data_1CL7
# 
_entry.id   1CL7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1CL7         
RCSB  RCSB001014   
WWPDB D_1000001014 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1CL7 
_pdbx_database_status.recvd_initial_deposition_date   1999-05-06 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lescar, J.'    1 
'Bentley, G.A.' 2 
# 
_citation.id                        primary 
_citation.title                     'Inhibition of the HIV-1 and HIV-2 proteases by a monoclonal antibody.' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            8 
_citation.page_first                2686 
_citation.page_last                 2696 
_citation.year                      1999 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10631984 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lescar, J.'     1  
primary 'Brynda, J.'     2  
primary 'Rezacova, P.'   3  
primary 'Stouracova, R.' 4  
primary 'Riottot, M.M.'  5  
primary 'Chitarra, V.'   6  
primary 'Fabry, M.'      7  
primary 'Horejsi, M.'    8  
primary 'Sedlacek, J.'   9  
primary 'Bentley, G.A.'  10 
# 
_cell.entry_id           1CL7 
_cell.length_a           46.400 
_cell.length_b           58.800 
_cell.length_c           143.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1CL7 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat 'PROTEIN (IGG1 ANTIBODY 1696 (light chain))'          23948.553 1 ? ? FAB ? 
2 polymer nat 'PROTEIN (IGG1 ANTIBODY 1696 (variable heavy chain))' 15050.611 1 ? ? FAB ? 
3 polymer nat 'PROTEIN (IGG1 ANTIBODY 1696 (constant heavy chain))' 8661.825  1 ? ? FAB ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'IMMUNOGLOBULIN, IGG1' 
2 'IMMUNOGLOBULIN, IGG1' 
3 'IMMUNOGLOBULIN, IGG1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;DVLMTQTPLYLPVSLGDQASISCRSSQTIVHNNGNTYLEWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKI
SRVEAEDLGIYYCFQGSHFPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSER
QNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
;
;DVLMTQTPLYLPVSLGDQASISCRSSQTIVHNNGNTYLEWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKI
SRVEAEDLGIYYCFQGSHFPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSER
QNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
;
L ? 
2 'polypeptide(L)' no no 
;QIQLQQSGPELKKPGETVKISCKATNYAFTDYSMHWVKQAPGGDLKYVGWINTETDEPTFADDFKGRFAFSLDTSTSTAF
LQINNLKNEDTATYFCVRDRHDYGEIFTYWGQGTTVTVSSAKTTPPSVYPLAPGS
;
;QIQLQQSGPELKKPGETVKISCKATNYAFTDYSMHWVKQAPGGDLKYVGWINTETDEPTFADDFKGRFAFSLDTSTSTAF
LQINNLKNEDTATYFCVRDRHDYGEIFTYWGQGTTVTVSSAKTTPPSVYPLAPGS
;
H ? 
3 'polypeptide(L)' no no 
;SMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
DC
;
;SMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
DC
;
I ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   VAL n 
1 3   LEU n 
1 4   MET n 
1 5   THR n 
1 6   GLN n 
1 7   THR n 
1 8   PRO n 
1 9   LEU n 
1 10  TYR n 
1 11  LEU n 
1 12  PRO n 
1 13  VAL n 
1 14  SER n 
1 15  LEU n 
1 16  GLY n 
1 17  ASP n 
1 18  GLN n 
1 19  ALA n 
1 20  SER n 
1 21  ILE n 
1 22  SER n 
1 23  CYS n 
1 24  ARG n 
1 25  SER n 
1 26  SER n 
1 27  GLN n 
1 28  THR n 
1 29  ILE n 
1 30  VAL n 
1 31  HIS n 
1 32  ASN n 
1 33  ASN n 
1 34  GLY n 
1 35  ASN n 
1 36  THR n 
1 37  TYR n 
1 38  LEU n 
1 39  GLU n 
1 40  TRP n 
1 41  TYR n 
1 42  LEU n 
1 43  GLN n 
1 44  LYS n 
1 45  PRO n 
1 46  GLY n 
1 47  GLN n 
1 48  SER n 
1 49  PRO n 
1 50  GLN n 
1 51  LEU n 
1 52  LEU n 
1 53  ILE n 
1 54  TYR n 
1 55  LYS n 
1 56  VAL n 
1 57  SER n 
1 58  ASN n 
1 59  ARG n 
1 60  PHE n 
1 61  SER n 
1 62  GLY n 
1 63  VAL n 
1 64  PRO n 
1 65  ASP n 
1 66  ARG n 
1 67  PHE n 
1 68  SER n 
1 69  GLY n 
1 70  SER n 
1 71  GLY n 
1 72  SER n 
1 73  GLY n 
1 74  THR n 
1 75  ASP n 
1 76  PHE n 
1 77  THR n 
1 78  LEU n 
1 79  LYS n 
1 80  ILE n 
1 81  SER n 
1 82  ARG n 
1 83  VAL n 
1 84  GLU n 
1 85  ALA n 
1 86  GLU n 
1 87  ASP n 
1 88  LEU n 
1 89  GLY n 
1 90  ILE n 
1 91  TYR n 
1 92  TYR n 
1 93  CYS n 
1 94  PHE n 
1 95  GLN n 
1 96  GLY n 
1 97  SER n 
1 98  HIS n 
1 99  PHE n 
1 100 PRO n 
1 101 PRO n 
1 102 THR n 
1 103 PHE n 
1 104 GLY n 
1 105 GLY n 
1 106 GLY n 
1 107 THR n 
1 108 LYS n 
1 109 LEU n 
1 110 GLU n 
1 111 ILE n 
1 112 LYS n 
1 113 ARG n 
1 114 ALA n 
1 115 ASP n 
1 116 ALA n 
1 117 ALA n 
1 118 PRO n 
1 119 THR n 
1 120 VAL n 
1 121 SER n 
1 122 ILE n 
1 123 PHE n 
1 124 PRO n 
1 125 PRO n 
1 126 SER n 
1 127 SER n 
1 128 GLU n 
1 129 GLN n 
1 130 LEU n 
1 131 THR n 
1 132 SER n 
1 133 GLY n 
1 134 GLY n 
1 135 ALA n 
1 136 SER n 
1 137 VAL n 
1 138 VAL n 
1 139 CYS n 
1 140 PHE n 
1 141 LEU n 
1 142 ASN n 
1 143 ASN n 
1 144 PHE n 
1 145 TYR n 
1 146 PRO n 
1 147 LYS n 
1 148 ASP n 
1 149 ILE n 
1 150 ASN n 
1 151 VAL n 
1 152 LYS n 
1 153 TRP n 
1 154 LYS n 
1 155 ILE n 
1 156 ASP n 
1 157 GLY n 
1 158 SER n 
1 159 GLU n 
1 160 ARG n 
1 161 GLN n 
1 162 ASN n 
1 163 GLY n 
1 164 VAL n 
1 165 LEU n 
1 166 ASN n 
1 167 SER n 
1 168 TRP n 
1 169 THR n 
1 170 ASP n 
1 171 GLN n 
1 172 ASP n 
1 173 SER n 
1 174 LYS n 
1 175 ASP n 
1 176 SER n 
1 177 THR n 
1 178 TYR n 
1 179 SER n 
1 180 MET n 
1 181 SER n 
1 182 SER n 
1 183 THR n 
1 184 LEU n 
1 185 THR n 
1 186 LEU n 
1 187 THR n 
1 188 LYS n 
1 189 ASP n 
1 190 GLU n 
1 191 TYR n 
1 192 GLU n 
1 193 ARG n 
1 194 HIS n 
1 195 ASN n 
1 196 SER n 
1 197 TYR n 
1 198 THR n 
1 199 CYS n 
1 200 GLU n 
1 201 ALA n 
1 202 THR n 
1 203 HIS n 
1 204 LYS n 
1 205 THR n 
1 206 SER n 
1 207 THR n 
1 208 SER n 
1 209 PRO n 
1 210 ILE n 
1 211 VAL n 
1 212 LYS n 
1 213 SER n 
1 214 PHE n 
1 215 ASN n 
1 216 ARG n 
2 1   GLN n 
2 2   ILE n 
2 3   GLN n 
2 4   LEU n 
2 5   GLN n 
2 6   GLN n 
2 7   SER n 
2 8   GLY n 
2 9   PRO n 
2 10  GLU n 
2 11  LEU n 
2 12  LYS n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  GLU n 
2 17  THR n 
2 18  VAL n 
2 19  LYS n 
2 20  ILE n 
2 21  SER n 
2 22  CYS n 
2 23  LYS n 
2 24  ALA n 
2 25  THR n 
2 26  ASN n 
2 27  TYR n 
2 28  ALA n 
2 29  PHE n 
2 30  THR n 
2 31  ASP n 
2 32  TYR n 
2 33  SER n 
2 34  MET n 
2 35  HIS n 
2 36  TRP n 
2 37  VAL n 
2 38  LYS n 
2 39  GLN n 
2 40  ALA n 
2 41  PRO n 
2 42  GLY n 
2 43  GLY n 
2 44  ASP n 
2 45  LEU n 
2 46  LYS n 
2 47  TYR n 
2 48  VAL n 
2 49  GLY n 
2 50  TRP n 
2 51  ILE n 
2 52  ASN n 
2 53  THR n 
2 54  GLU n 
2 55  THR n 
2 56  ASP n 
2 57  GLU n 
2 58  PRO n 
2 59  THR n 
2 60  PHE n 
2 61  ALA n 
2 62  ASP n 
2 63  ASP n 
2 64  PHE n 
2 65  LYS n 
2 66  GLY n 
2 67  ARG n 
2 68  PHE n 
2 69  ALA n 
2 70  PHE n 
2 71  SER n 
2 72  LEU n 
2 73  ASP n 
2 74  THR n 
2 75  SER n 
2 76  THR n 
2 77  SER n 
2 78  THR n 
2 79  ALA n 
2 80  PHE n 
2 81  LEU n 
2 82  GLN n 
2 83  ILE n 
2 84  ASN n 
2 85  ASN n 
2 86  LEU n 
2 87  LYS n 
2 88  ASN n 
2 89  GLU n 
2 90  ASP n 
2 91  THR n 
2 92  ALA n 
2 93  THR n 
2 94  TYR n 
2 95  PHE n 
2 96  CYS n 
2 97  VAL n 
2 98  ARG n 
2 99  ASP n 
2 100 ARG n 
2 101 HIS n 
2 102 ASP n 
2 103 TYR n 
2 104 GLY n 
2 105 GLU n 
2 106 ILE n 
2 107 PHE n 
2 108 THR n 
2 109 TYR n 
2 110 TRP n 
2 111 GLY n 
2 112 GLN n 
2 113 GLY n 
2 114 THR n 
2 115 THR n 
2 116 VAL n 
2 117 THR n 
2 118 VAL n 
2 119 SER n 
2 120 SER n 
2 121 ALA n 
2 122 LYS n 
2 123 THR n 
2 124 THR n 
2 125 PRO n 
2 126 PRO n 
2 127 SER n 
2 128 VAL n 
2 129 TYR n 
2 130 PRO n 
2 131 LEU n 
2 132 ALA n 
2 133 PRO n 
2 134 GLY n 
2 135 SER n 
3 1   SER n 
3 2   MET n 
3 3   VAL n 
3 4   THR n 
3 5   LEU n 
3 6   GLY n 
3 7   CYS n 
3 8   LEU n 
3 9   VAL n 
3 10  LYS n 
3 11  GLY n 
3 12  TYR n 
3 13  PHE n 
3 14  PRO n 
3 15  GLU n 
3 16  PRO n 
3 17  VAL n 
3 18  THR n 
3 19  VAL n 
3 20  THR n 
3 21  TRP n 
3 22  ASN n 
3 23  SER n 
3 24  GLY n 
3 25  SER n 
3 26  LEU n 
3 27  SER n 
3 28  SER n 
3 29  GLY n 
3 30  VAL n 
3 31  HIS n 
3 32  THR n 
3 33  PHE n 
3 34  PRO n 
3 35  ALA n 
3 36  VAL n 
3 37  LEU n 
3 38  GLN n 
3 39  SER n 
3 40  ASP n 
3 41  LEU n 
3 42  TYR n 
3 43  THR n 
3 44  LEU n 
3 45  SER n 
3 46  SER n 
3 47  SER n 
3 48  VAL n 
3 49  THR n 
3 50  VAL n 
3 51  PRO n 
3 52  SER n 
3 53  SER n 
3 54  PRO n 
3 55  ARG n 
3 56  PRO n 
3 57  SER n 
3 58  GLU n 
3 59  THR n 
3 60  VAL n 
3 61  THR n 
3 62  CYS n 
3 63  ASN n 
3 64  VAL n 
3 65  ALA n 
3 66  HIS n 
3 67  PRO n 
3 68  ALA n 
3 69  SER n 
3 70  SER n 
3 71  THR n 
3 72  LYS n 
3 73  VAL n 
3 74  ASP n 
3 75  LYS n 
3 76  LYS n 
3 77  ILE n 
3 78  VAL n 
3 79  PRO n 
3 80  ARG n 
3 81  ASP n 
3 82  CYS n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? 'house mouse' 'Mus musculus' 10090 Mus ? BALB/C ? ? ? ? ? HYBRIDOMA ? ? ? ? ? ? ? ? 
2 1 sample ? ? 'house mouse' 'Mus musculus' 10090 Mus ? BALB/C ? ? ? ? ? HYBRIDOMA ? ? ? ? ? ? ? ? 
3 1 sample ? ? 'house mouse' 'Mus musculus' 10090 Mus ? BALB/C ? ? ? ? ? HYBRIDOMA ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP IGH1M_MOUSE 3 P01869 ? ? ? 
2 PDB 1CL7        1 1CL7   ? ? ? 
3 PDB 1CL7        2 1CL7   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1CL7 I 1 ? 82  ? P01869 133 ? 214 ? 141 222 
2 2 1CL7 L 1 ? 216 ? 1CL7   1   ? 211 ? 1   211 
3 3 1CL7 H 1 ? 135 ? 1CL7   1   ? 128 ? 1   128 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1CL7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.05 
_exptl_crystal.density_percent_sol   39.86 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    'pH 7.0' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1995-03-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.99 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID2 
_diffrn_source.pdbx_wavelength             0.99 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1CL7 
_reflns.observed_criterion_sigma_I   0. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20. 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   40751 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            0.133 
_reflns.pdbx_Rsym_value              0.133 
_reflns.pdbx_netI_over_sigmaI        15. 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.05 
_reflns_shell.d_res_low              3.16 
_reflns_shell.percent_possible_all   100. 
_reflns_shell.Rmerge_I_obs           0.35 
_reflns_shell.pdbx_Rsym_value        0.35 
_reflns_shell.meanI_over_sigI_obs    4 
_reflns_shell.pdbx_redundancy        5.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1CL7 
_refine.ls_number_reflns_obs                     7406 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          3. 
_refine.pdbx_data_cutoff_high_absF               100000000. 
_refine.pdbx_data_cutoff_low_absF                0.0000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.0 
_refine.ls_d_res_high                            3.0 
_refine.ls_percent_reflns_obs                    96. 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.183 
_refine.ls_R_factor_R_free                       0.28 
_refine.ls_R_factor_R_free_error                 0.03 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5. 
_refine.ls_number_reflns_R_free                  323 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1FBI' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1CL7 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             0.25 
_refine_analyze.Luzzati_d_res_low_obs           8.0 
_refine_analyze.Luzzati_coordinate_error_free   0.34 
_refine_analyze.Luzzati_sigma_a_free            0.25 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3355 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               3355 
_refine_hist.d_res_high                       3.0 
_refine_hist.d_res_low                        8.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.012 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.95  ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      28.39 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.67  ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             1.38  1.5 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            2.    2   ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             2.    2   ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            2.5   2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       3.0 
_refine_ls_shell.d_res_low                        8.0 
_refine_ls_shell.number_reflns_R_work             3371 
_refine_ls_shell.R_factor_R_work                  0.25 
_refine_ls_shell.percent_reflns_obs               99.5 
_refine_ls_shell.R_factor_R_free                  0.315 
_refine_ls_shell.R_factor_R_free_error            0.05 
_refine_ls_shell.percent_reflns_R_free            5. 
_refine_ls_shell.number_reflns_R_free             50 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_pdbx_xplor_file.serial_no        1 
_pdbx_xplor_file.param_file       PARAM19X.PRO 
_pdbx_xplor_file.topol_file       TOPH19X.PRO 
_pdbx_xplor_file.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1CL7 
_struct.title                     'ANTI HIV1 PROTEASE FAB' 
_struct.pdbx_descriptor           'IGG1 ANTIBODY 1696 (FAB FRAGMENT)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1CL7 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'FAB FRAGMENT, CROSS-REACTIVITY, HIV1 PROTEASE, ENZYME INHIBITION, IMMUNOGLOBULIN, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 127 ? SER A 132 ? SER L 122 SER L 127 1 ? 6 
HELX_P HELX_P2 2 ILE A 155 ? GLY A 157 ? ILE L 150 GLY L 152 5 ? 3 
HELX_P HELX_P3 3 LYS A 188 ? ARG A 193 ? LYS L 183 ARG L 188 1 ? 6 
HELX_P HELX_P4 4 ASP B 62  ? PHE B 64  ? ASP H 61  PHE H 63  5 ? 3 
HELX_P HELX_P5 5 ASN C 22  ? GLY C 24  ? ASN I 162 GLY I 164 5 ? 3 
HELX_P HELX_P6 6 SER C 52  ? SER C 57  ? SER I 192 SER I 197 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 23  SG ? ? ? 1_555 A CYS 93  SG ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf2 disulf ? ? A CYS 139 SG ? ? ? 1_555 A CYS 199 SG ? ? L CYS 134 L CYS 194 1_555 ? ? ? ? ? ? ? 2.016 ? 
disulf3 disulf ? ? B CYS 22  SG ? ? ? 1_555 B CYS 96  SG ? ? H CYS 22  H CYS 92  1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf4 disulf ? ? C CYS 7   SG ? ? ? 1_555 C CYS 62  SG ? ? I CYS 147 I CYS 202 1_555 ? ? ? ? ? ? ? 2.029 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 7   A . ? THR 7   L PRO 8   A ? PRO 8   L 1 0.17  
2 PHE 99  A . ? PHE 94  L PRO 100 A ? PRO 95  L 1 0.50  
3 TYR 145 A . ? TYR 140 L PRO 146 A ? PRO 141 L 1 -1.21 
4 PHE 13  C . ? PHE 153 I PRO 14  C ? PRO 154 I 1 -0.80 
5 GLU 15  C . ? GLU 155 I PRO 16  C ? PRO 156 I 1 -0.27 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 5 ? 
C ? 4 ? 
D ? 3 ? 
E ? 4 ? 
F ? 6 ? 
G ? 3 ? 
H ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
F 5 6 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET A 4   ? THR A 7   ? MET L 4   THR L 7   
A 2 ALA A 19  ? SER A 25  ? ALA L 19  SER L 25  
A 3 PHE A 76  ? ILE A 80  ? PHE L 71  ILE L 75  
B 1 TYR A 10  ? VAL A 13  ? TYR L 10  VAL L 13  
B 2 THR A 107 ? ILE A 111 ? THR L 102 ILE L 106 
B 3 GLY A 89  ? GLN A 95  ? GLY L 84  GLN L 90  
B 4 LEU A 38  ? GLN A 43  ? LEU L 33  GLN L 38  
B 5 GLN A 50  ? ILE A 53  ? GLN L 45  ILE L 48  
C 1 SER A 121 ? PHE A 123 ? SER L 116 PHE L 118 
C 2 GLY A 134 ? PHE A 140 ? GLY L 129 PHE L 135 
C 3 MET A 180 ? THR A 187 ? MET L 175 THR L 182 
C 4 VAL A 164 ? TRP A 168 ? VAL L 159 TRP L 163 
D 1 TYR A 197 ? THR A 202 ? TYR L 192 THR L 197 
D 2 ASN A 150 ? ILE A 155 ? ASN L 145 ILE L 150 
D 3 SER A 158 ? ARG A 160 ? SER L 153 ARG L 155 
E 1 GLN B 3   ? GLN B 6   ? GLN H 3   GLN H 6   
E 2 VAL B 18  ? THR B 25  ? VAL H 18  THR H 25  
E 3 THR B 78  ? ILE B 83  ? THR H 77  ILE H 82  
E 4 PHE B 68  ? ASP B 73  ? PHE H 67  ASP H 72  
F 1 GLU B 10  ? LYS B 12  ? GLU H 10  LYS H 12  
F 2 THR B 114 ? VAL B 118 ? THR H 107 VAL H 111 
F 3 ALA B 92  ? VAL B 97  ? ALA H 88  VAL H 93  
F 4 MET B 34  ? GLN B 39  ? MET H 34  GLN H 39  
F 5 LEU B 45  ? ILE B 51  ? LEU H 45  ILE H 51  
F 6 PRO B 58  ? PHE B 60  ? PRO H 57  PHE H 59  
G 1 THR C 18  ? TRP C 21  ? THR I 158 TRP I 161 
G 2 THR C 61  ? HIS C 66  ? THR I 201 HIS I 206 
G 3 THR C 71  ? LYS C 76  ? THR I 211 LYS I 216 
H 1 VAL C 30  ? THR C 32  ? VAL I 170 THR I 172 
H 2 TYR C 42  ? PRO C 51  ? TYR I 182 PRO I 191 
H 3 MET C 2   ? TYR C 12  ? MET I 142 TYR I 152 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 5   ? O THR L 5   N ARG A 24  ? N ARG L 24  
A 2 3 O ALA A 19  ? O ALA L 19  N ILE A 80  ? N ILE L 75  
B 1 2 O LEU A 11  ? O LEU L 11  N LYS A 108 ? N LYS L 103 
B 2 3 O THR A 107 ? O THR L 102 N TYR A 91  ? N TYR L 86  
B 3 4 O ILE A 90  ? O ILE L 85  N GLN A 43  ? N GLN L 38  
B 4 5 O TRP A 40  ? O TRP L 35  N ILE A 53  ? N ILE L 48  
C 1 2 O SER A 121 ? O SER L 116 N PHE A 140 ? N PHE L 135 
C 2 3 O ALA A 135 ? O ALA L 130 N LEU A 186 ? N LEU L 181 
C 3 4 O SER A 181 ? O SER L 176 N SER A 167 ? N SER L 162 
D 1 2 O THR A 198 ? O THR L 193 N LYS A 154 ? N LYS L 149 
D 2 3 O TRP A 153 ? O TRP L 148 N ARG A 160 ? N ARG L 155 
E 1 2 O GLN B 3   ? O GLN H 3   N THR B 25  ? N THR H 25  
E 2 3 O VAL B 18  ? O VAL H 18  N ILE B 83  ? N ILE H 82  
E 3 4 O THR B 78  ? O THR H 77  N ASP B 73  ? N ASP H 72  
F 1 2 O GLU B 10  ? O GLU H 10  N THR B 117 ? N THR H 110 
F 2 3 O THR B 114 ? O THR H 107 N TYR B 94  ? N TYR H 90  
F 3 4 O THR B 93  ? O THR H 89  N GLN B 39  ? N GLN H 39  
F 4 5 O MET B 34  ? O MET H 34  N ILE B 51  ? N ILE H 51  
F 5 6 O TRP B 50  ? O TRP H 50  N THR B 59  ? N THR H 58  
G 1 2 O THR C 18  ? O THR I 158 N ALA C 65  ? N ALA I 205 
G 2 3 O CYS C 62  ? O CYS I 202 N LYS C 75  ? N LYS I 215 
H 1 2 O HIS C 31  ? O HIS I 171 N SER C 47  ? N SER I 187 
H 2 3 O TYR C 42  ? O TYR I 182 N TYR C 12  ? N TYR I 152 
# 
_database_PDB_matrix.entry_id          1CL7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1CL7 
_atom_sites.fract_transf_matrix[1][1]   0.021552 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017007 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006993 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . ASP A 1 1   ? 24.338 45.696 18.463 1.00 23.11 ? 1   ASP L N   1 
ATOM 2    C CA  . ASP A 1 1   ? 24.784 44.966 19.684 1.00 17.63 ? 1   ASP L CA  1 
ATOM 3    C C   . ASP A 1 1   ? 23.585 44.353 20.372 1.00 15.36 ? 1   ASP L C   1 
ATOM 4    O O   . ASP A 1 1   ? 22.803 45.059 21.013 1.00 12.93 ? 1   ASP L O   1 
ATOM 5    C CB  . ASP A 1 1   ? 25.489 45.919 20.652 1.00 21.13 ? 1   ASP L CB  1 
ATOM 6    C CG  . ASP A 1 1   ? 26.963 46.111 20.328 1.00 22.82 ? 1   ASP L CG  1 
ATOM 7    O OD1 . ASP A 1 1   ? 27.791 45.476 21.005 1.00 23.57 ? 1   ASP L OD1 1 
ATOM 8    O OD2 . ASP A 1 1   ? 27.305 46.906 19.423 1.00 23.58 ? 1   ASP L OD2 1 
ATOM 9    N N   . VAL A 1 2   ? 23.446 43.037 20.230 1.00 14.45 ? 2   VAL L N   1 
ATOM 10   C CA  . VAL A 1 2   ? 22.330 42.301 20.841 1.00 12.93 ? 2   VAL L CA  1 
ATOM 11   C C   . VAL A 1 2   ? 22.614 41.847 22.266 1.00 13.19 ? 2   VAL L C   1 
ATOM 12   O O   . VAL A 1 2   ? 23.342 40.878 22.501 1.00 9.43  ? 2   VAL L O   1 
ATOM 13   C CB  . VAL A 1 2   ? 21.925 41.077 20.013 1.00 9.69  ? 2   VAL L CB  1 
ATOM 14   C CG1 . VAL A 1 2   ? 20.904 40.262 20.756 1.00 12.32 ? 2   VAL L CG1 1 
ATOM 15   C CG2 . VAL A 1 2   ? 21.346 41.519 18.704 1.00 13.57 ? 2   VAL L CG2 1 
ATOM 16   N N   . LEU A 1 3   ? 22.006 42.537 23.218 1.00 12.14 ? 3   LEU L N   1 
ATOM 17   C CA  . LEU A 1 3   ? 22.209 42.188 24.605 1.00 14.80 ? 3   LEU L CA  1 
ATOM 18   C C   . LEU A 1 3   ? 21.462 40.885 24.908 1.00 13.77 ? 3   LEU L C   1 
ATOM 19   O O   . LEU A 1 3   ? 20.254 40.783 24.678 1.00 13.45 ? 3   LEU L O   1 
ATOM 20   C CB  . LEU A 1 3   ? 21.769 43.343 25.525 1.00 14.66 ? 3   LEU L CB  1 
ATOM 21   C CG  . LEU A 1 3   ? 22.274 44.763 25.177 1.00 20.13 ? 3   LEU L CG  1 
ATOM 22   C CD1 . LEU A 1 3   ? 23.744 44.713 24.774 1.00 23.99 ? 3   LEU L CD1 1 
ATOM 23   C CD2 . LEU A 1 3   ? 21.488 45.388 24.016 1.00 19.82 ? 3   LEU L CD2 1 
ATOM 24   N N   . MET A 1 4   ? 22.216 39.851 25.276 1.00 13.69 ? 4   MET L N   1 
ATOM 25   C CA  . MET A 1 4   ? 21.627 38.570 25.637 1.00 12.43 ? 4   MET L CA  1 
ATOM 26   C C   . MET A 1 4   ? 21.308 38.725 27.104 1.00 13.65 ? 4   MET L C   1 
ATOM 27   O O   . MET A 1 4   ? 22.146 39.215 27.880 1.00 12.80 ? 4   MET L O   1 
ATOM 28   C CB  . MET A 1 4   ? 22.603 37.416 25.450 1.00 9.82  ? 4   MET L CB  1 
ATOM 29   C CG  . MET A 1 4   ? 22.114 36.373 24.493 1.00 5.89  ? 4   MET L CG  1 
ATOM 30   S SD  . MET A 1 4   ? 21.773 37.107 22.882 1.00 2.00  ? 4   MET L SD  1 
ATOM 31   C CE  . MET A 1 4   ? 20.630 35.994 22.290 1.00 4.92  ? 4   MET L CE  1 
ATOM 32   N N   . THR A 1 5   ? 20.088 38.318 27.451 1.00 15.69 ? 5   THR L N   1 
ATOM 33   C CA  . THR A 1 5   ? 19.516 38.391 28.788 1.00 10.68 ? 5   THR L CA  1 
ATOM 34   C C   . THR A 1 5   ? 18.995 37.002 29.126 1.00 8.89  ? 5   THR L C   1 
ATOM 35   O O   . THR A 1 5   ? 18.301 36.396 28.319 1.00 5.91  ? 5   THR L O   1 
ATOM 36   C CB  . THR A 1 5   ? 18.355 39.420 28.747 1.00 11.24 ? 5   THR L CB  1 
ATOM 37   O OG1 . THR A 1 5   ? 18.884 40.749 28.896 1.00 10.40 ? 5   THR L OG1 1 
ATOM 38   C CG2 . THR A 1 5   ? 17.281 39.130 29.792 1.00 9.30  ? 5   THR L CG2 1 
ATOM 39   N N   . GLN A 1 6   ? 19.412 36.467 30.270 1.00 12.96 ? 6   GLN L N   1 
ATOM 40   C CA  . GLN A 1 6   ? 18.978 35.133 30.721 1.00 15.72 ? 6   GLN L CA  1 
ATOM 41   C C   . GLN A 1 6   ? 18.286 35.133 32.086 1.00 15.69 ? 6   GLN L C   1 
ATOM 42   O O   . GLN A 1 6   ? 18.584 35.950 32.979 1.00 10.37 ? 6   GLN L O   1 
ATOM 43   C CB  . GLN A 1 6   ? 20.126 34.140 30.776 1.00 16.80 ? 6   GLN L CB  1 
ATOM 44   C CG  . GLN A 1 6   ? 20.689 33.719 29.465 1.00 17.95 ? 6   GLN L CG  1 
ATOM 45   C CD  . GLN A 1 6   ? 21.829 32.752 29.671 1.00 23.23 ? 6   GLN L CD  1 
ATOM 46   O OE1 . GLN A 1 6   ? 22.999 33.085 29.463 1.00 20.90 ? 6   GLN L OE1 1 
ATOM 47   N NE2 . GLN A 1 6   ? 21.497 31.550 30.127 1.00 28.99 ? 6   GLN L NE2 1 
ATOM 48   N N   . THR A 1 7   ? 17.451 34.114 32.260 1.00 16.55 ? 7   THR L N   1 
ATOM 49   C CA  . THR A 1 7   ? 16.641 33.958 33.447 1.00 13.73 ? 7   THR L CA  1 
ATOM 50   C C   . THR A 1 7   ? 16.322 32.507 33.728 1.00 14.82 ? 7   THR L C   1 
ATOM 51   O O   . THR A 1 7   ? 15.725 31.820 32.891 1.00 11.08 ? 7   THR L O   1 
ATOM 52   C CB  . THR A 1 7   ? 15.367 34.797 33.282 1.00 13.79 ? 7   THR L CB  1 
ATOM 53   O OG1 . THR A 1 7   ? 15.632 36.120 33.768 1.00 12.74 ? 7   THR L OG1 1 
ATOM 54   C CG2 . THR A 1 7   ? 14.139 34.163 33.973 1.00 13.25 ? 7   THR L CG2 1 
ATOM 55   N N   . PRO A 1 8   ? 16.528 32.089 34.993 1.00 19.60 ? 8   PRO L N   1 
ATOM 56   C CA  . PRO A 1 8   ? 17.027 32.945 36.078 1.00 19.36 ? 8   PRO L CA  1 
ATOM 57   C C   . PRO A 1 8   ? 18.552 32.981 36.249 1.00 20.07 ? 8   PRO L C   1 
ATOM 58   O O   . PRO A 1 8   ? 19.272 32.210 35.616 1.00 19.82 ? 8   PRO L O   1 
ATOM 59   C CB  . PRO A 1 8   ? 16.326 32.357 37.292 1.00 18.35 ? 8   PRO L CB  1 
ATOM 60   C CG  . PRO A 1 8   ? 16.352 30.856 36.999 1.00 20.87 ? 8   PRO L CG  1 
ATOM 61   C CD  . PRO A 1 8   ? 16.328 30.706 35.474 1.00 22.82 ? 8   PRO L CD  1 
ATOM 62   N N   . LEU A 1 9   ? 19.037 33.902 37.079 1.00 19.26 ? 9   LEU L N   1 
ATOM 63   C CA  . LEU A 1 9   ? 20.472 34.021 37.326 1.00 19.80 ? 9   LEU L CA  1 
ATOM 64   C C   . LEU A 1 9   ? 20.919 32.705 37.973 1.00 20.11 ? 9   LEU L C   1 
ATOM 65   O O   . LEU A 1 9   ? 21.971 32.149 37.633 1.00 20.78 ? 9   LEU L O   1 
