data_1CKQ
# 
_entry.id   1CKQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1CKQ         
NDB   PD0049       
RCSB  RCSB000923   
WWPDB D_1000000923 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1CKQ 
_pdbx_database_status.recvd_initial_deposition_date   1999-04-22 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Horvath, M.'     1 
'Rosenberg, J.M.' 2 
# 
_citation.id                        primary 
_citation.title                     
;The Integration of Recognition and Cleavage: X-Ray Structures of Pre- Transition State and Post-Reactive DNA-Eco Ri Endonuclease Complexes
;
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Horvath, M.'       1 
primary 'Choi, J.'          2 
primary 'Kim, Y.'           3 
primary 'Wilkosz, P.A.'     4 
primary 'Chandrasekhar, K.' 5 
primary 'Rosenberg, J.M.'   6 
# 
_cell.entry_id           1CKQ 
_cell.length_a           118.110 
_cell.length_b           118.110 
_cell.length_c           49.450 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1CKQ 
_symmetry.space_group_name_H-M             'P 3 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     trigonal 
_symmetry.Int_Tables_number                150 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 
;DNA (5'-D(*TP*CP*GP*CP*GP*AP*AP*TP*TP*CP*GP*CP*G)-3')
;
3967.585  1   ? ? ? ? 
2 polymer nat 'PROTEIN (ENDONUCLEASE)'                                30970.184 1   ? ? ? ? 
3 water   nat water                                                   18.015    151 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DC)(DG)(DC)(DG)(DA)(DA)(DT)(DT)(DC)(DG)(DC)(DG)' TCGCGAATTCGCG B ? 
2 'polypeptide(L)'        no no 
;SNKKQSNRLTEQHKLSQGVIGIFGDYAKAHDLAVGEVSKLVKKALSNEYPQLSFRYRDSIKKTEINEALKKIDPDLGGTL
FVSNSSIKPDGGIVEVKDDYGEWRVVLVAEAKHQGKDIINIRNGLLVGKRGDQDLMAAGNAIERSHKNISEIANFMLSES
HFPYVLFLEGSNFLTENISITRPDGRVVNLEYNSGILNRLDRLTAANYGMPINSNLCINKFVNHKDKSIMLQAASIYTQG
DGREWDSKIMFEIMFDISTTSLRVLGRDLFEQLTSK
;
;SNKKQSNRLTEQHKLSQGVIGIFGDYAKAHDLAVGEVSKLVKKALSNEYPQLSFRYRDSIKKTEINEALKKIDPDLGGTL
FVSNSSIKPDGGIVEVKDDYGEWRVVLVAEAKHQGKDIINIRNGLLVGKRGDQDLMAAGNAIERSHKNISEIANFMLSES
HFPYVLFLEGSNFLTENISITRPDGRVVNLEYNSGILNRLDRLTAANYGMPINSNLCINKFVNHKDKSIMLQAASIYTQG
DGREWDSKIMFEIMFDISTTSLRVLGRDLFEQLTSK
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DT  n 
1 2   DC  n 
1 3   DG  n 
1 4   DC  n 
1 5   DG  n 
1 6   DA  n 
1 7   DA  n 
1 8   DT  n 
1 9   DT  n 
1 10  DC  n 
1 11  DG  n 
1 12  DC  n 
1 13  DG  n 
2 1   SER n 
2 2   ASN n 
2 3   LYS n 
2 4   LYS n 
2 5   GLN n 
2 6   SER n 
2 7   ASN n 
2 8   ARG n 
2 9   LEU n 
2 10  THR n 
2 11  GLU n 
2 12  GLN n 
2 13  HIS n 
2 14  LYS n 
2 15  LEU n 
2 16  SER n 
2 17  GLN n 
2 18  GLY n 
2 19  VAL n 
2 20  ILE n 
2 21  GLY n 
2 22  ILE n 
2 23  PHE n 
2 24  GLY n 
2 25  ASP n 
2 26  TYR n 
2 27  ALA n 
2 28  LYS n 
2 29  ALA n 
2 30  HIS n 
2 31  ASP n 
2 32  LEU n 
2 33  ALA n 
2 34  VAL n 
2 35  GLY n 
2 36  GLU n 
2 37  VAL n 
2 38  SER n 
2 39  LYS n 
2 40  LEU n 
2 41  VAL n 
2 42  LYS n 
2 43  LYS n 
2 44  ALA n 
2 45  LEU n 
2 46  SER n 
2 47  ASN n 
2 48  GLU n 
2 49  TYR n 
2 50  PRO n 
2 51  GLN n 
2 52  LEU n 
2 53  SER n 
2 54  PHE n 
2 55  ARG n 
2 56  TYR n 
2 57  ARG n 
2 58  ASP n 
2 59  SER n 
2 60  ILE n 
2 61  LYS n 
2 62  LYS n 
2 63  THR n 
2 64  GLU n 
2 65  ILE n 
2 66  ASN n 
2 67  GLU n 
2 68  ALA n 
2 69  LEU n 
2 70  LYS n 
2 71  LYS n 
2 72  ILE n 
2 73  ASP n 
2 74  PRO n 
2 75  ASP n 
2 76  LEU n 
2 77  GLY n 
2 78  GLY n 
2 79  THR n 
2 80  LEU n 
2 81  PHE n 
2 82  VAL n 
2 83  SER n 
2 84  ASN n 
2 85  SER n 
2 86  SER n 
2 87  ILE n 
2 88  LYS n 
2 89  PRO n 
2 90  ASP n 
2 91  GLY n 
2 92  GLY n 
2 93  ILE n 
2 94  VAL n 
2 95  GLU n 
2 96  VAL n 
2 97  LYS n 
2 98  ASP n 
2 99  ASP n 
2 100 TYR n 
2 101 GLY n 
2 102 GLU n 
2 103 TRP n 
2 104 ARG n 
2 105 VAL n 
2 106 VAL n 
2 107 LEU n 
2 108 VAL n 
2 109 ALA n 
2 110 GLU n 
2 111 ALA n 
2 112 LYS n 
2 113 HIS n 
2 114 GLN n 
2 115 GLY n 
2 116 LYS n 
2 117 ASP n 
2 118 ILE n 
2 119 ILE n 
2 120 ASN n 
2 121 ILE n 
2 122 ARG n 
2 123 ASN n 
2 124 GLY n 
2 125 LEU n 
2 126 LEU n 
2 127 VAL n 
2 128 GLY n 
2 129 LYS n 
2 130 ARG n 
2 131 GLY n 
2 132 ASP n 
2 133 GLN n 
2 134 ASP n 
2 135 LEU n 
2 136 MET n 
2 137 ALA n 
2 138 ALA n 
2 139 GLY n 
2 140 ASN n 
2 141 ALA n 
2 142 ILE n 
2 143 GLU n 
2 144 ARG n 
2 145 SER n 
2 146 HIS n 
2 147 LYS n 
2 148 ASN n 
2 149 ILE n 
2 150 SER n 
2 151 GLU n 
2 152 ILE n 
2 153 ALA n 
2 154 ASN n 
2 155 PHE n 
2 156 MET n 
2 157 LEU n 
2 158 SER n 
2 159 GLU n 
2 160 SER n 
2 161 HIS n 
2 162 PHE n 
2 163 PRO n 
2 164 TYR n 
2 165 VAL n 
2 166 LEU n 
2 167 PHE n 
2 168 LEU n 
2 169 GLU n 
2 170 GLY n 
2 171 SER n 
2 172 ASN n 
2 173 PHE n 
2 174 LEU n 
2 175 THR n 
2 176 GLU n 
2 177 ASN n 
2 178 ILE n 
2 179 SER n 
2 180 ILE n 
2 181 THR n 
2 182 ARG n 
2 183 PRO n 
2 184 ASP n 
2 185 GLY n 
2 186 ARG n 
2 187 VAL n 
2 188 VAL n 
2 189 ASN n 
2 190 LEU n 
2 191 GLU n 
2 192 TYR n 
2 193 ASN n 
2 194 SER n 
2 195 GLY n 
2 196 ILE n 
2 197 LEU n 
2 198 ASN n 
2 199 ARG n 
2 200 LEU n 
2 201 ASP n 
2 202 ARG n 
2 203 LEU n 
2 204 THR n 
2 205 ALA n 
2 206 ALA n 
2 207 ASN n 
2 208 TYR n 
2 209 GLY n 
2 210 MET n 
2 211 PRO n 
2 212 ILE n 
2 213 ASN n 
2 214 SER n 
2 215 ASN n 
2 216 LEU n 
2 217 CYS n 
2 218 ILE n 
2 219 ASN n 
2 220 LYS n 
2 221 PHE n 
2 222 VAL n 
2 223 ASN n 
2 224 HIS n 
2 225 LYS n 
2 226 ASP n 
2 227 LYS n 
2 228 SER n 
2 229 ILE n 
2 230 MET n 
2 231 LEU n 
2 232 GLN n 
2 233 ALA n 
2 234 ALA n 
2 235 SER n 
2 236 ILE n 
2 237 TYR n 
2 238 THR n 
2 239 GLN n 
2 240 GLY n 
2 241 ASP n 
2 242 GLY n 
2 243 ARG n 
2 244 GLU n 
2 245 TRP n 
2 246 ASP n 
2 247 SER n 
2 248 LYS n 
2 249 ILE n 
2 250 MET n 
2 251 PHE n 
2 252 GLU n 
2 253 ILE n 
2 254 MET n 
2 255 PHE n 
2 256 ASP n 
2 257 ILE n 
2 258 SER n 
2 259 THR n 
2 260 THR n 
2 261 SER n 
2 262 LEU n 
2 263 ARG n 
2 264 VAL n 
2 265 LEU n 
2 266 GLY n 
2 267 ARG n 
2 268 ASP n 
2 269 LEU n 
2 270 PHE n 
2 271 GLU n 
2 272 GLN n 
2 273 LEU n 
2 274 THR n 
2 275 SER n 
2 276 LYS n 
# 
_entity_src_nat.entity_id                  2 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Escherichia coli' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      562 
_entity_src_nat.genus                      Escherichia 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP T2E1_ECOLI 2 ? ? P00642 ? 
2 PDB 1CKQ       1 ? ? 1CKQ   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1CKQ A 1 ? 276 ? P00642 1 ? 276 ? 2 277 
2 2 1CKQ B 1 ? 13  ? 1CKQ   1 ? 13  ? 1 13  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1CKQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.84 
_exptl_crystal.density_percent_sol   58 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'pH 7.5, VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   1998-04-15 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.100 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             1.100 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1CKQ 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             8 
_reflns.d_resolution_high            1.85 
_reflns.number_obs                   32270 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.1 
_reflns.pdbx_Rmerge_I_obs            0.1240000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              10.6 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.85 
_reflns_shell.d_res_low              1.91 
_reflns_shell.percent_possible_all   91.1 
_reflns_shell.Rmerge_I_obs           0.4460000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2 
_reflns_shell.pdbx_redundancy        4.1 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1CKQ 
_refine.ls_number_reflns_obs                     27076 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2 
_refine.pdbx_data_cutoff_high_absF               10000000 
_refine.pdbx_data_cutoff_low_absF                0.001 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8 
_refine.ls_d_res_high                            1.85 
_refine.ls_percent_reflns_obs                    99 
_refine.ls_R_factor_obs                          0.2350000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2350000 
_refine.ls_R_factor_R_free                       0.2860000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10 
_refine.ls_number_reflns_R_free                  3025 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               38.3 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               RFREE 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1ERI' 
_refine.pdbx_method_to_determine_struct          OTHER 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1CKQ 
_refine_analyze.Luzzati_coordinate_error_obs    .30 
_refine_analyze.Luzzati_sigma_a_obs             .28 
_refine_analyze.Luzzati_d_res_low_obs           8 
_refine_analyze.Luzzati_coordinate_error_free   .34 
_refine_analyze.Luzzati_sigma_a_free            .31 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2051 
_refine_hist.pdbx_number_atoms_nucleic_acid   263 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             151 
_refine_hist.number_atoms_total               2465 
_refine_hist.d_res_high                       1.85 
_refine_hist.d_res_low                        8 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.003 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.026 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      0.889 ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       1.85 
_refine_ls_shell.d_res_low                        1.93 
_refine_ls_shell.number_reflns_R_work             801 
_refine_ls_shell.R_factor_R_work                  0.3798000 
_refine_ls_shell.percent_reflns_obs               91 
_refine_ls_shell.R_factor_R_free                  0.3858000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            12.0 
_refine_ls_shell.number_reflns_R_free             109 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO  TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARAM11.WAT   TOPH19.PEP   'X-RAY DIFFRACTION' 
3 DNA-RNA.PARAM TOPH11.WAT   'X-RAY DIFFRACTION' 
4 ?             DNA-RNA.TOP  'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1CKQ 
_struct.title                     'PRE-TRANSITION STATE ECO RI ENDONUCLEASE/COGNATE DNA (TCGCGAATTCGCG) COMPLEX' 
_struct.pdbx_descriptor           'ENDONUCLEASE/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1CKQ 
_struct_keywords.pdbx_keywords   PROTEIN/DNA 
_struct_keywords.text            'SEQUENCE-SPECIFIC DNA-PROTEIN COMPLEX, PROTEIN-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;ECO RI IS A DIMER. THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT
CONSISTS OF A MONOMER AND THE COORDINATES OF THIS MONOMER
ARE PRESENTED IN THIS ENTRY. TO GENERATE THE DIMER AND THE
OTHER HALF OF THE DNA DUPLEX ONE MUST APPLY THE FOLLOWING
CRYSTALLOGRAPHIC TWO-FOLD TRANSFORMATION TO THE COORDINATES
IN THIS ENTRY - -.5 .866025 0.0 .866025 .5 0.0 0.0 0.0 -1.0
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY B 18  ? HIS B 30  ? GLY A 19  HIS A 31  5 ? 13 
HELX_P HELX_P2  2  VAL B 34  ? GLU B 48  ? VAL A 35  GLU A 49  1 ? 15 
HELX_P HELX_P3  3  LYS B 62  ? ILE B 72  ? LYS A 63  ILE A 73  1 ? 11 
HELX_P HELX_P4  4  ASP B 117 ? ARG B 122 ? ASP A 118 ARG A 123 1 ? 6  
HELX_P HELX_P5  5  ALA B 141 ? PHE B 155 ? ALA A 142 PHE A 156 5 ? 15 
HELX_P HELX_P6  6  LEU B 200 ? ARG B 202 ? LEU A 201 ARG A 203 5 ? 3  
HELX_P HELX_P7  7  THR B 204 ? ASN B 207 ? THR A 205 ASN A 208 5 ? 4  
HELX_P HELX_P8  8  SER B 247 ? VAL B 264 ? SER A 248 VAL A 265 1 ? 18 
HELX_P HELX_P9  9  GLY B 266 ? ASP B 268 ? GLY A 267 ASP A 269 5 ? 3  
HELX_P HELX_P10 10 PHE B 270 ? THR B 274 ? PHE A 271 THR A 275 1 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DC 2  N3 ? ? ? 1_555 A DG 13 N1 ? ? B DC 2  B DG 13 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DC 2  N4 ? ? ? 1_555 A DG 13 O6 ? ? B DC 2  B DG 13 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DC 2  O2 ? ? ? 1_555 A DG 13 N2 ? ? B DC 2  B DG 13 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DG 3  N1 ? ? ? 1_555 A DC 12 N3 ? ? B DG 3  B DC 12 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DG 3  N2 ? ? ? 1_555 A DC 12 O2 ? ? B DG 3  B DC 12 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DG 3  O6 ? ? ? 1_555 A DC 12 N4 ? ? B DG 3  B DC 12 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DC 4  N3 ? ? ? 1_555 A DG 11 N1 ? ? B DC 4  B DG 11 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DC 4  N4 ? ? ? 1_555 A DG 11 O6 ? ? B DC 4  B DG 11 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DC 4  O2 ? ? ? 1_555 A DG 11 N2 ? ? B DC 4  B DG 11 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DG 5  N1 ? ? ? 1_555 A DC 10 N3 ? ? B DG 5  B DC 10 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DG 5  N2 ? ? ? 1_555 A DC 10 O2 ? ? B DG 5  B DC 10 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DG 5  O6 ? ? ? 1_555 A DC 10 N4 ? ? B DG 5  B DC 10 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DA 6  N1 ? ? ? 1_555 A DT 9  N3 ? ? B DA 6  B DT 9  4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DA 6  N6 ? ? ? 1_555 A DT 9  O4 ? ? B DA 6  B DT 9  4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DA 7  N1 ? ? ? 1_555 A DT 8  N3 ? ? B DA 7  B DT 8  4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DA 7  N6 ? ? ? 1_555 A DT 8  O4 ? ? B DA 7  B DT 8  4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DT 8  N3 ? ? ? 1_555 A DA 7  N1 ? ? B DT 8  B DA 7  4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DT 8  O4 ? ? ? 1_555 A DA 7  N6 ? ? B DT 8  B DA 7  4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DT 9  N3 ? ? ? 1_555 A DA 6  N1 ? ? B DT 9  B DA 6  4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DT 9  O4 ? ? ? 1_555 A DA 6  N6 ? ? B DT 9  B DA 6  4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DC 10 N3 ? ? ? 1_555 A DG 5  N1 ? ? B DC 10 B DG 5  4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DC 10 N4 ? ? ? 1_555 A DG 5  O6 ? ? B DC 10 B DG 5  4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DC 10 O2 ? ? ? 1_555 A DG 5  N2 ? ? B DC 10 B DG 5  4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DG 11 N1 ? ? ? 1_555 A DC 4  N3 ? ? B DG 11 B DC 4  4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? A DG 11 N2 ? ? ? 1_555 A DC 4  O2 ? ? B DG 11 B DC 4  4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? A DG 11 O6 ? ? ? 1_555 A DC 4  N4 ? ? B DG 11 B DC 4  4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? A DC 12 N3 ? ? ? 1_555 A DG 3  N1 ? ? B DC 12 B DG 3  4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? A DC 12 N4 ? ? ? 1_555 A DG 3  O6 ? ? B DC 12 B DG 3  4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? A DC 12 O2 ? ? ? 1_555 A DG 3  N2 ? ? B DC 12 B DG 3  4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? A DG 13 N1 ? ? ? 1_555 A DC 2  N3 ? ? B DG 13 B DC 2  4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? A DG 13 N2 ? ? ? 1_555 A DC 2  O2 ? ? B DG 13 B DC 2  4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? A DG 13 O6 ? ? ? 1_555 A DC 2  N4 ? ? B DG 13 B DC 2  4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE B 54  ? ARG B 57  ? PHE A 55  ARG A 58  
A 2 ILE B 93  ? LYS B 97  ? ILE A 94  LYS A 98  
A 3 TRP B 103 ? HIS B 113 ? TRP A 104 HIS A 114 
A 4 TYR B 164 ? GLU B 169 ? TYR A 165 GLU A 170 
A 5 SER B 235 ? THR B 238 ? SER A 236 THR A 239 
B 1 ILE B 178 ? THR B 181 ? ILE A 179 THR A 182 
B 2 VAL B 187 ? LEU B 190 ? VAL A 188 LEU A 191 
C 1 LYS B 220 ? VAL B 222 ? LYS A 221 VAL A 223 
C 2 ILE B 229 ? LEU B 231 ? ILE A 230 LEU A 232 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG B 55  ? O ARG A 56  N GLU B 95  ? N GLU A 96  
A 2 3 O VAL B 94  ? O VAL A 95  N LEU B 107 ? N LEU A 108 
A 3 4 O VAL B 108 ? O VAL A 109 N VAL B 165 ? N VAL A 166 
A 4 5 O LEU B 166 ? O LEU A 167 N SER B 235 ? N SER A 236 
B 1 2 O ILE B 178 ? O ILE A 179 N LEU B 190 ? N LEU A 191 
C 1 2 O LYS B 220 ? O LYS A 221 N LEU B 231 ? N LEU A 232 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
HYD Author ? ? ? ? 9 'PROTEIN RECOGNTION RESIDUES GROUPS THAT HYDROGEN BOND TO THE DNA BASES AND/OR PROVIDE PRIMARY BUTTRESSING.' 
DNA Author ? ? ? ? 6 'DNA RECOGNITION SEQUENCE THIS IS THE DNA TARGET RECOGNIZED BY THE PROTEIN'                                  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  HYD 9 ALA B 137 ? ALA A 138 . ? 1_555 ? 
2  HYD 9 ASN B 140 ? ASN A 141 . ? 1_555 ? 
3  HYD 9 ALA B 141 ? ALA A 142 . ? 1_555 ? 
4  HYD 9 GLU B 143 ? GLU A 144 . ? 1_555 ? 
5  HYD 9 ARG B 144 ? ARG A 145 . ? 1_555 ? 
6  HYD 9 ARG B 199 ? ARG A 200 . ? 1_555 ? 
7  HYD 9 ARG B 202 ? ARG A 203 . ? 1_555 ? 
8  HYD 9 HOH D .   ? HOH A 278 . ? 1_555 ? 
9  HYD 9 HOH C .   ? HOH B 14  . ? 1_555 ? 
10 DNA 6 DG  A 5   ? DG  B 5   . ? 1_555 ? 
11 DNA 6 DA  A 6   ? DA  B 6   . ? 1_555 ? 
12 DNA 6 DA  A 7   ? DA  B 7   . ? 1_555 ? 
13 DNA 6 DT  A 8   ? DT  B 8   . ? 1_555 ? 
14 DNA 6 DT  A 9   ? DT  B 9   . ? 1_555 ? 
15 DNA 6 DC  A 10  ? DC  B 10  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1CKQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1CKQ 
_atom_sites.fract_transf_matrix[1][1]   0.008467 
_atom_sites.fract_transf_matrix[1][2]   0.004888 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009776 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.020222 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DT  A 1 1   ? 8.668  23.844 26.023  1.00 50.54  ? 1   DT  B "O5'" 1 
ATOM   2    C "C5'" . DT  A 1 1   ? 8.638  24.735 24.908  1.00 43.13  ? 1   DT  B "C5'" 1 
ATOM   3    C "C4'" . DT  A 1 1   ? 8.776  26.171 25.354  1.00 41.05  ? 1   DT  B "C4'" 1 
ATOM   4    O "O4'" . DT  A 1 1   ? 9.895  26.262 26.265  1.00 37.44  ? 1   DT  B "O4'" 1 
ATOM   5    C "C3'" . DT  A 1 1   ? 9.074  27.154 24.223  1.00 40.11  ? 1   DT  B "C3'" 1 
ATOM   6    O "O3'" . DT  A 1 1   ? 8.479  28.425 24.497  1.00 42.66  ? 1   DT  B "O3'" 1 
ATOM   7    C "C2'" . DT  A 1 1   ? 10.585 27.265 24.254  1.00 37.34  ? 1   DT  B "C2'" 1 
ATOM   8    C "C1'" . DT  A 1 1   ? 10.901 27.106 25.731  1.00 30.74  ? 1   DT  B "C1'" 1 
ATOM   9    N N1    . DT  A 1 1   ? 12.198 26.462 25.970  1.00 26.84  ? 1   DT  B N1    1 
ATOM   10   C C2    . DT  A 1 1   ? 13.315 27.257 25.975  1.00 25.40  ? 1   DT  B C2    1 
ATOM   11   O O2    . DT  A 1 1   ? 13.272 28.467 25.826  1.00 28.81  ? 1   DT  B O2    1 
ATOM   12   N N3    . DT  A 1 1   ? 14.494 26.580 26.164  1.00 24.26  ? 1   DT  B N3    1 
ATOM   13   C C4    . DT  A 1 1   ? 14.658 25.220 26.350  1.00 24.30  ? 1   DT  B C4    1 
ATOM   14   O O4    . DT  A 1 1   ? 15.786 24.752 26.489  1.00 27.27  ? 1   DT  B O4    1 
ATOM   15   C C5    . DT  A 1 1   ? 13.436 24.449 26.355  1.00 22.20  ? 1   DT  B C5    1 
ATOM   16   C C7    . DT  A 1 1   ? 13.511 22.969 26.568  1.00 21.88  ? 1   DT  B C7    1 
ATOM   17   C C6    . DT  A 1 1   ? 12.282 25.099 26.167  1.00 22.24  ? 1   DT  B C6    1 
ATOM   18   P P     . DC  A 1 2   ? 8.155  29.429 23.285  1.00 45.94  ? 2   DC  B P     1 
ATOM   19   O OP1   . DC  A 1 2   ? 7.531  30.648 23.859  1.00 47.64  ? 2   DC  B OP1   1 
ATOM   20   O OP2   . DC  A 1 2   ? 7.439  28.657 22.236  1.00 47.36  ? 2   DC  B OP2   1 
ATOM   21   O "O5'" . DC  A 1 2   ? 9.588  29.825 22.715  1.00 43.57  ? 2   DC  B "O5'" 1 
ATOM   22   C "C5'" . DC  A 1 2   ? 10.564 30.432 23.561  1.00 40.50  ? 2   DC  B "C5'" 1 
ATOM   23   C "C4'" . DC  A 1 2   ? 11.777 30.841 22.759  1.00 33.48  ? 2   DC  B "C4'" 1 
ATOM   24   O "O4'" . DC  A 1 2   ? 12.515 29.665 22.351  1.00 34.88  ? 2   DC  B "O4'" 1 
ATOM   25   C "C3'" . DC  A 1 2   ? 11.475 31.617 21.478  1.00 30.68  ? 2   DC  B "C3'" 1 
ATOM   26   O "O3'" . DC  A 1 2   ? 12.462 32.633 21.304  1.00 27.45  ? 2   DC  B "O3'" 1 
ATOM   27   C "C2'" . DC  A 1 2   ? 11.579 30.559 20.394  1.00 25.72  ? 2   DC  B "C2'" 1 
ATOM   28   C "C1'" . DC  A 1 2   ? 12.659 29.641 20.937  1.00 29.60  ? 2   DC  B "C1'" 1 
ATOM   29   N N1    . DC  A 1 2   ? 12.557 28.239 20.503  1.00 25.45  ? 2   DC  B N1    1 
ATOM   30   C C2    . DC  A 1 2   ? 13.729 27.544 20.188  1.00 21.95  ? 2   DC  B C2    1 
ATOM   31   O O2    . DC  A 1 2   ? 14.818 28.132 20.261  1.00 21.68  ? 2   DC  B O2    1 
ATOM   32   N N3    . DC  A 1 2   ? 13.647 26.252 19.811  1.00 23.65  ? 2   DC  B N3    1 
ATOM   33   C C4    . DC  A 1 2   ? 12.458 25.653 19.737  1.00 21.24  ? 2   DC  B C4    1 
ATOM   34   N N4    . DC  A 1 2   ? 12.429 24.372 19.369  1.00 24.88  ? 2   DC  B N4    1 
ATOM   35   C C5    . DC  A 1 2   ? 11.248 26.337 20.040  1.00 20.52  ? 2   DC  B C5    1 
ATOM   36   C C6    . DC  A 1 2   ? 11.342 27.617 20.416  1.00 24.65  ? 2   DC  B C6    1 
ATOM   37   P P     . DG  A 1 3   ? 12.174 33.862 20.319  1.00 29.14  ? 3   DG  B P     1 
ATOM   38   O OP1   . DG  A 1 3   ? 12.574 35.104 21.001  1.00 28.16  ? 3   DG  B OP1   1 
ATOM   39   O OP2   . DG  A 1 3   ? 10.788 33.719 19.824  1.00 32.00  ? 3   DG  B OP2   1 
ATOM   40   O "O5'" . DG  A 1 3   ? 13.210 33.613 19.141  1.00 27.94  ? 3   DG  B "O5'" 1 
ATOM   41   C "C5'" . DG  A 1 3   ? 14.599 33.599 19.428  1.00 28.28  ? 3   DG  B "C5'" 1 
ATOM   42   C "C4'" . DG  A 1 3   ? 15.379 32.941 18.315  1.00 29.61  ? 3   DG  B "C4'" 1 
ATOM   43   O "O4'" . DG  A 1 3   ? 15.186 31.504 18.293  1.00 27.51  ? 3   DG  B "O4'" 1 
ATOM   44   C "C3'" . DG  A 1 3   ? 15.115 33.434 16.890  1.00 27.93  ? 3   DG  B "C3'" 1 
ATOM   45   O "O3'" . DG  A 1 3   ? 16.392 33.643 16.276  1.00 32.30  ? 3   DG  B "O3'" 1 
ATOM   46   C "C2'" . DG  A 1 3   ? 14.406 32.253 16.248  1.00 25.29  ? 3   DG  B "C2'" 1 
ATOM   47   C "C1'" . DG  A 1 3   ? 15.094 31.098 16.944  1.00 23.61  ? 3   DG  B "C1'" 1 
ATOM   48   N N9    . DG  A 1 3   ? 14.416 29.807 16.891  1.00 19.25  ? 3   DG  B N9    1 
ATOM   49   C C8    . DG  A 1 3   ? 13.064 29.566 16.895  1.00 18.97  ? 3   DG  B C8    1 
ATOM   50   N N7    . DG  A 1 3   ? 12.771 28.296 16.808  1.00 16.55  ? 3   DG  B N7    1 
ATOM   51   C C5    . DG  A 1 3   ? 14.004 27.661 16.751  1.00 15.35  ? 3   DG  B C5    1 
ATOM   52   C C6    . DG  A 1 3   ? 14.328 26.283 16.646  1.00 18.03  ? 3   DG  B C6    1 
ATOM   53   O O6    . DG  A 1 3   ? 13.562 25.312 16.582  1.00 22.59  ? 3   DG  B O6    1 
ATOM   54   N N1    . DG  A 1 3   ? 15.703 26.080 16.617  1.00 19.33  ? 3   DG  B N1    1 
ATOM   55   C C2    . DG  A 1 3   ? 16.646 27.073 16.679  1.00 19.66  ? 3   DG  B C2    1 
ATOM   56   N N2    . DG  A 1 3   ? 17.927 26.676 16.644  1.00 18.98  ? 3   DG  B N2    1 
ATOM   57   N N3    . DG  A 1 3   ? 16.357 28.360 16.772  1.00 21.63  ? 3   DG  B N3    1 
ATOM   58   C C4    . DG  A 1 3   ? 15.028 28.579 16.805  1.00 16.15  ? 3   DG  B C4    1 
ATOM   59   P P     . DC  A 1 4   ? 16.500 34.003 14.714  1.00 31.42  ? 4   DC  B P     1 
ATOM   60   O OP1   . DC  A 1 4   ? 17.098 35.353 14.606  1.00 30.52  ? 4   DC  B OP1   1 
ATOM   61   O OP2   . DC  A 1 4   ? 15.210 33.721 14.044  1.00 33.48  ? 4   DC  B OP2   1 
ATOM   62   O "O5'" . DC  A 1 4   ? 17.571 32.942 14.202  1.00 31.67  ? 4   DC  B "O5'" 1 
ATOM   63   C "C5'" . DC  A 1 4   ? 18.731 32.658 14.982  1.00 28.62  ? 4   DC  B "C5'" 1 
ATOM   64   C "C4'" . DC  A 1 4   ? 19.594 31.629 14.292  1.00 28.15  ? 4   DC  B "C4'" 1 
ATOM   65   O "O4'" . DC  A 1 4   ? 18.983 30.324 14.437  1.00 28.20  ? 4   DC  B "O4'" 1 
ATOM   66   C "C3'" . DC  A 1 4   ? 19.787 31.849 12.792  1.00 30.57  ? 4   DC  B "C3'" 1 
ATOM   67   O "O3'" . DC  A 1 4   ? 21.142 31.566 12.421  1.00 32.33  ? 4   DC  B "O3'" 1 
ATOM   68   C "C2'" . DC  A 1 4   ? 18.812 30.870 12.160  1.00 27.10  ? 4   DC  B "C2'" 1 
ATOM   69   C "C1'" . DC  A 1 4   ? 18.749 29.734 13.169  1.00 24.81  ? 4   DC  B "C1'" 1 
ATOM   70   N N1    . DC  A 1 4   ? 17.439 29.063 13.219  1.00 22.49  ? 4   DC  B N1    1 
ATOM   71   C C2    . DC  A 1 4   ? 17.388 27.664 13.253  1.00 21.68  ? 4   DC  B C2    1 
ATOM   72   O O2    . DC  A 1 4   ? 18.450 27.023 13.264  1.00 25.22  ? 4   DC  B O2    1 
ATOM   73   N N3    . DC  A 1 4   ? 16.181 27.046 13.272  1.00 20.81  ? 4   DC  B N3    1 
ATOM   74   C C4    . DC  A 1 4   ? 15.059 27.771 13.253  1.00 17.80  ? 4   DC  B C4    1 
ATOM   75   N N4    . DC  A 1 4   ? 13.892 27.123 13.243  1.00 19.34  ? 4   DC  B N4    1 
ATOM   76   C C5    . DC  A 1 4   ? 15.084 29.194 13.234  1.00 19.88  ? 4   DC  B C5    1 
ATOM   77   C C6    . DC  A 1 4   ? 16.283 29.793 13.220  1.00 20.77  ? 4   DC  B C6    1 
ATOM   78   P P     . DG  A 1 5   ? 21.581 31.640 10.878  1.00 28.16  ? 5   DG  B P     1 
ATOM   79   O OP1   . DG  A 1 5   ? 22.985 32.112 10.809  1.00 28.16  ? 5   DG  B OP1   1 
ATOM   80   O OP2   . DG  A 1 5   ? 20.526 32.383 10.148  1.00 31.52  ? 5   DG  B OP2   1 
ATOM   81   O "O5'" . DG  A 1 5   ? 21.552 30.114 10.426  1.00 26.20  ? 5   DG  B "O5'" 1 
ATOM   82   C "C5'" . DG  A 1 5   ? 22.342 29.147 11.114  1.00 26.71  ? 5   DG  B "C5'" 1 
ATOM   83   C "C4'" . DG  A 1 5   ? 22.185 27.782 10.487  1.00 31.34  ? 5   DG  B "C4'" 1 
ATOM   84   O "O4'" . DG  A 1 5   ? 20.864 27.247 10.758  1.00 30.07  ? 5   DG  B "O4'" 1 
ATOM   85   C "C3'" . DG  A 1 5   ? 22.370 27.727 8.969   1.00 32.94  ? 5   DG  B "C3'" 1 
ATOM   86   O "O3'" . DG  A 1 5   ? 23.148 26.577 8.622   1.00 37.52  ? 5   DG  B "O3'" 1 
ATOM   87   C "C2'" . DG  A 1 5   ? 20.950 27.590 8.445   1.00 29.64  ? 5   DG  B "C2'" 1 
ATOM   88   C "C1'" . DG  A 1 5   ? 20.260 26.808 9.552   1.00 24.40  ? 5   DG  B "C1'" 1 
ATOM   89   N N9    . DG  A 1 5   ? 18.827 27.072 9.645   1.00 20.10  ? 5   DG  B N9    1 
ATOM   90   C C8    . DG  A 1 5   ? 18.225 28.301 9.747   1.00 15.48  ? 5   DG  B C8    1 
ATOM   91   N N7    . DG  A 1 5   ? 16.922 28.233 9.777   1.00 16.81  ? 5   DG  B N7    1 
ATOM   92   C C5    . DG  A 1 5   ? 16.645 26.876 9.695   1.00 15.29  ? 5   DG  B C5    1 
ATOM   93   C C6    . DG  A 1 5   ? 15.402 26.197 9.667   1.00 16.24  ? 5   DG  B C6    1 
ATOM   94   O O6    . DG  A 1 5   ? 14.261 26.676 9.696   1.00 20.54  ? 5   DG  B O6    1 
ATOM   95   N N1    . DG  A 1 5   ? 15.574 24.820 9.588   1.00 15.65  ? 5   DG  B N1    1 
ATOM   96   C C2    . DG  A 1 5   ? 16.784 24.180 9.532   1.00 14.72  ? 5   DG  B C2    1 
ATOM   97   N N2    . DG  A 1 5   ? 16.738 22.843 9.463   1.00 14.87  ? 5   DG  B N2    1 
ATOM   98   N N3    . DG  A 1 5   ? 17.952 24.803 9.544   1.00 16.22  ? 5   DG  B N3    1 
ATOM   99   C C4    . DG  A 1 5   ? 17.808 26.142 9.626   1.00 17.58  ? 5   DG  B C4    1 
ATOM   100  P P     . DA  A 1 6   ? 23.671 26.385 7.112   1.00 37.92  ? 6   DA  B P     1 
ATOM   101  O OP1   . DA  A 1 6   ? 25.146 26.238 7.144   1.00 39.62  ? 6   DA  B OP1   1 
ATOM   102  O OP2   . DA  A 1 6   ? 23.055 27.426 6.253   1.00 34.00  ? 6   DA  B OP2   1 
ATOM   103  O "O5'" . DA  A 1 6   ? 23.049 24.982 6.699   1.00 36.94  ? 6   DA  B "O5'" 1 
ATOM   104  C "C5'" . DA  A 1 6   ? 23.236 23.838 7.527   1.00 33.92  ? 6   DA  B "C5'" 1 
ATOM   105  C "C4'" . DA  A 1 6   ? 22.497 22.657 6.949   1.00 32.66  ? 6   DA  B "C4'" 1 
ATOM   106  O "O4'" . DA  A 1 6   ? 21.074 22.835 7.138   1.00 28.13  ? 6   DA  B "O4'" 1 
ATOM   107  C "C3'" . DA  A 1 6   ? 22.710 22.484 5.447   1.00 36.16  ? 6   DA  B "C3'" 1 
ATOM   108  O "O3'" . DA  A 1 6   ? 22.833 21.101 5.117   1.00 43.86  ? 6   DA  B "O3'" 1 
ATOM   109  C "C2'" . DA  A 1 6   ? 21.453 23.078 4.839   1.00 31.85  ? 6   DA  B "C2'" 1 
ATOM   110  C "C1'" . DA  A 1 6   ? 20.400 22.780 5.891   1.00 26.57  ? 6   DA  B "C1'" 1 
ATOM   111  N N9    . DA  A 1 6   ? 19.316 23.760 5.928   1.00 18.53  ? 6   DA  B N9    1 
ATOM   112  C C8    . DA  A 1 6   ? 19.428 25.124 5.892   1.00 15.92  ? 6   DA  B C8    1 
ATOM   113  N N7    . DA  A 1 6   ? 18.279 25.749 5.938   1.00 17.08  ? 6   DA  B N7    1 
ATOM   114  C C5    . DA  A 1 6   ? 17.346 24.728 6.012   1.00 14.32  ? 6   DA  B C5    1 
ATOM   115  C C6    . DA  A 1 6   ? 15.942 24.732 6.090   1.00 13.00  ? 6   DA  B C6    1 
ATOM   116  N N6    . DA  A 1 6   ? 15.201 25.843 6.117   1.00 14.24  ? 6   DA  B N6    1 
ATOM   117  N N1    . DA  A 1 6   ? 15.315 23.541 6.148   1.00 14.69  ? 6   DA  B N1    1 
ATOM   118  C C2    . DA  A 1 6   ? 16.056 22.428 6.132   1.00 15.67  ? 6   DA  B C2    1 
ATOM   119  N N3    . DA  A 1 6   ? 17.376 22.295 6.065   1.00 20.47  ? 6   DA  B N3    1 
ATOM   120  C C4    . DA  A 1 6   ? 17.971 23.497 6.005   1.00 16.89  ? 6   DA  B C4    1 
ATOM   121  P P     . DA  A 1 7   ? 23.644 20.671 3.801   1.00 48.22  ? 7   DA  B P     1 
ATOM   122  O OP1   . DA  A 1 7   ? 23.764 19.192 3.841   1.00 46.95  ? 7   DA  B OP1   1 
ATOM   123  O OP2   . DA  A 1 7   ? 24.868 21.505 3.712   1.00 44.18  ? 7   DA  B OP2   1 
ATOM   124  O "O5'" . DA  A 1 7   ? 22.671 21.075 2.604   1.00 41.77  ? 7   DA  B "O5'" 1 
ATOM   125  C "C5'" . DA  A 1 7   ? 21.677 20.160 2.149   1.00 37.86  ? 7   DA  B "C5'" 1 
ATOM   126  C "C4'" . DA  A 1 7   ? 20.893 20.742 0.995   1.00 34.60  ? 7   DA  B "C4'" 1 
ATOM   127  O "O4'" . DA  A 1 7   ? 19.897 21.681 1.461   1.00 33.10  ? 7   DA  B "O4'" 1 
ATOM   128  C "C3'" . DA  A 1 7   ? 21.700 21.466 -0.089  1.00 32.75  ? 7   DA  B "C3'" 1 
ATOM   129  O "O3'" . DA  A 1 7   ? 21.209 21.095 -1.383  1.00 31.98  ? 7   DA  B "O3'" 1 
ATOM   130  C "C2'" . DA  A 1 7   ? 21.345 22.925 0.143   1.00 31.41  ? 7   DA  B "C2'" 1 
ATOM   131  C "C1'" . DA  A 1 7   ? 19.902 22.793 0.590   1.00 29.81  ? 7   DA  B "C1'" 1 
ATOM   132  N N9    . DA  A 1 7   ? 19.313 23.930 1.296   1.00 26.07  ? 7   DA  B N9    1 
ATOM   133  C C8    . DA  A 1 7   ? 19.936 24.958 1.958   1.00 28.74  ? 7   DA  B C8    1 
ATOM   134  N N7    . DA  A 1 7   ? 19.106 25.828 2.481   1.00 25.60  ? 7   DA  B N7    1 
ATOM   135  C C5    . DA  A 1 7   ? 17.853 25.338 2.143   1.00 25.01  ? 7   DA  B C5    1 
ATOM   136  C C6    . DA  A 1 7   ? 16.554 25.804 2.400   1.00 22.74  ? 7   DA  B C6    1 
ATOM   137  N N6    . DA  A 1 7   ? 16.290 26.914 3.086   1.00 26.51  ? 7   DA  B N6    1 
ATOM   138  N N1    . DA  A 1 7   ? 15.520 25.082 1.920   1.00 23.07  ? 7   DA  B N1    1 
ATOM   139  C C2    . DA  A 1 7   ? 15.784 23.968 1.227   1.00 24.60  ? 7   DA  B C2    1 
ATOM   140  N N3    . DA  A 1 7   ? 16.961 23.428 0.918   1.00 27.38  ? 7   DA  B N3    1 
ATOM   141  C C4    . DA  A 1 7   ? 17.966 24.171 1.412   1.00 25.33  ? 7   DA  B C4    1 
ATOM   142  P P     . DT  A 1 8   ? 21.649 19.694 -2.048  1.00 29.92  ? 8   DT  B P     1 
ATOM   143  O OP1   . DT  A 1 8   ? 22.526 18.926 -1.136  1.00 28.91  ? 8   DT  B OP1   1 
ATOM   144  O OP2   . DT  A 1 8   ? 22.113 19.996 -3.419  1.00 31.50  ? 8   DT  B OP2   1 
ATOM   145  O "O5'" . DT  A 1 8   ? 20.272 18.912 -2.155  1.00 26.72  ? 8   DT  B "O5'" 1 
ATOM   146  C "C5'" . DT  A 1 8   ? 19.535 18.559 -0.985  1.00 30.49  ? 8   DT  B "C5'" 1 
ATOM   147  C "C4'" . DT  A 1 8   ? 18.060 18.506 -1.299  1.00 30.83  ? 8   DT  B "C4'" 1 
ATOM   148  O "O4'" . DT  A 1 8   ? 17.452 19.798 -1.037  1.00 29.19  ? 8   DT  B "O4'" 1 
ATOM   149  C "C3'" . DT  A 1 8   ? 17.806 18.192 -2.773  1.00 36.65  ? 8   DT  B "C3'" 1 
ATOM   150  O "O3'" . DT  A 1 8   ? 16.951 17.081 -2.997  1.00 38.39  ? 8   DT  B "O3'" 1 
ATOM   151  C "C2'" . DT  A 1 8   ? 17.175 19.449 -3.333  1.00 38.29  ? 8   DT  B "C2'" 1 
ATOM   152  C "C1'" . DT  A 1 8   ? 16.624 20.180 -2.123  1.00 31.14  ? 8   DT  B "C1'" 1 
ATOM   153  N N1    . DT  A 1 8   ? 16.764 21.634 -2.337  1.00 23.93  ? 8   DT  B N1    1 
ATOM   154  C C2    . DT  A 1 8   ? 15.708 22.479 -2.077  1.00 23.76  ? 8   DT  B C2    1 
ATOM   155  O O2    . DT  A 1 8   ? 14.675 22.121 -1.544  1.00 24.90  ? 8   DT  B O2    1 
ATOM   156  N N3    . DT  A 1 8   ? 15.912 23.777 -2.470  1.00 24.21  ? 8   DT  B N3    1 
ATOM   157  C C4    . DT  A 1 8   ? 17.045 24.304 -3.060  1.00 24.37  ? 8   DT  B C4    1 
ATOM   158  O O4    . DT  A 1 8   ? 17.065 25.482 -3.402  1.00 28.92  ? 8   DT  B O4    1 
ATOM   159  C C5    . DT  A 1 8   ? 18.134 23.374 -3.234  1.00 23.04  ? 8   DT  B C5    1 
ATOM   160  C C7    . DT  A 1 8   ? 19.423 23.856 -3.823  1.00 24.50  ? 8   DT  B C7    1 
ATOM   161  C C6    . DT  A 1 8   ? 17.943 22.109 -2.861  1.00 22.31  ? 8   DT  B C6    1 
ATOM   162  P P     . DT  A 1 9   ? 16.989 16.355 -4.431  1.00 37.41  ? 9   DT  B P     1 
ATOM   163  O OP1   . DT  A 1 9   ? 17.186 14.896 -4.232  1.00 37.13  ? 9   DT  B OP1   1 
ATOM   164  O OP2   . DT  A 1 9   ? 17.946 17.113 -5.275  1.00 33.12  ? 9   DT  B OP2   1 
ATOM   165  O "O5'" . DT  A 1 9   ? 15.528 16.607 -5.002  1.00 34.30  ? 9   DT  B "O5'" 1 
ATOM   166  C "C5'" . DT  A 1 9   ? 14.382 16.256 -4.234  1.00 35.09  ? 9   DT  B "C5'" 1 
ATOM   167  C "C4'" . DT  A 1 9   ? 13.131 16.758 -4.911  1.00 33.00  ? 9   DT  B "C4'" 1 
ATOM   168  O "O4'" . DT  A 1 9   ? 13.104 18.204 -4.855  1.00 32.24  ? 9   DT  B "O4'" 1 
ATOM   169  C "C3'" . DT  A 1 9   ? 13.050 16.388 -6.389  1.00 34.50  ? 9   DT  B "C3'" 1 
ATOM   170  O "O3'" . DT  A 1 9   ? 11.691 16.109 -6.741  1.00 39.73  ? 9   DT  B "O3'" 1 
ATOM   171  C "C2'" . DT  A 1 9   ? 13.560 17.638 -7.084  1.00 30.20  ? 9   DT  B "C2'" 1 
