 1.00 12.39 ? 344 HOH A O   1 
HETATM 665 H H1  . HOH C 3 .  ? 108.366 123.364 18.710 1.00 0.00  ? 344 HOH A H1  1 
HETATM 666 H H2  . HOH C 3 .  ? 109.299 122.932 19.791 1.00 0.00  ? 344 HOH A H2  1 
HETATM 667 O O   . HOH C 3 .  ? 115.648 124.158 10.018 1.00 15.03 ? 345 HOH A O   1 
HETATM 668 H H1  . HOH C 3 .  ? 115.879 123.276 9.718  1.00 0.00  ? 345 HOH A H1  1 
HETATM 669 H H2  . HOH C 3 .  ? 116.545 124.549 10.107 1.00 0.00  ? 345 HOH A H2  1 
HETATM 670 O O   . HOH C 3 .  ? 113.433 146.803 19.486 1.00 20.37 ? 346 HOH A O   1 
HETATM 671 H H1  . HOH C 3 .  ? 113.492 146.782 18.528 1.00 0.00  ? 346 HOH A H1  1 
HETATM 672 H H2  . HOH C 3 .  ? 112.531 147.142 19.612 1.00 0.00  ? 346 HOH A H2  1 
HETATM 673 O O   . HOH C 3 .  ? 102.400 126.975 23.506 1.00 30.49 ? 348 HOH A O   1 
HETATM 674 H H1  . HOH C 3 .  ? 102.265 126.177 24.021 1.00 0.00  ? 348 HOH A H1  1 
HETATM 675 H H2  . HOH C 3 .  ? 103.364 127.067 23.443 1.00 0.00  ? 348 HOH A H2  1 
HETATM 676 O O   . HOH C 3 .  ? 110.745 145.039 11.868 1.00 22.59 ? 349 HOH A O   1 
HETATM 677 H H1  . HOH C 3 .  ? 110.165 144.720 12.580 1.00 0.00  ? 349 HOH A H1  1 
HETATM 678 H H2  . HOH C 3 .  ? 111.632 144.768 12.219 1.00 0.00  ? 349 HOH A H2  1 
HETATM 679 O O   . HOH C 3 .  ? 97.764  148.191 13.142 1.00 30.60 ? 350 HOH A O   1 
HETATM 680 H H1  . HOH C 3 .  ? 97.130  147.468 13.357 1.00 0.00  ? 350 HOH A H1  1 
HETATM 681 H H2  . HOH C 3 .  ? 97.692  148.203 12.185 1.00 0.00  ? 350 HOH A H2  1 
HETATM 682 O O   . HOH C 3 .  ? 113.060 144.268 12.719 1.00 21.64 ? 351 HOH A O   1 
HETATM 683 H H1  . HOH C 3 .  ? 113.128 143.360 13.026 1.00 0.00  ? 351 HOH A H1  1 
HETATM 684 H H2  . HOH C 3 .  ? 113.990 144.518 12.586 1.00 0.00  ? 351 HOH A H2  1 
HETATM 685 O O   . HOH C 3 .  ? 97.420  146.421 8.215  1.00 34.93 ? 352 HOH A O   1 
HETATM 686 H H1  . HOH C 3 .  ? 97.423  145.516 7.896  1.00 0.00  ? 352 HOH A H1  1 
HETATM 687 H H2  . HOH C 3 .  ? 97.795  146.914 7.479  1.00 0.00  ? 352 HOH A H2  1 
HETATM 688 O O   . HOH C 3 .  ? 103.488 142.056 25.613 1.00 41.82 ? 353 HOH A O   1 
HETATM 689 H H1  . HOH C 3 .  ? 103.702 142.999 25.675 1.00 0.00  ? 353 HOH A H1  1 
HETATM 690 H H2  . HOH C 3 .  ? 102.937 141.929 26.384 1.00 0.00  ? 353 HOH A H2  1 
HETATM 691 O O   . HOH C 3 .  ? 99.406  131.937 4.265  1.00 24.42 ? 354 HOH A O   1 
HETATM 692 H H1  . HOH C 3 .  ? 99.058  132.019 3.378  1.00 0.00  ? 354 HOH A H1  1 
HETATM 693 H H2  . HOH C 3 .  ? 100.094 132.614 4.295  1.00 0.00  ? 354 HOH A H2  1 
HETATM 694 O O   . HOH C 3 .  ? 98.717  140.976 6.204  1.00 28.63 ? 355 HOH A O   1 
HETATM 695 H H1  . HOH C 3 .  ? 98.275  141.391 5.449  1.00 0.00  ? 355 HOH A H1  1 