ATOM 66   C CB  . LEU A 1 9   ? 20.767 35.211 38.265 1.00 21.48 ? 9   LEU L CB  1 
ATOM 67   C CG  . LEU A 1 9   ? 22.155 35.896 38.285 1.00 21.92 ? 9   LEU L CG  1 
ATOM 68   C CD1 . LEU A 1 9   ? 22.479 36.479 39.671 1.00 18.01 ? 9   LEU L CD1 1 
ATOM 69   C CD2 . LEU A 1 9   ? 23.249 34.922 37.901 1.00 24.10 ? 9   LEU L CD2 1 
ATOM 70   N N   . TYR A 1 10  ? 20.101 32.212 38.898 1.00 18.62 ? 10  TYR L N   1 
ATOM 71   C CA  . TYR A 1 10  ? 20.382 30.968 39.591 1.00 16.83 ? 10  TYR L CA  1 
ATOM 72   C C   . TYR A 1 10  ? 19.163 30.078 39.511 1.00 13.87 ? 10  TYR L C   1 
ATOM 73   O O   . TYR A 1 10  ? 18.050 30.528 39.803 1.00 13.19 ? 10  TYR L O   1 
ATOM 74   C CB  . TYR A 1 10  ? 20.666 31.227 41.066 1.00 17.46 ? 10  TYR L CB  1 
ATOM 75   C CG  . TYR A 1 10  ? 21.886 32.044 41.335 1.00 18.76 ? 10  TYR L CG  1 
ATOM 76   C CD1 . TYR A 1 10  ? 21.790 33.305 41.938 1.00 20.96 ? 10  TYR L CD1 1 
ATOM 77   C CD2 . TYR A 1 10  ? 23.142 31.551 41.024 1.00 20.20 ? 10  TYR L CD2 1 
ATOM 78   C CE1 . TYR A 1 10  ? 22.924 34.053 42.223 1.00 20.80 ? 10  TYR L CE1 1 
ATOM 79   C CE2 . TYR A 1 10  ? 24.288 32.282 41.306 1.00 25.32 ? 10  TYR L CE2 1 
ATOM 80   C CZ  . TYR A 1 10  ? 24.175 33.540 41.903 1.00 23.90 ? 10  TYR L CZ  1 
ATOM 81   O OH  . TYR A 1 10  ? 25.320 34.282 42.146 1.00 26.58 ? 10  TYR L OH  1 
ATOM 82   N N   . LEU A 1 11  ? 19.380 28.819 39.159 1.00 6.36  ? 11  LEU L N   1 
ATOM 83   C CA  . LEU A 1 11  ? 18.298 27.865 39.090 1.00 8.71  ? 11  LEU L CA  1 
ATOM 84   C C   . LEU A 1 11  ? 18.726 26.582 39.796 1.00 13.70 ? 11  LEU L C   1 
ATOM 85   O O   . LEU A 1 11  ? 19.627 25.880 39.303 1.00 13.72 ? 11  LEU L O   1 
ATOM 86   C CB  . LEU A 1 11  ? 17.929 27.547 37.646 1.00 9.04  ? 11  LEU L CB  1 
ATOM 87   C CG  . LEU A 1 11  ? 16.784 26.557 37.370 1.00 11.11 ? 11  LEU L CG  1 
ATOM 88   C CD1 . LEU A 1 11  ? 17.161 25.088 37.550 1.00 6.92  ? 11  LEU L CD1 1 
ATOM 89   C CD2 . LEU A 1 11  ? 15.600 26.931 38.231 1.00 12.86 ? 11  LEU L CD2 1 
ATOM 90   N N   . PRO A 1 12  ? 18.159 26.319 41.009 1.00 12.96 ? 12  PRO L N   1 
ATOM 91   C CA  . PRO A 1 12  ? 18.413 25.139 41.845 1.00 7.89  ? 12  PRO L CA  1 
ATOM 92   C C   . PRO A 1 12  ? 17.262 24.196 41.622 1.00 3.79  ? 12  PRO L C   1 
ATOM 93   O O   . PRO A 1 12  ? 16.130 24.638 41.501 1.00 2.00  ? 12  PRO L O   1 
ATOM 94   C CB  . PRO A 1 12  ? 18.316 25.690 43.272 1.00 10.02 ? 12  PRO L CB  1 
ATOM 95   C CG  . PRO A 1 12  ? 18.232 27.200 43.113 1.00 10.47 ? 12  PRO L CG  1 
ATOM 96   C CD  . PRO A 1 12  ? 17.497 27.348 41.825 1.00 10.63 ? 12  PRO L CD  1 
ATOM 97   N N   . VAL A 1 13  ? 17.547 22.902 41.569 1.00 5.05  ? 13  VAL L N   1 
ATOM 98   C CA  . VAL A 1 13  ? 16.526 21.867 41.371 1.00 4.67  ? 13  VAL L CA  1 
ATOM 99   C C   . VAL A 1 13  ? 17.004 20.556 41.958 1.00 2.53  ? 13  VAL L C   1 
ATOM 100  O O   . VAL A 1 13  ? 18.153 20.443 42.410 1.00 2.00  ? 13  VAL L O   1 
ATOM 101  C CB  . VAL A 1 13  ? 16.183 21.607 39.853 1.00 7.54  ? 13  VAL L CB  1 
ATOM 102  C CG1 . VAL A 1 13  ? 15.103 22.571 39.377 1.00 11.33 ? 13  VAL L CG1 1 
ATOM 103  C CG2 . VAL A 1 13  ? 17.442 21.683 38.953 1.00 4.91  ? 13  VAL L CG2 1 
ATOM 104  N N   . SER A 1 14  ? 16.116 19.575 41.988 1.00 2.00  ? 14  SER L N   1 
ATOM 105  C CA  . SER A 1 14  ? 16.510 18.281 42.492 1.00 5.65  ? 14  SER L CA  1 
ATOM 106  C C   . SER A 1 14  ? 17.060 17.464 41.344 1.00 3.50  ? 14  SER L C   1 
ATOM 107  O O   . SER A 1 14  ? 17.015 17.877 40.182 1.00 2.84  ? 14  SER L O   1 
ATOM 108  C CB  . SER A 1 14  ? 15.330 17.579 43.130 1.00 7.68  ? 14  SER L CB  1 
ATOM 109  O OG  . SER A 1 14  ? 14.708 18.468 44.034 1.00 16.53 ? 14  SER L OG  1 
ATOM 110  N N   . LEU A 1 15  ? 17.635 16.323 41.661 1.00 2.69  ? 15  LEU L N   1 
ATOM 111  C CA  . LEU A 1 15  ? 18.159 15.496 40.596 1.00 7.50  ? 15  LEU L CA  1 
ATOM 112  C C   . LEU A 1 15  ? 16.941 14.909 39.873 1.00 9.02  ? 15  LEU L C   1 
ATOM 113  O O   . LEU A 1 15  ? 15.847 14.831 40.451 1.00 15.26 ? 15  LEU L O   1 
ATOM 114  C CB  . LEU A 1 15  ? 19.097 14.428 41.164 1.00 7.48  ? 15  LEU L CB  1 
ATOM 115  C CG  . LEU A 1 15  ? 20.480 14.946 41.589 1.00 7.49  ? 15  LEU L CG  1 
ATOM 116  C CD1 . LEU A 1 15  ? 21.543 14.515 40.580 1.00 6.17  ? 15  LEU L CD1 1 
ATOM 117  C CD2 . LEU A 1 15  ? 20.472 16.476 41.731 1.00 9.44  ? 15  LEU L CD2 1 
ATOM 118  N N   . GLY A 1 16  ? 17.080 14.622 38.586 1.00 5.41  ? 16  GLY L N   1 
ATOM 119  C CA  . GLY A 1 16  ? 15.958 14.078 37.844 1.00 3.88  ? 16  GLY L CA  1 
ATOM 120  C C   . GLY A 1 16  ? 14.808 15.055 37.596 1.00 4.05  ? 16  GLY L C   1 
ATOM 121  O O   . GLY A 1 16  ? 13.763 14.628 37.106 1.00 2.00  ? 16  GLY L O   1 
ATOM 122  N N   . ASP A 1 17  ? 14.991 16.343 37.909 1.00 2.00  ? 17  ASP L N   1 
ATOM 123  C CA  . ASP A 1 17  ? 13.950 17.334 37.695 1.00 2.00  ? 17  ASP L CA  1 
ATOM 124  C C   . ASP A 1 17  ? 14.120 17.988 36.357 1.00 10.42 ? 17  ASP L C   1 
ATOM 125  O O   . ASP A 1 17  ? 15.211 17.937 35.766 1.00 17.16 ? 17  ASP L O   1 
ATOM 126  C CB  . ASP A 1 17  ? 14.016 18.420 38.745 1.00 4.36  ? 17  ASP L CB  1 
ATOM 127  C CG  . ASP A 1 17  ? 13.558 17.942 40.092 1.00 10.98 ? 17  ASP L CG  1 
ATOM 128  O OD1 . ASP A 1 17  ? 13.896 16.787 40.439 1.00 14.53 ? 17  ASP L OD1 1 
ATOM 129  O OD2 . ASP A 1 17  ? 12.863 18.717 40.805 1.00 8.59  ? 17  ASP L OD2 1 
ATOM 130  N N   . GLN A 1 18  ? 13.034 18.560 35.839 1.00 13.38 ? 18  GLN L N   1 
ATOM 131  C CA  . GLN A 1 18  ? 13.126 19.267 34.572 1.00 12.65 ? 18  GLN L CA  1 
ATOM 132  C C   . GLN A 1 18  ? 13.437 20.745 34.814 1.00 11.80 ? 18  GLN L C   1 
ATOM 133  O O   . GLN A 1 18  ? 12.899 21.387 35.723 1.00 7.78  ? 18  GLN L O   1 
ATOM 134  C CB  . GLN A 1 18  ? 11.876 19.149 33.711 1.00 14.03 ? 18  GLN L CB  1 
ATOM 135  C CG  . GLN A 1 18  ? 11.981 20.123 32.548 1.00 21.78 ? 18  GLN L CG  1 
ATOM 136  C CD  . GLN A 1 18  ? 10.987 19.916 31.441 1.00 23.10 ? 18  GLN L CD  1 
ATOM 137  O OE1 . GLN A 1 18  ? 10.574 18.793 31.150 1.00 26.08 ? 18  GLN L OE1 1 
ATOM 138  N NE2 . GLN A 1 18  ? 10.614 21.012 30.786 1.00 23.87 ? 18  GLN L NE2 1 
ATOM 139  N N   . ALA A 1 19  ? 14.301 21.278 33.966 1.00 12.91 ? 19  ALA L N   1 
ATOM 140  C CA  . ALA A 1 19  ? 14.720 22.661 34.062 1.00 13.22 ? 19  ALA L CA  1 
ATOM 141  C C   . ALA A 1 19  ? 14.438 23.321 32.736 1.00 10.79 ? 19  ALA L C   1 
ATOM 142  O O   . ALA A 1 19  ? 14.562 22.697 31.688 1.00 13.58 ? 19  ALA L O   1 
ATOM 143  C CB  . ALA A 1 19  ? 16.223 22.726 34.371 1.00 12.87 ? 19  ALA L CB  1 
ATOM 144  N N   . SER A 1 20  ? 14.033 24.576 32.788 1.00 9.26  ? 20  SER L N   1 
ATOM 145  C CA  . SER A 1 20  ? 13.759 25.327 31.589 1.00 7.24  ? 20  SER L CA  1 
ATOM 146  C C   . SER A 1 20  ? 14.357 26.690 31.840 1.00 7.07  ? 20  SER L C   1 
ATOM 147  O O   . SER A 1 20  ? 13.859 27.452 32.679 1.00 15.20 ? 20  SER L O   1 
ATOM 148  C CB  . SER A 1 20  ? 12.247 25.407 31.343 1.00 9.52  ? 20  SER L CB  1 
ATOM 149  O OG  . SER A 1 20  ? 11.674 24.105 31.223 1.00 9.69  ? 20  SER L OG  1 
ATOM 150  N N   . ILE A 1 21  ? 15.521 26.912 31.239 1.00 4.77  ? 21  ILE L N   1 
ATOM 151  C CA  . ILE A 1 21  ? 16.245 28.175 31.351 1.00 4.56  ? 21  ILE L CA  1 
ATOM 152  C C   . ILE A 1 21  ? 15.873 28.983 30.102 1.00 5.37  ? 21  ILE L C   1 
ATOM 153  O O   . ILE A 1 21  ? 15.726 28.404 29.025 1.00 7.27  ? 21  ILE L O   1 
ATOM 154  C CB  . ILE A 1 21  ? 17.755 27.921 31.301 1.00 6.32  ? 21  ILE L CB  1 
ATOM 155  C CG1 . ILE A 1 21  ? 18.165 26.926 32.390 1.00 3.82  ? 21  ILE L CG1 1 
ATOM 156  C CG2 . ILE A 1 21  ? 18.525 29.257 31.325 1.00 5.26  ? 21  ILE L CG2 1 
ATOM 157  C CD1 . ILE A 1 21  ? 19.542 26.350 32.184 1.00 2.00  ? 21  ILE L CD1 1 
ATOM 158  N N   . SER A 1 22  ? 15.793 30.304 30.208 1.00 3.37  ? 22  SER L N   1 
ATOM 159  C CA  . SER A 1 22  ? 15.422 31.098 29.052 1.00 5.26  ? 22  SER L CA  1 
ATOM 160  C C   . SER A 1 22  ? 16.347 32.275 28.731 1.00 6.43  ? 22  SER L C   1 
ATOM 161  O O   . SER A 1 22  ? 16.850 32.944 29.639 1.00 2.00  ? 22  SER L O   1 
ATOM 162  C CB  . SER A 1 22  ? 14.002 31.619 29.230 1.00 7.33  ? 22  SER L CB  1 
ATOM 163  O OG  . SER A 1 22  ? 14.036 32.942 29.768 1.00 13.93 ? 22  SER L OG  1 
ATOM 164  N N   . CYS A 1 23  ? 16.446 32.579 27.430 1.00 12.31 ? 23  CYS L N   1 
ATOM 165  C CA  . CYS A 1 23  ? 17.262 33.672 26.874 1.00 15.36 ? 23  CYS L CA  1 
ATOM 166  C C   . CYS A 1 23  ? 16.341 34.697 26.167 1.00 16.83 ? 23  CYS L C   1 
ATOM 167  O O   . CYS A 1 23  ? 15.288 34.322 25.639 1.00 17.38 ? 23  CYS L O   1 
ATOM 168  C CB  . CYS A 1 23  ? 18.279 33.088 25.880 1.00 12.34 ? 23  CYS L CB  1 
ATOM 169  S SG  . CYS A 1 23  ? 19.545 34.247 25.270 1.00 13.69 ? 23  CYS L SG  1 
ATOM 170  N N   . ARG A 1 24  ? 16.725 35.974 26.158 1.00 15.55 ? 24  ARG L N   1 
ATOM 171  C CA  . ARG A 1 24  ? 15.909 37.007 25.523 1.00 17.62 ? 24  ARG L CA  1 
ATOM 172  C C   . ARG A 1 24  ? 16.862 37.822 24.689 1.00 19.07 ? 24  ARG L C   1 
ATOM 173  O O   . ARG A 1 24  ? 17.990 38.062 25.125 1.00 23.12 ? 24  ARG L O   1 
ATOM 174  C CB  . ARG A 1 24  ? 15.260 37.920 26.566 1.00 24.16 ? 24  ARG L CB  1 
ATOM 175  C CG  . ARG A 1 24  ? 13.856 38.427 26.213 1.00 30.56 ? 24  ARG L CG  1 
ATOM 176  C CD  . ARG A 1 24  ? 13.297 39.423 27.253 1.00 37.09 ? 24  ARG L CD  1 
ATOM 177  N NE  . ARG A 1 24  ? 13.426 38.960 28.641 1.00 44.89 ? 24  ARG L NE  1 
ATOM 178  C CZ  . ARG A 1 24  ? 12.842 39.516 29.712 1.00 48.78 ? 24  ARG L CZ  1 
ATOM 179  N NH1 . ARG A 1 24  ? 12.041 40.584 29.599 1.00 47.22 ? 24  ARG L NH1 1 
ATOM 180  N NH2 . ARG A 1 24  ? 13.102 39.025 30.927 1.00 48.65 ? 24  ARG L NH2 1 
ATOM 181  N N   . SER A 1 25  ? 16.403 38.253 23.508 1.00 16.52 ? 25  SER L N   1 
ATOM 182  C CA  . SER A 1 25  ? 17.188 39.046 22.549 1.00 9.73  ? 25  SER L CA  1 
ATOM 183  C C   . SER A 1 25  ? 16.693 40.496 22.367 1.00 9.06  ? 25  SER L C   1 
ATOM 184  O O   . SER A 1 25  ? 15.511 40.735 22.090 1.00 8.54  ? 25  SER L O   1 
ATOM 185  C CB  . SER A 1 25  ? 17.159 38.349 21.203 1.00 4.61  ? 25  SER L CB  1 
ATOM 186  O OG  . SER A 1 25  ? 18.463 38.236 20.711 1.00 4.81  ? 25  SER L OG  1 
ATOM 187  N N   . SER A 1 26  ? 17.601 41.457 22.481 1.00 2.37  ? 26  SER L N   1 
ATOM 188  C CA  . SER A 1 26  ? 17.223 42.841 22.330 1.00 2.00  ? 26  SER L CA  1 
ATOM 189  C C   . SER A 1 26  ? 16.717 43.060 20.931 1.00 6.94  ? 26  SER L C   1 
ATOM 190  O O   . SER A 1 26  ? 15.820 43.854 20.713 1.00 14.81 ? 26  SER L O   1 
ATOM 191  C CB  . SER A 1 26  ? 18.408 43.725 22.599 1.00 3.60  ? 26  SER L CB  1 
ATOM 192  O OG  . SER A 1 26  ? 19.609 43.034 22.329 1.00 5.36  ? 26  SER L OG  1 
ATOM 193  N N   . GLN A 1 27  ? 17.359 42.406 19.973 1.00 11.67 ? 27  GLN L N   1 
ATOM 194  C CA  . GLN A 1 27  ? 16.976 42.456 18.565 1.00 10.35 ? 27  GLN L CA  1 
ATOM 195  C C   . GLN A 1 27  ? 16.747 41.001 18.188 1.00 7.25  ? 27  GLN L C   1 
ATOM 196  O O   . GLN A 1 27  ? 17.185 40.087 18.889 1.00 5.09  ? 27  GLN L O   1 
ATOM 197  C CB  . GLN A 1 27  ? 18.121 42.984 17.683 1.00 14.00 ? 27  GLN L CB  1 
ATOM 198  C CG  . GLN A 1 27  ? 18.420 44.470 17.771 1.00 16.74 ? 27  GLN L CG  1 
ATOM 199  C CD  . GLN A 1 27  ? 19.466 44.947 16.750 1.00 16.57 ? 27  GLN L CD  1 
ATOM 200  O OE1 . GLN A 1 27  ? 20.636 44.531 16.786 1.00 18.36 ? 27  GLN L OE1 1 
ATOM 201  N NE2 . GLN A 1 27  ? 19.052 45.847 15.851 1.00 15.60 ? 27  GLN L NE2 1 
ATOM 202  N N   . THR A 1 28  A 16.037 40.773 17.100 1.00 2.85  ? 27  THR L N   1 
ATOM 203  C CA  . THR A 1 28  A 15.838 39.413 16.676 1.00 3.21  ? 27  THR L CA  1 
ATOM 204  C C   . THR A 1 28  A 17.214 38.939 16.315 1.00 9.38  ? 27  THR L C   1 
ATOM 205  O O   . THR A 1 28  A 18.121 39.748 16.078 1.00 7.68  ? 27  THR L O   1 
ATOM 206  C CB  . THR A 1 28  A 15.047 39.349 15.425 1.00 3.57  ? 27  THR L CB  1 
ATOM 207  O OG1 . THR A 1 28  A 13.802 40.023 15.622 1.00 8.35  ? 27  THR L OG1 1 
ATOM 208  C CG2 . THR A 1 28  A 14.796 37.928 15.056 1.00 6.02  ? 27  THR L CG2 1 
ATOM 209  N N   . ILE A 1 29  B 17.382 37.629 16.258 1.00 17.35 ? 27  ILE L N   1 
ATOM 210  C CA  . ILE A 1 29  B 18.676 37.091 15.894 1.00 19.63 ? 27  ILE L CA  1 
ATOM 211  C C   . ILE A 1 29  B 18.674 36.187 14.675 1.00 24.58 ? 27  ILE L C   1 
ATOM 212  O O   . ILE A 1 29  B 19.365 35.167 14.679 1.00 29.80 ? 27  ILE L O   1 
ATOM 213  C CB  . ILE A 1 29  B 19.370 36.394 17.070 1.00 16.03 ? 27  ILE L CB  1 
ATOM 214  C CG1 . ILE A 1 29  B 18.401 35.491 17.818 1.00 14.75 ? 27  ILE L CG1 1 
ATOM 215  C CG2 . ILE A 1 29  B 19.943 37.420 17.995 1.00 15.95 ? 27  ILE L CG2 1 
ATOM 216  C CD1 . ILE A 1 29  B 19.041 34.780 18.998 1.00 15.80 ? 27  ILE L CD1 1 
ATOM 217  N N   . VAL A 1 30  C 17.888 36.527 13.645 1.00 26.10 ? 27  VAL L N   1 
ATOM 218  C CA  . VAL A 1 30  C 17.895 35.736 12.406 1.00 23.65 ? 27  VAL L CA  1 
ATOM 219  C C   . VAL A 1 30  C 18.983 36.355 11.536 1.00 21.55 ? 27  VAL L C   1 
ATOM 220  O O   . VAL A 1 30  C 18.895 37.531 11.175 1.00 24.79 ? 27  VAL L O   1 
ATOM 221  C CB  . VAL A 1 30  C 16.502 35.702 11.649 1.00 24.28 ? 27  VAL L CB  1 
ATOM 222  C CG1 . VAL A 1 30  C 15.524 36.676 12.235 1.00 24.80 ? 27  VAL L CG1 1 
ATOM 223  C CG2 . VAL A 1 30  C 16.663 35.950 10.146 1.00 20.98 ? 27  VAL L CG2 1 
ATOM 224  N N   . HIS A 1 31  D 20.079 35.632 11.338 1.00 17.29 ? 27  HIS L N   1 
ATOM 225  C CA  . HIS A 1 31  D 21.151 36.157 10.511 1.00 17.17 ? 27  HIS L CA  1 
ATOM 226  C C   . HIS A 1 31  D 20.660 36.165 9.089  1.00 21.77 ? 27  HIS L C   1 
ATOM 227  O O   . HIS A 1 31  D 19.671 35.501 8.778  1.00 26.12 ? 27  HIS L O   1 
ATOM 228  C CB  . HIS A 1 31  D 22.381 35.279 10.586 1.00 14.49 ? 27  HIS L CB  1 
ATOM 229  C CG  . HIS A 1 31  D 23.464 35.684 9.647  1.00 13.82 ? 27  HIS L CG  1 
ATOM 230  N ND1 . HIS A 1 31  D 23.735 37.000 9.342  1.00 16.92 ? 27  HIS L ND1 1 
ATOM 231  C CD2 . HIS A 1 31  D 24.317 34.948 8.895  1.00 19.73 ? 27  HIS L CD2 1 
ATOM 232  C CE1 . HIS A 1 31  D 24.700 37.055 8.439  1.00 20.61 ? 27  HIS L CE1 1 
ATOM 233  N NE2 . HIS A 1 31  D 25.069 35.826 8.151  1.00 19.73 ? 27  HIS L NE2 1 
ATOM 234  N N   . ASN A 1 32  E 21.347 36.925 8.236  1.00 25.49 ? 27  ASN L N   1 
ATOM 235  C CA  . ASN A 1 32  E 21.035 37.044 6.798  1.00 25.40 ? 27  ASN L CA  1 
ATOM 236  C C   . ASN A 1 32  E 20.832 35.699 6.092  1.00 24.16 ? 27  ASN L C   1 
ATOM 237  O O   . ASN A 1 32  E 19.864 35.516 5.357  1.00 20.87 ? 27  ASN L O   1 
ATOM 238  C CB  . ASN A 1 32  E 22.131 37.855 6.099  1.00 25.77 ? 27  ASN L CB  1 
ATOM 239  C CG  . ASN A 1 32  E 22.322 39.234 6.727  1.00 26.70 ? 27  ASN L CG  1 
ATOM 240  O OD1 . ASN A 1 32  E 23.327 39.502 7.412  1.00 20.86 ? 27  ASN L OD1 1 
ATOM 241  N ND2 . ASN A 1 32  E 21.335 40.098 6.537  1.00 27.71 ? 27  ASN L ND2 1 
ATOM 242  N N   . ASN A 1 33  ? 21.719 34.750 6.372  1.00 25.10 ? 28  ASN L N   1 
ATOM 243  C CA  . ASN A 1 33  ? 21.653 33.400 5.800  1.00 27.72 ? 28  ASN L CA  1 
ATOM 244  C C   . ASN A 1 33  ? 20.228 32.840 5.724  1.00 27.72 ? 28  ASN L C   1 
ATOM 245  O O   . ASN A 1 33  ? 19.885 32.108 4.792  1.00 25.80 ? 28  ASN L O   1 
ATOM 246  C CB  . ASN A 1 33  ? 22.513 32.440 6.638  1.00 29.71 ? 28  ASN L CB  1 
ATOM 247  C CG  . ASN A 1 33  ? 24.013 32.574 6.353  1.00 35.10 ? 28  ASN L CG  1 
ATOM 248  O OD1 . ASN A 1 33  ? 24.418 32.769 5.212  1.00 39.15 ? 28  ASN L OD1 1 
ATOM 249  N ND2 . ASN A 1 33  ? 24.841 32.435 7.388  1.00 32.16 ? 28  ASN L ND2 1 
ATOM 250  N N   . GLY A 1 34  ? 19.409 33.212 6.707  1.00 28.84 ? 29  GLY L N   1 
ATOM 251  C CA  . GLY A 1 34  ? 18.033 32.744 6.807  1.00 29.52 ? 29  GLY L CA  1 
ATOM 252  C C   . GLY A 1 34  ? 17.904 31.801 8.009  1.00 28.16 ? 29  GLY L C   1 
ATOM 253  O O   . GLY A 1 34  ? 17.135 30.836 7.997  1.00 28.16 ? 29  GLY L O   1 
ATOM 254  N N   . ASN A 1 35  ? 18.691 32.066 9.048  1.00 25.18 ? 30  ASN L N   1 
ATOM 255  C CA  . ASN A 1 35  ? 18.693 31.249 10.249 1.00 22.14 ? 30  ASN L CA  1 
ATOM 256  C C   . ASN A 1 35  ? 19.159 31.991 11.494 1.00 24.43 ? 30  ASN L C   1 
ATOM 257  O O   . ASN A 1 35  ? 20.075 32.832 11.463 1.00 23.48 ? 30  ASN L O   1 
ATOM 258  C CB  . ASN A 1 35  ? 19.555 29.998 10.077 1.00 22.69 ? 30  ASN L CB  1 
ATOM 259  C CG  . ASN A 1 35  ? 20.483 30.075 8.889  1.00 20.38 ? 30  ASN L CG  1 
ATOM 260  O OD1 . ASN A 1 35  ? 21.257 31.015 8.741  1.00 22.10 ? 30  ASN L OD1 1 
ATOM 261  N ND2 . ASN A 1 35  ? 20.406 29.075 8.030  1.00 16.74 ? 30  ASN L ND2 1 
ATOM 262  N N   . THR A 1 36  ? 18.490 31.654 12.594 1.00 24.23 ? 31  THR L N   1 
ATOM 263  C CA  . THR A 1 36  ? 18.734 32.210 13.915 1.00 17.35 ? 31  THR L CA  1 
ATOM 264  C C   . THR A 1 36  ? 19.911 31.441 14.495 1.00 15.26 ? 31  THR L C   1 
ATOM 265  O O   . THR A 1 36  ? 19.979 30.219 14.375 1.00 13.36 ? 31  THR L O   1 
ATOM 266  C CB  . THR A 1 36  ? 17.488 32.005 14.817 1.00 18.29 ? 31  THR L CB  1 
ATOM 267  O OG1 . THR A 1 36  ? 16.337 32.640 14.237 1.00 17.06 ? 31  THR L OG1 1 
ATOM 268  C CG2 . THR A 1 36  ? 17.722 32.589 16.179 1.00 20.86 ? 31  THR L CG2 1 
ATOM 269  N N   . TYR A 1 37  ? 20.863 32.147 15.090 1.00 17.02 ? 32  TYR L N   1 
ATOM 270  C CA  . TYR A 1 37  ? 22.017 31.464 15.660 1.00 19.03 ? 32  TYR L CA  1 
ATOM 271  C C   . TYR A 1 37  ? 22.134 31.455 17.175 1.00 15.11 ? 32  TYR L C   1 
ATOM 272  O O   . TYR A 1 37  ? 23.159 31.843 17.713 1.00 9.36  ? 32  TYR L O   1 
ATOM 273  C CB  . TYR A 1 37  ? 23.310 31.941 15.012 1.00 21.06 ? 32  TYR L CB  1 
ATOM 274  C CG  . TYR A 1 37  ? 23.416 31.486 13.582 1.00 25.47 ? 32  TYR L CG  1 
ATOM 275  C CD1 . TYR A 1 37  ? 23.009 32.316 12.541 1.00 29.11 ? 32  TYR L CD1 1 
ATOM 276  C CD2 . TYR A 1 37  ? 23.932 30.236 13.263 1.00 26.19 ? 32  TYR L CD2 1 
ATOM 277  C CE1 . TYR A 1 37  ? 23.117 31.928 11.211 1.00 29.27 ? 32  TYR L CE1 1 
ATOM 278  C CE2 . TYR A 1 37  ? 24.045 29.831 11.931 1.00 31.11 ? 32  TYR L CE2 1 
ATOM 279  C CZ  . TYR A 1 37  ? 23.641 30.691 10.909 1.00 31.52 ? 32  TYR L CZ  1 
ATOM 280  O OH  . TYR A 1 37  ? 23.827 30.347 9.589  1.00 33.49 ? 32  TYR L OH  1 
ATOM 281  N N   . LEU A 1 38  ? 21.072 30.992 17.838 1.00 12.26 ? 33  LEU L N   1 
ATOM 282  C CA  . LEU A 1 38  ? 21.023 30.879 19.286 1.00 6.86  ? 33  LEU L CA  1 
ATOM 283  C C   . LEU A 1 38  ? 21.801 29.645 19.666 1.00 3.11  ? 33  LEU L C   1 
ATOM 284  O O   . LEU A 1 38  ? 21.460 28.542 19.253 1.00 2.00  ? 33  LEU L O   1 
ATOM 285  C CB  . LEU A 1 38  ? 19.592 30.709 19.755 1.00 5.87  ? 33  LEU L CB  1 
ATOM 286  C CG  . LEU A 1 38  ? 19.509 29.895 21.043 1.00 5.31  ? 33  LEU L CG  1 
ATOM 287  C CD1 . LEU A 1 38  ? 20.078 30.721 22.195 1.00 3.38  ? 33  LEU L CD1 1 
ATOM 288  C CD2 . LEU A 1 38  ? 18.071 29.403 21.296 1.00 2.00  ? 33  LEU L CD2 1 
ATOM 289  N N   . GLU A 1 39  ? 22.802 29.836 20.511 1.00 7.59  ? 34  GLU L N   1 
ATOM 290  C CA  . GLU A 1 39  ? 23.671 28.759 20.950 1.00 9.52  ? 34  GLU L CA  1 
ATOM 291  C C   . GLU A 1 39  ? 23.664 28.620 22.473 1.00 9.37  ? 34  GLU L C   1 
ATOM 292  O O   . GLU A 1 39  ? 23.704 29.619 23.196 1.00 7.97  ? 34  GLU L O   1 
ATOM 293  C CB  . GLU A 1 39  ? 25.103 29.028 20.464 1.00 11.62 ? 34  GLU L CB  1 
ATOM 294  C CG  . GLU A 1 39  ? 25.493 28.347 19.144 1.00 15.26 ? 34  GLU L CG  1 
ATOM 295  C CD  . GLU A 1 39  ? 24.855 28.997 17.917 1.00 19.48 ? 34  GLU L CD  1 
ATOM 296  O OE1 . GLU A 1 39  ? 25.359 30.052 17.452 1.00 18.79 ? 34  GLU L OE1 1 
ATOM 297  O OE2 . GLU A 1 39  ? 23.850 28.445 17.411 1.00 20.93 ? 34  GLU L OE2 1 
ATOM 298  N N   . TRP A 1 40  ? 23.639 27.376 22.953 1.00 8.45  ? 35  TRP L N   1 
ATOM 299  C CA  . TRP A 1 40  ? 23.637 27.108 24.387 1.00 6.33  ? 35  TRP L CA  1 
ATOM 300  C C   . TRP A 1 40  ? 24.928 26.420 24.768 1.00 2.00  ? 35  TRP L C   1 
ATOM 301  O O   . TRP A 1 40  ? 25.247 25.380 24.237 1.00 2.00  ? 35  TRP L O   1 
ATOM 302  C CB  . TRP A 1 40  ? 22.422 26.254 24.805 1.00 8.07  ? 35  TRP L CB  1 
ATOM 303  C CG  . TRP A 1 40  ? 21.102 27.004 24.855 1.00 3.85  ? 35  TRP L CG  1 
ATOM 304  C CD1 . TRP A 1 40  ? 20.114 26.989 23.909 1.00 2.00  ? 35  TRP L CD1 1 
ATOM 305  C CD2 . TRP A 1 40  ? 20.653 27.914 25.881 1.00 2.99  ? 35  TRP L CD2 1 
ATOM 306  N NE1 . TRP A 1 40  ? 19.091 27.831 24.277 1.00 2.26  ? 35  TRP L NE1 1 
ATOM 307  C CE2 . TRP A 1 40  ? 19.396 28.414 25.479 1.00 3.73  ? 35  TRP L CE2 1 
ATOM 308  C CE3 . TRP A 1 40  ? 21.203 28.348 27.102 1.00 2.00  ? 35  TRP L CE3 1 
ATOM 309  C CZ2 . TRP A 1 40  ? 18.663 29.339 26.257 1.00 3.92  ? 35  TRP L CZ2 1 
ATOM 310  C CZ3 . TRP A 1 40  ? 20.468 29.270 27.881 1.00 3.16  ? 35  TRP L CZ3 1 
ATOM 311  C CH2 . TRP A 1 40  ? 19.216 29.752 27.454 1.00 2.74  ? 35  TRP L CH2 1 
ATOM 312  N N   . TYR A 1 41  ? 25.685 27.047 25.655 1.00 3.49  ? 36  TYR L N   1 
ATOM 313  C CA  . TYR A 1 41  ? 26.958 26.530 26.129 1.00 4.02  ? 36  TYR L CA  1 
ATOM 314  C C   . TYR A 1 41  ? 26.804 26.135 27.583 1.00 5.63  ? 36  TYR L C   1 
ATOM 315  O O   . TYR A 1 41  ? 25.988 26.695 28.319 1.00 8.53  ? 36  TYR L O   1 
ATOM 316  C CB  . TYR A 1 41  ? 28.083 27.592 26.004 1.00 9.62  ? 36  TYR L CB  1 
ATOM 317  C CG  . TYR A 1 41  ? 28.485 27.874 24.582 1.00 10.77 ? 36  TYR L CG  1 
ATOM 318  C CD1 . TYR A 1 41  ? 29.426 27.070 23.944 1.00 13.58 ? 36  TYR L CD1 1 
ATOM 319  C CD2 . TYR A 1 41  ? 27.791 28.826 23.815 1.00 11.19 ? 36  TYR L CD2 1 
ATOM 320  C CE1 . TYR A 1 41  ? 29.637 27.173 22.580 1.00 14.23 ? 36  TYR L CE1 1 
ATOM 321  C CE2 . TYR A 1 41  ? 27.998 28.946 22.452 1.00 7.49  ? 36  TYR L CE2 1 
ATOM 322  C CZ  . TYR A 1 41  ? 28.918 28.109 21.840 1.00 11.29 ? 36  TYR L CZ  1 
ATOM 323  O OH  . TYR A 1 41  ? 29.082 28.142 20.476 1.00 12.93 ? 36  TYR L OH  1 
ATOM 324  N N   . LEU A 1 42  ? 27.631 25.198 28.005 1.00 4.36  ? 37  LEU L N   1 
ATOM 325  C CA  . LEU A 1 42  ? 27.612 24.741 29.362 1.00 6.82  ? 37  LEU L CA  1 
ATOM 326  C C   . LEU A 1 42  ? 29.031 24.824 29.867 1.00 9.03  ? 37  LEU L C   1 
ATOM 327  O O   . LEU A 1 42  ? 29.905 24.107 29.393 1.00 11.41 ? 37  LEU L O   1 
ATOM 328  C CB  . LEU A 1 42  ? 27.125 23.299 29.430 1.00 7.45  ? 37  LEU L CB  1 
ATOM 329  C CG  . LEU A 1 42  ? 27.474 22.540 30.719 1.00 9.30  ? 37  LEU L CG  1 
ATOM 330  C CD1 . LEU A 1 42  ? 26.933 23.233 31.955 1.00 9.96  ? 37  LEU L CD1 1 
ATOM 331  C CD2 . LEU A 1 42  ? 26.947 21.138 30.618 1.00 13.78 ? 37  LEU L CD2 1 
ATOM 332  N N   . GLN A 1 43  ? 29.288 25.704 30.818 1.00 10.07 ? 38  GLN L N   1 
ATOM 333  C CA  . GLN A 1 43  ? 30.638 25.767 31.328 1.00 11.96 ? 38  GLN L CA  1 
ATOM 334  C C   . GLN A 1 43  ? 30.635 25.167 32.711 1.00 15.08 ? 38  GLN L C   1 
ATOM 335  O O   . GLN A 1 43  ? 29.771 25.501 33.527 1.00 17.10 ? 38  GLN L O   1 
ATOM 336  C CB  . GLN A 1 43  ? 31.147 27.191 31.373 1.00 6.16  ? 38  GLN L CB  1 
ATOM 337  C CG  . GLN A 1 43  ? 32.589 27.280 31.768 1.00 2.00  ? 38  GLN L CG  1 
ATOM 338  C CD  . GLN A 1 43  ? 33.048 28.696 31.765 1.00 3.84  ? 38  GLN L CD  1 
ATOM 339  O OE1 . GLN A 1 43  ? 34.087 29.044 31.175 1.00 2.99  ? 38  GLN L OE1 1 
ATOM 340  N NE2 . GLN A 1 43  ? 32.232 29.564 32.362 1.00 3.34  ? 38  GLN L NE2 1 
ATOM 341  N N   . LYS A 1 44  ? 31.550 24.230 32.943 1.00 15.74 ? 39  LYS L N   1 
ATOM 342  C CA  . LYS A 1 44  ? 31.665 23.588 34.239 1.00 14.18 ? 39  LYS L CA  1 
ATOM 343  C C   . LYS A 1 44  ? 32.711 24.390 35.024 1.00 15.25 ? 39  LYS L C   1 
ATOM 344  O O   . LYS A 1 44  ? 33.141 25.454 34.573 1.00 15.54 ? 39  LYS L O   1 