ATOM   172  C "C1'" . DT  A 1 9   ? 13.065 18.741 -6.165  1.00 28.78  ? 9   DT  B "C1'" 1 
ATOM   173  N N1    . DT  A 1 9   ? 13.883 19.967 -6.175  1.00 22.81  ? 9   DT  B N1    1 
ATOM   174  C C2    . DT  A 1 9   ? 13.233 21.179 -6.157  1.00 21.76  ? 9   DT  B C2    1 
ATOM   175  O O2    . DT  A 1 9   ? 12.018 21.286 -6.144  1.00 25.14  ? 9   DT  B O2    1 
ATOM   176  N N3    . DT  A 1 9   ? 14.062 22.269 -6.158  1.00 17.26  ? 9   DT  B N3    1 
ATOM   177  C C4    . DT  A 1 9   ? 15.441 22.269 -6.174  1.00 20.07  ? 9   DT  B C4    1 
ATOM   178  O O4    . DT  A 1 9   ? 16.053 23.335 -6.159  1.00 22.12  ? 9   DT  B O4    1 
ATOM   179  C C5    . DT  A 1 9   ? 16.057 20.965 -6.206  1.00 18.74  ? 9   DT  B C5    1 
ATOM   180  C C7    . DT  A 1 9   ? 17.548 20.867 -6.249  1.00 19.64  ? 9   DT  B C7    1 
ATOM   181  C C6    . DT  A 1 9   ? 15.256 19.892 -6.201  1.00 18.04  ? 9   DT  B C6    1 
ATOM   182  P P     . DC  A 1 10  ? 11.369 15.145 -7.985  1.00 41.14  ? 10  DC  B P     1 
ATOM   183  O OP1   . DC  A 1 10  ? 10.395 14.110 -7.556  1.00 44.77  ? 10  DC  B OP1   1 
ATOM   184  O OP2   . DC  A 1 10  ? 12.663 14.736 -8.585  1.00 38.65  ? 10  DC  B OP2   1 
ATOM   185  O "O5'" . DC  A 1 10  ? 10.632 16.107 -9.009  1.00 40.30  ? 10  DC  B "O5'" 1 
ATOM   186  C "C5'" . DC  A 1 10  ? 11.262 17.300 -9.445  1.00 41.80  ? 10  DC  B "C5'" 1 
ATOM   187  C "C4'" . DC  A 1 10  ? 10.255 18.420 -9.526  1.00 40.45  ? 10  DC  B "C4'" 1 
ATOM   188  O "O4'" . DC  A 1 10  ? 10.870 19.615 -8.995  1.00 36.21  ? 10  DC  B "O4'" 1 
ATOM   189  C "C3'" . DC  A 1 10  ? 9.845  18.755 -10.956 1.00 39.35  ? 10  DC  B "C3'" 1 
ATOM   190  O "O3'" . DC  A 1 10  ? 8.492  19.211 -10.993 1.00 41.17  ? 10  DC  B "O3'" 1 
ATOM   191  C "C2'" . DC  A 1 10  ? 10.809 19.858 -11.344 1.00 38.22  ? 10  DC  B "C2'" 1 
ATOM   192  C "C1'" . DC  A 1 10  ? 11.057 20.574 -10.024 1.00 35.06  ? 10  DC  B "C1'" 1 
ATOM   193  N N1    . DC  A 1 10  ? 12.421 21.109 -9.896  1.00 29.81  ? 10  DC  B N1    1 
ATOM   194  C C2    . DC  A 1 10  ? 12.583 22.475 -9.689  1.00 26.53  ? 10  DC  B C2    1 
ATOM   195  O O2    . DC  A 1 10  ? 11.573 23.186 -9.586  1.00 29.91  ? 10  DC  B O2    1 
ATOM   196  N N3    . DC  A 1 10  ? 13.829 22.988 -9.606  1.00 22.66  ? 10  DC  B N3    1 
ATOM   197  C C4    . DC  A 1 10  ? 14.888 22.188 -9.715  1.00 19.85  ? 10  DC  B C4    1 
ATOM   198  N N4    . DC  A 1 10  ? 16.093 22.744 -9.646  1.00 22.72  ? 10  DC  B N4    1 
ATOM   199  C C5    . DC  A 1 10  ? 14.755 20.783 -9.906  1.00 20.80  ? 10  DC  B C5    1 
ATOM   200  C C6    . DC  A 1 10  ? 13.513 20.289 -9.989  1.00 26.17  ? 10  DC  B C6    1 
ATOM   201  P P     . DG  A 1 11  ? 7.630  19.036 -12.337 1.00 39.47  ? 11  DG  B P     1 
ATOM   202  O OP1   . DG  A 1 11  ? 6.489  18.132 -12.054 1.00 41.44  ? 11  DG  B OP1   1 
ATOM   203  O OP2   . DG  A 1 11  ? 8.571  18.704 -13.436 1.00 44.92  ? 11  DG  B OP2   1 
ATOM   204  O "O5'" . DG  A 1 11  ? 7.056  20.499 -12.592 1.00 42.35  ? 11  DG  B "O5'" 1 
ATOM   205  C "C5'" . DG  A 1 11  ? 6.266  21.149 -11.600 1.00 40.92  ? 11  DG  B "C5'" 1 
ATOM   206  C "C4'" . DG  A 1 11  ? 6.242  22.641 -11.839 1.00 40.69  ? 11  DG  B "C4'" 1 
ATOM   207  O "O4'" . DG  A 1 11  ? 7.555  23.202 -11.601 1.00 39.93  ? 11  DG  B "O4'" 1 
ATOM   208  C "C3'" . DG  A 1 11  ? 5.850  23.064 -13.253 1.00 39.85  ? 11  DG  B "C3'" 1 
ATOM   209  O "O3'" . DG  A 1 11  ? 5.050  24.248 -13.182 1.00 44.46  ? 11  DG  B "O3'" 1 
ATOM   210  C "C2'" . DG  A 1 11  ? 7.188  23.348 -13.913 1.00 36.40  ? 11  DG  B "C2'" 1 
ATOM   211  C "C1'" . DG  A 1 11  ? 8.012  23.888 -12.757 1.00 33.58  ? 11  DG  B "C1'" 1 
ATOM   212  N N9    . DG  A 1 11  ? 9.447  23.647 -12.872 1.00 28.06  ? 11  DG  B N9    1 
ATOM   213  C C8    . DG  A 1 11  ? 10.075 22.428 -12.969 1.00 26.12  ? 11  DG  B C8    1 
ATOM   214  N N7    . DG  A 1 11  ? 11.376 22.525 -13.041 1.00 24.73  ? 11  DG  B N7    1 
ATOM   215  C C5    . DG  A 1 11  ? 11.622 23.891 -12.991 1.00 19.96  ? 11  DG  B C5    1 
ATOM   216  C C6    . DG  A 1 11  ? 12.841 24.597 -13.024 1.00 16.27  ? 11  DG  B C6    1 
ATOM   217  O O6    . DG  A 1 11  ? 13.987 24.148 -13.093 1.00 22.79  ? 11  DG  B O6    1 
ATOM   218  N N1    . DG  A 1 11  ? 12.639 25.969 -12.966 1.00 17.37  ? 11  DG  B N1    1 
ATOM   219  C C2    . DG  A 1 11  ? 11.416 26.585 -12.876 1.00 16.80  ? 11  DG  B C2    1 
ATOM   220  N N2    . DG  A 1 11  ? 11.433 27.927 -12.839 1.00 19.65  ? 11  DG  B N2    1 
ATOM   221  N N3    . DG  A 1 11  ? 10.265 25.936 -12.828 1.00 19.51  ? 11  DG  B N3    1 
ATOM   222  C C4    . DG  A 1 11  ? 10.442 24.598 -12.892 1.00 23.35  ? 11  DG  B C4    1 
ATOM   223  P P     . DC  A 1 12  ? 4.189  24.713 -14.454 1.00 48.06  ? 12  DC  B P     1 
ATOM   224  O OP1   . DC  A 1 12  ? 2.871  25.195 -13.972 1.00 46.55  ? 12  DC  B OP1   1 
ATOM   225  O OP2   . DC  A 1 12  ? 4.249  23.627 -15.465 1.00 48.38  ? 12  DC  B OP2   1 
ATOM   226  O "O5'" . DC  A 1 12  ? 5.003  25.957 -15.022 1.00 46.00  ? 12  DC  B "O5'" 1 
ATOM   227  C "C5'" . DC  A 1 12  ? 5.946  26.652 -14.204 1.00 44.46  ? 12  DC  B "C5'" 1 
ATOM   228  C "C4'" . DC  A 1 12  ? 6.625  27.744 -14.997 1.00 41.69  ? 12  DC  B "C4'" 1 
ATOM   229  O "O4'" . DC  A 1 12  ? 8.050  27.491 -15.032 1.00 37.79  ? 12  DC  B "O4'" 1 
ATOM   230  C "C3'" . DC  A 1 12  ? 6.180  27.846 -16.456 1.00 43.21  ? 12  DC  B "C3'" 1 
ATOM   231  O "O3'" . DC  A 1 12  ? 6.123  29.213 -16.865 1.00 46.89  ? 12  DC  B "O3'" 1 
ATOM   232  C "C2'" . DC  A 1 12  ? 7.275  27.116 -17.210 1.00 39.50  ? 12  DC  B "C2'" 1 
ATOM   233  C "C1'" . DC  A 1 12  ? 8.505  27.412 -16.375 1.00 34.90  ? 12  DC  B "C1'" 1 
ATOM   234  N N1    . DC  A 1 12  ? 9.537  26.365 -16.440 1.00 28.44  ? 12  DC  B N1    1 
ATOM   235  C C2    . DC  A 1 12  ? 10.885 26.741 -16.442 1.00 23.82  ? 12  DC  B C2    1 
ATOM   236  O O2    . DC  A 1 12  ? 11.175 27.949 -16.407 1.00 27.68  ? 12  DC  B O2    1 
ATOM   237  N N3    . DC  A 1 12  ? 11.837 25.782 -16.483 1.00 20.71  ? 12  DC  B N3    1 
ATOM   238  C C4    . DC  A 1 12  ? 11.485 24.495 -16.523 1.00 21.10  ? 12  DC  B C4    1 
ATOM   239  N N4    . DC  A 1 12  ? 12.453 23.582 -16.546 1.00 24.80  ? 12  DC  B N4    1 
ATOM   240  C C5    . DC  A 1 12  ? 10.122 24.087 -16.537 1.00 23.88  ? 12  DC  B C5    1 
ATOM   241  C C6    . DC  A 1 12  ? 9.189  25.045 -16.493 1.00 27.03  ? 12  DC  B C6    1 
ATOM   242  P P     . DG  A 1 13  ? 5.296  29.614 -18.182 1.00 51.84  ? 13  DG  B P     1 
ATOM   243  O OP1   . DG  A 1 13  ? 4.054  30.309 -17.762 1.00 49.14  ? 13  DG  B OP1   1 
ATOM   244  O OP2   . DG  A 1 13  ? 5.207  28.413 -19.052 1.00 51.20  ? 13  DG  B OP2   1 
ATOM   245  O "O5'" . DG  A 1 13  ? 6.242  30.675 -18.895 1.00 50.74  ? 13  DG  B "O5'" 1 
ATOM   246  C "C5'" . DG  A 1 13  ? 6.519  30.590 -20.289 1.00 48.67  ? 13  DG  B "C5'" 1 
ATOM   247  C "C4'" . DG  A 1 13  ? 7.932  31.046 -20.561 1.00 45.39  ? 13  DG  B "C4'" 1 
ATOM   248  O "O4'" . DG  A 1 13  ? 8.852  30.135 -19.907 1.00 38.67  ? 13  DG  B "O4'" 1 
ATOM   249  C "C3'" . DG  A 1 13  ? 8.317  31.041 -22.042 1.00 46.77  ? 13  DG  B "C3'" 1 
ATOM   250  O "O3'" . DG  A 1 13  ? 9.306  32.044 -22.302 1.00 52.67  ? 13  DG  B "O3'" 1 
ATOM   251  C "C2'" . DG  A 1 13  ? 9.014  29.705 -22.202 1.00 44.96  ? 13  DG  B "C2'" 1 
ATOM   252  C "C1'" . DG  A 1 13  ? 9.734  29.584 -20.872 1.00 38.41  ? 13  DG  B "C1'" 1 
ATOM   253  N N9    . DG  A 1 13  ? 10.057 28.211 -20.490 1.00 29.63  ? 13  DG  B N9    1 
ATOM   254  C C8    . DG  A 1 13  ? 9.191  27.152 -20.353 1.00 26.73  ? 13  DG  B C8    1 
ATOM   255  N N7    . DG  A 1 13  ? 9.798  26.029 -20.069 1.00 25.39  ? 13  DG  B N7    1 
ATOM   256  C C5    . DG  A 1 13  ? 11.142 26.373 -20.002 1.00 23.59  ? 13  DG  B C5    1 
ATOM   257  C C6    . DG  A 1 13  ? 12.290 25.574 -19.741 1.00 22.09  ? 13  DG  B C6    1 
ATOM   258  O O6    . DG  A 1 13  ? 12.352 24.359 -19.518 1.00 24.33  ? 13  DG  B O6    1 
ATOM   259  N N1    . DG  A 1 13  ? 13.455 26.332 -19.760 1.00 22.66  ? 13  DG  B N1    1 
ATOM   260  C C2    . DG  A 1 13  ? 13.515 27.681 -20.004 1.00 22.06  ? 13  DG  B C2    1 
ATOM   261  N N2    . DG  A 1 13  ? 14.734 28.235 -19.980 1.00 23.09  ? 13  DG  B N2    1 
ATOM   262  N N3    . DG  A 1 13  ? 12.459 28.433 -20.253 1.00 22.95  ? 13  DG  B N3    1 
ATOM   263  C C4    . DG  A 1 13  ? 11.314 27.720 -20.239 1.00 24.60  ? 13  DG  B C4    1 
ATOM   264  N N     . SER B 2 16  ? 53.923 24.489 5.814   1.00 98.32  ? 17  SER A N     1 
ATOM   265  C CA    . SER B 2 16  ? 53.991 25.978 5.804   1.00 98.72  ? 17  SER A CA    1 
ATOM   266  C C     . SER B 2 16  ? 55.136 26.520 6.665   1.00 97.66  ? 17  SER A C     1 
ATOM   267  O O     . SER B 2 16  ? 56.003 25.766 7.110   1.00 97.87  ? 17  SER A O     1 
ATOM   268  C CB    . SER B 2 16  ? 52.656 26.569 6.269   1.00 99.86  ? 17  SER A CB    1 
ATOM   269  O OG    . SER B 2 16  ? 51.607 26.226 5.382   1.00 100.00 ? 17  SER A OG    1 
ATOM   270  N N     . GLN B 2 17  ? 55.119 27.831 6.897   1.00 95.92  ? 18  GLN A N     1 
ATOM   271  C CA    . GLN B 2 17  ? 56.143 28.514 7.683   1.00 93.39  ? 18  GLN A CA    1 
ATOM   272  C C     . GLN B 2 17  ? 56.153 28.126 9.162   1.00 90.84  ? 18  GLN A C     1 
ATOM   273  O O     . GLN B 2 17  ? 55.245 28.479 9.916   1.00 90.80  ? 18  GLN A O     1 
ATOM   274  C CB    . GLN B 2 17  ? 55.982 30.034 7.528   1.00 94.72  ? 18  GLN A CB    1 
ATOM   275  C CG    . GLN B 2 17  ? 57.070 30.890 8.187   1.00 97.85  ? 18  GLN A CG    1 
ATOM   276  C CD    . GLN B 2 17  ? 56.814 31.169 9.663   1.00 99.02  ? 18  GLN A CD    1 
ATOM   277  O OE1   . GLN B 2 17  ? 57.667 30.909 10.513  1.00 99.90  ? 18  GLN A OE1   1 
ATOM   278  N NE2   . GLN B 2 17  ? 55.639 31.708 9.970   1.00 99.77  ? 18  GLN A NE2   1 
ATOM   279  N N     . GLY B 2 18  ? 57.194 27.398 9.561   1.00 88.00  ? 19  GLY A N     1 
ATOM   280  C CA    . GLY B 2 18  ? 57.352 26.978 10.944  1.00 82.94  ? 19  GLY A CA    1 
ATOM   281  C C     . GLY B 2 18  ? 56.194 26.223 11.565  1.00 78.91  ? 19  GLY A C     1 
ATOM   282  O O     . GLY B 2 18  ? 55.837 25.131 11.117  1.00 78.68  ? 19  GLY A O     1 
ATOM   283  N N     . VAL B 2 19  ? 55.618 26.812 12.611  1.00 74.22  ? 20  VAL A N     1 
ATOM   284  C CA    . VAL B 2 19  ? 54.497 26.213 13.332  1.00 69.79  ? 20  VAL A CA    1 
ATOM   285  C C     . VAL B 2 19  ? 53.214 26.114 12.513  1.00 65.85  ? 20  VAL A C     1 
ATOM   286  O O     . VAL B 2 19  ? 52.343 25.305 12.823  1.00 65.70  ? 20  VAL A O     1 
ATOM   287  C CB    . VAL B 2 19  ? 54.186 26.977 14.640  1.00 70.43  ? 20  VAL A CB    1 
ATOM   288  C CG1   . VAL B 2 19  ? 55.377 26.926 15.580  1.00 71.24  ? 20  VAL A CG1   1 
ATOM   289  C CG2   . VAL B 2 19  ? 53.799 28.416 14.335  1.00 72.12  ? 20  VAL A CG2   1 
ATOM   290  N N     . ILE B 2 20  ? 53.095 26.941 11.478  1.00 61.43  ? 21  ILE A N     1 
ATOM   291  C CA    . ILE B 2 20  ? 51.912 26.930 10.623  1.00 57.68  ? 21  ILE A CA    1 
ATOM   292  C C     . ILE B 2 20  ? 51.786 25.585 9.904   1.00 54.16  ? 21  ILE A C     1 
ATOM   293  O O     . ILE B 2 20  ? 50.680 25.135 9.599   1.00 53.65  ? 21  ILE A O     1 
ATOM   294  C CB    . ILE B 2 20  ? 51.949 28.082 9.594   1.00 59.16  ? 21  ILE A CB    1 
ATOM   295  C CG1   . ILE B 2 20  ? 52.158 29.419 10.311  1.00 60.48  ? 21  ILE A CG1   1 
ATOM   296  C CG2   . ILE B 2 20  ? 50.642 28.135 8.809   1.00 58.96  ? 21  ILE A CG2   1 
ATOM   297  C CD1   . ILE B 2 20  ? 52.337 30.598 9.377   1.00 62.32  ? 21  ILE A CD1   1 
ATOM   298  N N     . GLY B 2 21  ? 52.925 24.940 9.661   1.00 50.33  ? 22  GLY A N     1 
ATOM   299  C CA    . GLY B 2 21  ? 52.926 23.644 9.004   1.00 45.59  ? 22  GLY A CA    1 
ATOM   300  C C     . GLY B 2 21  ? 52.513 22.544 9.966   1.00 43.24  ? 22  GLY A C     1 
ATOM   301  O O     . GLY B 2 21  ? 51.880 21.562 9.569   1.00 40.79  ? 22  GLY A O     1 
ATOM   302  N N     . ILE B 2 22  ? 52.875 22.720 11.236  1.00 38.86  ? 23  ILE A N     1 
ATOM   303  C CA    . ILE B 2 22  ? 52.548 21.766 12.290  1.00 38.16  ? 23  ILE A CA    1 
ATOM   304  C C     . ILE B 2 22  ? 51.048 21.803 12.603  1.00 38.40  ? 23  ILE A C     1 
ATOM   305  O O     . ILE B 2 22  ? 50.412 20.758 12.764  1.00 38.40  ? 23  ILE A O     1 
ATOM   306  C CB    . ILE B 2 22  ? 53.377 22.060 13.568  1.00 36.57  ? 23  ILE A CB    1 
ATOM   307  C CG1   . ILE B 2 22  ? 54.858 21.767 13.302  1.00 35.82  ? 23  ILE A CG1   1 
ATOM   308  C CG2   . ILE B 2 22  ? 52.855 21.254 14.753  1.00 36.18  ? 23  ILE A CG2   1 
ATOM   309  C CD1   . ILE B 2 22  ? 55.775 22.039 14.483  1.00 35.30  ? 23  ILE A CD1   1 
ATOM   310  N N     . PHE B 2 23  ? 50.486 23.007 12.672  1.00 36.04  ? 24  PHE A N     1 
ATOM   311  C CA    . PHE B 2 23  ? 49.064 23.175 12.947  1.00 34.55  ? 24  PHE A CA    1 
ATOM   312  C C     . PHE B 2 23  ? 48.239 22.653 11.779  1.00 33.25  ? 24  PHE A C     1 
ATOM   313  O O     . PHE B 2 23  ? 47.143 22.129 11.969  1.00 31.77  ? 24  PHE A O     1 
ATOM   314  C CB    . PHE B 2 23  ? 48.736 24.649 13.188  1.00 37.08  ? 24  PHE A CB    1 
ATOM   315  C CG    . PHE B 2 23  ? 49.039 25.124 14.581  1.00 39.27  ? 24  PHE A CG    1 
ATOM   316  C CD1   . PHE B 2 23  ? 48.122 24.933 15.608  1.00 40.34  ? 24  PHE A CD1   1 
ATOM   317  C CD2   . PHE B 2 23  ? 50.231 25.777 14.863  1.00 40.82  ? 24  PHE A CD2   1 
ATOM   318  C CE1   . PHE B 2 23  ? 48.387 25.387 16.895  1.00 41.93  ? 24  PHE A CE1   1 
ATOM   319  C CE2   . PHE B 2 23  ? 50.506 26.236 16.148  1.00 43.25  ? 24  PHE A CE2   1 
ATOM   320  C CZ    . PHE B 2 23  ? 49.581 26.040 17.166  1.00 41.73  ? 24  PHE A CZ    1 
ATOM   321  N N     . GLY B 2 24  ? 48.782 22.803 10.572  1.00 33.12  ? 25  GLY A N     1 
ATOM   322  C CA    . GLY B 2 24  ? 48.103 22.345 9.374   1.00 34.13  ? 25  GLY A CA    1 
ATOM   323  C C     . GLY B 2 24  ? 48.021 20.832 9.285   1.00 34.96  ? 25  GLY A C     1 
ATOM   324  O O     . GLY B 2 24  ? 47.022 20.291 8.804   1.00 34.32  ? 25  GLY A O     1 
ATOM   325  N N     . ASP B 2 25  ? 49.067 20.147 9.744   1.00 34.68  ? 26  ASP A N     1 
ATOM   326  C CA    . ASP B 2 25  ? 49.102 18.685 9.724   1.00 35.21  ? 26  ASP A CA    1 
ATOM   327  C C     . ASP B 2 25  ? 48.098 18.112 10.728  1.00 34.42  ? 26  ASP A C     1 
ATOM   328  O O     . ASP B 2 25  ? 47.548 17.033 10.511  1.00 34.54  ? 26  ASP A O     1 
ATOM   329  C CB    . ASP B 2 25  ? 50.515 18.172 10.034  1.00 37.71  ? 26  ASP A CB    1 
ATOM   330  C CG    . ASP B 2 25  ? 50.681 16.680 9.749   1.00 40.53  ? 26  ASP A CG    1 
ATOM   331  O OD1   . ASP B 2 25  ? 50.501 16.269 8.582   1.00 39.72  ? 26  ASP A OD1   1 
ATOM   332  O OD2   . ASP B 2 25  ? 51.008 15.921 10.687  1.00 37.86  ? 26  ASP A OD2   1 
ATOM   333  N N     . TYR B 2 26  ? 47.875 18.834 11.827  1.00 33.42  ? 27  TYR A N     1 
ATOM   334  C CA    . TYR B 2 26  ? 46.924 18.418 12.858  1.00 31.91  ? 27  TYR A CA    1 
ATOM   335  C C     . TYR B 2 26  ? 45.500 18.556 12.333  1.00 30.96  ? 27  TYR A C     1 
ATOM   336  O O     . TYR B 2 26  ? 44.621 17.772 12.681  1.00 31.69  ? 27  TYR A O     1 
ATOM   337  C CB    . TYR B 2 26  ? 47.091 19.270 14.117  1.00 33.85  ? 27  TYR A CB    1 
ATOM   338  C CG    . TYR B 2 26  ? 46.145 18.903 15.239  1.00 36.27  ? 27  TYR A CG    1 
ATOM   339  C CD1   . TYR B 2 26  ? 46.398 17.805 16.059  1.00 38.94  ? 27  TYR A CD1   1 
ATOM   340  C CD2   . TYR B 2 26  ? 44.993 19.651 15.479  1.00 38.36  ? 27  TYR A CD2   1 
ATOM   341  C CE1   . TYR B 2 26  ? 45.528 17.459 17.092  1.00 38.06  ? 27  TYR A CE1   1 
ATOM   342  C CE2   . TYR B 2 26  ? 44.115 19.311 16.508  1.00 38.13  ? 27  TYR A CE2   1 
ATOM   343  C CZ    . TYR B 2 26  ? 44.390 18.215 17.309  1.00 38.44  ? 27  TYR A CZ    1 
ATOM   344  O OH    . TYR B 2 26  ? 43.533 17.876 18.328  1.00 42.57  ? 27  TYR A OH    1 
ATOM   345  N N     . ALA B 2 27  ? 45.273 19.574 11.510  1.00 31.20  ? 28  ALA A N     1 
ATOM   346  C CA    . ALA B 2 27  ? 43.961 19.807 10.922  1.00 32.48  ? 28  ALA A CA    1 
ATOM   347  C C     . ALA B 2 27  ? 43.656 18.701 9.913   1.00 34.26  ? 28  ALA A C     1 
ATOM   348  O O     . ALA B 2 27  ? 42.544 18.176 9.870   1.00 33.53  ? 28  ALA A O     1 
ATOM   349  C CB    . ALA B 2 27  ? 43.924 21.167 10.243  1.00 30.75  ? 28  ALA A CB    1 
ATOM   350  N N     . LYS B 2 28  ? 44.662 18.334 9.124   1.00 37.23  ? 29  LYS A N     1 
ATOM   351  C CA    . LYS B 2 28  ? 44.521 17.288 8.112   1.00 42.53  ? 29  LYS A CA    1 
ATOM   352  C C     . LYS B 2 28  ? 44.354 15.891 8.721   1.00 42.92  ? 29  LYS A C     1 
ATOM   353  O O     . LYS B 2 28  ? 43.589 15.073 8.212   1.00 43.22  ? 29  LYS A O     1 
ATOM   354  C CB    . LYS B 2 28  ? 45.724 17.314 7.164   1.00 44.51  ? 29  LYS A CB    1 
ATOM   355  C CG    . LYS B 2 28  ? 45.675 16.289 6.038   1.00 49.75  ? 29  LYS A CG    1 
ATOM   356  C CD    . LYS B 2 28  ? 46.806 16.515 5.048   1.00 55.36  ? 29  LYS A CD    1 
ATOM   357  C CE    . LYS B 2 28  ? 48.164 16.481 5.741   1.00 62.32  ? 29  LYS A CE    1 
ATOM   358  N NZ    . LYS B 2 28  ? 49.283 16.837 4.820   1.00 67.54  ? 29  LYS A NZ    1 
ATOM   359  N N     . ALA B 2 29  ? 45.061 15.635 9.818   1.00 42.76  ? 30  ALA A N     1 
ATOM   360  C CA    . ALA B 2 29  ? 45.003 14.345 10.503  1.00 42.77  ? 30  ALA A CA    1 
ATOM   361  C C     . ALA B 2 29  ? 43.621 14.029 11.068  1.00 45.45  ? 30  ALA A C     1 
ATOM   362  O O     . ALA B 2 29  ? 43.240 12.863 11.169  1.00 46.24  ? 30  ALA A O     1 
ATOM   363  C CB    . ALA B 2 29  ? 46.034 14.299 11.616  1.00 40.23  ? 30  ALA A CB    1 
ATOM   364  N N     . HIS B 2 30  ? 42.873 15.067 11.429  1.00 46.65  ? 31  HIS A N     1 
ATOM   365  C CA    . HIS B 2 30  ? 41.542 14.884 11.997  1.00 49.16  ? 31  HIS A CA    1 
ATOM   366  C C     . HIS B 2 30  ? 40.407 15.331 11.080  1.00 50.21  ? 31  HIS A C     1 
ATOM   367  O O     . HIS B 2 30  ? 39.235 15.125 11.401  1.00 50.08  ? 31  HIS A O     1 
ATOM   368  C CB    . HIS B 2 30  ? 41.442 15.617 13.335  1.00 48.91  ? 31  HIS A CB    1 
ATOM   369  C CG    . HIS B 2 30  ? 42.437 15.153 14.353  1.00 51.26  ? 31  HIS A CG    1 
ATOM   370  N ND1   . HIS B 2 30  ? 42.214 14.065 15.170  1.00 52.69  ? 31  HIS A ND1   1 
ATOM   371  C CD2   . HIS B 2 30  ? 43.659 15.630 14.689  1.00 50.86  ? 31  HIS A CD2   1 
ATOM   372  C CE1   . HIS B 2 30  ? 43.256 13.891 15.964  1.00 51.42  ? 31  HIS A CE1   1 
ATOM   373  N NE2   . HIS B 2 30  ? 44.147 14.828 15.692  1.00 50.11  ? 31  HIS A NE2   1 
ATOM   374  N N     . ASP B 2 31  ? 40.759 15.930 9.943   1.00 51.51  ? 32  ASP A N     1 
ATOM   375  C CA    . ASP B 2 31  ? 39.782 16.428 8.971   1.00 52.88  ? 32  ASP A CA    1 
ATOM   376  C C     . ASP B 2 31  ? 38.725 17.283 9.679   1.00 50.01  ? 32  ASP A C     1 
ATOM   377  O O     . ASP B 2 31  ? 37.521 17.027 9.588   1.00 47.38  ? 32  ASP A O     1 
ATOM   378  C CB    . ASP B 2 31  ? 39.130 15.268 8.209   1.00 58.94  ? 32  ASP A CB    1 
ATOM   379  C CG    . ASP B 2 31  ? 38.465 15.720 6.917   1.00 66.20  ? 32  ASP A CG    1 
ATOM   380  O OD1   . ASP B 2 31  ? 39.195 16.084 5.968   1.00 68.97  ? 32  ASP A OD1   1 
ATOM   381  O OD2   . ASP B 2 31  ? 37.217 15.717 6.851   1.00 70.21  ? 32  ASP A OD2   1 
ATOM   382  N N     . LEU B 2 32  ? 39.206 18.305 10.382  1.00 47.15  ? 33  LEU A N     1 
ATOM   383  C CA    . LEU B 2 32  ? 38.365 19.215 11.154  1.00 44.27  ? 33  LEU A CA    1 
ATOM   384  C C     . LEU B 2 32  ? 37.406 20.041 10.308  1.00 42.78  ? 33  LEU A C     1 
ATOM   385  O O     . LEU B 2 32  ? 37.736 20.445 9.193   1.00 42.64  ? 33  LEU A O     1 
ATOM   386  C CB    . LEU B 2 32  ? 39.249 20.158 11.976  1.00 41.40  ? 33  LEU A CB    1 
ATOM   387  C CG    . LEU B 2 32  ? 40.314 19.515 12.869  1.00 37.80  ? 33  LEU A CG    1 
ATOM   388  C CD1   . LEU B 2 32  ? 41.251 20.580 13.396  1.00 35.61  ? 33  LEU A CD1   1 
ATOM   389  C CD2   . LEU B 2 32  ? 39.662 18.749 14.007  1.00 37.60  ? 33  LEU A CD2   1 
ATOM   390  N N     . ALA B 2 33  ? 36.217 20.289 10.853  1.00 42.09  ? 34  ALA A N     1 
ATOM   391  C CA    . ALA B 2 33  ? 35.203 21.095 10.174  1.00 41.32  ? 34  ALA A CA    1 
ATOM   392  C C     . ALA B 2 33  ? 35.636 22.560 10.234  1.00 40.46  ? 34  ALA A C     1 
ATOM   393  O O     . ALA B 2 33  ? 36.526 22.916 11.009  1.00 41.40  ? 34  ALA A O     1 
ATOM   394  C CB    . ALA B 2 33  ? 33.848 20.915 10.843  1.00 39.10  ? 34  ALA A CB    1 
ATOM   395  N N     . VAL B 2 34  ? 34.996 23.407 9.433   1.00 36.70  ? 35  VAL A N     1 
ATOM   396  C CA    . VAL B 2 34  ? 35.335 24.828 9.389   1.00 36.04  ? 35  VAL A CA    1 
ATOM   397  C C     . VAL B 2 34  ? 35.300 25.511 10.768  1.00 36.48  ? 35  VAL A C     1 
ATOM   398  O O     . VAL B 2 34  ? 36.177 26.317 11.089  1.00 36.59  ? 35  VAL A O     1 
ATOM   399  C CB    . VAL B 2 34  ? 34.430 25.587 8.377   1.00 33.84  ? 35  VAL A CB    1 
ATOM   400  C CG1   . VAL B 2 34  ? 32.967 25.553 8.821   1.00 30.24  ? 35  VAL A CG1   1 
ATOM   401  C CG2   . VAL B 2 34  ? 34.926 27.014 8.189   1.00 31.50  ? 35  VAL A CG2   1 
ATOM   402  N N     . GLY B 2 35  ? 34.313 25.153 11.588  1.00 35.31  ? 36  GLY A N     1 
ATOM   403  C CA    . GLY B 2 35  ? 34.188 25.731 12.916  1.00 32.56  ? 36  GLY A CA    1 
ATOM   404  C C     . GLY B 2 35  ? 35.361 25.355 13.798  1.00 33.92  ? 36  GLY A C     1 
ATOM   405  O O     . GLY B 2 35  ? 35.834 26.173 14.589  1.00 34.54  ? 36  GLY A O     1 
ATOM   406  N N     . GLU B 2 36  ? 35.834 24.117 13.647  1.00 32.56  ? 37  GLU A N     1 
ATOM   407  C CA    . GLU B 2 36  ? 36.967 23.614 14.419  1.00 33.19  ? 37  GLU A CA    1 
ATOM   408  C C     . GLU B 2 36  ? 38.298 24.135 13.889  1.00 31.27  ? 37  GLU A C     1 
ATOM   409  O O     . GLU B 2 36  ? 39.298 24.139 14.605  1.00 32.80  ? 37  GLU A O     1 
ATOM   410  C CB    . GLU B 2 36  ? 36.971 22.087 14.433  1.00 34.35  ? 37  GLU A CB    1 
ATOM   411  C CG    . GLU B 2 36  ? 35.754 21.486 15.109  1.00 41.89  ? 37  GLU A CG    1 
ATOM   412  C CD    . GLU B 2 36  ? 35.531 22.038 16.506  1.00 50.44  ? 37  GLU A CD    1 
ATOM   413  O OE1   . GLU B 2 36  ? 36.410 21.843 17.376  1.00 53.47  ? 37  GLU A OE1   1 
ATOM   414  O OE2   . GLU B 2 36  ? 34.477 22.673 16.731  1.00 53.80  ? 37  GLU A OE2   1 
ATOM   415  N N     . VAL B 2 37  ? 38.309 24.549 12.625  1.00 27.99  ? 38  VAL A N     1 
ATOM   416  C CA    . VAL B 2 37  ? 39.511 25.095 12.014  1.00 28.19  ? 38  VAL A CA    1 
ATOM   417  C C     . VAL B 2 37  ? 39.645 26.557 12.441  1.00 28.23  ? 38  VAL A C     1 
ATOM   418  O O     . VAL B 2 37  ? 40.752 27.087 12.529  1.00 28.11  ? 38  VAL A O     1 
ATOM   419  C CB    . VAL B 2 37  ? 39.464 24.982 10.471  1.00 29.83  ? 38  VAL A CB    1 
ATOM   420  C CG1   . VAL B 2 37  ? 40.676 25.663 9.848   1.00 30.97  ? 38  VAL A CG1   1 
ATOM   421  C CG2   . VAL B 2 37  ? 39.428 23.522 10.056  1.00 28.20  ? 38  VAL A CG2   1 
ATOM   422  N N     . SER B 2 38  ? 38.511 27.202 12.712  1.00 27.79  ? 39  SER A N     1 
ATOM   423  C CA    . SER B 2 38  ? 38.509 28.593 13.158  1.00 28.62  ? 39  SER A CA    1 
ATOM   424  C C     . SER B 2 38  ? 39.082 28.670 14.569  1.00 28.38  ? 39  SER A C     1 
ATOM   425  O O     . SER B 2 38  ? 39.745 29.644 14.928  1.00 29.18  ? 39  SER A O     1 
ATOM   426  C CB    . SER B 2 38  ? 37.094 29.168 13.145  1.00 27.40  ? 39  SER A CB    1 
ATOM   427  O OG    . SER B 2 38  ? 36.596 29.267 11.827  1.00 26.37  ? 39  SER A OG    1 
ATOM   428  N N     . LYS B 2 39  ? 38.810 27.642 15.368  1.00 26.66  ? 40  LYS A N     1 
ATOM   429  C CA    . LYS B 2 39  ? 39.322 27.577 16.729  1.00 28.50  ? 40  LYS A CA    1 
ATOM   430  C C     . LYS B 2 39  ? 40.832 27.349 16.682  1.00 29.18  ? 40  LYS A C     1 
ATOM   431  O O     . LYS B 2 39  ? 41.573 27.859 17.523  1.00 30.26  ? 40  LYS A O     1 
ATOM   432  C CB    . LYS B 2 39  ? 38.655 26.438 17.500  1.00 29.39  ? 40  LYS A CB    1 
ATOM   433  C CG    . LYS B 2 39  ? 37.179 26.649 17.812  1.00 29.25  ? 40  LYS A CG    1 
ATOM   434  C CD    . LYS B 2 39  ? 36.629 25.443 18.561  1.00 33.16  ? 40  LYS A CD    1 
ATOM   435  C CE    . LYS B 2 39  ? 35.139 25.570 18.851  1.00 37.35  ? 40  LYS A CE    1 
ATOM   436  N NZ    . LYS B 2 39  ? 34.844 26.635 19.853  1.00 44.11  ? 40  LYS A NZ    1 
ATOM   437  N N     . LEU B 2 40  ? 41.279 26.589 15.684  1.00 29.27  ? 41  LEU A N     1 
ATOM   438  C CA    . LEU B 2 40  ? 42.697 26.290 15.506  1.00 29.71  ? 41  LEU A CA    1 
ATOM   439  C C     . LEU B 2 40  ? 43.456 27.543 15.082  1.00 28.19  ? 41  LEU A C     1 
ATOM   440  O O     . LEU B 2 40  ? 44.622 27.721 15.432  1.00 27.43  ? 41  LEU A O     1 
ATOM   441  C CB    . LEU B 2 40  ? 42.876 25.194 14.454  1.00 31.95  ? 41  LEU A CB    1 
ATOM   442  C CG    . LEU B 2 40  ? 44.243 24.515 14.393  1.00 33.59  ? 41  LEU A CG    1 
ATOM   443  C CD1   . LEU B 2 40  ? 44.524 23.836 15.719  1.00 33.27  ? 41  LEU A CD1   1 
ATOM   444  C CD2   . LEU B 2 40  ? 44.273 23.497 13.263  1.00 32.76  ? 41  LEU A CD2   1 
ATOM   445  N N     . VAL B 2 41  ? 42.791 28.399 14.312  1.00 28.15  ? 42  VAL A N     1 
ATOM   446  C CA    . VAL B 2 41  ? 43.395 29.644 13.848  1.00 28.78  ? 42  VAL A CA    1 
ATOM   447  C C     . VAL B 2 41  ? 43.632 30.584 15.026  1.00 30.23  ? 42  VAL A C     1 
ATOM   448  O O     . VAL B 2 41  ? 44.628 31.302 15.049  1.00 30.54  ? 42  VAL A O     1 
ATOM   449  C CB    . VAL B 2 41  ? 42.516 30.346 12.777  1.00 28.94  ? 42  VAL A CB    1 
ATOM   450  C CG1   . VAL B 2 41  ? 43.096 31.700 12.406  1.00 27.89  ? 42  VAL A CG1   1 
ATOM   451  C CG2   . VAL B 2 41  ? 42.416 29.477 11.533  1.00 27.59  ? 42  VAL A CG2   1 
ATOM   452  N N     . LYS B 2 42  ? 42.739 30.560 16.015  1.00 32.16  ? 43  LYS A N     1 
ATOM   453  C CA    . LYS B 2 42  ? 42.899 31.422 17.188  1.00 33.00  ? 43  LYS A CA    1 
ATOM   454  C C     . LYS B 2 42  ? 44.097 30.966 18.020  1.00 31.11  ? 43  LYS A C     1 
ATOM   455  O O     . LYS B 2 42  ? 44.823 31.792 18.570  1.00 30.85  ? 43  LYS A O     1 
ATOM   456  C CB    . LYS B 2 42  ? 41.620 31.465 18.043  1.00 34.05  ? 43  LYS A CB    1 
ATOM   457  C CG    . LYS B 2 42  ? 41.596 30.523 19.236  1.00 42.80  ? 43  LYS A CG    1 
ATOM   458  C CD    . LYS B 2 42  ? 40.445 30.834 20.177  1.00 45.50  ? 43  LYS A CD    1 
ATOM   459  C CE    . LYS B 2 42  ? 40.415 29.869 21.359  1.00 46.49  ? 43  LYS A CE    1 
ATOM   460  N NZ    . LYS B 2 42  ? 41.641 29.984 22.193  1.00 47.31  ? 43  LYS A NZ    1 
ATOM   461  N N     . LYS B 2 43  ? 44.311 29.653 18.088  1.00 31.25  ? 44  LYS A N     1 
ATOM   462  C CA    . LYS B 2 43  ? 45.433 29.093 18.837  1.00 31.94  ? 44  LYS A CA    1 
ATOM   463  C C     . LYS B 2 43  ? 46.747 29.482 18.174  1.00 31.71  ? 44  LYS A C     1 
ATOM   464  O O     . LYS B 2 43  ? 47.707 29.847 18.848  1.00 35.66  ? 44  LYS A O     1 
ATOM   465  C CB    . LYS B 2 43  ? 45.339 27.568 18.911  1.00 34.91  ? 44  LYS A CB    1 
ATOM   466  C CG    . LYS B 2 43  ? 44.240 27.043 19.810  1.00 38.15  ? 44  LYS A CG    1 
ATOM   467  C CD    . LYS B 2 43  ? 44.279 25.527 19.868  1.00 42.49  ? 44  LYS A CD    1 
ATOM   468  C CE    . LYS B 2 43  ? 43.234 24.983 20.824  1.00 46.96  ? 44  LYS A CE    1 
ATOM   469  N NZ    . LYS B 2 43  ? 43.458 25.488 22.207  1.00 51.78  ? 44  LYS A NZ    1 
ATOM   470  N N     . ALA B 2 44  ? 46.774 29.407 16.847  1.00 29.74  ? 45  ALA A N     1 
ATOM   471  C CA    . ALA B 2 44  ? 47.959 29.753 16.074  1.00 29.08  ? 45  ALA A CA    1 
ATOM   472  C C     . ALA B 2 44  ? 48.284 31.232 16.227  1.00 29.23  ? 45  ALA A C     1 
ATOM   473  O O     . ALA B 2 44  ? 49.452 31.604 16.325  1.00 29.92  ? 45  ALA A O     1 
ATOM   474  C CB    . ALA B 2 44  ? 47.748 29.407 14.607  1.00 27.37  ? 45  ALA A CB    1 
ATOM   475  N N     . LEU B 2 45  ? 47.245 32.067 16.260  1.00 29.50  ? 46  LEU A N     1 
ATOM   476  C CA    . LEU B 2 45  ? 47.408 33.510 16.410  1.00 28.06  ? 46  LEU A CA    1 
ATOM   477  C C     . LEU B 2 45  ? 47.902 33.866 17.807  1.00 29.88  ? 46  LEU A C     1 
ATOM   478  O O     . LEU B 2 45  ? 48.669 34.812 17.973  1.00 29.80  ? 46  LEU A O     1 
ATOM   479  C CB    . LEU B 2 45  ? 46.092 34.240 16.128  1.00 26.47  ? 46  LEU A CB    1 
ATOM   480  C CG    . LEU B 2 45  ? 45.560 34.277 14.691  1.00 24.74  ? 46  LEU A CG    1 
ATOM   481  C CD1   . LEU B 2 45  ? 44.157 34.864 14.690  1.00 23.33  ? 46  LEU A CD1   1 
ATOM   482  C CD2   . LEU B 2 45  ? 46.480 35.080 13.783  1.00 21.08  ? 46  LEU A CD2   1 
ATOM   483  N N     . SER B 2 46  ? 47.447 33.115 18.807  1.00 32.28  ? 47  SER A N     1 
ATOM   484  C CA    . SER B 2 46  ? 47.855 33.335 20.196  1.00 36.38  ? 47  SER A CA    1 
ATOM   485  C C     . SER B 2 46  ? 49.317 32.938 20.366  1.00 38.69  ? 47  SER A C     1 
ATOM   486  O O     . SER B 2 46  ? 50.034 33.499 21.191  1.00 37.52  ? 47  SER A O     1 
ATOM   487  C CB    . SER B 2 46  ? 46.994 32.496 21.144  1.00 34.52  ? 47  SER A CB    1 
ATOM   488  O OG    . SER B 2 46  ? 45.631 32.870 21.066  1.00 36.00  ? 47  SER A OG    1 
ATOM   489  N N     . ASN B 2 47  ? 49.740 31.969 19.559  1.00 43.13  ? 48  ASN A N     1 
ATOM   490  C CA    . ASN B 2 47  ? 51.099 31.445 19.571  1.00 47.02  ? 48  ASN A CA    1 
ATOM   491  C C     . ASN B 2 47  ? 52.076 32.412 18.894  1.00 48.07  ? 48  ASN A C     1 
ATOM   492  O O     . ASN B 2 47  ? 53.205 32.584 19.353  1.00 49.06  ? 48  ASN A O     1 
ATOM   493  C CB    . ASN B 2 47  ? 51.118 30.091 18.851  1.00 51.43  ? 48  ASN A CB    1 
ATOM   494  C CG    . ASN B 2 47  ? 52.282 29.213 19.270  1.00 54.88  ? 48  ASN A CG    1 
ATOM   495  O OD1   . ASN B 2 47  ? 52.228 28.542 20.305  1.00 53.29  ? 48  ASN A OD1   1 
ATOM   496  N ND2   . ASN B 2 47  ? 53.331 29.192 18.453  1.00 54.69  ? 48  ASN A ND2   1 
ATOM   497  N N     . GLU B 2 48  ? 51.634 33.041 17.805  1.00 46.82  ? 49  GLU A N     1 
ATOM   498  C CA    . GLU B 2 48  ? 52.470 33.984 17.066  1.00 46.69  ? 49  GLU A CA    1 
ATOM   499  C C     . GLU B 2 48  ? 52.518 35.350 17.738  1.00 44.52  ? 49  GLU A C     1 
ATOM   500  O O     . GLU B 2 48  ? 53.540 36.033 17.692  1.00 44.55  ? 49  GLU A O     1 
ATOM   501  C CB    . GLU B 2 48  ? 51.967 34.137 15.629  1.00 51.88  ? 49  GLU A CB    1 
ATOM   502  C CG    . GLU B 2 48  ? 51.809 32.829 14.869  1.00 65.16  ? 49  GLU A CG    1 
ATOM   503  C CD    . GLU B 2 48  ? 53.119 32.084 14.670  1.00 72.20  ? 49  GLU A CD    1 
ATOM   504  O OE1   . GLU B 2 48  ? 53.605 31.455 15.637  1.00 75.90  ? 49  GLU A OE1   1 
ATOM   505  O OE2   . GLU B 2 48  ? 53.651 32.114 13.536  1.00 75.03  ? 49  GLU A OE2   1 
ATOM   506  N N     . TYR B 2 49  ? 51.399 35.753 18.335  1.00 42.78  ? 50  TYR A N     1 
ATOM   507  C CA    . TYR B 2 49  ? 51.305 37.038 19.026  1.00 41.92  ? 50  TYR A CA    1 
ATOM   508  C C     . TYR B 2 49  ? 50.871 36.786 20.462  1.00 41.49  ? 50  TYR A C     1 
ATOM   509  O O     . TYR B 2 49  ? 49.684 36.856 20.780  1.00 41.63  ? 50  TYR A O     1 
ATOM   510  C CB    . TYR B 2 49  ? 50.282 37.953 18.343  1.00 42.48  ? 50  TYR A CB    1 
ATOM   511  C CG    . TYR B 2 49  ? 50.469 38.082 16.854  1.00 44.81  ? 50  TYR A CG    1 
ATOM   512  C CD1   . TYR B 2 49  ? 51.295 39.066 16.317  1.00 43.94  ? 50  TYR A CD1   1 
ATOM   513  C CD2   . TYR B 2 49  ? 49.839 37.199 15.977  1.00 47.06  ? 50  TYR A CD2   1 
ATOM   514  C CE1   . TYR B 2 49  ? 51.492 39.166 14.940  1.00 47.29  ? 50  TYR A CE1   1 
ATOM   515  C CE2   . TYR B 2 49  ? 50.028 37.288 14.602  1.00 48.87  ? 50  TYR A CE2   1 
ATOM   516  C CZ    . TYR B 2 49  ? 50.855 38.272 14.090  1.00 48.72  ? 50  TYR A CZ    1 
ATOM   517  O OH    . TYR B 2 49  ? 51.044 38.357 12.731  1.00 49.75  ? 50  TYR A OH    1 
ATOM   518  N N     . PRO B 2 50  ? 51.826 36.450 21.345  1.00 41.98  ? 51  PRO A N     1 
ATOM   519  C CA    . PRO B 2 50  ? 51.505 36.189 22.749  1.00 42.56  ? 51  PRO A CA    1 
ATOM   520  C C     . PRO B 2 50  ? 51.094 37.453 23.501  1.00 42.68  ? 51  PRO A C     1 
ATOM   521  O O     . PRO B 2 50  ? 50.400 37.379 24.516  1.00 44.05  ? 51  PRO A O     1 
ATOM   522  C CB    . PRO B 2 50  ? 52.809 35.602 23.287  1.00 39.97  ? 51  PRO A CB    1 
ATOM   523  C CG    . PRO B 2 50  ? 53.841 36.295 22.475  1.00 41.34  ? 51  PRO A CG    1 
ATOM   524  C CD    . PRO B 2 50  ? 53.260 36.228 21.090  1.00 41.02  ? 51  PRO A CD    1 
ATOM   525  N N     . GLN B 2 51  ? 51.501 38.608 22.981  1.00 42.84  ? 52  GLN A N     1 
ATOM   526  C CA    . GLN B 2 51  ? 51.183 39.891 23.602  1.00 41.88  ? 52  GLN A CA    1 
ATOM   527  C C     . GLN B 2 51  ? 49.743 40.327 23.349  1.00 40.17  ? 52  GLN A C     1 
ATOM   528  O O     . GLN B 2 51  ? 49.246 41.249 23.996  1.00 39.82  ? 52  GLN A O     1 
ATOM   529  C CB    . GLN B 2 51  ? 52.142 40.981 23.115  1.00 44.73  ? 52  GLN A CB    1 
ATOM   530  C CG    . GLN B 2 51  ? 53.608 40.747 23.461  1.00 50.79  ? 52  GLN A CG    1 
ATOM   531  C CD    . GLN B 2 51  ? 54.403 40.114 22.326  1.00 56.03  ? 52  GLN A CD    1 
ATOM   532  O OE1   . GLN B 2 51  ? 53.839 39.599 21.358  1.00 56.34  ? 52  GLN A OE1   1 