HETATM 696 H H2  . HOH C 3 .  ? 98.044  141.066 6.912  1.00 0.00  ? 355 HOH A H2  1 
HETATM 697 O O   . HOH C 3 .  ? 115.452 135.585 27.548 1.00 28.14 ? 356 HOH A O   1 
HETATM 698 H H1  . HOH C 3 .  ? 115.966 135.208 28.266 1.00 0.00  ? 356 HOH A H1  1 
HETATM 699 H H2  . HOH C 3 .  ? 115.520 134.915 26.857 1.00 0.00  ? 356 HOH A H2  1 
HETATM 700 O O   . HOH C 3 .  ? 111.581 128.714 25.070 1.00 25.81 ? 357 HOH A O   1 
HETATM 701 H H1  . HOH C 3 .  ? 112.082 128.330 24.342 1.00 0.00  ? 357 HOH A H1  1 
HETATM 702 H H2  . HOH C 3 .  ? 112.119 128.510 25.838 1.00 0.00  ? 357 HOH A H2  1 
HETATM 703 O O   . HOH C 3 .  ? 102.820 124.445 14.467 1.00 22.04 ? 358 HOH A O   1 
HETATM 704 H H1  . HOH C 3 .  ? 103.441 124.354 15.190 1.00 0.00  ? 358 HOH A H1  1 
HETATM 705 H H2  . HOH C 3 .  ? 102.101 124.958 14.893 1.00 0.00  ? 358 HOH A H2  1 
HETATM 706 O O   . HOH C 3 .  ? 97.782  125.073 21.284 1.00 40.63 ? 359 HOH A O   1 
HETATM 707 H H1  . HOH C 3 .  ? 97.646  124.137 21.470 1.00 0.00  ? 359 HOH A H1  1 
HETATM 708 H H2  . HOH C 3 .  ? 98.726  125.052 21.083 1.00 0.00  ? 359 HOH A H2  1 
HETATM 709 O O   . HOH C 3 .  ? 96.898  133.844 10.034 1.00 31.35 ? 360 HOH A O   1 
HETATM 710 H H1  . HOH C 3 .  ? 96.620  133.352 10.768 1.00 0.00  ? 360 HOH A H1  1 
HETATM 711 H H2  . HOH C 3 .  ? 96.156  134.345 9.636  1.00 0.00  ? 360 HOH A H2  1 
HETATM 712 O O   . HOH C 3 .  ? 105.518 140.193 27.318 1.00 58.58 ? 361 HOH A O   1 
HETATM 713 H H1  . HOH C 3 .  ? 104.943 139.910 26.599 1.00 0.00  ? 361 HOH A H1  1 
HETATM 714 H H2  . HOH C 3 .  ? 106.094 140.783 26.799 1.00 0.00  ? 361 HOH A H2  1 
HETATM 715 O O   . HOH C 3 .  ? 96.859  138.442 14.488 1.00 47.06 ? 362 HOH A O   1 
HETATM 716 H H1  . HOH C 3 .  ? 96.429  137.700 14.076 1.00 0.00  ? 362 HOH A H1  1 
HETATM 717 H H2  . HOH C 3 .  ? 97.794  138.338 14.295 1.00 0.00  ? 362 HOH A H2  1 
HETATM 718 O O   . HOH C 3 .  ? 101.621 123.253 18.174 1.00 28.96 ? 363 HOH A O   1 
HETATM 719 H H1  . HOH C 3 .  ? 102.280 123.891 18.419 1.00 0.00  ? 363 HOH A H1  1 
HETATM 720 H H2  . HOH C 3 .  ? 100.998 123.780 17.662 1.00 0.00  ? 363 HOH A H2  1 
HETATM 721 O O   . HOH C 3 .  ? 110.111 128.251 20.980 1.00 22.93 ? 364 HOH A O   1 
HETATM 722 H H1  . HOH C 3 .  ? 110.595 127.568 20.504 1.00 0.00  ? 364 HOH A H1  1 
HETATM 723 H H2  . HOH C 3 .  ? 109.215 127.909 21.016 1.00 0.00  ? 364 HOH A H2  1 
HETATM 724 O O   . HOH C 3 .  ? 112.292 127.175 21.382 1.00 48.19 ? 365 HOH A O   1 
HETATM 725 H H1  . HOH C 3 .  ? 112.792 127.329 20.580 1.00 0.00  ? 365 HOH A H1  1 
HETATM 726 H H2  . HOH C 3 .  ? 112.177 128.088 21.689 1.00 0.00  ? 365 HOH A H2  1 