ATOM 345  C CB  . LYS A 1 44  ? 32.052 22.121 34.061 1.00 14.59 ? 39  LYS L CB  1 
ATOM 346  C CG  . LYS A 1 44  ? 31.116 21.338 33.124 1.00 18.55 ? 39  LYS L CG  1 
ATOM 347  C CD  . LYS A 1 44  ? 30.254 20.307 33.844 1.00 16.53 ? 39  LYS L CD  1 
ATOM 348  C CE  . LYS A 1 44  ? 29.152 19.752 32.937 1.00 15.58 ? 39  LYS L CE  1 
ATOM 349  N NZ  . LYS A 1 44  ? 29.480 18.499 32.206 1.00 14.73 ? 39  LYS L NZ  1 
ATOM 350  N N   . PRO A 1 45  ? 33.069 23.955 36.238 1.00 16.17 ? 40  PRO L N   1 
ATOM 351  C CA  . PRO A 1 45  ? 34.059 24.700 37.018 1.00 14.07 ? 40  PRO L CA  1 
ATOM 352  C C   . PRO A 1 45  ? 35.477 24.705 36.460 1.00 13.44 ? 40  PRO L C   1 
ATOM 353  O O   . PRO A 1 45  ? 36.121 23.668 36.346 1.00 14.39 ? 40  PRO L O   1 
ATOM 354  C CB  . PRO A 1 45  ? 33.997 24.008 38.366 1.00 17.49 ? 40  PRO L CB  1 
ATOM 355  C CG  . PRO A 1 45  ? 32.562 23.547 38.434 1.00 18.36 ? 40  PRO L CG  1 
ATOM 356  C CD  . PRO A 1 45  ? 32.398 22.950 37.084 1.00 17.82 ? 40  PRO L CD  1 
ATOM 357  N N   . GLY A 1 46  ? 35.964 25.895 36.138 1.00 15.08 ? 41  GLY L N   1 
ATOM 358  C CA  . GLY A 1 46  ? 37.314 26.043 35.606 1.00 20.39 ? 41  GLY L CA  1 
ATOM 359  C C   . GLY A 1 46  ? 37.489 25.389 34.246 1.00 22.31 ? 41  GLY L C   1 
ATOM 360  O O   . GLY A 1 46  ? 38.577 24.941 33.878 1.00 22.70 ? 41  GLY L O   1 
ATOM 361  N N   . GLN A 1 47  ? 36.406 25.367 33.480 1.00 21.66 ? 42  GLN L N   1 
ATOM 362  C CA  . GLN A 1 47  ? 36.407 24.764 32.161 1.00 19.20 ? 42  GLN L CA  1 
ATOM 363  C C   . GLN A 1 47  ? 35.922 25.746 31.077 1.00 18.33 ? 42  GLN L C   1 
ATOM 364  O O   . GLN A 1 47  ? 35.482 26.859 31.388 1.00 16.19 ? 42  GLN L O   1 
ATOM 365  C CB  . GLN A 1 47  ? 35.516 23.524 32.197 1.00 18.37 ? 42  GLN L CB  1 
ATOM 366  C CG  . GLN A 1 47  ? 35.924 22.483 33.236 1.00 16.76 ? 42  GLN L CG  1 
ATOM 367  C CD  . GLN A 1 47  ? 35.083 21.223 33.139 1.00 15.99 ? 42  GLN L CD  1 
ATOM 368  O OE1 . GLN A 1 47  ? 34.881 20.513 34.122 1.00 11.85 ? 42  GLN L OE1 1 
ATOM 369  N NE2 . GLN A 1 47  ? 34.548 20.964 31.951 1.00 18.50 ? 42  GLN L NE2 1 
ATOM 370  N N   . SER A 1 48  ? 36.020 25.329 29.812 1.00 14.25 ? 43  SER L N   1 
ATOM 371  C CA  . SER A 1 48  ? 35.576 26.145 28.685 1.00 11.98 ? 43  SER L CA  1 
ATOM 372  C C   . SER A 1 48  ? 34.143 25.741 28.277 1.00 11.71 ? 43  SER L C   1 
ATOM 373  O O   . SER A 1 48  ? 33.691 24.640 28.619 1.00 20.19 ? 43  SER L O   1 
ATOM 374  C CB  . SER A 1 48  ? 36.554 25.985 27.526 1.00 9.26  ? 43  SER L CB  1 
ATOM 375  O OG  . SER A 1 48  ? 37.063 24.669 27.510 1.00 10.72 ? 43  SER L OG  1 
ATOM 376  N N   . PRO A 1 49  ? 33.391 26.639 27.618 1.00 7.12  ? 44  PRO L N   1 
ATOM 377  C CA  . PRO A 1 49  ? 32.013 26.423 27.167 1.00 7.61  ? 44  PRO L CA  1 
ATOM 378  C C   . PRO A 1 49  ? 31.704 25.292 26.149 1.00 8.97  ? 44  PRO L C   1 
ATOM 379  O O   . PRO A 1 49  ? 32.064 25.369 24.978 1.00 14.40 ? 44  PRO L O   1 
ATOM 380  C CB  . PRO A 1 49  ? 31.625 27.796 26.627 1.00 6.60  ? 44  PRO L CB  1 
ATOM 381  C CG  . PRO A 1 49  ? 32.419 28.726 27.483 1.00 2.00  ? 44  PRO L CG  1 
ATOM 382  C CD  . PRO A 1 49  ? 33.753 28.063 27.468 1.00 4.93  ? 44  PRO L CD  1 
ATOM 383  N N   . GLN A 1 50  ? 30.978 24.278 26.602 1.00 9.05  ? 45  GLN L N   1 
ATOM 384  C CA  . GLN A 1 50  ? 30.576 23.160 25.759 1.00 8.29  ? 45  GLN L CA  1 
ATOM 385  C C   . GLN A 1 50  ? 29.296 23.508 24.986 1.00 8.73  ? 45  GLN L C   1 
ATOM 386  O O   . GLN A 1 50  ? 28.224 23.651 25.576 1.00 8.43  ? 45  GLN L O   1 
ATOM 387  C CB  . GLN A 1 50  ? 30.279 21.919 26.612 1.00 9.02  ? 45  GLN L CB  1 
ATOM 388  C CG  . GLN A 1 50  ? 31.377 21.518 27.565 1.00 16.84 ? 45  GLN L CG  1 
ATOM 389  C CD  . GLN A 1 50  ? 30.871 20.694 28.760 1.00 24.50 ? 45  GLN L CD  1 
ATOM 390  O OE1 . GLN A 1 50  ? 31.049 19.474 28.803 1.00 29.56 ? 45  GLN L OE1 1 
ATOM 391  N NE2 . GLN A 1 50  ? 30.287 21.369 29.755 1.00 22.58 ? 45  GLN L NE2 1 
ATOM 392  N N   . LEU A 1 51  ? 29.397 23.678 23.673 1.00 13.89 ? 46  LEU L N   1 
ATOM 393  C CA  . LEU A 1 51  ? 28.201 23.950 22.864 1.00 14.87 ? 46  LEU L CA  1 
ATOM 394  C C   . LEU A 1 51  ? 27.211 22.799 23.147 1.00 14.07 ? 46  LEU L C   1 
ATOM 395  O O   . LEU A 1 51  ? 27.581 21.618 23.155 1.00 19.05 ? 46  LEU L O   1 
ATOM 396  C CB  . LEU A 1 51  ? 28.565 23.979 21.374 1.00 14.70 ? 46  LEU L CB  1 
ATOM 397  C CG  . LEU A 1 51  ? 27.451 23.752 20.342 1.00 15.54 ? 46  LEU L CG  1 
ATOM 398  C CD1 . LEU A 1 51  ? 26.596 25.013 20.157 1.00 17.86 ? 46  LEU L CD1 1 
ATOM 399  C CD2 . LEU A 1 51  ? 28.071 23.344 19.021 1.00 14.73 ? 46  LEU L CD2 1 
ATOM 400  N N   . LEU A 1 52  ? 25.954 23.130 23.367 1.00 9.77  ? 47  LEU L N   1 
ATOM 401  C CA  . LEU A 1 52  ? 24.973 22.106 23.663 1.00 4.97  ? 47  LEU L CA  1 
ATOM 402  C C   . LEU A 1 52  ? 23.907 22.052 22.600 1.00 5.55  ? 47  LEU L C   1 
ATOM 403  O O   . LEU A 1 52  ? 23.532 20.970 22.172 1.00 7.89  ? 47  LEU L O   1 
ATOM 404  C CB  . LEU A 1 52  ? 24.339 22.363 25.020 1.00 3.80  ? 47  LEU L CB  1 
ATOM 405  C CG  . LEU A 1 52  ? 25.198 22.200 26.260 1.00 2.00  ? 47  LEU L CG  1 
ATOM 406  C CD1 . LEU A 1 52  ? 24.338 22.529 27.448 1.00 4.15  ? 47  LEU L CD1 1 
ATOM 407  C CD2 . LEU A 1 52  ? 25.717 20.779 26.366 1.00 2.00  ? 47  LEU L CD2 1 
ATOM 408  N N   . ILE A 1 53  ? 23.416 23.225 22.197 1.00 6.91  ? 48  ILE L N   1 
ATOM 409  C CA  . ILE A 1 53  ? 22.387 23.361 21.170 1.00 3.55  ? 48  ILE L CA  1 
ATOM 410  C C   . ILE A 1 53  ? 22.809 24.422 20.131 1.00 5.40  ? 48  ILE L C   1 
ATOM 411  O O   . ILE A 1 53  ? 23.568 25.360 20.431 1.00 2.00  ? 48  ILE L O   1 
ATOM 412  C CB  . ILE A 1 53  ? 21.037 23.733 21.825 1.00 3.18  ? 48  ILE L CB  1 
ATOM 413  C CG1 . ILE A 1 53  ? 20.060 22.563 21.739 1.00 3.72  ? 48  ILE L CG1 1 
ATOM 414  C CG2 . ILE A 1 53  ? 20.430 24.957 21.183 1.00 4.01  ? 48  ILE L CG2 1 
ATOM 415  C CD1 . ILE A 1 53  ? 20.305 21.472 22.715 1.00 3.01  ? 48  ILE L CD1 1 
ATOM 416  N N   . TYR A 1 54  ? 22.359 24.246 18.897 1.00 10.96 ? 49  TYR L N   1 
ATOM 417  C CA  . TYR A 1 54  ? 22.697 25.198 17.854 1.00 13.78 ? 49  TYR L CA  1 
ATOM 418  C C   . TYR A 1 54  ? 21.600 25.522 16.865 1.00 12.77 ? 49  TYR L C   1 
ATOM 419  O O   . TYR A 1 54  ? 20.649 24.750 16.671 1.00 6.04  ? 49  TYR L O   1 
ATOM 420  C CB  . TYR A 1 54  ? 24.054 24.892 17.170 1.00 16.69 ? 49  TYR L CB  1 
ATOM 421  C CG  . TYR A 1 54  ? 24.176 23.670 16.295 1.00 12.47 ? 49  TYR L CG  1 
ATOM 422  C CD1 . TYR A 1 54  ? 23.579 23.619 15.059 1.00 13.82 ? 49  TYR L CD1 1 
ATOM 423  C CD2 . TYR A 1 54  ? 24.979 22.613 16.672 1.00 16.20 ? 49  TYR L CD2 1 
ATOM 424  C CE1 . TYR A 1 54  ? 23.788 22.557 14.206 1.00 18.49 ? 49  TYR L CE1 1 
ATOM 425  C CE2 . TYR A 1 54  ? 25.195 21.538 15.828 1.00 19.43 ? 49  TYR L CE2 1 
ATOM 426  C CZ  . TYR A 1 54  ? 24.597 21.515 14.591 1.00 18.90 ? 49  TYR L CZ  1 
ATOM 427  O OH  . TYR A 1 54  ? 24.841 20.470 13.722 1.00 20.62 ? 49  TYR L OH  1 
ATOM 428  N N   . LYS A 1 55  ? 21.737 26.719 16.295 1.00 14.78 ? 50  LYS L N   1 
ATOM 429  C CA  . LYS A 1 55  ? 20.779 27.288 15.353 1.00 17.19 ? 50  LYS L CA  1 
ATOM 430  C C   . LYS A 1 55  ? 19.381 27.191 15.959 1.00 14.80 ? 50  LYS L C   1 
ATOM 431  O O   . LYS A 1 55  ? 18.418 26.906 15.267 1.00 16.77 ? 50  LYS L O   1 
ATOM 432  C CB  . LYS A 1 55  ? 20.858 26.607 13.980 1.00 19.44 ? 50  LYS L CB  1 
ATOM 433  C CG  . LYS A 1 55  ? 22.189 26.770 13.272 1.00 16.59 ? 50  LYS L CG  1 
ATOM 434  C CD  . LYS A 1 55  ? 22.418 25.611 12.337 1.00 21.43 ? 50  LYS L CD  1 
ATOM 435  C CE  . LYS A 1 55  ? 22.451 26.053 10.881 1.00 29.45 ? 50  LYS L CE  1 
ATOM 436  N NZ  . LYS A 1 55  ? 22.735 24.925 9.906  1.00 31.07 ? 50  LYS L NZ  1 
ATOM 437  N N   . VAL A 1 56  ? 19.309 27.423 17.270 1.00 15.50 ? 51  VAL L N   1 
ATOM 438  C CA  . VAL A 1 56  ? 18.084 27.396 18.083 1.00 16.59 ? 51  VAL L CA  1 
ATOM 439  C C   . VAL A 1 56  ? 17.715 26.052 18.708 1.00 18.43 ? 51  VAL L C   1 
ATOM 440  O O   . VAL A 1 56  ? 17.500 25.985 19.916 1.00 23.60 ? 51  VAL L O   1 
ATOM 441  C CB  . VAL A 1 56  ? 16.828 27.970 17.360 1.00 17.28 ? 51  VAL L CB  1 
ATOM 442  C CG1 . VAL A 1 56  ? 15.618 27.897 18.269 1.00 16.80 ? 51  VAL L CG1 1 
ATOM 443  C CG2 . VAL A 1 56  ? 17.052 29.413 16.964 1.00 20.44 ? 51  VAL L CG2 1 
ATOM 444  N N   . SER A 1 57  ? 17.642 24.984 17.919 1.00 19.89 ? 52  SER L N   1 
ATOM 445  C CA  . SER A 1 57  ? 17.258 23.688 18.480 1.00 18.62 ? 52  SER L CA  1 
ATOM 446  C C   . SER A 1 57  ? 18.182 22.505 18.195 1.00 20.06 ? 52  SER L C   1 
ATOM 447  O O   . SER A 1 57  ? 18.040 21.439 18.822 1.00 22.49 ? 52  SER L O   1 
ATOM 448  C CB  . SER A 1 57  ? 15.823 23.301 18.077 1.00 19.77 ? 52  SER L CB  1 
ATOM 449  O OG  . SER A 1 57  ? 15.194 24.209 17.175 1.00 17.89 ? 52  SER L OG  1 
ATOM 450  N N   . ASN A 1 58  ? 19.136 22.693 17.288 1.00 15.84 ? 53  ASN L N   1 
ATOM 451  C CA  . ASN A 1 58  ? 20.052 21.631 16.920 1.00 15.28 ? 53  ASN L CA  1 
ATOM 452  C C   . ASN A 1 58  ? 21.078 21.249 17.973 1.00 18.02 ? 53  ASN L C   1 
ATOM 453  O O   . ASN A 1 58  ? 22.191 21.769 17.954 1.00 25.37 ? 53  ASN L O   1 
ATOM 454  C CB  . ASN A 1 58  ? 20.791 21.986 15.633 1.00 18.45 ? 53  ASN L CB  1 
ATOM 455  C CG  . ASN A 1 58  ? 19.879 22.060 14.433 1.00 18.69 ? 53  ASN L CG  1 
ATOM 456  O OD1 . ASN A 1 58  ? 19.407 23.130 14.076 1.00 19.01 ? 53  ASN L OD1 1 
ATOM 457  N ND2 . ASN A 1 58  ? 19.604 20.918 13.819 1.00 18.44 ? 53  ASN L ND2 1 
ATOM 458  N N   . ARG A 1 59  ? 20.719 20.336 18.875 1.00 16.73 ? 54  ARG L N   1 
ATOM 459  C CA  . ARG A 1 59  ? 21.632 19.854 19.908 1.00 12.12 ? 54  ARG L CA  1 
ATOM 460  C C   . ARG A 1 59  ? 22.855 19.279 19.194 1.00 9.55  ? 54  ARG L C   1 
ATOM 461  O O   . ARG A 1 59  ? 22.720 18.449 18.306 1.00 8.72  ? 54  ARG L O   1 
ATOM 462  C CB  . ARG A 1 59  ? 20.945 18.773 20.743 1.00 15.18 ? 54  ARG L CB  1 
ATOM 463  C CG  . ARG A 1 59  ? 20.234 17.756 19.880 1.00 23.07 ? 54  ARG L CG  1 
ATOM 464  C CD  . ARG A 1 59  ? 19.860 16.502 20.625 1.00 26.57 ? 54  ARG L CD  1 
ATOM 465  N NE  . ARG A 1 59  ? 18.895 16.715 21.703 1.00 32.19 ? 54  ARG L NE  1 
ATOM 466  C CZ  . ARG A 1 59  ? 17.729 17.363 21.620 1.00 32.64 ? 54  ARG L CZ  1 
ATOM 467  N NH1 . ARG A 1 59  ? 17.301 17.933 20.496 1.00 29.81 ? 54  ARG L NH1 1 
ATOM 468  N NH2 . ARG A 1 59  ? 16.929 17.355 22.681 1.00 34.84 ? 54  ARG L NH2 1 
ATOM 469  N N   . PHE A 1 60  ? 24.038 19.765 19.560 1.00 10.23 ? 55  PHE L N   1 
ATOM 470  C CA  . PHE A 1 60  ? 25.322 19.349 18.978 1.00 8.66  ? 55  PHE L CA  1 
ATOM 471  C C   . PHE A 1 60  ? 25.637 17.830 19.025 1.00 10.84 ? 55  PHE L C   1 
ATOM 472  O O   . PHE A 1 60  ? 24.945 17.049 19.677 1.00 14.89 ? 55  PHE L O   1 
ATOM 473  C CB  . PHE A 1 60  ? 26.408 20.142 19.667 1.00 4.87  ? 55  PHE L CB  1 
ATOM 474  C CG  . PHE A 1 60  ? 27.737 20.010 19.050 1.00 3.77  ? 55  PHE L CG  1 
ATOM 475  C CD1 . PHE A 1 60  ? 27.897 20.076 17.685 1.00 7.63  ? 55  PHE L CD1 1 
ATOM 476  C CD2 . PHE A 1 60  ? 28.855 19.895 19.844 1.00 4.53  ? 55  PHE L CD2 1 
ATOM 477  C CE1 . PHE A 1 60  ? 29.177 20.030 17.108 1.00 8.79  ? 55  PHE L CE1 1 
ATOM 478  C CE2 . PHE A 1 60  ? 30.119 19.852 19.291 1.00 5.52  ? 55  PHE L CE2 1 
ATOM 479  C CZ  . PHE A 1 60  ? 30.280 19.921 17.912 1.00 4.79  ? 55  PHE L CZ  1 
ATOM 480  N N   . SER A 1 61  ? 26.678 17.405 18.323 1.00 10.70 ? 56  SER L N   1 
ATOM 481  C CA  . SER A 1 61  ? 27.025 15.990 18.274 1.00 13.49 ? 56  SER L CA  1 
ATOM 482  C C   . SER A 1 61  ? 27.401 15.457 19.633 1.00 14.94 ? 56  SER L C   1 
ATOM 483  O O   . SER A 1 61  ? 28.426 15.855 20.168 1.00 14.71 ? 56  SER L O   1 
ATOM 484  C CB  . SER A 1 61  ? 28.188 15.759 17.298 1.00 16.23 ? 56  SER L CB  1 
ATOM 485  O OG  . SER A 1 61  ? 27.810 16.098 15.971 1.00 15.36 ? 56  SER L OG  1 
ATOM 486  N N   . GLY A 1 62  ? 26.568 14.591 20.210 1.00 18.01 ? 57  GLY L N   1 
ATOM 487  C CA  . GLY A 1 62  ? 26.884 14.028 21.527 1.00 20.64 ? 57  GLY L CA  1 
ATOM 488  C C   . GLY A 1 62  ? 26.081 14.519 22.743 1.00 18.87 ? 57  GLY L C   1 
ATOM 489  O O   . GLY A 1 62  ? 25.910 13.800 23.733 1.00 12.86 ? 57  GLY L O   1 
ATOM 490  N N   . VAL A 1 63  ? 25.614 15.760 22.706 1.00 19.45 ? 58  VAL L N   1 
ATOM 491  C CA  . VAL A 1 63  ? 24.829 16.258 23.827 1.00 16.49 ? 58  VAL L CA  1 
ATOM 492  C C   . VAL A 1 63  ? 23.557 15.434 23.771 1.00 15.13 ? 58  VAL L C   1 
ATOM 493  O O   . VAL A 1 63  ? 23.050 15.151 22.684 1.00 18.35 ? 58  VAL L O   1 
ATOM 494  C CB  . VAL A 1 63  ? 24.531 17.813 23.750 1.00 13.37 ? 58  VAL L CB  1 
ATOM 495  C CG1 . VAL A 1 63  ? 25.259 18.454 22.586 1.00 11.93 ? 58  VAL L CG1 1 
ATOM 496  C CG2 . VAL A 1 63  ? 23.043 18.107 23.709 1.00 11.32 ? 58  VAL L CG2 1 
ATOM 497  N N   . PRO A 1 64  ? 23.111 14.928 24.923 1.00 12.54 ? 59  PRO L N   1 
ATOM 498  C CA  . PRO A 1 64  ? 21.919 14.109 25.134 1.00 11.96 ? 59  PRO L CA  1 
ATOM 499  C C   . PRO A 1 64  ? 20.595 14.686 24.665 1.00 12.33 ? 59  PRO L C   1 
ATOM 500  O O   . PRO A 1 64  ? 20.424 15.895 24.496 1.00 4.80  ? 59  PRO L O   1 
ATOM 501  C CB  . PRO A 1 64  ? 21.894 13.925 26.639 1.00 11.94 ? 59  PRO L CB  1 
ATOM 502  C CG  . PRO A 1 64  ? 23.308 13.857 26.965 1.00 15.23 ? 59  PRO L CG  1 
ATOM 503  C CD  . PRO A 1 64  ? 23.934 14.950 26.138 1.00 14.56 ? 59  PRO L CD  1 
ATOM 504  N N   . ASP A 1 65  ? 19.635 13.775 24.557 1.00 16.79 ? 60  ASP L N   1 
ATOM 505  C CA  . ASP A 1 65  ? 18.279 14.092 24.133 1.00 21.56 ? 60  ASP L CA  1 
ATOM 506  C C   . ASP A 1 65  ? 17.607 14.975 25.178 1.00 19.79 ? 60  ASP L C   1 
ATOM 507  O O   . ASP A 1 65  ? 16.586 15.598 24.929 1.00 16.77 ? 60  ASP L O   1 
ATOM 508  C CB  . ASP A 1 65  ? 17.479 12.791 23.969 1.00 24.71 ? 60  ASP L CB  1 
ATOM 509  C CG  . ASP A 1 65  ? 17.088 12.160 25.308 1.00 28.47 ? 60  ASP L CG  1 
ATOM 510  O OD1 . ASP A 1 65  ? 15.943 11.647 25.409 1.00 29.90 ? 60  ASP L OD1 1 
ATOM 511  O OD2 . ASP A 1 65  ? 17.913 12.185 26.258 1.00 28.42 ? 60  ASP L OD2 1 
ATOM 512  N N   . ARG A 1 66  ? 18.166 14.919 26.378 1.00 22.57 ? 61  ARG L N   1 
ATOM 513  C CA  . ARG A 1 66  ? 17.698 15.653 27.532 1.00 23.10 ? 61  ARG L CA  1 
ATOM 514  C C   . ARG A 1 66  ? 17.740 17.126 27.239 1.00 23.50 ? 61  ARG L C   1 
ATOM 515  O O   . ARG A 1 66  ? 16.811 17.853 27.570 1.00 30.49 ? 61  ARG L O   1 
ATOM 516  C CB  . ARG A 1 66  ? 18.627 15.367 28.702 1.00 25.44 ? 61  ARG L CB  1 
ATOM 517  C CG  . ARG A 1 66  ? 17.936 15.094 30.022 1.00 29.80 ? 61  ARG L CG  1 
ATOM 518  C CD  . ARG A 1 66  ? 18.906 14.409 30.999 1.00 30.12 ? 61  ARG L CD  1 
ATOM 519  N NE  . ARG A 1 66  ? 20.145 15.163 31.216 1.00 30.53 ? 61  ARG L NE  1 
ATOM 520  C CZ  . ARG A 1 66  ? 21.360 14.694 30.937 1.00 31.07 ? 61  ARG L CZ  1 
ATOM 521  N NH1 . ARG A 1 66  ? 21.492 13.475 30.423 1.00 32.79 ? 61  ARG L NH1 1 
ATOM 522  N NH2 . ARG A 1 66  ? 22.443 15.419 31.207 1.00 26.19 ? 61  ARG L NH2 1 
ATOM 523  N N   . PHE A 1 67  ? 18.810 17.562 26.591 1.00 20.89 ? 62  PHE L N   1 
ATOM 524  C CA  . PHE A 1 67  ? 18.986 18.976 26.281 1.00 18.52 ? 62  PHE L CA  1 
ATOM 525  C C   . PHE A 1 67  ? 18.253 19.401 25.024 1.00 18.03 ? 62  PHE L C   1 
ATOM 526  O O   . PHE A 1 67  ? 18.683 19.061 23.922 1.00 19.26 ? 62  PHE L O   1 
ATOM 527  C CB  . PHE A 1 67  ? 20.476 19.293 26.133 1.00 14.63 ? 62  PHE L CB  1 
ATOM 528  C CG  . PHE A 1 67  ? 21.300 18.830 27.284 1.00 10.90 ? 62  PHE L CG  1 
ATOM 529  C CD1 . PHE A 1 67  ? 21.537 17.469 27.478 1.00 8.29  ? 62  PHE L CD1 1 
ATOM 530  C CD2 . PHE A 1 67  ? 21.804 19.744 28.196 1.00 10.00 ? 62  PHE L CD2 1 
ATOM 531  C CE1 . PHE A 1 67  ? 22.254 17.027 28.557 1.00 6.34  ? 62  PHE L CE1 1 
ATOM 532  C CE2 . PHE A 1 67  ? 22.528 19.320 29.291 1.00 8.58  ? 62  PHE L CE2 1 
ATOM 533  C CZ  . PHE A 1 67  ? 22.755 17.956 29.476 1.00 9.39  ? 62  PHE L CZ  1 
ATOM 534  N N   . SER A 1 68  ? 17.198 20.202 25.192 1.00 18.89 ? 63  SER L N   1 
ATOM 535  C CA  . SER A 1 68  ? 16.402 20.699 24.067 1.00 19.06 ? 63  SER L CA  1 
ATOM 536  C C   . SER A 1 68  ? 16.295 22.228 23.939 1.00 18.57 ? 63  SER L C   1 
ATOM 537  O O   . SER A 1 68  ? 15.997 22.941 24.910 1.00 16.90 ? 63  SER L O   1 
ATOM 538  C CB  . SER A 1 68  ? 14.987 20.090 24.088 1.00 17.87 ? 63  SER L CB  1 
ATOM 539  O OG  . SER A 1 68  ? 14.952 18.793 23.521 1.00 14.04 ? 63  SER L OG  1 
ATOM 540  N N   . GLY A 1 69  ? 16.570 22.710 22.730 1.00 19.88 ? 64  GLY L N   1 
ATOM 541  C CA  . GLY A 1 69  ? 16.466 24.125 22.421 1.00 20.13 ? 64  GLY L CA  1 
ATOM 542  C C   . GLY A 1 69  ? 15.123 24.420 21.744 1.00 21.27 ? 64  GLY L C   1 
ATOM 543  O O   . GLY A 1 69  ? 14.652 23.662 20.884 1.00 15.92 ? 64  GLY L O   1 
ATOM 544  N N   . SER A 1 70  ? 14.490 25.512 22.158 1.00 24.39 ? 65  SER L N   1 
ATOM 545  C CA  . SER A 1 70  ? 13.198 25.946 21.619 1.00 24.04 ? 65  SER L CA  1 
ATOM 546  C C   . SER A 1 70  ? 13.431 27.366 21.152 1.00 21.90 ? 65  SER L C   1 
ATOM 547  O O   . SER A 1 70  ? 14.562 27.852 21.228 1.00 24.21 ? 65  SER L O   1 
ATOM 548  C CB  . SER A 1 70  ? 12.125 25.963 22.721 1.00 24.34 ? 65  SER L CB  1 
ATOM 549  O OG  . SER A 1 70  ? 12.283 24.882 23.637 1.00 29.67 ? 65  SER L OG  1 
ATOM 550  N N   . GLY A 1 71  ? 12.371 28.030 20.685 1.00 23.94 ? 66  GLY L N   1 
ATOM 551  C CA  . GLY A 1 71  ? 12.477 29.417 20.240 1.00 22.73 ? 66  GLY L CA  1 
ATOM 552  C C   . GLY A 1 71  ? 12.048 29.822 18.826 1.00 22.18 ? 66  GLY L C   1 
ATOM 553  O O   . GLY A 1 71  ? 11.826 28.986 17.943 1.00 22.49 ? 66  GLY L O   1 
ATOM 554  N N   . SER A 1 72  ? 11.978 31.137 18.623 1.00 20.99 ? 67  SER L N   1 
ATOM 555  C CA  . SER A 1 72  ? 11.586 31.766 17.369 1.00 14.48 ? 67  SER L CA  1 
ATOM 556  C C   . SER A 1 72  ? 11.568 33.277 17.567 1.00 15.19 ? 67  SER L C   1 
ATOM 557  O O   . SER A 1 72  ? 10.743 33.815 18.312 1.00 7.93  ? 67  SER L O   1 
ATOM 558  C CB  . SER A 1 72  ? 10.200 31.305 16.938 1.00 13.26 ? 67  SER L CB  1 
ATOM 559  O OG  . SER A 1 72  ? 9.771  32.041 15.805 1.00 14.45 ? 67  SER L OG  1 
ATOM 560  N N   . GLY A 1 73  ? 12.539 33.946 16.948 1.00 21.29 ? 68  GLY L N   1 
ATOM 561  C CA  . GLY A 1 73  ? 12.643 35.398 17.043 1.00 22.14 ? 68  GLY L CA  1 
ATOM 562  C C   . GLY A 1 73  ? 13.675 35.854 18.063 1.00 22.24 ? 68  GLY L C   1 
ATOM 563  O O   . GLY A 1 73  ? 14.879 35.692 17.837 1.00 23.41 ? 68  GLY L O   1 
ATOM 564  N N   . THR A 1 74  ? 13.207 36.449 19.162 1.00 21.35 ? 69  THR L N   1 
ATOM 565  C CA  . THR A 1 74  ? 14.078 36.910 20.244 1.00 17.68 ? 69  THR L CA  1 
ATOM 566  C C   . THR A 1 74  ? 14.018 35.945 21.428 1.00 19.35 ? 69  THR L C   1 
ATOM 567  O O   . THR A 1 74  ? 15.005 35.778 22.147 1.00 21.75 ? 69  THR L O   1 
ATOM 568  C CB  . THR A 1 74  ? 13.686 38.310 20.757 1.00 13.44 ? 69  THR L CB  1 
ATOM 569  O OG1 . THR A 1 74  ? 12.266 38.408 20.873 1.00 11.03 ? 69  THR L OG1 1 
ATOM 570  C CG2 . THR A 1 74  ? 14.177 39.374 19.830 1.00 14.42 ? 69  THR L CG2 1 
ATOM 571  N N   . ASP A 1 75  ? 12.874 35.283 21.592 1.00 19.16 ? 70  ASP L N   1 
ATOM 572  C CA  . ASP A 1 75  ? 12.653 34.359 22.693 1.00 19.22 ? 70  ASP L CA  1 
ATOM 573  C C   . ASP A 1 75  ? 12.989 32.919 22.414 1.00 17.82 ? 70  ASP L C   1 
ATOM 574  O O   . ASP A 1 75  ? 12.428 32.313 21.504 1.00 19.28 ? 70  ASP L O   1 
ATOM 575  C CB  . ASP A 1 75  ? 11.211 34.461 23.165 1.00 25.36 ? 70  ASP L CB  1 
ATOM 576  C CG  . ASP A 1 75  ? 10.928 35.779 23.847 1.00 29.88 ? 70  ASP L CG  1 
ATOM 577  O OD1 . ASP A 1 75  ? 10.009 36.501 23.388 1.00 32.73 ? 70  ASP L OD1 1 
ATOM 578  O OD2 . ASP A 1 75  ? 11.644 36.097 24.827 1.00 29.84 ? 70  ASP L OD2 1 
ATOM 579  N N   . PHE A 1 76  ? 13.840 32.357 23.267 1.00 14.67 ? 71  PHE L N   1 
ATOM 580  C CA  . PHE A 1 76  ? 14.288 30.979 23.141 1.00 11.33 ? 71  PHE L CA  1 
ATOM 581  C C   . PHE A 1 76  ? 14.344 30.370 24.521 1.00 11.28 ? 71  PHE L C   1 
ATOM 582  O O   . PHE A 1 76  ? 14.535 31.093 25.499 1.00 11.99 ? 71  PHE L O   1 
ATOM 583  C CB  . PHE A 1 76  ? 15.697 30.949 22.568 1.00 12.36 ? 71  PHE L CB  1 
ATOM 584  C CG  . PHE A 1 76  ? 15.846 31.716 21.307 1.00 14.29 ? 71  PHE L CG  1 
ATOM 585  C CD1 . PHE A 1 76  ? 15.725 31.081 20.078 1.00 17.06 ? 71  PHE L CD1 1 
ATOM 586  C CD2 . PHE A 1 76  ? 16.011 33.096 21.339 1.00 16.11 ? 71  PHE L CD2 1 
ATOM 587  C CE1 . PHE A 1 76  ? 15.752 31.808 18.887 1.00 18.72 ? 71  PHE L CE1 1 
ATOM 588  C CE2 . PHE A 1 76  ? 16.038 33.831 20.157 1.00 18.81 ? 71  PHE L CE2 1 
ATOM 589  C CZ  . PHE A 1 76  ? 15.904 33.183 18.925 1.00 18.40 ? 71  PHE L CZ  1 
ATOM 590  N N   . THR A 1 77  ? 14.226 29.047 24.599 1.00 7.53  ? 72  THR L N   1 
ATOM 591  C CA  . THR A 1 77  ? 14.282 28.355 25.880 1.00 9.64  ? 72  THR L CA  1 
ATOM 592  C C   . THR A 1 77  ? 14.986 27.024 25.723 1.00 7.96  ? 72  THR L C   1 
ATOM 593  O O   . THR A 1 77  ? 14.640 26.255 24.829 1.00 10.45 ? 72  THR L O   1 
ATOM 594  C CB  . THR A 1 77  ? 12.865 28.067 26.470 1.00 11.47 ? 72  THR L CB  1 
ATOM 595  O OG1 . THR A 1 77  ? 12.155 29.287 26.689 1.00 14.61 ? 72  THR L OG1 1 
ATOM 596  C CG2 . THR A 1 77  ? 12.977 27.369 27.810 1.00 12.46 ? 72  THR L CG2 1 
ATOM 597  N N   . LEU A 1 78  ? 15.966 26.748 26.581 1.00 5.62  ? 73  LEU L N   1 
ATOM 598  C CA  . LEU A 1 78  ? 16.670 25.469 26.527 1.00 6.04  ? 73  LEU L CA  1 
ATOM 599  C C   . LEU A 1 78  ? 15.947 24.717 27.620 1.00 6.50  ? 73  LEU L C   1 
ATOM 600  O O   . LEU A 1 78  ? 15.396 25.365 28.523 1.00 2.58  ? 73  LEU L O   1 
ATOM 601  C CB  . LEU A 1 78  ? 18.152 25.631 26.885 1.00 4.61  ? 73  LEU L CB  1 
ATOM 602  C CG  . LEU A 1 78  ? 19.190 24.497 26.712 1.00 3.48  ? 73  LEU L CG  1 
ATOM 603  C CD1 . LEU A 1 78  ? 19.219 23.536 27.894 1.00 4.01  ? 73  LEU L CD1 1 
ATOM 604  C CD2 . LEU A 1 78  ? 18.965 23.759 25.413 1.00 2.97  ? 73  LEU L CD2 1 
ATOM 605  N N   . LYS A 1 79  ? 15.897 23.384 27.538 1.00 6.42  ? 74  LYS L N   1 
ATOM 606  C CA  . LYS A 1 79  ? 15.209 22.610 28.575 1.00 8.22  ? 74  LYS L CA  1 
ATOM 607  C C   . LYS A 1 79  ? 15.638 21.179 28.792 1.00 6.59  ? 74  LYS L C   1 
ATOM 608  O O   . LYS A 1 79  ? 15.456 20.342 27.895 1.00 7.17  ? 74  LYS L O   1 
ATOM 609  C CB  . LYS A 1 79  ? 13.689 22.654 28.376 1.00 7.81  ? 74  LYS L CB  1 
ATOM 610  C CG  . LYS A 1 79  ? 13.252 22.919 26.956 1.00 11.75 ? 74  LYS L CG  1 
ATOM 611  C CD  . LYS A 1 79  ? 12.125 23.937 26.938 1.00 12.99 ? 74  LYS L CD  1 
ATOM 612  C CE  . LYS A 1 79  ? 10.974 23.514 27.817 1.00 10.87 ? 74  LYS L CE  1 
ATOM 613  N NZ  . LYS A 1 79  ? 10.007 24.625 27.917 1.00 14.67 ? 74  LYS L NZ  1 
ATOM 614  N N   . ILE A 1 80  ? 16.165 20.913 29.995 1.00 3.58  ? 75  ILE L N   1 
ATOM 615  C CA  . ILE A 1 80  ? 16.611 19.575 30.402 1.00 5.69  ? 75  ILE L CA  1 
ATOM 616  C C   . ILE A 1 80  ? 15.345 18.830 30.884 1.00 7.40  ? 75  ILE L C   1 
ATOM 617  O O   . ILE A 1 80  ? 14.335 19.466 31.163 1.00 4.95  ? 75  ILE L O   1 
ATOM 618  C CB  . ILE A 1 80  ? 17.733 19.627 31.510 1.00 2.00  ? 75  ILE L CB  1 
ATOM 619  C CG1 . ILE A 1 80  ? 18.930 20.460 31.037 1.00 3.44  ? 75  ILE L CG1 1 
ATOM 620  C CG2 . ILE A 1 80  ? 18.304 18.251 31.774 1.00 2.00  ? 75  ILE L CG2 1 
ATOM 621  C CD1 . ILE A 1 80  ? 18.867 21.947 31.335 1.00 2.05  ? 75  ILE L CD1 1 
ATOM 622  N N   . SER A 1 81  ? 15.361 17.495 30.903 1.00 11.08 ? 76  SER L N   1 
ATOM 623  C CA  . SER A 1 81  ? 14.177 16.740 31.333 1.00 10.97 ? 76  SER L CA  1 
ATOM 624  C C   . SER A 1 81  ? 14.400 15.792 32.522 1.00 11.71 ? 76  SER L C   1 