ATOM   533  N NE2   . GLN B 2 51  ? 55.726 40.163 22.439  1.00 58.41  ? 52  GLN A NE2   1 
ATOM   534  N N     . LEU B 2 52  ? 49.079 39.659 22.410  1.00 38.36  ? 53  LEU A N     1 
ATOM   535  C CA    . LEU B 2 52  ? 47.696 39.977 22.063  1.00 37.26  ? 53  LEU A CA    1 
ATOM   536  C C     . LEU B 2 52  ? 46.695 38.954 22.612  1.00 35.79  ? 53  LEU A C     1 
ATOM   537  O O     . LEU B 2 52  ? 47.034 37.793 22.840  1.00 34.96  ? 53  LEU A O     1 
ATOM   538  C CB    . LEU B 2 52  ? 47.545 40.096 20.541  1.00 37.50  ? 53  LEU A CB    1 
ATOM   539  C CG    . LEU B 2 52  ? 48.363 41.168 19.810  1.00 36.58  ? 53  LEU A CG    1 
ATOM   540  C CD1   . LEU B 2 52  ? 48.214 40.993 18.308  1.00 36.36  ? 53  LEU A CD1   1 
ATOM   541  C CD2   . LEU B 2 52  ? 47.919 42.559 20.227  1.00 38.46  ? 53  LEU A CD2   1 
ATOM   542  N N     . SER B 2 53  ? 45.454 39.399 22.792  1.00 34.54  ? 54  SER A N     1 
ATOM   543  C CA    . SER B 2 53  ? 44.379 38.564 23.314  1.00 33.60  ? 54  SER A CA    1 
ATOM   544  C C     . SER B 2 53  ? 43.366 38.248 22.219  1.00 32.16  ? 54  SER A C     1 
ATOM   545  O O     . SER B 2 53  ? 42.816 39.151 21.591  1.00 30.94  ? 54  SER A O     1 
ATOM   546  C CB    . SER B 2 53  ? 43.671 39.285 24.462  1.00 36.46  ? 54  SER A CB    1 
ATOM   547  O OG    . SER B 2 53  ? 44.599 39.746 25.431  1.00 40.33  ? 54  SER A OG    1 
ATOM   548  N N     . PHE B 2 54  ? 43.113 36.960 22.011  1.00 32.18  ? 55  PHE A N     1 
ATOM   549  C CA    . PHE B 2 54  ? 42.167 36.505 20.999  1.00 30.21  ? 55  PHE A CA    1 
ATOM   550  C C     . PHE B 2 54  ? 41.046 35.686 21.633  1.00 32.42  ? 55  PHE A C     1 
ATOM   551  O O     . PHE B 2 54  ? 41.210 35.132 22.724  1.00 31.91  ? 55  PHE A O     1 
ATOM   552  C CB    . PHE B 2 54  ? 42.877 35.637 19.955  1.00 27.14  ? 55  PHE A CB    1 
ATOM   553  C CG    . PHE B 2 54  ? 43.936 36.359 19.176  1.00 26.66  ? 55  PHE A CG    1 
ATOM   554  C CD1   . PHE B 2 54  ? 43.613 37.052 18.015  1.00 24.32  ? 55  PHE A CD1   1 
ATOM   555  C CD2   . PHE B 2 54  ? 45.259 36.345 19.599  1.00 25.20  ? 55  PHE A CD2   1 
ATOM   556  C CE1   . PHE B 2 54  ? 44.592 37.720 17.285  1.00 25.34  ? 55  PHE A CE1   1 
ATOM   557  C CE2   . PHE B 2 54  ? 46.244 37.009 18.877  1.00 28.00  ? 55  PHE A CE2   1 
ATOM   558  C CZ    . PHE B 2 54  ? 45.909 37.699 17.718  1.00 27.02  ? 55  PHE A CZ    1 
ATOM   559  N N     . ARG B 2 55  ? 39.913 35.605 20.934  1.00 32.95  ? 56  ARG A N     1 
ATOM   560  C CA    . ARG B 2 55  ? 38.760 34.839 21.398  1.00 31.90  ? 56  ARG A CA    1 
ATOM   561  C C     . ARG B 2 55  ? 37.925 34.349 20.213  1.00 31.38  ? 56  ARG A C     1 
ATOM   562  O O     . ARG B 2 55  ? 37.945 34.937 19.132  1.00 28.42  ? 56  ARG A O     1 
ATOM   563  C CB    . ARG B 2 55  ? 37.880 35.676 22.334  1.00 30.87  ? 56  ARG A CB    1 
ATOM   564  C CG    . ARG B 2 55  ? 37.021 36.704 21.624  1.00 33.72  ? 56  ARG A CG    1 
ATOM   565  C CD    . ARG B 2 55  ? 36.005 37.343 22.550  1.00 33.52  ? 56  ARG A CD    1 
ATOM   566  N NE    . ARG B 2 55  ? 35.126 38.242 21.810  1.00 35.34  ? 56  ARG A NE    1 
ATOM   567  C CZ    . ARG B 2 55  ? 34.343 39.162 22.364  1.00 38.54  ? 56  ARG A CZ    1 
ATOM   568  N NH1   . ARG B 2 55  ? 34.320 39.320 23.681  1.00 38.46  ? 56  ARG A NH1   1 
ATOM   569  N NH2   . ARG B 2 55  ? 33.589 39.936 21.594  1.00 38.69  ? 56  ARG A NH2   1 
ATOM   570  N N     . TYR B 2 56  ? 37.197 33.261 20.430  1.00 30.43  ? 57  TYR A N     1 
ATOM   571  C CA    . TYR B 2 56  ? 36.344 32.681 19.408  1.00 28.74  ? 57  TYR A CA    1 
ATOM   572  C C     . TYR B 2 56  ? 34.902 32.796 19.867  1.00 30.82  ? 57  TYR A C     1 
ATOM   573  O O     . TYR B 2 56  ? 34.586 32.540 21.026  1.00 32.55  ? 57  TYR A O     1 
ATOM   574  C CB    . TYR B 2 56  ? 36.706 31.212 19.184  1.00 29.79  ? 57  TYR A CB    1 
ATOM   575  C CG    . TYR B 2 56  ? 35.791 30.488 18.221  1.00 29.90  ? 57  TYR A CG    1 
ATOM   576  C CD1   . TYR B 2 56  ? 36.035 30.505 16.852  1.00 26.92  ? 57  TYR A CD1   1 
ATOM   577  C CD2   . TYR B 2 56  ? 34.686 29.777 18.683  1.00 30.35  ? 57  TYR A CD2   1 
ATOM   578  C CE1   . TYR B 2 56  ? 35.204 29.833 15.967  1.00 30.41  ? 57  TYR A CE1   1 
ATOM   579  C CE2   . TYR B 2 56  ? 33.847 29.102 17.805  1.00 34.86  ? 57  TYR A CE2   1 
ATOM   580  C CZ    . TYR B 2 56  ? 34.112 29.133 16.448  1.00 31.91  ? 57  TYR A CZ    1 
ATOM   581  O OH    . TYR B 2 56  ? 33.286 28.461 15.575  1.00 36.03  ? 57  TYR A OH    1 
ATOM   582  N N     . ARG B 2 57  ? 34.027 33.149 18.940  1.00 30.23  ? 58  ARG A N     1 
ATOM   583  C CA    . ARG B 2 57  ? 32.618 33.313 19.237  1.00 32.52  ? 58  ARG A CA    1 
ATOM   584  C C     . ARG B 2 57  ? 31.832 32.580 18.160  1.00 33.74  ? 58  ARG A C     1 
ATOM   585  O O     . ARG B 2 57  ? 32.202 32.611 16.990  1.00 34.11  ? 58  ARG A O     1 
ATOM   586  C CB    . ARG B 2 57  ? 32.284 34.805 19.244  1.00 32.86  ? 58  ARG A CB    1 
ATOM   587  C CG    . ARG B 2 57  ? 30.988 35.167 19.919  1.00 36.71  ? 58  ARG A CG    1 
ATOM   588  C CD    . ARG B 2 57  ? 31.085 36.560 20.514  1.00 39.12  ? 58  ARG A CD    1 
ATOM   589  N NE    . ARG B 2 57  ? 31.492 37.559 19.532  1.00 41.85  ? 58  ARG A NE    1 
ATOM   590  C CZ    . ARG B 2 57  ? 30.730 38.575 19.141  1.00 45.41  ? 58  ARG A CZ    1 
ATOM   591  N NH1   . ARG B 2 57  ? 29.517 38.727 19.652  1.00 46.53  ? 58  ARG A NH1   1 
ATOM   592  N NH2   . ARG B 2 57  ? 31.176 39.437 18.236  1.00 46.17  ? 58  ARG A NH2   1 
ATOM   593  N N     . ASP B 2 58  ? 30.766 31.896 18.559  1.00 34.06  ? 59  ASP A N     1 
ATOM   594  C CA    . ASP B 2 58  ? 29.952 31.148 17.607  1.00 37.78  ? 59  ASP A CA    1 
ATOM   595  C C     . ASP B 2 58  ? 28.698 31.890 17.151  1.00 36.85  ? 59  ASP A C     1 
ATOM   596  O O     . ASP B 2 58  ? 28.009 31.442 16.233  1.00 36.24  ? 59  ASP A O     1 
ATOM   597  C CB    . ASP B 2 58  ? 29.572 29.782 18.194  1.00 45.43  ? 59  ASP A CB    1 
ATOM   598  C CG    . ASP B 2 58  ? 28.951 29.890 19.579  1.00 54.98  ? 59  ASP A CG    1 
ATOM   599  O OD1   . ASP B 2 58  ? 27.757 30.246 19.673  1.00 58.10  ? 59  ASP A OD1   1 
ATOM   600  O OD2   . ASP B 2 58  ? 29.661 29.620 20.573  1.00 61.96  ? 59  ASP A OD2   1 
ATOM   601  N N     . SER B 2 59  ? 28.428 33.044 17.757  1.00 34.72  ? 60  SER A N     1 
ATOM   602  C CA    . SER B 2 59  ? 27.236 33.809 17.413  1.00 36.41  ? 60  SER A CA    1 
ATOM   603  C C     . SER B 2 59  ? 27.359 35.302 17.705  1.00 35.23  ? 60  SER A C     1 
ATOM   604  O O     . SER B 2 59  ? 28.175 35.721 18.517  1.00 37.89  ? 60  SER A O     1 
ATOM   605  C CB    . SER B 2 59  ? 26.038 33.233 18.174  1.00 39.39  ? 60  SER A CB    1 
ATOM   606  O OG    . SER B 2 59  ? 24.846 33.942 17.891  1.00 51.02  ? 60  SER A OG    1 
ATOM   607  N N     . ILE B 2 60  ? 26.545 36.096 17.015  1.00 34.36  ? 61  ILE A N     1 
ATOM   608  C CA    . ILE B 2 60  ? 26.502 37.547 17.186  1.00 33.22  ? 61  ILE A CA    1 
ATOM   609  C C     . ILE B 2 60  ? 25.028 37.928 17.142  1.00 33.93  ? 61  ILE A C     1 
ATOM   610  O O     . ILE B 2 60  ? 24.366 37.700 16.134  1.00 34.93  ? 61  ILE A O     1 
ATOM   611  C CB    . ILE B 2 60  ? 27.212 38.282 16.028  1.00 32.77  ? 61  ILE A CB    1 
ATOM   612  C CG1   . ILE B 2 60  ? 28.699 37.937 16.007  1.00 35.50  ? 61  ILE A CG1   1 
ATOM   613  C CG2   . ILE B 2 60  ? 27.026 39.789 16.163  1.00 29.77  ? 61  ILE A CG2   1 
ATOM   614  C CD1   . ILE B 2 60  ? 29.447 38.568 14.853  1.00 39.25  ? 61  ILE A CD1   1 
ATOM   615  N N     . LYS B 2 61  ? 24.503 38.486 18.227  1.00 33.22  ? 62  LYS A N     1 
ATOM   616  C CA    . LYS B 2 61  ? 23.096 38.871 18.245  1.00 34.91  ? 62  LYS A CA    1 
ATOM   617  C C     . LYS B 2 61  ? 22.835 40.155 17.452  1.00 31.62  ? 62  LYS A C     1 
ATOM   618  O O     . LYS B 2 61  ? 23.735 40.974 17.271  1.00 32.66  ? 62  LYS A O     1 
ATOM   619  C CB    . LYS B 2 61  ? 22.570 38.973 19.684  1.00 40.68  ? 62  LYS A CB    1 
ATOM   620  C CG    . LYS B 2 61  ? 23.353 39.897 20.598  1.00 51.19  ? 62  LYS A CG    1 
ATOM   621  C CD    . LYS B 2 61  ? 22.765 39.920 22.007  1.00 58.28  ? 62  LYS A CD    1 
ATOM   622  C CE    . LYS B 2 61  ? 21.308 40.369 22.001  1.00 60.79  ? 62  LYS A CE    1 
ATOM   623  N NZ    . LYS B 2 61  ? 20.738 40.480 23.371  1.00 59.51  ? 62  LYS A NZ    1 
ATOM   624  N N     . LYS B 2 62  ? 21.614 40.305 16.946  1.00 29.09  ? 63  LYS A N     1 
ATOM   625  C CA    . LYS B 2 62  ? 21.246 41.477 16.159  1.00 29.78  ? 63  LYS A CA    1 
ATOM   626  C C     . LYS B 2 62  ? 21.360 42.799 16.903  1.00 30.84  ? 63  LYS A C     1 
ATOM   627  O O     . LYS B 2 62  ? 21.494 43.853 16.281  1.00 30.41  ? 63  LYS A O     1 
ATOM   628  C CB    . LYS B 2 62  ? 19.839 41.331 15.580  1.00 31.57  ? 63  LYS A CB    1 
ATOM   629  C CG    . LYS B 2 62  ? 19.814 40.833 14.134  1.00 41.42  ? 63  LYS A CG    1 
ATOM   630  C CD    . LYS B 2 62  ? 18.533 41.258 13.419  1.00 45.64  ? 63  LYS A CD    1 
ATOM   631  C CE    . LYS B 2 62  ? 18.409 42.782 13.365  1.00 48.46  ? 63  LYS A CE    1 
ATOM   632  N NZ    . LYS B 2 62  ? 17.106 43.250 12.810  1.00 45.42  ? 63  LYS A NZ    1 
ATOM   633  N N     . THR B 2 63  ? 21.302 42.742 18.230  1.00 31.14  ? 64  THR A N     1 
ATOM   634  C CA    . THR B 2 63  ? 21.410 43.941 19.054  1.00 32.68  ? 64  THR A CA    1 
ATOM   635  C C     . THR B 2 63  ? 22.822 44.519 18.967  1.00 30.32  ? 64  THR A C     1 
ATOM   636  O O     . THR B 2 63  ? 23.010 45.733 19.071  1.00 30.79  ? 64  THR A O     1 
ATOM   637  C CB    . THR B 2 63  ? 21.048 43.645 20.523  1.00 34.72  ? 64  THR A CB    1 
ATOM   638  O OG1   . THR B 2 63  ? 19.741 43.062 20.579  1.00 39.40  ? 64  THR A OG1   1 
ATOM   639  C CG2   . THR B 2 63  ? 21.038 44.929 21.341  1.00 39.49  ? 64  THR A CG2   1 
ATOM   640  N N     . GLU B 2 64  ? 23.809 43.645 18.777  1.00 28.62  ? 65  GLU A N     1 
ATOM   641  C CA    . GLU B 2 64  ? 25.201 44.067 18.644  1.00 29.86  ? 65  GLU A CA    1 
ATOM   642  C C     . GLU B 2 64  ? 25.407 44.777 17.308  1.00 29.71  ? 65  GLU A C     1 
ATOM   643  O O     . GLU B 2 64  ? 26.077 45.810 17.239  1.00 31.85  ? 65  GLU A O     1 
ATOM   644  C CB    . GLU B 2 64  ? 26.141 42.866 18.686  1.00 32.86  ? 65  GLU A CB    1 
ATOM   645  C CG    . GLU B 2 64  ? 26.208 42.131 20.000  1.00 42.40  ? 65  GLU A CG    1 
ATOM   646  C CD    . GLU B 2 64  ? 27.268 41.045 19.980  1.00 44.93  ? 65  GLU A CD    1 
ATOM   647  O OE1   . GLU B 2 64  ? 28.455 41.387 19.773  1.00 41.33  ? 65  GLU A OE1   1 
ATOM   648  O OE2   . GLU B 2 64  ? 26.912 39.855 20.159  1.00 44.15  ? 65  GLU A OE2   1 
ATOM   649  N N     . ILE B 2 65  ? 24.854 44.194 16.247  1.00 27.29  ? 66  ILE A N     1 
ATOM   650  C CA    . ILE B 2 65  ? 24.970 44.755 14.905  1.00 27.35  ? 66  ILE A CA    1 
ATOM   651  C C     . ILE B 2 65  ? 24.313 46.136 14.852  1.00 27.33  ? 66  ILE A C     1 
ATOM   652  O O     . ILE B 2 65  ? 24.894 47.087 14.329  1.00 26.10  ? 66  ILE A O     1 
ATOM   653  C CB    . ILE B 2 65  ? 24.344 43.805 13.849  1.00 25.88  ? 66  ILE A CB    1 
ATOM   654  C CG1   . ILE B 2 65  ? 25.026 42.434 13.917  1.00 24.48  ? 66  ILE A CG1   1 
ATOM   655  C CG2   . ILE B 2 65  ? 24.491 44.386 12.447  1.00 23.36  ? 66  ILE A CG2   1 
ATOM   656  C CD1   . ILE B 2 65  ? 24.419 41.387 13.003  1.00 24.40  ? 66  ILE A CD1   1 
ATOM   657  N N     . ASN B 2 66  ? 23.125 46.252 15.440  1.00 28.61  ? 67  ASN A N     1 
ATOM   658  C CA    . ASN B 2 66  ? 22.407 47.523 15.475  1.00 31.13  ? 67  ASN A CA    1 
ATOM   659  C C     . ASN B 2 66  ? 23.155 48.598 16.259  1.00 30.99  ? 67  ASN A C     1 
ATOM   660  O O     . ASN B 2 66  ? 23.123 49.772 15.898  1.00 30.23  ? 67  ASN A O     1 
ATOM   661  C CB    . ASN B 2 66  ? 21.012 47.330 16.068  1.00 30.58  ? 67  ASN A CB    1 
ATOM   662  C CG    . ASN B 2 66  ? 20.033 46.760 15.070  1.00 31.81  ? 67  ASN A CG    1 
ATOM   663  O OD1   . ASN B 2 66  ? 20.281 46.771 13.866  1.00 32.50  ? 67  ASN A OD1   1 
ATOM   664  N ND2   . ASN B 2 66  ? 18.909 46.263 15.564  1.00 33.60  ? 67  ASN A ND2   1 
ATOM   665  N N     . GLU B 2 67  ? 23.834 48.190 17.327  1.00 34.69  ? 68  GLU A N     1 
ATOM   666  C CA    . GLU B 2 67  ? 24.591 49.123 18.151  1.00 36.33  ? 68  GLU A CA    1 
ATOM   667  C C     . GLU B 2 67  ? 25.744 49.699 17.336  1.00 34.20  ? 68  GLU A C     1 
ATOM   668  O O     . GLU B 2 67  ? 26.022 50.896 17.403  1.00 33.00  ? 68  GLU A O     1 
ATOM   669  C CB    . GLU B 2 67  ? 25.126 48.419 19.402  1.00 44.98  ? 68  GLU A CB    1 
ATOM   670  C CG    . GLU B 2 67  ? 25.632 49.359 20.493  1.00 58.81  ? 68  GLU A CG    1 
ATOM   671  C CD    . GLU B 2 67  ? 24.507 50.013 21.288  1.00 66.65  ? 68  GLU A CD    1 
ATOM   672  O OE1   . GLU B 2 67  ? 23.950 51.035 20.827  1.00 68.39  ? 68  GLU A OE1   1 
ATOM   673  O OE2   . GLU B 2 67  ? 24.185 49.505 22.384  1.00 70.39  ? 68  GLU A OE2   1 
ATOM   674  N N     . ALA B 2 68  ? 26.388 48.842 16.547  1.00 30.29  ? 69  ALA A N     1 
ATOM   675  C CA    . ALA B 2 68  ? 27.509 49.251 15.702  1.00 30.88  ? 69  ALA A CA    1 
ATOM   676  C C     . ALA B 2 68  ? 27.039 50.163 14.569  1.00 30.63  ? 69  ALA A C     1 
ATOM   677  O O     . ALA B 2 68  ? 27.751 51.082 14.160  1.00 31.32  ? 69  ALA A O     1 
ATOM   678  C CB    . ALA B 2 68  ? 28.213 48.022 15.135  1.00 30.66  ? 69  ALA A CB    1 
ATOM   679  N N     . LEU B 2 69  ? 25.829 49.909 14.080  1.00 29.56  ? 70  LEU A N     1 
ATOM   680  C CA    . LEU B 2 69  ? 25.235 50.690 12.999  1.00 30.25  ? 70  LEU A CA    1 
ATOM   681  C C     . LEU B 2 69  ? 24.845 52.091 13.483  1.00 33.64  ? 70  LEU A C     1 
ATOM   682  O O     . LEU B 2 69  ? 24.924 53.060 12.726  1.00 33.87  ? 70  LEU A O     1 
ATOM   683  C CB    . LEU B 2 69  ? 24.007 49.950 12.458  1.00 28.67  ? 70  LEU A CB    1 
ATOM   684  C CG    . LEU B 2 69  ? 23.884 49.580 10.977  1.00 29.46  ? 70  LEU A CG    1 
ATOM   685  C CD1   . LEU B 2 69  ? 25.227 49.281 10.361  1.00 28.90  ? 70  LEU A CD1   1 
ATOM   686  C CD2   . LEU B 2 69  ? 22.960 48.383 10.844  1.00 25.13  ? 70  LEU A CD2   1 
ATOM   687  N N     . LYS B 2 70  ? 24.434 52.194 14.747  1.00 36.16  ? 71  LYS A N     1 
ATOM   688  C CA    . LYS B 2 70  ? 24.041 53.477 15.330  1.00 37.12  ? 71  LYS A CA    1 
ATOM   689  C C     . LYS B 2 70  ? 25.222 54.423 15.539  1.00 37.81  ? 71  LYS A C     1 
ATOM   690  O O     . LYS B 2 70  ? 25.060 55.641 15.471  1.00 37.28  ? 71  LYS A O     1 
ATOM   691  C CB    . LYS B 2 70  ? 23.312 53.277 16.658  1.00 35.55  ? 71  LYS A CB    1 
ATOM   692  C CG    . LYS B 2 70  ? 21.915 52.718 16.532  1.00 36.55  ? 71  LYS A CG    1 
ATOM   693  C CD    . LYS B 2 70  ? 21.144 52.932 17.825  1.00 43.61  ? 71  LYS A CD    1 
ATOM   694  C CE    . LYS B 2 70  ? 19.765 52.297 17.780  1.00 45.21  ? 71  LYS A CE    1 
ATOM   695  N NZ    . LYS B 2 70  ? 19.846 50.813 17.741  1.00 47.19  ? 71  LYS A NZ    1 
ATOM   696  N N     . LYS B 2 71  ? 26.401 53.858 15.800  1.00 39.03  ? 72  LYS A N     1 
ATOM   697  C CA    . LYS B 2 71  ? 27.616 54.646 16.010  1.00 40.39  ? 72  LYS A CA    1 
ATOM   698  C C     . LYS B 2 71  ? 28.058 55.355 14.727  1.00 41.91  ? 72  LYS A C     1 
ATOM   699  O O     . LYS B 2 71  ? 28.712 56.398 14.779  1.00 43.30  ? 72  LYS A O     1 
ATOM   700  C CB    . LYS B 2 71  ? 28.759 53.754 16.498  1.00 41.24  ? 72  LYS A CB    1 
ATOM   701  C CG    . LYS B 2 71  ? 28.494 53.016 17.797  1.00 45.17  ? 72  LYS A CG    1 
ATOM   702  C CD    . LYS B 2 71  ? 29.716 52.197 18.205  1.00 49.20  ? 72  LYS A CD    1 
ATOM   703  C CE    . LYS B 2 71  ? 29.428 51.294 19.398  1.00 51.37  ? 72  LYS A CE    1 
ATOM   704  N NZ    . LYS B 2 71  ? 29.035 52.059 20.613  1.00 54.38  ? 72  LYS A NZ    1 
ATOM   705  N N     . ILE B 2 72  ? 27.717 54.765 13.582  1.00 42.11  ? 73  ILE A N     1 
ATOM   706  C CA    . ILE B 2 72  ? 28.067 55.316 12.274  1.00 41.44  ? 73  ILE A CA    1 
ATOM   707  C C     . ILE B 2 72  ? 27.113 56.441 11.882  1.00 42.08  ? 73  ILE A C     1 
ATOM   708  O O     . ILE B 2 72  ? 27.544 57.511 11.453  1.00 41.54  ? 73  ILE A O     1 
ATOM   709  C CB    . ILE B 2 72  ? 28.042 54.212 11.189  1.00 40.44  ? 73  ILE A CB    1 
ATOM   710  C CG1   . ILE B 2 72  ? 29.087 53.145 11.517  1.00 40.09  ? 73  ILE A CG1   1 
ATOM   711  C CG2   . ILE B 2 72  ? 28.309 54.803 9.809   1.00 40.16  ? 73  ILE A CG2   1 
ATOM   712  C CD1   . ILE B 2 72  ? 28.991 51.920 10.662  1.00 39.76  ? 73  ILE A CD1   1 
ATOM   713  N N     . ASP B 2 73  ? 25.819 56.179 12.030  1.00 42.67  ? 74  ASP A N     1 
ATOM   714  C CA    . ASP B 2 73  ? 24.772 57.144 11.714  1.00 43.29  ? 74  ASP A CA    1 
ATOM   715  C C     . ASP B 2 73  ? 23.628 56.863 12.684  1.00 43.13  ? 74  ASP A C     1 
ATOM   716  O O     . ASP B 2 73  ? 23.229 55.714 12.857  1.00 43.10  ? 74  ASP A O     1 
ATOM   717  C CB    . ASP B 2 73  ? 24.304 56.959 10.266  1.00 47.92  ? 74  ASP A CB    1 
ATOM   718  C CG    . ASP B 2 73  ? 23.412 58.093 9.782   1.00 53.05  ? 74  ASP A CG    1 
ATOM   719  O OD1   . ASP B 2 73  ? 22.257 58.194 10.248  1.00 53.71  ? 74  ASP A OD1   1 
ATOM   720  O OD2   . ASP B 2 73  ? 23.861 58.879 8.918   1.00 56.69  ? 74  ASP A OD2   1 
ATOM   721  N N     . PRO B 2 74  ? 23.097 57.908 13.342  1.00 43.60  ? 75  PRO A N     1 
ATOM   722  C CA    . PRO B 2 74  ? 21.997 57.774 14.306  1.00 44.00  ? 75  PRO A CA    1 
ATOM   723  C C     . PRO B 2 74  ? 20.686 57.193 13.768  1.00 43.02  ? 75  PRO A C     1 
ATOM   724  O O     . PRO B 2 74  ? 19.884 56.664 14.536  1.00 43.75  ? 75  PRO A O     1 
ATOM   725  C CB    . PRO B 2 74  ? 21.813 59.209 14.812  1.00 43.93  ? 75  PRO A CB    1 
ATOM   726  C CG    . PRO B 2 74  ? 22.256 60.042 13.649  1.00 43.90  ? 75  PRO A CG    1 
ATOM   727  C CD    . PRO B 2 74  ? 23.504 59.319 13.217  1.00 43.80  ? 75  PRO A CD    1 
ATOM   728  N N     . ASP B 2 75  ? 20.483 57.269 12.456  1.00 41.52  ? 76  ASP A N     1 
ATOM   729  C CA    . ASP B 2 75  ? 19.261 56.762 11.836  1.00 41.54  ? 76  ASP A CA    1 
ATOM   730  C C     . ASP B 2 75  ? 19.375 55.313 11.364  1.00 39.93  ? 76  ASP A C     1 
ATOM   731  O O     . ASP B 2 75  ? 18.445 54.774 10.757  1.00 40.61  ? 76  ASP A O     1 
ATOM   732  C CB    . ASP B 2 75  ? 18.855 57.660 10.664  1.00 46.48  ? 76  ASP A CB    1 
ATOM   733  C CG    . ASP B 2 75  ? 18.758 59.128 11.056  1.00 53.58  ? 76  ASP A CG    1 
ATOM   734  O OD1   . ASP B 2 75  ? 18.094 59.443 12.069  1.00 53.48  ? 76  ASP A OD1   1 
ATOM   735  O OD2   . ASP B 2 75  ? 19.354 59.970 10.350  1.00 58.04  ? 76  ASP A OD2   1 
ATOM   736  N N     . LEU B 2 76  ? 20.511 54.685 11.656  1.00 35.87  ? 77  LEU A N     1 
ATOM   737  C CA    . LEU B 2 76  ? 20.763 53.305 11.260  1.00 32.89  ? 77  LEU A CA    1 
ATOM   738  C C     . LEU B 2 76  ? 20.629 52.327 12.427  1.00 33.06  ? 77  LEU A C     1 
ATOM   739  O O     . LEU B 2 76  ? 20.865 52.687 13.579  1.00 34.12  ? 77  LEU A O     1 
ATOM   740  C CB    . LEU B 2 76  ? 22.161 53.190 10.644  1.00 28.31  ? 77  LEU A CB    1 
ATOM   741  C CG    . LEU B 2 76  ? 22.361 53.419 9.142   1.00 25.88  ? 77  LEU A CG    1 
ATOM   742  C CD1   . LEU B 2 76  ? 21.528 54.565 8.610   1.00 26.62  ? 77  LEU A CD1   1 
ATOM   743  C CD2   . LEU B 2 76  ? 23.833 53.668 8.885   1.00 25.41  ? 77  LEU A CD2   1 
ATOM   744  N N     . GLY B 2 77  ? 20.249 51.091 12.114  1.00 32.32  ? 78  GLY A N     1 
ATOM   745  C CA    . GLY B 2 77  ? 20.094 50.064 13.129  1.00 31.84  ? 78  GLY A CA    1 
ATOM   746  C C     . GLY B 2 77  ? 18.931 50.300 14.074  1.00 33.80  ? 78  GLY A C     1 
ATOM   747  O O     . GLY B 2 77  ? 18.990 49.921 15.244  1.00 33.23  ? 78  GLY A O     1 
ATOM   748  N N     . GLY B 2 78  ? 17.863 50.905 13.564  1.00 34.39  ? 79  GLY A N     1 
ATOM   749  C CA    . GLY B 2 78  ? 16.709 51.183 14.400  1.00 37.67  ? 79  GLY A CA    1 
ATOM   750  C C     . GLY B 2 78  ? 15.529 50.263 14.164  1.00 38.95  ? 79  GLY A C     1 
ATOM   751  O O     . GLY B 2 78  ? 14.378 50.691 14.267  1.00 43.06  ? 79  GLY A O     1 
ATOM   752  N N     . THR B 2 79  ? 15.808 48.998 13.866  1.00 37.75  ? 80  THR A N     1 
ATOM   753  C CA    . THR B 2 79  ? 14.753 48.024 13.612  1.00 36.10  ? 80  THR A CA    1 
ATOM   754  C C     . THR B 2 79  ? 15.098 46.666 14.213  1.00 34.87  ? 80  THR A C     1 
ATOM   755  O O     . THR B 2 79  ? 16.204 46.156 14.032  1.00 35.11  ? 80  THR A O     1 
ATOM   756  C CB    . THR B 2 79  ? 14.503 47.863 12.098  1.00 37.37  ? 80  THR A CB    1 
ATOM   757  O OG1   . THR B 2 79  ? 14.129 49.127 11.537  1.00 42.52  ? 80  THR A OG1   1 
ATOM   758  C CG2   . THR B 2 79  ? 13.387 46.880 11.847  1.00 41.49  ? 80  THR A CG2   1 
ATOM   759  N N     . LEU B 2 80  ? 14.137 46.084 14.922  1.00 33.50  ? 81  LEU A N     1 
ATOM   760  C CA    . LEU B 2 80  ? 14.316 44.784 15.562  1.00 33.70  ? 81  LEU A CA    1 
ATOM   761  C C     . LEU B 2 80  ? 12.942 44.253 15.946  1.00 33.82  ? 81  LEU A C     1 
ATOM   762  O O     . LEU B 2 80  ? 12.282 44.808 16.824  1.00 36.43  ? 81  LEU A O     1 
ATOM   763  C CB    . LEU B 2 80  ? 15.193 44.925 16.810  1.00 32.40  ? 81  LEU A CB    1 
ATOM   764  C CG    . LEU B 2 80  ? 15.557 43.654 17.578  1.00 34.58  ? 81  LEU A CG    1 
ATOM   765  C CD1   . LEU B 2 80  ? 16.414 42.742 16.714  1.00 33.58  ? 81  LEU A CD1   1 
ATOM   766  C CD2   . LEU B 2 80  ? 16.295 44.026 18.851  1.00 34.72  ? 81  LEU A CD2   1 
ATOM   767  N N     . PHE B 2 81  ? 12.512 43.186 15.277  1.00 33.91  ? 82  PHE A N     1 
ATOM   768  C CA    . PHE B 2 81  ? 11.204 42.587 15.530  1.00 33.51  ? 82  PHE A CA    1 
ATOM   769  C C     . PHE B 2 81  ? 11.220 41.495 16.590  1.00 31.79  ? 82  PHE A C     1 
ATOM   770  O O     . PHE B 2 81  ? 10.289 41.385 17.385  1.00 33.03  ? 82  PHE A O     1 
ATOM   771  C CB    . PHE B 2 81  ? 10.607 42.068 14.222  1.00 36.43  ? 82  PHE A CB    1 
ATOM   772  C CG    . PHE B 2 81  ? 10.379 43.144 13.207  1.00 38.63  ? 82  PHE A CG    1 
ATOM   773  C CD1   . PHE B 2 81  ? 9.242  43.946 13.269  1.00 40.93  ? 82  PHE A CD1   1 
ATOM   774  C CD2   . PHE B 2 81  ? 11.324 43.394 12.218  1.00 38.87  ? 82  PHE A CD2   1 
ATOM   775  C CE1   . PHE B 2 81  ? 9.050  44.990 12.364  1.00 41.69  ? 82  PHE A CE1   1 
ATOM   776  C CE2   . PHE B 2 81  ? 11.144 44.434 11.307  1.00 41.95  ? 82  PHE A CE2   1 
ATOM   777  C CZ    . PHE B 2 81  ? 10.004 45.235 11.381  1.00 43.14  ? 82  PHE A CZ    1 
ATOM   778  N N     . VAL B 2 82  ? 12.271 40.685 16.587  1.00 30.86  ? 83  VAL A N     1 
ATOM   779  C CA    . VAL B 2 82  ? 12.428 39.609 17.558  1.00 30.89  ? 83  VAL A CA    1 
ATOM   780  C C     . VAL B 2 82  ? 13.654 39.964 18.392  1.00 32.20  ? 83  VAL A C     1 
ATOM   781  O O     . VAL B 2 82  ? 14.787 39.838 17.930  1.00 31.81  ? 83  VAL A O     1 
ATOM   782  C CB    . VAL B 2 82  ? 12.632 38.252 16.860  1.00 28.12  ? 83  VAL A CB    1 
ATOM   783  C CG1   . VAL B 2 82  ? 12.845 37.159 17.884  1.00 29.77  ? 83  VAL A CG1   1 
ATOM   784  C CG2   . VAL B 2 82  ? 11.436 37.931 15.984  1.00 26.30  ? 83  VAL A CG2   1 
ATOM   785  N N     . SER B 2 83  ? 13.404 40.426 19.615  1.00 33.44  ? 84  SER A N     1 
ATOM   786  C CA    . SER B 2 83  ? 14.438 40.861 20.555  1.00 33.95  ? 84  SER A CA    1 
ATOM   787  C C     . SER B 2 83  ? 15.754 40.091 20.579  1.00 32.71  ? 84  SER A C     1 
ATOM   788  O O     . SER B 2 83  ? 16.828 40.694 20.565  1.00 32.93  ? 84  SER A O     1 
ATOM   789  C CB    . SER B 2 83  ? 13.857 40.920 21.968  1.00 36.45  ? 84  SER A CB    1 
ATOM   790  O OG    . SER B 2 83  ? 12.740 41.790 22.006  1.00 42.68  ? 84  SER A OG    1 
ATOM   791  N N     . ASN B 2 84  ? 15.674 38.767 20.624  1.00 31.68  ? 85  ASN A N     1 
ATOM   792  C CA    . ASN B 2 84  ? 16.876 37.945 20.667  1.00 35.84  ? 85  ASN A CA    1 
ATOM   793  C C     . ASN B 2 84  ? 17.252 37.263 19.348  1.00 33.17  ? 85  ASN A C     1 
ATOM   794  O O     . ASN B 2 84  ? 17.614 36.085 19.322  1.00 31.37  ? 85  ASN A O     1 
ATOM   795  C CB    . ASN B 2 84  ? 16.812 36.939 21.830  1.00 44.32  ? 85  ASN A CB    1 
ATOM   796  C CG    . ASN B 2 84  ? 15.489 36.193 21.899  1.00 55.39  ? 85  ASN A CG    1 
ATOM   797  O OD1   . ASN B 2 84  ? 14.475 36.645 21.365  1.00 60.48  ? 85  ASN A OD1   1 
ATOM   798  N ND2   . ASN B 2 84  ? 15.491 35.047 22.572  1.00 60.60  ? 85  ASN A ND2   1 
ATOM   799  N N     . SER B 2 85  ? 17.162 38.018 18.256  1.00 30.20  ? 86  SER A N     1 
ATOM   800  C CA    . SER B 2 85  ? 17.528 37.518 16.935  1.00 28.91  ? 86  SER A CA    1 
ATOM   801  C C     . SER B 2 85  ? 19.046 37.497 16.860  1.00 27.46  ? 86  SER A C     1 
ATOM   802  O O     . SER B 2 85  ? 19.711 38.273 17.543  1.00 24.58  ? 86  SER A O     1 
ATOM   803  C CB    . SER B 2 85  ? 16.992 38.440 15.842  1.00 29.82  ? 86  SER A CB    1 
ATOM   804  O OG    . SER B 2 85  ? 15.587 38.358 15.744  1.00 39.21  ? 86  SER A OG    1 
ATOM   805  N N     . SER B 2 86  ? 19.590 36.619 16.023  1.00 29.10  ? 87  SER A N     1 
ATOM   806  C CA    . SER B 2 86  ? 21.038 36.513 15.872  1.00 29.59  ? 87  SER A CA    1 
ATOM   807  C C     . SER B 2 86  ? 21.445 35.798 14.587  1.00 29.17  ? 87  SER A C     1 
ATOM   808  O O     . SER B 2 86  ? 20.597 35.380 13.799  1.00 28.91  ? 87  SER A O     1 
ATOM   809  C CB    . SER B 2 86  ? 21.640 35.767 17.070  1.00 29.01  ? 87  SER A CB    1 
ATOM   810  O OG    . SER B 2 86  ? 21.230 34.411 17.095  1.00 27.63  ? 87  SER A OG    1 
ATOM   811  N N     . ILE B 2 87  ? 22.755 35.692 14.376  1.00 28.61  ? 88  ILE A N     1 
ATOM   812  C CA    . ILE B 2 87  ? 23.305 34.998 13.215  1.00 28.77  ? 88  ILE A CA    1 
ATOM   813  C C     . ILE B 2 87  ? 24.375 34.030 13.696  1.00 29.86  ? 88  ILE A C     1 
ATOM   814  O O     . ILE B 2 87  ? 25.147 34.340 14.608  1.00 29.29  ? 88  ILE A O     1 
ATOM   815  C CB    . ILE B 2 87  ? 23.913 35.959 12.165  1.00 26.44  ? 88  ILE A CB    1 
ATOM   816  C CG1   . ILE B 2 87  ? 24.998 36.836 12.793  1.00 24.81  ? 88  ILE A CG1   1 
ATOM   817  C CG2   . ILE B 2 87  ? 22.816 36.793 11.518  1.00 27.04  ? 88  ILE A CG2   1 
ATOM   818  C CD1   . ILE B 2 87  ? 25.772 37.655 11.791  1.00 26.25  ? 88  ILE A CD1   1 
ATOM   819  N N     . LYS B 2 88  ? 24.390 32.845 13.099  1.00 31.49  ? 89  LYS A N     1 
ATOM   820  C CA    . LYS B 2 88  ? 25.345 31.806 13.454  1.00 33.40  ? 89  LYS A CA    1 
ATOM   821  C C     . LYS B 2 88  ? 26.123 31.263 12.264  1.00 33.12  ? 89  LYS A C     1 
ATOM   822  O O     . LYS B 2 88  ? 25.707 30.282 11.646  1.00 34.89  ? 89  LYS A O     1 
ATOM   823  C CB    . LYS B 2 88  ? 24.629 30.633 14.125  1.00 38.22  ? 89  LYS A CB    1 
ATOM   824  C CG    . LYS B 2 88  ? 24.466 30.736 15.623  1.00 47.03  ? 89  LYS A CG    1 
ATOM   825  C CD    . LYS B 2 88  ? 24.174 29.358 16.203  1.00 53.23  ? 89  LYS A CD    1 
ATOM   826  C CE    . LYS B 2 88  ? 25.289 28.372 15.866  1.00 56.99  ? 89  LYS A CE    1 
ATOM   827  N NZ    . LYS B 2 88  ? 25.036 27.011 16.410  1.00 61.74  ? 89  LYS A NZ    1 
ATOM   828  N N     . PRO B 2 89  ? 27.242 31.910 11.899  1.00 32.35  ? 90  PRO A N     1 
ATOM   829  C CA    . PRO B 2 89  ? 28.024 31.405 10.765  1.00 30.67  ? 90  PRO A CA    1 
ATOM   830  C C     . PRO B 2 89  ? 28.621 30.090 11.250  1.00 28.98  ? 90  PRO A C     1 
ATOM   831  O O     . PRO B 2 89  ? 29.149 30.033 12.359  1.00 30.26  ? 90  PRO A O     1 
ATOM   832  C CB    . PRO B 2 89  ? 29.106 32.473 10.600  1.00 30.58  ? 90  PRO A CB    1 
ATOM   833  C CG    . PRO B 2 89  ? 28.461 33.714 11.157  1.00 31.81  ? 90  PRO A CG    1 
ATOM   834  C CD    . PRO B 2 89  ? 27.795 33.181 12.391  1.00 32.31  ? 90  PRO A CD    1 
ATOM   835  N N     . ASP B 2 90  ? 28.523 29.033 10.452  1.00 29.17  ? 91  ASP A N     1 
ATOM   836  C CA    . ASP B 2 90  ? 29.046 27.735 10.881  1.00 34.07  ? 91  ASP A CA    1 
ATOM   837  C C     . ASP B 2 90  ? 30.547 27.687 11.175  1.00 31.97  ? 91  ASP A C     1 
ATOM   838  O O     . ASP B 2 90  ? 31.040 26.727 11.768  1.00 32.52  ? 91  ASP A O     1 
ATOM   839  C CB    . ASP B 2 90  ? 28.619 26.610 9.919   1.00 40.31  ? 91  ASP A CB    1 
ATOM   840  C CG    . ASP B 2 90  ? 29.175 26.775 8.515   1.00 44.87  ? 91  ASP A CG    1 
ATOM   841  O OD1   . ASP B 2 90  ? 29.572 27.895 8.141   1.00 48.27  ? 91  ASP A OD1   1 
ATOM   842  O OD2   . ASP B 2 90  ? 29.203 25.768 7.778   1.00 47.52  ? 91  ASP A OD2   1 
ATOM   843  N N     . GLY B 2 91  ? 31.262 28.737 10.787  1.00 31.38  ? 92  GLY A N     1 
ATOM   844  C CA    . GLY B 2 91  ? 32.690 28.801 11.038  1.00 29.41  ? 92  GLY A CA    1 
ATOM   845  C C     . GLY B 2 91  ? 33.013 29.639 12.262  1.00 29.29  ? 92  GLY A C     1 
ATOM   846  O O     . GLY B 2 91  ? 34.150 29.660 12.723  1.00 30.34  ? 92  GLY A O     1 
ATOM   847  N N     . GLY B 2 92  ? 32.014 30.342 12.785  1.00 28.37  ? 93  GLY A N     1 
ATOM   848  C CA    . GLY B 2 92  ? 32.227 31.173 13.957  1.00 26.90  ? 93  GLY A CA    1 
ATOM   849  C C     . GLY B 2 92  ? 32.902 32.492 13.638  1.00 28.28  ? 93  GLY A C     1 
ATOM   850  O O     . GLY B 2 92  ? 32.987 32.888 12.474  1.00 27.76  ? 93  GLY A O     1 
ATOM   851  N N     . ILE B 2 93  ? 33.419 33.151 14.673  1.00 27.00  ? 94  ILE A N     1 
ATOM   852  C CA    . ILE B 2 93  ? 34.082 34.448 14.539  1.00 28.19  ? 94  ILE A CA    1 
ATOM   853  C C     . ILE B 2 93  ? 35.308 34.514 15.451  1.00 26.64  ? 94  ILE A C     1 
ATOM   854  O O     . ILE B 2 93  ? 35.273 34.033 16.577  1.00 27.57  ? 94  ILE A O     1 
ATOM   855  C CB    . ILE B 2 93  ? 33.119 35.618 14.931  1.00 30.41  ? 94  ILE A CB    1 
ATOM   856  C CG1   . ILE B 2 93  ? 31.903 35.667 14.002  1.00 30.30  ? 94  ILE A CG1   1 
ATOM   857  C CG2   . ILE B 2 93  ? 33.844 36.956 14.893  1.00 30.13  ? 94  ILE A CG2   1 
ATOM   858  C CD1   . ILE B 2 93  ? 30.705 34.887 14.514  1.00 33.06  ? 94  ILE A CD1   1 
ATOM   859  N N     . VAL B 2 94  ? 36.398 35.087 14.950  1.00 26.31  ? 95  VAL A N     1 
ATOM   860  C CA    . VAL B 2 94  ? 37.622 35.237 15.733  1.00 23.70  ? 95  VAL A CA    1 
ATOM   861  C C     . VAL B 2 94  ? 37.826 36.732 15.919  1.00 26.30  ? 95  VAL A C     1 
ATOM   862  O O     . VAL B 2 94  ? 37.621 37.506 14.986  1.00 25.68  ? 95  VAL A O     1 
ATOM   863  C CB    . VAL B 2 94  ? 38.855 34.643 15.008  1.00 22.23  ? 95  VAL A CB    1 
ATOM   864  C CG1   . VAL B 2 94  ? 40.115 34.868 15.837  1.00 21.44  ? 95  VAL A CG1   1 
ATOM   865  C CG2   . VAL B 2 94  ? 38.655 33.160 14.741  1.00 21.38  ? 95  VAL A CG2   1 
ATOM   866  N N     . GLU B 2 95  ? 38.211 37.138 17.127  1.00 28.96  ? 96  GLU A N     1 
ATOM   867  C CA    . GLU B 2 95  ? 38.422 38.551 17.429  1.00 27.09  ? 96  GLU A CA    1 
ATOM   868  C C     . GLU B 2 95  ? 39.699 38.813 18.217  1.00 25.17  ? 96  GLU A C     1 
ATOM   869  O O     . GLU B 2 95  ? 40.265 37.911 18.834  1.00 22.32  ? 96  GLU A O     1 
ATOM   870  C CB    . GLU B 2 95  ? 37.225 39.106 18.205  1.00 30.49  ? 96  GLU A CB    1 
ATOM   871  C CG    . GLU B 2 95  ? 35.916 39.081 17.434  1.00 39.13  ? 96  GLU A CG    1 
ATOM   872  C CD    . GLU B 2 95  ? 34.705 39.282 18.325  1.00 46.14  ? 96  GLU A CD    1 
ATOM   873  O OE1   . GLU B 2 95  ? 34.317 38.321 19.023  1.00 48.56  ? 96  GLU A OE1   1 
ATOM   874  O OE2   . GLU B 2 95  ? 34.136 40.394 18.325  1.00 49.22  ? 96  GLU A OE2   1 
ATOM   875  N N     . VAL B 2 96  ? 40.139 40.066 18.185  1.00 23.55  ? 97  VAL A N     1 
ATOM   876  C CA    . VAL B 2 96  ? 41.338 40.500 18.889  1.00 23.55  ? 97  VAL A CA    1 
ATOM   877  C C     . VAL B 2 96  ? 40.993 41.769 19.666  1.00 24.33  ? 97  VAL A C     1 
ATOM   878  O O     . VAL B 2 96  ? 40.113 42.526 19.267  1.00 24.01  ? 97  VAL A O     1 
ATOM   879  C CB    . VAL B 2 96  ? 42.507 40.771 17.894  1.00 20.04  ? 97  VAL A CB    1 
ATOM   880  C CG1   . VAL B 2 96  ? 42.202 41.970 17.017  1.00 16.91  ? 97  VAL A CG1   1 
ATOM   881  C CG2   . VAL B 2 96  ? 43.819 40.962 18.641  1.00 20.64  ? 97  VAL A CG2   1 
ATOM   882  N N     . LYS B 2 97  ? 41.645 41.979 20.802  1.00 27.29  ? 98  LYS A N     1 
ATOM   883  C CA    . LYS B 2 97  ? 41.381 43.168 21.600  1.00 30.58  ? 98  LYS A CA    1 
ATOM   884  C C     . LYS B 2 97  ? 42.398 44.246 21.247  1.00 32.05  ? 98  LYS A C     1 
ATOM   885  O O     . LYS B 2 97  ? 43.596 43.983 21.220  1.00 32.59  ? 98  LYS A O     1 
ATOM   886  C CB    . LYS B 2 97  ? 41.445 42.830 23.093  1.00 34.55  ? 98  LYS A CB    1 
ATOM   887  C CG    . LYS B 2 97  ? 40.995 43.963 24.006  1.00 41.92  ? 98  LYS A CG    1 
ATOM   888  C CD    . LYS B 2 97  ? 40.609 43.480 25.406  1.00 49.96  ? 98  LYS A CD    1 
ATOM   889  C CE    . LYS B 2 97  ? 41.813 43.175 26.292  1.00 54.38  ? 98  LYS A CE    1 
ATOM   890  N NZ    . LYS B 2 97  ? 42.571 41.964 25.876  1.00 60.21  ? 98  LYS A NZ    1 
ATOM   891  N N     . ASP B 2 98  ? 41.922 45.443 20.920  1.00 32.96  ? 99  ASP A N     1 
ATOM   892  C CA    . ASP B 2 98  ? 42.830 46.533 20.580  1.00 36.72  ? 99  ASP A CA    1 
ATOM   893  C C     . ASP B 2 98  ? 43.302 47.299 21.821  1.00 39.94  ? 99  ASP A C     1 
ATOM   894  O O     . ASP B 2 98  ? 42.987 46.917 22.952  1.00 38.33  ? 99  ASP A O     1 