HETATM 727 O O   . HOH C 3 .  ? 119.342 143.461 17.430 1.00 35.24 ? 366 HOH A O   1 
HETATM 728 H H1  . HOH C 3 .  ? 118.813 143.006 16.767 1.00 0.00  ? 366 HOH A H1  1 
HETATM 729 H H2  . HOH C 3 .  ? 119.065 144.376 17.323 1.00 0.00  ? 366 HOH A H2  1 
HETATM 730 O O   . HOH C 3 .  ? 100.650 129.073 5.428  1.00 25.59 ? 367 HOH A O   1 
HETATM 731 H H1  . HOH C 3 .  ? 99.863  129.110 4.876  1.00 0.00  ? 367 HOH A H1  1 
HETATM 732 H H2  . HOH C 3 .  ? 100.742 128.146 5.644  1.00 0.00  ? 367 HOH A H2  1 
HETATM 733 O O   . HOH C 3 .  ? 95.760  144.389 11.023 1.00 32.42 ? 368 HOH A O   1 
HETATM 734 H H1  . HOH C 3 .  ? 95.841  143.960 11.877 1.00 0.00  ? 368 HOH A H1  1 
HETATM 735 H H2  . HOH C 3 .  ? 96.003  143.653 10.451 1.00 0.00  ? 368 HOH A H2  1 
HETATM 736 O O   . HOH D 3 .  ? 121.320 130.302 15.802 1.00 27.69 ? 303 HOH B O   1 
HETATM 737 H H1  . HOH D 3 .  ? 120.869 131.117 15.560 1.00 0.00  ? 303 HOH B H1  1 
HETATM 738 H H2  . HOH D 3 .  ? 121.504 129.906 14.951 1.00 0.00  ? 303 HOH B H2  1 
HETATM 739 O O   . HOH D 3 .  ? 118.334 124.830 9.927  1.00 20.91 ? 347 HOH B O   1 
HETATM 740 H H1  . HOH D 3 .  ? 119.018 124.248 9.580  1.00 0.00  ? 347 HOH B H1  1 
HETATM 741 H H2  . HOH D 3 .  ? 118.311 125.551 9.274  1.00 0.00  ? 347 HOH B H2  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ALA 1  134 134 ALA ALA A . n 
A 1 2  GLU 2  135 135 GLU GLU A . n 
A 1 3  TYR 3  136 136 TYR TYR A . n 
A 1 4  VAL 4  137 137 VAL VAL A . n 
A 1 5  ARG 5  138 138 ARG ARG A . n 
A 1 6  ALA 6  139 139 ALA ALA A . n 
A 1 7  LEU 7  140 140 LEU LEU A . n 
A 1 8  PHE 8  141 141 PHE PHE A . n 
A 1 9  ASP 9  142 142 ASP ASP A . n 
A 1 10 PHE 10 143 143 PHE PHE A . n 
A 1 11 ASN 11 144 144 ASN ASN A . n 
A 1 12 GLY 12 145 145 GLY GLY A . n 
A 1 13 ASN 13 146 146 ASN ASN A . n 
A 1 14 ASP 14 147 147 ASP ASP A . n 
A 1 15 GLU 15 148 148 GLU GLU A . n 
A 1 16 GLU 16 149 149 GLU GLU A . n 
A 1 17 ASP 17 150 150 ASP ASP A . n 
A 1 18 LEU 18 151 151 LEU LEU A . n 
A 1 19 PRO 19 152 152 PRO PRO A . n 
A 1 20 PHE 20 153 153 PHE PHE A . n 
A 1 21 LYS 21 154 154 LYS LYS A . n 
A 1 22 LYS 22 155 155 LYS LYS A . n 
A 1 23 GLY 23 156 156 GLY GLY A . n 
A 1 24 ASP 24 157 157 ASP ASP A . n 
A 1 25 ILE 25 158 158 ILE ILE A . n 
A 1 26 LEU 26 159 159 LEU LEU A . n 
A 1 27 ARG 27 160 160 ARG ARG A . n 
A 1 28 ILE 28 161 161 ILE ILE A . n 
A 1 29 ARG 29 162 162 ARG ARG A . n 
A 1 30 ASP 30 163 163 ASP ASP A . n 
A 1 31 LYS 31 164 164 LYS LYS A . n 
A 1 32 PRO 32 165 165 PRO PRO A . n 
A 1 33 GLU 33 166 166 GLU GLU A . n 
A 1 34 GLU 34 167 167 GLU GLU A . n 
A 1 35 GLN 35 168 168 GLN GLN A . n 