ATOM 625  O O   . SER A 1 81  ? 13.445 15.415 33.213 1.00 7.41  ? 76  SER L O   1 
ATOM 626  C CB  . SER A 1 81  ? 13.560 15.985 30.148 1.00 2.65  ? 76  SER L CB  1 
ATOM 627  O OG  . SER A 1 81  ? 14.527 15.176 29.517 1.00 2.00  ? 76  SER L OG  1 
ATOM 628  N N   . ARG A 1 82  ? 15.656 15.416 32.754 1.00 12.48 ? 77  ARG L N   1 
ATOM 629  C CA  . ARG A 1 82  ? 16.007 14.517 33.854 1.00 16.65 ? 77  ARG L CA  1 
ATOM 630  C C   . ARG A 1 82  ? 17.396 14.902 34.376 1.00 19.25 ? 77  ARG L C   1 
ATOM 631  O O   . ARG A 1 82  ? 18.341 14.116 34.287 1.00 19.86 ? 77  ARG L O   1 
ATOM 632  C CB  . ARG A 1 82  ? 16.001 13.044 33.384 1.00 17.59 ? 77  ARG L CB  1 
ATOM 633  C CG  . ARG A 1 82  ? 14.648 12.312 33.452 1.00 19.86 ? 77  ARG L CG  1 
ATOM 634  C CD  . ARG A 1 82  ? 14.549 11.154 32.431 1.00 24.61 ? 77  ARG L CD  1 
ATOM 635  N NE  . ARG A 1 82  ? 14.406 11.646 31.055 1.00 29.98 ? 77  ARG L NE  1 
ATOM 636  C CZ  . ARG A 1 82  ? 13.245 11.756 30.396 1.00 32.98 ? 77  ARG L CZ  1 
ATOM 637  N NH1 . ARG A 1 82  ? 12.104 11.379 30.978 1.00 35.47 ? 77  ARG L NH1 1 
ATOM 638  N NH2 . ARG A 1 82  ? 13.196 12.373 29.210 1.00 27.80 ? 77  ARG L NH2 1 
ATOM 639  N N   . VAL A 1 83  ? 17.508 16.098 34.953 1.00 18.70 ? 78  VAL L N   1 
ATOM 640  C CA  . VAL A 1 83  ? 18.791 16.586 35.463 1.00 15.75 ? 78  VAL L CA  1 
ATOM 641  C C   . VAL A 1 83  ? 19.682 15.549 36.147 1.00 12.65 ? 78  VAL L C   1 
ATOM 642  O O   . VAL A 1 83  ? 19.385 15.049 37.219 1.00 9.15  ? 78  VAL L O   1 
ATOM 643  C CB  . VAL A 1 83  ? 18.614 17.827 36.372 1.00 17.29 ? 78  VAL L CB  1 
ATOM 644  C CG1 . VAL A 1 83  ? 19.927 18.177 37.062 1.00 17.06 ? 78  VAL L CG1 1 
ATOM 645  C CG2 . VAL A 1 83  ? 18.143 19.023 35.531 1.00 18.55 ? 78  VAL L CG2 1 
ATOM 646  N N   . GLU A 1 84  ? 20.774 15.220 35.481 1.00 14.09 ? 79  GLU L N   1 
ATOM 647  C CA  . GLU A 1 84  ? 21.737 14.272 35.994 1.00 17.38 ? 79  GLU L CA  1 
ATOM 648  C C   . GLU A 1 84  ? 22.781 15.069 36.771 1.00 21.45 ? 79  GLU L C   1 
ATOM 649  O O   . GLU A 1 84  ? 22.884 16.300 36.627 1.00 24.81 ? 79  GLU L O   1 
ATOM 650  C CB  . GLU A 1 84  ? 22.369 13.500 34.839 1.00 18.17 ? 79  GLU L CB  1 
ATOM 651  C CG  . GLU A 1 84  ? 21.368 13.185 33.702 1.00 22.81 ? 79  GLU L CG  1 
ATOM 652  C CD  . GLU A 1 84  ? 20.882 11.721 33.605 1.00 22.21 ? 79  GLU L CD  1 
ATOM 653  O OE1 . GLU A 1 84  ? 21.450 10.995 32.750 1.00 23.03 ? 79  GLU L OE1 1 
ATOM 654  O OE2 . GLU A 1 84  ? 19.920 11.326 34.330 1.00 16.54 ? 79  GLU L OE2 1 
ATOM 655  N N   . ALA A 1 85  ? 23.579 14.362 37.565 1.00 22.71 ? 80  ALA L N   1 
ATOM 656  C CA  . ALA A 1 85  ? 24.618 14.966 38.416 1.00 19.76 ? 80  ALA L CA  1 
ATOM 657  C C   . ALA A 1 85  ? 25.786 15.674 37.733 1.00 17.81 ? 80  ALA L C   1 
ATOM 658  O O   . ALA A 1 85  ? 26.759 16.000 38.393 1.00 20.14 ? 80  ALA L O   1 
ATOM 659  C CB  . ALA A 1 85  ? 25.178 13.904 39.361 1.00 20.27 ? 80  ALA L CB  1 
ATOM 660  N N   . GLU A 1 86  ? 25.694 15.933 36.434 1.00 17.94 ? 81  GLU L N   1 
ATOM 661  C CA  . GLU A 1 86  ? 26.791 16.561 35.698 1.00 15.23 ? 81  GLU L CA  1 
ATOM 662  C C   . GLU A 1 86  ? 26.280 17.681 34.819 1.00 13.75 ? 81  GLU L C   1 
ATOM 663  O O   . GLU A 1 86  ? 26.973 18.131 33.908 1.00 12.77 ? 81  GLU L O   1 
ATOM 664  C CB  . GLU A 1 86  ? 27.496 15.547 34.780 1.00 14.37 ? 81  GLU L CB  1 
ATOM 665  C CG  . GLU A 1 86  ? 27.529 14.106 35.255 1.00 17.08 ? 81  GLU L CG  1 
ATOM 666  C CD  . GLU A 1 86  ? 26.142 13.481 35.313 1.00 21.57 ? 81  GLU L CD  1 
ATOM 667  O OE1 . GLU A 1 86  ? 25.870 12.705 36.245 1.00 30.80 ? 81  GLU L OE1 1 
ATOM 668  O OE2 . GLU A 1 86  ? 25.295 13.794 34.461 1.00 23.18 ? 81  GLU L OE2 1 
ATOM 669  N N   . ASP A 1 87  ? 25.040 18.081 35.038 1.00 9.48  ? 82  ASP L N   1 
ATOM 670  C CA  . ASP A 1 87  ? 24.470 19.132 34.236 1.00 9.17  ? 82  ASP L CA  1 
ATOM 671  C C   . ASP A 1 87  ? 24.709 20.468 34.906 1.00 14.37 ? 82  ASP L C   1 
ATOM 672  O O   . ASP A 1 87  ? 24.515 21.521 34.304 1.00 16.96 ? 82  ASP L O   1 
ATOM 673  C CB  . ASP A 1 87  ? 22.983 18.890 34.091 1.00 8.12  ? 82  ASP L CB  1 
ATOM 674  C CG  . ASP A 1 87  ? 22.675 17.697 33.250 1.00 8.64  ? 82  ASP L CG  1 
ATOM 675  O OD1 . ASP A 1 87  ? 23.521 16.796 33.151 1.00 7.32  ? 82  ASP L OD1 1 
ATOM 676  O OD2 . ASP A 1 87  ? 21.572 17.647 32.673 1.00 16.02 ? 82  ASP L OD2 1 
ATOM 677  N N   . LEU A 1 88  ? 25.154 20.415 36.156 1.00 14.40 ? 83  LEU L N   1 
ATOM 678  C CA  . LEU A 1 88  ? 25.374 21.607 36.959 1.00 7.45  ? 83  LEU L CA  1 
ATOM 679  C C   . LEU A 1 88  ? 26.567 22.377 36.421 1.00 4.61  ? 83  LEU L C   1 
ATOM 680  O O   . LEU A 1 88  ? 27.582 21.798 36.058 1.00 4.02  ? 83  LEU L O   1 
ATOM 681  C CB  . LEU A 1 88  ? 25.580 21.203 38.420 1.00 10.44 ? 83  LEU L CB  1 
ATOM 682  C CG  . LEU A 1 88  ? 24.521 20.356 39.172 1.00 15.56 ? 83  LEU L CG  1 
ATOM 683  C CD1 . LEU A 1 88  ? 23.289 21.182 39.528 1.00 16.56 ? 83  LEU L CD1 1 
ATOM 684  C CD2 . LEU A 1 88  ? 24.098 19.090 38.386 1.00 19.15 ? 83  LEU L CD2 1 
ATOM 685  N N   . GLY A 1 89  ? 26.400 23.680 36.304 1.00 2.23  ? 84  GLY L N   1 
ATOM 686  C CA  . GLY A 1 89  ? 27.450 24.534 35.800 1.00 2.00  ? 84  GLY L CA  1 
ATOM 687  C C   . GLY A 1 89  ? 26.714 25.784 35.407 1.00 2.00  ? 84  GLY L C   1 
ATOM 688  O O   . GLY A 1 89  ? 25.525 25.917 35.728 1.00 2.00  ? 84  GLY L O   1 
ATOM 689  N N   . ILE A 1 90  ? 27.393 26.702 34.725 1.00 4.27  ? 85  ILE L N   1 
ATOM 690  C CA  . ILE A 1 90  ? 26.758 27.952 34.294 1.00 5.23  ? 85  ILE L CA  1 
ATOM 691  C C   . ILE A 1 90  ? 26.384 27.901 32.817 1.00 7.48  ? 85  ILE L C   1 
ATOM 692  O O   . ILE A 1 90  ? 27.268 27.992 31.950 1.00 8.59  ? 85  ILE L O   1 
ATOM 693  C CB  . ILE A 1 90  ? 27.667 29.192 34.492 1.00 2.00  ? 85  ILE L CB  1 
ATOM 694  C CG1 . ILE A 1 90  ? 28.262 29.230 35.885 1.00 2.00  ? 85  ILE L CG1 1 
ATOM 695  C CG2 . ILE A 1 90  ? 26.859 30.448 34.338 1.00 3.79  ? 85  ILE L CG2 1 
ATOM 696  C CD1 . ILE A 1 90  ? 29.257 30.330 36.057 1.00 2.65  ? 85  ILE L CD1 1 
ATOM 697  N N   . TYR A 1 91  ? 25.078 27.804 32.545 1.00 8.03  ? 86  TYR L N   1 
ATOM 698  C CA  . TYR A 1 91  ? 24.539 27.761 31.177 1.00 7.86  ? 86  TYR L CA  1 
ATOM 699  C C   . TYR A 1 91  ? 24.602 29.145 30.543 1.00 9.48  ? 86  TYR L C   1 
ATOM 700  O O   . TYR A 1 91  ? 24.376 30.149 31.249 1.00 9.99  ? 86  TYR L O   1 
ATOM 701  C CB  . TYR A 1 91  ? 23.115 27.236 31.186 1.00 3.36  ? 86  TYR L CB  1 
ATOM 702  C CG  . TYR A 1 91  ? 23.101 25.779 31.445 1.00 2.00  ? 86  TYR L CG  1 
ATOM 703  C CD1 . TYR A 1 91  ? 23.338 25.283 32.710 1.00 2.00  ? 86  TYR L CD1 1 
ATOM 704  C CD2 . TYR A 1 91  ? 22.932 24.883 30.406 1.00 5.36  ? 86  TYR L CD2 1 
ATOM 705  C CE1 . TYR A 1 91  ? 23.419 23.926 32.936 1.00 2.00  ? 86  TYR L CE1 1 
ATOM 706  C CE2 . TYR A 1 91  ? 23.011 23.510 30.622 1.00 5.74  ? 86  TYR L CE2 1 
ATOM 707  C CZ  . TYR A 1 91  ? 23.255 23.047 31.893 1.00 2.49  ? 86  TYR L CZ  1 
ATOM 708  O OH  . TYR A 1 91  ? 23.343 21.706 32.110 1.00 3.42  ? 86  TYR L OH  1 
ATOM 709  N N   . TYR A 1 92  ? 24.898 29.195 29.233 1.00 5.34  ? 87  TYR L N   1 
ATOM 710  C CA  . TYR A 1 92  ? 25.056 30.458 28.496 1.00 5.52  ? 87  TYR L CA  1 
ATOM 711  C C   . TYR A 1 92  ? 24.474 30.476 27.104 1.00 5.12  ? 87  TYR L C   1 
ATOM 712  O O   . TYR A 1 92  ? 24.882 29.685 26.265 1.00 5.17  ? 87  TYR L O   1 
ATOM 713  C CB  . TYR A 1 92  ? 26.548 30.763 28.283 1.00 5.93  ? 87  TYR L CB  1 
ATOM 714  C CG  . TYR A 1 92  ? 27.308 31.359 29.442 1.00 7.33  ? 87  TYR L CG  1 
ATOM 715  C CD1 . TYR A 1 92  ? 27.191 32.710 29.756 1.00 4.17  ? 87  TYR L CD1 1 
ATOM 716  C CD2 . TYR A 1 92  ? 28.167 30.571 30.209 1.00 9.90  ? 87  TYR L CD2 1 
ATOM 717  C CE1 . TYR A 1 92  ? 27.903 33.267 30.800 1.00 6.73  ? 87  TYR L CE1 1 
ATOM 718  C CE2 . TYR A 1 92  ? 28.893 31.124 31.269 1.00 11.29 ? 87  TYR L CE2 1 
ATOM 719  C CZ  . TYR A 1 92  ? 28.756 32.480 31.562 1.00 8.93  ? 87  TYR L CZ  1 
ATOM 720  O OH  . TYR A 1 92  ? 29.470 33.035 32.619 1.00 6.42  ? 87  TYR L OH  1 
ATOM 721  N N   . CYS A 1 93  ? 23.595 31.424 26.802 1.00 8.90  ? 88  CYS L N   1 
ATOM 722  C CA  . CYS A 1 93  ? 23.108 31.487 25.423 1.00 8.66  ? 88  CYS L CA  1 
ATOM 723  C C   . CYS A 1 93  ? 24.139 32.313 24.624 1.00 5.87  ? 88  CYS L C   1 
ATOM 724  O O   . CYS A 1 93  ? 24.996 32.985 25.193 1.00 2.33  ? 88  CYS L O   1 
ATOM 725  C CB  . CYS A 1 93  ? 21.668 32.016 25.294 1.00 9.03  ? 88  CYS L CB  1 
ATOM 726  S SG  . CYS A 1 93  ? 21.289 33.595 26.104 1.00 13.24 ? 88  CYS L SG  1 
ATOM 727  N N   . PHE A 1 94  ? 24.097 32.218 23.312 1.00 2.00  ? 89  PHE L N   1 
ATOM 728  C CA  . PHE A 1 94  ? 25.054 32.916 22.477 1.00 2.00  ? 89  PHE L CA  1 
ATOM 729  C C   . PHE A 1 94  ? 24.312 33.194 21.208 1.00 2.00  ? 89  PHE L C   1 
ATOM 730  O O   . PHE A 1 94  ? 23.146 32.833 21.080 1.00 3.71  ? 89  PHE L O   1 
ATOM 731  C CB  . PHE A 1 94  ? 26.237 31.970 22.187 1.00 5.30  ? 89  PHE L CB  1 
ATOM 732  C CG  . PHE A 1 94  ? 27.171 32.434 21.083 1.00 5.03  ? 89  PHE L CG  1 
ATOM 733  C CD1 . PHE A 1 94  ? 27.838 33.660 21.166 1.00 2.00  ? 89  PHE L CD1 1 
ATOM 734  C CD2 . PHE A 1 94  ? 27.423 31.610 19.990 1.00 3.16  ? 89  PHE L CD2 1 
ATOM 735  C CE1 . PHE A 1 94  ? 28.741 34.050 20.190 1.00 2.00  ? 89  PHE L CE1 1 
ATOM 736  C CE2 . PHE A 1 94  ? 28.323 31.994 19.008 1.00 2.00  ? 89  PHE L CE2 1 
ATOM 737  C CZ  . PHE A 1 94  ? 28.987 33.222 19.116 1.00 2.00  ? 89  PHE L CZ  1 
ATOM 738  N N   . GLN A 1 95  ? 24.963 33.876 20.283 1.00 5.15  ? 90  GLN L N   1 
ATOM 739  C CA  . GLN A 1 95  ? 24.359 34.143 18.997 1.00 9.22  ? 90  GLN L CA  1 
ATOM 740  C C   . GLN A 1 95  ? 25.465 34.531 18.022 1.00 7.89  ? 90  GLN L C   1 
ATOM 741  O O   . GLN A 1 95  ? 26.338 35.326 18.358 1.00 12.11 ? 90  GLN L O   1 
ATOM 742  C CB  . GLN A 1 95  ? 23.302 35.230 19.125 1.00 8.02  ? 90  GLN L CB  1 
ATOM 743  C CG  . GLN A 1 95  ? 23.877 36.512 19.608 1.00 10.57 ? 90  GLN L CG  1 
ATOM 744  C CD  . GLN A 1 95  ? 23.664 37.567 18.612 1.00 7.99  ? 90  GLN L CD  1 
ATOM 745  O OE1 . GLN A 1 95  ? 22.571 38.087 18.529 1.00 8.57  ? 90  GLN L OE1 1 
ATOM 746  N NE2 . GLN A 1 95  ? 24.667 37.837 17.772 1.00 4.49  ? 90  GLN L NE2 1 
ATOM 747  N N   . GLY A 1 96  ? 25.451 33.918 16.843 1.00 10.12 ? 91  GLY L N   1 
ATOM 748  C CA  . GLY A 1 96  ? 26.454 34.195 15.826 1.00 9.11  ? 91  GLY L CA  1 
ATOM 749  C C   . GLY A 1 96  ? 25.829 34.820 14.593 1.00 8.96  ? 91  GLY L C   1 
ATOM 750  O O   . GLY A 1 96  ? 26.364 34.748 13.482 1.00 3.97  ? 91  GLY L O   1 
ATOM 751  N N   . SER A 1 97  ? 24.658 35.406 14.787 1.00 10.91 ? 92  SER L N   1 
ATOM 752  C CA  . SER A 1 97  ? 23.979 36.051 13.690 1.00 14.44 ? 92  SER L CA  1 
ATOM 753  C C   . SER A 1 97  ? 24.552 37.439 13.435 1.00 18.74 ? 92  SER L C   1 
ATOM 754  O O   . SER A 1 97  ? 24.939 37.747 12.305 1.00 25.85 ? 92  SER L O   1 
ATOM 755  C CB  . SER A 1 97  ? 22.478 36.116 13.939 1.00 8.73  ? 92  SER L CB  1 
ATOM 756  O OG  . SER A 1 97  ? 21.975 34.803 14.024 1.00 7.24  ? 92  SER L OG  1 
ATOM 757  N N   . HIS A 1 98  ? 24.658 38.266 14.469 1.00 17.14 ? 93  HIS L N   1 
ATOM 758  C CA  . HIS A 1 98  ? 25.177 39.606 14.245 1.00 17.65 ? 93  HIS L CA  1 
ATOM 759  C C   . HIS A 1 98  ? 26.578 39.824 14.752 1.00 18.53 ? 93  HIS L C   1 
ATOM 760  O O   . HIS A 1 98  ? 27.288 38.879 15.111 1.00 22.68 ? 93  HIS L O   1 
ATOM 761  C CB  . HIS A 1 98  ? 24.231 40.650 14.834 1.00 16.63 ? 93  HIS L CB  1 
ATOM 762  C CG  . HIS A 1 98  ? 22.873 40.615 14.231 1.00 17.82 ? 93  HIS L CG  1 
ATOM 763  N ND1 . HIS A 1 98  ? 21.991 41.670 14.298 1.00 20.11 ? 93  HIS L ND1 1 
ATOM 764  C CD2 . HIS A 1 98  ? 22.224 39.632 13.546 1.00 14.96 ? 93  HIS L CD2 1 
ATOM 765  C CE1 . HIS A 1 98  ? 20.862 41.341 13.691 1.00 18.57 ? 93  HIS L CE1 1 
ATOM 766  N NE2 . HIS A 1 98  ? 20.987 40.108 13.231 1.00 15.52 ? 93  HIS L NE2 1 
ATOM 767  N N   . PHE A 1 99  ? 26.993 41.081 14.722 1.00 16.42 ? 94  PHE L N   1 
ATOM 768  C CA  . PHE A 1 99  ? 28.298 41.445 15.211 1.00 13.51 ? 94  PHE L CA  1 
ATOM 769  C C   . PHE A 1 99  ? 28.086 42.614 16.154 1.00 13.50 ? 94  PHE L C   1 
ATOM 770  O O   . PHE A 1 99  ? 27.446 43.615 15.784 1.00 15.08 ? 94  PHE L O   1 
ATOM 771  C CB  . PHE A 1 99  ? 29.245 41.839 14.093 1.00 9.59  ? 94  PHE L CB  1 
ATOM 772  C CG  . PHE A 1 99  ? 30.654 41.969 14.543 1.00 5.23  ? 94  PHE L CG  1 
ATOM 773  C CD1 . PHE A 1 99  ? 31.460 40.859 14.616 1.00 4.68  ? 94  PHE L CD1 1 
ATOM 774  C CD2 . PHE A 1 99  ? 31.171 43.202 14.899 1.00 8.54  ? 94  PHE L CD2 1 
ATOM 775  C CE1 . PHE A 1 99  ? 32.758 40.961 15.038 1.00 6.56  ? 94  PHE L CE1 1 
ATOM 776  C CE2 . PHE A 1 99  ? 32.483 43.320 15.328 1.00 9.73  ? 94  PHE L CE2 1 
ATOM 777  C CZ  . PHE A 1 99  ? 33.281 42.188 15.394 1.00 7.01  ? 94  PHE L CZ  1 
ATOM 778  N N   . PRO A 1 100 ? 28.693 42.536 17.349 1.00 10.98 ? 95  PRO L N   1 
ATOM 779  C CA  . PRO A 1 100 ? 29.520 41.390 17.710 1.00 6.54  ? 95  PRO L CA  1 
ATOM 780  C C   . PRO A 1 100 ? 28.683 40.350 18.389 1.00 6.02  ? 95  PRO L C   1 
ATOM 781  O O   . PRO A 1 100 ? 27.611 40.661 18.919 1.00 2.00  ? 95  PRO L O   1 
ATOM 782  C CB  . PRO A 1 100 ? 30.514 41.991 18.672 1.00 6.19  ? 95  PRO L CB  1 
ATOM 783  C CG  . PRO A 1 100 ? 29.648 42.937 19.426 1.00 8.50  ? 95  PRO L CG  1 
ATOM 784  C CD  . PRO A 1 100 ? 28.685 43.531 18.434 1.00 7.29  ? 95  PRO L CD  1 
ATOM 785  N N   . PRO A 1 101 ? 29.134 39.089 18.317 1.00 6.83  ? 96  PRO L N   1 
ATOM 786  C CA  . PRO A 1 101 ? 28.470 37.934 18.921 1.00 5.63  ? 96  PRO L CA  1 
ATOM 787  C C   . PRO A 1 101 ? 28.399 38.165 20.429 1.00 4.66  ? 96  PRO L C   1 
ATOM 788  O O   . PRO A 1 101 ? 29.426 38.344 21.088 1.00 3.09  ? 96  PRO L O   1 
ATOM 789  C CB  . PRO A 1 101 ? 29.419 36.800 18.573 1.00 2.23  ? 96  PRO L CB  1 
ATOM 790  C CG  . PRO A 1 101 ? 29.954 37.221 17.246 1.00 2.00  ? 96  PRO L CG  1 
ATOM 791  C CD  . PRO A 1 101 ? 30.278 38.656 17.491 1.00 5.94  ? 96  PRO L CD  1 
ATOM 792  N N   . THR A 1 102 ? 27.194 38.236 20.966 1.00 2.00  ? 97  THR L N   1 
ATOM 793  C CA  . THR A 1 102 ? 27.078 38.481 22.367 1.00 2.00  ? 97  THR L CA  1 
ATOM 794  C C   . THR A 1 102 ? 26.848 37.182 23.120 1.00 4.61  ? 97  THR L C   1 
ATOM 795  O O   . THR A 1 102 ? 26.356 36.217 22.535 1.00 7.01  ? 97  THR L O   1 
ATOM 796  C CB  . THR A 1 102 ? 25.976 39.488 22.616 1.00 2.00  ? 97  THR L CB  1 
ATOM 797  O OG1 . THR A 1 102 ? 25.682 40.145 21.395 1.00 2.00  ? 97  THR L OG1 1 
ATOM 798  C CG2 . THR A 1 102 ? 26.454 40.547 23.576 1.00 4.14  ? 97  THR L CG2 1 
ATOM 799  N N   . PHE A 1 103 ? 27.255 37.147 24.396 1.00 4.33  ? 98  PHE L N   1 
ATOM 800  C CA  . PHE A 1 103 ? 27.101 35.972 25.250 1.00 2.00  ? 98  PHE L CA  1 
ATOM 801  C C   . PHE A 1 103 ? 26.068 36.261 26.325 1.00 2.00  ? 98  PHE L C   1 
ATOM 802  O O   . PHE A 1 103 ? 26.181 37.272 26.991 1.00 6.80  ? 98  PHE L O   1 
ATOM 803  C CB  . PHE A 1 103 ? 28.428 35.653 25.929 1.00 2.00  ? 98  PHE L CB  1 
ATOM 804  C CG  . PHE A 1 103 ? 29.301 34.691 25.166 1.00 2.00  ? 98  PHE L CG  1 
ATOM 805  C CD1 . PHE A 1 103 ? 30.278 35.151 24.292 1.00 2.00  ? 98  PHE L CD1 1 
ATOM 806  C CD2 . PHE A 1 103 ? 29.167 33.326 25.346 1.00 2.00  ? 98  PHE L CD2 1 
ATOM 807  C CE1 . PHE A 1 103 ? 31.097 34.270 23.616 1.00 2.00  ? 98  PHE L CE1 1 
ATOM 808  C CE2 . PHE A 1 103 ? 29.979 32.448 24.680 1.00 2.00  ? 98  PHE L CE2 1 
ATOM 809  C CZ  . PHE A 1 103 ? 30.948 32.923 23.810 1.00 2.00  ? 98  PHE L CZ  1 
ATOM 810  N N   . GLY A 1 104 ? 25.067 35.396 26.497 1.00 3.33  ? 99  GLY L N   1 
ATOM 811  C CA  . GLY A 1 104 ? 24.054 35.611 27.527 1.00 2.82  ? 99  GLY L CA  1 
ATOM 812  C C   . GLY A 1 104 ? 24.622 35.816 28.927 1.00 4.87  ? 99  GLY L C   1 
ATOM 813  O O   . GLY A 1 104 ? 25.834 35.643 29.151 1.00 2.00  ? 99  GLY L O   1 
ATOM 814  N N   . GLY A 1 105 ? 23.735 36.131 29.876 1.00 5.09  ? 100 GLY L N   1 
ATOM 815  C CA  . GLY A 1 105 ? 24.139 36.383 31.264 1.00 11.11 ? 100 GLY L CA  1 
ATOM 816  C C   . GLY A 1 105 ? 24.744 35.230 32.058 1.00 13.82 ? 100 GLY L C   1 
ATOM 817  O O   . GLY A 1 105 ? 25.720 35.427 32.789 1.00 13.26 ? 100 GLY L O   1 
ATOM 818  N N   . GLY A 1 106 ? 24.168 34.035 31.887 1.00 15.73 ? 101 GLY L N   1 
ATOM 819  C CA  . GLY A 1 106 ? 24.614 32.830 32.560 1.00 7.31  ? 101 GLY L CA  1 
ATOM 820  C C   . GLY A 1 106 ? 23.564 32.433 33.573 1.00 8.08  ? 101 GLY L C   1 
ATOM 821  O O   . GLY A 1 106 ? 23.155 33.273 34.364 1.00 9.55  ? 101 GLY L O   1 
ATOM 822  N N   . THR A 1 107 ? 23.045 31.211 33.481 1.00 6.49  ? 102 THR L N   1 
ATOM 823  C CA  . THR A 1 107 ? 22.065 30.710 34.449 1.00 6.48  ? 102 THR L CA  1 
ATOM 824  C C   . THR A 1 107 ? 22.782 29.610 35.190 1.00 6.44  ? 102 THR L C   1 
ATOM 825  O O   . THR A 1 107 ? 23.112 28.595 34.578 1.00 8.86  ? 102 THR L O   1 
ATOM 826  C CB  . THR A 1 107 ? 20.829 30.067 33.791 1.00 5.89  ? 102 THR L CB  1 
ATOM 827  O OG1 . THR A 1 107 ? 19.984 31.084 33.239 1.00 13.71 ? 102 THR L OG1 1 
ATOM 828  C CG2 . THR A 1 107 ? 20.029 29.297 34.807 1.00 2.00  ? 102 THR L CG2 1 
ATOM 829  N N   . LYS A 1 108 ? 23.064 29.809 36.477 1.00 7.96  ? 103 LYS L N   1 
ATOM 830  C CA  . LYS A 1 108 ? 23.768 28.787 37.248 1.00 9.40  ? 103 LYS L CA  1 
ATOM 831  C C   . LYS A 1 108 ? 22.790 27.695 37.657 1.00 10.43 ? 103 LYS L C   1 
ATOM 832  O O   . LYS A 1 108 ? 21.750 27.973 38.275 1.00 7.80  ? 103 LYS L O   1 
ATOM 833  C CB  . LYS A 1 108 ? 24.494 29.386 38.456 1.00 10.25 ? 103 LYS L CB  1 
ATOM 834  C CG  . LYS A 1 108 ? 25.314 28.359 39.229 1.00 16.05 ? 103 LYS L CG  1 
ATOM 835  C CD  . LYS A 1 108 ? 26.822 28.644 39.262 1.00 16.78 ? 103 LYS L CD  1 
ATOM 836  C CE  . LYS A 1 108 ? 27.603 27.520 40.001 1.00 19.39 ? 103 LYS L CE  1 
ATOM 837  N NZ  . LYS A 1 108 ? 27.242 27.284 41.456 1.00 16.54 ? 103 LYS L NZ  1 
ATOM 838  N N   . LEU A 1 109 ? 23.094 26.470 37.228 1.00 9.25  ? 104 LEU L N   1 
ATOM 839  C CA  . LEU A 1 109 ? 22.256 25.313 37.496 1.00 12.10 ? 104 LEU L CA  1 
ATOM 840  C C   . LEU A 1 109 ? 22.790 24.599 38.732 1.00 15.69 ? 104 LEU L C   1 
ATOM 841  O O   . LEU A 1 109 ? 23.831 23.946 38.631 1.00 17.12 ? 104 LEU L O   1 
ATOM 842  C CB  . LEU A 1 109 ? 22.336 24.400 36.275 1.00 15.19 ? 104 LEU L CB  1 
ATOM 843  C CG  . LEU A 1 109 ? 21.335 23.283 35.966 1.00 17.82 ? 104 LEU L CG  1 
ATOM 844  C CD1 . LEU A 1 109 ? 21.863 21.947 36.455 1.00 15.91 ? 104 LEU L CD1 1 
ATOM 845  C CD2 . LEU A 1 109 ? 19.959 23.621 36.529 1.00 17.27 ? 104 LEU L CD2 1 
ATOM 846  N N   . GLU A 1 110 ? 22.080 24.697 39.871 1.00 15.35 ? 105 GLU L N   1 
ATOM 847  C CA  . GLU A 1 110 ? 22.509 24.081 41.147 1.00 12.83 ? 105 GLU L CA  1 
ATOM 848  C C   . GLU A 1 110 ? 21.515 23.126 41.793 1.00 11.47 ? 105 GLU L C   1 
ATOM 849  O O   . GLU A 1 110 ? 20.399 22.968 41.332 1.00 6.87  ? 105 GLU L O   1 
ATOM 850  C CB  . GLU A 1 110 ? 22.810 25.142 42.208 1.00 12.83 ? 105 GLU L CB  1 
ATOM 851  C CG  . GLU A 1 110 ? 23.434 26.410 41.710 1.00 17.98 ? 105 GLU L CG  1 
ATOM 852  C CD  . GLU A 1 110 ? 22.591 27.640 42.010 1.00 21.28 ? 105 GLU L CD  1 
ATOM 853  O OE1 . GLU A 1 110 ? 23.174 28.742 42.064 1.00 24.77 ? 105 GLU L OE1 1 
ATOM 854  O OE2 . GLU A 1 110 ? 21.355 27.523 42.186 1.00 21.27 ? 105 GLU L OE2 1 
ATOM 855  N N   . ILE A 1 111 ? 21.913 22.593 42.945 1.00 14.06 ? 106 ILE L N   1 
ATOM 856  C CA  . ILE A 1 111 ? 21.102 21.666 43.730 1.00 15.85 ? 106 ILE L CA  1 
ATOM 857  C C   . ILE A 1 111 ? 20.218 22.426 44.745 1.00 16.59 ? 106 ILE L C   1 
ATOM 858  O O   . ILE A 1 111 ? 20.562 23.516 45.199 1.00 14.15 ? 106 ILE L O   1 
ATOM 859  C CB  . ILE A 1 111 ? 22.008 20.631 44.469 1.00 17.22 ? 106 ILE L CB  1 
ATOM 860  C CG1 . ILE A 1 111 ? 22.655 19.673 43.465 1.00 14.58 ? 106 ILE L CG1 1 
ATOM 861  C CG2 . ILE A 1 111 ? 21.212 19.831 45.525 1.00 20.39 ? 106 ILE L CG2 1 
ATOM 862  C CD1 . ILE A 1 111 ? 23.206 18.406 44.112 1.00 12.49 ? 106 ILE L CD1 1 
ATOM 863  N N   . LYS A 1 112 ? 19.064 21.849 45.060 1.00 16.04 ? 107 LYS L N   1 
ATOM 864  C CA  . LYS A 1 112 ? 18.112 22.442 45.990 1.00 16.37 ? 107 LYS L CA  1 
ATOM 865  C C   . LYS A 1 112 ? 18.133 21.575 47.220 1.00 19.03 ? 107 LYS L C   1 
ATOM 866  O O   . LYS A 1 112 ? 18.367 20.370 47.113 1.00 26.71 ? 107 LYS L O   1 
ATOM 867  C CB  . LYS A 1 112 ? 16.705 22.437 45.375 1.00 19.38 ? 107 LYS L CB  1 
ATOM 868  C CG  . LYS A 1 112 ? 15.532 22.678 46.339 1.00 20.32 ? 107 LYS L CG  1 
ATOM 869  C CD  . LYS A 1 112 ? 14.200 22.376 45.648 1.00 22.59 ? 107 LYS L CD  1 
ATOM 870  C CE  . LYS A 1 112 ? 13.802 23.473 44.656 1.00 25.79 ? 107 LYS L CE  1 
ATOM 871  N NZ  . LYS A 1 112 ? 12.594 23.174 43.812 1.00 23.53 ? 107 LYS L NZ  1 
ATOM 872  N N   . ARG A 1 113 ? 17.889 22.169 48.387 1.00 18.77 ? 108 ARG L N   1 
ATOM 873  C CA  . ARG A 1 113 ? 17.870 21.404 49.634 1.00 16.49 ? 108 ARG L CA  1 
ATOM 874  C C   . ARG A 1 113 ? 17.043 22.072 50.737 1.00 16.43 ? 108 ARG L C   1 
ATOM 875  O O   . ARG A 1 113 ? 16.381 23.091 50.506 1.00 16.95 ? 108 ARG L O   1 
ATOM 876  C CB  . ARG A 1 113 ? 19.294 21.158 50.131 1.00 12.27 ? 108 ARG L CB  1 
ATOM 877  C CG  . ARG A 1 113 ? 20.052 22.404 50.478 1.00 8.94  ? 108 ARG L CG  1 
ATOM 878  C CD  . ARG A 1 113 ? 21.416 22.051 51.018 1.00 14.14 ? 108 ARG L CD  1 
ATOM 879  N NE  . ARG A 1 113 ? 21.377 21.233 52.233 1.00 13.74 ? 108 ARG L NE  1 
ATOM 880  C CZ  . ARG A 1 113 ? 21.069 21.701 53.440 1.00 16.04 ? 108 ARG L CZ  1 
ATOM 881  N NH1 . ARG A 1 113 ? 20.755 22.984 53.608 1.00 16.93 ? 108 ARG L NH1 1 
ATOM 882  N NH2 . ARG A 1 113 ? 21.128 20.905 54.492 1.00 12.31 ? 108 ARG L NH2 1 
ATOM 883  N N   . ALA A 1 114 ? 17.059 21.472 51.924 1.00 12.07 ? 109 ALA L N   1 
ATOM 884  C CA  . ALA A 1 114 ? 16.342 22.011 53.062 1.00 10.87 ? 109 ALA L CA  1 
ATOM 885  C C   . ALA A 1 114 ? 17.068 23.275 53.494 1.00 10.13 ? 109 ALA L C   1 
ATOM 886  O O   . ALA A 1 114 ? 18.288 23.267 53.640 1.00 10.38 ? 109 ALA L O   1 
ATOM 887  C CB  . ALA A 1 114 ? 16.343 20.999 54.194 1.00 13.68 ? 109 ALA L CB  1 
ATOM 888  N N   . ASP A 1 115 ? 16.344 24.379 53.623 1.00 7.82  ? 110 ASP L N   1 
ATOM 889  C CA  . ASP A 1 115 ? 16.974 25.620 54.053 1.00 11.70 ? 110 ASP L CA  1 
ATOM 890  C C   . ASP A 1 115 ? 17.485 25.336 55.461 1.00 14.86 ? 110 ASP L C   1 
ATOM 891  O O   . ASP A 1 115 ? 16.800 24.634 56.233 1.00 15.41 ? 110 ASP L O   1 
ATOM 892  C CB  . ASP A 1 115 ? 15.963 26.767 54.093 1.00 14.50 ? 110 ASP L CB  1 
ATOM 893  C CG  . ASP A 1 115 ? 15.030 26.758 52.902 1.00 19.87 ? 110 ASP L CG  1 
ATOM 894  O OD1 . ASP A 1 115 ? 13.789 26.675 53.140 1.00 19.32 ? 110 ASP L OD1 1 
ATOM 895  O OD2 . ASP A 1 115 ? 15.533 26.807 51.739 1.00 17.33 ? 110 ASP L OD2 1 
ATOM 896  N N   . ALA A 1 116 ? 18.678 25.855 55.777 1.00 10.37 ? 111 ALA L N   1 
ATOM 897  C CA  . ALA A 1 116 ? 19.319 25.665 57.073 1.00 5.72  ? 111 ALA L CA  1 
ATOM 898  C C   . ALA A 1 116 ? 20.017 26.955 57.508 1.00 6.57  ? 111 ALA L C   1 
ATOM 899  O O   . ALA A 1 116 ? 20.476 27.738 56.670 1.00 3.07  ? 111 ALA L O   1 
ATOM 900  C CB  . ALA A 1 116 ? 20.314 24.505 56.997 1.00 4.21  ? 111 ALA L CB  1 
ATOM 901  N N   . ALA A 1 117 ? 20.067 27.191 58.820 1.00 7.19  ? 112 ALA L N   1 
ATOM 902  C CA  . ALA A 1 117 ? 20.683 28.396 59.380 1.00 4.37  ? 112 ALA L CA  1 
ATOM 903  C C   . ALA A 1 117 ? 22.215 28.289 59.449 1.00 7.12  ? 112 ALA L C   1 