ATOM   895  C CB    . ASP B 2 98  ? 42.200 47.475 19.544  1.00 36.90  ? 99  ASP A CB    1 
ATOM   896  C CG    . ASP B 2 98  ? 40.888 48.093 20.009  1.00 40.12  ? 99  ASP A CG    1 
ATOM   897  O OD1   . ASP B 2 98  ? 40.550 48.002 21.204  1.00 41.22  ? 99  ASP A OD1   1 
ATOM   898  O OD2   . ASP B 2 98  ? 40.190 48.687 19.162  1.00 39.71  ? 99  ASP A OD2   1 
ATOM   899  N N     . ASP B 2 99  ? 44.051 48.378 21.603  1.00 43.91  ? 100 ASP A N     1 
ATOM   900  C CA    . ASP B 2 99  ? 44.585 49.198 22.691  1.00 45.16  ? 100 ASP A CA    1 
ATOM   901  C C     . ASP B 2 99  ? 43.515 49.985 23.450  1.00 45.56  ? 100 ASP A C     1 
ATOM   902  O O     . ASP B 2 99  ? 43.802 50.597 24.479  1.00 48.03  ? 100 ASP A O     1 
ATOM   903  C CB    . ASP B 2 99  ? 45.647 50.169 22.156  1.00 43.96  ? 100 ASP A CB    1 
ATOM   904  C CG    . ASP B 2 99  ? 46.817 49.461 21.485  1.00 44.77  ? 100 ASP A CG    1 
ATOM   905  O OD1   . ASP B 2 99  ? 47.139 48.316 21.869  1.00 40.28  ? 100 ASP A OD1   1 
ATOM   906  O OD2   . ASP B 2 99  ? 47.423 50.063 20.570  1.00 45.09  ? 100 ASP A OD2   1 
ATOM   907  N N     . TYR B 2 100 ? 42.288 49.973 22.941  1.00 43.77  ? 101 TYR A N     1 
ATOM   908  C CA    . TYR B 2 100 ? 41.196 50.693 23.579  1.00 41.84  ? 101 TYR A CA    1 
ATOM   909  C C     . TYR B 2 100 ? 40.260 49.753 24.325  1.00 40.80  ? 101 TYR A C     1 
ATOM   910  O O     . TYR B 2 100 ? 39.201 50.168 24.792  1.00 41.67  ? 101 TYR A O     1 
ATOM   911  C CB    . TYR B 2 100 ? 40.412 51.483 22.536  1.00 45.20  ? 101 TYR A CB    1 
ATOM   912  C CG    . TYR B 2 100 ? 41.272 52.362 21.661  1.00 49.43  ? 101 TYR A CG    1 
ATOM   913  C CD1   . TYR B 2 100 ? 41.966 53.446 22.197  1.00 52.05  ? 101 TYR A CD1   1 
ATOM   914  C CD2   . TYR B 2 100 ? 41.386 52.117 20.294  1.00 49.75  ? 101 TYR A CD2   1 
ATOM   915  C CE1   . TYR B 2 100 ? 42.751 54.264 21.393  1.00 53.72  ? 101 TYR A CE1   1 
ATOM   916  C CE2   . TYR B 2 100 ? 42.167 52.928 19.482  1.00 52.51  ? 101 TYR A CE2   1 
ATOM   917  C CZ    . TYR B 2 100 ? 42.845 54.000 20.037  1.00 54.28  ? 101 TYR A CZ    1 
ATOM   918  O OH    . TYR B 2 100 ? 43.611 54.815 19.239  1.00 59.31  ? 101 TYR A OH    1 
ATOM   919  N N     . GLY B 2 101 ? 40.644 48.484 24.417  1.00 39.40  ? 102 GLY A N     1 
ATOM   920  C CA    . GLY B 2 101 ? 39.828 47.507 25.117  1.00 39.63  ? 102 GLY A CA    1 
ATOM   921  C C     . GLY B 2 101 ? 38.633 46.965 24.349  1.00 38.67  ? 102 GLY A C     1 
ATOM   922  O O     . GLY B 2 101 ? 37.833 46.215 24.905  1.00 39.04  ? 102 GLY A O     1 
ATOM   923  N N     . GLU B 2 102 ? 38.504 47.345 23.082  1.00 38.52  ? 103 GLU A N     1 
ATOM   924  C CA    . GLU B 2 102 ? 37.397 46.878 22.252  1.00 39.78  ? 103 GLU A CA    1 
ATOM   925  C C     . GLU B 2 102 ? 37.788 45.714 21.351  1.00 35.18  ? 103 GLU A C     1 
ATOM   926  O O     . GLU B 2 102 ? 38.921 45.636 20.883  1.00 33.73  ? 103 GLU A O     1 
ATOM   927  C CB    . GLU B 2 102 ? 36.837 48.025 21.410  1.00 46.78  ? 103 GLU A CB    1 
ATOM   928  C CG    . GLU B 2 102 ? 35.395 48.378 21.742  1.00 59.86  ? 103 GLU A CG    1 
ATOM   929  C CD    . GLU B 2 102 ? 34.428 47.245 21.431  1.00 68.25  ? 103 GLU A CD    1 
ATOM   930  O OE1   . GLU B 2 102 ? 33.970 47.156 20.270  1.00 73.92  ? 103 GLU A OE1   1 
ATOM   931  O OE2   . GLU B 2 102 ? 34.126 46.444 22.345  1.00 69.76  ? 103 GLU A OE2   1 
ATOM   932  N N     . TRP B 2 103 ? 36.842 44.810 21.116  1.00 32.37  ? 104 TRP A N     1 
ATOM   933  C CA    . TRP B 2 103 ? 37.083 43.644 20.272  1.00 33.16  ? 104 TRP A CA    1 
ATOM   934  C C     . TRP B 2 103 ? 36.850 43.953 18.798  1.00 32.00  ? 104 TRP A C     1 
ATOM   935  O O     . TRP B 2 103 ? 35.831 44.538 18.429  1.00 32.48  ? 104 TRP A O     1 
ATOM   936  C CB    . TRP B 2 103 ? 36.209 42.471 20.724  1.00 33.57  ? 104 TRP A CB    1 
ATOM   937  C CG    . TRP B 2 103 ? 36.541 42.008 22.111  1.00 34.68  ? 104 TRP A CG    1 
ATOM   938  C CD1   . TRP B 2 103 ? 36.001 42.464 23.279  1.00 33.15  ? 104 TRP A CD1   1 
ATOM   939  C CD2   . TRP B 2 103 ? 37.527 41.033 22.478  1.00 34.92  ? 104 TRP A CD2   1 
ATOM   940  N NE1   . TRP B 2 103 ? 36.595 41.840 24.349  1.00 34.67  ? 104 TRP A NE1   1 
ATOM   941  C CE2   . TRP B 2 103 ? 37.534 40.956 23.887  1.00 34.55  ? 104 TRP A CE2   1 
ATOM   942  C CE3   . TRP B 2 103 ? 38.405 40.218 21.752  1.00 34.16  ? 104 TRP A CE3   1 
ATOM   943  C CZ2   . TRP B 2 103 ? 38.387 40.099 24.586  1.00 34.36  ? 104 TRP A CZ2   1 
ATOM   944  C CZ3   . TRP B 2 103 ? 39.255 39.364 22.449  1.00 33.30  ? 104 TRP A CZ3   1 
ATOM   945  C CH2   . TRP B 2 103 ? 39.237 39.313 23.852  1.00 34.69  ? 104 TRP A CH2   1 
ATOM   946  N N     . ARG B 2 104 ? 37.819 43.574 17.967  1.00 29.81  ? 105 ARG A N     1 
ATOM   947  C CA    . ARG B 2 104 ? 37.767 43.805 16.525  1.00 28.65  ? 105 ARG A CA    1 
ATOM   948  C C     . ARG B 2 104 ? 37.796 42.456 15.814  1.00 26.26  ? 105 ARG A C     1 
ATOM   949  O O     . ARG B 2 104 ? 38.684 41.644 16.064  1.00 23.26  ? 105 ARG A O     1 
ATOM   950  C CB    . ARG B 2 104 ? 38.983 44.628 16.082  1.00 28.62  ? 105 ARG A CB    1 
ATOM   951  C CG    . ARG B 2 104 ? 39.320 45.821 16.983  1.00 26.12  ? 105 ARG A CG    1 
ATOM   952  C CD    . ARG B 2 104 ? 38.324 46.969 16.841  1.00 24.60  ? 105 ARG A CD    1 
ATOM   953  N NE    . ARG B 2 104 ? 38.447 47.650 15.556  1.00 25.44  ? 105 ARG A NE    1 
ATOM   954  C CZ    . ARG B 2 104 ? 39.382 48.551 15.271  1.00 25.68  ? 105 ARG A CZ    1 
ATOM   955  N NH1   . ARG B 2 104 ? 40.285 48.893 16.179  1.00 27.62  ? 105 ARG A NH1   1 
ATOM   956  N NH2   . ARG B 2 104 ? 39.421 49.105 14.068  1.00 28.17  ? 105 ARG A NH2   1 
ATOM   957  N N     . VAL B 2 105 ? 36.833 42.216 14.930  1.00 25.73  ? 106 VAL A N     1 
ATOM   958  C CA    . VAL B 2 105 ? 36.788 40.949 14.206  1.00 26.04  ? 106 VAL A CA    1 
ATOM   959  C C     . VAL B 2 105 ? 37.945 40.764 13.220  1.00 25.24  ? 106 VAL A C     1 
ATOM   960  O O     . VAL B 2 105 ? 38.273 41.654 12.435  1.00 24.78  ? 106 VAL A O     1 
ATOM   961  C CB    . VAL B 2 105 ? 35.388 40.669 13.560  1.00 26.95  ? 106 VAL A CB    1 
ATOM   962  C CG1   . VAL B 2 105 ? 34.687 41.947 13.227  1.00 32.24  ? 106 VAL A CG1   1 
ATOM   963  C CG2   . VAL B 2 105 ? 35.521 39.793 12.320  1.00 24.45  ? 106 VAL A CG2   1 
ATOM   964  N N     . VAL B 2 106 ? 38.587 39.606 13.329  1.00 25.37  ? 107 VAL A N     1 
ATOM   965  C CA    . VAL B 2 106 ? 39.727 39.236 12.506  1.00 26.88  ? 107 VAL A CA    1 
ATOM   966  C C     . VAL B 2 106 ? 39.357 38.163 11.477  1.00 27.11  ? 107 VAL A C     1 
ATOM   967  O O     . VAL B 2 106 ? 40.020 38.038 10.444  1.00 28.48  ? 107 VAL A O     1 
ATOM   968  C CB    . VAL B 2 106 ? 40.876 38.697 13.397  1.00 29.78  ? 107 VAL A CB    1 
ATOM   969  C CG1   . VAL B 2 106 ? 42.106 38.425 12.576  1.00 34.69  ? 107 VAL A CG1   1 
ATOM   970  C CG2   . VAL B 2 106 ? 41.205 39.683 14.487  1.00 32.33  ? 107 VAL A CG2   1 
ATOM   971  N N     . LEU B 2 107 ? 38.288 37.413 11.744  1.00 25.32  ? 108 LEU A N     1 
ATOM   972  C CA    . LEU B 2 107 ? 37.861 36.346 10.841  1.00 22.79  ? 108 LEU A CA    1 
ATOM   973  C C     . LEU B 2 107 ? 36.432 35.840 11.040  1.00 23.75  ? 108 LEU A C     1 
ATOM   974  O O     . LEU B 2 107 ? 35.970 35.685 12.167  1.00 25.24  ? 108 LEU A O     1 
ATOM   975  C CB    . LEU B 2 107 ? 38.815 35.155 10.975  1.00 24.65  ? 108 LEU A CB    1 
ATOM   976  C CG    . LEU B 2 107 ? 38.494 33.878 10.195  1.00 27.96  ? 108 LEU A CG    1 
ATOM   977  C CD1   . LEU B 2 107 ? 38.685 34.128 8.710   1.00 24.34  ? 108 LEU A CD1   1 
ATOM   978  C CD2   . LEU B 2 107 ? 39.392 32.741 10.664  1.00 27.31  ? 108 LEU A CD2   1 
ATOM   979  N N     . VAL B 2 108 ? 35.751 35.574 9.924   1.00 23.71  ? 109 VAL A N     1 
ATOM   980  C CA    . VAL B 2 108 ? 34.392 35.025 9.915   1.00 23.46  ? 109 VAL A CA    1 
ATOM   981  C C     . VAL B 2 108 ? 34.377 33.995 8.787   1.00 24.39  ? 109 VAL A C     1 
ATOM   982  O O     . VAL B 2 108 ? 34.585 34.343 7.627   1.00 24.60  ? 109 VAL A O     1 
ATOM   983  C CB    . VAL B 2 108 ? 33.304 36.092 9.629   1.00 22.32  ? 109 VAL A CB    1 
ATOM   984  C CG1   . VAL B 2 108 ? 31.920 35.448 9.659   1.00 17.42  ? 109 VAL A CG1   1 
ATOM   985  C CG2   . VAL B 2 108 ? 33.365 37.207 10.652  1.00 22.98  ? 109 VAL A CG2   1 
ATOM   986  N N     . ALA B 2 109 ? 34.161 32.729 9.128   1.00 25.60  ? 110 ALA A N     1 
ATOM   987  C CA    . ALA B 2 109 ? 34.154 31.667 8.122   1.00 25.40  ? 110 ALA A CA    1 
ATOM   988  C C     . ALA B 2 109 ? 32.800 30.996 7.930   1.00 25.66  ? 110 ALA A C     1 
ATOM   989  O O     . ALA B 2 109 ? 31.975 30.951 8.841   1.00 29.46  ? 110 ALA A O     1 
ATOM   990  C CB    . ALA B 2 109 ? 35.214 30.627 8.455   1.00 24.29  ? 110 ALA A CB    1 
ATOM   991  N N     . GLU B 2 110 ? 32.597 30.449 6.737   1.00 25.20  ? 111 GLU A N     1 
ATOM   992  C CA    . GLU B 2 110 ? 31.356 29.778 6.381   1.00 25.81  ? 111 GLU A CA    1 
ATOM   993  C C     . GLU B 2 110 ? 31.664 28.726 5.306   1.00 26.17  ? 111 GLU A C     1 
ATOM   994  O O     . GLU B 2 110 ? 32.566 28.911 4.489   1.00 24.86  ? 111 GLU A O     1 
ATOM   995  C CB    . GLU B 2 110 ? 30.356 30.811 5.844   1.00 28.46  ? 111 GLU A CB    1 
ATOM   996  C CG    . GLU B 2 110 ? 28.933 30.306 5.635   1.00 37.36  ? 111 GLU A CG    1 
ATOM   997  C CD    . GLU B 2 110 ? 27.988 30.672 6.776   1.00 41.87  ? 111 GLU A CD    1 
ATOM   998  O OE1   . GLU B 2 110 ? 27.761 31.880 7.007   1.00 42.80  ? 111 GLU A OE1   1 
ATOM   999  O OE2   . GLU B 2 110 ? 27.448 29.751 7.425   1.00 44.09  ? 111 GLU A OE2   1 
ATOM   1000 N N     . ALA B 2 111 ? 30.938 27.612 5.338   1.00 25.39  ? 112 ALA A N     1 
ATOM   1001 C CA    . ALA B 2 111 ? 31.116 26.532 4.369   1.00 26.43  ? 112 ALA A CA    1 
ATOM   1002 C C     . ALA B 2 111 ? 29.752 26.031 3.899   1.00 27.75  ? 112 ALA A C     1 
ATOM   1003 O O     . ALA B 2 111 ? 28.920 25.621 4.709   1.00 29.30  ? 112 ALA A O     1 
ATOM   1004 C CB    . ALA B 2 111 ? 31.912 25.396 4.983   1.00 23.33  ? 112 ALA A CB    1 
ATOM   1005 N N     . LYS B 2 112 ? 29.525 26.081 2.589   1.00 27.44  ? 113 LYS A N     1 
ATOM   1006 C CA    . LYS B 2 112 ? 28.256 25.650 2.010   1.00 27.63  ? 113 LYS A CA    1 
ATOM   1007 C C     . LYS B 2 112 ? 28.444 24.476 1.058   1.00 27.74  ? 113 LYS A C     1 
ATOM   1008 O O     . LYS B 2 112 ? 29.517 24.301 0.479   1.00 25.36  ? 113 LYS A O     1 
ATOM   1009 C CB    . LYS B 2 112 ? 27.610 26.808 1.250   1.00 28.90  ? 113 LYS A CB    1 
ATOM   1010 C CG    . LYS B 2 112 ? 27.391 28.080 2.059   1.00 34.17  ? 113 LYS A CG    1 
ATOM   1011 C CD    . LYS B 2 112 ? 26.301 27.916 3.104   1.00 35.64  ? 113 LYS A CD    1 
ATOM   1012 C CE    . LYS B 2 112 ? 25.923 29.266 3.681   1.00 38.40  ? 113 LYS A CE    1 
ATOM   1013 N NZ    . LYS B 2 112 ? 24.827 29.163 4.672   1.00 41.57  ? 113 LYS A NZ    1 
ATOM   1014 N N     . HIS B 2 113 ? 27.388 23.685 0.890   1.00 27.85  ? 114 HIS A N     1 
ATOM   1015 C CA    . HIS B 2 113 ? 27.419 22.528 0.002   1.00 32.87  ? 114 HIS A CA    1 
ATOM   1016 C C     . HIS B 2 113 ? 26.165 22.508 -0.869  1.00 30.48  ? 114 HIS A C     1 
ATOM   1017 O O     . HIS B 2 113 ? 25.081 22.858 -0.410  1.00 29.33  ? 114 HIS A O     1 
ATOM   1018 C CB    . HIS B 2 113 ? 27.474 21.221 0.810   1.00 42.00  ? 114 HIS A CB    1 
ATOM   1019 C CG    . HIS B 2 113 ? 28.480 21.223 1.923   1.00 54.84  ? 114 HIS A CG    1 
ATOM   1020 N ND1   . HIS B 2 113 ? 29.813 21.522 1.729   1.00 60.97  ? 114 HIS A ND1   1 
ATOM   1021 C CD2   . HIS B 2 113 ? 28.344 20.965 3.245   1.00 57.39  ? 114 HIS A CD2   1 
ATOM   1022 C CE1   . HIS B 2 113 ? 30.453 21.448 2.883   1.00 60.60  ? 114 HIS A CE1   1 
ATOM   1023 N NE2   . HIS B 2 113 ? 29.583 21.113 3.819   1.00 59.21  ? 114 HIS A NE2   1 
ATOM   1024 N N     . GLN B 2 114 ? 26.320 22.121 -2.132  1.00 29.39  ? 115 GLN A N     1 
ATOM   1025 C CA    . GLN B 2 114 ? 25.186 22.025 -3.046  1.00 27.14  ? 115 GLN A CA    1 
ATOM   1026 C C     . GLN B 2 114 ? 25.549 21.230 -4.292  1.00 26.53  ? 115 GLN A C     1 
ATOM   1027 O O     . GLN B 2 114 ? 26.589 21.457 -4.907  1.00 26.83  ? 115 GLN A O     1 
ATOM   1028 C CB    . GLN B 2 114 ? 24.658 23.406 -3.444  1.00 26.21  ? 115 GLN A CB    1 
ATOM   1029 C CG    . GLN B 2 114 ? 23.303 23.336 -4.145  1.00 25.19  ? 115 GLN A CG    1 
ATOM   1030 C CD    . GLN B 2 114 ? 22.733 24.690 -4.493  1.00 26.05  ? 115 GLN A CD    1 
ATOM   1031 O OE1   . GLN B 2 114 ? 22.362 25.459 -3.610  1.00 26.02  ? 115 GLN A OE1   1 
ATOM   1032 N NE2   . GLN B 2 114 ? 22.637 24.982 -5.787  1.00 21.33  ? 115 GLN A NE2   1 
ATOM   1033 N N     . GLY B 2 115 ? 24.678 20.298 -4.657  1.00 26.27  ? 116 GLY A N     1 
ATOM   1034 C CA    . GLY B 2 115 ? 24.915 19.475 -5.826  1.00 30.27  ? 116 GLY A CA    1 
ATOM   1035 C C     . GLY B 2 115 ? 25.429 18.099 -5.452  1.00 33.33  ? 116 GLY A C     1 
ATOM   1036 O O     . GLY B 2 115 ? 26.583 17.943 -5.047  1.00 34.51  ? 116 GLY A O     1 
ATOM   1037 N N     . LYS B 2 116 ? 24.568 17.099 -5.588  1.00 34.94  ? 117 LYS A N     1 
ATOM   1038 C CA    . LYS B 2 116 ? 24.929 15.726 -5.265  1.00 39.74  ? 117 LYS A CA    1 
ATOM   1039 C C     . LYS B 2 116 ? 24.917 14.829 -6.501  1.00 41.34  ? 117 LYS A C     1 
ATOM   1040 O O     . LYS B 2 116 ? 24.618 13.637 -6.419  1.00 43.36  ? 117 LYS A O     1 
ATOM   1041 C CB    . LYS B 2 116 ? 24.001 15.181 -4.171  1.00 41.92  ? 117 LYS A CB    1 
ATOM   1042 C CG    . LYS B 2 116 ? 22.530 15.501 -4.369  1.00 46.34  ? 117 LYS A CG    1 
ATOM   1043 C CD    . LYS B 2 116 ? 21.697 15.036 -3.190  1.00 50.41  ? 117 LYS A CD    1 
ATOM   1044 C CE    . LYS B 2 116 ? 21.756 13.529 -3.036  1.00 56.24  ? 117 LYS A CE    1 
ATOM   1045 N NZ    . LYS B 2 116 ? 20.882 13.060 -1.929  1.00 63.24  ? 117 LYS A NZ    1 
ATOM   1046 N N     . ASP B 2 117 ? 25.288 15.408 -7.640  1.00 41.62  ? 118 ASP A N     1 
ATOM   1047 C CA    . ASP B 2 117 ? 25.320 14.686 -8.907  1.00 42.19  ? 118 ASP A CA    1 
ATOM   1048 C C     . ASP B 2 117 ? 26.473 13.701 -8.995  1.00 42.30  ? 118 ASP A C     1 
ATOM   1049 O O     . ASP B 2 117 ? 26.307 12.600 -9.515  1.00 41.34  ? 118 ASP A O     1 
ATOM   1050 C CB    . ASP B 2 117 ? 25.379 15.667 -10.074 1.00 43.43  ? 118 ASP A CB    1 
ATOM   1051 C CG    . ASP B 2 117 ? 24.188 16.597 -10.102 1.00 44.66  ? 118 ASP A CG    1 
ATOM   1052 O OD1   . ASP B 2 117 ? 23.052 16.097 -10.221 1.00 43.80  ? 118 ASP A OD1   1 
ATOM   1053 O OD2   . ASP B 2 117 ? 24.386 17.823 -9.986  1.00 47.98  ? 118 ASP A OD2   1 
ATOM   1054 N N     . ILE B 2 118 ? 27.637 14.096 -8.485  1.00 41.59  ? 119 ILE A N     1 
ATOM   1055 C CA    . ILE B 2 118 ? 28.807 13.225 -8.505  1.00 41.70  ? 119 ILE A CA    1 
ATOM   1056 C C     . ILE B 2 118 ? 28.529 11.968 -7.685  1.00 44.03  ? 119 ILE A C     1 
ATOM   1057 O O     . ILE B 2 118 ? 28.931 10.873 -8.066  1.00 45.39  ? 119 ILE A O     1 
ATOM   1058 C CB    . ILE B 2 118 ? 30.062 13.942 -7.956  1.00 40.34  ? 119 ILE A CB    1 
ATOM   1059 C CG1   . ILE B 2 118 ? 30.420 15.128 -8.850  1.00 37.52  ? 119 ILE A CG1   1 
ATOM   1060 C CG2   . ILE B 2 118 ? 31.241 12.981 -7.891  1.00 39.61  ? 119 ILE A CG2   1 
ATOM   1061 C CD1   . ILE B 2 118 ? 31.583 15.939 -8.343  1.00 35.52  ? 119 ILE A CD1   1 
ATOM   1062 N N     . ILE B 2 119 ? 27.802 12.128 -6.583  1.00 45.41  ? 120 ILE A N     1 
ATOM   1063 C CA    . ILE B 2 119 ? 27.460 11.003 -5.718  1.00 48.77  ? 120 ILE A CA    1 
ATOM   1064 C C     . ILE B 2 119 ? 26.428 10.091 -6.388  1.00 50.34  ? 120 ILE A C     1 
ATOM   1065 O O     . ILE B 2 119 ? 26.492 8.868  -6.255  1.00 49.79  ? 120 ILE A O     1 
ATOM   1066 C CB    . ILE B 2 119 ? 26.915 11.495 -4.353  1.00 50.25  ? 120 ILE A CB    1 
ATOM   1067 C CG1   . ILE B 2 119 ? 27.966 12.368 -3.657  1.00 49.88  ? 120 ILE A CG1   1 
ATOM   1068 C CG2   . ILE B 2 119 ? 26.537 10.309 -3.467  1.00 50.15  ? 120 ILE A CG2   1 
ATOM   1069 C CD1   . ILE B 2 119 ? 27.486 13.017 -2.370  1.00 51.20  ? 120 ILE A CD1   1 
ATOM   1070 N N     . ASN B 2 120 ? 25.490 10.689 -7.117  1.00 52.34  ? 121 ASN A N     1 
ATOM   1071 C CA    . ASN B 2 120 ? 24.455 9.923  -7.805  1.00 54.75  ? 121 ASN A CA    1 
ATOM   1072 C C     . ASN B 2 120 ? 25.010 9.088  -8.954  1.00 56.38  ? 121 ASN A C     1 
ATOM   1073 O O     . ASN B 2 120 ? 24.680 7.910  -9.077  1.00 56.73  ? 121 ASN A O     1 
ATOM   1074 C CB    . ASN B 2 120 ? 23.345 10.843 -8.329  1.00 55.56  ? 121 ASN A CB    1 
ATOM   1075 C CG    . ASN B 2 120 ? 22.512 11.465 -7.215  1.00 57.09  ? 121 ASN A CG    1 
ATOM   1076 O OD1   . ASN B 2 120 ? 21.952 12.549 -7.382  1.00 58.97  ? 121 ASN A OD1   1 
ATOM   1077 N ND2   . ASN B 2 120 ? 22.412 10.776 -6.082  1.00 57.26  ? 121 ASN A ND2   1 
ATOM   1078 N N     . ILE B 2 121 ? 25.851 9.695  -9.792  1.00 58.59  ? 122 ILE A N     1 
ATOM   1079 C CA    . ILE B 2 121 ? 26.426 8.982  -10.930 1.00 60.30  ? 122 ILE A CA    1 
ATOM   1080 C C     . ILE B 2 121 ? 27.566 8.035  -10.564 1.00 62.57  ? 122 ILE A C     1 
ATOM   1081 O O     . ILE B 2 121 ? 27.978 7.220  -11.387 1.00 63.40  ? 122 ILE A O     1 
ATOM   1082 C CB    . ILE B 2 121 ? 26.832 9.932  -12.089 1.00 58.16  ? 122 ILE A CB    1 
ATOM   1083 C CG1   . ILE B 2 121 ? 27.861 10.957 -11.628 1.00 60.51  ? 122 ILE A CG1   1 
ATOM   1084 C CG2   . ILE B 2 121 ? 25.603 10.641 -12.637 1.00 57.50  ? 122 ILE A CG2   1 
ATOM   1085 C CD1   . ILE B 2 121 ? 28.185 12.000 -12.682 1.00 61.41  ? 122 ILE A CD1   1 
ATOM   1086 N N     . ARG B 2 122 ? 28.080 8.147  -9.339  1.00 65.15  ? 123 ARG A N     1 
ATOM   1087 C CA    . ARG B 2 122 ? 29.132 7.243  -8.864  1.00 67.93  ? 123 ARG A CA    1 
ATOM   1088 C C     . ARG B 2 122 ? 28.439 5.900  -8.665  1.00 69.35  ? 123 ARG A C     1 
ATOM   1089 O O     . ARG B 2 122 ? 29.063 4.840  -8.718  1.00 70.08  ? 123 ARG A O     1 
ATOM   1090 C CB    . ARG B 2 122 ? 29.719 7.726  -7.535  1.00 70.07  ? 123 ARG A CB    1 
ATOM   1091 C CG    . ARG B 2 122 ? 30.943 8.624  -7.667  1.00 74.25  ? 123 ARG A CG    1 
ATOM   1092 C CD    . ARG B 2 122 ? 32.240 7.827  -7.675  1.00 77.69  ? 123 ARG A CD    1 
ATOM   1093 N NE    . ARG B 2 122 ? 32.291 6.840  -8.750  1.00 83.62  ? 123 ARG A NE    1 
ATOM   1094 C CZ    . ARG B 2 122 ? 32.835 5.631  -8.632  1.00 86.38  ? 123 ARG A CZ    1 
ATOM   1095 N NH1   . ARG B 2 122 ? 33.380 5.247  -7.484  1.00 86.50  ? 123 ARG A NH1   1 
ATOM   1096 N NH2   . ARG B 2 122 ? 32.827 4.797  -9.663  1.00 87.31  ? 123 ARG A NH2   1 
ATOM   1097 N N     . ASN B 2 123 ? 27.134 5.980  -8.417  1.00 70.59  ? 124 ASN A N     1 
ATOM   1098 C CA    . ASN B 2 123 ? 26.277 4.818  -8.239  1.00 71.28  ? 124 ASN A CA    1 
ATOM   1099 C C     . ASN B 2 123 ? 25.397 4.756  -9.487  1.00 72.12  ? 124 ASN A C     1 
ATOM   1100 O O     . ASN B 2 123 ? 25.561 5.556  -10.413 1.00 71.45  ? 124 ASN A O     1 
ATOM   1101 C CB    . ASN B 2 123 ? 25.398 4.991  -6.998  1.00 71.13  ? 124 ASN A CB    1 
ATOM   1102 C CG    . ASN B 2 123 ? 26.197 5.350  -5.760  1.00 73.66  ? 124 ASN A CG    1 
ATOM   1103 O OD1   . ASN B 2 123 ? 25.780 6.191  -4.965  1.00 73.99  ? 124 ASN A OD1   1 
ATOM   1104 N ND2   . ASN B 2 123 ? 27.352 4.715  -5.590  1.00 74.60  ? 124 ASN A ND2   1 
ATOM   1105 N N     . GLY B 2 124 ? 24.468 3.808  -9.517  1.00 73.14  ? 125 GLY A N     1 
ATOM   1106 C CA    . GLY B 2 124 ? 23.586 3.687  -10.664 1.00 73.52  ? 125 GLY A CA    1 
ATOM   1107 C C     . GLY B 2 124 ? 22.246 4.355  -10.424 1.00 72.67  ? 125 GLY A C     1 
ATOM   1108 O O     . GLY B 2 124 ? 21.217 3.880  -10.908 1.00 74.80  ? 125 GLY A O     1 
ATOM   1109 N N     . LEU B 2 125 ? 22.259 5.465  -9.689  1.00 69.91  ? 126 LEU A N     1 
ATOM   1110 C CA    . LEU B 2 125 ? 21.033 6.186  -9.373  1.00 66.75  ? 126 LEU A CA    1 
ATOM   1111 C C     . LEU B 2 125 ? 20.642 7.234  -10.410 1.00 66.04  ? 126 LEU A C     1 
ATOM   1112 O O     . LEU B 2 125 ? 21.445 8.092  -10.786 1.00 65.92  ? 126 LEU A O     1 
ATOM   1113 C CB    . LEU B 2 125 ? 21.136 6.832  -7.989  1.00 64.05  ? 126 LEU A CB    1 
ATOM   1114 C CG    . LEU B 2 125 ? 19.899 7.580  -7.483  1.00 62.30  ? 126 LEU A CG    1 
ATOM   1115 C CD1   . LEU B 2 125 ? 18.716 6.635  -7.366  1.00 61.55  ? 126 LEU A CD1   1 
ATOM   1116 C CD2   . LEU B 2 125 ? 20.197 8.214  -6.142  1.00 60.69  ? 126 LEU A CD2   1 
ATOM   1117 N N     . LEU B 2 126 ? 19.402 7.130  -10.881 1.00 64.36  ? 127 LEU A N     1 
ATOM   1118 C CA    . LEU B 2 126 ? 18.847 8.062  -11.855 1.00 62.01  ? 127 LEU A CA    1 
ATOM   1119 C C     . LEU B 2 126 ? 17.831 8.925  -11.118 1.00 60.57  ? 127 LEU A C     1 
ATOM   1120 O O     . LEU B 2 126 ? 16.949 8.408  -10.429 1.00 60.24  ? 127 LEU A O     1 
ATOM   1121 C CB    . LEU B 2 126 ? 18.158 7.320  -13.008 1.00 61.83  ? 127 LEU A CB    1 
ATOM   1122 C CG    . LEU B 2 126 ? 18.990 6.520  -14.019 1.00 62.37  ? 127 LEU A CG    1 
ATOM   1123 C CD1   . LEU B 2 126 ? 20.080 7.402  -14.602 1.00 60.83  ? 127 LEU A CD1   1 
ATOM   1124 C CD2   . LEU B 2 126 ? 19.594 5.282  -13.371 1.00 63.89  ? 127 LEU A CD2   1 
ATOM   1125 N N     . VAL B 2 127 ? 17.978 10.239 -11.241 1.00 58.74  ? 128 VAL A N     1 
ATOM   1126 C CA    . VAL B 2 127 ? 17.082 11.180 -10.578 1.00 55.48  ? 128 VAL A CA    1 
ATOM   1127 C C     . VAL B 2 127 ? 16.039 11.767 -11.527 1.00 55.21  ? 128 VAL A C     1 
ATOM   1128 O O     . VAL B 2 127 ? 15.997 11.420 -12.706 1.00 54.51  ? 128 VAL A O     1 
ATOM   1129 C CB    . VAL B 2 127 ? 17.880 12.318 -9.909  1.00 53.29  ? 128 VAL A CB    1 
ATOM   1130 C CG1   . VAL B 2 127 ? 18.723 11.765 -8.769  1.00 50.47  ? 128 VAL A CG1   1 
ATOM   1131 C CG2   . VAL B 2 127 ? 18.768 13.011 -10.932 1.00 52.37  ? 128 VAL A CG2   1 
ATOM   1132 N N     . GLY B 2 128 ? 15.196 12.650 -11.002 1.00 56.07  ? 129 GLY A N     1 
ATOM   1133 C CA    . GLY B 2 128 ? 14.161 13.264 -11.813 1.00 57.62  ? 129 GLY A CA    1 
ATOM   1134 C C     . GLY B 2 128 ? 12.784 12.739 -11.463 1.00 59.47  ? 129 GLY A C     1 
ATOM   1135 O O     . GLY B 2 128 ? 12.660 11.690 -10.828 1.00 59.18  ? 129 GLY A O     1 
ATOM   1136 N N     . LYS B 2 129 ? 11.747 13.461 -11.880 1.00 61.35  ? 130 LYS A N     1 
ATOM   1137 C CA    . LYS B 2 129 ? 10.372 13.057 -11.597 1.00 65.21  ? 130 LYS A CA    1 
ATOM   1138 C C     . LYS B 2 129 ? 10.039 11.697 -12.208 1.00 66.20  ? 130 LYS A C     1 
ATOM   1139 O O     . LYS B 2 129 ? 9.222  10.952 -11.668 1.00 65.75  ? 130 LYS A O     1 
ATOM   1140 C CB    . LYS B 2 129 ? 9.371  14.121 -12.076 1.00 67.85  ? 130 LYS A CB    1 
ATOM   1141 C CG    . LYS B 2 129 ? 9.173  14.211 -13.589 1.00 75.06  ? 130 LYS A CG    1 
ATOM   1142 C CD    . LYS B 2 129 ? 10.382 14.798 -14.305 1.00 80.71  ? 130 LYS A CD    1 
ATOM   1143 C CE    . LYS B 2 129 ? 10.191 14.775 -15.816 1.00 82.04  ? 130 LYS A CE    1 
ATOM   1144 N NZ    . LYS B 2 129 ? 11.354 15.366 -16.531 1.00 83.17  ? 130 LYS A NZ    1 
ATOM   1145 N N     . ARG B 2 130 ? 10.688 11.376 -13.326 1.00 67.58  ? 131 ARG A N     1 
ATOM   1146 C CA    . ARG B 2 130 ? 10.475 10.106 -14.017 1.00 68.81  ? 131 ARG A CA    1 
ATOM   1147 C C     . ARG B 2 130 ? 11.518 9.057  -13.625 1.00 67.05  ? 131 ARG A C     1 
ATOM   1148 O O     . ARG B 2 130 ? 11.337 7.865  -13.883 1.00 66.46  ? 131 ARG A O     1 
ATOM   1149 C CB    . ARG B 2 130 ? 10.500 10.318 -15.534 1.00 73.18  ? 131 ARG A CB    1 
ATOM   1150 C CG    . ARG B 2 130 ? 9.279  11.031 -16.101 1.00 78.30  ? 131 ARG A CG    1 
ATOM   1151 C CD    . ARG B 2 130 ? 9.464  11.350 -17.582 1.00 85.22  ? 131 ARG A CD    1 
ATOM   1152 N NE    . ARG B 2 130 ? 9.848  10.175 -18.366 1.00 90.62  ? 131 ARG A NE    1 
ATOM   1153 C CZ    . ARG B 2 130 ? 10.054 10.179 -19.681 1.00 92.70  ? 131 ARG A CZ    1 
ATOM   1154 N NH1   . ARG B 2 130 ? 9.913  11.298 -20.381 1.00 94.29  ? 131 ARG A NH1   1 
ATOM   1155 N NH2   . ARG B 2 130 ? 10.422 9.063  -20.298 1.00 93.10  ? 131 ARG A NH2   1 
ATOM   1156 N N     . GLY B 2 131 ? 12.605 9.509  -13.002 1.00 64.95  ? 132 GLY A N     1 
ATOM   1157 C CA    . GLY B 2 131 ? 13.666 8.606  -12.587 1.00 62.27  ? 132 GLY A CA    1 
ATOM   1158 C C     . GLY B 2 131 ? 14.464 8.088  -13.767 1.00 60.35  ? 132 GLY A C     1 
ATOM   1159 O O     . GLY B 2 131 ? 14.709 6.887  -13.879 1.00 61.75  ? 132 GLY A O     1 
ATOM   1160 N N     . ASP B 2 132 ? 14.909 9.004  -14.623 1.00 57.90  ? 133 ASP A N     1 
ATOM   1161 C CA    . ASP B 2 132 ? 15.664 8.638  -15.816 1.00 56.50  ? 133 ASP A CA    1 
ATOM   1162 C C     . ASP B 2 132 ? 16.781 9.613  -16.187 1.00 54.40  ? 133 ASP A C     1 
ATOM   1163 O O     . ASP B 2 132 ? 17.479 9.418  -17.184 1.00 54.52  ? 133 ASP A O     1 
ATOM   1164 C CB    . ASP B 2 132 ? 14.705 8.472  -17.004 1.00 58.71  ? 133 ASP A CB    1 
ATOM   1165 C CG    . ASP B 2 132 ? 13.797 9.686  -17.216 1.00 60.68  ? 133 ASP A CG    1 
ATOM   1166 O OD1   . ASP B 2 132 ? 13.825 10.641 -16.405 1.00 60.80  ? 133 ASP A OD1   1 
ATOM   1167 O OD2   . ASP B 2 132 ? 13.040 9.679  -18.208 1.00 62.47  ? 133 ASP A OD2   1 
ATOM   1168 N N     . GLN B 2 133 ? 16.948 10.658 -15.383 1.00 51.17  ? 134 GLN A N     1 
ATOM   1169 C CA    . GLN B 2 133 ? 17.973 11.669 -15.631 1.00 48.53  ? 134 GLN A CA    1 
ATOM   1170 C C     . GLN B 2 133 ? 19.265 11.358 -14.884 1.00 46.68  ? 134 GLN A C     1 
ATOM   1171 O O     . GLN B 2 133 ? 19.236 10.883 -13.751 1.00 46.63  ? 134 GLN A O     1 
ATOM   1172 C CB    . GLN B 2 133 ? 17.474 13.042 -15.184 1.00 48.55  ? 134 GLN A CB    1 
ATOM   1173 C CG    . GLN B 2 133 ? 16.131 13.456 -15.759 1.00 49.42  ? 134 GLN A CG    1 
ATOM   1174 C CD    . GLN B 2 133 ? 15.536 14.649 -15.035 1.00 49.99  ? 134 GLN A CD    1 
ATOM   1175 O OE1   . GLN B 2 133 ? 14.319 14.754 -14.884 1.00 49.64  ? 134 GLN A OE1   1 
ATOM   1176 N NE2   . GLN B 2 133 ? 16.395 15.552 -14.572 1.00 50.48  ? 134 GLN A NE2   1 
ATOM   1177 N N     . ASP B 2 134 ? 20.396 11.631 -15.522 1.00 46.63  ? 135 ASP A N     1 
ATOM   1178 C CA    . ASP B 2 134 ? 21.692 11.405 -14.891 1.00 49.02  ? 135 ASP A CA    1 
ATOM   1179 C C     . ASP B 2 134 ? 21.995 12.562 -13.948 1.00 47.02  ? 135 ASP A C     1 
ATOM   1180 O O     . ASP B 2 134 ? 22.640 12.384 -12.917 1.00 45.64  ? 135 ASP A O     1 
ATOM   1181 C CB    . ASP B 2 134 ? 22.803 11.311 -15.943 1.00 55.91  ? 135 ASP A CB    1 
ATOM   1182 C CG    . ASP B 2 134 ? 22.718 10.048 -16.774 1.00 61.10  ? 135 ASP A CG    1 
ATOM   1183 O OD1   . ASP B 2 134 ? 22.875 8.949  -16.202 1.00 64.24  ? 135 ASP A OD1   1 
ATOM   1184 O OD2   . ASP B 2 134 ? 22.502 10.155 -18.000 1.00 65.52  ? 135 ASP A OD2   1 
ATOM   1185 N N     . LEU B 2 135 ? 21.514 13.747 -14.315 1.00 44.06  ? 136 LEU A N     1 
ATOM   1186 C CA    . LEU B 2 135 ? 21.732 14.955 -13.531 1.00 39.99  ? 136 LEU A CA    1 
ATOM   1187 C C     . LEU B 2 135 ? 20.446 15.569 -13.000 1.00 38.34  ? 136 LEU A C     1 
ATOM   1188 O O     . LEU B 2 135 ? 19.362 15.369 -13.549 1.00 38.65  ? 136 LEU A O     1 
ATOM   1189 C CB    . LEU B 2 135 ? 22.467 16.001 -14.372 1.00 38.97  ? 136 LEU A CB    1 
ATOM   1190 C CG    . LEU B 2 135 ? 23.833 15.617 -14.937 1.00 38.88  ? 136 LEU A CG    1 
ATOM   1191 C CD1   . LEU B 2 135 ? 24.323 16.702 -15.882 1.00 41.44  ? 136 LEU A CD1   1 
ATOM   1192 C CD2   . LEU B 2 135 ? 24.818 15.397 -13.807 1.00 39.76  ? 136 LEU A CD2   1 
ATOM   1193 N N     . MET B 2 136 ? 20.590 16.325 -11.920 1.00 37.15  ? 137 MET A N     1 
ATOM   1194 C CA    . MET B 2 136 ? 19.483 17.017 -11.281 1.00 34.90  ? 137 MET A CA    1 
ATOM   1195 C C     . MET B 2 136 ? 19.647 18.499 -11.598 1.00 34.97  ? 137 MET A C     1 
ATOM   1196 O O     . MET B 2 136 ? 20.760 19.028 -11.532 1.00 35.06  ? 137 MET A O     1 
ATOM   1197 C CB    . MET B 2 136 ? 19.542 16.798 -9.765  1.00 34.17  ? 137 MET A CB    1 
ATOM   1198 C CG    . MET B 2 136 ? 18.607 17.674 -8.940  1.00 30.60  ? 137 MET A CG    1 
ATOM   1199 S SD    . MET B 2 136 ? 16.867 17.375 -9.256  1.00 35.23  ? 137 MET A SD    1 
ATOM   1200 C CE    . MET B 2 136 ? 16.671 15.768 -8.543  1.00 32.43  ? 137 MET A CE    1 
ATOM   1201 N N     . ALA B 2 137 ? 18.556 19.151 -11.995 1.00 32.86  ? 138 ALA A N     1 
ATOM   1202 C CA    . ALA B 2 137 ? 18.597 20.581 -12.296 1.00 32.06  ? 138 ALA A CA    1 
ATOM   1203 C C     . ALA B 2 137 ? 18.986 21.299 -11.001 1.00 31.06  ? 138 ALA A C     1 
ATOM   1204 O O     . ALA B 2 137 ? 18.312 21.153 -9.983  1.00 29.79  ? 138 ALA A O     1 
ATOM   1205 C CB    . ALA B 2 137 ? 17.234 21.057 -12.782 1.00 30.99  ? 138 ALA A CB    1 
ATOM   1206 N N     . ALA B 2 138 ? 20.089 22.041 -11.042 1.00 28.99  ? 139 ALA A N     1 
ATOM   1207 C CA    . ALA B 2 138 ? 20.594 22.752 -9.871  1.00 27.81  ? 139 ALA A CA    1 
ATOM   1208 C C     . ALA B 2 138 ? 19.646 23.790 -9.269  1.00 29.65  ? 139 ALA A C     1 
ATOM   1209 O O     . ALA B 2 138 ? 19.041 24.592 -9.988  1.00 30.94  ? 139 ALA A O     1 
ATOM   1210 C CB    . ALA B 2 138 ? 21.934 23.383 -10.188 1.00 26.83  ? 139 ALA A CB    1 
ATOM   1211 N N     . GLY B 2 139 ? 19.543 23.769 -7.939  1.00 28.14  ? 140 GLY A N     1 
ATOM   1212 C CA    . GLY B 2 139 ? 18.682 24.693 -7.220  1.00 21.26  ? 140 GLY A CA    1 
ATOM   1213 C C     . GLY B 2 139 ? 19.333 26.038 -6.963  1.00 22.00  ? 140 GLY A C     1 
ATOM   1214 O O     . GLY B 2 139 ? 20.388 26.336 -7.521  1.00 20.54  ? 140 GLY A O     1 
ATOM   1215 N N     . ASN B 2 140 ? 18.745 26.823 -6.063  1.00 21.53  ? 141 ASN A N     1 
ATOM   1216 C CA    . ASN B 2 140 ? 19.255 28.159 -5.759  1.00 22.72  ? 141 ASN A CA    1 
ATOM   1217 C C     . ASN B 2 140 ? 19.402 28.501 -4.270  1.00 23.21  ? 141 ASN A C     1 
ATOM   1218 O O     . ASN B 2 140 ? 19.609 29.663 -3.921  1.00 23.54  ? 141 ASN A O     1 
ATOM   1219 C CB    . ASN B 2 140 ? 18.348 29.194 -6.421  1.00 21.61  ? 141 ASN A CB    1 
ATOM   1220 C CG    . ASN B 2 140 ? 16.897 29.016 -6.036  1.00 22.62  ? 141 ASN A CG    1 
ATOM   1221 O OD1   . ASN B 2 140 ? 16.552 28.074 -5.332  1.00 24.80  ? 141 ASN A OD1   1 
ATOM   1222 N ND2   . ASN B 2 140 ? 16.040 29.921 -6.489  1.00 20.68  ? 141 ASN A ND2   1 
ATOM   1223 N N     . ALA B 2 141 ? 19.323 27.498 -3.398  1.00 20.52  ? 142 ALA A N     1 
ATOM   1224 C CA    . ALA B 2 141 ? 19.438 27.727 -1.956  1.00 23.30  ? 142 ALA A CA    1 
ATOM   1225 C C     . ALA B 2 141 ? 20.764 28.359 -1.528  1.00 23.10  ? 142 ALA A C     1 
ATOM   1226 O O     . ALA B 2 141 ? 20.877 28.890 -0.425  1.00 24.92  ? 142 ALA A O     1 
ATOM   1227 C CB    . ALA B 2 141 ? 19.209 26.430 -1.200  1.00 21.94  ? 142 ALA A CB    1 
ATOM   1228 N N     . ILE B 2 142 ? 21.767 28.295 -2.397  1.00 23.76  ? 143 ILE A N     1 
ATOM   1229 C CA    . ILE B 2 142 ? 23.078 28.865 -2.111  1.00 22.96  ? 143 ILE A CA    1 
ATOM   1230 C C     . ILE B 2 142 ? 23.017 30.400 -2.055  1.00 24.68  ? 143 ILE A C     1 
ATOM   1231 O O     . ILE B 2 142 ? 23.919 31.050 -1.520  1.00 25.74  ? 143 ILE A O     1 
ATOM   1232 C CB    . ILE B 2 142 ? 24.117 28.413 -3.181  1.00 24.19  ? 143 ILE A CB    1 
ATOM   1233 C CG1   . ILE B 2 142 ? 25.525 28.863 -2.795  1.00 24.33  ? 143 ILE A CG1   1 
ATOM   1234 C CG2   . ILE B 2 142 ? 23.744 28.945 -4.557  1.00 20.08  ? 143 ILE A CG2   1 
ATOM   1235 C CD1   . ILE B 2 142 ? 26.070 28.163 -1.585  1.00 22.93  ? 143 ILE A CD1   1 
ATOM   1236 N N     . GLU B 2 143 ? 21.941 30.972 -2.590  1.00 22.33  ? 144 GLU A N     1 
ATOM   1237 C CA    . GLU B 2 143 ? 21.764 32.421 -2.608  1.00 20.70  ? 144 GLU A CA    1 
ATOM   1238 C C     . GLU B 2 143 ? 21.567 33.017 -1.213  1.00 19.06  ? 144 GLU A C     1 
ATOM   1239 O O     . GLU B 2 143 ? 21.778 34.214 -1.015  1.00 19.01  ? 144 GLU A O     1 
ATOM   1240 C CB    . GLU B 2 143 ? 20.598 32.801 -3.524  1.00 20.96  ? 144 GLU A CB    1 
ATOM   1241 C CG    . GLU B 2 143 ? 20.785 32.369 -4.978  1.00 24.52  ? 144 GLU A CG    1 
ATOM   1242 C CD    . GLU B 2 143 ? 19.580 32.664 -5.861  1.00 28.87  ? 144 GLU A CD    1 
ATOM   1243 O OE1   . GLU B 2 143 ? 18.519 33.078 -5.346  1.00 31.85  ? 144 GLU A OE1   1 
ATOM   1244 O OE2   . GLU B 2 143 ? 19.693 32.477 -7.089  1.00 34.69  ? 144 GLU A OE2   1 
ATOM   1245 N N     . ARG B 2 144 ? 21.170 32.185 -0.253  1.00 18.65  ? 145 ARG A N     1 
ATOM   1246 C CA    . ARG B 2 144 ? 20.966 32.632 1.127   1.00 20.59  ? 145 ARG A CA    1 
ATOM   1247 C C     . ARG B 2 144 ? 22.264 33.162 1.733   1.00 22.69  ? 145 ARG A C     1 
ATOM   1248 O O     . ARG B 2 144 ? 22.239 33.949 2.679   1.00 23.20  ? 145 ARG A O     1 
ATOM   1249 C CB    . ARG B 2 144 ? 20.480 31.483 2.013   1.00 20.56  ? 145 ARG A CB    1 
ATOM   1250 C CG    . ARG B 2 144 ? 19.099 30.944 1.703   1.00 22.46  ? 145 ARG A CG    1 
ATOM   1251 C CD    . ARG B 2 144 ? 18.615 30.028 2.830   1.00 23.35  ? 145 ARG A CD    1 
ATOM   1252 N NE    . ARG B 2 144 ? 19.517 28.902 3.074   1.00 25.14  ? 145 ARG A NE    1 
ATOM   1253 C CZ    . ARG B 2 144 ? 20.296 28.777 4.145   1.00 26.04  ? 145 ARG A CZ    1 
ATOM   1254 N NH1   . ARG B 2 144 ? 20.298 29.708 5.091   1.00 24.07  ? 145 ARG A NH1   1 
ATOM   1255 N NH2   . ARG B 2 144 ? 21.085 27.719 4.268   1.00 24.69  ? 145 ARG A NH2   1 
ATOM   1256 N N     . SER B 2 145 ? 23.392 32.709 1.189   1.00 22.60  ? 146 SER A N     1 