A 1 36 TRP 36 169 169 TRP TRP A . n 
A 1 37 TRP 37 170 170 TRP TRP A . n 
A 1 38 ASN 38 171 171 ASN ASN A . n 
A 1 39 ALA 39 172 172 ALA ALA A . n 
A 1 40 GLU 40 173 173 GLU GLU A . n 
A 1 41 ASP 41 174 174 ASP ASP A . n 
A 1 42 SER 42 175 175 SER SER A . n 
A 1 43 GLU 43 176 176 GLU GLU A . n 
A 1 44 GLY 44 177 177 GLY GLY A . n 
A 1 45 LYS 45 178 178 LYS LYS A . n 
A 1 46 ARG 46 179 179 ARG ARG A . n 
A 1 47 GLY 47 180 180 GLY GLY A . n 
A 1 48 MET 48 181 181 MET MET A . n 
A 1 49 ILE 49 182 182 ILE ILE A . n 
A 1 50 PRO 50 183 183 PRO PRO A . n 
A 1 51 VAL 51 184 184 VAL VAL A . n 
A 1 52 PRO 52 185 185 PRO PRO A . n 
A 1 53 TYR 53 186 186 TYR TYR A . n 
A 1 54 VAL 54 187 187 VAL VAL A . n 
A 1 55 GLU 55 188 188 GLU GLU A . n 
A 1 56 LYS 56 189 189 LYS LYS A . n 
A 1 57 TYR 57 190 190 TYR TYR A . n 
B 2 1  PRO 1  1   1   PRO PRO B . n 
B 2 2  PRO 2  2   2   PRO PRO B . n 
B 2 3  PRO 3  3   3   PRO PRO B . n 
B 2 4  VAL 4  4   4   VAL VAL B . n 
B 2 5  PRO 5  5   5   PRO PRO B . n 
B 2 6  PRO 6  6   6   PRO PRO B . n 
B 2 7  ARG 7  7   7   ARG ARG B . n 
B 2 8  ARG 8  8   8   ARG ARG B . n 
B 2 9  ARG 9  9   ?   ?   ?   B . n 
B 2 10 ARG 10 10  ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  301 301 HOH HOH A . 
C 3 HOH 2  302 302 HOH HOH A . 
C 3 HOH 3  304 304 HOH HOH A . 
C 3 HOH 4  305 305 HOH HOH A . 
C 3 HOH 5  306 306 HOH HOH A . 
C 3 HOH 6  307 307 HOH HOH A . 
C 3 HOH 7  308 308 HOH HOH A . 
C 3 HOH 8  309 309 HOH HOH A . 
C 3 HOH 9  310 310 HOH HOH A . 
C 3 HOH 10 311 311 HOH HOH A . 
C 3 HOH 11 312 312 HOH HOH A . 
C 3 HOH 12 313 313 HOH HOH A . 
C 3 HOH 13 314 314 HOH HOH A . 
C 3 HOH 14 315 315 HOH HOH A . 
C 3 HOH 15 316 316 HOH HOH A . 
C 3 HOH 16 317 317 HOH HOH A . 
C 3 HOH 17 318 318 HOH HOH A . 
C 3 HOH 18 319 319 HOH HOH A . 
C 3 HOH 19 320 320 HOH HOH A . 
C 3 HOH 20 321 321 HOH HOH A . 
C 3 HOH 21 322 322 HOH HOH A . 
C 3 HOH 22 323 323 HOH HOH A . 
C 3 HOH 23 324 324 HOH HOH A . 
C 3 HOH 24 325 325 HOH HOH A . 
C 3 HOH 25 326 326 HOH HOH A . 
C 3 HOH 26 327 327 HOH HOH A . 
C 3 HOH 27 328 328 HOH HOH A . 
C 3 HOH 28 329 329 HOH HOH A . 
C 3 HOH 29 330 330 HOH HOH A . 
C 3 HOH 30 331 331 HOH HOH A . 
C 3 HOH 31 332 332 HOH HOH A . 
C 3 HOH 32 333 333 HOH HOH A . 
C 3 HOH 33 334 334 HOH HOH A . 
C 3 HOH 34 335 335 HOH HOH A . 
C 3 HOH 35 336 336 HOH HOH A . 
C 3 HOH 36 337 337 HOH HOH A . 
C 3 HOH 37 338 338 HOH HOH A . 
C 3 HOH 38 339 339 HOH HOH A . 
C 3 HOH 39 340 340 HOH HOH A . 
C 3 HOH 40 341 341 HOH HOH A . 
C 3 HOH 41 342 342 HOH HOH A . 
C 3 HOH 42 343 343 HOH HOH A . 
C 3 HOH 43 344 344 HOH HOH A . 
C 3 HOH 44 345 345 HOH HOH A . 