ATOM 904  O O   . ALA A 1 117 ? 22.784 27.185 59.406 1.00 8.70  ? 112 ALA L O   1 
ATOM 905  C CB  . ALA A 1 117 ? 20.115 28.659 60.748 1.00 2.52  ? 112 ALA L CB  1 
ATOM 906  N N   . PRO A 1 118 ? 22.907 29.431 59.595 1.00 4.88  ? 113 PRO L N   1 
ATOM 907  C CA  . PRO A 1 118 ? 24.371 29.405 59.663 1.00 5.34  ? 113 PRO L CA  1 
ATOM 908  C C   . PRO A 1 118 ? 24.950 29.064 61.043 1.00 3.81  ? 113 PRO L C   1 
ATOM 909  O O   . PRO A 1 118 ? 24.254 29.078 62.056 1.00 3.47  ? 113 PRO L O   1 
ATOM 910  C CB  . PRO A 1 118 ? 24.768 30.841 59.271 1.00 4.01  ? 113 PRO L CB  1 
ATOM 911  C CG  . PRO A 1 118 ? 23.497 31.505 58.836 1.00 2.00  ? 113 PRO L CG  1 
ATOM 912  C CD  . PRO A 1 118 ? 22.418 30.816 59.580 1.00 3.12  ? 113 PRO L CD  1 
ATOM 913  N N   . THR A 1 119 ? 26.249 28.818 61.064 1.00 3.07  ? 114 THR L N   1 
ATOM 914  C CA  . THR A 1 119 ? 26.981 28.534 62.280 1.00 5.83  ? 114 THR L CA  1 
ATOM 915  C C   . THR A 1 119 ? 28.038 29.637 62.447 1.00 5.96  ? 114 THR L C   1 
ATOM 916  O O   . THR A 1 119 ? 29.235 29.423 62.185 1.00 8.86  ? 114 THR L O   1 
ATOM 917  C CB  . THR A 1 119 ? 27.679 27.193 62.180 1.00 8.29  ? 114 THR L CB  1 
ATOM 918  O OG1 . THR A 1 119 ? 26.717 26.166 61.907 1.00 12.40 ? 114 THR L OG1 1 
ATOM 919  C CG2 . THR A 1 119 ? 28.393 26.899 63.470 1.00 9.72  ? 114 THR L CG2 1 
ATOM 920  N N   . VAL A 1 120 ? 27.575 30.812 62.862 1.00 2.00  ? 115 VAL L N   1 
ATOM 921  C CA  . VAL A 1 120 ? 28.421 31.976 63.059 1.00 2.00  ? 115 VAL L CA  1 
ATOM 922  C C   . VAL A 1 120 ? 29.486 31.761 64.132 1.00 2.00  ? 115 VAL L C   1 
ATOM 923  O O   . VAL A 1 120 ? 29.244 31.145 65.150 1.00 2.00  ? 115 VAL L O   1 
ATOM 924  C CB  . VAL A 1 120 ? 27.572 33.213 63.426 1.00 3.02  ? 115 VAL L CB  1 
ATOM 925  C CG1 . VAL A 1 120 ? 28.386 34.515 63.243 1.00 2.00  ? 115 VAL L CG1 1 
ATOM 926  C CG2 . VAL A 1 120 ? 26.312 33.232 62.584 1.00 2.65  ? 115 VAL L CG2 1 
ATOM 927  N N   . SER A 1 121 ? 30.674 32.285 63.880 1.00 4.42  ? 116 SER L N   1 
ATOM 928  C CA  . SER A 1 121 ? 31.799 32.181 64.794 1.00 3.16  ? 116 SER L CA  1 
ATOM 929  C C   . SER A 1 121 ? 32.541 33.491 64.575 1.00 4.90  ? 116 SER L C   1 
ATOM 930  O O   . SER A 1 121 ? 32.657 33.965 63.443 1.00 5.08  ? 116 SER L O   1 
ATOM 931  C CB  . SER A 1 121 ? 32.695 31.000 64.430 1.00 2.00  ? 116 SER L CB  1 
ATOM 932  O OG  . SER A 1 121 ? 31.950 29.912 63.908 1.00 3.04  ? 116 SER L OG  1 
ATOM 933  N N   . ILE A 1 122 ? 33.065 34.054 65.651 1.00 5.46  ? 117 ILE L N   1 
ATOM 934  C CA  . ILE A 1 122 ? 33.735 35.333 65.593 1.00 6.69  ? 117 ILE L CA  1 
ATOM 935  C C   . ILE A 1 122 ? 35.151 35.230 66.228 1.00 7.32  ? 117 ILE L C   1 
ATOM 936  O O   . ILE A 1 122 ? 35.330 34.679 67.316 1.00 10.77 ? 117 ILE L O   1 
ATOM 937  C CB  . ILE A 1 122 ? 32.772 36.351 66.260 1.00 6.36  ? 117 ILE L CB  1 
ATOM 938  C CG1 . ILE A 1 122 ? 33.155 37.799 65.982 1.00 2.56  ? 117 ILE L CG1 1 
ATOM 939  C CG2 . ILE A 1 122 ? 32.585 35.990 67.729 1.00 10.15 ? 117 ILE L CG2 1 
ATOM 940  C CD1 . ILE A 1 122 ? 32.035 38.760 66.304 1.00 2.00  ? 117 ILE L CD1 1 
ATOM 941  N N   . PHE A 1 123 ? 36.162 35.707 65.510 1.00 8.65  ? 118 PHE L N   1 
ATOM 942  C CA  . PHE A 1 123 ? 37.543 35.627 65.972 1.00 9.47  ? 118 PHE L CA  1 
ATOM 943  C C   . PHE A 1 123 ? 38.240 36.988 65.971 1.00 15.30 ? 118 PHE L C   1 
ATOM 944  O O   . PHE A 1 123 ? 38.215 37.707 64.968 1.00 16.95 ? 118 PHE L O   1 
ATOM 945  C CB  . PHE A 1 123 ? 38.365 34.671 65.078 1.00 5.42  ? 118 PHE L CB  1 
ATOM 946  C CG  . PHE A 1 123 ? 37.762 33.293 64.906 1.00 6.03  ? 118 PHE L CG  1 
ATOM 947  C CD1 . PHE A 1 123 ? 38.225 32.210 65.647 1.00 2.88  ? 118 PHE L CD1 1 
ATOM 948  C CD2 . PHE A 1 123 ? 36.717 33.082 64.015 1.00 5.43  ? 118 PHE L CD2 1 
ATOM 949  C CE1 . PHE A 1 123 ? 37.656 30.944 65.509 1.00 2.00  ? 118 PHE L CE1 1 
ATOM 950  C CE2 . PHE A 1 123 ? 36.148 31.820 63.877 1.00 4.64  ? 118 PHE L CE2 1 
ATOM 951  C CZ  . PHE A 1 123 ? 36.623 30.749 64.633 1.00 2.00  ? 118 PHE L CZ  1 
ATOM 952  N N   . PRO A 1 124 ? 38.808 37.397 67.122 1.00 21.32 ? 119 PRO L N   1 
ATOM 953  C CA  . PRO A 1 124 ? 39.506 38.678 67.208 1.00 20.56 ? 119 PRO L CA  1 
ATOM 954  C C   . PRO A 1 124 ? 40.852 38.517 66.484 1.00 17.31 ? 119 PRO L C   1 
ATOM 955  O O   . PRO A 1 124 ? 41.268 37.402 66.169 1.00 18.02 ? 119 PRO L O   1 
ATOM 956  C CB  . PRO A 1 124 ? 39.734 38.844 68.720 1.00 18.58 ? 119 PRO L CB  1 
ATOM 957  C CG  . PRO A 1 124 ? 38.681 38.068 69.335 1.00 17.24 ? 119 PRO L CG  1 
ATOM 958  C CD  . PRO A 1 124 ? 38.677 36.824 68.477 1.00 24.29 ? 119 PRO L CD  1 
ATOM 959  N N   . PRO A 1 125 ? 41.545 39.622 66.221 1.00 13.39 ? 120 PRO L N   1 
ATOM 960  C CA  . PRO A 1 125 ? 42.832 39.512 65.543 1.00 16.93 ? 120 PRO L CA  1 
ATOM 961  C C   . PRO A 1 125 ? 43.831 38.698 66.393 1.00 21.74 ? 120 PRO L C   1 
ATOM 962  O O   . PRO A 1 125 ? 43.636 38.550 67.600 1.00 27.15 ? 120 PRO L O   1 
ATOM 963  C CB  . PRO A 1 125 ? 43.257 40.975 65.428 1.00 17.07 ? 120 PRO L CB  1 
ATOM 964  C CG  . PRO A 1 125 ? 42.547 41.640 66.582 1.00 11.68 ? 120 PRO L CG  1 
ATOM 965  C CD  . PRO A 1 125 ? 41.209 41.026 66.497 1.00 11.10 ? 120 PRO L CD  1 
ATOM 966  N N   . SER A 1 126 ? 44.878 38.149 65.776 1.00 20.81 ? 121 SER L N   1 
ATOM 967  C CA  . SER A 1 126 ? 45.885 37.399 66.531 1.00 18.81 ? 121 SER L CA  1 
ATOM 968  C C   . SER A 1 126 ? 46.931 38.357 67.110 1.00 19.37 ? 121 SER L C   1 
ATOM 969  O O   . SER A 1 126 ? 47.029 39.523 66.709 1.00 15.46 ? 121 SER L O   1 
ATOM 970  C CB  . SER A 1 126 ? 46.603 36.391 65.631 1.00 21.19 ? 121 SER L CB  1 
ATOM 971  O OG  . SER A 1 126 ? 47.591 37.029 64.821 1.00 25.86 ? 121 SER L OG  1 
ATOM 972  N N   . SER A 1 127 ? 47.775 37.828 67.985 1.00 21.32 ? 122 SER L N   1 
ATOM 973  C CA  . SER A 1 127 ? 48.842 38.616 68.588 1.00 22.80 ? 122 SER L CA  1 
ATOM 974  C C   . SER A 1 127 ? 49.813 39.179 67.522 1.00 25.07 ? 122 SER L C   1 
ATOM 975  O O   . SER A 1 127 ? 49.988 40.399 67.428 1.00 24.90 ? 122 SER L O   1 
ATOM 976  C CB  . SER A 1 127 ? 49.611 37.762 69.603 1.00 19.11 ? 122 SER L CB  1 
ATOM 977  O OG  . SER A 1 127 ? 48.798 37.444 70.712 1.00 15.50 ? 122 SER L OG  1 
ATOM 978  N N   . GLU A 1 128 ? 50.396 38.293 66.699 1.00 25.38 ? 123 GLU L N   1 
ATOM 979  C CA  . GLU A 1 128 ? 51.359 38.684 65.652 1.00 23.83 ? 123 GLU L CA  1 
ATOM 980  C C   . GLU A 1 128 ? 50.832 39.671 64.617 1.00 23.16 ? 123 GLU L C   1 
ATOM 981  O O   . GLU A 1 128 ? 51.474 40.705 64.370 1.00 23.24 ? 123 GLU L O   1 
ATOM 982  C CB  . GLU A 1 128 ? 51.986 37.472 64.957 1.00 22.81 ? 123 GLU L CB  1 
ATOM 983  C CG  . GLU A 1 128 ? 50.998 36.391 64.560 1.00 24.00 ? 123 GLU L CG  1 
ATOM 984  C CD  . GLU A 1 128 ? 50.918 35.252 65.565 1.00 21.13 ? 123 GLU L CD  1 
ATOM 985  O OE1 . GLU A 1 128 ? 51.764 34.334 65.487 1.00 18.77 ? 123 GLU L OE1 1 
ATOM 986  O OE2 . GLU A 1 128 ? 50.001 35.271 66.418 1.00 18.01 ? 123 GLU L OE2 1 
ATOM 987  N N   . GLN A 1 129 ? 49.690 39.388 63.995 1.00 17.43 ? 124 GLN L N   1 
ATOM 988  C CA  . GLN A 1 129 ? 49.186 40.374 63.047 1.00 17.40 ? 124 GLN L CA  1 
ATOM 989  C C   . GLN A 1 129 ? 49.057 41.678 63.804 1.00 21.52 ? 124 GLN L C   1 
ATOM 990  O O   . GLN A 1 129 ? 49.309 42.741 63.242 1.00 27.67 ? 124 GLN L O   1 
ATOM 991  C CB  . GLN A 1 129 ? 47.811 40.030 62.504 1.00 14.11 ? 124 GLN L CB  1 
ATOM 992  C CG  . GLN A 1 129 ? 47.049 41.268 62.103 1.00 2.00  ? 124 GLN L CG  1 
ATOM 993  C CD  . GLN A 1 129 ? 45.992 40.975 61.124 1.00 2.00  ? 124 GLN L CD  1 
ATOM 994  O OE1 . GLN A 1 129 ? 44.889 40.618 61.480 1.00 2.00  ? 124 GLN L OE1 1 
ATOM 995  N NE2 . GLN A 1 129 ? 46.317 41.120 59.863 1.00 3.94  ? 124 GLN L NE2 1 
ATOM 996  N N   . LEU A 1 130 ? 48.649 41.579 65.074 1.00 22.81 ? 125 LEU L N   1 
ATOM 997  C CA  . LEU A 1 130 ? 48.471 42.747 65.925 1.00 19.89 ? 125 LEU L CA  1 
ATOM 998  C C   . LEU A 1 130 ? 49.752 43.493 66.221 1.00 20.50 ? 125 LEU L C   1 
ATOM 999  O O   . LEU A 1 130 ? 49.689 44.682 66.518 1.00 21.48 ? 125 LEU L O   1 
ATOM 1000 C CB  . LEU A 1 130 ? 47.757 42.385 67.213 1.00 16.71 ? 125 LEU L CB  1 
ATOM 1001 C CG  . LEU A 1 130 ? 46.321 42.886 67.230 1.00 15.22 ? 125 LEU L CG  1 
ATOM 1002 C CD1 . LEU A 1 130 ? 45.571 42.134 68.294 1.00 17.14 ? 125 LEU L CD1 1 
ATOM 1003 C CD2 . LEU A 1 130 ? 46.269 44.382 67.474 1.00 14.31 ? 125 LEU L CD2 1 
ATOM 1004 N N   . THR A 1 131 ? 50.899 42.804 66.205 1.00 19.22 ? 126 THR L N   1 
ATOM 1005 C CA  . THR A 1 131 ? 52.173 43.493 66.425 1.00 20.26 ? 126 THR L CA  1 
ATOM 1006 C C   . THR A 1 131 ? 52.390 44.219 65.098 1.00 18.60 ? 126 THR L C   1 
ATOM 1007 O O   . THR A 1 131 ? 52.483 45.454 65.059 1.00 18.77 ? 126 THR L O   1 
ATOM 1008 C CB  . THR A 1 131 ? 53.404 42.535 66.682 1.00 20.71 ? 126 THR L CB  1 
ATOM 1009 O OG1 . THR A 1 131 ? 53.804 41.906 65.455 1.00 23.02 ? 126 THR L OG1 1 
ATOM 1010 C CG2 . THR A 1 131 ? 53.086 41.469 67.731 1.00 18.23 ? 126 THR L CG2 1 
ATOM 1011 N N   . SER A 1 132 ? 52.356 43.435 64.012 1.00 13.62 ? 127 SER L N   1 
ATOM 1012 C CA  . SER A 1 132 ? 52.539 43.924 62.647 1.00 12.85 ? 127 SER L CA  1 
ATOM 1013 C C   . SER A 1 132 ? 51.811 45.239 62.443 1.00 12.82 ? 127 SER L C   1 
ATOM 1014 O O   . SER A 1 132 ? 52.162 46.023 61.547 1.00 16.40 ? 127 SER L O   1 
ATOM 1015 C CB  . SER A 1 132 ? 52.025 42.901 61.635 1.00 12.63 ? 127 SER L CB  1 
ATOM 1016 O OG  . SER A 1 132 ? 52.533 41.620 61.920 1.00 7.37  ? 127 SER L OG  1 
ATOM 1017 N N   . GLY A 1 133 ? 50.763 45.438 63.242 1.00 8.38  ? 128 GLY L N   1 
ATOM 1018 C CA  . GLY A 1 133 ? 50.015 46.667 63.193 1.00 12.76 ? 128 GLY L CA  1 
ATOM 1019 C C   . GLY A 1 133 ? 48.621 46.522 62.655 1.00 12.45 ? 128 GLY L C   1 
ATOM 1020 O O   . GLY A 1 133 ? 47.741 47.254 63.062 1.00 13.68 ? 128 GLY L O   1 
ATOM 1021 N N   . GLY A 1 134 ? 48.417 45.633 61.698 1.00 13.34 ? 129 GLY L N   1 
ATOM 1022 C CA  . GLY A 1 134 ? 47.083 45.480 61.148 1.00 15.91 ? 129 GLY L CA  1 
ATOM 1023 C C   . GLY A 1 134 ? 46.207 44.781 62.155 1.00 17.43 ? 129 GLY L C   1 
ATOM 1024 O O   . GLY A 1 134 ? 46.711 44.232 63.140 1.00 20.95 ? 129 GLY L O   1 
ATOM 1025 N N   . ALA A 1 135 ? 44.900 44.828 61.947 1.00 15.59 ? 130 ALA L N   1 
ATOM 1026 C CA  . ALA A 1 135 ? 43.995 44.123 62.840 1.00 16.55 ? 130 ALA L CA  1 
ATOM 1027 C C   . ALA A 1 135 ? 42.832 43.625 61.999 1.00 17.33 ? 130 ALA L C   1 
ATOM 1028 O O   . ALA A 1 135 ? 42.133 44.437 61.371 1.00 18.63 ? 130 ALA L O   1 
ATOM 1029 C CB  . ALA A 1 135 ? 43.517 45.016 63.962 1.00 16.43 ? 130 ALA L CB  1 
ATOM 1030 N N   . SER A 1 136 ? 42.685 42.297 61.917 1.00 13.63 ? 131 SER L N   1 
ATOM 1031 C CA  . SER A 1 136 ? 41.611 41.684 61.147 1.00 11.66 ? 131 SER L CA  1 
ATOM 1032 C C   . SER A 1 136 ? 40.729 40.814 62.009 1.00 9.80  ? 131 SER L C   1 
ATOM 1033 O O   . SER A 1 136 ? 41.188 39.852 62.622 1.00 11.93 ? 131 SER L O   1 
ATOM 1034 C CB  . SER A 1 136 ? 42.181 40.875 59.994 1.00 14.59 ? 131 SER L CB  1 
ATOM 1035 O OG  . SER A 1 136 ? 42.997 41.702 59.173 1.00 22.10 ? 131 SER L OG  1 
ATOM 1036 N N   . VAL A 1 137 ? 39.471 41.218 62.108 1.00 9.17  ? 132 VAL L N   1 
ATOM 1037 C CA  . VAL A 1 137 ? 38.468 40.517 62.892 1.00 8.24  ? 132 VAL L CA  1 
ATOM 1038 C C   . VAL A 1 137 ? 37.652 39.736 61.866 1.00 7.61  ? 132 VAL L C   1 
ATOM 1039 O O   . VAL A 1 137 ? 37.005 40.333 61.001 1.00 7.45  ? 132 VAL L O   1 
ATOM 1040 C CB  . VAL A 1 137 ? 37.569 41.532 63.647 1.00 7.82  ? 132 VAL L CB  1 
ATOM 1041 C CG1 . VAL A 1 137 ? 36.580 40.823 64.538 1.00 8.99  ? 132 VAL L CG1 1 
ATOM 1042 C CG2 . VAL A 1 137 ? 38.414 42.451 64.477 1.00 6.99  ? 132 VAL L CG2 1 
ATOM 1043 N N   . VAL A 1 138 ? 37.696 38.410 61.963 1.00 6.47  ? 133 VAL L N   1 
ATOM 1044 C CA  . VAL A 1 138 ? 36.999 37.535 61.026 1.00 6.84  ? 133 VAL L CA  1 
ATOM 1045 C C   . VAL A 1 138 ? 35.745 36.883 61.579 1.00 6.08  ? 133 VAL L C   1 
ATOM 1046 O O   . VAL A 1 138 ? 35.655 36.608 62.770 1.00 2.00  ? 133 VAL L O   1 
ATOM 1047 C CB  . VAL A 1 138 ? 37.926 36.427 60.510 1.00 8.21  ? 133 VAL L CB  1 
ATOM 1048 C CG1 . VAL A 1 138 ? 37.202 35.580 59.457 1.00 10.57 ? 133 VAL L CG1 1 
ATOM 1049 C CG2 . VAL A 1 138 ? 39.197 37.041 59.918 1.00 8.01  ? 133 VAL L CG2 1 
ATOM 1050 N N   . CYS A 1 139 ? 34.793 36.607 60.693 1.00 9.00  ? 134 CYS L N   1 
ATOM 1051 C CA  . CYS A 1 139 ? 33.531 35.974 61.076 1.00 11.43 ? 134 CYS L CA  1 
ATOM 1052 C C   . CYS A 1 139 ? 33.136 34.914 60.016 1.00 12.20 ? 134 CYS L C   1 
ATOM 1053 O O   . CYS A 1 139 ? 33.000 35.226 58.825 1.00 15.85 ? 134 CYS L O   1 
ATOM 1054 C CB  . CYS A 1 139 ? 32.445 37.058 61.216 1.00 9.50  ? 134 CYS L CB  1 
ATOM 1055 S SG  . CYS A 1 139 ? 30.856 36.606 62.003 1.00 12.48 ? 134 CYS L SG  1 
ATOM 1056 N N   . PHE A 1 140 ? 33.069 33.650 60.419 1.00 5.93  ? 135 PHE L N   1 
ATOM 1057 C CA  . PHE A 1 140 ? 32.674 32.611 59.489 1.00 2.94  ? 135 PHE L CA  1 
ATOM 1058 C C   . PHE A 1 140 ? 31.195 32.432 59.734 1.00 3.06  ? 135 PHE L C   1 
ATOM 1059 O O   . PHE A 1 140 ? 30.780 32.450 60.889 1.00 2.00  ? 135 PHE L O   1 
ATOM 1060 C CB  . PHE A 1 140 ? 33.394 31.301 59.778 1.00 2.00  ? 135 PHE L CB  1 
ATOM 1061 C CG  . PHE A 1 140 ? 34.884 31.374 59.636 1.00 2.00  ? 135 PHE L CG  1 
ATOM 1062 C CD1 . PHE A 1 140 ? 35.476 32.236 58.733 1.00 2.00  ? 135 PHE L CD1 1 
ATOM 1063 C CD2 . PHE A 1 140 ? 35.692 30.548 60.391 1.00 2.75  ? 135 PHE L CD2 1 
ATOM 1064 C CE1 . PHE A 1 140 ? 36.855 32.273 58.576 1.00 2.00  ? 135 PHE L CE1 1 
ATOM 1065 C CE2 . PHE A 1 140 ? 37.068 30.581 60.241 1.00 7.56  ? 135 PHE L CE2 1 
ATOM 1066 C CZ  . PHE A 1 140 ? 37.653 31.450 59.325 1.00 2.00  ? 135 PHE L CZ  1 
ATOM 1067 N N   . LEU A 1 141 ? 30.398 32.307 58.668 1.00 2.00  ? 136 LEU L N   1 
ATOM 1068 C CA  . LEU A 1 141 ? 28.950 32.115 58.791 1.00 2.38  ? 136 LEU L CA  1 
ATOM 1069 C C   . LEU A 1 141 ? 28.566 30.785 58.164 1.00 6.35  ? 136 LEU L C   1 
ATOM 1070 O O   . LEU A 1 141 ? 27.419 30.563 57.806 1.00 10.31 ? 136 LEU L O   1 
ATOM 1071 C CB  . LEU A 1 141 ? 28.175 33.225 58.089 1.00 2.00  ? 136 LEU L CB  1 
ATOM 1072 C CG  . LEU A 1 141 ? 28.230 34.662 58.579 1.00 2.00  ? 136 LEU L CG  1 
ATOM 1073 C CD1 . LEU A 1 141 ? 29.618 35.218 58.362 1.00 8.41  ? 136 LEU L CD1 1 
ATOM 1074 C CD2 . LEU A 1 141 ? 27.246 35.496 57.808 1.00 4.76  ? 136 LEU L CD2 1 
ATOM 1075 N N   . ASN A 1 142 ? 29.545 29.897 58.084 1.00 11.38 ? 137 ASN L N   1 
ATOM 1076 C CA  . ASN A 1 142 ? 29.457 28.546 57.511 1.00 13.31 ? 137 ASN L CA  1 
ATOM 1077 C C   . ASN A 1 142 ? 28.153 27.726 57.479 1.00 11.13 ? 137 ASN L C   1 
ATOM 1078 O O   . ASN A 1 142 ? 27.314 27.797 58.372 1.00 15.92 ? 137 ASN L O   1 
ATOM 1079 C CB  . ASN A 1 142 ? 30.520 27.662 58.182 1.00 15.81 ? 137 ASN L CB  1 
ATOM 1080 C CG  . ASN A 1 142 ? 31.919 28.269 58.147 1.00 19.72 ? 137 ASN L CG  1 
ATOM 1081 O OD1 . ASN A 1 142 ? 32.144 29.366 57.606 1.00 18.69 ? 137 ASN L OD1 1 
ATOM 1082 N ND2 . ASN A 1 142 ? 32.872 27.544 58.719 1.00 18.98 ? 137 ASN L ND2 1 
ATOM 1083 N N   . ASN A 1 143 ? 28.040 26.904 56.444 1.00 8.05  ? 138 ASN L N   1 
ATOM 1084 C CA  . ASN A 1 143 ? 26.944 25.960 56.266 1.00 6.34  ? 138 ASN L CA  1 
ATOM 1085 C C   . ASN A 1 143 ? 25.486 26.363 56.157 1.00 8.22  ? 138 ASN L C   1 
ATOM 1086 O O   . ASN A 1 143 ? 24.605 25.510 56.270 1.00 12.94 ? 138 ASN L O   1 
ATOM 1087 C CB  . ASN A 1 143 ? 27.088 24.856 57.309 1.00 6.54  ? 138 ASN L CB  1 
ATOM 1088 C CG  . ASN A 1 143 ? 28.380 24.093 57.157 1.00 6.01  ? 138 ASN L CG  1 
ATOM 1089 O OD1 . ASN A 1 143 ? 28.539 23.327 56.223 1.00 8.56  ? 138 ASN L OD1 1 
ATOM 1090 N ND2 . ASN A 1 143 ? 29.338 24.353 58.036 1.00 6.41  ? 138 ASN L ND2 1 
ATOM 1091 N N   . PHE A 1 144 ? 25.201 27.636 55.947 1.00 9.14  ? 139 PHE L N   1 
ATOM 1092 C CA  . PHE A 1 144 ? 23.804 28.040 55.803 1.00 7.99  ? 139 PHE L CA  1 
ATOM 1093 C C   . PHE A 1 144 ? 23.295 27.607 54.422 1.00 8.44  ? 139 PHE L C   1 
ATOM 1094 O O   . PHE A 1 144 ? 24.012 26.974 53.640 1.00 6.82  ? 139 PHE L O   1 
ATOM 1095 C CB  . PHE A 1 144 ? 23.638 29.559 55.970 1.00 5.67  ? 139 PHE L CB  1 
ATOM 1096 C CG  . PHE A 1 144 ? 24.418 30.362 54.982 1.00 2.00  ? 139 PHE L CG  1 
ATOM 1097 C CD1 . PHE A 1 144 ? 23.808 30.878 53.857 1.00 2.00  ? 139 PHE L CD1 1 
ATOM 1098 C CD2 . PHE A 1 144 ? 25.785 30.535 55.141 1.00 2.11  ? 139 PHE L CD2 1 
ATOM 1099 C CE1 . PHE A 1 144 ? 24.554 31.539 52.903 1.00 2.00  ? 139 PHE L CE1 1 
ATOM 1100 C CE2 . PHE A 1 144 ? 26.532 31.187 54.201 1.00 2.00  ? 139 PHE L CE2 1 
ATOM 1101 C CZ  . PHE A 1 144 ? 25.915 31.691 53.077 1.00 2.00  ? 139 PHE L CZ  1 
ATOM 1102 N N   . TYR A 1 145 ? 22.038 27.923 54.152 1.00 9.13  ? 140 TYR L N   1 
ATOM 1103 C CA  . TYR A 1 145 ? 21.379 27.613 52.878 1.00 9.51  ? 140 TYR L CA  1 
ATOM 1104 C C   . TYR A 1 145 ? 19.951 28.129 53.030 1.00 9.14  ? 140 TYR L C   1 
ATOM 1105 O O   . TYR A 1 145 ? 19.295 27.815 54.028 1.00 11.14 ? 140 TYR L O   1 
ATOM 1106 C CB  . TYR A 1 145 ? 21.356 26.104 52.573 1.00 5.25  ? 140 TYR L CB  1 
ATOM 1107 C CG  . TYR A 1 145 ? 20.573 25.842 51.318 1.00 6.19  ? 140 TYR L CG  1 
ATOM 1108 C CD1 . TYR A 1 145 ? 19.189 25.871 51.338 1.00 12.64 ? 140 TYR L CD1 1 
ATOM 1109 C CD2 . TYR A 1 145 ? 21.198 25.733 50.089 1.00 4.98  ? 140 TYR L CD2 1 
ATOM 1110 C CE1 . TYR A 1 145 ? 18.447 25.826 50.166 1.00 13.10 ? 140 TYR L CE1 1 
ATOM 1111 C CE2 . TYR A 1 145 ? 20.465 25.676 48.917 1.00 5.03  ? 140 TYR L CE2 1 
ATOM 1112 C CZ  . TYR A 1 145 ? 19.091 25.730 48.966 1.00 8.15  ? 140 TYR L CZ  1 
ATOM 1113 O OH  . TYR A 1 145 ? 18.331 25.723 47.824 1.00 11.67 ? 140 TYR L OH  1 
ATOM 1114 N N   . PRO A 1 146 ? 19.426 28.886 52.045 1.00 4.44  ? 141 PRO L N   1 
ATOM 1115 C CA  . PRO A 1 146 ? 19.983 29.367 50.785 1.00 5.97  ? 141 PRO L CA  1 
ATOM 1116 C C   . PRO A 1 146 ? 21.208 30.250 50.924 1.00 9.18  ? 141 PRO L C   1 
ATOM 1117 O O   . PRO A 1 146 ? 21.535 30.690 52.015 1.00 10.45 ? 141 PRO L O   1 
ATOM 1118 C CB  . PRO A 1 146 ? 18.823 30.141 50.192 1.00 6.73  ? 141 PRO L CB  1 
ATOM 1119 C CG  . PRO A 1 146 ? 18.064 30.576 51.390 1.00 2.99  ? 141 PRO L CG  1 
ATOM 1120 C CD  . PRO A 1 146 ? 18.045 29.355 52.189 1.00 3.42  ? 141 PRO L CD  1 
ATOM 1121 N N   . LYS A 1 147 ? 21.851 30.519 49.792 1.00 12.54 ? 142 LYS L N   1 
ATOM 1122 C CA  . LYS A 1 147 ? 23.061 31.322 49.708 1.00 14.32 ? 142 LYS L CA  1 
ATOM 1123 C C   . LYS A 1 147 ? 22.847 32.779 50.106 1.00 16.88 ? 142 LYS L C   1 
ATOM 1124 O O   . LYS A 1 147 ? 23.797 33.448 50.535 1.00 19.22 ? 142 LYS L O   1 
ATOM 1125 C CB  . LYS A 1 147 ? 23.638 31.234 48.291 1.00 18.83 ? 142 LYS L CB  1 
ATOM 1126 C CG  . LYS A 1 147 ? 22.719 31.833 47.214 1.00 20.71 ? 142 LYS L CG  1 
ATOM 1127 C CD  . LYS A 1 147 ? 23.149 31.491 45.782 1.00 18.62 ? 142 LYS L CD  1 
ATOM 1128 C CE  . LYS A 1 147 ? 22.223 30.428 45.167 1.00 21.15 ? 142 LYS L CE  1 
ATOM 1129 N NZ  . LYS A 1 147 ? 20.817 30.916 44.996 1.00 23.88 ? 142 LYS L NZ  1 
ATOM 1130 N N   . ASP A 1 148 ? 21.621 33.279 49.953 1.00 16.58 ? 143 ASP L N   1 
ATOM 1131 C CA  . ASP A 1 148 ? 21.320 34.665 50.346 1.00 19.37 ? 143 ASP L CA  1 
ATOM 1132 C C   . ASP A 1 148 ? 21.509 34.762 51.868 1.00 16.81 ? 143 ASP L C   1 
ATOM 1133 O O   . ASP A 1 148 ? 21.010 33.914 52.612 1.00 16.89 ? 143 ASP L O   1 
ATOM 1134 C CB  . ASP A 1 148 ? 19.866 35.052 50.016 1.00 21.46 ? 143 ASP L CB  1 
ATOM 1135 C CG  . ASP A 1 148 ? 19.340 34.378 48.761 1.00 25.26 ? 143 ASP L CG  1 
ATOM 1136 O OD1 . ASP A 1 148 ? 18.539 33.427 48.894 1.00 22.13 ? 143 ASP L OD1 1 
ATOM 1137 O OD2 . ASP A 1 148 ? 19.713 34.804 47.642 1.00 29.78 ? 143 ASP L OD2 1 
ATOM 1138 N N   . ILE A 1 149 ? 22.237 35.773 52.322 1.00 13.92 ? 144 ILE L N   1 
ATOM 1139 C CA  . ILE A 1 149 ? 22.489 35.973 53.750 1.00 16.60 ? 144 ILE L CA  1 
ATOM 1140 C C   . ILE A 1 149 ? 23.277 37.273 53.852 1.00 15.28 ? 144 ILE L C   1 
ATOM 1141 O O   . ILE A 1 149 ? 24.056 37.593 52.961 1.00 14.84 ? 144 ILE L O   1 
ATOM 1142 C CB  . ILE A 1 149 ? 23.343 34.802 54.369 1.00 17.44 ? 144 ILE L CB  1 
ATOM 1143 C CG1 . ILE A 1 149 ? 23.236 34.793 55.889 1.00 12.03 ? 144 ILE L CG1 1 
ATOM 1144 C CG2 . ILE A 1 149 ? 24.833 34.959 54.019 1.00 20.51 ? 144 ILE L CG2 1 
ATOM 1145 C CD1 . ILE A 1 149 ? 24.238 33.915 56.515 1.00 8.55  ? 144 ILE L CD1 1 
ATOM 1146 N N   . ASN A 1 150 ? 23.101 38.024 54.924 1.00 14.73 ? 145 ASN L N   1 
ATOM 1147 C CA  . ASN A 1 150 ? 23.843 39.260 55.019 1.00 19.36 ? 145 ASN L CA  1 
ATOM 1148 C C   . ASN A 1 150 ? 24.407 39.531 56.399 1.00 20.33 ? 145 ASN L C   1 
ATOM 1149 O O   . ASN A 1 150 ? 23.658 39.576 57.391 1.00 18.32 ? 145 ASN L O   1 
ATOM 1150 C CB  . ASN A 1 150 ? 22.966 40.424 54.563 1.00 26.31 ? 145 ASN L CB  1 
ATOM 1151 C CG  . ASN A 1 150 ? 23.775 41.571 53.978 1.00 29.47 ? 145 ASN L CG  1 
ATOM 1152 O OD1 . ASN A 1 150 ? 24.815 41.366 53.324 1.00 29.61 ? 145 ASN L OD1 1 
ATOM 1153 N ND2 . ASN A 1 150 ? 23.296 42.786 54.197 1.00 29.57 ? 145 ASN L ND2 1 
ATOM 1154 N N   . VAL A 1 151 ? 25.728 39.701 56.457 1.00 18.51 ? 146 VAL L N   1 
ATOM 1155 C CA  . VAL A 1 151 ? 26.403 39.974 57.717 1.00 19.44 ? 146 VAL L CA  1 
ATOM 1156 C C   . VAL A 1 151 ? 26.775 41.459 57.859 1.00 20.88 ? 146 VAL L C   1 
ATOM 1157 O O   . VAL A 1 151 ? 27.299 42.078 56.918 1.00 17.39 ? 146 VAL L O   1 
ATOM 1158 C CB  . VAL A 1 151 ? 27.647 39.076 57.917 1.00 17.46 ? 146 VAL L CB  1 
ATOM 1159 C CG1 . VAL A 1 151 ? 28.738 39.457 56.959 1.00 17.01 ? 146 VAL L CG1 1 
ATOM 1160 C CG2 . VAL A 1 151 ? 28.133 39.183 59.347 1.00 18.79 ? 146 VAL L CG2 1 
ATOM 1161 N N   . LYS A 1 152 ? 26.459 42.014 59.035 1.00 21.48 ? 147 LYS L N   1 
ATOM 1162 C CA  . LYS A 1 152 ? 26.719 43.410 59.376 1.00 18.64 ? 147 LYS L CA  1 
ATOM 1163 C C   . LYS A 1 152 ? 27.706 43.496 60.532 1.00 18.68 ? 147 LYS L C   1 
ATOM 1164 O O   . LYS A 1 152 ? 27.572 42.759 61.510 1.00 17.74 ? 147 LYS L O   1 
ATOM 1165 C CB  . LYS A 1 152 ? 25.420 44.088 59.820 1.00 18.14 ? 147 LYS L CB  1 
ATOM 1166 C CG  . LYS A 1 152 ? 24.529 44.565 58.684 1.00 23.62 ? 147 LYS L CG  1 
ATOM 1167 C CD  . LYS A 1 152 ? 23.666 45.781 59.071 1.00 22.62 ? 147 LYS L CD  1 
ATOM 1168 C CE  . LYS A 1 152 ? 24.416 46.778 59.984 1.00 25.48 ? 147 LYS L CE  1 
ATOM 1169 N NZ  . LYS A 1 152 ? 25.875 47.007 59.696 1.00 19.62 ? 147 LYS L NZ  1 
ATOM 1170 N N   . TRP A 1 153 ? 28.710 44.360 60.416 1.00 18.63 ? 148 TRP L N   1 
ATOM 1171 C CA  . TRP A 1 153 ? 29.672 44.542 61.506 1.00 17.15 ? 148 TRP L CA  1 
ATOM 1172 C C   . TRP A 1 153 ? 29.215 45.749 62.320 1.00 15.30 ? 148 TRP L C   1 
ATOM 1173 O O   . TRP A 1 153 ? 28.707 46.732 61.767 1.00 11.01 ? 148 TRP L O   1 
ATOM 1174 C CB  . TRP A 1 153 ? 31.103 44.773 60.995 1.00 15.81 ? 148 TRP L CB  1 
ATOM 1175 C CG  . TRP A 1 153 ? 31.762 43.542 60.423 1.00 14.35 ? 148 TRP L CG  1 
ATOM 1176 C CD1 . TRP A 1 153 ? 31.768 43.148 59.114 1.00 12.84 ? 148 TRP L CD1 1 
ATOM 1177 C CD2 . TRP A 1 153 ? 32.533 42.569 61.138 1.00 10.59 ? 148 TRP L CD2 1 
ATOM 1178 N NE1 . TRP A 1 153 ? 32.507 42.001 58.970 1.00 11.75 ? 148 TRP L NE1 1 
ATOM 1179 C CE2 . TRP A 1 153 ? 32.989 41.621 60.194 1.00 10.98 ? 148 TRP L CE2 1 
ATOM 1180 C CE3 . TRP A 1 153 ? 32.887 42.404 62.477 1.00 6.30  ? 148 TRP L CE3 1 
ATOM 1181 C CZ2 . TRP A 1 153 ? 33.781 40.526 60.556 1.00 8.07  ? 148 TRP L CZ2 1 
ATOM 1182 C CZ3 . TRP A 1 153 ? 33.669 41.316 62.827 1.00 5.04  ? 148 TRP L CZ3 1 