ATOM   1257 C CA    . SER B 2 145 ? 24.716 33.101 1.661   1.00 20.79  ? 146 SER A CA    1 
ATOM   1258 C C     . SER B 2 145 ? 24.898 34.604 1.770   1.00 22.15  ? 146 SER A C     1 
ATOM   1259 O O     . SER B 2 145 ? 25.631 35.083 2.632   1.00 24.06  ? 146 SER A O     1 
ATOM   1260 C CB    . SER B 2 145 ? 25.789 32.534 0.734   1.00 24.29  ? 146 SER A CB    1 
ATOM   1261 O OG    . SER B 2 145 ? 25.689 31.125 0.646   1.00 27.51  ? 146 SER A OG    1 
ATOM   1262 N N     . HIS B 2 146 ? 24.224 35.341 0.894   1.00 21.66  ? 147 HIS A N     1 
ATOM   1263 C CA    . HIS B 2 146 ? 24.310 36.794 0.874   1.00 24.52  ? 147 HIS A CA    1 
ATOM   1264 C C     . HIS B 2 146 ? 23.804 37.488 2.140   1.00 24.69  ? 147 HIS A C     1 
ATOM   1265 O O     . HIS B 2 146 ? 24.252 38.590 2.451   1.00 26.00  ? 147 HIS A O     1 
ATOM   1266 C CB    . HIS B 2 146 ? 23.584 37.351 -0.350  1.00 26.57  ? 147 HIS A CB    1 
ATOM   1267 C CG    . HIS B 2 146 ? 24.207 36.957 -1.653  1.00 31.38  ? 147 HIS A CG    1 
ATOM   1268 N ND1   . HIS B 2 146 ? 25.027 37.800 -2.370  1.00 32.36  ? 147 HIS A ND1   1 
ATOM   1269 C CD2   . HIS B 2 146 ? 24.133 35.809 -2.367  1.00 30.98  ? 147 HIS A CD2   1 
ATOM   1270 C CE1   . HIS B 2 146 ? 25.435 37.190 -3.468  1.00 28.51  ? 147 HIS A CE1   1 
ATOM   1271 N NE2   . HIS B 2 146 ? 24.906 35.980 -3.490  1.00 28.23  ? 147 HIS A NE2   1 
ATOM   1272 N N     . LYS B 2 147 ? 22.894 36.852 2.877   1.00 21.93  ? 148 LYS A N     1 
ATOM   1273 C CA    . LYS B 2 147 ? 22.367 37.468 4.097   1.00 23.05  ? 148 LYS A CA    1 
ATOM   1274 C C     . LYS B 2 147 ? 23.439 37.709 5.157   1.00 22.23  ? 148 LYS A C     1 
ATOM   1275 O O     . LYS B 2 147 ? 23.596 38.828 5.633   1.00 22.06  ? 148 LYS A O     1 
ATOM   1276 C CB    . LYS B 2 147 ? 21.233 36.644 4.710   1.00 21.92  ? 148 LYS A CB    1 
ATOM   1277 C CG    . LYS B 2 147 ? 20.491 37.408 5.797   1.00 25.18  ? 148 LYS A CG    1 
ATOM   1278 C CD    . LYS B 2 147 ? 19.939 36.496 6.869   1.00 28.29  ? 148 LYS A CD    1 
ATOM   1279 C CE    . LYS B 2 147 ? 21.048 35.881 7.685   1.00 29.21  ? 148 LYS A CE    1 
ATOM   1280 N NZ    . LYS B 2 147 ? 20.534 34.922 8.699   1.00 28.57  ? 148 LYS A NZ    1 
ATOM   1281 N N     . ASN B 2 148 ? 24.153 36.656 5.546   1.00 22.74  ? 149 ASN A N     1 
ATOM   1282 C CA    . ASN B 2 148 ? 25.205 36.783 6.552   1.00 21.88  ? 149 ASN A CA    1 
ATOM   1283 C C     . ASN B 2 148 ? 26.328 37.701 6.098   1.00 23.77  ? 149 ASN A C     1 
ATOM   1284 O O     . ASN B 2 148 ? 26.936 38.396 6.912   1.00 22.59  ? 149 ASN A O     1 
ATOM   1285 C CB    . ASN B 2 148 ? 25.764 35.414 6.934   1.00 25.90  ? 149 ASN A CB    1 
ATOM   1286 C CG    . ASN B 2 148 ? 24.839 34.644 7.856   1.00 29.20  ? 149 ASN A CG    1 
ATOM   1287 O OD1   . ASN B 2 148 ? 23.864 35.188 8.371   1.00 31.98  ? 149 ASN A OD1   1 
ATOM   1288 N ND2   . ASN B 2 148 ? 25.147 33.372 8.076   1.00 35.02  ? 149 ASN A ND2   1 
ATOM   1289 N N     . ILE B 2 149 ? 26.603 37.699 4.795   1.00 23.43  ? 150 ILE A N     1 
ATOM   1290 C CA    . ILE B 2 149 ? 27.643 38.555 4.232   1.00 21.47  ? 150 ILE A CA    1 
ATOM   1291 C C     . ILE B 2 149 ? 27.225 40.018 4.411   1.00 21.72  ? 150 ILE A C     1 
ATOM   1292 O O     . ILE B 2 149 ? 28.051 40.867 4.740   1.00 24.08  ? 150 ILE A O     1 
ATOM   1293 C CB    . ILE B 2 149 ? 27.886 38.231 2.735   1.00 20.51  ? 150 ILE A CB    1 
ATOM   1294 C CG1   . ILE B 2 149 ? 28.495 36.833 2.604   1.00 20.16  ? 150 ILE A CG1   1 
ATOM   1295 C CG2   . ILE B 2 149 ? 28.792 39.276 2.088   1.00 19.10  ? 150 ILE A CG2   1 
ATOM   1296 C CD1   . ILE B 2 149 ? 28.677 36.362 1.175   1.00 20.58  ? 150 ILE A CD1   1 
ATOM   1297 N N     . SER B 2 150 ? 25.932 40.291 4.254   1.00 20.44  ? 151 SER A N     1 
ATOM   1298 C CA    . SER B 2 150 ? 25.400 41.644 4.408   1.00 22.92  ? 151 SER A CA    1 
ATOM   1299 C C     . SER B 2 150 ? 25.370 42.077 5.879   1.00 23.82  ? 151 SER A C     1 
ATOM   1300 O O     . SER B 2 150 ? 25.609 43.242 6.191   1.00 24.48  ? 151 SER A O     1 
ATOM   1301 C CB    . SER B 2 150 ? 23.992 41.731 3.812   1.00 25.29  ? 151 SER A CB    1 
ATOM   1302 O OG    . SER B 2 150 ? 23.535 43.073 3.777   1.00 31.40  ? 151 SER A OG    1 
ATOM   1303 N N     . GLU B 2 151 ? 25.081 41.131 6.771   1.00 25.15  ? 152 GLU A N     1 
ATOM   1304 C CA    . GLU B 2 151 ? 25.023 41.388 8.210   1.00 26.09  ? 152 GLU A CA    1 
ATOM   1305 C C     . GLU B 2 151 ? 26.400 41.738 8.763   1.00 24.95  ? 152 GLU A C     1 
ATOM   1306 O O     . GLU B 2 151 ? 26.545 42.703 9.513   1.00 26.25  ? 152 GLU A O     1 
ATOM   1307 C CB    . GLU B 2 151 ? 24.489 40.159 8.951   1.00 28.34  ? 152 GLU A CB    1 
ATOM   1308 C CG    . GLU B 2 151 ? 23.047 39.794 8.636   1.00 35.84  ? 152 GLU A CG    1 
ATOM   1309 C CD    . GLU B 2 151 ? 22.031 40.553 9.475   1.00 41.97  ? 152 GLU A CD    1 
ATOM   1310 O OE1   . GLU B 2 151 ? 22.293 41.717 9.844   1.00 44.99  ? 152 GLU A OE1   1 
ATOM   1311 O OE2   . GLU B 2 151 ? 20.958 39.979 9.761   1.00 44.40  ? 152 GLU A OE2   1 
ATOM   1312 N N     . ILE B 2 152 ? 27.405 40.941 8.403   1.00 24.00  ? 153 ILE A N     1 
ATOM   1313 C CA    . ILE B 2 152 ? 28.769 41.175 8.860   1.00 22.96  ? 153 ILE A CA    1 
ATOM   1314 C C     . ILE B 2 152 ? 29.326 42.458 8.257   1.00 23.99  ? 153 ILE A C     1 
ATOM   1315 O O     . ILE B 2 152 ? 30.081 43.178 8.908   1.00 24.73  ? 153 ILE A O     1 
ATOM   1316 C CB    . ILE B 2 152 ? 29.689 39.979 8.532   1.00 24.99  ? 153 ILE A CB    1 
ATOM   1317 C CG1   . ILE B 2 152 ? 29.299 38.775 9.390   1.00 27.79  ? 153 ILE A CG1   1 
ATOM   1318 C CG2   . ILE B 2 152 ? 31.145 40.329 8.809   1.00 27.23  ? 153 ILE A CG2   1 
ATOM   1319 C CD1   . ILE B 2 152 ? 29.548 38.981 10.880  1.00 31.06  ? 153 ILE A CD1   1 
ATOM   1320 N N     . ALA B 2 153 ? 28.921 42.763 7.027   1.00 23.26  ? 154 ALA A N     1 
ATOM   1321 C CA    . ALA B 2 153 ? 29.374 43.976 6.353   1.00 23.93  ? 154 ALA A CA    1 
ATOM   1322 C C     . ALA B 2 153 ? 28.844 45.210 7.067   1.00 22.07  ? 154 ALA A C     1 
ATOM   1323 O O     . ALA B 2 153 ? 29.520 46.233 7.129   1.00 21.42  ? 154 ALA A O     1 
ATOM   1324 C CB    . ALA B 2 153 ? 28.927 43.977 4.899   1.00 24.72  ? 154 ALA A CB    1 
ATOM   1325 N N     . ASN B 2 154 ? 27.622 45.110 7.584   1.00 22.98  ? 155 ASN A N     1 
ATOM   1326 C CA    . ASN B 2 154 ? 26.992 46.207 8.316   1.00 24.13  ? 155 ASN A CA    1 
ATOM   1327 C C     . ASN B 2 154 ? 27.645 46.346 9.691   1.00 24.60  ? 155 ASN A C     1 
ATOM   1328 O O     . ASN B 2 154 ? 27.798 47.450 10.210  1.00 26.77  ? 155 ASN A O     1 
ATOM   1329 C CB    . ASN B 2 154 ? 25.490 45.950 8.478   1.00 24.58  ? 155 ASN A CB    1 
ATOM   1330 C CG    . ASN B 2 154 ? 24.707 46.174 7.193   1.00 25.43  ? 155 ASN A CG    1 
ATOM   1331 O OD1   . ASN B 2 154 ? 25.269 46.524 6.156   1.00 27.24  ? 155 ASN A OD1   1 
ATOM   1332 N ND2   . ASN B 2 154 ? 23.397 45.985 7.264   1.00 20.19  ? 155 ASN A ND2   1 
ATOM   1333 N N     . PHE B 2 155 ? 28.047 45.212 10.258  1.00 26.89  ? 156 PHE A N     1 
ATOM   1334 C CA    . PHE B 2 155 ? 28.699 45.161 11.565  1.00 25.34  ? 156 PHE A CA    1 
ATOM   1335 C C     . PHE B 2 155 ? 30.109 45.751 11.487  1.00 28.21  ? 156 PHE A C     1 
ATOM   1336 O O     . PHE B 2 155 ? 30.604 46.333 12.453  1.00 28.90  ? 156 PHE A O     1 
ATOM   1337 C CB    . PHE B 2 155 ? 28.767 43.703 12.029  1.00 24.10  ? 156 PHE A CB    1 
ATOM   1338 C CG    . PHE B 2 155 ? 29.262 43.518 13.436  1.00 24.76  ? 156 PHE A CG    1 
ATOM   1339 C CD1   . PHE B 2 155 ? 28.723 44.250 14.487  1.00 26.18  ? 156 PHE A CD1   1 
ATOM   1340 C CD2   . PHE B 2 155 ? 30.235 42.565 13.718  1.00 23.56  ? 156 PHE A CD2   1 
ATOM   1341 C CE1   . PHE B 2 155 ? 29.141 44.030 15.797  1.00 23.68  ? 156 PHE A CE1   1 
ATOM   1342 C CE2   . PHE B 2 155 ? 30.658 42.341 15.028  1.00 27.02  ? 156 PHE A CE2   1 
ATOM   1343 C CZ    . PHE B 2 155 ? 30.107 43.075 16.066  1.00 21.24  ? 156 PHE A CZ    1 
ATOM   1344 N N     . MET B 2 156 ? 30.734 45.619 10.319  1.00 26.74  ? 157 MET A N     1 
ATOM   1345 C CA    . MET B 2 156 ? 32.088 46.116 10.097  1.00 26.74  ? 157 MET A CA    1 
ATOM   1346 C C     . MET B 2 156 ? 32.147 47.285 9.117   1.00 26.83  ? 157 MET A C     1 
ATOM   1347 O O     . MET B 2 156 ? 33.174 47.520 8.479   1.00 28.70  ? 157 MET A O     1 
ATOM   1348 C CB    . MET B 2 156 ? 32.970 44.976 9.586   1.00 29.51  ? 157 MET A CB    1 
ATOM   1349 C CG    . MET B 2 156 ? 33.064 43.796 10.530  1.00 27.93  ? 157 MET A CG    1 
ATOM   1350 S SD    . MET B 2 156 ? 34.133 42.523 9.871   1.00 33.09  ? 157 MET A SD    1 
ATOM   1351 C CE    . MET B 2 156 ? 35.751 43.268 10.167  1.00 28.79  ? 157 MET A CE    1 
ATOM   1352 N N     . LEU B 2 157 ? 31.058 48.041 9.030   1.00 26.94  ? 158 LEU A N     1 
ATOM   1353 C CA    . LEU B 2 157 ? 30.972 49.179 8.122   1.00 25.65  ? 158 LEU A CA    1 
ATOM   1354 C C     . LEU B 2 157 ? 31.990 50.276 8.431   1.00 28.17  ? 158 LEU A C     1 
ATOM   1355 O O     . LEU B 2 157 ? 32.359 51.054 7.551   1.00 30.14  ? 158 LEU A O     1 
ATOM   1356 C CB    . LEU B 2 157 ? 29.549 49.740 8.144   1.00 25.58  ? 158 LEU A CB    1 
ATOM   1357 C CG    . LEU B 2 157 ? 29.078 50.603 6.976   1.00 27.95  ? 158 LEU A CG    1 
ATOM   1358 C CD1   . LEU B 2 157 ? 29.346 49.884 5.671   1.00 27.78  ? 158 LEU A CD1   1 
ATOM   1359 C CD2   . LEU B 2 157 ? 27.590 50.900 7.129   1.00 26.87  ? 158 LEU A CD2   1 
ATOM   1360 N N     . SER B 2 158 ? 32.459 50.322 9.675   1.00 28.59  ? 159 SER A N     1 
ATOM   1361 C CA    . SER B 2 158 ? 33.442 51.322 10.092  1.00 30.16  ? 159 SER A CA    1 
ATOM   1362 C C     . SER B 2 158 ? 34.879 50.822 9.940   1.00 31.52  ? 159 SER A C     1 
ATOM   1363 O O     . SER B 2 158 ? 35.829 51.590 10.087  1.00 32.88  ? 159 SER A O     1 
ATOM   1364 C CB    . SER B 2 158 ? 33.195 51.734 11.545  1.00 31.80  ? 159 SER A CB    1 
ATOM   1365 O OG    . SER B 2 158 ? 33.447 50.659 12.434  1.00 34.54  ? 159 SER A OG    1 
ATOM   1366 N N     . GLU B 2 159 ? 35.029 49.528 9.668   1.00 30.46  ? 160 GLU A N     1 
ATOM   1367 C CA    . GLU B 2 159 ? 36.340 48.914 9.503   1.00 29.10  ? 160 GLU A CA    1 
ATOM   1368 C C     . GLU B 2 159 ? 36.888 49.113 8.091   1.00 29.45  ? 160 GLU A C     1 
ATOM   1369 O O     . GLU B 2 159 ? 36.151 49.474 7.171   1.00 27.54  ? 160 GLU A O     1 
ATOM   1370 C CB    . GLU B 2 159 ? 36.260 47.420 9.812   1.00 27.66  ? 160 GLU A CB    1 
ATOM   1371 C CG    . GLU B 2 159 ? 35.746 47.086 11.203  1.00 36.01  ? 160 GLU A CG    1 
ATOM   1372 C CD    . GLU B 2 159 ? 36.728 47.424 12.318  1.00 45.29  ? 160 GLU A CD    1 
ATOM   1373 O OE1   . GLU B 2 159 ? 37.938 47.576 12.043  1.00 46.13  ? 160 GLU A OE1   1 
ATOM   1374 O OE2   . GLU B 2 159 ? 36.283 47.526 13.483  1.00 51.09  ? 160 GLU A OE2   1 
ATOM   1375 N N     . SER B 2 160 ? 38.193 48.897 7.939   1.00 28.00  ? 161 SER A N     1 
ATOM   1376 C CA    . SER B 2 160 ? 38.862 49.032 6.650   1.00 26.50  ? 161 SER A CA    1 
ATOM   1377 C C     . SER B 2 160 ? 39.151 47.668 6.028   1.00 27.99  ? 161 SER A C     1 
ATOM   1378 O O     . SER B 2 160 ? 39.720 47.577 4.936   1.00 29.05  ? 161 SER A O     1 
ATOM   1379 C CB    . SER B 2 160 ? 40.154 49.827 6.804   1.00 23.76  ? 161 SER A CB    1 
ATOM   1380 O OG    . SER B 2 160 ? 39.872 51.193 7.028   1.00 27.64  ? 161 SER A OG    1 
ATOM   1381 N N     . HIS B 2 161 ? 38.759 46.612 6.734   1.00 27.70  ? 162 HIS A N     1 
ATOM   1382 C CA    . HIS B 2 161 ? 38.944 45.249 6.259   1.00 26.06  ? 162 HIS A CA    1 
ATOM   1383 C C     . HIS B 2 161 ? 37.644 44.448 6.410   1.00 24.14  ? 162 HIS A C     1 
ATOM   1384 O O     . HIS B 2 161 ? 36.780 44.790 7.216   1.00 23.53  ? 162 HIS A O     1 
ATOM   1385 C CB    . HIS B 2 161 ? 40.100 44.571 7.003   1.00 26.54  ? 162 HIS A CB    1 
ATOM   1386 C CG    . HIS B 2 161 ? 39.839 44.343 8.459   1.00 27.49  ? 162 HIS A CG    1 
ATOM   1387 N ND1   . HIS B 2 161 ? 39.641 45.373 9.352   1.00 28.19  ? 162 HIS A ND1   1 
ATOM   1388 C CD2   . HIS B 2 161 ? 39.748 43.200 9.179   1.00 28.52  ? 162 HIS A CD2   1 
ATOM   1389 C CE1   . HIS B 2 161 ? 39.441 44.875 10.559  1.00 27.17  ? 162 HIS A CE1   1 
ATOM   1390 N NE2   . HIS B 2 161 ? 39.501 43.558 10.481  1.00 27.45  ? 162 HIS A NE2   1 
ATOM   1391 N N     . PHE B 2 162 ? 37.503 43.401 5.604   1.00 23.54  ? 163 PHE A N     1 
ATOM   1392 C CA    . PHE B 2 162 ? 36.319 42.546 5.619   1.00 23.80  ? 163 PHE A CA    1 
ATOM   1393 C C     . PHE B 2 162 ? 36.808 41.106 5.442   1.00 23.29  ? 163 PHE A C     1 
ATOM   1394 O O     . PHE B 2 162 ? 36.896 40.600 4.322   1.00 22.97  ? 163 PHE A O     1 
ATOM   1395 C CB    . PHE B 2 162 ? 35.380 42.953 4.474   1.00 24.26  ? 163 PHE A CB    1 
ATOM   1396 C CG    . PHE B 2 162 ? 34.058 42.230 4.472   1.00 26.31  ? 163 PHE A CG    1 
ATOM   1397 C CD1   . PHE B 2 162 ? 33.230 42.255 5.592   1.00 26.54  ? 163 PHE A CD1   1 
ATOM   1398 C CD2   . PHE B 2 162 ? 33.632 41.539 3.339   1.00 24.24  ? 163 PHE A CD2   1 
ATOM   1399 C CE1   . PHE B 2 162 ? 31.996 41.604 5.581   1.00 26.39  ? 163 PHE A CE1   1 
ATOM   1400 C CE2   . PHE B 2 162 ? 32.404 40.888 3.319   1.00 23.78  ? 163 PHE A CE2   1 
ATOM   1401 C CZ    . PHE B 2 162 ? 31.583 40.920 4.443   1.00 24.98  ? 163 PHE A CZ    1 
ATOM   1402 N N     . PRO B 2 163 ? 37.137 40.431 6.556   1.00 22.95  ? 164 PRO A N     1 
ATOM   1403 C CA    . PRO B 2 163 ? 37.633 39.055 6.593   1.00 22.56  ? 164 PRO A CA    1 
ATOM   1404 C C     . PRO B 2 163 ? 36.593 37.942 6.505   1.00 23.40  ? 164 PRO A C     1 
ATOM   1405 O O     . PRO B 2 163 ? 36.641 36.992 7.285   1.00 24.83  ? 164 PRO A O     1 
ATOM   1406 C CB    . PRO B 2 163 ? 38.364 39.019 7.927   1.00 24.60  ? 164 PRO A CB    1 
ATOM   1407 C CG    . PRO B 2 163 ? 37.459 39.822 8.787   1.00 22.30  ? 164 PRO A CG    1 
ATOM   1408 C CD    . PRO B 2 163 ? 37.136 41.011 7.911   1.00 24.71  ? 164 PRO A CD    1 
ATOM   1409 N N     . TYR B 2 164 ? 35.679 38.036 5.544   1.00 24.36  ? 165 TYR A N     1 
ATOM   1410 C CA    . TYR B 2 164 ? 34.651 37.013 5.373   1.00 23.10  ? 165 TYR A CA    1 
ATOM   1411 C C     . TYR B 2 164 ? 35.111 35.961 4.365   1.00 25.23  ? 165 TYR A C     1 
ATOM   1412 O O     . TYR B 2 164 ? 35.378 36.280 3.207   1.00 26.29  ? 165 TYR A O     1 
ATOM   1413 C CB    . TYR B 2 164 ? 33.333 37.643 4.912   1.00 22.19  ? 165 TYR A CB    1 
ATOM   1414 C CG    . TYR B 2 164 ? 32.126 36.766 5.165   1.00 24.91  ? 165 TYR A CG    1 
ATOM   1415 C CD1   . TYR B 2 164 ? 31.883 35.630 4.391   1.00 26.50  ? 165 TYR A CD1   1 
ATOM   1416 C CD2   . TYR B 2 164 ? 31.242 37.052 6.203   1.00 25.18  ? 165 TYR A CD2   1 
ATOM   1417 C CE1   . TYR B 2 164 ? 30.797 34.800 4.646   1.00 25.37  ? 165 TYR A CE1   1 
ATOM   1418 C CE2   . TYR B 2 164 ? 30.154 36.229 6.467   1.00 27.96  ? 165 TYR A CE2   1 
ATOM   1419 C CZ    . TYR B 2 164 ? 29.937 35.105 5.686   1.00 29.01  ? 165 TYR A CZ    1 
ATOM   1420 O OH    . TYR B 2 164 ? 28.865 34.282 5.954   1.00 33.39  ? 165 TYR A OH    1 
ATOM   1421 N N     . VAL B 2 165 ? 35.206 34.710 4.810   1.00 24.70  ? 166 VAL A N     1 
ATOM   1422 C CA    . VAL B 2 165 ? 35.636 33.612 3.946   1.00 23.87  ? 166 VAL A CA    1 
ATOM   1423 C C     . VAL B 2 165 ? 34.510 32.608 3.748   1.00 25.01  ? 166 VAL A C     1 
ATOM   1424 O O     . VAL B 2 165 ? 33.947 32.101 4.716   1.00 25.08  ? 166 VAL A O     1 
ATOM   1425 C CB    . VAL B 2 165 ? 36.829 32.840 4.548   1.00 27.31  ? 166 VAL A CB    1 
ATOM   1426 C CG1   . VAL B 2 165 ? 37.568 32.081 3.459   1.00 27.09  ? 166 VAL A CG1   1 
ATOM   1427 C CG2   . VAL B 2 165 ? 37.753 33.773 5.285   1.00 31.53  ? 166 VAL A CG2   1 
ATOM   1428 N N     . LEU B 2 166 ? 34.216 32.301 2.488   1.00 26.06  ? 167 LEU A N     1 
ATOM   1429 C CA    . LEU B 2 166 ? 33.169 31.349 2.135   1.00 26.02  ? 167 LEU A CA    1 
ATOM   1430 C C     . LEU B 2 166 ? 33.778 30.197 1.334   1.00 27.92  ? 167 LEU A C     1 
ATOM   1431 O O     . LEU B 2 166 ? 34.467 30.425 0.339   1.00 28.48  ? 167 LEU A O     1 
ATOM   1432 C CB    . LEU B 2 166 ? 32.083 32.054 1.312   1.00 25.93  ? 167 LEU A CB    1 
ATOM   1433 C CG    . LEU B 2 166 ? 30.913 31.231 0.759   1.00 28.53  ? 167 LEU A CG    1 
ATOM   1434 C CD1   . LEU B 2 166 ? 30.154 30.546 1.883   1.00 29.92  ? 167 LEU A CD1   1 
ATOM   1435 C CD2   . LEU B 2 166 ? 29.986 32.135 -0.027  1.00 27.10  ? 167 LEU A CD2   1 
ATOM   1436 N N     . PHE B 2 167 ? 33.555 28.967 1.795   1.00 26.52  ? 168 PHE A N     1 
ATOM   1437 C CA    . PHE B 2 167 ? 34.068 27.773 1.122   1.00 26.46  ? 168 PHE A CA    1 
ATOM   1438 C C     . PHE B 2 167 ? 32.920 27.033 0.436   1.00 26.42  ? 168 PHE A C     1 
ATOM   1439 O O     . PHE B 2 167 ? 31.920 26.702 1.072   1.00 28.00  ? 168 PHE A O     1 
ATOM   1440 C CB    . PHE B 2 167 ? 34.753 26.831 2.122   1.00 24.79  ? 168 PHE A CB    1 
ATOM   1441 C CG    . PHE B 2 167 ? 36.054 27.352 2.672   1.00 23.13  ? 168 PHE A CG    1 
ATOM   1442 C CD1   . PHE B 2 167 ? 37.219 27.287 1.916   1.00 20.83  ? 168 PHE A CD1   1 
ATOM   1443 C CD2   . PHE B 2 167 ? 36.124 27.871 3.961   1.00 23.96  ? 168 PHE A CD2   1 
ATOM   1444 C CE1   . PHE B 2 167 ? 38.435 27.726 2.435   1.00 21.76  ? 168 PHE A CE1   1 
ATOM   1445 C CE2   . PHE B 2 167 ? 37.335 28.313 4.489   1.00 22.04  ? 168 PHE A CE2   1 
ATOM   1446 C CZ    . PHE B 2 167 ? 38.491 28.240 3.726   1.00 21.35  ? 168 PHE A CZ    1 
ATOM   1447 N N     . LEU B 2 168 ? 33.062 26.784 -0.863  1.00 26.57  ? 169 LEU A N     1 
ATOM   1448 C CA    . LEU B 2 168 ? 32.036 26.086 -1.633  1.00 25.31  ? 169 LEU A CA    1 
ATOM   1449 C C     . LEU B 2 168 ? 32.456 24.655 -1.947  1.00 26.83  ? 169 LEU A C     1 
ATOM   1450 O O     . LEU B 2 168 ? 33.640 24.373 -2.135  1.00 25.54  ? 169 LEU A O     1 
ATOM   1451 C CB    . LEU B 2 168 ? 31.741 26.819 -2.946  1.00 25.58  ? 169 LEU A CB    1 
ATOM   1452 C CG    . LEU B 2 168 ? 31.150 28.229 -2.934  1.00 27.21  ? 169 LEU A CG    1 
ATOM   1453 C CD1   . LEU B 2 168 ? 29.920 28.275 -2.048  1.00 27.74  ? 169 LEU A CD1   1 
ATOM   1454 C CD2   . LEU B 2 168 ? 32.183 29.213 -2.455  1.00 31.48  ? 169 LEU A CD2   1 
ATOM   1455 N N     . GLU B 2 169 ? 31.475 23.765 -2.036  1.00 28.34  ? 170 GLU A N     1 
ATOM   1456 C CA    . GLU B 2 169 ? 31.737 22.363 -2.331  1.00 31.48  ? 170 GLU A CA    1 
ATOM   1457 C C     . GLU B 2 169 ? 30.505 21.712 -2.954  1.00 29.98  ? 170 GLU A C     1 
ATOM   1458 O O     . GLU B 2 169 ? 29.374 22.029 -2.584  1.00 26.58  ? 170 GLU A O     1 
ATOM   1459 C CB    . GLU B 2 169 ? 32.127 21.632 -1.045  1.00 35.78  ? 170 GLU A CB    1 
ATOM   1460 C CG    . GLU B 2 169 ? 32.595 20.210 -1.240  1.00 44.37  ? 170 GLU A CG    1 
ATOM   1461 C CD    . GLU B 2 169 ? 33.009 19.559 0.062   1.00 51.54  ? 170 GLU A CD    1 
ATOM   1462 O OE1   . GLU B 2 169 ? 33.806 20.166 0.811   1.00 52.83  ? 170 GLU A OE1   1 
ATOM   1463 O OE2   . GLU B 2 169 ? 32.539 18.435 0.336   1.00 57.34  ? 170 GLU A OE2   1 
ATOM   1464 N N     . GLY B 2 170 ? 30.736 20.812 -3.909  1.00 31.64  ? 171 GLY A N     1 
ATOM   1465 C CA    . GLY B 2 170 ? 29.644 20.122 -4.578  1.00 31.76  ? 171 GLY A CA    1 
ATOM   1466 C C     . GLY B 2 170 ? 29.756 20.131 -6.094  1.00 32.16  ? 171 GLY A C     1 
ATOM   1467 O O     . GLY B 2 170 ? 30.689 20.715 -6.651  1.00 32.62  ? 171 GLY A O     1 
ATOM   1468 N N     . SER B 2 171 ? 28.796 19.495 -6.763  1.00 31.04  ? 172 SER A N     1 
ATOM   1469 C CA    . SER B 2 171 ? 28.792 19.433 -8.222  1.00 32.23  ? 172 SER A CA    1 
ATOM   1470 C C     . SER B 2 171 ? 28.241 20.704 -8.864  1.00 32.60  ? 172 SER A C     1 
ATOM   1471 O O     . SER B 2 171 ? 28.262 20.842 -10.088 1.00 35.18  ? 172 SER A O     1 
ATOM   1472 C CB    . SER B 2 171 ? 28.011 18.209 -8.717  1.00 31.17  ? 172 SER A CB    1 
ATOM   1473 O OG    . SER B 2 171 ? 26.625 18.321 -8.447  1.00 30.27  ? 172 SER A OG    1 
ATOM   1474 N N     . ASN B 2 172 ? 27.747 21.624 -8.039  1.00 30.19  ? 173 ASN A N     1 
ATOM   1475 C CA    . ASN B 2 172 ? 27.202 22.886 -8.531  1.00 27.42  ? 173 ASN A CA    1 
ATOM   1476 C C     . ASN B 2 172 ? 28.225 24.022 -8.514  1.00 28.40  ? 173 ASN A C     1 
ATOM   1477 O O     . ASN B 2 172 ? 27.884 25.165 -8.818  1.00 28.12  ? 173 ASN A O     1 
ATOM   1478 C CB    . ASN B 2 172 ? 25.965 23.299 -7.721  1.00 26.19  ? 173 ASN A CB    1 
ATOM   1479 C CG    . ASN B 2 172 ? 24.768 22.390 -7.956  1.00 25.20  ? 173 ASN A CG    1 
ATOM   1480 O OD1   . ASN B 2 172 ? 23.765 22.484 -7.250  1.00 21.81  ? 173 ASN A OD1   1 
ATOM   1481 N ND2   . ASN B 2 172 ? 24.856 21.522 -8.959  1.00 27.90  ? 173 ASN A ND2   1 
ATOM   1482 N N     . PHE B 2 173 ? 29.477 23.711 -8.180  1.00 28.08  ? 174 PHE A N     1 
ATOM   1483 C CA    . PHE B 2 173 ? 30.529 24.729 -8.124  1.00 30.45  ? 174 PHE A CA    1 
ATOM   1484 C C     . PHE B 2 173 ? 31.821 24.271 -8.804  1.00 32.13  ? 174 PHE A C     1 
ATOM   1485 O O     . PHE B 2 173 ? 32.910 24.399 -8.240  1.00 33.75  ? 174 PHE A O     1 
ATOM   1486 C CB    . PHE B 2 173 ? 30.819 25.108 -6.665  1.00 28.52  ? 174 PHE A CB    1 
ATOM   1487 C CG    . PHE B 2 173 ? 29.593 25.460 -5.873  1.00 24.60  ? 174 PHE A CG    1 
ATOM   1488 C CD1   . PHE B 2 173 ? 28.831 26.575 -6.201  1.00 24.54  ? 174 PHE A CD1   1 
ATOM   1489 C CD2   . PHE B 2 173 ? 29.185 24.656 -4.816  1.00 24.47  ? 174 PHE A CD2   1 
ATOM   1490 C CE1   . PHE B 2 173 ? 27.675 26.882 -5.487  1.00 27.81  ? 174 PHE A CE1   1 
ATOM   1491 C CE2   . PHE B 2 173 ? 28.035 24.951 -4.096  1.00 24.87  ? 174 PHE A CE2   1 
ATOM   1492 C CZ    . PHE B 2 173 ? 27.276 26.065 -4.432  1.00 27.09  ? 174 PHE A CZ    1 
ATOM   1493 N N     . LEU B 2 174 ? 31.696 23.756 -10.024 1.00 34.70  ? 175 LEU A N     1 
ATOM   1494 C CA    . LEU B 2 174 ? 32.846 23.269 -10.789 1.00 33.80  ? 175 LEU A CA    1 
ATOM   1495 C C     . LEU B 2 174 ? 33.556 24.390 -11.545 1.00 33.60  ? 175 LEU A C     1 
ATOM   1496 O O     . LEU B 2 174 ? 32.915 25.318 -12.039 1.00 29.44  ? 175 LEU A O     1 
ATOM   1497 C CB    . LEU B 2 174 ? 32.400 22.184 -11.780 1.00 32.57  ? 175 LEU A CB    1 
ATOM   1498 C CG    . LEU B 2 174 ? 31.711 20.934 -11.219 1.00 34.89  ? 175 LEU A CG    1 
ATOM   1499 C CD1   . LEU B 2 174 ? 31.080 20.132 -12.347 1.00 33.04  ? 175 LEU A CD1   1 
ATOM   1500 C CD2   . LEU B 2 174 ? 32.704 20.086 -10.435 1.00 33.60  ? 175 LEU A CD2   1 
ATOM   1501 N N     . THR B 2 175 ? 34.883 24.302 -11.614 1.00 35.96  ? 176 THR A N     1 
ATOM   1502 C CA    . THR B 2 175 ? 35.700 25.287 -12.327 1.00 38.24  ? 176 THR A CA    1 
ATOM   1503 C C     . THR B 2 175 ? 36.490 24.608 -13.447 1.00 39.51  ? 176 THR A C     1 
ATOM   1504 O O     . THR B 2 175 ? 37.243 25.256 -14.173 1.00 39.43  ? 176 THR A O     1 
ATOM   1505 C CB    . THR B 2 175 ? 36.693 26.006 -11.387 1.00 39.27  ? 176 THR A CB    1 
ATOM   1506 O OG1   . THR B 2 175 ? 37.536 25.039 -10.750 1.00 40.74  ? 176 THR A OG1   1 
ATOM   1507 C CG2   . THR B 2 175 ? 35.953 26.811 -10.332 1.00 40.08  ? 176 THR A CG2   1 
ATOM   1508 N N     . GLU B 2 176 ? 36.300 23.298 -13.578 1.00 39.74  ? 177 GLU A N     1 
ATOM   1509 C CA    . GLU B 2 176 ? 36.972 22.499 -14.595 1.00 42.99  ? 177 GLU A CA    1 
ATOM   1510 C C     . GLU B 2 176 ? 36.116 21.275 -14.910 1.00 44.12  ? 177 GLU A C     1 
ATOM   1511 O O     . GLU B 2 176 ? 35.305 20.853 -14.082 1.00 44.52  ? 177 GLU A O     1 
ATOM   1512 C CB    . GLU B 2 176 ? 38.343 22.048 -14.088 1.00 45.86  ? 177 GLU A CB    1 
ATOM   1513 C CG    . GLU B 2 176 ? 38.282 21.229 -12.808 1.00 52.65  ? 177 GLU A CG    1 
ATOM   1514 C CD    . GLU B 2 176 ? 39.633 20.690 -12.391 1.00 57.71  ? 177 GLU A CD    1 
ATOM   1515 O OE1   . GLU B 2 176 ? 40.441 21.467 -11.840 1.00 62.22  ? 177 GLU A OE1   1 
ATOM   1516 O OE2   . GLU B 2 176 ? 39.884 19.485 -12.610 1.00 60.90  ? 177 GLU A OE2   1 
ATOM   1517 N N     . ASN B 2 177 ? 36.308 20.705 -16.098 1.00 44.35  ? 178 ASN A N     1 
ATOM   1518 C CA    . ASN B 2 177 ? 35.556 19.523 -16.526 1.00 45.47  ? 178 ASN A CA    1 
ATOM   1519 C C     . ASN B 2 177 ? 35.986 18.254 -15.797 1.00 45.40  ? 178 ASN A C     1 
ATOM   1520 O O     . ASN B 2 177 ? 37.165 18.074 -15.485 1.00 45.59  ? 178 ASN A O     1 
ATOM   1521 C CB    . ASN B 2 177 ? 35.697 19.312 -18.035 1.00 48.01  ? 178 ASN A CB    1 
ATOM   1522 C CG    . ASN B 2 177 ? 34.955 20.355 -18.843 1.00 51.91  ? 178 ASN A CG    1 
ATOM   1523 O OD1   . ASN B 2 177 ? 34.632 21.433 -18.347 1.00 54.80  ? 178 ASN A OD1   1 
ATOM   1524 N ND2   . ASN B 2 177 ? 34.674 20.035 -20.099 1.00 54.74  ? 178 ASN A ND2   1 
ATOM   1525 N N     . ILE B 2 178 ? 35.018 17.385 -15.518 1.00 45.70  ? 179 ILE A N     1 
ATOM   1526 C CA    . ILE B 2 178 ? 35.283 16.123 -14.830 1.00 47.93  ? 179 ILE A CA    1 
ATOM   1527 C C     . ILE B 2 178 ? 34.503 14.983 -15.479 1.00 50.33  ? 179 ILE A C     1 
ATOM   1528 O O     . ILE B 2 178 ? 33.440 15.197 -16.069 1.00 48.37  ? 179 ILE A O     1 
ATOM   1529 C CB    . ILE B 2 178 ? 34.899 16.182 -13.324 1.00 45.08  ? 179 ILE A CB    1 
ATOM   1530 C CG1   . ILE B 2 178 ? 33.400 16.440 -13.166 1.00 42.64  ? 179 ILE A CG1   1 
ATOM   1531 C CG2   . ILE B 2 178 ? 35.706 17.257 -12.607 1.00 43.40  ? 179 ILE A CG2   1 
ATOM   1532 C CD1   . ILE B 2 178 ? 32.891 16.249 -11.765 1.00 40.62  ? 179 ILE A CD1   1 
ATOM   1533 N N     . SER B 2 179 ? 35.048 13.775 -15.379 1.00 54.12  ? 180 SER A N     1 
ATOM   1534 C CA    . SER B 2 179 ? 34.410 12.590 -15.939 1.00 58.04  ? 180 SER A CA    1 
ATOM   1535 C C     . SER B 2 179 ? 34.161 11.592 -14.813 1.00 58.76  ? 180 SER A C     1 
ATOM   1536 O O     . SER B 2 179 ? 35.093 11.177 -14.123 1.00 61.17  ? 180 SER A O     1 
ATOM   1537 C CB    . SER B 2 179 ? 35.301 11.961 -17.014 1.00 59.22  ? 180 SER A CB    1 
ATOM   1538 O OG    . SER B 2 179 ? 35.592 12.890 -18.045 1.00 62.16  ? 180 SER A OG    1 
ATOM   1539 N N     . ILE B 2 180 ? 32.897 11.237 -14.608 1.00 58.84  ? 181 ILE A N     1 
ATOM   1540 C CA    . ILE B 2 180 ? 32.529 10.297 -13.556 1.00 60.15  ? 181 ILE A CA    1 
ATOM   1541 C C     . ILE B 2 180 ? 32.034 8.979  -14.142 1.00 62.43  ? 181 ILE A C     1 
ATOM   1542 O O     . ILE B 2 180 ? 31.066 8.950  -14.902 1.00 62.61  ? 181 ILE A O     1 
ATOM   1543 C CB    . ILE B 2 180 ? 31.435 10.880 -12.639 1.00 58.09  ? 181 ILE A CB    1 
ATOM   1544 C CG1   . ILE B 2 180 ? 31.840 12.273 -12.145 1.00 58.33  ? 181 ILE A CG1   1 
ATOM   1545 C CG2   . ILE B 2 180 ? 31.191 9.950  -11.460 1.00 57.38  ? 181 ILE A CG2   1 
ATOM   1546 C CD1   . ILE B 2 180 ? 33.143 12.306 -11.363 1.00 58.37  ? 181 ILE A CD1   1 
ATOM   1547 N N     . THR B 2 181 ? 32.696 7.889  -13.768 1.00 65.12  ? 182 THR A N     1 
ATOM   1548 C CA    . THR B 2 181 ? 32.338 6.562  -14.256 1.00 66.35  ? 182 THR A CA    1 
ATOM   1549 C C     . THR B 2 181 ? 31.361 5.854  -13.320 1.00 67.59  ? 182 THR A C     1 
ATOM   1550 O O     . THR B 2 181 ? 31.621 5.713  -12.125 1.00 68.31  ? 182 THR A O     1 
ATOM   1551 C CB    . THR B 2 181 ? 33.589 5.686  -14.424 1.00 65.52  ? 182 THR A CB    1 
ATOM   1552 O OG1   . THR B 2 181 ? 34.579 6.407  -15.167 1.00 66.02  ? 182 THR A OG1   1 
ATOM   1553 C CG2   . THR B 2 181 ? 33.246 4.406  -15.168 1.00 67.02  ? 182 THR A CG2   1 
ATOM   1554 N N     . ARG B 2 182 ? 30.235 5.413  -13.873 1.00 69.14  ? 183 ARG A N     1 
ATOM   1555 C CA    . ARG B 2 182 ? 29.217 4.712  -13.097 1.00 72.69  ? 183 ARG A CA    1 
ATOM   1556 C C     . ARG B 2 182 ? 29.491 3.205  -13.084 1.00 74.96  ? 183 ARG A C     1 
ATOM   1557 O O     . ARG B 2 182 ? 30.367 2.724  -13.804 1.00 75.48  ? 183 ARG A O     1 
ATOM   1558 C CB    . ARG B 2 182 ? 27.826 5.014  -13.668 1.00 73.35  ? 183 ARG A CB    1 
ATOM   1559 C CG    . ARG B 2 182 ? 27.618 4.590  -15.108 1.00 75.93  ? 183 ARG A CG    1 
ATOM   1560 C CD    . ARG B 2 182 ? 26.319 5.148  -15.669 1.00 78.26  ? 183 ARG A CD    1 
ATOM   1561 N NE    . ARG B 2 182 ? 25.143 4.691  -14.933 1.00 81.54  ? 183 ARG A NE    1 
ATOM   1562 C CZ    . ARG B 2 182 ? 24.247 5.499  -14.374 1.00 84.39  ? 183 ARG A CZ    1 
ATOM   1563 N NH1   . ARG B 2 182 ? 24.385 6.815  -14.460 1.00 87.02  ? 183 ARG A NH1   1 
ATOM   1564 N NH2   . ARG B 2 182 ? 23.205 4.990  -13.732 1.00 84.92  ? 183 ARG A NH2   1 
ATOM   1565 N N     . PRO B 2 183 ? 28.783 2.447  -12.225 1.00 77.44  ? 184 PRO A N     1 
ATOM   1566 C CA    . PRO B 2 183 ? 28.953 0.992  -12.123 1.00 79.67  ? 184 PRO A CA    1 
ATOM   1567 C C     . PRO B 2 183 ? 28.654 0.250  -13.428 1.00 81.43  ? 184 PRO A C     1 
ATOM   1568 O O     . PRO B 2 183 ? 29.047 -0.905 -13.596 1.00 82.46  ? 184 PRO A O     1 
ATOM   1569 C CB    . PRO B 2 183 ? 27.955 0.614  -11.031 1.00 79.82  ? 184 PRO A CB    1 
ATOM   1570 C CG    . PRO B 2 183 ? 27.973 1.812  -10.147 1.00 79.24  ? 184 PRO A CG    1 
ATOM   1571 C CD    . PRO B 2 183 ? 27.901 2.934  -11.150 1.00 78.43  ? 184 PRO A CD    1 
ATOM   1572 N N     . ASP B 2 184 ? 27.940 0.913  -14.334 1.00 82.84  ? 185 ASP A N     1 
ATOM   1573 C CA    . ASP B 2 184 ? 27.589 0.342  -15.632 1.00 82.37  ? 185 ASP A CA    1 
ATOM   1574 C C     . ASP B 2 184 ? 28.803 0.356  -16.559 1.00 81.42  ? 185 ASP A C     1 
ATOM   1575 O O     . ASP B 2 184 ? 28.908 -0.461 -17.476 1.00 81.78  ? 185 ASP A O     1 
ATOM   1576 C CB    . ASP B 2 184 ? 26.458 1.148  -16.281 1.00 84.14  ? 185 ASP A CB    1 
ATOM   1577 C CG    . ASP B 2 184 ? 25.178 1.124  -15.469 1.00 86.75  ? 185 ASP A CG    1 
ATOM   1578 O OD1   . ASP B 2 184 ? 25.186 1.611  -14.318 1.00 88.55  ? 185 ASP A OD1   1 
ATOM   1579 O OD2   . ASP B 2 184 ? 24.156 0.629  -15.990 1.00 88.37  ? 185 ASP A OD2   1 
ATOM   1580 N N     . GLY B 2 185 ? 29.712 1.295  -16.312 1.00 79.31  ? 186 GLY A N     1 
ATOM   1581 C CA    . GLY B 2 185 ? 30.903 1.424  -17.129 1.00 76.94  ? 186 GLY A CA    1 
ATOM   1582 C C     . GLY B 2 185 ? 30.854 2.697  -17.951 1.00 76.35  ? 186 GLY A C     1 
ATOM   1583 O O     . GLY B 2 185 ? 31.890 3.206  -18.379 1.00 76.76  ? 186 GLY A O     1 
ATOM   1584 N N     . ARG B 2 186 ? 29.645 3.209  -18.168 1.00 75.73  ? 187 ARG A N     1 
ATOM   1585 C CA    . ARG B 2 186 ? 29.438 4.434  -18.936 1.00 76.19  ? 187 ARG A CA    1 
ATOM   1586 C C     . ARG B 2 186 ? 30.004 5.646  -18.199 1.00 75.83  ? 187 ARG A C     1 
ATOM   1587 O O     . ARG B 2 186 ? 29.727 5.854  -17.017 1.00 76.11  ? 187 ARG A O     1 
ATOM   1588 C CB    . ARG B 2 186 ? 27.944 4.632  -19.219 1.00 76.38  ? 187 ARG A CB    1 
ATOM   1589 C CG    . ARG B 2 186 ? 27.582 5.983  -19.830 1.00 77.48  ? 187 ARG A CG    1 
ATOM   1590 C CD    . ARG B 2 186 ? 26.103 6.059  -20.189 1.00 77.71  ? 187 ARG A CD    1 
ATOM   1591 N NE    . ARG B 2 186 ? 25.236 5.675  -19.076 1.00 78.42  ? 187 ARG A NE    1 
ATOM   1592 C CZ    . ARG B 2 186 ? 24.111 6.303  -18.746 1.00 78.54  ? 187 ARG A CZ    1 
ATOM   1593 N NH1   . ARG B 2 186 ? 23.705 7.359  -19.440 1.00 78.59  ? 187 ARG A NH1   1 
ATOM   1594 N NH2   . ARG B 2 186 ? 23.385 5.868  -17.726 1.00 77.29  ? 187 ARG A NH2   1 
ATOM   1595 N N     . VAL B 2 187 ? 30.808 6.436  -18.904 1.00 74.59  ? 188 VAL A N     1 
ATOM   1596 C CA    . VAL B 2 187 ? 31.421 7.624  -18.323 1.00 71.73  ? 188 VAL A CA    1 
ATOM   1597 C C     . VAL B 2 187 ? 30.598 8.894  -18.560 1.00 70.99  ? 188 VAL A C     1 
ATOM   1598 O O     . VAL B 2 187 ? 30.437 9.342  -19.696 1.00 72.74  ? 188 VAL A O     1 
ATOM   1599 C CB    . VAL B 2 187 ? 32.871 7.817  -18.840 1.00 70.64  ? 188 VAL A CB    1 
ATOM   1600 C CG1   . VAL B 2 187 ? 33.743 6.669  -18.371 1.00 68.31  ? 188 VAL A CG1   1 
ATOM   1601 C CG2   . VAL B 2 187 ? 32.898 7.891  -20.360 1.00 71.60  ? 188 VAL A CG2   1 
ATOM   1602 N N     . VAL B 2 188 ? 30.037 9.436  -17.482 1.00 67.62  ? 189 VAL A N     1 
ATOM   1603 C CA    . VAL B 2 188 ? 29.236 10.656 -17.550 1.00 64.37  ? 189 VAL A CA    1 
ATOM   1604 C C     . VAL B 2 188 ? 30.168 11.865 -17.503 1.00 62.72  ? 189 VAL A C     1 
ATOM   1605 O O     . VAL B 2 188 ? 30.887 12.063 -16.526 1.00 62.24  ? 189 VAL A O     1 
ATOM   1606 C CB    . VAL B 2 188 ? 28.234 10.735 -16.376 1.00 63.94  ? 189 VAL A CB    1 
ATOM   1607 C CG1   . VAL B 2 188 ? 27.360 11.969 -16.511 1.00 62.56  ? 189 VAL A CG1   1 
ATOM   1608 C CG2   . VAL B 2 188 ? 27.375 9.479  -16.330 1.00 63.14  ? 189 VAL A CG2   1 
ATOM   1609 N N     . ASN B 2 189 ? 30.154 12.668 -18.563 1.00 61.84  ? 190 ASN A N     1 
ATOM   1610 C CA    . ASN B 2 189 ? 31.020 13.841 -18.646 1.00 62.58  ? 190 ASN A CA    1 
ATOM   1611 C C     . ASN B 2 189 ? 30.325 15.146 -18.277 1.00 62.13  ? 190 ASN A C     1 
ATOM   1612 O O     . ASN B 2 189 ? 29.370 15.562 -18.934 1.00 61.43  ? 190 ASN A O     1 
ATOM   1613 C CB    . ASN B 2 189 ? 31.621 13.951 -20.047 1.00 64.07  ? 190 ASN A CB    1 
ATOM   1614 C CG    . ASN B 2 189 ? 32.360 12.695 -20.460 1.00 66.81  ? 190 ASN A CG    1 
ATOM   1615 O OD1   . ASN B 2 189 ? 33.387 12.345 -19.878 1.00 67.91  ? 190 ASN A OD1   1 
ATOM   1616 N ND2   . ASN B 2 189 ? 31.831 12.000 -21.462 1.00 68.09  ? 190 ASN A ND2   1 
ATOM   1617 N N     . LEU B 2 190 ? 30.828 15.795 -17.229 1.00 61.39  ? 191 LEU A N     1 