C 3 HOH 45 346 346 HOH HOH A . 
C 3 HOH 46 348 348 HOH HOH A . 
C 3 HOH 47 349 349 HOH HOH A . 
C 3 HOH 48 350 350 HOH HOH A . 
C 3 HOH 49 351 351 HOH HOH A . 
C 3 HOH 50 352 352 HOH HOH A . 
C 3 HOH 51 353 353 HOH HOH A . 
C 3 HOH 52 354 354 HOH HOH A . 
C 3 HOH 53 355 355 HOH HOH A . 
C 3 HOH 54 356 356 HOH HOH A . 
C 3 HOH 55 357 357 HOH HOH A . 
C 3 HOH 56 358 358 HOH HOH A . 
C 3 HOH 57 359 359 HOH HOH A . 
C 3 HOH 58 360 360 HOH HOH A . 
C 3 HOH 59 361 361 HOH HOH A . 
C 3 HOH 60 362 362 HOH HOH A . 
C 3 HOH 61 363 363 HOH HOH A . 
C 3 HOH 62 364 364 HOH HOH A . 
C 3 HOH 63 365 365 HOH HOH A . 
C 3 HOH 64 366 366 HOH HOH A . 
C 3 HOH 65 367 367 HOH HOH A . 
C 3 HOH 66 368 368 HOH HOH A . 
D 3 HOH 1  303 303 HOH HOH B . 
D 3 HOH 2  347 347 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 870  ? 
1 MORE         -4   ? 
1 'SSA (A^2)'  4220 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1995-05-08 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
DENZO  'data reduction' . ? 3 
X-PLOR phasing          . ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 OE1 A GLU 135 ? ? H1 A HOH 363 ? ? 0.97 
2  1 O   A ASP 174 ? ? H2 A HOH 362 ? ? 1.00 
3  1 O   A GLU 149 ? ? H1 A HOH 332 ? ? 1.11 
4  1 O   A TYR 136 ? ? H1 A HOH 305 ? ? 1.33 
5  1 OE1 A GLU 173 ? ? H2 A HOH 314 ? ? 1.53 
6  1 OE2 A GLU 173 ? ? H2 A HOH 314 ? ? 1.57 
7  1 OD1 A ASN 144 ? ? H2 A HOH 351 ? ? 1.59 
8  1 H1  A HOH 306 ? ? O  A HOH 334 ? ? 1.59 
9  1 H2  A HOH 349 ? ? O  A HOH 351 ? ? 1.59 
10 1 O   A GLU 149 ? ? O  A HOH 332 ? ? 1.82 
11 1 OE1 A GLU 173 ? ? O  A HOH 360 ? ? 1.85 
12 1 OE1 A GLU 135 ? ? O  A HOH 363 ? ? 1.85 
13 1 O   A ASP 174 ? ? O  A HOH 362 ? ? 1.95 
14 1 OD1 A ASN 144 ? ? O  A HOH 351 ? ? 2.17 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O   A ARG 162 ? ? 1_555 H2  A HOH 346 ? ? 4_4104 0.96 
2 1 O   A ILE 161 ? ? 1_555 H1  A HOH 324 ? ? 4_4104 1.22 
3 1 O   A LYS 164 ? ? 1_555 H2  A HOH 304 ? ? 3_1055 1.34 
4 1 O   A HOH 324 ? ? 1_555 H2  A HOH 358 ? ? 3_1065 1.55 
5 1 CG  A LYS 154 ? ? 1_555 NH2 A ARG 162 ? ? 3_1065 1.78 
6 1 O   A ARG 162 ? ? 1_555 O   A HOH 346 ? ? 4_4104 1.87 
7 1 OD2 A ASP 157 ? ? 1_555 NH2 A ARG 179 ? ? 3_1065 1.98 
8 1 O   A ILE 161 ? ? 1_555 O   A HOH 324 ? ? 4_4104 2.12 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A TYR 190 ? O   ? A TYR 57 O   
2 1 Y 1 B ARG 8   ? O   ? B ARG 8  O   
3 1 Y 1 B ARG 8   ? CG  ? B ARG 8  CG  
4 1 Y 1 B ARG 8   ? CD  ? B ARG 8  CD  
5 1 Y 1 B ARG 8   ? NE  ? B ARG 8  NE  
6 1 Y 1 B ARG 8   ? CZ  ? B ARG 8  CZ  
7 1 Y 1 B ARG 8   ? NH1 ? B ARG 8  NH1 
8 1 Y 1 B ARG 8   ? NH2 ? B ARG 8  NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 B ARG 9  ? B ARG 9  
2 1 Y 1 B ARG 10 ? B ARG 10 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#