ATOM 1183 C CH2 . TRP A 1 153 ? 34.108 40.394 61.870 1.00 3.65  ? 148 TRP L CH2 1 
ATOM 1184 N N   . LYS A 1 154 ? 29.397 45.670 63.632 1.00 15.02 ? 149 LYS L N   1 
ATOM 1185 C CA  . LYS A 1 154 ? 28.992 46.740 64.512 1.00 18.20 ? 149 LYS L CA  1 
ATOM 1186 C C   . LYS A 1 154 ? 30.002 46.967 65.600 1.00 19.36 ? 149 LYS L C   1 
ATOM 1187 O O   . LYS A 1 154 ? 30.071 46.206 66.577 1.00 24.01 ? 149 LYS L O   1 
ATOM 1188 C CB  . LYS A 1 154 ? 27.652 46.428 65.172 1.00 24.21 ? 149 LYS L CB  1 
ATOM 1189 C CG  . LYS A 1 154 ? 26.458 46.545 64.269 1.00 27.66 ? 149 LYS L CG  1 
ATOM 1190 C CD  . LYS A 1 154 ? 25.202 46.685 65.094 1.00 32.43 ? 149 LYS L CD  1 
ATOM 1191 C CE  . LYS A 1 154 ? 24.043 47.130 64.225 1.00 36.16 ? 149 LYS L CE  1 
ATOM 1192 N NZ  . LYS A 1 154 ? 22.822 47.379 65.030 1.00 39.35 ? 149 LYS L NZ  1 
ATOM 1193 N N   . ILE A 1 155 ? 30.787 48.018 65.447 1.00 15.86 ? 150 ILE L N   1 
ATOM 1194 C CA  . ILE A 1 155 ? 31.773 48.339 66.452 1.00 12.45 ? 150 ILE L CA  1 
ATOM 1195 C C   . ILE A 1 155 ? 31.116 49.226 67.496 1.00 12.41 ? 150 ILE L C   1 
ATOM 1196 O O   . ILE A 1 155 ? 30.413 50.179 67.172 1.00 12.23 ? 150 ILE L O   1 
ATOM 1197 C CB  . ILE A 1 155 ? 32.940 49.067 65.840 1.00 8.84  ? 150 ILE L CB  1 
ATOM 1198 C CG1 . ILE A 1 155 ? 33.443 48.275 64.637 1.00 7.23  ? 150 ILE L CG1 1 
ATOM 1199 C CG2 . ILE A 1 155 ? 34.027 49.205 66.867 1.00 9.53  ? 150 ILE L CG2 1 
ATOM 1200 C CD1 . ILE A 1 155 ? 34.497 48.975 63.830 1.00 8.83  ? 150 ILE L CD1 1 
ATOM 1201 N N   . ASP A 1 156 ? 31.307 48.875 68.754 1.00 13.92 ? 151 ASP L N   1 
ATOM 1202 C CA  . ASP A 1 156 ? 30.744 49.631 69.874 1.00 19.54 ? 151 ASP L CA  1 
ATOM 1203 C C   . ASP A 1 156 ? 29.239 50.038 69.741 1.00 19.96 ? 151 ASP L C   1 
ATOM 1204 O O   . ASP A 1 156 ? 28.800 51.084 70.223 1.00 23.96 ? 151 ASP L O   1 
ATOM 1205 C CB  . ASP A 1 156 ? 31.655 50.841 70.202 1.00 20.66 ? 151 ASP L CB  1 
ATOM 1206 C CG  . ASP A 1 156 ? 32.938 50.452 70.977 1.00 18.53 ? 151 ASP L CG  1 
ATOM 1207 O OD1 . ASP A 1 156 ? 33.302 49.258 71.016 1.00 14.59 ? 151 ASP L OD1 1 
ATOM 1208 O OD2 . ASP A 1 156 ? 33.581 51.369 71.554 1.00 17.93 ? 151 ASP L OD2 1 
ATOM 1209 N N   . GLY A 1 157 ? 28.447 49.162 69.138 1.00 22.23 ? 152 GLY L N   1 
ATOM 1210 C CA  . GLY A 1 157 ? 27.028 49.424 68.963 1.00 19.17 ? 152 GLY L CA  1 
ATOM 1211 C C   . GLY A 1 157 ? 26.786 49.968 67.574 1.00 21.50 ? 152 GLY L C   1 
ATOM 1212 O O   . GLY A 1 157 ? 25.771 49.689 66.931 1.00 20.79 ? 152 GLY L O   1 
ATOM 1213 N N   . SER A 1 158 ? 27.793 50.681 67.087 1.00 20.46 ? 153 SER L N   1 
ATOM 1214 C CA  . SER A 1 158 ? 27.759 51.334 65.793 1.00 16.58 ? 153 SER L CA  1 
ATOM 1215 C C   . SER A 1 158 ? 28.082 50.377 64.668 1.00 13.29 ? 153 SER L C   1 
ATOM 1216 O O   . SER A 1 158 ? 28.976 49.548 64.794 1.00 2.91  ? 153 SER L O   1 
ATOM 1217 C CB  . SER A 1 158 ? 28.779 52.481 65.817 1.00 21.24 ? 153 SER L CB  1 
ATOM 1218 O OG  . SER A 1 158 ? 28.500 53.484 64.852 1.00 26.47 ? 153 SER L OG  1 
ATOM 1219 N N   . GLU A 1 159 ? 27.356 50.509 63.560 1.00 17.64 ? 154 GLU L N   1 
ATOM 1220 C CA  . GLU A 1 159 ? 27.580 49.667 62.371 1.00 19.67 ? 154 GLU L CA  1 
ATOM 1221 C C   . GLU A 1 159 ? 28.772 50.128 61.540 1.00 15.12 ? 154 GLU L C   1 
ATOM 1222 O O   . GLU A 1 159 ? 28.866 51.290 61.141 1.00 12.19 ? 154 GLU L O   1 
ATOM 1223 C CB  . GLU A 1 159 ? 26.331 49.608 61.494 1.00 19.15 ? 154 GLU L CB  1 
ATOM 1224 C CG  . GLU A 1 159 ? 25.805 50.955 61.079 1.00 22.90 ? 154 GLU L CG  1 
ATOM 1225 C CD  . GLU A 1 159 ? 24.410 50.847 60.522 1.00 23.90 ? 154 GLU L CD  1 
ATOM 1226 O OE1 . GLU A 1 159 ? 23.523 51.572 61.028 1.00 23.70 ? 154 GLU L OE1 1 
ATOM 1227 O OE2 . GLU A 1 159 ? 24.199 50.014 59.605 1.00 23.56 ? 154 GLU L OE2 1 
ATOM 1228 N N   . ARG A 1 160 ? 29.688 49.210 61.292 1.00 14.03 ? 155 ARG L N   1 
ATOM 1229 C CA  . ARG A 1 160 ? 30.865 49.542 60.530 1.00 19.61 ? 155 ARG L CA  1 
ATOM 1230 C C   . ARG A 1 160 ? 30.683 49.130 59.075 1.00 23.51 ? 155 ARG L C   1 
ATOM 1231 O O   . ARG A 1 160 ? 30.773 47.950 58.683 1.00 23.45 ? 155 ARG L O   1 
ATOM 1232 C CB  . ARG A 1 160 ? 32.107 48.928 61.161 1.00 21.78 ? 155 ARG L CB  1 
ATOM 1233 C CG  . ARG A 1 160 ? 33.407 49.330 60.535 1.00 24.94 ? 155 ARG L CG  1 
ATOM 1234 C CD  . ARG A 1 160 ? 33.635 50.825 60.515 1.00 29.46 ? 155 ARG L CD  1 
ATOM 1235 N NE  . ARG A 1 160 ? 34.947 51.090 59.923 1.00 33.29 ? 155 ARG L NE  1 
ATOM 1236 C CZ  . ARG A 1 160 ? 35.994 51.561 60.597 1.00 35.49 ? 155 ARG L CZ  1 
ATOM 1237 N NH1 . ARG A 1 160 ? 35.899 51.855 61.894 1.00 37.12 ? 155 ARG L NH1 1 
ATOM 1238 N NH2 . ARG A 1 160 ? 37.173 51.632 60.001 1.00 38.14 ? 155 ARG L NH2 1 
ATOM 1239 N N   . GLN A 1 161 ? 30.373 50.155 58.297 1.00 22.99 ? 156 GLN L N   1 
ATOM 1240 C CA  . GLN A 1 161 ? 30.132 50.059 56.880 1.00 21.62 ? 156 GLN L CA  1 
ATOM 1241 C C   . GLN A 1 161 ? 31.339 49.695 56.027 1.00 21.29 ? 156 GLN L C   1 
ATOM 1242 O O   . GLN A 1 161 ? 31.191 48.948 55.066 1.00 22.33 ? 156 GLN L O   1 
ATOM 1243 C CB  . GLN A 1 161 ? 29.559 51.378 56.386 1.00 20.06 ? 156 GLN L CB  1 
ATOM 1244 C CG  . GLN A 1 161 ? 30.418 52.574 56.706 1.00 20.53 ? 156 GLN L CG  1 
ATOM 1245 C CD  . GLN A 1 161 ? 30.361 52.970 58.152 1.00 19.34 ? 156 GLN L CD  1 
ATOM 1246 O OE1 . GLN A 1 161 ? 31.346 52.840 58.875 1.00 21.17 ? 156 GLN L OE1 1 
ATOM 1247 N NE2 . GLN A 1 161 ? 29.202 53.427 58.594 1.00 17.59 ? 156 GLN L NE2 1 
ATOM 1248 N N   . ASN A 1 162 ? 32.515 50.235 56.337 1.00 20.63 ? 157 ASN L N   1 
ATOM 1249 C CA  . ASN A 1 162 ? 33.684 49.946 55.511 1.00 22.21 ? 157 ASN L CA  1 
ATOM 1250 C C   . ASN A 1 162 ? 34.900 49.336 56.198 1.00 19.91 ? 157 ASN L C   1 
ATOM 1251 O O   . ASN A 1 162 ? 35.167 49.595 57.370 1.00 21.11 ? 157 ASN L O   1 
ATOM 1252 C CB  . ASN A 1 162 ? 34.100 51.198 54.746 1.00 27.26 ? 157 ASN L CB  1 
ATOM 1253 C CG  . ASN A 1 162 ? 34.667 52.273 55.650 1.00 31.06 ? 157 ASN L CG  1 
ATOM 1254 O OD1 . ASN A 1 162 ? 35.869 52.267 55.958 1.00 32.57 ? 157 ASN L OD1 1 
ATOM 1255 N ND2 . ASN A 1 162 ? 33.818 53.224 56.054 1.00 27.97 ? 157 ASN L ND2 1 
ATOM 1256 N N   . GLY A 1 163 ? 35.661 48.573 55.417 1.00 15.45 ? 158 GLY L N   1 
ATOM 1257 C CA  . GLY A 1 163 ? 36.845 47.897 55.913 1.00 9.30  ? 158 GLY L CA  1 
ATOM 1258 C C   . GLY A 1 163 ? 36.692 46.393 55.736 1.00 10.77 ? 158 GLY L C   1 
ATOM 1259 O O   . GLY A 1 163 ? 37.665 45.641 55.827 1.00 11.86 ? 158 GLY L O   1 
ATOM 1260 N N   . VAL A 1 164 ? 35.471 45.952 55.439 1.00 7.59  ? 159 VAL L N   1 
ATOM 1261 C CA  . VAL A 1 164 ? 35.170 44.533 55.274 1.00 2.57  ? 159 VAL L CA  1 
ATOM 1262 C C   . VAL A 1 164 ? 35.332 43.995 53.865 1.00 4.31  ? 159 VAL L C   1 
ATOM 1263 O O   . VAL A 1 164 ? 34.921 44.634 52.898 1.00 6.45  ? 159 VAL L O   1 
ATOM 1264 C CB  . VAL A 1 164 ? 33.726 44.237 55.709 1.00 2.00  ? 159 VAL L CB  1 
ATOM 1265 C CG1 . VAL A 1 164 ? 33.482 42.745 55.805 1.00 2.00  ? 159 VAL L CG1 1 
ATOM 1266 C CG2 . VAL A 1 164 ? 33.449 44.917 57.016 1.00 6.31  ? 159 VAL L CG2 1 
ATOM 1267 N N   . LEU A 1 165 ? 35.956 42.831 53.747 1.00 4.19  ? 160 LEU L N   1 
ATOM 1268 C CA  . LEU A 1 165 ? 36.092 42.164 52.456 1.00 6.37  ? 160 LEU L CA  1 
ATOM 1269 C C   . LEU A 1 165 ? 35.459 40.819 52.739 1.00 10.43 ? 160 LEU L C   1 
ATOM 1270 O O   . LEU A 1 165 ? 35.778 40.206 53.751 1.00 12.99 ? 160 LEU L O   1 
ATOM 1271 C CB  . LEU A 1 165 ? 37.545 41.974 52.033 1.00 7.30  ? 160 LEU L CB  1 
ATOM 1272 C CG  . LEU A 1 165 ? 38.216 43.114 51.252 1.00 12.14 ? 160 LEU L CG  1 
ATOM 1273 C CD1 . LEU A 1 165 ? 38.409 44.355 52.110 1.00 13.91 ? 160 LEU L CD1 1 
ATOM 1274 C CD2 . LEU A 1 165 ? 39.572 42.649 50.745 1.00 14.42 ? 160 LEU L CD2 1 
ATOM 1275 N N   . ASN A 1 166 ? 34.477 40.434 51.923 1.00 12.04 ? 161 ASN L N   1 
ATOM 1276 C CA  . ASN A 1 166 ? 33.753 39.163 52.064 1.00 9.61  ? 161 ASN L CA  1 
ATOM 1277 C C   . ASN A 1 166 ? 34.284 38.149 51.057 1.00 9.41  ? 161 ASN L C   1 
ATOM 1278 O O   . ASN A 1 166 ? 34.979 38.526 50.113 1.00 16.83 ? 161 ASN L O   1 
ATOM 1279 C CB  . ASN A 1 166 ? 32.262 39.382 51.805 1.00 8.26  ? 161 ASN L CB  1 
ATOM 1280 C CG  . ASN A 1 166 ? 31.601 40.279 52.854 1.00 12.53 ? 161 ASN L CG  1 
ATOM 1281 O OD1 . ASN A 1 166 ? 32.041 40.351 54.016 1.00 9.05  ? 161 ASN L OD1 1 
ATOM 1282 N ND2 . ASN A 1 166 ? 30.527 40.955 52.451 1.00 11.38 ? 161 ASN L ND2 1 
ATOM 1283 N N   . SER A 1 167 ? 33.986 36.870 51.246 1.00 2.95  ? 162 SER L N   1 
ATOM 1284 C CA  . SER A 1 167 ? 34.437 35.864 50.297 1.00 2.42  ? 162 SER L CA  1 
ATOM 1285 C C   . SER A 1 167 ? 33.602 34.599 50.417 1.00 4.65  ? 162 SER L C   1 
ATOM 1286 O O   . SER A 1 167 ? 33.609 33.937 51.445 1.00 9.29  ? 162 SER L O   1 
ATOM 1287 C CB  . SER A 1 167 ? 35.920 35.574 50.464 1.00 2.00  ? 162 SER L CB  1 
ATOM 1288 O OG  . SER A 1 167 ? 36.224 34.318 49.882 1.00 4.81  ? 162 SER L OG  1 
ATOM 1289 N N   . TRP A 1 168 ? 32.900 34.264 49.342 1.00 5.54  ? 163 TRP L N   1 
ATOM 1290 C CA  . TRP A 1 168 ? 31.985 33.132 49.307 1.00 7.19  ? 163 TRP L CA  1 
ATOM 1291 C C   . TRP A 1 168 ? 32.399 31.747 48.789 1.00 8.81  ? 163 TRP L C   1 
ATOM 1292 O O   . TRP A 1 168 ? 33.008 31.598 47.728 1.00 3.61  ? 163 TRP L O   1 
ATOM 1293 C CB  . TRP A 1 168 ? 30.750 33.555 48.530 1.00 9.56  ? 163 TRP L CB  1 
ATOM 1294 C CG  . TRP A 1 168 ? 29.845 34.543 49.199 1.00 11.02 ? 163 TRP L CG  1 
ATOM 1295 C CD1 . TRP A 1 168 ? 28.679 34.264 49.877 1.00 11.60 ? 163 TRP L CD1 1 
ATOM 1296 C CD2 . TRP A 1 168 ? 29.934 35.984 49.142 1.00 10.24 ? 163 TRP L CD2 1 
ATOM 1297 N NE1 . TRP A 1 168 ? 28.038 35.435 50.222 1.00 13.67 ? 163 TRP L NE1 1 
ATOM 1298 C CE2 . TRP A 1 168 ? 28.786 36.501 49.787 1.00 10.90 ? 163 TRP L CE2 1 
ATOM 1299 C CE3 . TRP A 1 168 ? 30.870 36.872 48.589 1.00 7.09  ? 163 TRP L CE3 1 
ATOM 1300 C CZ2 . TRP A 1 168 ? 28.543 37.873 49.901 1.00 3.82  ? 163 TRP L CZ2 1 
ATOM 1301 C CZ3 . TRP A 1 168 ? 30.622 38.232 48.701 1.00 6.19  ? 163 TRP L CZ3 1 
ATOM 1302 C CH2 . TRP A 1 168 ? 29.464 38.717 49.354 1.00 5.09  ? 163 TRP L CH2 1 
ATOM 1303 N N   . THR A 1 169 ? 31.957 30.723 49.505 1.00 13.90 ? 164 THR L N   1 
ATOM 1304 C CA  . THR A 1 169 ? 32.214 29.338 49.107 1.00 17.41 ? 164 THR L CA  1 
ATOM 1305 C C   . THR A 1 169 ? 31.159 29.073 48.019 1.00 18.34 ? 164 THR L C   1 
ATOM 1306 O O   . THR A 1 169 ? 30.198 29.850 47.892 1.00 17.16 ? 164 THR L O   1 
ATOM 1307 C CB  . THR A 1 169 ? 31.960 28.337 50.314 1.00 14.75 ? 164 THR L CB  1 
ATOM 1308 O OG1 . THR A 1 169 ? 32.851 28.639 51.387 1.00 14.77 ? 164 THR L OG1 1 
ATOM 1309 C CG2 . THR A 1 169 ? 32.204 26.887 49.917 1.00 10.04 ? 164 THR L CG2 1 
ATOM 1310 N N   . ASP A 1 170 ? 31.373 28.047 47.192 1.00 17.85 ? 165 ASP L N   1 
ATOM 1311 C CA  . ASP A 1 170 ? 30.387 27.689 46.176 1.00 15.67 ? 165 ASP L CA  1 
ATOM 1312 C C   . ASP A 1 170 ? 29.576 26.617 46.867 1.00 12.66 ? 165 ASP L C   1 
ATOM 1313 O O   . ASP A 1 170 ? 29.868 26.263 48.005 1.00 16.16 ? 165 ASP L O   1 
ATOM 1314 C CB  . ASP A 1 170 ? 31.057 27.121 44.925 1.00 22.67 ? 165 ASP L CB  1 
ATOM 1315 C CG  . ASP A 1 170 ? 30.303 27.460 43.631 1.00 26.34 ? 165 ASP L CG  1 
ATOM 1316 O OD1 . ASP A 1 170 ? 29.205 26.903 43.372 1.00 28.75 ? 165 ASP L OD1 1 
ATOM 1317 O OD2 . ASP A 1 170 ? 30.841 28.276 42.855 1.00 27.77 ? 165 ASP L OD2 1 
ATOM 1318 N N   . GLN A 1 171 ? 28.579 26.069 46.197 1.00 12.30 ? 166 GLN L N   1 
ATOM 1319 C CA  . GLN A 1 171 ? 27.767 25.053 46.844 1.00 15.67 ? 166 GLN L CA  1 
ATOM 1320 C C   . GLN A 1 171 ? 28.650 23.975 47.417 1.00 12.76 ? 166 GLN L C   1 
ATOM 1321 O O   . GLN A 1 171 ? 29.441 23.377 46.696 1.00 13.64 ? 166 GLN L O   1 
ATOM 1322 C CB  . GLN A 1 171 ? 26.748 24.452 45.876 1.00 17.03 ? 166 GLN L CB  1 
ATOM 1323 C CG  . GLN A 1 171 ? 25.524 23.854 46.566 1.00 18.91 ? 166 GLN L CG  1 
ATOM 1324 C CD  . GLN A 1 171 ? 24.382 23.519 45.599 1.00 20.43 ? 166 GLN L CD  1 
ATOM 1325 O OE1 . GLN A 1 171 ? 23.219 23.425 46.000 1.00 20.85 ? 166 GLN L OE1 1 
ATOM 1326 N NE2 . GLN A 1 171 ? 24.716 23.311 44.325 1.00 20.43 ? 166 GLN L NE2 1 
ATOM 1327 N N   . ASP A 1 172 ? 28.671 23.902 48.739 1.00 12.07 ? 167 ASP L N   1 
ATOM 1328 C CA  . ASP A 1 172 ? 29.430 22.881 49.433 1.00 19.52 ? 167 ASP L CA  1 
ATOM 1329 C C   . ASP A 1 172 ? 29.137 21.536 48.754 1.00 18.66 ? 167 ASP L C   1 
ATOM 1330 O O   . ASP A 1 172 ? 27.969 21.166 48.573 1.00 20.69 ? 167 ASP L O   1 
ATOM 1331 C CB  . ASP A 1 172 ? 29.000 22.823 50.911 1.00 26.51 ? 167 ASP L CB  1 
ATOM 1332 C CG  . ASP A 1 172 ? 29.871 23.681 51.832 1.00 27.72 ? 167 ASP L CG  1 
ATOM 1333 O OD1 . ASP A 1 172 ? 29.357 24.124 52.893 1.00 23.18 ? 167 ASP L OD1 1 
ATOM 1334 O OD2 . ASP A 1 172 ? 31.065 23.882 51.508 1.00 31.76 ? 167 ASP L OD2 1 
ATOM 1335 N N   . SER A 1 173 ? 30.181 20.784 48.424 1.00 15.02 ? 168 SER L N   1 
ATOM 1336 C CA  . SER A 1 173 ? 29.983 19.519 47.732 1.00 18.44 ? 168 SER L CA  1 
ATOM 1337 C C   . SER A 1 173 ? 29.404 18.391 48.567 1.00 17.27 ? 168 SER L C   1 
ATOM 1338 O O   . SER A 1 173 ? 28.484 17.702 48.123 1.00 19.67 ? 168 SER L O   1 
ATOM 1339 C CB  . SER A 1 173 ? 31.271 19.058 47.034 1.00 19.31 ? 168 SER L CB  1 
ATOM 1340 O OG  . SER A 1 173 ? 32.368 19.039 47.923 1.00 21.02 ? 168 SER L OG  1 
ATOM 1341 N N   . LYS A 1 174 ? 29.898 18.239 49.788 1.00 12.75 ? 169 LYS L N   1 
ATOM 1342 C CA  . LYS A 1 174 ? 29.451 17.172 50.654 1.00 7.15  ? 169 LYS L CA  1 
ATOM 1343 C C   . LYS A 1 174 ? 27.963 17.230 50.970 1.00 6.21  ? 169 LYS L C   1 
ATOM 1344 O O   . LYS A 1 174 ? 27.303 16.203 51.094 1.00 2.00  ? 169 LYS L O   1 
ATOM 1345 C CB  . LYS A 1 174 ? 30.281 17.194 51.927 1.00 7.16  ? 169 LYS L CB  1 
ATOM 1346 C CG  . LYS A 1 174 ? 31.774 17.129 51.681 1.00 10.00 ? 169 LYS L CG  1 
ATOM 1347 C CD  . LYS A 1 174 ? 32.529 17.548 52.938 1.00 17.46 ? 169 LYS L CD  1 
ATOM 1348 C CE  . LYS A 1 174 ? 34.067 17.630 52.739 1.00 22.01 ? 169 LYS L CE  1 
ATOM 1349 N NZ  . LYS A 1 174 ? 34.817 18.284 53.890 1.00 20.35 ? 169 LYS L NZ  1 
ATOM 1350 N N   . ASP A 1 175 ? 27.409 18.434 51.002 1.00 8.28  ? 170 ASP L N   1 
ATOM 1351 C CA  . ASP A 1 175 ? 26.001 18.571 51.354 1.00 7.95  ? 170 ASP L CA  1 
ATOM 1352 C C   . ASP A 1 175 ? 25.147 19.599 50.630 1.00 7.64  ? 170 ASP L C   1 
ATOM 1353 O O   . ASP A 1 175 ? 24.039 19.857 51.095 1.00 11.03 ? 170 ASP L O   1 
ATOM 1354 C CB  . ASP A 1 175 ? 25.887 18.869 52.844 1.00 6.53  ? 170 ASP L CB  1 
ATOM 1355 C CG  . ASP A 1 175 ? 26.567 20.164 53.221 1.00 6.33  ? 170 ASP L CG  1 
ATOM 1356 O OD1 . ASP A 1 175 ? 26.862 20.962 52.309 1.00 2.00  ? 170 ASP L OD1 1 
ATOM 1357 O OD2 . ASP A 1 175 ? 26.809 20.379 54.429 1.00 8.21  ? 170 ASP L OD2 1 
ATOM 1358 N N   . SER A 1 176 ? 25.662 20.241 49.580 1.00 5.32  ? 171 SER L N   1 
ATOM 1359 C CA  . SER A 1 176 ? 24.885 21.247 48.829 1.00 6.71  ? 171 SER L CA  1 
ATOM 1360 C C   . SER A 1 176 ? 24.649 22.621 49.545 1.00 5.86  ? 171 SER L C   1 
ATOM 1361 O O   . SER A 1 176 ? 23.955 23.522 49.043 1.00 2.00  ? 171 SER L O   1 
ATOM 1362 C CB  . SER A 1 176 ? 23.546 20.634 48.393 1.00 5.79  ? 171 SER L CB  1 
ATOM 1363 O OG  . SER A 1 176 ? 23.647 19.224 48.227 1.00 9.18  ? 171 SER L OG  1 
ATOM 1364 N N   . THR A 1 177 ? 25.258 22.785 50.708 1.00 3.80  ? 172 THR L N   1 
ATOM 1365 C CA  . THR A 1 177 ? 25.114 24.019 51.423 1.00 3.21  ? 172 THR L CA  1 
ATOM 1366 C C   . THR A 1 177 ? 26.082 25.054 50.866 1.00 5.55  ? 172 THR L C   1 
ATOM 1367 O O   . THR A 1 177 ? 26.715 24.844 49.831 1.00 2.00  ? 172 THR L O   1 
ATOM 1368 C CB  . THR A 1 177 ? 25.366 23.835 52.937 1.00 5.24  ? 172 THR L CB  1 
ATOM 1369 O OG1 . THR A 1 177 ? 26.744 23.548 53.194 1.00 2.00  ? 172 THR L OG1 1 
ATOM 1370 C CG2 . THR A 1 177 ? 24.498 22.735 53.474 1.00 7.73  ? 172 THR L CG2 1 
ATOM 1371 N N   . TYR A 1 178 ? 26.169 26.179 51.566 1.00 8.41  ? 173 TYR L N   1 
ATOM 1372 C CA  . TYR A 1 178 ? 27.043 27.289 51.226 1.00 9.91  ? 173 TYR L CA  1 
ATOM 1373 C C   . TYR A 1 178 ? 27.677 27.754 52.556 1.00 14.57 ? 173 TYR L C   1 
ATOM 1374 O O   . TYR A 1 178 ? 27.153 27.460 53.654 1.00 12.87 ? 173 TYR L O   1 
ATOM 1375 C CB  . TYR A 1 178 ? 26.236 28.439 50.610 1.00 9.03  ? 173 TYR L CB  1 
ATOM 1376 C CG  . TYR A 1 178 ? 25.643 28.136 49.257 1.00 10.52 ? 173 TYR L CG  1 
ATOM 1377 C CD1 . TYR A 1 178 ? 26.416 28.224 48.111 1.00 10.94 ? 173 TYR L CD1 1 
ATOM 1378 C CD2 . TYR A 1 178 ? 24.307 27.768 49.118 1.00 9.95  ? 173 TYR L CD2 1 
ATOM 1379 C CE1 . TYR A 1 178 ? 25.879 27.953 46.853 1.00 9.86  ? 173 TYR L CE1 1 
ATOM 1380 C CE2 . TYR A 1 178 ? 23.761 27.491 47.868 1.00 7.93  ? 173 TYR L CE2 1 
ATOM 1381 C CZ  . TYR A 1 178 ? 24.553 27.590 46.735 1.00 8.19  ? 173 TYR L CZ  1 
ATOM 1382 O OH  . TYR A 1 178 ? 24.027 27.358 45.474 1.00 7.57  ? 173 TYR L OH  1 
ATOM 1383 N N   . SER A 1 179 ? 28.800 28.471 52.460 1.00 12.17 ? 174 SER L N   1 
ATOM 1384 C CA  . SER A 1 179 ? 29.505 28.978 53.629 1.00 6.48  ? 174 SER L CA  1 
ATOM 1385 C C   . SER A 1 179 ? 30.133 30.304 53.241 1.00 3.52  ? 174 SER L C   1 
ATOM 1386 O O   . SER A 1 179 ? 30.239 30.583 52.054 1.00 4.84  ? 174 SER L O   1 
ATOM 1387 C CB  . SER A 1 179 ? 30.528 27.950 54.069 1.00 8.74  ? 174 SER L CB  1 
ATOM 1388 O OG  . SER A 1 179 ? 29.900 26.673 54.229 1.00 2.00  ? 174 SER L OG  1 
ATOM 1389 N N   . MET A 1 180 ? 30.568 31.112 54.203 1.00 3.24  ? 175 MET L N   1 
ATOM 1390 C CA  . MET A 1 180 ? 31.107 32.440 53.865 1.00 2.35  ? 175 MET L CA  1 
ATOM 1391 C C   . MET A 1 180 ? 31.892 33.142 54.969 1.00 4.86  ? 175 MET L C   1 
ATOM 1392 O O   . MET A 1 180 ? 31.549 33.010 56.143 1.00 13.20 ? 175 MET L O   1 
ATOM 1393 C CB  . MET A 1 180 ? 29.941 33.354 53.474 1.00 2.00  ? 175 MET L CB  1 
ATOM 1394 C CG  . MET A 1 180 ? 30.252 34.845 53.493 1.00 5.05  ? 175 MET L CG  1 
ATOM 1395 S SD  . MET A 1 180 ? 28.814 35.884 53.746 1.00 4.32  ? 175 MET L SD  1 
ATOM 1396 C CE  . MET A 1 180 ? 29.506 37.503 53.679 1.00 2.73  ? 175 MET L CE  1 
ATOM 1397 N N   . SER A 1 181 ? 32.912 33.921 54.609 1.00 2.21  ? 176 SER L N   1 
ATOM 1398 C CA  . SER A 1 181 ? 33.650 34.664 55.625 1.00 2.73  ? 176 SER L CA  1 
ATOM 1399 C C   . SER A 1 181 ? 33.545 36.162 55.365 1.00 5.66  ? 176 SER L C   1 
ATOM 1400 O O   . SER A 1 181 ? 33.520 36.611 54.221 1.00 4.87  ? 176 SER L O   1 
ATOM 1401 C CB  . SER A 1 181 ? 35.106 34.240 55.719 1.00 2.00  ? 176 SER L CB  1 
ATOM 1402 O OG  . SER A 1 181 ? 35.783 34.439 54.503 1.00 2.50  ? 176 SER L OG  1 
ATOM 1403 N N   . SER A 1 182 ? 33.457 36.910 56.453 1.00 7.05  ? 177 SER L N   1 
ATOM 1404 C CA  . SER A 1 182 ? 33.329 38.353 56.463 1.00 5.85  ? 177 SER L CA  1 
ATOM 1405 C C   . SER A 1 182 ? 34.451 38.843 57.395 1.00 4.36  ? 177 SER L C   1 
ATOM 1406 O O   . SER A 1 182 ? 34.460 38.535 58.596 1.00 2.00  ? 177 SER L O   1 
ATOM 1407 C CB  . SER A 1 182 ? 31.940 38.694 57.019 1.00 6.37  ? 177 SER L CB  1 
ATOM 1408 O OG  . SER A 1 182 ? 31.768 40.070 57.322 1.00 8.87  ? 177 SER L OG  1 
ATOM 1409 N N   . THR A 1 183 ? 35.398 39.581 56.822 1.00 6.06  ? 178 THR L N   1 
ATOM 1410 C CA  . THR A 1 183 ? 36.559 40.101 57.534 1.00 3.62  ? 178 THR L CA  1 
ATOM 1411 C C   . THR A 1 183 ? 36.611 41.609 57.509 1.00 4.64  ? 178 THR L C   1 
ATOM 1412 O O   . THR A 1 183 ? 36.666 42.201 56.428 1.00 9.50  ? 178 THR L O   1 
ATOM 1413 C CB  . THR A 1 183 ? 37.882 39.638 56.874 1.00 4.49  ? 178 THR L CB  1 
ATOM 1414 O OG1 . THR A 1 183 ? 37.905 38.211 56.751 1.00 6.85  ? 178 THR L OG1 1 
ATOM 1415 C CG2 . THR A 1 183 ? 39.084 40.095 57.700 1.00 7.51  ? 178 THR L CG2 1 
ATOM 1416 N N   . LEU A 1 184 ? 36.641 42.209 58.702 1.00 5.29  ? 179 LEU L N   1 
ATOM 1417 C CA  . LEU A 1 184 ? 36.736 43.664 58.912 1.00 2.90  ? 179 LEU L CA  1 
ATOM 1418 C C   . LEU A 1 184 ? 38.204 43.956 59.262 1.00 2.57  ? 179 LEU L C   1 
ATOM 1419 O O   . LEU A 1 184 ? 38.790 43.290 60.123 1.00 3.87  ? 179 LEU L O   1 
ATOM 1420 C CB  . LEU A 1 184 ? 35.835 44.069 60.074 1.00 3.63  ? 179 LEU L CB  1 
ATOM 1421 C CG  . LEU A 1 184 ? 36.160 45.340 60.854 1.00 5.59  ? 179 LEU L CG  1 
ATOM 1422 C CD1 . LEU A 1 184 ? 35.661 46.571 60.073 1.00 8.46  ? 179 LEU L CD1 1 
ATOM 1423 C CD2 . LEU A 1 184 ? 35.518 45.254 62.249 1.00 4.29  ? 179 LEU L CD2 1 
ATOM 1424 N N   . THR A 1 185 ? 38.813 44.923 58.590 1.00 3.44  ? 180 THR L N   1 
ATOM 1425 C CA  . THR A 1 185 ? 40.214 45.212 58.857 1.00 3.22  ? 180 THR L CA  1 
ATOM 1426 C C   . THR A 1 185 ? 40.559 46.656 59.133 1.00 5.40  ? 180 THR L C   1 
ATOM 1427 O O   . THR A 1 185 ? 40.636 47.492 58.226 1.00 4.89  ? 180 THR L O   1 
ATOM 1428 C CB  . THR A 1 185 ? 41.124 44.674 57.730 1.00 2.00  ? 180 THR L CB  1 
ATOM 1429 O OG1 . THR A 1 185 ? 40.990 43.251 57.659 1.00 3.93  ? 180 THR L OG1 1 
ATOM 1430 C CG2 . THR A 1 185 ? 42.567 44.998 57.985 1.00 2.00  ? 180 THR L CG2 1 
ATOM 1431 N N   . LEU A 1 186 ? 40.769 46.930 60.411 1.00 6.84  ? 181 LEU L N   1 
ATOM 1432 C CA  . LEU A 1 186 ? 41.174 48.247 60.837 1.00 7.99  ? 181 LEU L CA  1 
ATOM 1433 C C   . LEU A 1 186 ? 42.691 48.111 61.010 1.00 9.77  ? 181 LEU L C   1 
ATOM 1434 O O   . LEU A 1 186 ? 43.275 47.062 60.736 1.00 7.91  ? 181 LEU L O   1 
ATOM 1435 C CB  . LEU A 1 186 ? 40.582 48.619 62.206 1.00 8.35  ? 181 LEU L CB  1 
ATOM 1436 C CG  . LEU A 1 186 ? 39.420 47.986 62.970 1.00 6.72  ? 181 LEU L CG  1 
ATOM 1437 C CD1 . LEU A 1 186 ? 38.118 48.098 62.181 1.00 9.19  ? 181 LEU L CD1 1 
ATOM 1438 C CD2 . LEU A 1 186 ? 39.761 46.552 63.319 1.00 4.34  ? 181 LEU L CD2 1 
ATOM 1439 N N   . THR A 1 187 ? 43.328 49.183 61.463 1.00 14.77 ? 182 THR L N   1 
ATOM 1440 C CA  . THR A 1 187 ? 44.760 49.168 61.752 1.00 15.17 ? 182 THR L CA  1 
ATOM 1441 C C   . THR A 1 187 ? 44.814 48.946 63.281 1.00 10.51 ? 182 THR L C   1 
ATOM 1442 O O   . THR A 1 187 ? 43.800 49.073 63.972 1.00 9.85  ? 182 THR L O   1 
ATOM 1443 C CB  . THR A 1 187 ? 45.441 50.520 61.416 1.00 15.40 ? 182 THR L CB  1 
ATOM 1444 O OG1 . THR A 1 187 ? 44.928 51.530 62.289 1.00 18.21 ? 182 THR L OG1 1 
ATOM 1445 C CG2 . THR A 1 187 ? 45.191 50.926 59.964 1.00 12.54 ? 182 THR L CG2 1 
ATOM 1446 N N   . LYS A 1 188 ? 45.986 48.657 63.812 1.00 9.24  ? 183 LYS L N   1 
ATOM 1447 C CA  . LYS A 1 188 ? 46.111 48.423 65.241 1.00 12.18 ? 183 LYS L CA  1 
ATOM 1448 C C   . LYS A 1 188 ? 45.491 49.591 65.978 1.00 14.33 ? 183 LYS L C   1 
ATOM 1449 O O   . LYS A 1 188 ? 44.687 49.396 66.880 1.00 20.65 ? 183 LYS L O   1 
ATOM 1450 C CB  . LYS A 1 188 ? 47.578 48.273 65.660 1.00 10.20 ? 183 LYS L CB  1 
ATOM 1451 C CG  . LYS A 1 188 ? 47.812 47.946 67.131 1.00 7.69  ? 183 LYS L CG  1 
ATOM 1452 C CD  . LYS A 1 188 ? 49.311 47.873 67.416 1.00 10.76 ? 183 LYS L CD  1 
ATOM 1453 C CE  . LYS A 1 188 ? 49.619 47.161 68.721 1.00 16.24 ? 183 LYS L CE  1 
ATOM 1454 N NZ  . LYS A 1 188 ? 49.289 47.949 69.946 1.00 21.68 ? 183 LYS L NZ  1 
ATOM 1455 N N   . ASP A 1 189 ? 45.786 50.802 65.527 1.00 13.05 ? 184 ASP L N   1 
ATOM 1456 C CA  . ASP A 1 189 ? 45.258 51.969 66.191 1.00 14.09 ? 184 ASP L CA  1 
ATOM 1457 C C   . ASP A 1 189 ? 43.752 52.059 66.122 1.00 15.16 ? 184 ASP L C   1 
ATOM 1458 O O   . ASP A 1 189 ? 43.121 52.432 67.102 1.00 19.46 ? 184 ASP L O   1 
ATOM 1459 C CB  . ASP A 1 189 ? 45.899 53.236 65.657 1.00 14.06 ? 184 ASP L CB  1 
ATOM 1460 C CG  . ASP A 1 189 ? 45.731 53.370 64.205 1.00 12.86 ? 184 ASP L CG  1 
ATOM 1461 O OD1 . ASP A 1 189 ? 46.647 52.953 63.479 1.00 12.64 ? 184 ASP L OD1 1 
ATOM 1462 O OD2 . ASP A 1 189 ? 44.666 53.868 63.796 1.00 17.99 ? 184 ASP L OD2 1 