ATOM   1618 C CA    . LEU B 2 190 ? 30.273 17.059 -16.753 1.00 59.80  ? 191 LEU A CA    1 
ATOM   1619 C C     . LEU B 2 190 ? 31.130 18.252 -17.173 1.00 59.06  ? 191 LEU A C     1 
ATOM   1620 O O     . LEU B 2 190 ? 32.348 18.248 -16.987 1.00 59.33  ? 191 LEU A O     1 
ATOM   1621 C CB    . LEU B 2 190 ? 30.141 17.038 -15.226 1.00 59.09  ? 191 LEU A CB    1 
ATOM   1622 C CG    . LEU B 2 190 ? 29.354 15.882 -14.604 1.00 59.44  ? 191 LEU A CG    1 
ATOM   1623 C CD1   . LEU B 2 190 ? 29.242 16.071 -13.099 1.00 58.83  ? 191 LEU A CD1   1 
ATOM   1624 C CD2   . LEU B 2 190 ? 27.979 15.811 -15.228 1.00 60.85  ? 191 LEU A CD2   1 
ATOM   1625 N N     . GLU B 2 191 ? 30.486 19.266 -17.745 1.00 57.14  ? 192 GLU A N     1 
ATOM   1626 C CA    . GLU B 2 191 ? 31.174 20.478 -18.184 1.00 55.31  ? 192 GLU A CA    1 
ATOM   1627 C C     . GLU B 2 191 ? 30.881 21.605 -17.200 1.00 51.09  ? 192 GLU A C     1 
ATOM   1628 O O     . GLU B 2 191 ? 29.723 21.926 -16.943 1.00 52.21  ? 192 GLU A O     1 
ATOM   1629 C CB    . GLU B 2 191 ? 30.720 20.861 -19.589 1.00 59.88  ? 192 GLU A CB    1 
ATOM   1630 C CG    . GLU B 2 191 ? 31.051 19.808 -20.633 1.00 68.24  ? 192 GLU A CG    1 
ATOM   1631 C CD    . GLU B 2 191 ? 30.544 20.168 -22.012 1.00 73.16  ? 192 GLU A CD    1 
ATOM   1632 O OE1   . GLU B 2 191 ? 30.992 21.197 -22.564 1.00 75.39  ? 192 GLU A OE1   1 
ATOM   1633 O OE2   . GLU B 2 191 ? 29.700 19.416 -22.548 1.00 75.31  ? 192 GLU A OE2   1 
ATOM   1634 N N     . TYR B 2 192 ? 31.936 22.215 -16.673 1.00 46.41  ? 193 TYR A N     1 
ATOM   1635 C CA    . TYR B 2 192 ? 31.804 23.282 -15.687 1.00 44.58  ? 193 TYR A CA    1 
ATOM   1636 C C     . TYR B 2 192 ? 31.019 24.519 -16.124 1.00 43.07  ? 193 TYR A C     1 
ATOM   1637 O O     . TYR B 2 192 ? 30.387 25.175 -15.296 1.00 41.54  ? 193 TYR A O     1 
ATOM   1638 C CB    . TYR B 2 192 ? 33.184 23.702 -15.172 1.00 45.79  ? 193 TYR A CB    1 
ATOM   1639 C CG    . TYR B 2 192 ? 33.907 24.708 -16.040 1.00 48.83  ? 193 TYR A CG    1 
ATOM   1640 C CD1   . TYR B 2 192 ? 34.593 24.309 -17.185 1.00 51.39  ? 193 TYR A CD1   1 
ATOM   1641 C CD2   . TYR B 2 192 ? 33.909 26.064 -15.709 1.00 50.97  ? 193 TYR A CD2   1 
ATOM   1642 C CE1   . TYR B 2 192 ? 35.264 25.235 -17.981 1.00 55.57  ? 193 TYR A CE1   1 
ATOM   1643 C CE2   . TYR B 2 192 ? 34.576 26.997 -16.496 1.00 56.11  ? 193 TYR A CE2   1 
ATOM   1644 C CZ    . TYR B 2 192 ? 35.251 26.577 -17.630 1.00 57.27  ? 193 TYR A CZ    1 
ATOM   1645 O OH    . TYR B 2 192 ? 35.911 27.498 -18.412 1.00 60.86  ? 193 TYR A OH    1 
ATOM   1646 N N     . ASN B 2 193 ? 31.067 24.843 -17.414 1.00 40.77  ? 194 ASN A N     1 
ATOM   1647 C CA    . ASN B 2 193 ? 30.371 26.021 -17.931 1.00 38.93  ? 194 ASN A CA    1 
ATOM   1648 C C     . ASN B 2 193 ? 28.887 25.800 -18.227 1.00 36.21  ? 194 ASN A C     1 
ATOM   1649 O O     . ASN B 2 193 ? 28.204 26.705 -18.706 1.00 35.88  ? 194 ASN A O     1 
ATOM   1650 C CB    . ASN B 2 193 ? 31.087 26.564 -19.176 1.00 41.85  ? 194 ASN A CB    1 
ATOM   1651 C CG    . ASN B 2 193 ? 31.042 25.603 -20.349 1.00 45.24  ? 194 ASN A CG    1 
ATOM   1652 O OD1   . ASN B 2 193 ? 30.877 24.396 -20.178 1.00 47.93  ? 194 ASN A OD1   1 
ATOM   1653 N ND2   . ASN B 2 193 ? 31.185 26.141 -21.555 1.00 47.75  ? 194 ASN A ND2   1 
ATOM   1654 N N     . SER B 2 194 ? 28.393 24.603 -17.928 1.00 33.70  ? 195 SER A N     1 
ATOM   1655 C CA    . SER B 2 194 ? 26.994 24.265 -18.158 1.00 32.56  ? 195 SER A CA    1 
ATOM   1656 C C     . SER B 2 194 ? 26.065 24.881 -17.117 1.00 30.53  ? 195 SER A C     1 
ATOM   1657 O O     . SER B 2 194 ? 26.137 24.554 -15.933 1.00 29.82  ? 195 SER A O     1 
ATOM   1658 C CB    . SER B 2 194 ? 26.810 22.747 -18.168 1.00 33.83  ? 195 SER A CB    1 
ATOM   1659 O OG    . SER B 2 194 ? 25.445 22.399 -18.333 1.00 34.63  ? 195 SER A OG    1 
ATOM   1660 N N     . GLY B 2 195 ? 25.164 25.739 -17.581 1.00 30.64  ? 196 GLY A N     1 
ATOM   1661 C CA    . GLY B 2 195 ? 24.209 26.388 -16.700 1.00 32.13  ? 196 GLY A CA    1 
ATOM   1662 C C     . GLY B 2 195 ? 23.178 25.454 -16.096 1.00 32.13  ? 196 GLY A C     1 
ATOM   1663 O O     . GLY B 2 195 ? 22.277 25.896 -15.391 1.00 32.15  ? 196 GLY A O     1 
ATOM   1664 N N     . ILE B 2 196 ? 23.280 24.165 -16.406 1.00 33.56  ? 197 ILE A N     1 
ATOM   1665 C CA    . ILE B 2 196 ? 22.363 23.166 -15.867 1.00 32.80  ? 197 ILE A CA    1 
ATOM   1666 C C     . ILE B 2 196 ? 22.778 22.865 -14.428 1.00 30.59  ? 197 ILE A C     1 
ATOM   1667 O O     . ILE B 2 196 ? 21.940 22.540 -13.589 1.00 30.49  ? 197 ILE A O     1 
ATOM   1668 C CB    . ILE B 2 196 ? 22.438 21.833 -16.672 1.00 35.31  ? 197 ILE A CB    1 
ATOM   1669 C CG1   . ILE B 2 196 ? 22.079 22.061 -18.143 1.00 38.03  ? 197 ILE A CG1   1 
ATOM   1670 C CG2   . ILE B 2 196 ? 21.506 20.784 -16.064 1.00 36.31  ? 197 ILE A CG2   1 
ATOM   1671 C CD1   . ILE B 2 196 ? 20.607 22.303 -18.394 1.00 38.14  ? 197 ILE A CD1   1 
ATOM   1672 N N     . LEU B 2 197 ? 24.073 23.023 -14.154 1.00 30.09  ? 198 LEU A N     1 
ATOM   1673 C CA    . LEU B 2 197 ? 24.650 22.731 -12.845 1.00 28.89  ? 198 LEU A CA    1 
ATOM   1674 C C     . LEU B 2 197 ? 25.372 23.876 -12.132 1.00 27.92  ? 198 LEU A C     1 
ATOM   1675 O O     . LEU B 2 197 ? 25.237 24.031 -10.921 1.00 28.72  ? 198 LEU A O     1 
ATOM   1676 C CB    . LEU B 2 197 ? 25.621 21.554 -12.980 1.00 27.51  ? 198 LEU A CB    1 
ATOM   1677 C CG    . LEU B 2 197 ? 25.209 20.158 -12.506 1.00 29.27  ? 198 LEU A CG    1 
ATOM   1678 C CD1   . LEU B 2 197 ? 23.881 19.736 -13.089 1.00 27.49  ? 198 LEU A CD1   1 
ATOM   1679 C CD2   . LEU B 2 197 ? 26.300 19.176 -12.882 1.00 31.11  ? 198 LEU A CD2   1 
ATOM   1680 N N     . ASN B 2 198 ? 26.151 24.658 -12.873 1.00 26.91  ? 199 ASN A N     1 
ATOM   1681 C CA    . ASN B 2 198 ? 26.928 25.754 -12.296 1.00 25.36  ? 199 ASN A CA    1 
ATOM   1682 C C     . ASN B 2 198 ? 26.122 26.881 -11.650 1.00 28.18  ? 199 ASN A C     1 
ATOM   1683 O O     . ASN B 2 198 ? 25.340 27.564 -12.313 1.00 28.52  ? 199 ASN A O     1 
ATOM   1684 C CB    . ASN B 2 198 ? 27.879 26.324 -13.345 1.00 26.93  ? 199 ASN A CB    1 
ATOM   1685 C CG    . ASN B 2 198 ? 29.030 27.086 -12.733 1.00 30.42  ? 199 ASN A CG    1 
ATOM   1686 O OD1   . ASN B 2 198 ? 28.915 28.274 -12.432 1.00 33.08  ? 199 ASN A OD1   1 
ATOM   1687 N ND2   . ASN B 2 198 ? 30.158 26.406 -12.550 1.00 31.06  ? 199 ASN A ND2   1 
ATOM   1688 N N     . ARG B 2 199 ? 26.333 27.063 -10.346 1.00 28.04  ? 200 ARG A N     1 
ATOM   1689 C CA    . ARG B 2 199 ? 25.660 28.101 -9.566  1.00 26.27  ? 200 ARG A CA    1 
ATOM   1690 C C     . ARG B 2 199 ? 26.690 29.092 -9.029  1.00 29.27  ? 200 ARG A C     1 
ATOM   1691 O O     . ARG B 2 199 ? 26.375 29.951 -8.203  1.00 28.48  ? 200 ARG A O     1 
ATOM   1692 C CB    . ARG B 2 199 ? 24.899 27.483 -8.390  1.00 23.32  ? 200 ARG A CB    1 
ATOM   1693 C CG    . ARG B 2 199 ? 23.780 26.520 -8.754  1.00 25.90  ? 200 ARG A CG    1 
ATOM   1694 C CD    . ARG B 2 199 ? 22.601 27.212 -9.418  1.00 24.78  ? 200 ARG A CD    1 
ATOM   1695 N NE    . ARG B 2 199 ? 22.792 27.348 -10.854 1.00 33.42  ? 200 ARG A NE    1 
ATOM   1696 C CZ    . ARG B 2 199 ? 21.973 26.847 -11.772 1.00 30.78  ? 200 ARG A CZ    1 
ATOM   1697 N NH1   . ARG B 2 199 ? 20.888 26.175 -11.420 1.00 31.64  ? 200 ARG A NH1   1 
ATOM   1698 N NH2   . ARG B 2 199 ? 22.267 26.989 -13.052 1.00 34.05  ? 200 ARG A NH2   1 
ATOM   1699 N N     . LEU B 2 200 ? 27.918 28.979 -9.527  1.00 29.63  ? 201 LEU A N     1 
ATOM   1700 C CA    . LEU B 2 200 ? 29.024 29.836 -9.115  1.00 29.35  ? 201 LEU A CA    1 
ATOM   1701 C C     . LEU B 2 200 ? 28.756 31.322 -9.360  1.00 30.55  ? 201 LEU A C     1 
ATOM   1702 O O     . LEU B 2 200 ? 29.254 32.175 -8.621  1.00 29.77  ? 201 LEU A O     1 
ATOM   1703 C CB    . LEU B 2 200 ? 30.298 29.391 -9.833  1.00 29.74  ? 201 LEU A CB    1 
ATOM   1704 C CG    . LEU B 2 200 ? 31.594 29.211 -9.042  1.00 29.72  ? 201 LEU A CG    1 
ATOM   1705 C CD1   . LEU B 2 200 ? 31.326 28.639 -7.669  1.00 32.38  ? 201 LEU A CD1   1 
ATOM   1706 C CD2   . LEU B 2 200 ? 32.518 28.297 -9.821  1.00 27.68  ? 201 LEU A CD2   1 
ATOM   1707 N N     . ASP B 2 201 ? 27.952 31.630 -10.376 1.00 30.74  ? 202 ASP A N     1 
ATOM   1708 C CA    . ASP B 2 201 ? 27.620 33.017 -10.690 1.00 33.40  ? 202 ASP A CA    1 
ATOM   1709 C C     . ASP B 2 201 ? 26.590 33.617 -9.731  1.00 32.78  ? 202 ASP A C     1 
ATOM   1710 O O     . ASP B 2 201 ? 26.429 34.839 -9.674  1.00 33.26  ? 202 ASP A O     1 
ATOM   1711 C CB    . ASP B 2 201 ? 27.146 33.155 -12.140 1.00 35.14  ? 202 ASP A CB    1 
ATOM   1712 C CG    . ASP B 2 201 ? 28.281 33.000 -13.144 1.00 42.64  ? 202 ASP A CG    1 
ATOM   1713 O OD1   . ASP B 2 201 ? 29.295 33.722 -13.028 1.00 43.23  ? 202 ASP A OD1   1 
ATOM   1714 O OD2   . ASP B 2 201 ? 28.160 32.156 -14.055 1.00 44.66  ? 202 ASP A OD2   1 
ATOM   1715 N N     . ARG B 2 202 ? 25.906 32.757 -8.975  1.00 31.31  ? 203 ARG A N     1 
ATOM   1716 C CA    . ARG B 2 202 ? 24.909 33.208 -8.000  1.00 28.19  ? 203 ARG A CA    1 
ATOM   1717 C C     . ARG B 2 202 ? 25.605 33.763 -6.759  1.00 27.95  ? 203 ARG A C     1 
ATOM   1718 O O     . ARG B 2 202 ? 24.946 34.145 -5.795  1.00 28.68  ? 203 ARG A O     1 
ATOM   1719 C CB    . ARG B 2 202 ? 23.990 32.056 -7.574  1.00 25.45  ? 203 ARG A CB    1 
ATOM   1720 C CG    . ARG B 2 202 ? 23.291 31.319 -8.708  1.00 26.34  ? 203 ARG A CG    1 
ATOM   1721 C CD    . ARG B 2 202 ? 22.258 32.172 -9.434  1.00 23.13  ? 203 ARG A CD    1 
ATOM   1722 N NE    . ARG B 2 202 ? 21.657 31.426 -10.536 1.00 20.56  ? 203 ARG A NE    1 
ATOM   1723 C CZ    . ARG B 2 202 ? 20.699 30.515 -10.393 1.00 22.45  ? 203 ARG A CZ    1 
ATOM   1724 N NH1   . ARG B 2 202 ? 20.209 30.236 -9.194  1.00 22.55  ? 203 ARG A NH1   1 
ATOM   1725 N NH2   . ARG B 2 202 ? 20.278 29.830 -11.446 1.00 19.81  ? 203 ARG A NH2   1 
ATOM   1726 N N     . LEU B 2 203 ? 26.937 33.800 -6.790  1.00 27.90  ? 204 LEU A N     1 
ATOM   1727 C CA    . LEU B 2 203 ? 27.737 34.298 -5.675  1.00 28.03  ? 204 LEU A CA    1 
ATOM   1728 C C     . LEU B 2 203 ? 28.688 35.436 -6.038  1.00 27.55  ? 204 LEU A C     1 
ATOM   1729 O O     . LEU B 2 203 ? 29.119 36.182 -5.162  1.00 27.12  ? 204 LEU A O     1 
ATOM   1730 C CB    . LEU B 2 203 ? 28.555 33.156 -5.067  1.00 28.89  ? 204 LEU A CB    1 
ATOM   1731 C CG    . LEU B 2 203 ? 27.828 32.129 -4.201  1.00 34.13  ? 204 LEU A CG    1 
ATOM   1732 C CD1   . LEU B 2 203 ? 28.731 30.941 -3.973  1.00 33.30  ? 204 LEU A CD1   1 
ATOM   1733 C CD2   . LEU B 2 203 ? 27.425 32.757 -2.874  1.00 33.04  ? 204 LEU A CD2   1 
ATOM   1734 N N     . THR B 2 204 ? 29.011 35.565 -7.322  1.00 26.90  ? 205 THR A N     1 
ATOM   1735 C CA    . THR B 2 204 ? 29.940 36.593 -7.796  1.00 27.45  ? 205 THR A CA    1 
ATOM   1736 C C     . THR B 2 204 ? 29.629 38.037 -7.407  1.00 27.90  ? 205 THR A C     1 
ATOM   1737 O O     . THR B 2 204 ? 30.526 38.881 -7.398  1.00 31.99  ? 205 THR A O     1 
ATOM   1738 C CB    . THR B 2 204 ? 30.145 36.508 -9.324  1.00 27.38  ? 205 THR A CB    1 
ATOM   1739 O OG1   . THR B 2 204 ? 28.877 36.370 -9.970  1.00 30.09  ? 205 THR A OG1   1 
ATOM   1740 C CG2   . THR B 2 204 ? 31.016 35.315 -9.682  1.00 28.95  ? 205 THR A CG2   1 
ATOM   1741 N N     . ALA B 2 205 ? 28.371 38.330 -7.091  1.00 25.45  ? 206 ALA A N     1 
ATOM   1742 C CA    . ALA B 2 205 ? 27.995 39.684 -6.695  1.00 24.48  ? 206 ALA A CA    1 
ATOM   1743 C C     . ALA B 2 205 ? 28.613 40.042 -5.342  1.00 24.77  ? 206 ALA A C     1 
ATOM   1744 O O     . ALA B 2 205 ? 28.871 41.212 -5.059  1.00 25.41  ? 206 ALA A O     1 
ATOM   1745 C CB    . ALA B 2 205 ? 26.486 39.811 -6.633  1.00 22.62  ? 206 ALA A CB    1 
ATOM   1746 N N     . ALA B 2 206 ? 28.876 39.020 -4.528  1.00 25.74  ? 207 ALA A N     1 
ATOM   1747 C CA    . ALA B 2 206 ? 29.461 39.188 -3.198  1.00 24.98  ? 207 ALA A CA    1 
ATOM   1748 C C     . ALA B 2 206 ? 30.858 39.802 -3.197  1.00 26.78  ? 207 ALA A C     1 
ATOM   1749 O O     . ALA B 2 206 ? 31.268 40.410 -2.207  1.00 26.21  ? 207 ALA A O     1 
ATOM   1750 C CB    . ALA B 2 206 ? 29.475 37.862 -2.460  1.00 23.42  ? 207 ALA A CB    1 
ATOM   1751 N N     . ASN B 2 207 ? 31.604 39.621 -4.283  1.00 25.71  ? 208 ASN A N     1 
ATOM   1752 C CA    . ASN B 2 207 ? 32.940 40.197 -4.359  1.00 25.10  ? 208 ASN A CA    1 
ATOM   1753 C C     . ASN B 2 207 ? 33.167 41.078 -5.588  1.00 24.22  ? 208 ASN A C     1 
ATOM   1754 O O     . ASN B 2 207 ? 34.295 41.246 -6.043  1.00 25.48  ? 208 ASN A O     1 
ATOM   1755 C CB    . ASN B 2 207 ? 34.027 39.120 -4.225  1.00 26.38  ? 208 ASN A CB    1 
ATOM   1756 C CG    . ASN B 2 207 ? 34.002 38.090 -5.341  1.00 29.82  ? 208 ASN A CG    1 
ATOM   1757 O OD1   . ASN B 2 207 ? 34.847 37.199 -5.370  1.00 34.73  ? 208 ASN A OD1   1 
ATOM   1758 N ND2   . ASN B 2 207 ? 33.041 38.195 -6.251  1.00 27.53  ? 208 ASN A ND2   1 
ATOM   1759 N N     . TYR B 2 208 ? 32.078 41.637 -6.110  1.00 22.22  ? 209 TYR A N     1 
ATOM   1760 C CA    . TYR B 2 208 ? 32.104 42.539 -7.264  1.00 23.66  ? 209 TYR A CA    1 
ATOM   1761 C C     . TYR B 2 208 ? 32.793 41.989 -8.506  1.00 23.99  ? 209 TYR A C     1 
ATOM   1762 O O     . TYR B 2 208 ? 33.398 42.740 -9.272  1.00 24.95  ? 209 TYR A O     1 
ATOM   1763 C CB    . TYR B 2 208 ? 32.736 43.881 -6.875  1.00 23.98  ? 209 TYR A CB    1 
ATOM   1764 C CG    . TYR B 2 208 ? 32.123 44.498 -5.646  1.00 26.58  ? 209 TYR A CG    1 
ATOM   1765 C CD1   . TYR B 2 208 ? 32.618 44.198 -4.378  1.00 26.76  ? 209 TYR A CD1   1 
ATOM   1766 C CD2   . TYR B 2 208 ? 31.030 45.356 -5.742  1.00 28.35  ? 209 TYR A CD2   1 
ATOM   1767 C CE1   . TYR B 2 208 ? 32.040 44.732 -3.236  1.00 32.41  ? 209 TYR A CE1   1 
ATOM   1768 C CE2   . TYR B 2 208 ? 30.442 45.899 -4.600  1.00 32.21  ? 209 TYR A CE2   1 
ATOM   1769 C CZ    . TYR B 2 208 ? 30.954 45.581 -3.350  1.00 33.47  ? 209 TYR A CZ    1 
ATOM   1770 O OH    . TYR B 2 208 ? 30.396 46.112 -2.209  1.00 40.13  ? 209 TYR A OH    1 
ATOM   1771 N N     . GLY B 2 209 ? 32.685 40.684 -8.714  1.00 24.89  ? 210 GLY A N     1 
ATOM   1772 C CA    . GLY B 2 209 ? 33.301 40.073 -9.873  1.00 25.04  ? 210 GLY A CA    1 
ATOM   1773 C C     . GLY B 2 209 ? 34.813 39.986 -9.822  1.00 27.22  ? 210 GLY A C     1 
ATOM   1774 O O     . GLY B 2 209 ? 35.454 39.756 -10.845 1.00 28.43  ? 210 GLY A O     1 
ATOM   1775 N N     . MET B 2 210 ? 35.391 40.205 -8.645  1.00 28.21  ? 211 MET A N     1 
ATOM   1776 C CA    . MET B 2 210 ? 36.837 40.115 -8.479  1.00 29.19  ? 211 MET A CA    1 
ATOM   1777 C C     . MET B 2 210 ? 37.218 38.630 -8.505  1.00 28.64  ? 211 MET A C     1 
ATOM   1778 O O     . MET B 2 210 ? 36.354 37.765 -8.385  1.00 28.50  ? 211 MET A O     1 
ATOM   1779 C CB    . MET B 2 210 ? 37.273 40.799 -7.178  1.00 30.47  ? 211 MET A CB    1 
ATOM   1780 C CG    . MET B 2 210 ? 37.094 42.315 -7.203  1.00 36.85  ? 211 MET A CG    1 
ATOM   1781 S SD    . MET B 2 210 ? 37.622 43.174 -5.701  1.00 43.62  ? 211 MET A SD    1 
ATOM   1782 C CE    . MET B 2 210 ? 39.268 43.660 -6.170  1.00 45.67  ? 211 MET A CE    1 
ATOM   1783 N N     . PRO B 2 211 ? 38.513 38.315 -8.677  1.00 30.10  ? 212 PRO A N     1 
ATOM   1784 C CA    . PRO B 2 211 ? 38.959 36.917 -8.725  1.00 28.01  ? 212 PRO A CA    1 
ATOM   1785 C C     . PRO B 2 211 ? 38.544 36.049 -7.544  1.00 27.76  ? 212 PRO A C     1 
ATOM   1786 O O     . PRO B 2 211 ? 38.575 36.492 -6.401  1.00 26.92  ? 212 PRO A O     1 
ATOM   1787 C CB    . PRO B 2 211 ? 40.481 37.054 -8.788  1.00 28.16  ? 212 PRO A CB    1 
ATOM   1788 C CG    . PRO B 2 211 ? 40.678 38.350 -9.481  1.00 29.88  ? 212 PRO A CG    1 
ATOM   1789 C CD    . PRO B 2 211 ? 39.665 39.225 -8.802  1.00 30.33  ? 212 PRO A CD    1 
ATOM   1790 N N     . ILE B 2 212 ? 38.128 34.818 -7.832  1.00 26.00  ? 213 ILE A N     1 
ATOM   1791 C CA    . ILE B 2 212 ? 37.755 33.877 -6.780  1.00 26.27  ? 213 ILE A CA    1 
ATOM   1792 C C     . ILE B 2 212 ? 39.038 33.204 -6.298  1.00 25.19  ? 213 ILE A C     1 
ATOM   1793 O O     . ILE B 2 212 ? 40.104 33.404 -6.880  1.00 25.34  ? 213 ILE A O     1 
ATOM   1794 C CB    . ILE B 2 212 ? 36.761 32.791 -7.265  1.00 27.66  ? 213 ILE A CB    1 
ATOM   1795 C CG1   . ILE B 2 212 ? 37.406 31.905 -8.334  1.00 30.31  ? 213 ILE A CG1   1 
ATOM   1796 C CG2   . ILE B 2 212 ? 35.483 33.437 -7.778  1.00 29.35  ? 213 ILE A CG2   1 
ATOM   1797 C CD1   . ILE B 2 212 ? 36.591 30.682 -8.679  1.00 30.16  ? 213 ILE A CD1   1 
ATOM   1798 N N     . ASN B 2 213 ? 38.938 32.426 -5.225  1.00 26.74  ? 214 ASN A N     1 
ATOM   1799 C CA    . ASN B 2 213 ? 40.090 31.731 -4.656  1.00 26.68  ? 214 ASN A CA    1 
ATOM   1800 C C     . ASN B 2 213 ? 41.220 32.694 -4.293  1.00 25.31  ? 214 ASN A C     1 
ATOM   1801 O O     . ASN B 2 213 ? 42.396 32.335 -4.355  1.00 24.22  ? 214 ASN A O     1 
ATOM   1802 C CB    . ASN B 2 213 ? 40.596 30.659 -5.629  1.00 28.02  ? 214 ASN A CB    1 
ATOM   1803 C CG    . ASN B 2 213 ? 39.562 29.584 -5.902  1.00 31.84  ? 214 ASN A CG    1 
ATOM   1804 O OD1   . ASN B 2 213 ? 38.553 29.484 -5.208  1.00 34.10  ? 214 ASN A OD1   1 
ATOM   1805 N ND2   . ASN B 2 213 ? 39.814 28.768 -6.915  1.00 36.07  ? 214 ASN A ND2   1 
ATOM   1806 N N     . SER B 2 214 ? 40.851 33.911 -3.899  1.00 25.09  ? 215 SER A N     1 
ATOM   1807 C CA    . SER B 2 214 ? 41.823 34.939 -3.533  1.00 25.86  ? 215 SER A CA    1 
ATOM   1808 C C     . SER B 2 214 ? 41.471 35.615 -2.207  1.00 28.37  ? 215 SER A C     1 
ATOM   1809 O O     . SER B 2 214 ? 40.320 35.582 -1.763  1.00 27.53  ? 215 SER A O     1 
ATOM   1810 C CB    . SER B 2 214 ? 41.901 36.007 -4.629  1.00 24.18  ? 215 SER A CB    1 
ATOM   1811 O OG    . SER B 2 214 ? 42.178 35.436 -5.895  1.00 30.84  ? 215 SER A OG    1 
ATOM   1812 N N     . ASN B 2 215 ? 42.477 36.224 -1.584  1.00 28.79  ? 216 ASN A N     1 
ATOM   1813 C CA    . ASN B 2 215 ? 42.315 36.937 -0.322  1.00 27.94  ? 216 ASN A CA    1 
ATOM   1814 C C     . ASN B 2 215 ? 41.914 38.377 -0.643  1.00 26.69  ? 216 ASN A C     1 
ATOM   1815 O O     . ASN B 2 215 ? 42.753 39.184 -1.037  1.00 27.51  ? 216 ASN A O     1 
ATOM   1816 C CB    . ASN B 2 215 ? 43.638 36.905 0.459   1.00 29.47  ? 216 ASN A CB    1 
ATOM   1817 C CG    . ASN B 2 215 ? 43.581 37.684 1.770   1.00 31.62  ? 216 ASN A CG    1 
ATOM   1818 O OD1   . ASN B 2 215 ? 42.644 38.440 2.027   1.00 29.69  ? 216 ASN A OD1   1 
ATOM   1819 N ND2   . ASN B 2 215 ? 44.600 37.504 2.604   1.00 27.51  ? 216 ASN A ND2   1 
ATOM   1820 N N     . LEU B 2 216 ? 40.634 38.691 -0.462  1.00 24.89  ? 217 LEU A N     1 
ATOM   1821 C CA    . LEU B 2 216 ? 40.106 40.025 -0.742  1.00 25.28  ? 217 LEU A CA    1 
ATOM   1822 C C     . LEU B 2 216 ? 39.778 40.798 0.534   1.00 27.38  ? 217 LEU A C     1 
ATOM   1823 O O     . LEU B 2 216 ? 38.859 41.618 0.551   1.00 27.50  ? 217 LEU A O     1 
ATOM   1824 C CB    . LEU B 2 216 ? 38.846 39.908 -1.608  1.00 26.90  ? 217 LEU A CB    1 
ATOM   1825 C CG    . LEU B 2 216 ? 38.953 39.795 -3.133  1.00 26.79  ? 217 LEU A CG    1 
ATOM   1826 C CD1   . LEU B 2 216 ? 39.943 38.742 -3.543  1.00 30.25  ? 217 LEU A CD1   1 
ATOM   1827 C CD2   . LEU B 2 216 ? 37.590 39.475 -3.710  1.00 27.36  ? 217 LEU A CD2   1 
ATOM   1828 N N     . CYS B 2 217 ? 40.564 40.566 1.582   1.00 28.47  ? 218 CYS A N     1 
ATOM   1829 C CA    . CYS B 2 217 ? 40.355 41.205 2.882   1.00 27.81  ? 218 CYS A CA    1 
ATOM   1830 C C     . CYS B 2 217 ? 40.469 42.734 2.925   1.00 27.97  ? 218 CYS A C     1 
ATOM   1831 O O     . CYS B 2 217 ? 39.662 43.392 3.578   1.00 26.22  ? 218 CYS A O     1 
ATOM   1832 C CB    . CYS B 2 217 ? 41.291 40.579 3.918   1.00 29.78  ? 218 CYS A CB    1 
ATOM   1833 S SG    . CYS B 2 217 ? 40.924 40.995 5.636   1.00 30.75  ? 218 CYS A SG    1 
ATOM   1834 N N     . ILE B 2 218 ? 41.463 43.302 2.244   1.00 29.83  ? 219 ILE A N     1 
ATOM   1835 C CA    . ILE B 2 218 ? 41.646 44.756 2.244   1.00 27.64  ? 219 ILE A CA    1 
ATOM   1836 C C     . ILE B 2 218 ? 40.620 45.446 1.344   1.00 27.21  ? 219 ILE A C     1 
ATOM   1837 O O     . ILE B 2 218 ? 40.595 45.229 0.132   1.00 26.37  ? 219 ILE A O     1 
ATOM   1838 C CB    . ILE B 2 218 ? 43.074 45.154 1.802   1.00 28.19  ? 219 ILE A CB    1 
ATOM   1839 C CG1   . ILE B 2 218 ? 44.110 44.412 2.646   1.00 27.93  ? 219 ILE A CG1   1 
ATOM   1840 C CG2   . ILE B 2 218 ? 43.278 46.655 1.967   1.00 26.02  ? 219 ILE A CG2   1 
ATOM   1841 C CD1   . ILE B 2 218 ? 45.538 44.687 2.238   1.00 31.44  ? 219 ILE A CD1   1 
ATOM   1842 N N     . ASN B 2 219 ? 39.783 46.282 1.954   1.00 26.99  ? 220 ASN A N     1 
ATOM   1843 C CA    . ASN B 2 219 ? 38.731 47.010 1.244   1.00 25.64  ? 220 ASN A CA    1 
ATOM   1844 C C     . ASN B 2 219 ? 39.241 47.956 0.171   1.00 27.91  ? 220 ASN A C     1 
ATOM   1845 O O     . ASN B 2 219 ? 40.228 48.663 0.373   1.00 29.31  ? 220 ASN A O     1 
ATOM   1846 C CB    . ASN B 2 219 ? 37.879 47.818 2.229   1.00 24.11  ? 220 ASN A CB    1 
ATOM   1847 C CG    . ASN B 2 219 ? 37.101 46.950 3.202   1.00 22.52  ? 220 ASN A CG    1 
ATOM   1848 O OD1   . ASN B 2 219 ? 36.377 47.467 4.048   1.00 25.56  ? 220 ASN A OD1   1 
ATOM   1849 N ND2   . ASN B 2 219 ? 37.248 45.637 3.095   1.00 21.22  ? 220 ASN A ND2   1 
ATOM   1850 N N     . LYS B 2 220 ? 38.536 47.981 -0.958  1.00 29.33  ? 221 LYS A N     1 
ATOM   1851 C CA    . LYS B 2 220 ? 38.870 48.853 -2.083  1.00 33.46  ? 221 LYS A CA    1 
ATOM   1852 C C     . LYS B 2 220 ? 38.066 50.143 -1.979  1.00 34.60  ? 221 LYS A C     1 
ATOM   1853 O O     . LYS B 2 220 ? 36.950 50.144 -1.464  1.00 34.69  ? 221 LYS A O     1 
ATOM   1854 C CB    . LYS B 2 220 ? 38.537 48.167 -3.411  1.00 38.86  ? 221 LYS A CB    1 
ATOM   1855 C CG    . LYS B 2 220 ? 39.454 47.013 -3.771  1.00 48.39  ? 221 LYS A CG    1 
ATOM   1856 C CD    . LYS B 2 220 ? 40.459 47.397 -4.854  1.00 54.12  ? 221 LYS A CD    1 
ATOM   1857 C CE    . LYS B 2 220 ? 39.862 47.309 -6.261  1.00 55.53  ? 221 LYS A CE    1 
ATOM   1858 N NZ    . LYS B 2 220 ? 38.719 48.232 -6.491  1.00 54.53  ? 221 LYS A NZ    1 
ATOM   1859 N N     . PHE B 2 221 ? 38.635 51.241 -2.462  1.00 36.84  ? 222 PHE A N     1 
ATOM   1860 C CA    . PHE B 2 221 ? 37.955 52.530 -2.427  1.00 39.77  ? 222 PHE A CA    1 
ATOM   1861 C C     . PHE B 2 221 ? 37.826 53.106 -3.829  1.00 44.73  ? 222 PHE A C     1 
ATOM   1862 O O     . PHE B 2 221 ? 38.746 53.750 -4.327  1.00 49.57  ? 222 PHE A O     1 
ATOM   1863 C CB    . PHE B 2 221 ? 38.705 53.521 -1.528  1.00 37.52  ? 222 PHE A CB    1 
ATOM   1864 C CG    . PHE B 2 221 ? 38.559 53.244 -0.060  1.00 36.02  ? 222 PHE A CG    1 
ATOM   1865 C CD1   . PHE B 2 221 ? 37.464 53.729 0.644   1.00 35.11  ? 222 PHE A CD1   1 
ATOM   1866 C CD2   . PHE B 2 221 ? 39.511 52.493 0.618   1.00 37.06  ? 222 PHE A CD2   1 
ATOM   1867 C CE1   . PHE B 2 221 ? 37.317 53.467 2.003   1.00 33.62  ? 222 PHE A CE1   1 
ATOM   1868 C CE2   . PHE B 2 221 ? 39.372 52.226 1.981   1.00 36.68  ? 222 PHE A CE2   1 
ATOM   1869 C CZ    . PHE B 2 221 ? 38.271 52.714 2.673   1.00 33.69  ? 222 PHE A CZ    1 
ATOM   1870 N N     . VAL B 2 222 ? 36.691 52.851 -4.473  1.00 49.64  ? 223 VAL A N     1 
ATOM   1871 C CA    . VAL B 2 222 ? 36.449 53.361 -5.818  1.00 52.02  ? 223 VAL A CA    1 
ATOM   1872 C C     . VAL B 2 222 ? 35.742 54.713 -5.751  1.00 57.65  ? 223 VAL A C     1 
ATOM   1873 O O     . VAL B 2 222 ? 35.578 55.287 -4.671  1.00 55.34  ? 223 VAL A O     1 
ATOM   1874 C CB    . VAL B 2 222 ? 35.604 52.374 -6.675  1.00 47.40  ? 223 VAL A CB    1 
ATOM   1875 C CG1   . VAL B 2 222 ? 36.294 51.028 -6.764  1.00 45.36  ? 223 VAL A CG1   1 
ATOM   1876 C CG2   . VAL B 2 222 ? 34.206 52.221 -6.104  1.00 45.30  ? 223 VAL A CG2   1 
ATOM   1877 N N     . ASN B 2 223 ? 35.354 55.221 -6.916  1.00 65.48  ? 224 ASN A N     1 
ATOM   1878 C CA    . ASN B 2 223 ? 34.658 56.497 -7.032  1.00 73.86  ? 224 ASN A CA    1 
ATOM   1879 C C     . ASN B 2 223 ? 34.254 56.683 -8.486  1.00 79.34  ? 224 ASN A C     1 
ATOM   1880 O O     . ASN B 2 223 ? 35.029 56.366 -9.391  1.00 82.10  ? 224 ASN A O     1 
ATOM   1881 C CB    . ASN B 2 223 ? 35.561 57.657 -6.580  1.00 75.15  ? 224 ASN A CB    1 
ATOM   1882 C CG    . ASN B 2 223 ? 36.868 57.731 -7.358  1.00 76.49  ? 224 ASN A CG    1 
ATOM   1883 O OD1   . ASN B 2 223 ? 37.056 58.615 -8.192  1.00 78.22  ? 224 ASN A OD1   1 
ATOM   1884 N ND2   . ASN B 2 223 ? 37.781 56.807 -7.078  1.00 77.40  ? 224 ASN A ND2   1 
ATOM   1885 N N     . HIS B 2 224 ? 33.028 57.140 -8.718  1.00 85.69  ? 225 HIS A N     1 
ATOM   1886 C CA    . HIS B 2 224 ? 32.571 57.357 -10.086 1.00 91.74  ? 225 HIS A CA    1 
ATOM   1887 C C     . HIS B 2 224 ? 33.037 58.732 -10.552 1.00 93.37  ? 225 HIS A C     1 
ATOM   1888 O O     . HIS B 2 224 ? 33.936 58.844 -11.391 1.00 93.31  ? 225 HIS A O     1 
ATOM   1889 C CB    . HIS B 2 224 ? 31.048 57.248 -10.185 1.00 94.58  ? 225 HIS A CB    1 
ATOM   1890 C CG    . HIS B 2 224 ? 30.534 57.269 -11.592 1.00 97.23  ? 225 HIS A CG    1 
ATOM   1891 N ND1   . HIS B 2 224 ? 31.065 56.480 -12.590 1.00 97.91  ? 225 HIS A ND1   1 
ATOM   1892 C CD2   . HIS B 2 224 ? 29.540 57.986 -12.169 1.00 98.31  ? 225 HIS A CD2   1 
ATOM   1893 C CE1   . HIS B 2 224 ? 30.421 56.709 -13.721 1.00 99.46  ? 225 HIS A CE1   1 
ATOM   1894 N NE2   . HIS B 2 224 ? 29.492 57.619 -13.492 1.00 100.00 ? 225 HIS A NE2   1 
ATOM   1895 N N     . LYS B 2 225 ? 32.429 59.773 -9.988  1.00 94.38  ? 226 LYS A N     1 
ATOM   1896 C CA    . LYS B 2 225 ? 32.774 61.150 -10.318 1.00 95.27  ? 226 LYS A CA    1 
ATOM   1897 C C     . LYS B 2 225 ? 32.798 61.962 -9.030  1.00 93.80  ? 226 LYS A C     1 
ATOM   1898 O O     . LYS B 2 225 ? 31.786 62.544 -8.635  1.00 93.93  ? 226 LYS A O     1 
ATOM   1899 C CB    . LYS B 2 225 ? 31.763 61.743 -11.310 1.00 97.02  ? 226 LYS A CB    1 
ATOM   1900 C CG    . LYS B 2 225 ? 31.816 61.133 -12.710 1.00 98.52  ? 226 LYS A CG    1 
ATOM   1901 C CD    . LYS B 2 225 ? 33.171 61.369 -13.377 1.00 99.88  ? 226 LYS A CD    1 
ATOM   1902 C CE    . LYS B 2 225 ? 33.325 60.558 -14.660 1.00 99.89  ? 226 LYS A CE    1 
ATOM   1903 N NZ    . LYS B 2 225 ? 33.312 59.085 -14.413 1.00 99.72  ? 226 LYS A NZ    1 
ATOM   1904 N N     . ASP B 2 226 ? 33.959 61.971 -8.373  1.00 92.35  ? 227 ASP A N     1 
ATOM   1905 C CA    . ASP B 2 226 ? 34.153 62.689 -7.114  1.00 90.88  ? 227 ASP A CA    1 
ATOM   1906 C C     . ASP B 2 226 ? 33.048 62.277 -6.147  1.00 88.26  ? 227 ASP A C     1 
ATOM   1907 O O     . ASP B 2 226 ? 32.110 63.038 -5.898  1.00 88.00  ? 227 ASP A O     1 
ATOM   1908 C CB    . ASP B 2 226 ? 34.132 64.203 -7.351  1.00 94.07  ? 227 ASP A CB    1 
ATOM   1909 C CG    . ASP B 2 226 ? 34.461 64.994 -6.100  1.00 97.53  ? 227 ASP A CG    1 
ATOM   1910 O OD1   . ASP B 2 226 ? 35.662 65.140 -5.786  1.00 98.88  ? 227 ASP A OD1   1 
ATOM   1911 O OD2   . ASP B 2 226 ? 33.519 65.469 -5.431  1.00 99.92  ? 227 ASP A OD2   1 
ATOM   1912 N N     . LYS B 2 227 ? 33.163 61.067 -5.609  1.00 84.39  ? 228 LYS A N     1 
ATOM   1913 C CA    . LYS B 2 227 ? 32.146 60.548 -4.707  1.00 78.67  ? 228 LYS A CA    1 
ATOM   1914 C C     . LYS B 2 227 ? 32.711 59.747 -3.528  1.00 74.95  ? 228 LYS A C     1 
ATOM   1915 O O     . LYS B 2 227 ? 32.395 60.036 -2.371  1.00 74.45  ? 228 LYS A O     1 
ATOM   1916 C CB    . LYS B 2 227 ? 31.153 59.700 -5.519  1.00 76.97  ? 228 LYS A CB    1 
ATOM   1917 C CG    . LYS B 2 227 ? 29.837 59.403 -4.813  1.00 73.49  ? 228 LYS A CG    1 
ATOM   1918 C CD    . LYS B 2 227 ? 28.766 58.902 -5.781  1.00 66.38  ? 228 LYS A CD    1 
ATOM   1919 C CE    . LYS B 2 227 ? 29.164 57.599 -6.454  1.00 62.56  ? 228 LYS A CE    1 
ATOM   1920 N NZ    . LYS B 2 227 ? 28.052 57.057 -7.279  1.00 55.72  ? 228 LYS A NZ    1 
ATOM   1921 N N     . SER B 2 228 ? 33.552 58.759 -3.836  1.00 70.03  ? 229 SER A N     1 
ATOM   1922 C CA    . SER B 2 228 ? 34.182 57.870 -2.848  1.00 62.82  ? 229 SER A CA    1 
ATOM   1923 C C     . SER B 2 228 ? 33.237 56.831 -2.237  1.00 58.18  ? 229 SER A C     1 
ATOM   1924 O O     . SER B 2 228 ? 32.250 57.164 -1.578  1.00 57.16  ? 229 SER A O     1 
ATOM   1925 C CB    . SER B 2 228 ? 34.885 58.654 -1.737  1.00 61.28  ? 229 SER A CB    1 
ATOM   1926 O OG    . SER B 2 228 ? 35.458 57.765 -0.792  1.00 55.43  ? 229 SER A OG    1 
ATOM   1927 N N     . ILE B 2 229 ? 33.568 55.565 -2.458  1.00 51.18  ? 230 ILE A N     1 
ATOM   1928 C CA    . ILE B 2 229 ? 32.783 54.447 -1.955  1.00 44.09  ? 230 ILE A CA    1 
ATOM   1929 C C     . ILE B 2 229 ? 33.756 53.385 -1.458  1.00 40.41  ? 230 ILE A C     1 
ATOM   1930 O O     . ILE B 2 229 ? 34.855 53.246 -1.992  1.00 37.37  ? 230 ILE A O     1 
ATOM   1931 C CB    . ILE B 2 229 ? 31.936 53.803 -3.084  1.00 46.03  ? 230 ILE A CB    1 
ATOM   1932 C CG1   . ILE B 2 229 ? 31.099 54.859 -3.807  1.00 44.30  ? 230 ILE A CG1   1 
ATOM   1933 C CG2   . ILE B 2 229 ? 31.029 52.717 -2.511  1.00 48.46  ? 230 ILE A CG2   1 
ATOM   1934 C CD1   . ILE B 2 229 ? 30.369 54.323 -5.016  1.00 44.33  ? 230 ILE A CD1   1 
ATOM   1935 N N     . MET B 2 230 ? 33.359 52.649 -0.426  1.00 35.25  ? 231 MET A N     1 
ATOM   1936 C CA    . MET B 2 230 ? 34.197 51.586 0.104   1.00 32.20  ? 231 MET A CA    1 
ATOM   1937 C C     . MET B 2 230 ? 33.533 50.255 -0.210  1.00 32.21  ? 231 MET A C     1 
ATOM   1938 O O     . MET B 2 230 ? 32.366 50.039 0.119   1.00 35.81  ? 231 MET A O     1 
ATOM   1939 C CB    . MET B 2 230 ? 34.380 51.735 1.610   1.00 32.99  ? 231 MET A CB    1 
ATOM   1940 C CG    . MET B 2 230 ? 35.239 50.646 2.219   1.00 30.21  ? 231 MET A CG    1 
ATOM   1941 S SD    . MET B 2 230 ? 35.457 50.841 3.981   1.00 30.51  ? 231 MET A SD    1 
ATOM   1942 C CE    . MET B 2 230 ? 33.937 50.136 4.573   1.00 25.90  ? 231 MET A CE    1 
ATOM   1943 N N     . LEU B 2 231 ? 34.273 49.369 -0.863  1.00 29.76  ? 232 LEU A N     1 
ATOM   1944 C CA    . LEU B 2 231 ? 33.750 48.062 -1.231  1.00 27.64  ? 232 LEU A CA    1 
ATOM   1945 C C     . LEU B 2 231 ? 34.152 46.990 -0.232  1.00 27.83  ? 232 LEU A C     1 
ATOM   1946 O O     . LEU B 2 231 ? 35.300 46.934 0.202   1.00 30.82  ? 232 LEU A O     1 
ATOM   1947 C CB    . LEU B 2 231 ? 34.243 47.667 -2.623  1.00 27.90  ? 232 LEU A CB    1 
ATOM   1948 C CG    . LEU B 2 231 ? 34.018 48.654 -3.768  1.00 26.88  ? 232 LEU A CG    1 
ATOM   1949 C CD1   . LEU B 2 231 ? 34.446 47.999 -5.067  1.00 27.68  ? 232 LEU A CD1   1 
ATOM   1950 C CD2   . LEU B 2 231 ? 32.560 49.077 -3.838  1.00 26.08  ? 232 LEU A CD2   1 
ATOM   1951 N N     . GLN B 2 232 ? 33.190 46.156 0.146   1.00 26.15  ? 233 GLN A N     1 
ATOM   1952 C CA    . GLN B 2 232 ? 33.444 45.069 1.078   1.00 25.01  ? 233 GLN A CA    1 
ATOM   1953 C C     . GLN B 2 232 ? 33.245 43.765 0.316   1.00 25.85  ? 233 GLN A C     1 
ATOM   1954 O O     . GLN B 2 232 ? 32.119 43.301 0.135   1.00 27.05  ? 233 GLN A O     1 
ATOM   1955 C CB    . GLN B 2 232 ? 32.501 45.160 2.275   1.00 23.63  ? 233 GLN A CB    1 
ATOM   1956 C CG    . GLN B 2 232 ? 32.739 46.393 3.136   1.00 25.40  ? 233 GLN A CG    1 
ATOM   1957 C CD    . GLN B 2 232 ? 31.653 46.608 4.165   1.00 27.14  ? 233 GLN A CD    1 
ATOM   1958 O OE1   . GLN B 2 232 ? 30.555 47.054 3.835   1.00 26.16  ? 233 GLN A OE1   1 
ATOM   1959 N NE2   . GLN B 2 232 ? 31.949 46.286 5.421   1.00 25.61  ? 233 GLN A NE2   1 
ATOM   1960 N N     . ALA B 2 233 ? 34.352 43.215 -0.176  1.00 26.15  ? 234 ALA A N     1 
ATOM   1961 C CA    . ALA B 2 233 ? 34.341 41.978 -0.947  1.00 23.87  ? 234 ALA A CA    1 
ATOM   1962 C C     . ALA B 2 233 ? 34.710 40.748 -0.127  1.00 23.54  ? 234 ALA A C     1 
ATOM   1963 O O     . ALA B 2 233 ? 35.733 40.726 0.561   1.00 21.90  ? 234 ALA A O     1 
ATOM   1964 C CB    . ALA B 2 233 ? 35.274 42.108 -2.145  1.00 20.34  ? 234 ALA A CB    1 
ATOM   1965 N N     . ALA B 2 234 ? 33.866 39.725 -0.217  1.00 24.44  ? 235 ALA A N     1 
ATOM   1966 C CA    . ALA B 2 234 ? 34.080 38.469 0.490   1.00 24.79  ? 235 ALA A CA    1 
ATOM   1967 C C     . ALA B 2 234 ? 35.002 37.561 -0.322  1.00 26.64  ? 235 ALA A C     1 
ATOM   1968 O O     . ALA B 2 234 ? 34.982 37.594 -1.553  1.00 26.43  ? 235 ALA A O     1 
ATOM   1969 C CB    . ALA B 2 234 ? 32.747 37.775 0.723   1.00 21.86  ? 235 ALA A CB    1 
ATOM   1970 N N     . SER B 2 235 ? 35.835 36.788 0.371   1.00 26.71  ? 236 SER A N     1 
ATOM   1971 C CA    . SER B 2 235 ? 36.742 35.844 -0.278  1.00 25.80  ? 236 SER A CA    1 
ATOM   1972 C C     . SER B 2 235 ? 35.961 34.563 -0.560  1.00 27.89  ? 236 SER A C     1 
ATOM   1973 O O     . SER B 2 235 ? 35.551 33.860 0.364   1.00 28.57  ? 236 SER A O     1 
ATOM   1974 C CB    . SER B 2 235 ? 37.940 35.539 0.620   1.00 24.94  ? 236 SER A CB    1 
ATOM   1975 O OG    . SER B 2 235 ? 38.712 36.701 0.830   1.00 25.60  ? 236 SER A OG    1 
ATOM   1976 N N     . ILE B 2 236 ? 35.736 34.280 -1.839  1.00 25.67  ? 237 ILE A N     1 
ATOM   1977 C CA    . ILE B 2 236 ? 34.980 33.102 -2.247  1.00 23.92  ? 237 ILE A CA    1 
ATOM   1978 C C     . ILE B 2 236 ? 35.889 32.009 -2.800  1.00 26.26  ? 237 ILE A C     1 
ATOM   1979 O O     . ILE B 2 236 ? 36.387 32.111 -3.916  1.00 27.05  ? 237 ILE A O     1 