ATOM 1463 N N   . GLU A 1 190 ? 43.161 51.732 64.983 1.00 12.69 ? 185 GLU L N   1 
ATOM 1464 C CA  . GLU A 1 190 ? 41.716 51.783 64.911 1.00 13.69 ? 185 GLU L CA  1 
ATOM 1465 C C   . GLU A 1 190 ? 41.146 50.733 65.862 1.00 12.99 ? 185 GLU L C   1 
ATOM 1466 O O   . GLU A 1 190 ? 40.460 51.073 66.818 1.00 11.66 ? 185 GLU L O   1 
ATOM 1467 C CB  . GLU A 1 190 ? 41.236 51.485 63.508 1.00 20.59 ? 185 GLU L CB  1 
ATOM 1468 C CG  . GLU A 1 190 ? 41.692 52.440 62.462 1.00 27.18 ? 185 GLU L CG  1 
ATOM 1469 C CD  . GLU A 1 190 ? 41.249 52.006 61.067 1.00 32.29 ? 185 GLU L CD  1 
ATOM 1470 O OE1 . GLU A 1 190 ? 40.114 52.356 60.649 1.00 35.55 ? 185 GLU L OE1 1 
ATOM 1471 O OE2 . GLU A 1 190 ? 42.044 51.314 60.390 1.00 30.08 ? 185 GLU L OE2 1 
ATOM 1472 N N   . TYR A 1 191 ? 41.485 49.465 65.631 1.00 11.75 ? 186 TYR L N   1 
ATOM 1473 C CA  . TYR A 1 191 ? 40.994 48.361 66.456 1.00 12.60 ? 186 TYR L CA  1 
ATOM 1474 C C   . TYR A 1 191 ? 41.103 48.669 67.946 1.00 13.71 ? 186 TYR L C   1 
ATOM 1475 O O   . TYR A 1 191 ? 40.197 48.385 68.742 1.00 13.60 ? 186 TYR L O   1 
ATOM 1476 C CB  . TYR A 1 191 ? 41.806 47.112 66.174 1.00 11.51 ? 186 TYR L CB  1 
ATOM 1477 C CG  . TYR A 1 191 ? 41.389 45.933 67.017 1.00 14.65 ? 186 TYR L CG  1 
ATOM 1478 C CD1 . TYR A 1 191 ? 40.296 45.169 66.665 1.00 16.33 ? 186 TYR L CD1 1 
ATOM 1479 C CD2 . TYR A 1 191 ? 42.128 45.543 68.126 1.00 16.92 ? 186 TYR L CD2 1 
ATOM 1480 C CE1 . TYR A 1 191 ? 39.949 44.039 67.381 1.00 18.27 ? 186 TYR L CE1 1 
ATOM 1481 C CE2 . TYR A 1 191 ? 41.791 44.411 68.850 1.00 18.27 ? 186 TYR L CE2 1 
ATOM 1482 C CZ  . TYR A 1 191 ? 40.701 43.661 68.463 1.00 18.84 ? 186 TYR L CZ  1 
ATOM 1483 O OH  . TYR A 1 191 ? 40.401 42.493 69.117 1.00 21.06 ? 186 TYR L OH  1 
ATOM 1484 N N   . GLU A 1 192 ? 42.270 49.190 68.302 1.00 11.18 ? 187 GLU L N   1 
ATOM 1485 C CA  . GLU A 1 192 ? 42.608 49.566 69.653 1.00 4.55  ? 187 GLU L CA  1 
ATOM 1486 C C   . GLU A 1 192 ? 41.515 50.478 70.258 1.00 4.56  ? 187 GLU L C   1 
ATOM 1487 O O   . GLU A 1 192 ? 40.919 50.108 71.256 1.00 9.41  ? 187 GLU L O   1 
ATOM 1488 C CB  . GLU A 1 192 ? 44.006 50.211 69.638 1.00 2.00  ? 187 GLU L CB  1 
ATOM 1489 C CG  . GLU A 1 192 ? 44.985 49.708 70.725 1.00 5.00  ? 187 GLU L CG  1 
ATOM 1490 C CD  . GLU A 1 192 ? 45.874 48.493 70.386 1.00 2.00  ? 187 GLU L CD  1 
ATOM 1491 O OE1 . GLU A 1 192 ? 45.541 47.663 69.533 1.00 3.17  ? 187 GLU L OE1 1 
ATOM 1492 O OE2 . GLU A 1 192 ? 46.922 48.348 71.031 1.00 2.00  ? 187 GLU L OE2 1 
ATOM 1493 N N   . ARG A 1 193 ? 41.140 51.559 69.574 1.00 2.00  ? 188 ARG L N   1 
ATOM 1494 C CA  . ARG A 1 193 ? 40.126 52.502 70.066 1.00 2.27  ? 188 ARG L CA  1 
ATOM 1495 C C   . ARG A 1 193 ? 38.749 51.935 70.387 1.00 7.67  ? 188 ARG L C   1 
ATOM 1496 O O   . ARG A 1 193 ? 37.836 52.717 70.655 1.00 5.58  ? 188 ARG L O   1 
ATOM 1497 C CB  . ARG A 1 193 ? 39.873 53.622 69.054 1.00 5.50  ? 188 ARG L CB  1 
ATOM 1498 C CG  . ARG A 1 193 ? 41.050 54.499 68.719 1.00 12.09 ? 188 ARG L CG  1 
ATOM 1499 C CD  . ARG A 1 193 ? 40.823 55.360 67.451 1.00 11.86 ? 188 ARG L CD  1 
ATOM 1500 N NE  . ARG A 1 193 ? 42.097 55.944 67.026 1.00 15.96 ? 188 ARG L NE  1 
ATOM 1501 C CZ  . ARG A 1 193 ? 42.643 55.818 65.817 1.00 21.05 ? 188 ARG L CZ  1 
ATOM 1502 N NH1 . ARG A 1 193 ? 42.022 55.141 64.844 1.00 22.19 ? 188 ARG L NH1 1 
ATOM 1503 N NH2 . ARG A 1 193 ? 43.888 56.252 65.623 1.00 20.11 ? 188 ARG L NH2 1 
ATOM 1504 N N   . HIS A 1 194 ? 38.542 50.618 70.315 1.00 14.27 ? 189 HIS L N   1 
ATOM 1505 C CA  . HIS A 1 194 ? 37.210 50.097 70.608 1.00 16.56 ? 189 HIS L CA  1 
ATOM 1506 C C   . HIS A 1 194 ? 37.085 48.974 71.605 1.00 18.00 ? 189 HIS L C   1 
ATOM 1507 O O   . HIS A 1 194 ? 38.070 48.513 72.148 1.00 16.71 ? 189 HIS L O   1 
ATOM 1508 C CB  . HIS A 1 194 ? 36.473 49.755 69.331 1.00 20.77 ? 189 HIS L CB  1 
ATOM 1509 C CG  . HIS A 1 194 ? 36.295 50.929 68.428 1.00 25.50 ? 189 HIS L CG  1 
ATOM 1510 N ND1 . HIS A 1 194 ? 35.738 52.115 68.855 1.00 25.93 ? 189 HIS L ND1 1 
ATOM 1511 C CD2 . HIS A 1 194 ? 36.670 51.125 67.141 1.00 26.42 ? 189 HIS L CD2 1 
ATOM 1512 C CE1 . HIS A 1 194 ? 35.775 52.997 67.870 1.00 26.05 ? 189 HIS L CE1 1 
ATOM 1513 N NE2 . HIS A 1 194 ? 36.341 52.418 66.819 1.00 27.00 ? 189 HIS L NE2 1 
ATOM 1514 N N   . ASN A 1 195 ? 35.838 48.627 71.910 1.00 19.22 ? 190 ASN L N   1 
ATOM 1515 C CA  . ASN A 1 195 ? 35.500 47.582 72.866 1.00 20.77 ? 190 ASN L CA  1 
ATOM 1516 C C   . ASN A 1 195 ? 34.787 46.377 72.260 1.00 17.51 ? 190 ASN L C   1 
ATOM 1517 O O   . ASN A 1 195 ? 35.327 45.273 72.214 1.00 20.30 ? 190 ASN L O   1 
ATOM 1518 C CB  . ASN A 1 195 ? 34.583 48.150 73.950 1.00 30.59 ? 190 ASN L CB  1 
ATOM 1519 C CG  . ASN A 1 195 ? 35.339 48.757 75.141 1.00 36.75 ? 190 ASN L CG  1 
ATOM 1520 O OD1 . ASN A 1 195 ? 34.717 49.397 76.020 1.00 34.43 ? 190 ASN L OD1 1 
ATOM 1521 N ND2 . ASN A 1 195 ? 36.660 48.557 75.191 1.00 40.76 ? 190 ASN L ND2 1 
ATOM 1522 N N   . SER A 1 196 ? 33.569 46.601 71.789 1.00 10.89 ? 191 SER L N   1 
ATOM 1523 C CA  . SER A 1 196 ? 32.750 45.532 71.241 1.00 8.07  ? 191 SER L CA  1 
ATOM 1524 C C   . SER A 1 196 ? 32.718 45.337 69.722 1.00 5.78  ? 191 SER L C   1 
ATOM 1525 O O   . SER A 1 196 ? 32.608 46.297 68.951 1.00 8.27  ? 191 SER L O   1 
ATOM 1526 C CB  . SER A 1 196 ? 31.305 45.667 71.782 1.00 12.18 ? 191 SER L CB  1 
ATOM 1527 O OG  . SER A 1 196 ? 30.859 47.022 71.926 1.00 8.29  ? 191 SER L OG  1 
ATOM 1528 N N   . TYR A 1 197 ? 32.766 44.089 69.279 1.00 2.00  ? 192 TYR L N   1 
ATOM 1529 C CA  . TYR A 1 197 ? 32.704 43.833 67.842 1.00 2.85  ? 192 TYR L CA  1 
ATOM 1530 C C   . TYR A 1 197 ? 31.660 42.760 67.563 1.00 2.25  ? 192 TYR L C   1 
ATOM 1531 O O   . TYR A 1 197 ? 31.809 41.635 68.030 1.00 2.00  ? 192 TYR L O   1 
ATOM 1532 C CB  . TYR A 1 197 ? 34.084 43.423 67.328 1.00 4.50  ? 192 TYR L CB  1 
ATOM 1533 C CG  . TYR A 1 197 ? 35.103 44.548 67.384 1.00 4.25  ? 192 TYR L CG  1 
ATOM 1534 C CD1 . TYR A 1 197 ? 35.419 45.292 66.239 1.00 3.04  ? 192 TYR L CD1 1 
ATOM 1535 C CD2 . TYR A 1 197 ? 35.740 44.876 68.580 1.00 2.00  ? 192 TYR L CD2 1 
ATOM 1536 C CE1 . TYR A 1 197 ? 36.340 46.328 66.290 1.00 2.00  ? 192 TYR L CE1 1 
ATOM 1537 C CE2 . TYR A 1 197 ? 36.664 45.913 68.642 1.00 2.00  ? 192 TYR L CE2 1 
ATOM 1538 C CZ  . TYR A 1 197 ? 36.965 46.637 67.499 1.00 3.61  ? 192 TYR L CZ  1 
ATOM 1539 O OH  . TYR A 1 197 ? 37.902 47.663 67.557 1.00 2.00  ? 192 TYR L OH  1 
ATOM 1540 N N   . THR A 1 198 ? 30.575 43.125 66.875 1.00 2.00  ? 193 THR L N   1 
ATOM 1541 C CA  . THR A 1 198 ? 29.504 42.178 66.580 1.00 2.53  ? 193 THR L CA  1 
ATOM 1542 C C   . THR A 1 198 ? 29.406 41.937 65.095 1.00 6.32  ? 193 THR L C   1 
ATOM 1543 O O   . THR A 1 198 ? 29.697 42.821 64.283 1.00 4.95  ? 193 THR L O   1 
ATOM 1544 C CB  . THR A 1 198 ? 28.127 42.662 67.077 1.00 2.67  ? 193 THR L CB  1 
ATOM 1545 O OG1 . THR A 1 198 ? 28.272 43.228 68.373 1.00 4.51  ? 193 THR L OG1 1 
ATOM 1546 C CG2 . THR A 1 198 ? 27.129 41.520 67.180 1.00 2.00  ? 193 THR L CG2 1 
ATOM 1547 N N   . CYS A 1 199 ? 28.977 40.719 64.772 1.00 10.52 ? 194 CYS L N   1 
ATOM 1548 C CA  . CYS A 1 199 ? 28.816 40.220 63.422 1.00 10.70 ? 194 CYS L CA  1 
ATOM 1549 C C   . CYS A 1 199 ? 27.430 39.548 63.338 1.00 10.71 ? 194 CYS L C   1 
ATOM 1550 O O   . CYS A 1 199 ? 27.274 38.398 63.705 1.00 10.60 ? 194 CYS L O   1 
ATOM 1551 C CB  . CYS A 1 199 ? 29.939 39.221 63.174 1.00 6.62  ? 194 CYS L CB  1 
ATOM 1552 S SG  . CYS A 1 199 ? 29.728 38.244 61.671 1.00 8.95  ? 194 CYS L SG  1 
ATOM 1553 N N   . GLU A 1 200 ? 26.422 40.296 62.896 1.00 16.86 ? 195 GLU L N   1 
ATOM 1554 C CA  . GLU A 1 200 ? 25.042 39.809 62.801 1.00 18.13 ? 195 GLU L CA  1 
ATOM 1555 C C   . GLU A 1 200 ? 24.673 39.074 61.525 1.00 15.44 ? 195 GLU L C   1 
ATOM 1556 O O   . GLU A 1 200 ? 24.479 39.706 60.492 1.00 13.74 ? 195 GLU L O   1 
ATOM 1557 C CB  . GLU A 1 200 ? 24.056 40.970 62.926 1.00 22.93 ? 195 GLU L CB  1 
ATOM 1558 C CG  . GLU A 1 200 ? 24.195 41.873 64.135 1.00 27.39 ? 195 GLU L CG  1 
ATOM 1559 C CD  . GLU A 1 200 ? 23.510 43.234 63.898 1.00 31.41 ? 195 GLU L CD  1 
ATOM 1560 O OE1 . GLU A 1 200 ? 24.206 44.139 63.370 1.00 29.33 ? 195 GLU L OE1 1 
ATOM 1561 O OE2 . GLU A 1 200 ? 22.284 43.382 64.198 1.00 29.65 ? 195 GLU L OE2 1 
ATOM 1562 N N   . ALA A 1 201 ? 24.462 37.766 61.623 1.00 13.26 ? 196 ALA L N   1 
ATOM 1563 C CA  . ALA A 1 201 ? 24.070 36.980 60.466 1.00 16.11 ? 196 ALA L CA  1 
ATOM 1564 C C   . ALA A 1 201 ? 22.568 37.018 60.303 1.00 16.20 ? 196 ALA L C   1 
ATOM 1565 O O   . ALA A 1 201 ? 21.839 36.663 61.219 1.00 21.07 ? 196 ALA L O   1 
ATOM 1566 C CB  . ALA A 1 201 ? 24.519 35.557 60.625 1.00 19.03 ? 196 ALA L CB  1 
ATOM 1567 N N   . THR A 1 202 ? 22.099 37.478 59.155 1.00 16.04 ? 197 THR L N   1 
ATOM 1568 C CA  . THR A 1 202 ? 20.671 37.528 58.902 1.00 14.94 ? 197 THR L CA  1 
ATOM 1569 C C   . THR A 1 202 ? 20.300 36.661 57.698 1.00 14.14 ? 197 THR L C   1 
ATOM 1570 O O   . THR A 1 202 ? 20.507 37.020 56.531 1.00 5.51  ? 197 THR L O   1 
ATOM 1571 C CB  . THR A 1 202 ? 20.203 38.956 58.708 1.00 17.77 ? 197 THR L CB  1 
ATOM 1572 O OG1 . THR A 1 202 ? 20.675 39.748 59.802 1.00 22.72 ? 197 THR L OG1 1 
ATOM 1573 C CG2 . THR A 1 202 ? 18.690 39.018 58.686 1.00 20.13 ? 197 THR L CG2 1 
ATOM 1574 N N   . HIS A 1 203 ? 19.806 35.473 58.024 1.00 18.55 ? 198 HIS L N   1 
ATOM 1575 C CA  . HIS A 1 203 ? 19.394 34.470 57.060 1.00 17.12 ? 198 HIS L CA  1 
ATOM 1576 C C   . HIS A 1 203 ? 17.870 34.399 57.093 1.00 17.31 ? 198 HIS L C   1 
ATOM 1577 O O   . HIS A 1 203 ? 17.255 34.590 58.142 1.00 15.85 ? 198 HIS L O   1 
ATOM 1578 C CB  . HIS A 1 203 ? 19.993 33.112 57.455 1.00 18.12 ? 198 HIS L CB  1 
ATOM 1579 C CG  . HIS A 1 203 ? 19.979 32.092 56.357 1.00 20.92 ? 198 HIS L CG  1 
ATOM 1580 N ND1 . HIS A 1 203 ? 19.099 31.028 56.334 1.00 21.33 ? 198 HIS L ND1 1 
ATOM 1581 C CD2 . HIS A 1 203 ? 20.729 31.980 55.232 1.00 21.71 ? 198 HIS L CD2 1 
ATOM 1582 C CE1 . HIS A 1 203 ? 19.304 30.312 55.244 1.00 20.43 ? 198 HIS L CE1 1 
ATOM 1583 N NE2 . HIS A 1 203 ? 20.283 30.864 54.561 1.00 23.16 ? 198 HIS L NE2 1 
ATOM 1584 N N   . LYS A 1 204 ? 17.278 34.128 55.931 1.00 19.31 ? 199 LYS L N   1 
ATOM 1585 C CA  . LYS A 1 204 ? 15.836 33.998 55.747 1.00 17.21 ? 199 LYS L CA  1 
ATOM 1586 C C   . LYS A 1 204 ? 15.198 32.921 56.640 1.00 20.85 ? 199 LYS L C   1 
ATOM 1587 O O   . LYS A 1 204 ? 13.981 32.780 56.686 1.00 23.35 ? 199 LYS L O   1 
ATOM 1588 C CB  . LYS A 1 204 ? 15.554 33.711 54.275 1.00 18.02 ? 199 LYS L CB  1 
ATOM 1589 C CG  . LYS A 1 204 ? 16.314 32.520 53.697 1.00 19.01 ? 199 LYS L CG  1 
ATOM 1590 C CD  . LYS A 1 204 ? 15.548 31.221 53.876 1.00 18.16 ? 199 LYS L CD  1 
ATOM 1591 C CE  . LYS A 1 204 ? 14.263 31.276 53.106 1.00 17.44 ? 199 LYS L CE  1 
ATOM 1592 N NZ  . LYS A 1 204 ? 13.485 30.061 53.306 1.00 22.43 ? 199 LYS L NZ  1 
ATOM 1593 N N   . THR A 1 205 ? 16.023 32.119 57.302 1.00 20.45 ? 200 THR L N   1 
ATOM 1594 C CA  . THR A 1 205 ? 15.532 31.096 58.216 1.00 19.03 ? 200 THR L CA  1 
ATOM 1595 C C   . THR A 1 205 ? 15.136 31.699 59.581 1.00 20.35 ? 200 THR L C   1 
ATOM 1596 O O   . THR A 1 205 ? 14.797 30.963 60.516 1.00 21.35 ? 200 THR L O   1 
ATOM 1597 C CB  . THR A 1 205 ? 16.619 30.022 58.439 1.00 19.68 ? 200 THR L CB  1 
ATOM 1598 O OG1 . THR A 1 205 ? 17.879 30.646 58.700 1.00 17.22 ? 200 THR L OG1 1 
ATOM 1599 C CG2 . THR A 1 205 ? 16.764 29.162 57.202 1.00 23.15 ? 200 THR L CG2 1 
ATOM 1600 N N   . SER A 1 206 ? 15.200 33.027 59.701 1.00 22.40 ? 201 SER L N   1 
ATOM 1601 C CA  . SER A 1 206 ? 14.883 33.729 60.948 1.00 23.77 ? 201 SER L CA  1 
ATOM 1602 C C   . SER A 1 206 ? 14.381 35.136 60.716 1.00 26.37 ? 201 SER L C   1 
ATOM 1603 O O   . SER A 1 206 ? 14.322 35.605 59.577 1.00 31.34 ? 201 SER L O   1 
ATOM 1604 C CB  . SER A 1 206 ? 16.118 33.841 61.842 1.00 23.30 ? 201 SER L CB  1 
ATOM 1605 O OG  . SER A 1 206 ? 16.587 32.566 62.218 1.00 28.85 ? 201 SER L OG  1 
ATOM 1606 N N   . THR A 1 207 ? 14.070 35.808 61.828 1.00 25.39 ? 202 THR L N   1 
ATOM 1607 C CA  . THR A 1 207 ? 13.571 37.182 61.839 1.00 23.64 ? 202 THR L CA  1 
ATOM 1608 C C   . THR A 1 207 ? 14.625 38.014 62.550 1.00 20.01 ? 202 THR L C   1 
ATOM 1609 O O   . THR A 1 207 ? 15.050 39.069 62.074 1.00 18.29 ? 202 THR L O   1 
ATOM 1610 C CB  . THR A 1 207 ? 12.269 37.286 62.663 1.00 26.88 ? 202 THR L CB  1 
ATOM 1611 O OG1 . THR A 1 207 ? 11.345 36.275 62.235 1.00 29.44 ? 202 THR L OG1 1 
ATOM 1612 C CG2 . THR A 1 207 ? 11.617 38.677 62.498 1.00 28.39 ? 202 THR L CG2 1 
ATOM 1613 N N   . SER A 1 208 ? 15.024 37.507 63.710 1.00 18.32 ? 203 SER L N   1 
ATOM 1614 C CA  . SER A 1 208 ? 16.029 38.119 64.567 1.00 17.30 ? 203 SER L CA  1 
ATOM 1615 C C   . SER A 1 208 ? 17.419 37.613 64.187 1.00 15.61 ? 203 SER L C   1 
ATOM 1616 O O   . SER A 1 208 ? 17.740 36.453 64.430 1.00 19.59 ? 203 SER L O   1 
ATOM 1617 C CB  . SER A 1 208 ? 15.728 37.723 66.005 1.00 16.92 ? 203 SER L CB  1 
ATOM 1618 O OG  . SER A 1 208 ? 15.210 36.404 66.036 1.00 12.83 ? 203 SER L OG  1 
ATOM 1619 N N   . PRO A 1 209 ? 18.258 38.462 63.581 1.00 12.16 ? 204 PRO L N   1 
ATOM 1620 C CA  . PRO A 1 209 ? 19.598 38.022 63.193 1.00 9.96  ? 204 PRO L CA  1 
ATOM 1621 C C   . PRO A 1 209 ? 20.426 37.385 64.264 1.00 7.65  ? 204 PRO L C   1 
ATOM 1622 O O   . PRO A 1 209 ? 20.381 37.800 65.417 1.00 9.32  ? 204 PRO L O   1 
ATOM 1623 C CB  . PRO A 1 209 ? 20.263 39.290 62.662 1.00 9.04  ? 204 PRO L CB  1 
ATOM 1624 C CG  . PRO A 1 209 ? 19.420 40.381 63.134 1.00 12.85 ? 204 PRO L CG  1 
ATOM 1625 C CD  . PRO A 1 209 ? 18.023 39.828 63.094 1.00 12.06 ? 204 PRO L CD  1 
ATOM 1626 N N   . ILE A 1 210 ? 21.173 36.369 63.847 1.00 5.93  ? 205 ILE L N   1 
ATOM 1627 C CA  . ILE A 1 210 ? 22.078 35.617 64.705 1.00 6.75  ? 205 ILE L CA  1 
ATOM 1628 C C   . ILE A 1 210 ? 23.268 36.531 64.992 1.00 5.89  ? 205 ILE L C   1 
ATOM 1629 O O   . ILE A 1 210 ? 23.956 36.943 64.067 1.00 2.07  ? 205 ILE L O   1 
ATOM 1630 C CB  . ILE A 1 210 ? 22.522 34.317 63.994 1.00 2.27  ? 205 ILE L CB  1 
ATOM 1631 C CG1 . ILE A 1 210 ? 21.297 33.466 63.717 1.00 2.00  ? 205 ILE L CG1 1 
ATOM 1632 C CG2 . ILE A 1 210 ? 23.528 33.529 64.830 1.00 2.00  ? 205 ILE L CG2 1 
ATOM 1633 C CD1 . ILE A 1 210 ? 21.629 32.186 63.073 1.00 2.27  ? 205 ILE L CD1 1 
ATOM 1634 N N   . VAL A 1 211 ? 23.523 36.781 66.277 1.00 7.45  ? 206 VAL L N   1 
ATOM 1635 C CA  . VAL A 1 211 ? 24.573 37.689 66.758 1.00 11.45 ? 206 VAL L CA  1 
ATOM 1636 C C   . VAL A 1 211 ? 25.695 37.038 67.575 1.00 9.84  ? 206 VAL L C   1 
ATOM 1637 O O   . VAL A 1 211 ? 25.454 36.150 68.388 1.00 12.72 ? 206 VAL L O   1 
ATOM 1638 C CB  . VAL A 1 211 ? 23.915 38.836 67.669 1.00 15.64 ? 206 VAL L CB  1 
ATOM 1639 C CG1 . VAL A 1 211 ? 24.962 39.673 68.403 1.00 13.83 ? 206 VAL L CG1 1 
ATOM 1640 C CG2 . VAL A 1 211 ? 23.034 39.764 66.831 1.00 19.86 ? 206 VAL L CG2 1 
ATOM 1641 N N   . LYS A 1 212 ? 26.921 37.479 67.334 1.00 9.01  ? 207 LYS L N   1 
ATOM 1642 C CA  . LYS A 1 212 ? 28.075 37.035 68.096 1.00 12.93 ? 207 LYS L CA  1 
ATOM 1643 C C   . LYS A 1 212 ? 29.004 38.248 68.216 1.00 17.36 ? 207 LYS L C   1 
ATOM 1644 O O   . LYS A 1 212 ? 28.931 39.182 67.413 1.00 19.53 ? 207 LYS L O   1 
ATOM 1645 C CB  . LYS A 1 212 ? 28.749 35.819 67.485 1.00 8.93  ? 207 LYS L CB  1 
ATOM 1646 C CG  . LYS A 1 212 ? 27.950 34.556 67.722 1.00 12.39 ? 207 LYS L CG  1 
ATOM 1647 C CD  . LYS A 1 212 ? 28.823 33.309 67.678 1.00 17.29 ? 207 LYS L CD  1 
ATOM 1648 C CE  . LYS A 1 212 ? 28.001 32.046 67.952 1.00 17.20 ? 207 LYS L CE  1 
ATOM 1649 N NZ  . LYS A 1 212 ? 28.817 30.792 67.914 1.00 13.57 ? 207 LYS L NZ  1 
ATOM 1650 N N   . SER A 1 213 ? 29.831 38.273 69.253 1.00 20.25 ? 208 SER L N   1 
ATOM 1651 C CA  . SER A 1 213 ? 30.700 39.416 69.483 1.00 14.90 ? 208 SER L CA  1 
ATOM 1652 C C   . SER A 1 213 ? 31.894 39.147 70.423 1.00 13.46 ? 208 SER L C   1 
ATOM 1653 O O   . SER A 1 213 ? 32.254 37.990 70.679 1.00 9.11  ? 208 SER L O   1 
ATOM 1654 C CB  . SER A 1 213 ? 29.835 40.569 70.018 1.00 16.06 ? 208 SER L CB  1 
ATOM 1655 O OG  . SER A 1 213 ? 28.793 40.101 70.876 1.00 14.30 ? 208 SER L OG  1 
ATOM 1656 N N   . PHE A 1 214 ? 32.534 40.225 70.879 1.00 9.02  ? 209 PHE L N   1 
ATOM 1657 C CA  . PHE A 1 214 ? 33.660 40.140 71.784 1.00 3.71  ? 209 PHE L CA  1 
ATOM 1658 C C   . PHE A 1 214 ? 34.136 41.543 72.160 1.00 4.71  ? 209 PHE L C   1 
ATOM 1659 O O   . PHE A 1 214 ? 33.950 42.501 71.407 1.00 11.02 ? 209 PHE L O   1 
ATOM 1660 C CB  . PHE A 1 214 ? 34.796 39.339 71.137 1.00 7.96  ? 209 PHE L CB  1 
ATOM 1661 C CG  . PHE A 1 214 ? 35.599 40.107 70.109 1.00 9.63  ? 209 PHE L CG  1 
ATOM 1662 C CD1 . PHE A 1 214 ? 36.664 40.900 70.488 1.00 11.93 ? 209 PHE L CD1 1 
ATOM 1663 C CD2 . PHE A 1 214 ? 35.322 39.998 68.772 1.00 12.27 ? 209 PHE L CD2 1 
ATOM 1664 C CE1 . PHE A 1 214 ? 37.432 41.565 69.549 1.00 15.04 ? 209 PHE L CE1 1 
ATOM 1665 C CE2 . PHE A 1 214 ? 36.097 40.668 67.821 1.00 15.21 ? 209 PHE L CE2 1 
ATOM 1666 C CZ  . PHE A 1 214 ? 37.150 41.447 68.209 1.00 12.12 ? 209 PHE L CZ  1 
ATOM 1667 N N   . ASN A 1 215 ? 34.728 41.668 73.336 1.00 6.82  ? 210 ASN L N   1 
ATOM 1668 C CA  . ASN A 1 215 ? 35.257 42.939 73.807 1.00 4.71  ? 210 ASN L CA  1 
ATOM 1669 C C   . ASN A 1 215 ? 36.773 42.735 73.766 1.00 9.58  ? 210 ASN L C   1 
ATOM 1670 O O   . ASN A 1 215 ? 37.247 41.744 73.203 1.00 14.04 ? 210 ASN L O   1 
ATOM 1671 C CB  . ASN A 1 215 ? 34.841 43.214 75.255 1.00 2.34  ? 210 ASN L CB  1 
ATOM 1672 C CG  . ASN A 1 215 ? 33.332 43.114 75.497 1.00 7.51  ? 210 ASN L CG  1 
ATOM 1673 O OD1 . ASN A 1 215 ? 32.487 43.211 74.584 1.00 7.01  ? 210 ASN L OD1 1 
ATOM 1674 N ND2 . ASN A 1 215 ? 32.987 42.941 76.760 1.00 9.40  ? 210 ASN L ND2 1 
ATOM 1675 N N   . ARG A 1 216 ? 37.536 43.623 74.405 1.00 12.07 ? 211 ARG L N   1 
ATOM 1676 C CA  . ARG A 1 216 ? 38.999 43.505 74.429 1.00 8.32  ? 211 ARG L CA  1 
ATOM 1677 C C   . ARG A 1 216 ? 39.531 43.816 75.832 1.00 8.26  ? 211 ARG L C   1 
ATOM 1678 O O   . ARG A 1 216 ? 38.721 43.896 76.781 1.00 10.43 ? 211 ARG L O   1 
ATOM 1679 C CB  . ARG A 1 216 ? 39.655 44.460 73.412 1.00 9.15  ? 211 ARG L CB  1 
ATOM 1680 C CG  . ARG A 1 216 ? 38.859 44.762 72.132 1.00 6.25  ? 211 ARG L CG  1 
ATOM 1681 C CD  . ARG A 1 216 ? 39.606 45.735 71.215 1.00 7.62  ? 211 ARG L CD  1 
ATOM 1682 N NE  . ARG A 1 216 ? 40.012 46.961 71.900 1.00 7.87  ? 211 ARG L NE  1 
ATOM 1683 C CZ  . ARG A 1 216 ? 41.229 47.196 72.354 1.00 7.78  ? 211 ARG L CZ  1 
ATOM 1684 N NH1 . ARG A 1 216 ? 42.190 46.294 72.180 1.00 6.55  ? 211 ARG L NH1 1 
ATOM 1685 N NH2 . ARG A 1 216 ? 41.445 48.277 73.093 1.00 9.67  ? 211 ARG L NH2 1 
ATOM 1686 O OXT . ARG A 1 216 ? 40.762 43.986 75.972 1.00 8.66  ? 211 ARG L OXT 1 
ATOM 1687 N N   . GLN B 2 1   ? 38.807 15.100 16.738 1.00 19.94 ? 1   GLN H N   1 
ATOM 1688 C CA  . GLN B 2 1   ? 40.206 15.006 17.231 1.00 15.30 ? 1   GLN H CA  1 
ATOM 1689 C C   . GLN B 2 1   ? 40.779 16.387 17.104 1.00 10.90 ? 1   GLN H C   1 
ATOM 1690 O O   . GLN B 2 1   ? 41.921 16.619 17.434 1.00 11.19 ? 1   GLN H O   1 
ATOM 1691 C CB  . GLN B 2 1   ? 40.993 14.026 16.360 1.00 20.63 ? 1   GLN H CB  1 
ATOM 1692 C CG  . GLN B 2 1   ? 41.879 13.070 17.132 1.00 21.96 ? 1   GLN H CG  1 
ATOM 1693 C CD  . GLN B 2 1   ? 42.975 13.789 17.854 1.00 22.31 ? 1   GLN H CD  1 
ATOM 1694 O OE1 . GLN B 2 1   ? 43.750 14.528 17.247 1.00 25.52 ? 1   GLN H OE1 1 
ATOM 1695 N NE2 . GLN B 2 1   ? 43.053 13.585 19.158 1.00 26.60 ? 1   GLN H NE2 1 
ATOM 1696 N N   . ILE B 2 2   ? 39.961 17.314 16.631 1.00 7.89  ? 2   ILE H N   1 
ATOM 1697 C CA  . ILE B 2 2   ? 40.411 18.681 16.470 1.00 8.71  ? 2   ILE H CA  1 
ATOM 1698 C C   . ILE B 2 2   ? 40.670 19.180 17.872 1.00 10.63 ? 2   ILE H C   1 
ATOM 1699 O O   . ILE B 2 2   ? 39.803 19.030 18.735 1.00 13.67 ? 2   ILE H O   1 
ATOM 1700 C CB  . ILE B 2 2   ? 39.335 19.581 15.809 1.00 4.22  ? 2   ILE H CB  1 
ATOM 1701 C CG1 . ILE B 2 2   ? 39.189 19.266 14.311 1.00 3.09  ? 2   ILE H CG1 1 
ATOM 1702 C CG2 . ILE B 2 2   ? 39.710 21.021 15.981 1.00 2.00  ? 2   ILE H CG2 1 
ATOM 1703 C CD1 . ILE B 2 2   ? 38.365 18.025 13.957 1.00 2.00  ? 2   ILE H CD1 1 
ATOM 1704 N N   . GLN B 2 3   ? 41.882 19.686 18.115 1.00 13.61 ? 3   GLN H N   1 
ATOM 1705 C CA  . GLN B 2 3   ? 42.262 20.222 19.434 1.00 16.07 ? 3   GLN H CA  1 
ATOM 1706 C C   . GLN B 2 3   ? 42.803 21.656 19.302 1.00 12.87 ? 3   GLN H C   1 
ATOM 1707 O O   . GLN B 2 3   ? 43.271 22.045 18.237 1.00 11.91 ? 3   GLN H O   1 
ATOM 1708 C CB  . GLN B 2 3   ? 43.304 19.306 20.099 1.00 16.41 ? 3   GLN H CB  1 
ATOM 1709 C CG  . GLN B 2 3   ? 42.895 17.838 20.099 1.00 19.04 ? 3   GLN H CG  1 
ATOM 1710 C CD  . GLN B 2 3   ? 43.765 16.967 20.976 1.00 20.86 ? 3   GLN H CD  1 
ATOM 1711 O OE1 . GLN B 2 3   ? 44.726 16.336 20.510 1.00 24.14 ? 3   GLN H OE1 1 
ATOM 1712 N NE2 . GLN B 2 3   ? 43.423 16.906 22.259 1.00 20.64 ? 3   GLN H NE2 1 
ATOM 1713 N N   . LEU B 2 4   ? 42.698 22.450 20.362 1.00 11.68 ? 4   LEU H N   1 
ATOM 1714 C CA  . LEU B 2 4   ? 43.191 23.831 20.332 1.00 10.95 ? 4   LEU H CA  1 
ATOM 1715 C C   . LEU B 2 4   ? 43.927 24.153 21.622 1.00 11.52 ? 4   LEU H C   1 
ATOM 1716 O O   . LEU B 2 4   ? 43.520 24.996 22.417 1.00 9.61  ? 4   LEU H O   1 
ATOM 1717 C CB  . LEU B 2 4   ? 42.057 24.831 20.076 1.00 8.34  ? 4   LEU H CB  1 
ATOM 1718 C CG  . LEU B 2 4   ? 41.458 24.730 18.675 1.00 4.39  ? 4   LEU H CG  1 
ATOM 1719 C CD1 . LEU B 2 4   ? 40.157 25.479 18.615 1.00 2.00  ? 4   LEU H CD1 1 
ATOM 1720 C CD2 . LEU B 2 4   ? 42.439 25.265 17.669 1.00 2.00  ? 4   LEU H CD2 1 
ATOM 1721 N N   . GLN B 2 5   ? 45.047 23.463 21.790 1.00 13.21 ? 5   GLN H N   1 
ATOM 1722 C CA  . GLN B 2 5   ? 45.903 23.592 22.956 1.00 12.95 ? 5   GLN H CA  1 
ATOM 1723 C C   . GLN B 2 5   ? 46.538 24.994 23.071 1.00 9.77  ? 5   GLN H C   1 
ATOM 1724 O O   . GLN B 2 5   ? 47.183 25.481 22.142 1.00 7.89  ? 5   GLN H O   1 
ATOM 1725 C CB  . GLN B 2 5   ? 46.941 22.489 22.893 1.00 10.10 ? 5   GLN H CB  1 
ATOM 1726 C CG  . GLN B 2 5   ? 47.823 22.425 24.064 1.00 18.06 ? 5   GLN H CG  1 
ATOM 1727 C CD  . GLN B 2 5   ? 49.181 21.911 23.664 1.00 27.44 ? 5   GLN H CD  1 
ATOM 1728 O OE1 . GLN B 2 5   ? 49.587 22.056 22.500 1.00 29.95 ? 5   GLN H OE1 1 
ATOM 1729 N NE2 . GLN B 2 5   ? 49.898 21.301 24.612 1.00 29.75 ? 5   GLN H NE2 1 
ATOM 1730 N N   . GLN B 2 6   ? 46.328 25.622 24.222 1.00 2.70  ? 6   GLN H N   1 
ATOM 1731 C CA  . GLN B 2 6   ? 46.811 26.961 24.498 1.00 2.59  ? 6   GLN H CA  1 
ATOM 1732 C C   . GLN B 2 6   ? 47.956 26.943 25.458 1.00 2.00  ? 6   GLN H C   1 
ATOM 1733 O O   . GLN B 2 6   ? 48.216 25.931 26.055 1.00 3.51  ? 6   GLN H O   1 
ATOM 1734 C CB  . GLN B 2 6   ? 45.722 27.774 25.183 1.00 3.64  ? 6   GLN H CB  1 
ATOM 1735 C CG  . GLN B 2 6   ? 44.353 27.647 24.649 1.00 2.00  ? 6   GLN H CG  1 
ATOM 1736 C CD  . GLN B 2 6   ? 43.633 28.954 24.721 1.00 2.00  ? 6   GLN H CD  1 
ATOM 1737 O OE1 . GLN B 2 6   ? 42.418 28.987 24.729 1.00 3.70  ? 6   GLN H OE1 1 
ATOM 1738 N NE2 . GLN B 2 6   ? 44.374 30.045 24.738 1.00 2.00  ? 6   GLN H NE2 1 
ATOM 1739 N N   . SER B 2 7   ? 48.471 28.135 25.744 1.00 2.00  ? 7   SER H N   1 
ATOM 1740 C CA  . SER B 2 7   ? 49.589 28.388 26.653 1.00 4.79  ? 7   SER H CA  1 
ATOM 1741 C C   . SER B 2 7   ? 49.267 28.380 28.174 1.00 5.88  ? 7   SER H C   1 