ATOM   1980 C CB    . ILE B 2 236 ? 33.917 33.483 -3.297  1.00 21.76  ? 237 ILE A CB    1 
ATOM   1981 C CG1   . ILE B 2 236 ? 33.015 34.587 -2.740  1.00 23.56  ? 237 ILE A CG1   1 
ATOM   1982 C CG2   . ILE B 2 236 ? 33.079 32.279 -3.668  1.00 21.75  ? 237 ILE A CG2   1 
ATOM   1983 C CD1   . ILE B 2 236 ? 32.022 35.134 -3.734  1.00 25.17  ? 237 ILE A CD1   1 
ATOM   1984 N N     . TYR B 2 237 ? 36.121 30.977 -1.998  1.00 26.86  ? 238 TYR A N     1 
ATOM   1985 C CA    . TYR B 2 237 ? 36.966 29.860 -2.403  1.00 28.61  ? 238 TYR A CA    1 
ATOM   1986 C C     . TYR B 2 237 ? 36.110 28.660 -2.774  1.00 31.72  ? 238 TYR A C     1 
ATOM   1987 O O     . TYR B 2 237 ? 35.151 28.338 -2.080  1.00 33.05  ? 238 TYR A O     1 
ATOM   1988 C CB    . TYR B 2 237 ? 37.928 29.477 -1.279  1.00 26.81  ? 238 TYR A CB    1 
ATOM   1989 C CG    . TYR B 2 237 ? 39.052 30.461 -1.055  1.00 25.39  ? 238 TYR A CG    1 
ATOM   1990 C CD1   . TYR B 2 237 ? 38.828 31.672 -0.402  1.00 24.60  ? 238 TYR A CD1   1 
ATOM   1991 C CD2   . TYR B 2 237 ? 40.345 30.171 -1.478  1.00 23.57  ? 238 TYR A CD2   1 
ATOM   1992 C CE1   . TYR B 2 237 ? 39.867 32.569 -0.170  1.00 25.40  ? 238 TYR A CE1   1 
ATOM   1993 C CE2   . TYR B 2 237 ? 41.393 31.059 -1.253  1.00 26.27  ? 238 TYR A CE2   1 
ATOM   1994 C CZ    . TYR B 2 237 ? 41.147 32.256 -0.597  1.00 27.69  ? 238 TYR A CZ    1 
ATOM   1995 O OH    . TYR B 2 237 ? 42.185 33.126 -0.353  1.00 30.69  ? 238 TYR A OH    1 
ATOM   1996 N N     . THR B 2 238 ? 36.471 27.985 -3.858  1.00 33.48  ? 239 THR A N     1 
ATOM   1997 C CA    . THR B 2 238 ? 35.713 26.825 -4.303  1.00 34.47  ? 239 THR A CA    1 
ATOM   1998 C C     . THR B 2 238 ? 36.601 25.637 -4.638  1.00 36.60  ? 239 THR A C     1 
ATOM   1999 O O     . THR B 2 238 ? 37.773 25.796 -4.985  1.00 36.05  ? 239 THR A O     1 
ATOM   2000 C CB    . THR B 2 238 ? 34.859 27.158 -5.551  1.00 36.11  ? 239 THR A CB    1 
ATOM   2001 O OG1   . THR B 2 238 ? 34.077 26.015 -5.916  1.00 38.05  ? 239 THR A OG1   1 
ATOM   2002 C CG2   . THR B 2 238 ? 35.749 27.544 -6.730  1.00 31.74  ? 239 THR A CG2   1 
ATOM   2003 N N     . GLN B 2 239 ? 36.041 24.444 -4.487  1.00 37.66  ? 240 GLN A N     1 
ATOM   2004 C CA    . GLN B 2 239 ? 36.751 23.221 -4.823  1.00 40.50  ? 240 GLN A CA    1 
ATOM   2005 C C     . GLN B 2 239 ? 36.146 22.833 -6.170  1.00 40.49  ? 240 GLN A C     1 
ATOM   2006 O O     . GLN B 2 239 ? 35.138 22.128 -6.232  1.00 39.30  ? 240 GLN A O     1 
ATOM   2007 C CB    . GLN B 2 239 ? 36.495 22.140 -3.767  1.00 42.62  ? 240 GLN A CB    1 
ATOM   2008 C CG    . GLN B 2 239 ? 37.445 20.948 -3.842  1.00 43.91  ? 240 GLN A CG    1 
ATOM   2009 C CD    . GLN B 2 239 ? 38.902 21.348 -3.711  1.00 46.83  ? 240 GLN A CD    1 
ATOM   2010 O OE1   . GLN B 2 239 ? 39.270 22.136 -2.838  1.00 49.14  ? 240 GLN A OE1   1 
ATOM   2011 N NE2   . GLN B 2 239 ? 39.740 20.812 -4.588  1.00 48.62  ? 240 GLN A NE2   1 
ATOM   2012 N N     . GLY B 2 240 ? 36.727 23.368 -7.241  1.00 41.43  ? 241 GLY A N     1 
ATOM   2013 C CA    . GLY B 2 240 ? 36.228 23.108 -8.581  1.00 45.86  ? 241 GLY A CA    1 
ATOM   2014 C C     . GLY B 2 240 ? 36.436 21.713 -9.132  1.00 47.34  ? 241 GLY A C     1 
ATOM   2015 O O     . GLY B 2 240 ? 35.926 21.388 -10.203 1.00 46.78  ? 241 GLY A O     1 
ATOM   2016 N N     . ASP B 2 241 ? 37.197 20.898 -8.410  1.00 50.92  ? 242 ASP A N     1 
ATOM   2017 C CA    . ASP B 2 241 ? 37.478 19.526 -8.814  1.00 54.31  ? 242 ASP A CA    1 
ATOM   2018 C C     . ASP B 2 241 ? 36.241 18.658 -8.619  1.00 53.83  ? 242 ASP A C     1 
ATOM   2019 O O     . ASP B 2 241 ? 36.005 17.717 -9.369  1.00 54.23  ? 242 ASP A O     1 
ATOM   2020 C CB    . ASP B 2 241 ? 38.628 18.959 -7.973  1.00 60.19  ? 242 ASP A CB    1 
ATOM   2021 C CG    . ASP B 2 241 ? 39.902 19.779 -8.091  1.00 67.50  ? 242 ASP A CG    1 
ATOM   2022 O OD1   . ASP B 2 241 ? 39.929 20.926 -7.593  1.00 69.45  ? 242 ASP A OD1   1 
ATOM   2023 O OD2   . ASP B 2 241 ? 40.881 19.272 -8.678  1.00 72.65  ? 242 ASP A OD2   1 
ATOM   2024 N N     . GLY B 2 242 ? 35.448 19.001 -7.610  1.00 54.64  ? 243 GLY A N     1 
ATOM   2025 C CA    . GLY B 2 242 ? 34.253 18.241 -7.301  1.00 54.37  ? 243 GLY A CA    1 
ATOM   2026 C C     . GLY B 2 242 ? 34.455 17.477 -6.007  1.00 55.88  ? 243 GLY A C     1 
ATOM   2027 O O     . GLY B 2 242 ? 33.498 16.986 -5.408  1.00 56.53  ? 243 GLY A O     1 
ATOM   2028 N N     . ARG B 2 243 ? 35.710 17.392 -5.573  1.00 56.54  ? 244 ARG A N     1 
ATOM   2029 C CA    . ARG B 2 243 ? 36.070 16.692 -4.346  1.00 57.35  ? 244 ARG A CA    1 
ATOM   2030 C C     . ARG B 2 243 ? 35.837 17.517 -3.084  1.00 54.42  ? 244 ARG A C     1 
ATOM   2031 O O     . ARG B 2 243 ? 35.470 18.691 -3.149  1.00 52.96  ? 244 ARG A O     1 
ATOM   2032 C CB    . ARG B 2 243 ? 37.533 16.237 -4.400  1.00 61.69  ? 244 ARG A CB    1 
ATOM   2033 C CG    . ARG B 2 243 ? 37.788 15.050 -5.314  1.00 69.70  ? 244 ARG A CG    1 
ATOM   2034 C CD    . ARG B 2 243 ? 36.837 13.894 -5.005  1.00 78.29  ? 244 ARG A CD    1 
ATOM   2035 N NE    . ARG B 2 243 ? 36.804 13.547 -3.583  1.00 83.96  ? 244 ARG A NE    1 
ATOM   2036 C CZ    . ARG B 2 243 ? 37.534 12.587 -3.022  1.00 87.12  ? 244 ARG A CZ    1 
ATOM   2037 N NH1   . ARG B 2 243 ? 38.369 11.861 -3.756  1.00 87.97  ? 244 ARG A NH1   1 
ATOM   2038 N NH2   . ARG B 2 243 ? 37.421 12.344 -1.723  1.00 88.68  ? 244 ARG A NH2   1 
ATOM   2039 N N     . GLU B 2 244 ? 36.048 16.882 -1.935  1.00 50.88  ? 245 GLU A N     1 
ATOM   2040 C CA    . GLU B 2 244 ? 35.870 17.534 -0.646  1.00 48.59  ? 245 GLU A CA    1 
ATOM   2041 C C     . GLU B 2 244 ? 37.057 18.433 -0.334  1.00 43.71  ? 245 GLU A C     1 
ATOM   2042 O O     . GLU B 2 244 ? 38.142 18.253 -0.884  1.00 41.93  ? 245 GLU A O     1 
ATOM   2043 C CB    . GLU B 2 244 ? 35.719 16.491 0.462   1.00 54.96  ? 245 GLU A CB    1 
ATOM   2044 C CG    . GLU B 2 244 ? 34.542 15.542 0.281   1.00 64.85  ? 245 GLU A CG    1 
ATOM   2045 C CD    . GLU B 2 244 ? 34.417 14.541 1.419   1.00 71.04  ? 245 GLU A CD    1 
ATOM   2046 O OE1   . GLU B 2 244 ? 35.374 13.767 1.643   1.00 74.53  ? 245 GLU A OE1   1 
ATOM   2047 O OE2   . GLU B 2 244 ? 33.361 14.524 2.089   1.00 73.90  ? 245 GLU A OE2   1 
ATOM   2048 N N     . TRP B 2 245 ? 36.835 19.404 0.549   1.00 39.92  ? 246 TRP A N     1 
ATOM   2049 C CA    . TRP B 2 245 ? 37.873 20.343 0.964   1.00 36.18  ? 246 TRP A CA    1 
ATOM   2050 C C     . TRP B 2 245 ? 38.877 19.698 1.910   1.00 36.29  ? 246 TRP A C     1 
ATOM   2051 O O     . TRP B 2 245 ? 38.511 18.891 2.769   1.00 36.92  ? 246 TRP A O     1 
ATOM   2052 C CB    . TRP B 2 245 ? 37.248 21.560 1.656   1.00 33.80  ? 246 TRP A CB    1 
ATOM   2053 C CG    . TRP B 2 245 ? 36.983 22.716 0.745   1.00 31.11  ? 246 TRP A CG    1 
ATOM   2054 C CD1   . TRP B 2 245 ? 35.789 23.062 0.181   1.00 29.71  ? 246 TRP A CD1   1 
ATOM   2055 C CD2   . TRP B 2 245 ? 37.943 23.671 0.273   1.00 29.79  ? 246 TRP A CD2   1 
ATOM   2056 N NE1   . TRP B 2 245 ? 35.948 24.170 -0.617  1.00 32.12  ? 246 TRP A NE1   1 
ATOM   2057 C CE2   . TRP B 2 245 ? 37.261 24.564 -0.581  1.00 30.12  ? 246 TRP A CE2   1 
ATOM   2058 C CE3   . TRP B 2 245 ? 39.317 23.856 0.485   1.00 29.37  ? 246 TRP A CE3   1 
ATOM   2059 C CZ2   . TRP B 2 245 ? 37.903 25.627 -1.227  1.00 26.30  ? 246 TRP A CZ2   1 
ATOM   2060 C CZ3   . TRP B 2 245 ? 39.957 24.915 -0.159  1.00 28.41  ? 246 TRP A CZ3   1 
ATOM   2061 C CH2   . TRP B 2 245 ? 39.248 25.784 -1.004  1.00 25.40  ? 246 TRP A CH2   1 
ATOM   2062 N N     . ASP B 2 246 ? 40.146 20.053 1.741   1.00 35.35  ? 247 ASP A N     1 
ATOM   2063 C CA    . ASP B 2 246 ? 41.209 19.536 2.595   1.00 36.33  ? 247 ASP A CA    1 
ATOM   2064 C C     . ASP B 2 246 ? 41.360 20.496 3.780   1.00 35.41  ? 247 ASP A C     1 
ATOM   2065 O O     . ASP B 2 246 ? 41.526 21.700 3.589   1.00 34.55  ? 247 ASP A O     1 
ATOM   2066 C CB    . ASP B 2 246 ? 42.514 19.438 1.799   1.00 39.38  ? 247 ASP A CB    1 
ATOM   2067 C CG    . ASP B 2 246 ? 43.659 18.857 2.608   1.00 47.42  ? 247 ASP A CG    1 
ATOM   2068 O OD1   . ASP B 2 246 ? 43.422 17.962 3.449   1.00 56.49  ? 247 ASP A OD1   1 
ATOM   2069 O OD2   . ASP B 2 246 ? 44.808 19.291 2.391   1.00 50.72  ? 247 ASP A OD2   1 
ATOM   2070 N N     . SER B 2 247 ? 41.285 19.962 4.997   1.00 34.58  ? 248 SER A N     1 
ATOM   2071 C CA    . SER B 2 247 ? 41.395 20.775 6.209   1.00 33.02  ? 248 SER A CA    1 
ATOM   2072 C C     . SER B 2 247 ? 42.684 21.575 6.335   1.00 33.45  ? 248 SER A C     1 
ATOM   2073 O O     . SER B 2 247 ? 42.680 22.678 6.885   1.00 31.47  ? 248 SER A O     1 
ATOM   2074 C CB    . SER B 2 247 ? 41.200 19.914 7.454   1.00 33.49  ? 248 SER A CB    1 
ATOM   2075 O OG    . SER B 2 247 ? 39.845 19.540 7.591   1.00 33.56  ? 248 SER A OG    1 
ATOM   2076 N N     . LYS B 2 248 ? 43.782 21.019 5.831   1.00 33.51  ? 249 LYS A N     1 
ATOM   2077 C CA    . LYS B 2 248 ? 45.069 21.702 5.891   1.00 33.99  ? 249 LYS A CA    1 
ATOM   2078 C C     . LYS B 2 248 ? 45.052 22.965 5.029   1.00 33.49  ? 249 LYS A C     1 
ATOM   2079 O O     . LYS B 2 248 ? 45.534 24.015 5.457   1.00 30.99  ? 249 LYS A O     1 
ATOM   2080 C CB    . LYS B 2 248 ? 46.195 20.761 5.453   1.00 36.81  ? 249 LYS A CB    1 
ATOM   2081 C CG    . LYS B 2 248 ? 47.597 21.247 5.812   1.00 43.18  ? 249 LYS A CG    1 
ATOM   2082 C CD    . LYS B 2 248 ? 48.320 21.874 4.635   1.00 51.08  ? 249 LYS A CD    1 
ATOM   2083 C CE    . LYS B 2 248 ? 48.708 20.831 3.598   1.00 56.28  ? 249 LYS A CE    1 
ATOM   2084 N NZ    . LYS B 2 248 ? 49.418 21.434 2.434   1.00 57.54  ? 249 LYS A NZ    1 
ATOM   2085 N N     . ILE B 2 249 ? 44.478 22.869 3.829   1.00 32.08  ? 250 ILE A N     1 
ATOM   2086 C CA    . ILE B 2 249 ? 44.407 24.021 2.937   1.00 32.73  ? 250 ILE A CA    1 
ATOM   2087 C C     . ILE B 2 249 ? 43.349 25.028 3.384   1.00 33.17  ? 250 ILE A C     1 
ATOM   2088 O O     . ILE B 2 249 ? 43.430 26.201 3.031   1.00 35.67  ? 250 ILE A O     1 
ATOM   2089 C CB    . ILE B 2 249 ? 44.207 23.627 1.451   1.00 32.62  ? 250 ILE A CB    1 
ATOM   2090 C CG1   . ILE B 2 249 ? 42.877 22.903 1.251   1.00 39.44  ? 250 ILE A CG1   1 
ATOM   2091 C CG2   . ILE B 2 249 ? 45.362 22.767 0.983   1.00 33.77  ? 250 ILE A CG2   1 
ATOM   2092 C CD1   . ILE B 2 249 ? 42.613 22.472 -0.183  1.00 42.30  ? 250 ILE A CD1   1 
ATOM   2093 N N     . MET B 2 250 ? 42.363 24.574 4.159   1.00 32.37  ? 251 MET A N     1 
ATOM   2094 C CA    . MET B 2 250 ? 41.334 25.473 4.683   1.00 31.01  ? 251 MET A CA    1 
ATOM   2095 C C     . MET B 2 250 ? 41.978 26.338 5.759   1.00 30.78  ? 251 MET A C     1 
ATOM   2096 O O     . MET B 2 250 ? 41.739 27.542 5.828   1.00 28.87  ? 251 MET A O     1 
ATOM   2097 C CB    . MET B 2 250 ? 40.176 24.699 5.318   1.00 36.40  ? 251 MET A CB    1 
ATOM   2098 C CG    . MET B 2 250 ? 39.144 24.160 4.348   1.00 42.27  ? 251 MET A CG    1 
ATOM   2099 S SD    . MET B 2 250 ? 37.556 23.870 5.170   1.00 48.55  ? 251 MET A SD    1 
ATOM   2100 C CE    . MET B 2 250 ? 37.930 22.407 6.120   1.00 48.40  ? 251 MET A CE    1 
ATOM   2101 N N     . PHE B 2 251 ? 42.811 25.706 6.584   1.00 30.28  ? 252 PHE A N     1 
ATOM   2102 C CA    . PHE B 2 251 ? 43.517 26.378 7.670   1.00 29.18  ? 252 PHE A CA    1 
ATOM   2103 C C     . PHE B 2 251 ? 44.482 27.445 7.166   1.00 28.22  ? 252 PHE A C     1 
ATOM   2104 O O     . PHE B 2 251 ? 44.537 28.539 7.718   1.00 29.67  ? 252 PHE A O     1 
ATOM   2105 C CB    . PHE B 2 251 ? 44.270 25.350 8.524   1.00 28.46  ? 252 PHE A CB    1 
ATOM   2106 C CG    . PHE B 2 251 ? 45.160 25.961 9.568   1.00 27.33  ? 252 PHE A CG    1 
ATOM   2107 C CD1   . PHE B 2 251 ? 44.623 26.492 10.735  1.00 29.38  ? 252 PHE A CD1   1 
ATOM   2108 C CD2   . PHE B 2 251 ? 46.539 26.019 9.376   1.00 30.29  ? 252 PHE A CD2   1 
ATOM   2109 C CE1   . PHE B 2 251 ? 45.445 27.074 11.700  1.00 30.17  ? 252 PHE A CE1   1 
ATOM   2110 C CE2   . PHE B 2 251 ? 47.372 26.599 10.334  1.00 29.47  ? 252 PHE A CE2   1 
ATOM   2111 C CZ    . PHE B 2 251 ? 46.823 27.129 11.498  1.00 30.77  ? 252 PHE A CZ    1 
ATOM   2112 N N     . GLU B 2 252 ? 45.249 27.117 6.129   1.00 29.64  ? 253 GLU A N     1 
ATOM   2113 C CA    . GLU B 2 252 ? 46.217 28.051 5.560   1.00 30.50  ? 253 GLU A CA    1 
ATOM   2114 C C     . GLU B 2 252 ? 45.521 29.288 5.010   1.00 29.43  ? 253 GLU A C     1 
ATOM   2115 O O     . GLU B 2 252 ? 45.974 30.414 5.222   1.00 29.35  ? 253 GLU A O     1 
ATOM   2116 C CB    . GLU B 2 252 ? 47.025 27.373 4.453   1.00 35.23  ? 253 GLU A CB    1 
ATOM   2117 C CG    . GLU B 2 252 ? 47.850 26.183 4.929   1.00 46.62  ? 253 GLU A CG    1 
ATOM   2118 C CD    . GLU B 2 252 ? 48.571 25.463 3.797   1.00 55.51  ? 253 GLU A CD    1 
ATOM   2119 O OE1   . GLU B 2 252 ? 48.091 25.510 2.640   1.00 58.03  ? 253 GLU A OE1   1 
ATOM   2120 O OE2   . GLU B 2 252 ? 49.617 24.838 4.069   1.00 58.71  ? 253 GLU A OE2   1 
ATOM   2121 N N     . ILE B 2 253 ? 44.404 29.068 4.323   1.00 28.63  ? 254 ILE A N     1 
ATOM   2122 C CA    . ILE B 2 253 ? 43.620 30.151 3.739   1.00 26.94  ? 254 ILE A CA    1 
ATOM   2123 C C     . ILE B 2 253 ? 43.068 31.070 4.824   1.00 27.48  ? 254 ILE A C     1 
ATOM   2124 O O     . ILE B 2 253 ? 43.216 32.288 4.747   1.00 29.67  ? 254 ILE A O     1 
ATOM   2125 C CB    . ILE B 2 253 ? 42.456 29.592 2.885   1.00 27.31  ? 254 ILE A CB    1 
ATOM   2126 C CG1   . ILE B 2 253 ? 43.012 28.896 1.637   1.00 25.72  ? 254 ILE A CG1   1 
ATOM   2127 C CG2   . ILE B 2 253 ? 41.496 30.705 2.499   1.00 24.71  ? 254 ILE A CG2   1 
ATOM   2128 C CD1   . ILE B 2 253 ? 42.002 28.058 0.885   1.00 24.79  ? 254 ILE A CD1   1 
ATOM   2129 N N     . MET B 2 254 ? 42.468 30.473 5.851   1.00 26.29  ? 255 MET A N     1 
ATOM   2130 C CA    . MET B 2 254 ? 41.888 31.221 6.960   1.00 24.63  ? 255 MET A CA    1 
ATOM   2131 C C     . MET B 2 254 ? 42.923 31.950 7.817   1.00 25.58  ? 255 MET A C     1 
ATOM   2132 O O     . MET B 2 254 ? 42.647 33.037 8.328   1.00 27.08  ? 255 MET A O     1 
ATOM   2133 C CB    . MET B 2 254 ? 41.038 30.292 7.819   1.00 24.07  ? 255 MET A CB    1 
ATOM   2134 C CG    . MET B 2 254 ? 39.770 29.845 7.127   1.00 25.42  ? 255 MET A CG    1 
ATOM   2135 S SD    . MET B 2 254 ? 39.000 28.426 7.914   1.00 32.12  ? 255 MET A SD    1 
ATOM   2136 C CE    . MET B 2 254 ? 38.530 29.127 9.444   1.00 29.46  ? 255 MET A CE    1 
ATOM   2137 N N     . PHE B 2 255 ? 44.109 31.360 7.972   1.00 25.17  ? 256 PHE A N     1 
ATOM   2138 C CA    . PHE B 2 255 ? 45.169 31.984 8.753   1.00 27.98  ? 256 PHE A CA    1 
ATOM   2139 C C     . PHE B 2 255 ? 45.715 33.176 7.972   1.00 30.08  ? 256 PHE A C     1 
ATOM   2140 O O     . PHE B 2 255 ? 46.042 34.208 8.552   1.00 31.49  ? 256 PHE A O     1 
ATOM   2141 C CB    . PHE B 2 255 ? 46.301 30.995 9.055   1.00 27.43  ? 256 PHE A CB    1 
ATOM   2142 C CG    . PHE B 2 255 ? 47.345 31.539 10.004  1.00 31.57  ? 256 PHE A CG    1 
ATOM   2143 C CD1   . PHE B 2 255 ? 47.107 31.583 11.374  1.00 30.59  ? 256 PHE A CD1   1 
ATOM   2144 C CD2   . PHE B 2 255 ? 48.557 32.027 9.524   1.00 32.48  ? 256 PHE A CD2   1 
ATOM   2145 C CE1   . PHE B 2 255 ? 48.060 32.107 12.251  1.00 29.87  ? 256 PHE A CE1   1 
ATOM   2146 C CE2   . PHE B 2 255 ? 49.516 32.554 10.397  1.00 32.90  ? 256 PHE A CE2   1 
ATOM   2147 C CZ    . PHE B 2 255 ? 49.265 32.593 11.761  1.00 29.09  ? 256 PHE A CZ    1 
ATOM   2148 N N     . ASP B 2 256 ? 45.799 33.027 6.653   1.00 31.01  ? 257 ASP A N     1 
ATOM   2149 C CA    . ASP B 2 256 ? 46.290 34.092 5.783   1.00 32.04  ? 257 ASP A CA    1 
ATOM   2150 C C     . ASP B 2 256 ? 45.384 35.320 5.877   1.00 29.73  ? 257 ASP A C     1 
ATOM   2151 O O     . ASP B 2 256 ? 45.864 36.450 5.989   1.00 29.49  ? 257 ASP A O     1 
ATOM   2152 C CB    . ASP B 2 256 ? 46.360 33.596 4.332   1.00 36.09  ? 257 ASP A CB    1 
ATOM   2153 C CG    . ASP B 2 256 ? 46.735 34.696 3.347   1.00 42.24  ? 257 ASP A CG    1 
ATOM   2154 O OD1   . ASP B 2 256 ? 47.715 35.430 3.601   1.00 45.37  ? 257 ASP A OD1   1 
ATOM   2155 O OD2   . ASP B 2 256 ? 46.048 34.824 2.311   1.00 46.80  ? 257 ASP A OD2   1 
ATOM   2156 N N     . ILE B 2 257 ? 44.074 35.086 5.846   1.00 28.13  ? 258 ILE A N     1 
ATOM   2157 C CA    . ILE B 2 257 ? 43.091 36.163 5.929   1.00 25.85  ? 258 ILE A CA    1 
ATOM   2158 C C     . ILE B 2 257 ? 43.102 36.848 7.299   1.00 24.79  ? 258 ILE A C     1 
ATOM   2159 O O     . ILE B 2 257 ? 42.934 38.065 7.384   1.00 25.38  ? 258 ILE A O     1 
ATOM   2160 C CB    . ILE B 2 257 ? 41.676 35.649 5.561   1.00 24.67  ? 258 ILE A CB    1 
ATOM   2161 C CG1   . ILE B 2 257 ? 41.649 35.283 4.076   1.00 23.93  ? 258 ILE A CG1   1 
ATOM   2162 C CG2   . ILE B 2 257 ? 40.619 36.695 5.867   1.00 24.76  ? 258 ILE A CG2   1 
ATOM   2163 C CD1   . ILE B 2 257 ? 40.317 34.814 3.566   1.00 26.55  ? 258 ILE A CD1   1 
ATOM   2164 N N     . SER B 2 258 ? 43.342 36.071 8.357   1.00 23.06  ? 259 SER A N     1 
ATOM   2165 C CA    . SER B 2 258 ? 43.403 36.608 9.718   1.00 22.37  ? 259 SER A CA    1 
ATOM   2166 C C     . SER B 2 258 ? 44.624 37.509 9.907   1.00 22.47  ? 259 SER A C     1 
ATOM   2167 O O     . SER B 2 258 ? 44.552 38.531 10.592  1.00 22.11  ? 259 SER A O     1 
ATOM   2168 C CB    . SER B 2 258 ? 43.443 35.475 10.747  1.00 20.62  ? 259 SER A CB    1 
ATOM   2169 O OG    . SER B 2 258 ? 42.216 34.772 10.780  1.00 27.92  ? 259 SER A OG    1 
ATOM   2170 N N     . THR B 2 259 ? 45.746 37.123 9.308   1.00 23.67  ? 260 THR A N     1 
ATOM   2171 C CA    . THR B 2 259 ? 46.972 37.905 9.410   1.00 25.57  ? 260 THR A CA    1 
ATOM   2172 C C     . THR B 2 259 ? 46.801 39.246 8.700   1.00 24.94  ? 260 THR A C     1 
ATOM   2173 O O     . THR B 2 259 ? 47.300 40.272 9.166   1.00 26.68  ? 260 THR A O     1 
ATOM   2174 C CB    . THR B 2 259 ? 48.173 37.142 8.826   1.00 26.95  ? 260 THR A CB    1 
ATOM   2175 O OG1   . THR B 2 259 ? 48.358 35.926 9.560   1.00 31.70  ? 260 THR A OG1   1 
ATOM   2176 C CG2   . THR B 2 259 ? 49.444 37.976 8.930   1.00 35.12  ? 260 THR A CG2   1 
ATOM   2177 N N     . THR B 2 260 ? 46.074 39.237 7.586   1.00 23.85  ? 261 THR A N     1 
ATOM   2178 C CA    . THR B 2 260 ? 45.820 40.457 6.829   1.00 22.78  ? 261 THR A CA    1 
ATOM   2179 C C     . THR B 2 260 ? 44.967 41.413 7.667   1.00 23.94  ? 261 THR A C     1 
ATOM   2180 O O     . THR B 2 260 ? 45.183 42.623 7.651   1.00 23.57  ? 261 THR A O     1 
ATOM   2181 C CB    . THR B 2 260 ? 45.104 40.150 5.511   1.00 21.07  ? 261 THR A CB    1 
ATOM   2182 O OG1   . THR B 2 260 ? 45.895 39.238 4.744   1.00 22.54  ? 261 THR A OG1   1 
ATOM   2183 C CG2   . THR B 2 260 ? 44.908 41.416 4.707   1.00 23.06  ? 261 THR A CG2   1 
ATOM   2184 N N     . SER B 2 261 ? 44.012 40.857 8.411   1.00 24.46  ? 262 SER A N     1 
ATOM   2185 C CA    . SER B 2 261 ? 43.142 41.654 9.273   1.00 24.65  ? 262 SER A CA    1 
ATOM   2186 C C     . SER B 2 261 ? 43.962 42.385 10.331  1.00 26.38  ? 262 SER A C     1 
ATOM   2187 O O     . SER B 2 261 ? 43.669 43.532 10.663  1.00 27.36  ? 262 SER A O     1 
ATOM   2188 C CB    . SER B 2 261 ? 42.110 40.767 9.964   1.00 22.30  ? 262 SER A CB    1 
ATOM   2189 O OG    . SER B 2 261 ? 41.221 40.187 9.029   1.00 22.85  ? 262 SER A OG    1 
ATOM   2190 N N     . LEU B 2 262 ? 44.981 41.710 10.860  1.00 27.04  ? 263 LEU A N     1 
ATOM   2191 C CA    . LEU B 2 262 ? 45.856 42.290 11.874  1.00 28.44  ? 263 LEU A CA    1 
ATOM   2192 C C     . LEU B 2 262 ? 46.719 43.415 11.300  1.00 30.80  ? 263 LEU A C     1 
ATOM   2193 O O     . LEU B 2 262 ? 47.024 44.384 11.999  1.00 32.20  ? 263 LEU A O     1 
ATOM   2194 C CB    . LEU B 2 262 ? 46.746 41.210 12.498  1.00 26.19  ? 263 LEU A CB    1 
ATOM   2195 C CG    . LEU B 2 262 ? 46.046 40.106 13.299  1.00 27.17  ? 263 LEU A CG    1 
ATOM   2196 C CD1   . LEU B 2 262 ? 47.060 39.110 13.806  1.00 24.61  ? 263 LEU A CD1   1 
ATOM   2197 C CD2   . LEU B 2 262 ? 45.288 40.712 14.463  1.00 29.56  ? 263 LEU A CD2   1 
ATOM   2198 N N     . ARG B 2 263 ? 47.103 43.285 10.030  1.00 30.67  ? 264 ARG A N     1 
ATOM   2199 C CA    . ARG B 2 263 ? 47.923 44.296 9.362   1.00 32.29  ? 264 ARG A CA    1 
ATOM   2200 C C     . ARG B 2 263 ? 47.171 45.615 9.231   1.00 30.54  ? 264 ARG A C     1 
ATOM   2201 O O     . ARG B 2 263 ? 47.725 46.683 9.488   1.00 28.72  ? 264 ARG A O     1 
ATOM   2202 C CB    . ARG B 2 263 ? 48.352 43.812 7.974   1.00 37.03  ? 264 ARG A CB    1 
ATOM   2203 C CG    . ARG B 2 263 ? 49.314 42.635 7.988   1.00 48.62  ? 264 ARG A CG    1 
ATOM   2204 C CD    . ARG B 2 263 ? 49.652 42.169 6.578   1.00 56.98  ? 264 ARG A CD    1 
ATOM   2205 N NE    . ARG B 2 263 ? 50.350 43.195 5.807   1.00 67.56  ? 264 ARG A NE    1 
ATOM   2206 C CZ    . ARG B 2 263 ? 49.770 44.000 4.919   1.00 72.14  ? 264 ARG A CZ    1 
ATOM   2207 N NH1   . ARG B 2 263 ? 48.468 43.909 4.679   1.00 74.16  ? 264 ARG A NH1   1 
ATOM   2208 N NH2   . ARG B 2 263 ? 50.495 44.901 4.270   1.00 74.22  ? 264 ARG A NH2   1 
ATOM   2209 N N     . VAL B 2 264 ? 45.907 45.525 8.822   1.00 29.06  ? 265 VAL A N     1 
ATOM   2210 C CA    . VAL B 2 264 ? 45.046 46.694 8.657   1.00 26.52  ? 265 VAL A CA    1 
ATOM   2211 C C     . VAL B 2 264 ? 44.730 47.299 10.028  1.00 26.76  ? 265 VAL A C     1 
ATOM   2212 O O     . VAL B 2 264 ? 44.551 48.507 10.162  1.00 28.83  ? 265 VAL A O     1 
ATOM   2213 C CB    . VAL B 2 264 ? 43.711 46.304 7.966   1.00 25.50  ? 265 VAL A CB    1 
ATOM   2214 C CG1   . VAL B 2 264 ? 42.877 47.540 7.675   1.00 23.94  ? 265 VAL A CG1   1 
ATOM   2215 C CG2   . VAL B 2 264 ? 43.982 45.531 6.680   1.00 26.91  ? 265 VAL A CG2   1 
ATOM   2216 N N     . LEU B 2 265 ? 44.700 46.437 11.039  1.00 25.73  ? 266 LEU A N     1 
ATOM   2217 C CA    . LEU B 2 265 ? 44.405 46.818 12.418  1.00 28.84  ? 266 LEU A CA    1 
ATOM   2218 C C     . LEU B 2 265 ? 45.664 47.247 13.176  1.00 29.53  ? 266 LEU A C     1 
ATOM   2219 O O     . LEU B 2 265 ? 45.587 47.651 14.335  1.00 30.06  ? 266 LEU A O     1 
ATOM   2220 C CB    . LEU B 2 265 ? 43.771 45.616 13.128  1.00 28.37  ? 266 LEU A CB    1 
ATOM   2221 C CG    . LEU B 2 265 ? 42.390 45.699 13.780  1.00 30.90  ? 266 LEU A CG    1 
ATOM   2222 C CD1   . LEU B 2 265 ? 41.418 46.506 12.940  1.00 29.07  ? 266 LEU A CD1   1 
ATOM   2223 C CD2   . LEU B 2 265 ? 41.880 44.285 13.991  1.00 27.60  ? 266 LEU A CD2   1 
ATOM   2224 N N     . GLY B 2 266 ? 46.807 47.188 12.500  1.00 30.98  ? 267 GLY A N     1 
ATOM   2225 C CA    . GLY B 2 266 ? 48.082 47.531 13.110  1.00 32.60  ? 267 GLY A CA    1 
ATOM   2226 C C     . GLY B 2 266 ? 48.181 48.755 14.003  1.00 34.22  ? 267 GLY A C     1 
ATOM   2227 O O     . GLY B 2 266 ? 48.771 48.686 15.083  1.00 34.11  ? 267 GLY A O     1 
ATOM   2228 N N     . ARG B 2 267 ? 47.601 49.869 13.569  1.00 34.98  ? 268 ARG A N     1 
ATOM   2229 C CA    . ARG B 2 267 ? 47.657 51.115 14.332  1.00 36.84  ? 268 ARG A CA    1 
ATOM   2230 C C     . ARG B 2 267 ? 47.008 51.060 15.717  1.00 36.42  ? 268 ARG A C     1 
ATOM   2231 O O     . ARG B 2 267 ? 47.383 51.824 16.608  1.00 37.49  ? 268 ARG A O     1 
ATOM   2232 C CB    . ARG B 2 267 ? 47.063 52.266 13.512  1.00 36.98  ? 268 ARG A CB    1 
ATOM   2233 C CG    . ARG B 2 267 ? 45.595 52.093 13.147  1.00 39.41  ? 268 ARG A CG    1 
ATOM   2234 C CD    . ARG B 2 267 ? 45.174 53.098 12.091  1.00 41.04  ? 268 ARG A CD    1 
ATOM   2235 N NE    . ARG B 2 267 ? 45.887 52.872 10.836  1.00 43.27  ? 268 ARG A NE    1 
ATOM   2236 C CZ    . ARG B 2 267 ? 45.849 53.690 9.790   1.00 45.50  ? 268 ARG A CZ    1 
ATOM   2237 N NH1   . ARG B 2 267 ? 45.131 54.805 9.832   1.00 47.96  ? 268 ARG A NH1   1 
ATOM   2238 N NH2   . ARG B 2 267 ? 46.536 53.395 8.697   1.00 46.33  ? 268 ARG A NH2   1 
ATOM   2239 N N     . ASP B 2 268 ? 46.059 50.144 15.899  1.00 34.46  ? 269 ASP A N     1 
ATOM   2240 C CA    . ASP B 2 268 ? 45.362 50.002 17.173  1.00 33.54  ? 269 ASP A CA    1 
ATOM   2241 C C     . ASP B 2 268 ? 45.811 48.796 17.990  1.00 31.49  ? 269 ASP A C     1 
ATOM   2242 O O     . ASP B 2 268 ? 45.126 48.390 18.923  1.00 30.94  ? 269 ASP A O     1 
ATOM   2243 C CB    . ASP B 2 268 ? 43.846 49.935 16.947  1.00 35.94  ? 269 ASP A CB    1 
ATOM   2244 C CG    . ASP B 2 268 ? 43.280 51.215 16.341  1.00 41.12  ? 269 ASP A CG    1 
ATOM   2245 O OD1   . ASP B 2 268 ? 43.930 52.279 16.436  1.00 41.99  ? 269 ASP A OD1   1 
ATOM   2246 O OD2   . ASP B 2 268 ? 42.171 51.156 15.771  1.00 40.88  ? 269 ASP A OD2   1 
ATOM   2247 N N     . LEU B 2 269 ? 46.971 48.240 17.652  1.00 31.48  ? 270 LEU A N     1 
ATOM   2248 C CA    . LEU B 2 269 ? 47.513 47.075 18.355  1.00 30.37  ? 270 LEU A CA    1 
ATOM   2249 C C     . LEU B 2 269 ? 48.954 47.322 18.802  1.00 33.08  ? 270 LEU A C     1 
ATOM   2250 O O     . LEU B 2 269 ? 49.508 46.557 19.593  1.00 32.20  ? 270 LEU A O     1 
ATOM   2251 C CB    . LEU B 2 269 ? 47.476 45.843 17.442  1.00 29.49  ? 270 LEU A CB    1 
ATOM   2252 C CG    . LEU B 2 269 ? 46.305 44.852 17.439  1.00 30.20  ? 270 LEU A CG    1 
ATOM   2253 C CD1   . LEU B 2 269 ? 44.964 45.547 17.389  1.00 28.94  ? 270 LEU A CD1   1 
ATOM   2254 C CD2   . LEU B 2 269 ? 46.465 43.915 16.251  1.00 30.25  ? 270 LEU A CD2   1 
ATOM   2255 N N     . PHE B 2 270 ? 49.541 48.407 18.305  1.00 34.37  ? 271 PHE A N     1 
ATOM   2256 C CA    . PHE B 2 270 ? 50.921 48.776 18.604  1.00 36.31  ? 271 PHE A CA    1 
ATOM   2257 C C     . PHE B 2 270 ? 51.312 48.823 20.081  1.00 39.54  ? 271 PHE A C     1 
ATOM   2258 O O     . PHE B 2 270 ? 52.334 48.255 20.464  1.00 40.59  ? 271 PHE A O     1 
ATOM   2259 C CB    . PHE B 2 270 ? 51.253 50.115 17.939  1.00 35.66  ? 271 PHE A CB    1 
ATOM   2260 C CG    . PHE B 2 270 ? 52.658 50.588 18.189  1.00 34.82  ? 271 PHE A CG    1 
ATOM   2261 C CD1   . PHE B 2 270 ? 53.713 50.099 17.430  1.00 32.97  ? 271 PHE A CD1   1 
ATOM   2262 C CD2   . PHE B 2 270 ? 52.925 51.518 19.190  1.00 34.66  ? 271 PHE A CD2   1 
ATOM   2263 C CE1   . PHE B 2 270 ? 55.014 50.524 17.662  1.00 34.25  ? 271 PHE A CE1   1 
ATOM   2264 C CE2   . PHE B 2 270 ? 54.222 51.950 19.432  1.00 37.29  ? 271 PHE A CE2   1 
ATOM   2265 C CZ    . PHE B 2 270 ? 55.272 51.451 18.664  1.00 36.77  ? 271 PHE A CZ    1 
ATOM   2266 N N     . GLU B 2 271 ? 50.525 49.517 20.899  1.00 42.37  ? 272 GLU A N     1 
ATOM   2267 C CA    . GLU B 2 271 ? 50.825 49.640 22.325  1.00 46.03  ? 272 GLU A CA    1 
ATOM   2268 C C     . GLU B 2 271 ? 50.918 48.313 23.072  1.00 48.06  ? 272 GLU A C     1 
ATOM   2269 O O     . GLU B 2 271 ? 51.608 48.221 24.083  1.00 49.97  ? 272 GLU A O     1 
ATOM   2270 C CB    . GLU B 2 271 ? 49.823 50.566 23.021  1.00 48.95  ? 272 GLU A CB    1 
ATOM   2271 C CG    . GLU B 2 271 ? 49.977 52.047 22.669  1.00 55.86  ? 272 GLU A CG    1 
ATOM   2272 C CD    . GLU B 2 271 ? 51.316 52.632 23.107  1.00 61.70  ? 272 GLU A CD    1 
ATOM   2273 O OE1   . GLU B 2 271 ? 51.683 52.481 24.294  1.00 64.62  ? 272 GLU A OE1   1 
ATOM   2274 O OE2   . GLU B 2 271 ? 51.999 53.251 22.261  1.00 63.03  ? 272 GLU A OE2   1 
ATOM   2275 N N     . GLN B 2 272 ? 50.231 47.289 22.574  1.00 49.10  ? 273 GLN A N     1 
ATOM   2276 C CA    . GLN B 2 272 ? 50.259 45.974 23.206  1.00 49.96  ? 273 GLN A CA    1 
ATOM   2277 C C     . GLN B 2 272 ? 51.472 45.140 22.802  1.00 53.10  ? 273 GLN A C     1 
ATOM   2278 O O     . GLN B 2 272 ? 51.877 44.242 23.531  1.00 53.67  ? 273 GLN A O     1 
ATOM   2279 C CB    . GLN B 2 272 ? 48.969 45.218 22.909  1.00 49.58  ? 273 GLN A CB    1 
ATOM   2280 C CG    . GLN B 2 272 ? 47.763 45.811 23.597  1.00 49.55  ? 273 GLN A CG    1 
ATOM   2281 C CD    . GLN B 2 272 ? 46.468 45.205 23.121  1.00 48.37  ? 273 GLN A CD    1 
ATOM   2282 O OE1   . GLN B 2 272 ? 45.864 44.385 23.806  1.00 49.01  ? 273 GLN A OE1   1 
ATOM   2283 N NE2   . GLN B 2 272 ? 46.030 45.611 21.940  1.00 48.63  ? 273 GLN A NE2   1 
ATOM   2284 N N     . LEU B 2 273 ? 52.034 45.424 21.630  1.00 58.50  ? 274 LEU A N     1 
ATOM   2285 C CA    . LEU B 2 273 ? 53.216 44.709 21.151  1.00 64.11  ? 274 LEU A CA    1 
ATOM   2286 C C     . LEU B 2 273 ? 54.495 45.341 21.687  1.00 68.01  ? 274 LEU A C     1 
ATOM   2287 O O     . LEU B 2 273 ? 55.572 44.751 21.599  1.00 69.20  ? 274 LEU A O     1 
ATOM   2288 C CB    . LEU B 2 273 ? 53.272 44.704 19.621  1.00 65.58  ? 274 LEU A CB    1 
ATOM   2289 C CG    . LEU B 2 273 ? 52.517 43.612 18.864  1.00 66.71  ? 274 LEU A CG    1 
ATOM   2290 C CD1   . LEU B 2 273 ? 51.024 43.763 19.072  1.00 69.50  ? 274 LEU A CD1   1 
ATOM   2291 C CD2   . LEU B 2 273 ? 52.861 43.694 17.387  1.00 67.48  ? 274 LEU A CD2   1 
ATOM   2292 N N     . THR B 2 274 ? 54.370 46.552 22.222  1.00 73.63  ? 275 THR A N     1 
ATOM   2293 C CA    . THR B 2 274 ? 55.507 47.286 22.764  1.00 80.22  ? 275 THR A CA    1 
ATOM   2294 C C     . THR B 2 274 ? 55.430 47.398 24.285  1.00 83.94  ? 275 THR A C     1 
ATOM   2295 O O     . THR B 2 274 ? 56.315 46.923 24.998  1.00 85.15  ? 275 THR A O     1 
ATOM   2296 C CB    . THR B 2 274 ? 55.577 48.708 22.160  1.00 80.89  ? 275 THR A CB    1 
ATOM   2297 O OG1   . THR B 2 274 ? 55.609 48.620 20.731  1.00 82.83  ? 275 THR A OG1   1 
ATOM   2298 C CG2   . THR B 2 274 ? 56.820 49.443 22.643  1.00 83.63  ? 275 THR A CG2   1 
ATOM   2299 N N     . SER B 2 275 ? 54.359 48.020 24.772  1.00 88.15  ? 276 SER A N     1 
ATOM   2300 C CA    . SER B 2 275 ? 54.148 48.221 26.203  1.00 91.68  ? 276 SER A CA    1 
ATOM   2301 C C     . SER B 2 275 ? 53.491 47.015 26.880  1.00 93.49  ? 276 SER A C     1 
ATOM   2302 O O     . SER B 2 275 ? 52.575 47.173 27.691  1.00 93.63  ? 276 SER A O     1 
ATOM   2303 C CB    . SER B 2 275 ? 53.296 49.475 26.429  1.00 91.96  ? 276 SER A CB    1 
ATOM   2304 O OG    . SER B 2 275 ? 53.827 50.592 25.736  1.00 91.20  ? 276 SER A OG    1 
ATOM   2305 N N     . LYS B 2 276 ? 53.977 45.818 26.558  1.00 95.62  ? 277 LYS A N     1 
ATOM   2306 C CA    . LYS B 2 276 ? 53.444 44.579 27.125  1.00 97.99  ? 277 LYS A CA    1 
ATOM   2307 C C     . LYS B 2 276 ? 54.388 43.419 26.807  1.00 98.69  ? 277 LYS A C     1 
ATOM   2308 O O     . LYS B 2 276 ? 54.865 43.343 25.654  1.00 99.72  ? 277 LYS A O     1 
ATOM   2309 C CB    . LYS B 2 276 ? 52.038 44.305 26.560  1.00 98.64  ? 277 LYS A CB    1 
ATOM   2310 C CG    . LYS B 2 276 ? 51.220 43.224 27.276  1.00 99.16  ? 277 LYS A CG    1 
ATOM   2311 C CD    . LYS B 2 276 ? 51.580 41.814 26.823  1.00 100.00 ? 277 LYS A CD    1 
ATOM   2312 C CE    . LYS B 2 276 ? 50.666 40.765 27.447  1.00 100.00 ? 277 LYS A CE    1 
ATOM   2313 N NZ    . LYS B 2 276 ? 49.246 40.893 27.000  1.00 100.00 ? 277 LYS A NZ    1 
ATOM   2314 O OXT   . LYS B 2 276 ? 54.644 42.603 27.718  1.00 98.77  ? 277 LYS A OXT   1 
HETATM 2315 O O     . HOH C 3 .   ? 18.976 30.884 8.323   1.00 29.14  ? 14  HOH B O     1 
HETATM 2316 O O     . HOH C 3 .   ? 24.683 24.025 3.199   1.00 25.77  ? 15  HOH B O     1 
HETATM 2317 O O     . HOH C 3 .   ? 17.535 19.467 2.816   1.00 31.66  ? 16  HOH B O     1 
HETATM 2318 O O     . HOH C 3 .   ? 20.213 18.963 -5.433  1.00 27.87  ? 17  HOH B O     1 
HETATM 2319 O O     . HOH C 3 .   ? 23.108 26.035 1.901   1.00 40.27  ? 18  HOH B O     1 
HETATM 2320 O O     . HOH C 3 .   ? 19.955 15.183 -6.936  1.00 37.51  ? 19  HOH B O     1 
HETATM 2321 O O     . HOH C 3 .   ? 21.107 27.284 14.370  1.00 41.79  ? 20  HOH B O     1 
HETATM 2322 O O     . HOH C 3 .   ? 13.834 20.734 2.753   1.00 27.82  ? 21  HOH B O     1 
HETATM 2323 O O     . HOH C 3 .   ? 20.051 22.989 9.935   1.00 37.36  ? 22  HOH B O     1 
HETATM 2324 O O     . HOH C 3 .   ? 18.400 19.823 6.793   1.00 46.58  ? 23  HOH B O     1 
HETATM 2325 O O     . HOH C 3 .   ? 9.431  22.550 -19.964 1.00 41.14  ? 24  HOH B O     1 
HETATM 2326 O O     . HOH C 3 .   ? 26.631 21.403 6.243   1.00 42.86  ? 25  HOH B O     1 
HETATM 2327 O O     . HOH C 3 .   ? 22.568 16.871 0.845   1.00 33.73  ? 26  HOH B O     1 
HETATM 2328 O O     . HOH C 3 .   ? 26.546 24.333 5.628   1.00 42.52  ? 27  HOH B O     1 
HETATM 2329 O O     . HOH C 3 .   ? 14.837 12.992 -7.177  1.00 35.13  ? 28  HOH B O     1 
HETATM 2330 O O     . HOH C 3 .   ? 18.458 30.698 19.435  1.00 51.12  ? 29  HOH B O     1 
HETATM 2331 O O     . HOH C 3 .   ? 11.245 20.916 -17.087 1.00 38.28  ? 30  HOH B O     1 
HETATM 2332 O O     . HOH C 3 .   ? 25.012 18.497 -0.258  1.00 44.03  ? 31  HOH B O     1 
HETATM 2333 O O     . HOH C 3 .   ? 9.616  23.154 20.151  1.00 45.12  ? 32  HOH B O     1 
HETATM 2334 O O     . HOH D 3 .   ? 18.603 27.592 -9.984  1.00 20.92  ? 278 HOH A O     1 
HETATM 2335 O O     . HOH D 3 .   ? 14.666 34.886 -6.717  1.00 25.31  ? 279 HOH A O     1 
HETATM 2336 O O     . HOH D 3 .   ? 23.294 33.525 5.142   1.00 28.42  ? 280 HOH A O     1 
HETATM 2337 O O     . HOH D 3 .   ? 10.791 39.026 20.665  1.00 34.13  ? 281 HOH A O     1 
HETATM 2338 O O     . HOH D 3 .   ? 25.624 30.213 -12.835 1.00 43.55  ? 282 HOH A O     1 
HETATM 2339 O O     . HOH D 3 .   ? 44.943 50.603 8.202   1.00 30.31  ? 283 HOH A O     1 
HETATM 2340 O O     . HOH D 3 .   ? 35.011 45.689 25.306  1.00 39.52  ? 284 HOH A O     1 
HETATM 2341 O O     . HOH D 3 .   ? 30.870 49.232 12.398  1.00 45.38  ? 285 HOH A O     1 
HETATM 2342 O O     . HOH D 3 .   ? 36.922 43.743 1.087   1.00 24.43  ? 286 HOH A O     1 
HETATM 2343 O O     . HOH D 3 .   ? 27.484 41.632 -9.655  1.00 33.99  ? 287 HOH A O     1 
HETATM 2344 O O     . HOH D 3 .   ? 37.486 38.964 2.215   1.00 27.84  ? 288 HOH A O     1 
HETATM 2345 O O     . HOH D 3 .   ? 26.430 40.229 -1.765  1.00 29.16  ? 289 HOH A O     1 
HETATM 2346 O O     . HOH D 3 .   ? 25.617 36.768 -7.648  1.00 37.46  ? 290 HOH A O     1 
HETATM 2347 O O     . HOH D 3 .   ? 9.297  43.677 19.004  1.00 38.93  ? 291 HOH A O     1 
HETATM 2348 O O     . HOH D 3 .   ? 38.064 35.617 -3.580  1.00 21.53  ? 292 HOH A O     1 
HETATM 2349 O O     . HOH D 3 .   ? 18.452 54.110 14.967  1.00 34.16  ? 293 HOH A O     1 
HETATM 2350 O O     . HOH D 3 .   ? 30.608 51.414 14.348  1.00 42.48  ? 294 HOH A O     1 
HETATM 2351 O O     . HOH D 3 .   ? 30.428 22.892 7.279   1.00 41.62  ? 295 HOH A O     1 
HETATM 2352 O O     . HOH D 3 .   ? 28.850 43.031 -1.954  1.00 50.30  ? 296 HOH A O     1 
HETATM 2353 O O     . HOH D 3 .   ? 41.808 23.885 -3.541  1.00 38.96  ? 297 HOH A O     1 
HETATM 2354 O O     . HOH D 3 .   ? 42.169 49.882 10.661  1.00 34.82  ? 298 HOH A O     1 
HETATM 2355 O O     . HOH D 3 .   ? 21.066 21.494 -6.582  1.00 26.10  ? 299 HOH A O     1 
HETATM 2356 O O     . HOH D 3 .   ? 34.632 46.375 6.414   1.00 22.23  ? 300 HOH A O     1 
HETATM 2357 O O     . HOH D 3 .   ? 33.237 22.205 7.197   1.00 33.95  ? 301 HOH A O     1 
HETATM 2358 O O     . HOH D 3 .   ? 33.378 43.024 17.476  1.00 34.35  ? 302 HOH A O     1 
HETATM 2359 O O     . HOH D 3 .   ? 35.301 44.904 14.179  1.00 29.74  ? 303 HOH A O     1 
HETATM 2360 O O     . HOH D 3 .   ? 37.066 29.882 -16.299 1.00 51.84  ? 304 HOH A O     1 
HETATM 2361 O O     . HOH D 3 .   ? 38.776 26.176 -8.410  1.00 36.67  ? 305 HOH A O     1 
HETATM 2362 O O     . HOH D 3 .   ? 36.889 45.349 -1.608  1.00 26.10  ? 306 HOH A O     1 
HETATM 2363 O O     . HOH D 3 .   ? 19.237 23.792 -13.886 1.00 32.29  ? 307 HOH A O     1 
HETATM 2364 O O     . HOH D 3 .   ? 17.217 49.302 17.626  1.00 48.22  ? 308 HOH A O     1 
HETATM 2365 O O     . HOH D 3 .   ? 23.617 32.650 -12.350 1.00 39.84  ? 309 HOH A O     1 
HETATM 2366 O O     . HOH D 3 .   ? 23.537 25.498 -0.968  1.00 29.57  ? 310 HOH A O     1 
HETATM 2367 O O     . HOH D 3 .   ? 35.547 50.442 14.743  1.00 59.18  ? 311 HOH A O     1 
HETATM 2368 O O     . HOH D 3 .   ? 19.659 15.124 0.086   1.00 52.40  ? 312 HOH A O     1 
HETATM 2369 O O     . HOH D 3 .   ? 31.633 23.710 11.520  1.00 35.08  ? 313 HOH A O     1 
HETATM 2370 O O     . HOH D 3 .   ? 19.445 37.795 11.381  1.00 45.99  ? 314 HOH A O     1 
HETATM 2371 O O     . HOH D 3 .   ? 40.013 48.075 10.172  1.00 23.03  ? 315 HOH A O     1 
HETATM 2372 O O     . HOH D 3 .   ? 14.829 52.482 11.806  1.00 24.92  ? 316 HOH A O     1 
HETATM 2373 O O     . HOH D 3 .   ? 28.706 29.020 14.898  1.00 42.64  ? 317 HOH A O     1 
HETATM 2374 O O     . HOH D 3 .   ? 28.496 15.755 -5.675  1.00 39.17  ? 318 HOH A O     1 
HETATM 2375 O O     . HOH D 3 .   ? 45.327 35.015 -2.139  1.00 37.37  ? 319 HOH A O     1 
HETATM 2376 O O     . HOH D 3 .   ? 43.540 41.643 0.508   1.00 27.69  ? 320 HOH A O     1 
HETATM 2377 O O     . HOH D 3 .   ? 20.473 14.482 -17.453 1.00 33.37  ? 321 HOH A O     1 
HETATM 2378 O O     . HOH D 3 .   ? 21.907 17.551 -7.047  1.00 31.68  ? 322 HOH A O     1 
HETATM 2379 O O     . HOH D 3 .   ? 24.936 30.149 8.823   1.00 35.79  ? 323 HOH A O     1 
HETATM 2380 O O     . HOH D 3 .   ? 15.895 55.131 11.859  1.00 56.18  ? 324 HOH A O     1 
HETATM 2381 O O     . HOH D 3 .   ? 41.229 49.269 3.058   1.00 24.07  ? 325 HOH A O     1 
HETATM 2382 O O     . HOH D 3 .   ? 53.717 31.452 22.227  1.00 52.95  ? 326 HOH A O     1 
HETATM 2383 O O     . HOH D 3 .   ? 35.568 18.431 13.395  1.00 27.69  ? 327 HOH A O     1 
HETATM 2384 O O     . HOH D 3 .   ? 27.064 18.245 -2.018  1.00 31.44  ? 328 HOH A O     1 
HETATM 2385 O O     . HOH D 3 .   ? 47.826 30.790 1.646   1.00 48.17  ? 329 HOH A O     1 
HETATM 2386 O O     . HOH D 3 .   ? 26.496 45.297 1.660   1.00 51.81  ? 330 HOH A O     1 
HETATM 2387 O O     . HOH D 3 .   ? 21.329 44.081 13.093  1.00 50.43  ? 331 HOH A O     1 
HETATM 2388 O O     . HOH D 3 .   ? 18.252 46.748 12.084  1.00 34.83  ? 332 HOH A O     1 
HETATM 2389 O O     . HOH D 3 .   ? 29.848 40.301 -10.047 1.00 36.54  ? 333 HOH A O     1 
HETATM 2390 O O     . HOH D 3 .   ? 25.944 52.908 19.777  1.00 39.41  ? 334 HOH A O     1 
HETATM 2391 O O     . HOH D 3 .   ? 42.773 50.276 -0.439  1.00 50.65  ? 335 HOH A O     1 
HETATM 2392 O O     . HOH D 3 .   ? 45.702 56.517 14.307  1.00 49.34  ? 336 HOH A O     1 
HETATM 2393 O O     . HOH D 3 .   ? 13.472 16.900 -11.230 1.00 47.56  ? 337 HOH A O     1 
HETATM 2394 O O     . HOH D 3 .   ? 17.973 22.390 -16.121 1.00 44.31  ? 338 HOH A O     1 
HETATM 2395 O O     . HOH D 3 .   ? 47.247 47.787 4.676   1.00 43.27  ? 339 HOH A O     1 
HETATM 2396 O O     . HOH D 3 .   ? 36.067 32.318 11.897  1.00 43.53  ? 340 HOH A O     1 
HETATM 2397 O O     . HOH D 3 .   ? 19.416 17.123 -16.351 1.00 45.63  ? 341 HOH A O     1 
HETATM 2398 O O     . HOH D 3 .   ? 39.308 19.785 -16.785 1.00 47.24  ? 342 HOH A O     1 
HETATM 2399 O O     . HOH D 3 .   ? 33.649 20.358 -4.715  1.00 36.91  ? 343 HOH A O     1 
HETATM 2400 O O     . HOH D 3 .   ? 42.972 54.530 14.945  1.00 40.42  ? 344 HOH A O     1 
HETATM 2401 O O     . HOH D 3 .   ? 14.074 48.351 18.617  1.00 49.00  ? 345 HOH A O     1 
HETATM 2402 O O     . HOH D 3 .   ? 31.671 26.676 17.115  1.00 61.98  ? 346 HOH A O     1 
HETATM 2403 O O     . HOH D 3 .   ? 29.465 47.410 0.994   1.00 60.27  ? 347 HOH A O     1 
HETATM 2404 O O     . HOH D 3 .   ? 37.898 31.801 23.006  1.00 28.51  ? 348 HOH A O     1 
HETATM 2405 O O     . HOH D 3 .   ? 32.455 46.303 15.543  1.00 34.53  ? 349 HOH A O     1 
HETATM 2406 O O     . HOH D 3 .   ? 39.759 40.495 28.368  1.00 34.05  ? 350 HOH A O     1 
HETATM 2407 O O     . HOH D 3 .   ? 13.982 15.493 -18.602 1.00 48.55  ? 351 HOH A O     1 
HETATM 2408 O O     . HOH D 3 .   ? 25.097 40.903 0.522   1.00 35.58  ? 352 HOH A O     1 
HETATM 2409 O O     . HOH D 3 .   ? 40.687 29.683 -9.554  1.00 58.29  ? 353 HOH A O     1 
HETATM 2410 O O     . HOH D 3 .   ? 33.902 36.845 -8.752  1.00 30.66  ? 354 HOH A O     1 
HETATM 2411 O O     . HOH D 3 .   ? 38.246 31.892 -12.362 1.00 44.25  ? 355 HOH A O     1 
HETATM 2412 O O     . HOH D 3 .   ? 38.392 34.329 -10.813 1.00 36.01  ? 356 HOH A O     1 
HETATM 2413 O O     . HOH D 3 .   ? 39.313 36.527 -12.466 1.00 31.39  ? 357 HOH A O     1 
HETATM 2414 O O     . HOH D 3 .   ? 28.430 46.576 18.936  1.00 27.36  ? 358 HOH A O     1 
HETATM 2415 O O     . HOH D 3 .   ? 46.196 53.885 5.805   1.00 35.11  ? 359 HOH A O     1 
HETATM 2416 O O     . HOH D 3 .   ? 35.589 50.094 17.658  1.00 52.45  ? 360 HOH A O     1 
HETATM 2417 O O     . HOH D 3 .   ? 38.110 50.532 19.511  1.00 44.97  ? 361 HOH A O     1 
HETATM 2418 O O     . HOH D 3 .   ? 43.440 34.737 -11.120 1.00 43.09  ? 362 HOH A O     1 
HETATM 2419 O O     . HOH D 3 .   ? 44.281 37.654 -8.390  1.00 45.84  ? 363 HOH A O     1 
HETATM 2420 O O     . HOH D 3 .   ? 22.240 19.518 -9.297  1.00 27.09  ? 364 HOH A O     1 
HETATM 2421 O O     . HOH D 3 .   ? 43.887 38.949 -11.484 1.00 42.15  ? 365 HOH A O     1 
HETATM 2422 O O     . HOH D 3 .   ? 21.864 30.317 17.929  1.00 43.80  ? 366 HOH A O     1 
HETATM 2423 O O     . HOH D 3 .   ? 29.733 32.451 21.980  1.00 49.08  ? 367 HOH A O     1 
HETATM 2424 O O     . HOH D 3 .   ? 24.895 28.712 19.507  1.00 62.31  ? 368 HOH A O     1 
HETATM 2425 O O     . HOH D 3 .   ? 37.116 33.207 -14.989 1.00 52.82  ? 369 HOH A O     1 
HETATM 2426 O O     . HOH D 3 .   ? 25.805 27.542 12.121  1.00 34.81  ? 370 HOH A O     1 
HETATM 2427 O O     . HOH D 3 .   ? 17.563 54.830 18.973  1.00 51.43  ? 371 HOH A O     1 
HETATM 2428 O O     . HOH D 3 .   ? 48.861 28.299 20.921  1.00 36.86  ? 372 HOH A O     1 
HETATM 2429 O O     . HOH D 3 .   ? 43.634 54.857 6.959   1.00 45.57  ? 373 HOH A O     1 
HETATM 2430 O O     . HOH D 3 .   ? 33.810 34.149 23.278  1.00 46.94  ? 374 HOH A O     1 
HETATM 2431 O O     . HOH D 3 .   ? 56.417 33.122 18.066  1.00 42.03  ? 375 HOH A O     1 
HETATM 2432 O O     . HOH D 3 .   ? 31.099 41.522 22.733  1.00 37.73  ? 376 HOH A O     1 
HETATM 2433 O O     . HOH D 3 .   ? 26.500 29.079 21.965  1.00 49.97  ? 377 HOH A O     1 
HETATM 2434 O O     . HOH D 3 .   ? 32.399 23.894 1.573   1.00 37.01  ? 378 HOH A O     1 
HETATM 2435 O O     . HOH D 3 .   ? 7.646  7.584  -18.281 1.00 52.88  ? 379 HOH A O     1 
HETATM 2436 O O     . HOH D 3 .   ? 45.067 42.181 22.304  1.00 34.16  ? 380 HOH A O     1 
HETATM 2437 O O     . HOH D 3 .   ? 13.962 20.068 -13.550 1.00 44.71  ? 381 HOH A O     1 
HETATM 2438 O O     . HOH D 3 .   ? 15.735 17.725 -12.659 1.00 32.28  ? 382 HOH A O     1 
HETATM 2439 O O     . HOH D 3 .   ? 19.466 42.333 10.229  1.00 38.75  ? 383 HOH A O     1 
HETATM 2440 O O     . HOH D 3 .   ? 35.809 37.445 26.093  1.00 39.26  ? 384 HOH A O     1 
HETATM 2441 O O     . HOH D 3 .   ? 35.635 18.717 5.809   1.00 48.01  ? 385 HOH A O     1 
HETATM 2442 O O     . HOH D 3 .   ? 29.041 23.088 -11.498 1.00 25.10  ? 386 HOH A O     1 
HETATM 2443 O O     . HOH D 3 .   ? 41.665 51.441 12.938  1.00 63.05  ? 387 HOH A O     1 
HETATM 2444 O O     . HOH D 3 .   ? 27.139 33.146 4.173   1.00 33.57  ? 388 HOH A O     1 
HETATM 2445 O O     . HOH D 3 .   ? 26.207 19.377 -17.735 1.00 46.41  ? 389 HOH A O     1 
HETATM 2446 O O     . HOH D 3 .   ? 47.337 35.728 -0.070  1.00 50.49  ? 390 HOH A O     1 
HETATM 2447 O O     . HOH D 3 .   ? 26.199 25.850 26.603  1.00 52.38  ? 391 HOH A O     1 
HETATM 2448 O O     . HOH D 3 .   ? 44.531 30.139 22.713  1.00 51.97  ? 392 HOH A O     1 
HETATM 2449 O O     . HOH D 3 .   ? 27.237 46.507 21.702  1.00 46.59  ? 393 HOH A O     1 
HETATM 2450 O O     . HOH D 3 .   ? 39.179 43.683 -1.751  1.00 30.65  ? 394 HOH A O     1 
HETATM 2451 O O     . HOH D 3 .   ? 15.393 54.542 14.698  1.00 40.24  ? 395 HOH A O     1 
HETATM 2452 O O     . HOH D 3 .   ? 27.638 47.156 4.513   1.00 33.42  ? 396 HOH A O     1 
HETATM 2453 O O     . HOH D 3 .   ? 14.963 4.585  -12.115 1.00 38.88  ? 397 HOH A O     1 
HETATM 2454 O O     . HOH D 3 .   ? 39.190 25.332 -16.276 1.00 48.50  ? 398 HOH A O     1 
HETATM 2455 O O     . HOH D 3 .   ? 37.660 57.653 -3.224  1.00 36.65  ? 399 HOH A O     1 
HETATM 2456 O O     . HOH D 3 .   ? 27.416 21.657 27.914  1.00 58.97  ? 400 HOH A O     1 
HETATM 2457 O O     . HOH D 3 .   ? 33.258 16.957 28.299  1.00 51.48  ? 401 HOH A O     1 
HETATM 2458 O O     . HOH D 3 .   ? 32.568 20.090 13.878  1.00 53.22  ? 402 HOH A O     1 
HETATM 2459 O O     . HOH D 3 .   ? 48.693 32.407 -1.309  1.00 46.05  ? 403 HOH A O     1 
HETATM 2460 O O     . HOH D 3 .   ? 18.757 11.262 -5.178  1.00 50.22  ? 404 HOH A O     1 
HETATM 2461 O O     . HOH D 3 .   ? 29.006 48.598 -1.822  1.00 54.62  ? 405 HOH A O     1 
HETATM 2462 O O     . HOH D 3 .   ? 15.265 21.372 -16.472 1.00 61.32  ? 406 HOH A O     1 
HETATM 2463 O O     . HOH D 3 .   ? 17.406 34.947 -7.149  1.00 37.87  ? 407 HOH A O     1 
HETATM 2464 O O     . HOH D 3 .   ? 18.588 47.247 19.133  1.00 31.92  ? 408 HOH A O     1 
HETATM 2465 O O     . HOH D 3 .   ? 42.291 39.664 27.824  1.00 63.84  ? 409 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DT  1   1   1   DT  T   B . n 
A 1 2   DC  2   2   2   DC  C   B . n 
A 1 3   DG  3   3   3   DG  G   B . n 
A 1 4   DC  4   4   4   DC  C   B . n 
A 1 5   DG  5   5   5   DG  G   B . n 
A 1 6   DA  6   6   6   DA  A   B . n 
A 1 7   DA  7   7   7   DA  A   B . n 
A 1 8   DT  8   8   8   DT  T   B . n 
A 1 9   DT  9   9   9   DT  T   B . n 
A 1 10  DC  10  10  10  DC  C   B . n 
A 1 11  DG  11  11  11  DG  G   B . n 
A 1 12  DC  12  12  12  DC  C   B . n 
A 1 13  DG  13  13  13  DG  G   B . n 
B 2 1   SER 1   2   ?   ?   ?   A . n 
B 2 2   ASN 2   3   ?   ?   ?   A . n 
B 2 3   LYS 3   4   ?   ?   ?   A . n 
B 2 4   LYS 4   5   ?   ?   ?   A . n 
B 2 5   GLN 5   6   ?   ?   ?   A . n 
B 2 6   SER 6   7   ?   ?   ?   A . n 
B 2 7   ASN 7   8   ?   ?   ?   A . n 
B 2 8   ARG 8   9   ?   ?   ?   A . n 
B 2 9   LEU 9   10  ?   ?   ?   A . n 
B 2 10  THR 10  11  ?   ?   ?   A . n 
B 2 11  GLU 11  12  ?   ?   ?   A . n 
B 2 12  GLN 12  13  ?   ?   ?   A . n 
B 2 13  HIS 13  14  ?   ?   ?   A . n 
B 2 14  LYS 14  15  ?   ?   ?   A . n 
B 2 15  LEU 15  16  ?   ?   ?   A . n 
B 2 16  SER 16  17  17  SER SER A . n 
B 2 17  GLN 17  18  18  GLN GLN A . n 
B 2 18  GLY 18  19  19  GLY GLY A . n 
B 2 19  VAL 19  20  20  VAL VAL A . n 
B 2 20  ILE 20  21  21  ILE ILE A . n 
B 2 21  GLY 21  22  22  GLY GLY A . n 
B 2 22  ILE 22  23  23  ILE ILE A . n 
B 2 23  PHE 23  24  24  PHE PHE A . n 
B 2 24  GLY 24  25  25  GLY GLY A . n 
B 2 25  ASP 25  26  26  ASP ASP A . n 
B 2 26  TYR 26  27  27  TYR TYR A . n 
B 2 27  ALA 27  28  28  ALA ALA A . n 
B 2 28  LYS 28  29  29  LYS LYS A . n 
B 2 29  ALA 29  30  30  ALA ALA A . n 
B 2 30  HIS 30  31  31  HIS HIS A . n 
B 2 31  ASP 31  32  32  ASP ASP A . n 
B 2 32  LEU 32  33  33  LEU LEU A . n 
B 2 33  ALA 33  34  34  ALA ALA A . n 
B 2 34  VAL 34  35  35  VAL VAL A . n 
B 2 35  GLY 35  36  36  GLY GLY A . n 
B 2 36  GLU 36  37  37  GLU GLU A . n 
B 2 37  VAL 37  38  38  VAL VAL A . n 
B 2 38  SER 38  39  39  SER SER A . n 
B 2 39  LYS 39  40  40  LYS LYS A . n 
B 2 40  LEU 40  41  41  LEU LEU A . n 
B 2 41  VAL 41  42  42  VAL VAL A . n 
B 2 42  LYS 42  43  43  LYS LYS A . n 
B 2 43  LYS 43  44  44  LYS LYS A . n 
B 2 44  ALA 44  45  45  ALA ALA A . n 
B 2 45  LEU 45  46  46  LEU LEU A . n 
B 2 46  SER 46  47  47  SER SER A . n 
B 2 47  ASN 47  48  48  ASN ASN A . n 
B 2 48  GLU 48  49  49  GLU GLU A . n 
B 2 49  TYR 49  50  50  TYR TYR A . n 
B 2 50  PRO 50  51  51  PRO PRO A . n 
B 2 51  GLN 51  52  52  GLN GLN A . n 
B 2 52  LEU 52  53  53  LEU LEU A . n 
B 2 53  SER 53  54  54  SER SER A . n 
B 2 54  PHE 54  55  55  PHE PHE A . n 
B 2 55  ARG 55  56  56  ARG ARG A . n 
B 2 56  TYR 56  57  57  TYR TYR A . n 
B 2 57  ARG 57  58  58  ARG ARG A . n 
B 2 58  ASP 58  59  59  ASP ASP A . n 
B 2 59  SER 59  60  60  SER SER A . n 
B 2 60  ILE 60  61  61  ILE ILE A . n 
B 2 61  LYS 61  62  62  LYS LYS A . n 
B 2 62  LYS 62  63  63  LYS LYS A . n 
B 2 63  THR 63  64  64  THR THR A . n 
B 2 64  GLU 64  65  65  GLU GLU A . n 
B 2 65  ILE 65  66  66  ILE ILE A . n 
B 2 66  ASN 66  67  67  ASN ASN A . n 
B 2 67  GLU 67  68  68  GLU GLU A . n 
B 2 68  ALA 68  69  69  ALA ALA A . n 
B 2 69  LEU 69  70  70  LEU LEU A . n 
B 2 70  LYS 70  71  71  LYS LYS A . n 
B 2 71  LYS 71  72  72  LYS LYS A . n 
B 2 72  ILE 72  73  73  ILE ILE A . n 
B 2 73  ASP 73  74  74  ASP ASP A . n 
B 2 74  PRO 74  75  75  PRO PRO A . n 
B 2 75  ASP 75  76  76  ASP ASP A . n 
B 2 76  LEU 76  77  77  LEU LEU A . n 
B 2 77  GLY 77  78  78  GLY GLY A . n 
B 2 78  GLY 78  79  79  GLY GLY A . n 
B 2 79  THR 79  80  80  THR THR A . n 
B 2 80  LEU 80  81  81  LEU LEU A . n 
B 2 81  PHE 81  82  82  PHE PHE A . n 
B 2 82  VAL 82  83  83  VAL VAL A . n 
B 2 83  SER 83  84  84  SER SER A . n 
B 2 84  ASN 84  85  85  ASN ASN A . n 
B 2 85  SER 85  86  86  SER SER A . n 
B 2 86  SER 86  87  87  SER SER A . n 
B 2 87  ILE 87  88  88  ILE ILE A . n 
B 2 88  LYS 88  89  89  LYS LYS A . n 
B 2 89  PRO 89  90  90  PRO PRO A . n 
B 2 90  ASP 90  91  91  ASP ASP A . n 
B 2 91  GLY 91  92  92  GLY GLY A . n 
B 2 92  GLY 92  93  93  GLY GLY A . n 
B 2 93  ILE 93  94  94  ILE ILE A . n 
B 2 94  VAL 94  95  95  VAL VAL A . n 
B 2 95  GLU 95  96  96  GLU GLU A . n 
B 2 96  VAL 96  97  97  VAL VAL A . n 
B 2 97  LYS 97  98  98  LYS LYS A . n 
B 2 98  ASP 98  99  99  ASP ASP A . n 
B 2 99  ASP 99  100 100 ASP ASP A . n 
B 2 100 TYR 100 101 101 TYR TYR A . n 
B 2 101 GLY 101 102 102 GLY GLY A . n 
B 2 102 GLU 102 103 103 GLU GLU A . n 
B 2 103 TRP 103 104 104 TRP TRP A . n 
B 2 104 ARG 104 105 105 ARG ARG A . n 
B 2 105 VAL 105 106 106 VAL VAL A . n 
B 2 106 VAL 106 107 107 VAL VAL A . n 
B 2 107 LEU 107 108 108 LEU LEU A . n 
B 2 108 VAL 108 109 109 VAL VAL A . n 
B 2 109 ALA 109 110 110 ALA ALA A . n 
B 2 110 GLU 110 111 111 GLU GLU A . n 
B 2 111 ALA 111 112 112 ALA ALA A . n 
B 2 112 LYS 112 113 113 LYS LYS A . n 
B 2 113 HIS 113 114 114 HIS HIS A . n 
B 2 114 GLN 114 115 115 GLN GLN A . n 
B 2 115 GLY 115 116 116 GLY GLY A . n 
B 2 116 LYS 116 117 117 LYS LYS A . n 
B 2 117 ASP 117 118 118 ASP ASP A . n 
B 2 118 ILE 118 119 119 ILE ILE A . n 
B 2 119 ILE 119 120 120 ILE ILE A . n 
B 2 120 ASN 120 121 121 ASN ASN A . n 
B 2 121 ILE 121 122 122 ILE ILE A . n 
B 2 122 ARG 122 123 123 ARG ARG A . n 
B 2 123 ASN 123 124 124 ASN ASN A . n 
B 2 124 GLY 124 125 125 GLY GLY A . n 
B 2 125 LEU 125 126 126 LEU LEU A . n 
B 2 126 LEU 126 127 127 LEU LEU A . n 
B 2 127 VAL 127 128 128 VAL VAL A . n 
B 2 128 GLY 128 129 129 GLY GLY A . n 
B 2 129 LYS 129 130 130 LYS LYS A . n 
B 2 130 ARG 130 131 131 ARG ARG A . n 
B 2 131 GLY 131 132 132 GLY GLY A . n 
B 2 132 ASP 132 133 133 ASP ASP A . n 
B 2 133 GLN 133 134 134 GLN GLN A . n 
B 2 134 ASP 134 135 135 ASP ASP A . n 
B 2 135 LEU 135 136 136 LEU LEU A . n 
B 2 136 MET 136 137 137 MET MET A . n 
B 2 137 ALA 137 138 138 ALA ALA A . n 
B 2 138 ALA 138 139 139 ALA ALA A . n 
B 2 139 GLY 139 140 140 GLY GLY A . n 
B 2 140 ASN 140 141 141 ASN ASN A . n 
B 2 141 ALA 141 142 142 ALA ALA A . n 
B 2 142 ILE 142 143 143 ILE ILE A . n 
B 2 143 GLU 143 144 144 GLU GLU A . n 
B 2 144 ARG 144 145 145 ARG ARG A . n 
B 2 145 SER 145 146 146 SER SER A . n 
B 2 146 HIS 146 147 147 HIS HIS A . n 
B 2 147 LYS 147 148 148 LYS LYS A . n 
B 2 148 ASN 148 149 149 ASN ASN A . n 
B 2 149 ILE 149 150 150 ILE ILE A . n 
B 2 150 SER 150 151 151 SER SER A . n 
B 2 151 GLU 151 152 152 GLU GLU A . n 
B 2 152 ILE 152 153 153 ILE ILE A . n 
B 2 153 ALA 153 154 154 ALA ALA A . n 
B 2 154 ASN 154 155 155 ASN ASN A . n 
B 2 155 PHE 155 156 156 PHE PHE A . n 
B 2 156 MET 156 157 157 MET MET A . n 
B 2 157 LEU 157 158 158 LEU LEU A . n 
B 2 158 SER 158 159 159 SER SER A . n 
B 2 159 GLU 159 160 160 GLU GLU A . n 
B 2 160 SER 160 161 161 SER SER A . n 
B 2 161 HIS 161 162 162 HIS HIS A . n 
B 2 162 PHE 162 163 163 PHE PHE A . n 
B 2 163 PRO 163 164 164 PRO PRO A . n 
B 2 164 TYR 164 165 165 TYR TYR A . n 
B 2 165 VAL 165 166 166 VAL VAL A . n 
B 2 166 LEU 166 167 167 LEU LEU A . n 
B 2 167 PHE 167 168 168 PHE PHE A . n 
B 2 168 LEU 168 169 169 LEU LEU A . n 
B 2 169 GLU 169 170 170 GLU GLU A . n 
B 2 170 GLY 170 171 171 GLY GLY A . n 
B 2 171 SER 171 172 172 SER SER A . n 
B 2 172 ASN 172 173 173 ASN ASN A . n 
B 2 173 PHE 173 174 174 PHE PHE A . n 
B 2 174 LEU 174 175 175 LEU LEU A . n 
B 2 175 THR 175 176 176 THR THR A . n 
B 2 176 GLU 176 177 177 GLU GLU A . n 
B 2 177 ASN 177 178 178 ASN ASN A . n 
B 2 178 ILE 178 179 179 ILE ILE A . n 
B 2 179 SER 179 180 180 SER SER A . n 
B 2 180 ILE 180 181 181 ILE ILE A . n 
B 2 181 THR 181 182 182 THR THR A . n 
B 2 182 ARG 182 183 183 ARG ARG A . n 
B 2 183 PRO 183 184 184 PRO PRO A . n 
B 2 184 ASP 184 185 185 ASP ASP A . n 
B 2 185 GLY 185 186 186 GLY GLY A . n 
B 2 186 ARG 186 187 187 ARG ARG A . n 
B 2 187 VAL 187 188 188 VAL VAL A . n 
B 2 188 VAL 188 189 189 VAL VAL A . n 
B 2 189 ASN 189 190 190 ASN ASN A . n 
B 2 190 LEU 190 191 191 LEU LEU A . n 
B 2 191 GLU 191 192 192 GLU GLU A . n 
B 2 192 TYR 192 193 193 TYR TYR A . n 
B 2 193 ASN 193 194 194 ASN ASN A . n 
B 2 194 SER 194 195 195 SER SER A . n 
B 2 195 GLY 195 196 196 GLY GLY A . n 
B 2 196 ILE 196 197 197 ILE ILE A . n 
B 2 197 LEU 197 198 198 LEU LEU A . n 
B 2 198 ASN 198 199 199 ASN ASN A . n 
B 2 199 ARG 199 200 200 ARG ARG A . n 
B 2 200 LEU 200 201 201 LEU LEU A . n 
B 2 201 ASP 201 202 202 ASP ASP A . n 
B 2 202 ARG 202 203 203 ARG ARG A . n 
B 2 203 LEU 203 204 204 LEU LEU A . n 
B 2 204 THR 204 205 205 THR THR A . n 
B 2 205 ALA 205 206 206 ALA ALA A . n 
B 2 206 ALA 206 207 207 ALA ALA A . n 
B 2 207 ASN 207 208 208 ASN ASN A . n 
B 2 208 TYR 208 209 209 TYR TYR A . n 
B 2 209 GLY 209 210 210 GLY GLY A . n 
B 2 210 MET 210 211 211 MET MET A . n 
B 2 211 PRO 211 212 212 PRO PRO A . n 
B 2 212 ILE 212 213 213 ILE ILE A . n 
B 2 213 ASN 213 214 214 ASN ASN A . n 
B 2 214 SER 214 215 215 SER SER A . n 
B 2 215 ASN 215 216 216 ASN ASN A . n 
B 2 216 LEU 216 217 217 LEU LEU A . n 
B 2 217 CYS 217 218 218 CYS CYS A . n 
B 2 218 ILE 218 219 219 ILE ILE A . n 
B 2 219 ASN 219 220 220 ASN ASN A . n 
B 2 220 LYS 220 221 221 LYS LYS A . n 
B 2 221 PHE 221 222 222 PHE PHE A . n 
B 2 222 VAL 222 223 223 VAL VAL A . n 
B 2 223 ASN 223 224 224 ASN ASN A . n 
B 2 224 HIS 224 225 225 HIS HIS A . n 
B 2 225 LYS 225 226 226 LYS LYS A . n 
B 2 226 ASP 226 227 227 ASP ASP A . n 
B 2 227 LYS 227 228 228 LYS LYS A . n 
B 2 228 SER 228 229 229 SER SER A . n 
B 2 229 ILE 229 230 230 ILE ILE A . n 
B 2 230 MET 230 231 231 MET MET A . n 
B 2 231 LEU 231 232 232 LEU LEU A . n 
B 2 232 GLN 232 233 233 GLN GLN A . n 
B 2 233 ALA 233 234 234 ALA ALA A . n 
B 2 234 ALA 234 235 235 ALA ALA A . n 
B 2 235 SER 235 236 236 SER SER A . n 
B 2 236 ILE 236 237 237 ILE ILE A . n 
B 2 237 TYR 237 238 238 TYR TYR A . n 
B 2 238 THR 238 239 239 THR THR A . n 
B 2 239 GLN 239 240 240 GLN GLN A . n 
B 2 240 GLY 240 241 241 GLY GLY A . n 
B 2 241 ASP 241 242 242 ASP ASP A . n 
B 2 242 GLY 242 243 243 GLY GLY A . n 
B 2 243 ARG 243 244 244 ARG ARG A . n 
B 2 244 GLU 244 245 245 GLU GLU A . n 
B 2 245 TRP 245 246 246 TRP TRP A . n 
B 2 246 ASP 246 247 247 ASP ASP A . n 
B 2 247 SER 247 248 248 SER SER A . n 
B 2 248 LYS 248 249 249 LYS LYS A . n 
B 2 249 ILE 249 250 250 ILE ILE A . n 
B 2 250 MET 250 251 251 MET MET A . n 
B 2 251 PHE 251 252 252 PHE PHE A . n 
B 2 252 GLU 252 253 253 GLU GLU A . n 
B 2 253 ILE 253 254 254 ILE ILE A . n 
B 2 254 MET 254 255 255 MET MET A . n 
B 2 255 PHE 255 256 256 PHE PHE A . n 
B 2 256 ASP 256 257 257 ASP ASP A . n 
B 2 257 ILE 257 258 258 ILE ILE A . n 
B 2 258 SER 258 259 259 SER SER A . n 
B 2 259 THR 259 260 260 THR THR A . n 
B 2 260 THR 260 261 261 THR THR A . n 
B 2 261 SER 261 262 262 SER SER A . n 
B 2 262 LEU 262 263 263 LEU LEU A . n 
B 2 263 ARG 263 264 264 ARG ARG A . n 
B 2 264 VAL 264 265 265 VAL VAL A . n 
B 2 265 LEU 265 266 266 LEU LEU A . n 
B 2 266 GLY 266 267 267 GLY GLY A . n 
B 2 267 ARG 267 268 268 ARG ARG A . n 
B 2 268 ASP 268 269 269 ASP ASP A . n 
B 2 269 LEU 269 270 270 LEU LEU A . n 
B 2 270 PHE 270 271 271 PHE PHE A . n 
B 2 271 GLU 271 272 272 GLU GLU A . n 
B 2 272 GLN 272 273 273 GLN GLN A . n 
B 2 273 LEU 273 274 274 LEU LEU A . n 
B 2 274 THR 274 275 275 THR THR A . n 
B 2 275 SER 275 276 276 SER SER A . n 
B 2 276 LYS 276 277 277 LYS LYS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1   14  2   HOH HOH B . 
C 3 HOH 2   15  7   HOH HOH B . 
C 3 HOH 3   16  9   HOH HOH B . 
C 3 HOH 4   17  11  HOH HOH B . 
C 3 HOH 5   18  12  HOH HOH B . 
C 3 HOH 6   19  17  HOH HOH B . 
C 3 HOH 7   20  22  HOH HOH B . 
C 3 HOH 8   21  26  HOH HOH B . 
C 3 HOH 9   22  27  HOH HOH B . 
C 3 HOH 10  23  30  HOH HOH B . 
C 3 HOH 11  24  38  HOH HOH B . 
C 3 HOH 12  25  51  HOH HOH B . 
C 3 HOH 13  26  56  HOH HOH B . 
C 3 HOH 14  27  79  HOH HOH B . 
C 3 HOH 15  28  87  HOH HOH B . 
C 3 HOH 16  29  106 HOH HOH B . 
C 3 HOH 17  30  115 HOH HOH B . 
C 3 HOH 18  31  136 HOH HOH B . 
C 3 HOH 19  32  138 HOH HOH B . 
D 3 HOH 1   278 1   HOH HOH A . 
D 3 HOH 2   279 3   HOH HOH A . 
D 3 HOH 3   280 4   HOH HOH A . 
D 3 HOH 4   281 5   HOH HOH A . 
D 3 HOH 5   282 6   HOH HOH A . 
D 3 HOH 6   283 8   HOH HOH A . 
D 3 HOH 7   284 10  HOH HOH A . 
D 3 HOH 8   285 13  HOH HOH A . 
D 3 HOH 9   286 14  HOH HOH A . 
D 3 HOH 10  287 15  HOH HOH A . 
D 3 HOH 11  288 16  HOH HOH A . 
D 3 HOH 12  289 18  HOH HOH A . 
D 3 HOH 13  290 19  HOH HOH A . 
D 3 HOH 14  291 20  HOH HOH A . 
D 3 HOH 15  292 21  HOH HOH A . 
D 3 HOH 16  293 23  HOH HOH A . 
D 3 HOH 17  294 24  HOH HOH A . 
D 3 HOH 18  295 25  HOH HOH A . 
D 3 HOH 19  296 28  HOH HOH A . 
D 3 HOH 20  297 29  HOH HOH A . 
D 3 HOH 21  298 31  HOH HOH A . 
D 3 HOH 22  299 32  HOH HOH A . 
D 3 HOH 23  300 33  HOH HOH A . 
D 3 HOH 24  301 34  HOH HOH A . 
D 3 HOH 25  302 35  HOH HOH A . 
D 3 HOH 26  303 36  HOH HOH A . 
D 3 HOH 27  304 37  HOH HOH A . 
D 3 HOH 28  305 39  HOH HOH A . 
D 3 HOH 29  306 40  HOH HOH A . 
D 3 HOH 30  307 41  HOH HOH A . 
D 3 HOH 31  308 42  HOH HOH A . 
D 3 HOH 32  309 43  HOH HOH A . 
D 3 HOH 33  310 44  HOH HOH A . 
D 3 HOH 34  311 45  HOH HOH A . 
D 3 HOH 35  312 46  HOH HOH A . 
D 3 HOH 36  313 47  HOH HOH A . 
D 3 HOH 37  314 48  HOH HOH A . 
D 3 HOH 38  315 49  HOH HOH A . 
D 3 HOH 39  316 50  HOH HOH A . 
D 3 HOH 40  317 52  HOH HOH A . 
D 3 HOH 41  318 53  HOH HOH A . 
D 3 HOH 42  319 54  HOH HOH A . 
D 3 HOH 43  320 55  HOH HOH A . 
D 3 HOH 44  321 57  HOH HOH A . 
D 3 HOH 45  322 58  HOH HOH A . 
D 3 HOH 46  323 59  HOH HOH A . 
D 3 HOH 47  324 60  HOH HOH A . 
D 3 HOH 48  325 61  HOH HOH A . 
D 3 HOH 49  326 62  HOH HOH A . 
D 3 HOH 50  327 63  HOH HOH A . 
D 3 HOH 51  328 64  HOH HOH A . 
D 3 HOH 52  329 65  HOH HOH A . 
D 3 HOH 53  330 66  HOH HOH A . 
D 3 HOH 54  331 67  HOH HOH A . 
D 3 HOH 55  332 68  HOH HOH A . 
D 3 HOH 56  333 69  HOH HOH A . 
D 3 HOH 57  334 70  HOH HOH A . 
D 3 HOH 58  335 71  HOH HOH A . 
D 3 HOH 59  336 72  HOH HOH A . 
D 3 HOH 60  337 73  HOH HOH A . 
D 3 HOH 61  338 74  HOH HOH A . 
D 3 HOH 62  339 75  HOH HOH A . 
D 3 HOH 63  340 76  HOH HOH A . 
D 3 HOH 64  341 77  HOH HOH A . 
D 3 HOH 65  342 78  HOH HOH A . 
D 3 HOH 66  343 80  HOH HOH A . 
D 3 HOH 67  344 81  HOH HOH A . 
D 3 HOH 68  345 82  HOH HOH A . 
D 3 HOH 69  346 83  HOH HOH A . 
D 3 HOH 70  347 84  HOH HOH A . 
D 3 HOH 71  348 85  HOH HOH A . 
D 3 HOH 72  349 86  HOH HOH A . 
D 3 HOH 73  350 88  HOH HOH A . 
D 3 HOH 74  351 89  HOH HOH A . 
D 3 HOH 75  352 90  HOH HOH A . 
D 3 HOH 76  353 91  HOH HOH A . 
D 3 HOH 77  354 92  HOH HOH A . 
D 3 HOH 78  355 93  HOH HOH A . 
D 3 HOH 79  356 94  HOH HOH A . 
D 3 HOH 80  357 95  HOH HOH A . 
D 3 HOH 81  358 96  HOH HOH A . 
D 3 HOH 82  359 97  HOH HOH A . 
D 3 HOH 83  360 98  HOH HOH A . 
D 3 HOH 84  361 100 HOH HOH A . 
D 3 HOH 85  362 101 HOH HOH A . 
D 3 HOH 86  363 102 HOH HOH A . 
D 3 HOH 87  364 103 HOH HOH A . 
D 3 HOH 88  365 104 HOH HOH A . 
D 3 HOH 89  366 105 HOH HOH A . 
D 3 HOH 90  367 107 HOH HOH A . 
D 3 HOH 91  368 108 HOH HOH A . 
D 3 HOH 92  369 109 HOH HOH A . 
D 3 HOH 93  370 110 HOH HOH A . 
D 3 HOH 94  371 111 HOH HOH A . 
D 3 HOH 95  372 112 HOH HOH A . 
D 3 HOH 96  373 113 HOH HOH A . 
D 3 HOH 97  374 114 HOH HOH A . 
D 3 HOH 98  375 116 HOH HOH A . 
D 3 HOH 99  376 117 HOH HOH A . 
D 3 HOH 100 377 118 HOH HOH A . 
D 3 HOH 101 378 119 HOH HOH A . 
D 3 HOH 102 379 120 HOH HOH A . 
D 3 HOH 103 380 121 HOH HOH A . 
D 3 HOH 104 381 122 HOH HOH A . 
D 3 HOH 105 382 123 HOH HOH A . 
D 3 HOH 106 383 124 HOH HOH A . 
D 3 HOH 107 384 125 HOH HOH A . 
D 3 HOH 108 385 126 HOH HOH A . 
D 3 HOH 109 386 127 HOH HOH A . 
D 3 HOH 110 387 128 HOH HOH A . 
D 3 HOH 111 388 129 HOH HOH A . 
D 3 HOH 112 389 130 HOH HOH A . 
D 3 HOH 113 390 131 HOH HOH A . 
D 3 HOH 114 391 132 HOH HOH A . 
D 3 HOH 115 392 133 HOH HOH A . 
D 3 HOH 116 393 134 HOH HOH A . 
D 3 HOH 117 394 135 HOH HOH A . 
D 3 HOH 118 395 137 HOH HOH A . 
D 3 HOH 119 396 139 HOH HOH A . 
D 3 HOH 120 397 140 HOH HOH A . 
D 3 HOH 121 398 141 HOH HOH A . 
D 3 HOH 122 399 142 HOH HOH A . 
D 3 HOH 123 400 143 HOH HOH A . 
D 3 HOH 124 401 144 HOH HOH A . 
D 3 HOH 125 402 145 HOH HOH A . 
D 3 HOH 126 403 146 HOH HOH A . 
D 3 HOH 127 404 147 HOH HOH A . 
D 3 HOH 128 405 148 HOH HOH A . 
D 3 HOH 129 406 149 HOH HOH A . 
D 3 HOH 130 407 150 HOH HOH A . 
D 3 HOH 131 408 151 HOH HOH A . 
D 3 HOH 132 409 152 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z  1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 4_555 y,x,-z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-04-26 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    refinement       3.851 ? 1 
DENZO     'data reduction' .     ? 2 
SCALEPACK 'data scaling'   .     ? 3 
# 
_pdbx_entry_details.entry_id             1CKQ 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;FIRST 15 RESIDUES ARE DISORDERED IN THE CRYSTAL STRUCTURE
AND NOT SEEN IN THE ELECTRON DENSITY.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 81  ? ? -164.62 111.78 
2 1 ASN A 85  ? ? -103.43 43.69  
3 1 PRO A 164 ? ? -81.34  48.40  
4 1 ASN A 224 ? ? -174.42 136.51 
5 1 HIS A 225 ? ? -84.22  -70.81 
6 1 ASP A 227 ? ? 51.83   74.58  
7 1 LYS A 228 ? ? -141.11 -52.53 
8 1 SER A 229 ? ? 73.68   118.67 
9 1 SER A 276 ? ? -84.86  44.87  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    DT 
_pdbx_validate_planes.auth_asym_id    B 
_pdbx_validate_planes.auth_seq_id     8 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.062 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 2  ? B SER 1  
2  1 Y 1 A ASN 3  ? B ASN 2  
3  1 Y 1 A LYS 4  ? B LYS 3  
4  1 Y 1 A LYS 5  ? B LYS 4  
5  1 Y 1 A GLN 6  ? B GLN 5  
6  1 Y 1 A SER 7  ? B SER 6  
7  1 Y 1 A ASN 8  ? B ASN 7  
8  1 Y 1 A ARG 9  ? B ARG 8  
9  1 Y 1 A LEU 10 ? B LEU 9  
10 1 Y 1 A THR 11 ? B THR 10 
11 1 Y 1 A GLU 12 ? B GLU 11 
12 1 Y 1 A GLN 13 ? B GLN 12 
13 1 Y 1 A HIS 14 ? B HIS 13 
14 1 Y 1 A LYS 15 ? B LYS 14 
15 1 Y 1 A LEU 16 ? B LEU 15 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1CKQ 'double helix'        
1CKQ 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC 2  1_555 A DG 13 4_555 0.150  -0.112 0.361  -23.436 -1.841 2.537  1  B_DC2:DG13_B B 2  ? B 13 ? 19 1 
1 A DG 3  1_555 A DC 12 4_555 -0.203 -0.067 -0.064 -3.746  -3.302 -5.498 2  B_DG3:DC12_B B 3  ? B 12 ? 19 1 
1 A DC 4  1_555 A DG 11 4_555 0.280  0.014  -0.284 1.928   -3.963 -4.770 3  B_DC4:DG11_B B 4  ? B 11 ? 19 1 
1 A DG 5  1_555 A DC 10 4_555 -0.512 -0.180 -0.333 -9.480  1.981  0.868  4  B_DG5:DC10_B B 5  ? B 10 ? 19 1 
1 A DA 6  1_555 A DT 9  4_555 0.074  0.083  -0.053 2.387   -1.331 -2.827 5  B_DA6:DT9_B  B 6  ? B 9  ? 20 1 
1 A DA 7  1_555 A DT 8  4_555 0.365  -0.006 0.217  0.950   7.773  -6.041 6  B_DA7:DT8_B  B 7  ? B 8  ? 20 1 
1 A DT 8  1_555 A DA 7  4_555 -0.365 -0.006 0.217  -0.950  7.773  -6.041 7  B_DT8:DA7_B  B 8  ? B 7  ? 20 1 
1 A DT 9  1_555 A DA 6  4_555 -0.074 0.083  -0.053 -2.387  -1.331 -2.827 8  B_DT9:DA6_B  B 9  ? B 6  ? 20 1 
1 A DC 10 1_555 A DG 5  4_555 0.512  -0.180 -0.333 9.480   1.981  0.868  9  B_DC10:DG5_B B 10 ? B 5  ? 19 1 
1 A DG 11 1_555 A DC 4  4_555 -0.280 0.014  -0.284 -1.928  -3.963 -4.770 10 B_DG11:DC4_B B 11 ? B 4  ? 19 1 
1 A DC 12 1_555 A DG 3  4_555 0.203  -0.067 -0.064 3.746   -3.302 -5.498 11 B_DC12:DG3_B B 12 ? B 3  ? 19 1 
1 A DG 13 1_555 A DC 2  4_555 -0.150 -0.112 0.361  23.436  -1.841 2.537  12 B_DG13:DC2_B B 13 ? B 2  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 2  1_555 A DG 13 4_555 A DG 3  1_555 A DC 12 4_555 -0.224 0.222  2.874 2.278  8.338   25.953 -1.370 0.976  2.779 17.943  
-4.903 27.331 1  BB_DC2DG3:DC12DG13_BB B 2  ? B 13 ? B 3  ? B 12 ? 
1 A DG 3  1_555 A DC 12 4_555 A DC 4  1_555 A DG 11 4_555 -0.303 -0.503 3.347 1.279  0.773   37.068 -0.896 0.650  3.324 1.216   
-2.010 37.097 2  BB_DG3DC4:DG11DC12_BB B 3  ? B 12 ? B 4  ? B 11 ? 
1 A DC 4  1_555 A DG 11 4_555 A DG 5  1_555 A DC 10 4_555 0.911  -0.079 3.760 1.686  1.290   34.025 -0.372 -1.244 3.794 2.201   
-2.878 34.090 3  BB_DC4DG5:DC10DG11_BB B 4  ? B 11 ? B 5  ? B 10 ? 
1 A DG 5  1_555 A DC 10 4_555 A DA 6  1_555 A DT 9  4_555 -1.082 -0.233 3.305 -1.749 -0.711  33.157 -0.286 1.595  3.360 -1.244  
3.062  33.209 4  BB_DG5DA6:DT9DC10_BB  B 5  ? B 10 ? B 6  ? B 9  ? 
1 A DA 6  1_555 A DT 9  4_555 A DA 7  1_555 A DT 8  4_555 0.525  0.483  4.063 -2.203 28.680  23.536 -4.377 -1.221 2.949 51.351  
3.944  37.008 5  BB_DA6DA7:DT8DT9_BB   B 6  ? B 9  ? B 7  ? B 8  ? 
1 A DA 7  1_555 A DT 8  4_555 A DT 8  1_555 A DA 7  4_555 0.000  0.569  4.646 0.000  -49.303 39.473 3.760  0.000  2.598 -53.653 
0.000  62.376 6  BB_DA7DT8:DA7DT8_BB   B 7  ? B 8  ? B 8  ? B 7  ? 
1 A DT 8  1_555 A DA 7  4_555 A DT 9  1_555 A DA 6  4_555 -0.525 0.483  4.063 2.203  28.680  23.536 -4.377 1.221  2.949 51.351  
-3.944 37.008 7  BB_DT8DT9:DA6DA7_BB   B 8  ? B 7  ? B 9  ? B 6  ? 
1 A DT 9  1_555 A DA 6  4_555 A DC 10 1_555 A DG 5  4_555 1.082  -0.233 3.305 1.749  -0.711  33.157 -0.286 -1.595 3.360 -1.244  
-3.062 33.209 8  BB_DT9DC10:DG5DA6_BB  B 9  ? B 6  ? B 10 ? B 5  ? 
1 A DC 10 1_555 A DG 5  4_555 A DG 11 1_555 A DC 4  4_555 -0.911 -0.079 3.760 -1.686 1.290   34.025 -0.372 1.244  3.794 2.201   
2.878  34.090 9  BB_DC10DG11:DC4DG5_BB B 10 ? B 5  ? B 11 ? B 4  ? 
1 A DG 11 1_555 A DC 4  4_555 A DC 12 1_555 A DG 3  4_555 0.303  -0.503 3.347 -1.279 0.773   37.068 -0.896 -0.650 3.324 1.216   
2.010  37.097 10 BB_DG11DC12:DG3DC4_BB B 11 ? B 4  ? B 12 ? B 3  ? 
1 A DC 12 1_555 A DG 3  4_555 A DG 13 1_555 A DC 2  4_555 0.224  0.222  2.874 -2.278 8.338   25.953 -1.370 -0.976 2.779 17.943  
4.903  27.331 11 BB_DC12DG13:DC2DG3_BB B 12 ? B 3  ? B 13 ? B 2  ? 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#