ATOM 1742 O O   . SER B 2 7   ? 48.121 28.624 28.580 1.00 5.08  ? 7   SER H O   1 
ATOM 1743 C CB  . SER B 2 7   ? 50.196 29.760 26.316 1.00 9.85  ? 7   SER H CB  1 
ATOM 1744 O OG  . SER B 2 7   ? 50.338 29.991 24.923 1.00 9.73  ? 7   SER H OG  1 
ATOM 1745 N N   . GLY B 2 8   ? 50.314 28.217 28.997 1.00 4.25  ? 8   GLY H N   1 
ATOM 1746 C CA  . GLY B 2 8   ? 50.161 28.203 30.447 1.00 7.57  ? 8   GLY H CA  1 
ATOM 1747 C C   . GLY B 2 8   ? 49.906 29.597 31.011 1.00 9.63  ? 8   GLY H C   1 
ATOM 1748 O O   . GLY B 2 8   ? 49.956 30.544 30.221 1.00 7.69  ? 8   GLY H O   1 
ATOM 1749 N N   . PRO B 2 9   ? 49.647 29.763 32.348 1.00 12.42 ? 9   PRO H N   1 
ATOM 1750 C CA  . PRO B 2 9   ? 49.378 31.044 33.040 1.00 15.31 ? 9   PRO H CA  1 
ATOM 1751 C C   . PRO B 2 9   ? 50.483 32.088 32.950 1.00 17.92 ? 9   PRO H C   1 
ATOM 1752 O O   . PRO B 2 9   ? 51.664 31.752 32.810 1.00 23.47 ? 9   PRO H O   1 
ATOM 1753 C CB  . PRO B 2 9   ? 49.127 30.622 34.486 1.00 15.16 ? 9   PRO H CB  1 
ATOM 1754 C CG  . PRO B 2 9   ? 48.530 29.263 34.331 1.00 15.36 ? 9   PRO H CG  1 
ATOM 1755 C CD  . PRO B 2 9   ? 49.435 28.643 33.276 1.00 14.11 ? 9   PRO H CD  1 
ATOM 1756 N N   . GLU B 2 10  ? 50.098 33.351 33.106 1.00 16.44 ? 10  GLU H N   1 
ATOM 1757 C CA  . GLU B 2 10  ? 51.030 34.461 32.968 1.00 18.79 ? 10  GLU H CA  1 
ATOM 1758 C C   . GLU B 2 10  ? 50.792 35.561 33.997 1.00 18.23 ? 10  GLU H C   1 
ATOM 1759 O O   . GLU B 2 10  ? 49.801 36.294 33.917 1.00 19.16 ? 10  GLU H O   1 
ATOM 1760 C CB  . GLU B 2 10  ? 50.891 35.064 31.554 1.00 19.90 ? 10  GLU H CB  1 
ATOM 1761 C CG  . GLU B 2 10  ? 51.434 34.227 30.395 1.00 18.90 ? 10  GLU H CG  1 
ATOM 1762 C CD  . GLU B 2 10  ? 52.907 34.524 30.075 1.00 23.56 ? 10  GLU H CD  1 
ATOM 1763 O OE1 . GLU B 2 10  ? 53.443 35.551 30.561 1.00 22.78 ? 10  GLU H OE1 1 
ATOM 1764 O OE2 . GLU B 2 10  ? 53.528 33.735 29.315 1.00 26.55 ? 10  GLU H OE2 1 
ATOM 1765 N N   . LEU B 2 11  ? 51.732 35.709 34.926 1.00 16.55 ? 11  LEU H N   1 
ATOM 1766 C CA  . LEU B 2 11  ? 51.633 36.723 35.990 1.00 15.96 ? 11  LEU H CA  1 
ATOM 1767 C C   . LEU B 2 11  ? 52.294 38.057 35.581 1.00 17.22 ? 11  LEU H C   1 
ATOM 1768 O O   . LEU B 2 11  ? 53.367 38.411 36.089 1.00 19.48 ? 11  LEU H O   1 
ATOM 1769 C CB  . LEU B 2 11  ? 52.256 36.203 37.312 1.00 10.50 ? 11  LEU H CB  1 
ATOM 1770 C CG  . LEU B 2 11  ? 51.692 35.018 38.115 1.00 3.98  ? 11  LEU H CG  1 
ATOM 1771 C CD1 . LEU B 2 11  ? 50.205 35.206 38.278 1.00 4.24  ? 11  LEU H CD1 1 
ATOM 1772 C CD2 . LEU B 2 11  ? 51.986 33.663 37.485 1.00 6.09  ? 11  LEU H CD2 1 
ATOM 1773 N N   . LYS B 2 12  ? 51.658 38.795 34.675 1.00 13.45 ? 12  LYS H N   1 
ATOM 1774 C CA  . LYS B 2 12  ? 52.215 40.058 34.216 1.00 8.63  ? 12  LYS H CA  1 
ATOM 1775 C C   . LYS B 2 12  ? 51.962 41.256 35.161 1.00 6.83  ? 12  LYS H C   1 
ATOM 1776 O O   . LYS B 2 12  ? 51.220 41.140 36.117 1.00 4.34  ? 12  LYS H O   1 
ATOM 1777 C CB  . LYS B 2 12  ? 51.682 40.336 32.816 1.00 9.49  ? 12  LYS H CB  1 
ATOM 1778 C CG  . LYS B 2 12  ? 52.762 40.393 31.747 1.00 9.96  ? 12  LYS H CG  1 
ATOM 1779 C CD  . LYS B 2 12  ? 53.404 39.047 31.523 1.00 9.20  ? 12  LYS H CD  1 
ATOM 1780 C CE  . LYS B 2 12  ? 54.440 39.134 30.423 1.00 8.28  ? 12  LYS H CE  1 
ATOM 1781 N NZ  . LYS B 2 12  ? 54.937 37.781 30.047 1.00 8.51  ? 12  LYS H NZ  1 
ATOM 1782 N N   . LYS B 2 13  ? 52.593 42.399 34.885 1.00 8.20  ? 13  LYS H N   1 
ATOM 1783 C CA  . LYS B 2 13  ? 52.450 43.643 35.685 1.00 7.13  ? 13  LYS H CA  1 
ATOM 1784 C C   . LYS B 2 13  ? 51.951 44.838 34.830 1.00 6.94  ? 13  LYS H C   1 
ATOM 1785 O O   . LYS B 2 13  ? 52.348 44.955 33.664 1.00 8.99  ? 13  LYS H O   1 
ATOM 1786 C CB  . LYS B 2 13  ? 53.802 44.047 36.300 1.00 2.00  ? 13  LYS H CB  1 
ATOM 1787 C CG  . LYS B 2 13  ? 54.221 43.246 37.501 1.00 2.00  ? 13  LYS H CG  1 
ATOM 1788 C CD  . LYS B 2 13  ? 55.638 43.599 37.942 1.00 2.00  ? 13  LYS H CD  1 
ATOM 1789 C CE  . LYS B 2 13  ? 56.275 42.472 38.750 1.00 2.00  ? 13  LYS H CE  1 
ATOM 1790 N NZ  . LYS B 2 13  ? 55.734 41.133 38.337 1.00 7.43  ? 13  LYS H NZ  1 
ATOM 1791 N N   . PRO B 2 14  ? 51.107 45.750 35.396 1.00 5.61  ? 14  PRO H N   1 
ATOM 1792 C CA  . PRO B 2 14  ? 50.616 46.896 34.629 1.00 2.00  ? 14  PRO H CA  1 
ATOM 1793 C C   . PRO B 2 14  ? 51.687 47.509 33.738 1.00 8.65  ? 14  PRO H C   1 
ATOM 1794 O O   . PRO B 2 14  ? 52.820 47.793 34.185 1.00 8.31  ? 14  PRO H O   1 
ATOM 1795 C CB  . PRO B 2 14  ? 50.159 47.859 35.712 1.00 2.00  ? 14  PRO H CB  1 
ATOM 1796 C CG  . PRO B 2 14  ? 49.536 46.960 36.677 1.00 2.00  ? 14  PRO H CG  1 
ATOM 1797 C CD  . PRO B 2 14  ? 50.535 45.791 36.759 1.00 5.88  ? 14  PRO H CD  1 
ATOM 1798 N N   . GLY B 2 15  ? 51.367 47.541 32.445 1.00 10.90 ? 15  GLY H N   1 
ATOM 1799 C CA  . GLY B 2 15  ? 52.258 48.110 31.449 1.00 9.70  ? 15  GLY H CA  1 
ATOM 1800 C C   . GLY B 2 15  ? 52.968 47.093 30.593 1.00 7.70  ? 15  GLY H C   1 
ATOM 1801 O O   . GLY B 2 15  ? 53.086 47.278 29.374 1.00 10.06 ? 15  GLY H O   1 
ATOM 1802 N N   . GLU B 2 16  ? 53.427 46.014 31.216 1.00 5.22  ? 16  GLU H N   1 
ATOM 1803 C CA  . GLU B 2 16  ? 54.138 44.971 30.491 1.00 10.37 ? 16  GLU H CA  1 
ATOM 1804 C C   . GLU B 2 16  ? 53.312 44.523 29.271 1.00 11.85 ? 16  GLU H C   1 
ATOM 1805 O O   . GLU B 2 16  ? 52.113 44.783 29.191 1.00 16.19 ? 16  GLU H O   1 
ATOM 1806 C CB  . GLU B 2 16  ? 54.441 43.771 31.421 1.00 12.30 ? 16  GLU H CB  1 
ATOM 1807 C CG  . GLU B 2 16  ? 55.104 44.137 32.769 1.00 13.58 ? 16  GLU H CG  1 
ATOM 1808 C CD  . GLU B 2 16  ? 55.752 42.957 33.509 1.00 13.26 ? 16  GLU H CD  1 
ATOM 1809 O OE1 . GLU B 2 16  ? 56.980 43.025 33.718 1.00 15.00 ? 16  GLU H OE1 1 
ATOM 1810 O OE2 . GLU B 2 16  ? 55.058 41.988 33.905 1.00 9.76  ? 16  GLU H OE2 1 
ATOM 1811 N N   . THR B 2 17  ? 53.950 43.838 28.334 1.00 8.92  ? 17  THR H N   1 
ATOM 1812 C CA  . THR B 2 17  ? 53.273 43.364 27.140 1.00 6.95  ? 17  THR H CA  1 
ATOM 1813 C C   . THR B 2 17  ? 53.265 41.841 27.194 1.00 5.65  ? 17  THR H C   1 
ATOM 1814 O O   . THR B 2 17  ? 54.169 41.230 27.754 1.00 9.57  ? 17  THR H O   1 
ATOM 1815 C CB  . THR B 2 17  ? 54.016 43.856 25.898 1.00 10.48 ? 17  THR H CB  1 
ATOM 1816 O OG1 . THR B 2 17  ? 54.181 45.281 25.979 1.00 12.06 ? 17  THR H OG1 1 
ATOM 1817 C CG2 . THR B 2 17  ? 53.261 43.487 24.627 1.00 11.66 ? 17  THR H CG2 1 
ATOM 1818 N N   . VAL B 2 18  ? 52.253 41.216 26.617 1.00 6.80  ? 18  VAL H N   1 
ATOM 1819 C CA  . VAL B 2 18  ? 52.161 39.763 26.659 1.00 12.45 ? 18  VAL H CA  1 
ATOM 1820 C C   . VAL B 2 18  ? 51.626 39.227 25.364 1.00 10.60 ? 18  VAL H C   1 
ATOM 1821 O O   . VAL B 2 18  ? 50.640 39.756 24.850 1.00 8.67  ? 18  VAL H O   1 
ATOM 1822 C CB  . VAL B 2 18  ? 51.135 39.268 27.730 1.00 17.71 ? 18  VAL H CB  1 
ATOM 1823 C CG1 . VAL B 2 18  ? 51.785 38.305 28.726 1.00 13.91 ? 18  VAL H CG1 1 
ATOM 1824 C CG2 . VAL B 2 18  ? 50.423 40.443 28.402 1.00 19.29 ? 18  VAL H CG2 1 
ATOM 1825 N N   . LYS B 2 19  ? 52.234 38.143 24.892 1.00 7.19  ? 19  LYS H N   1 
ATOM 1826 C CA  . LYS B 2 19  ? 51.806 37.464 23.677 1.00 11.10 ? 19  LYS H CA  1 
ATOM 1827 C C   . LYS B 2 19  ? 51.353 36.074 24.183 1.00 13.03 ? 19  LYS H C   1 
ATOM 1828 O O   . LYS B 2 19  ? 51.973 35.508 25.087 1.00 13.64 ? 19  LYS H O   1 
ATOM 1829 C CB  . LYS B 2 19  ? 52.974 37.384 22.674 1.00 10.67 ? 19  LYS H CB  1 
ATOM 1830 C CG  . LYS B 2 19  ? 52.654 36.744 21.306 1.00 11.37 ? 19  LYS H CG  1 
ATOM 1831 C CD  . LYS B 2 19  ? 53.919 36.633 20.413 1.00 12.98 ? 19  LYS H CD  1 
ATOM 1832 C CE  . LYS B 2 19  ? 54.235 35.176 19.992 1.00 12.80 ? 19  LYS H CE  1 
ATOM 1833 N NZ  . LYS B 2 19  ? 55.701 34.785 20.024 1.00 10.08 ? 19  LYS H NZ  1 
ATOM 1834 N N   . ILE B 2 20  ? 50.274 35.537 23.623 1.00 13.22 ? 20  ILE H N   1 
ATOM 1835 C CA  . ILE B 2 20  ? 49.733 34.245 24.049 1.00 12.15 ? 20  ILE H CA  1 
ATOM 1836 C C   . ILE B 2 20  ? 49.472 33.304 22.839 1.00 14.69 ? 20  ILE H C   1 
ATOM 1837 O O   . ILE B 2 20  ? 49.013 33.749 21.782 1.00 19.76 ? 20  ILE H O   1 
ATOM 1838 C CB  . ILE B 2 20  ? 48.490 34.529 24.935 1.00 9.79  ? 20  ILE H CB  1 
ATOM 1839 C CG1 . ILE B 2 20  ? 48.904 34.489 26.398 1.00 9.01  ? 20  ILE H CG1 1 
ATOM 1840 C CG2 . ILE B 2 20  ? 47.294 33.653 24.581 1.00 10.20 ? 20  ILE H CG2 1 
ATOM 1841 C CD1 . ILE B 2 20  ? 47.777 34.731 27.362 1.00 7.99  ? 20  ILE H CD1 1 
ATOM 1842 N N   . SER B 2 21  ? 49.791 32.021 22.971 1.00 10.48 ? 21  SER H N   1 
ATOM 1843 C CA  . SER B 2 21  ? 49.628 31.099 21.846 1.00 5.86  ? 21  SER H CA  1 
ATOM 1844 C C   . SER B 2 21  ? 48.397 30.233 21.909 1.00 5.99  ? 21  SER H C   1 
ATOM 1845 O O   . SER B 2 21  ? 47.819 30.018 22.971 1.00 5.28  ? 21  SER H O   1 
ATOM 1846 C CB  . SER B 2 21  ? 50.837 30.185 21.761 1.00 5.11  ? 21  SER H CB  1 
ATOM 1847 O OG  . SER B 2 21  ? 51.969 30.858 22.278 1.00 12.17 ? 21  SER H OG  1 
ATOM 1848 N N   . CYS B 2 22  ? 48.075 29.643 20.767 1.00 6.82  ? 22  CYS H N   1 
ATOM 1849 C CA  . CYS B 2 22  ? 46.934 28.758 20.615 1.00 5.97  ? 22  CYS H CA  1 
ATOM 1850 C C   . CYS B 2 22  ? 47.244 27.852 19.441 1.00 4.79  ? 22  CYS H C   1 
ATOM 1851 O O   . CYS B 2 22  ? 47.029 28.216 18.285 1.00 2.00  ? 22  CYS H O   1 
ATOM 1852 C CB  . CYS B 2 22  ? 45.657 29.556 20.355 1.00 5.06  ? 22  CYS H CB  1 
ATOM 1853 S SG  . CYS B 2 22  ? 44.315 28.569 19.636 1.00 6.20  ? 22  CYS H SG  1 
ATOM 1854 N N   . LYS B 2 23  ? 47.821 26.699 19.751 1.00 6.73  ? 23  LYS H N   1 
ATOM 1855 C CA  . LYS B 2 23  ? 48.188 25.717 18.740 1.00 11.12 ? 23  LYS H CA  1 
ATOM 1856 C C   . LYS B 2 23  ? 46.970 24.957 18.199 1.00 8.57  ? 23  LYS H C   1 
ATOM 1857 O O   . LYS B 2 23  ? 46.197 24.415 18.975 1.00 13.82 ? 23  LYS H O   1 
ATOM 1858 C CB  . LYS B 2 23  ? 49.193 24.723 19.324 1.00 13.09 ? 23  LYS H CB  1 
ATOM 1859 C CG  . LYS B 2 23  ? 50.040 24.038 18.261 1.00 16.06 ? 23  LYS H CG  1 
ATOM 1860 C CD  . LYS B 2 23  ? 50.263 22.586 18.575 1.00 18.15 ? 23  LYS H CD  1 
ATOM 1861 C CE  . LYS B 2 23  ? 50.872 21.895 17.382 1.00 22.44 ? 23  LYS H CE  1 
ATOM 1862 N NZ  . LYS B 2 23  ? 52.351 22.048 17.343 1.00 28.22 ? 23  LYS H NZ  1 
ATOM 1863 N N   . ALA B 2 24  ? 46.822 24.886 16.881 1.00 4.27  ? 24  ALA H N   1 
ATOM 1864 C CA  . ALA B 2 24  ? 45.695 24.190 16.268 1.00 5.80  ? 24  ALA H CA  1 
ATOM 1865 C C   . ALA B 2 24  ? 45.998 22.767 15.772 1.00 4.29  ? 24  ALA H C   1 
ATOM 1866 O O   . ALA B 2 24  ? 46.867 22.561 14.919 1.00 2.00  ? 24  ALA H O   1 
ATOM 1867 C CB  . ALA B 2 24  ? 45.147 25.019 15.138 1.00 9.14  ? 24  ALA H CB  1 
ATOM 1868 N N   . THR B 2 25  ? 45.231 21.795 16.249 1.00 2.91  ? 25  THR H N   1 
ATOM 1869 C CA  . THR B 2 25  ? 45.459 20.412 15.850 1.00 6.93  ? 25  THR H CA  1 
ATOM 1870 C C   . THR B 2 25  ? 44.326 19.822 15.023 1.00 10.85 ? 25  THR H C   1 
ATOM 1871 O O   . THR B 2 25  ? 43.177 20.275 15.106 1.00 15.85 ? 25  THR H O   1 
ATOM 1872 C CB  . THR B 2 25  ? 45.683 19.492 17.083 1.00 5.29  ? 25  THR H CB  1 
ATOM 1873 O OG1 . THR B 2 25  ? 46.703 20.052 17.922 1.00 8.68  ? 25  THR H OG1 1 
ATOM 1874 C CG2 . THR B 2 25  ? 46.120 18.103 16.663 1.00 2.00  ? 25  THR H CG2 1 
ATOM 1875 N N   . ASN B 2 26  ? 44.706 18.872 14.164 1.00 11.23 ? 26  ASN H N   1 
ATOM 1876 C CA  . ASN B 2 26  ? 43.828 18.078 13.296 1.00 8.45  ? 26  ASN H CA  1 
ATOM 1877 C C   . ASN B 2 26  ? 42.796 18.710 12.399 1.00 5.50  ? 26  ASN H C   1 
ATOM 1878 O O   . ASN B 2 26  ? 41.643 18.292 12.387 1.00 5.57  ? 26  ASN H O   1 
ATOM 1879 C CB  . ASN B 2 26  ? 43.162 16.954 14.093 1.00 11.54 ? 26  ASN H CB  1 
ATOM 1880 C CG  . ASN B 2 26  ? 43.100 15.662 13.314 1.00 12.81 ? 26  ASN H CG  1 
ATOM 1881 O OD1 . ASN B 2 26  ? 42.035 15.264 12.803 1.00 12.64 ? 26  ASN H OD1 1 
ATOM 1882 N ND2 . ASN B 2 26  ? 44.261 15.003 13.188 1.00 10.19 ? 26  ASN H ND2 1 
ATOM 1883 N N   . TYR B 2 27  ? 43.239 19.655 11.586 1.00 5.83  ? 27  TYR H N   1 
ATOM 1884 C CA  . TYR B 2 27  ? 42.378 20.331 10.641 1.00 5.65  ? 27  TYR H CA  1 
ATOM 1885 C C   . TYR B 2 27  ? 43.197 21.345 9.840  1.00 6.09  ? 27  TYR H C   1 
ATOM 1886 O O   . TYR B 2 27  ? 44.366 21.598 10.132 1.00 2.00  ? 27  TYR H O   1 
ATOM 1887 C CB  . TYR B 2 27  ? 41.163 20.971 11.356 1.00 11.40 ? 27  TYR H CB  1 
ATOM 1888 C CG  . TYR B 2 27  ? 41.397 22.241 12.163 1.00 10.40 ? 27  TYR H CG  1 
ATOM 1889 C CD1 . TYR B 2 27  ? 41.440 22.228 13.558 1.00 7.99  ? 27  TYR H CD1 1 
ATOM 1890 C CD2 . TYR B 2 27  ? 41.525 23.462 11.519 1.00 16.26 ? 27  TYR H CD2 1 
ATOM 1891 C CE1 . TYR B 2 27  ? 41.603 23.409 14.279 1.00 10.91 ? 27  TYR H CE1 1 
ATOM 1892 C CE2 . TYR B 2 27  ? 41.687 24.645 12.221 1.00 17.66 ? 27  TYR H CE2 1 
ATOM 1893 C CZ  . TYR B 2 27  ? 41.726 24.622 13.586 1.00 15.66 ? 27  TYR H CZ  1 
ATOM 1894 O OH  . TYR B 2 27  ? 41.888 25.842 14.195 1.00 16.48 ? 27  TYR H OH  1 
ATOM 1895 N N   . ALA B 2 28  ? 42.612 21.847 8.766  1.00 7.11  ? 28  ALA H N   1 
ATOM 1896 C CA  . ALA B 2 28  ? 43.278 22.822 7.936  1.00 4.12  ? 28  ALA H CA  1 
ATOM 1897 C C   . ALA B 2 28  ? 43.284 24.178 8.637  1.00 7.15  ? 28  ALA H C   1 
ATOM 1898 O O   . ALA B 2 28  ? 42.392 24.980 8.426  1.00 14.82 ? 28  ALA H O   1 
ATOM 1899 C CB  . ALA B 2 28  ? 42.564 22.905 6.628  1.00 8.10  ? 28  ALA H CB  1 
ATOM 1900 N N   . PHE B 2 29  ? 44.285 24.422 9.478  1.00 9.93  ? 29  PHE H N   1 
ATOM 1901 C CA  . PHE B 2 29  ? 44.434 25.668 10.253 1.00 10.87 ? 29  PHE H CA  1 
ATOM 1902 C C   . PHE B 2 29  ? 44.223 26.977 9.495  1.00 13.75 ? 29  PHE H C   1 
ATOM 1903 O O   . PHE B 2 29  ? 43.874 27.997 10.080 1.00 15.32 ? 29  PHE H O   1 
ATOM 1904 C CB  . PHE B 2 29  ? 45.808 25.689 10.952 1.00 9.21  ? 29  PHE H CB  1 
ATOM 1905 C CG  . PHE B 2 29  ? 46.171 27.017 11.544 1.00 10.22 ? 29  PHE H CG  1 
ATOM 1906 C CD1 . PHE B 2 29  ? 45.553 27.477 12.706 1.00 9.41  ? 29  PHE H CD1 1 
ATOM 1907 C CD2 . PHE B 2 29  ? 47.107 27.842 10.911 1.00 13.58 ? 29  PHE H CD2 1 
ATOM 1908 C CE1 . PHE B 2 29  ? 45.860 28.752 13.233 1.00 8.37  ? 29  PHE H CE1 1 
ATOM 1909 C CE2 . PHE B 2 29  ? 47.428 29.122 11.430 1.00 11.19 ? 29  PHE H CE2 1 
ATOM 1910 C CZ  . PHE B 2 29  ? 46.797 29.574 12.594 1.00 7.91  ? 29  PHE H CZ  1 
ATOM 1911 N N   . THR B 2 30  ? 44.442 26.966 8.192  1.00 18.44 ? 30  THR H N   1 
ATOM 1912 C CA  . THR B 2 30  ? 44.283 28.183 7.415  1.00 21.14 ? 30  THR H CA  1 
ATOM 1913 C C   . THR B 2 30  ? 42.950 28.306 6.674  1.00 24.45 ? 30  THR H C   1 
ATOM 1914 O O   . THR B 2 30  ? 42.700 29.288 5.956  1.00 24.63 ? 30  THR H O   1 
ATOM 1915 C CB  . THR B 2 30  ? 45.477 28.349 6.486  1.00 21.72 ? 30  THR H CB  1 
ATOM 1916 O OG1 . THR B 2 30  ? 45.852 27.057 5.977  1.00 22.15 ? 30  THR H OG1 1 
ATOM 1917 C CG2 . THR B 2 30  ? 46.666 28.956 7.270  1.00 18.89 ? 30  THR H CG2 1 
ATOM 1918 N N   . ASP B 2 31  ? 42.065 27.341 6.902  1.00 27.02 ? 31  ASP H N   1 
ATOM 1919 C CA  . ASP B 2 31  ? 40.758 27.353 6.267  1.00 27.49 ? 31  ASP H CA  1 
ATOM 1920 C C   . ASP B 2 31  ? 39.635 27.697 7.243  1.00 23.55 ? 31  ASP H C   1 
ATOM 1921 O O   . ASP B 2 31  ? 38.467 27.614 6.907  1.00 25.32 ? 31  ASP H O   1 
ATOM 1922 C CB  . ASP B 2 31  ? 40.490 26.029 5.536  1.00 29.47 ? 31  ASP H CB  1 
ATOM 1923 C CG  . ASP B 2 31  ? 40.240 26.238 4.029  1.00 32.40 ? 31  ASP H CG  1 
ATOM 1924 O OD1 . ASP B 2 31  ? 41.175 25.998 3.228  1.00 30.62 ? 31  ASP H OD1 1 
ATOM 1925 O OD2 . ASP B 2 31  ? 39.116 26.663 3.654  1.00 30.19 ? 31  ASP H OD2 1 
ATOM 1926 N N   . TYR B 2 32  ? 39.997 28.115 8.443  1.00 21.06 ? 32  TYR H N   1 
ATOM 1927 C CA  . TYR B 2 32  ? 39.017 28.498 9.445  1.00 21.02 ? 32  TYR H CA  1 
ATOM 1928 C C   . TYR B 2 32  ? 39.661 29.588 10.288 1.00 19.35 ? 32  TYR H C   1 
ATOM 1929 O O   . TYR B 2 32  ? 40.724 29.377 10.871 1.00 18.74 ? 32  TYR H O   1 
ATOM 1930 C CB  . TYR B 2 32  ? 38.646 27.307 10.338 1.00 23.24 ? 32  TYR H CB  1 
ATOM 1931 C CG  . TYR B 2 32  ? 37.788 26.259 9.667  1.00 24.33 ? 32  TYR H CG  1 
ATOM 1932 C CD1 . TYR B 2 32  ? 36.721 26.629 8.847  1.00 26.15 ? 32  TYR H CD1 1 
ATOM 1933 C CD2 . TYR B 2 32  ? 38.057 24.906 9.828  1.00 22.19 ? 32  TYR H CD2 1 
ATOM 1934 C CE1 . TYR B 2 32  ? 35.957 25.682 8.205  1.00 25.68 ? 32  TYR H CE1 1 
ATOM 1935 C CE2 . TYR B 2 32  ? 37.300 23.951 9.196  1.00 24.56 ? 32  TYR H CE2 1 
ATOM 1936 C CZ  . TYR B 2 32  ? 36.253 24.344 8.380  1.00 26.56 ? 32  TYR H CZ  1 
ATOM 1937 O OH  . TYR B 2 32  ? 35.513 23.404 7.700  1.00 32.10 ? 32  TYR H OH  1 
ATOM 1938 N N   . SER B 2 33  ? 39.046 30.761 10.347 1.00 16.03 ? 33  SER H N   1 
ATOM 1939 C CA  . SER B 2 33  ? 39.648 31.813 11.138 1.00 14.53 ? 33  SER H CA  1 
ATOM 1940 C C   . SER B 2 33  ? 39.477 31.493 12.613 1.00 12.26 ? 33  SER H C   1 
ATOM 1941 O O   . SER B 2 33  ? 38.511 30.825 13.014 1.00 10.10 ? 33  SER H O   1 
ATOM 1942 C CB  . SER B 2 33  ? 39.167 33.248 10.737 1.00 13.88 ? 33  SER H CB  1 
ATOM 1943 O OG  . SER B 2 33  ? 37.836 33.596 11.091 1.00 10.57 ? 33  SER H OG  1 
ATOM 1944 N N   . MET B 2 34  ? 40.482 31.896 13.387 1.00 10.93 ? 34  MET H N   1 
ATOM 1945 C CA  . MET B 2 34  ? 40.509 31.697 14.828 1.00 8.12  ? 34  MET H CA  1 
ATOM 1946 C C   . MET B 2 34  ? 39.796 32.848 15.528 1.00 8.32  ? 34  MET H C   1 
ATOM 1947 O O   . MET B 2 34  ? 39.806 33.996 15.054 1.00 3.34  ? 34  MET H O   1 
ATOM 1948 C CB  . MET B 2 34  ? 41.948 31.670 15.322 1.00 9.88  ? 34  MET H CB  1 
ATOM 1949 C CG  . MET B 2 34  ? 42.134 30.888 16.594 1.00 8.37  ? 34  MET H CG  1 
ATOM 1950 S SD  . MET B 2 34  ? 41.704 29.164 16.318 1.00 8.30  ? 34  MET H SD  1 
ATOM 1951 C CE  . MET B 2 34  ? 43.328 28.421 16.184 1.00 2.00  ? 34  MET H CE  1 
ATOM 1952 N N   . HIS B 2 35  ? 39.215 32.537 16.680 1.00 8.63  ? 35  HIS H N   1 
ATOM 1953 C CA  . HIS B 2 35  ? 38.511 33.518 17.487 1.00 5.94  ? 35  HIS H CA  1 
ATOM 1954 C C   . HIS B 2 35  ? 39.070 33.532 18.913 1.00 7.67  ? 35  HIS H C   1 
ATOM 1955 O O   . HIS B 2 35  ? 39.553 32.514 19.431 1.00 2.00  ? 35  HIS H O   1 
ATOM 1956 C CB  . HIS B 2 35  ? 37.031 33.192 17.550 1.00 3.28  ? 35  HIS H CB  1 
ATOM 1957 C CG  . HIS B 2 35  ? 36.334 33.245 16.230 1.00 3.50  ? 35  HIS H CG  1 
ATOM 1958 N ND1 . HIS B 2 35  ? 35.619 34.342 15.817 1.00 2.00  ? 35  HIS H ND1 1 
ATOM 1959 C CD2 . HIS B 2 35  ? 36.171 32.304 15.268 1.00 6.40  ? 35  HIS H CD2 1 
ATOM 1960 C CE1 . HIS B 2 35  ? 35.038 34.090 14.663 1.00 5.80  ? 35  HIS H CE1 1 
ATOM 1961 N NE2 . HIS B 2 35  ? 35.360 32.845 14.305 1.00 10.50 ? 35  HIS H NE2 1 
ATOM 1962 N N   . TRP B 2 36  ? 38.969 34.689 19.557 1.00 9.57  ? 36  TRP H N   1 
ATOM 1963 C CA  . TRP B 2 36  ? 39.462 34.853 20.922 1.00 7.70  ? 36  TRP H CA  1 
ATOM 1964 C C   . TRP B 2 36  ? 38.369 35.414 21.806 1.00 2.00  ? 36  TRP H C   1 
ATOM 1965 O O   . TRP B 2 36  ? 37.739 36.391 21.443 1.00 3.36  ? 36  TRP H O   1 
ATOM 1966 C CB  . TRP B 2 36  ? 40.672 35.792 20.914 1.00 9.29  ? 36  TRP H CB  1 
ATOM 1967 C CG  . TRP B 2 36  ? 41.773 35.258 20.069 1.00 9.30  ? 36  TRP H CG  1 
ATOM 1968 C CD1 . TRP B 2 36  ? 41.908 35.386 18.713 1.00 7.36  ? 36  TRP H CD1 1 
ATOM 1969 C CD2 . TRP B 2 36  ? 42.824 34.394 20.495 1.00 9.06  ? 36  TRP H CD2 1 
ATOM 1970 N NE1 . TRP B 2 36  ? 42.972 34.641 18.275 1.00 9.06  ? 36  TRP H NE1 1 
ATOM 1971 C CE2 . TRP B 2 36  ? 43.553 34.017 19.352 1.00 9.37  ? 36  TRP H CE2 1 
ATOM 1972 C CE3 . TRP B 2 36  ? 43.220 33.898 21.743 1.00 8.77  ? 36  TRP H CE3 1 
ATOM 1973 C CZ2 . TRP B 2 36  ? 44.655 33.160 19.407 1.00 10.67 ? 36  TRP H CZ2 1 
ATOM 1974 C CZ3 . TRP B 2 36  ? 44.314 33.050 21.798 1.00 11.51 ? 36  TRP H CZ3 1 
ATOM 1975 C CH2 . TRP B 2 36  ? 45.021 32.690 20.632 1.00 8.90  ? 36  TRP H CH2 1 
ATOM 1976 N N   . VAL B 2 37  ? 38.114 34.792 22.945 1.00 2.00  ? 37  VAL H N   1 
ATOM 1977 C CA  . VAL B 2 37  ? 37.077 35.303 23.833 1.00 5.78  ? 37  VAL H CA  1 
ATOM 1978 C C   . VAL B 2 37  ? 37.695 35.640 25.181 1.00 5.40  ? 37  VAL H C   1 
ATOM 1979 O O   . VAL B 2 37  ? 38.725 35.071 25.563 1.00 9.00  ? 37  VAL H O   1 
ATOM 1980 C CB  . VAL B 2 37  ? 35.860 34.323 23.995 1.00 7.02  ? 37  VAL H CB  1 
ATOM 1981 C CG1 . VAL B 2 37  ? 35.583 33.566 22.691 1.00 6.97  ? 37  VAL H CG1 1 
ATOM 1982 C CG2 . VAL B 2 37  ? 36.062 33.388 25.148 1.00 3.82  ? 37  VAL H CG2 1 
ATOM 1983 N N   . LYS B 2 38  ? 37.123 36.614 25.863 1.00 2.00  ? 38  LYS H N   1 
ATOM 1984 C CA  . LYS B 2 38  ? 37.639 37.017 27.143 1.00 2.00  ? 38  LYS H CA  1 
ATOM 1985 C C   . LYS B 2 38  ? 36.653 36.649 28.216 1.00 2.00  ? 38  LYS H C   1 
ATOM 1986 O O   . LYS B 2 38  ? 35.459 36.811 28.055 1.00 3.47  ? 38  LYS H O   1 
ATOM 1987 C CB  . LYS B 2 38  ? 37.864 38.519 27.151 1.00 5.51  ? 38  LYS H CB  1 
ATOM 1988 C CG  . LYS B 2 38  ? 38.221 39.083 28.521 1.00 6.88  ? 38  LYS H CG  1 
ATOM 1989 C CD  . LYS B 2 38  ? 38.416 40.578 28.469 1.00 5.19  ? 38  LYS H CD  1 
ATOM 1990 C CE  . LYS B 2 38  ? 38.907 41.117 29.784 1.00 5.89  ? 38  LYS H CE  1 
ATOM 1991 N NZ  . LYS B 2 38  ? 39.438 42.494 29.581 1.00 11.67 ? 38  LYS H NZ  1 
ATOM 1992 N N   . GLN B 2 39  ? 37.150 36.169 29.334 1.00 2.00  ? 39  GLN H N   1 
ATOM 1993 C CA  . GLN B 2 39  ? 36.266 35.809 30.414 1.00 2.74  ? 39  GLN H CA  1 
ATOM 1994 C C   . GLN B 2 39  ? 36.804 36.390 31.729 1.00 5.18  ? 39  GLN H C   1 
ATOM 1995 O O   . GLN B 2 39  ? 37.753 35.859 32.301 1.00 8.98  ? 39  GLN H O   1 
ATOM 1996 C CB  . GLN B 2 39  ? 36.133 34.298 30.486 1.00 2.00  ? 39  GLN H CB  1 
ATOM 1997 C CG  . GLN B 2 39  ? 35.046 33.891 31.402 1.00 4.35  ? 39  GLN H CG  1 
ATOM 1998 C CD  . GLN B 2 39  ? 34.979 32.407 31.631 1.00 6.11  ? 39  GLN H CD  1 
ATOM 1999 O OE1 . GLN B 2 39  ? 36.002 31.739 31.737 1.00 9.21  ? 39  GLN H OE1 1 
ATOM 2000 N NE2 . GLN B 2 39  ? 33.768 31.879 31.735 1.00 4.38  ? 39  GLN H NE2 1 
ATOM 2001 N N   . ALA B 2 40  ? 36.273 37.527 32.168 1.00 3.62  ? 40  ALA H N   1 
ATOM 2002 C CA  . ALA B 2 40  ? 36.748 38.139 33.415 1.00 5.19  ? 40  ALA H CA  1 
ATOM 2003 C C   . ALA B 2 40  ? 36.439 37.223 34.582 1.00 7.20  ? 40  ALA H C   1 
ATOM 2004 O O   . ALA B 2 40  ? 35.455 36.493 34.521 1.00 14.46 ? 40  ALA H O   1 
ATOM 2005 C CB  . ALA B 2 40  ? 36.095 39.469 33.625 1.00 7.03  ? 40  ALA H CB  1 
ATOM 2006 N N   . PRO B 2 41  ? 37.259 37.244 35.658 1.00 6.76  ? 41  PRO H N   1 
ATOM 2007 C CA  . PRO B 2 41  ? 37.002 36.372 36.809 1.00 7.13  ? 41  PRO H CA  1 
ATOM 2008 C C   . PRO B 2 41  ? 35.571 36.336 37.320 1.00 4.64  ? 41  PRO H C   1 
ATOM 2009 O O   . PRO B 2 41  ? 34.945 37.374 37.598 1.00 2.01  ? 41  PRO H O   1 
ATOM 2010 C CB  . PRO B 2 41  ? 38.012 36.856 37.832 1.00 5.88  ? 41  PRO H CB  1 
ATOM 2011 C CG  . PRO B 2 41  ? 39.196 37.087 36.968 1.00 5.38  ? 41  PRO H CG  1 
ATOM 2012 C CD  . PRO B 2 41  ? 38.578 37.885 35.806 1.00 8.15  ? 41  PRO H CD  1 
ATOM 2013 N N   . GLY B 2 42  ? 35.053 35.115 37.400 1.00 2.00  ? 42  GLY H N   1 
ATOM 2014 C CA  . GLY B 2 42  ? 33.692 34.954 37.832 1.00 8.75  ? 42  GLY H CA  1 
ATOM 2015 C C   . GLY B 2 42  ? 32.765 35.540 36.781 1.00 11.15 ? 42  GLY H C   1 
ATOM 2016 O O   . GLY B 2 42  ? 32.357 36.707 36.870 1.00 7.27  ? 42  GLY H O   1 
ATOM 2017 N N   . GLY B 2 43  ? 32.579 34.769 35.709 1.00 12.79 ? 43  GLY H N   1 
ATOM 2018 C CA  . GLY B 2 43  ? 31.664 35.159 34.654 1.00 11.84 ? 43  GLY H CA  1 
ATOM 2019 C C   . GLY B 2 43  ? 32.125 35.866 33.403 1.00 8.83  ? 43  GLY H C   1 
ATOM 2020 O O   . GLY B 2 43  ? 32.629 35.212 32.509 1.00 11.24 ? 43  GLY H O   1 
ATOM 2021 N N   . ASP B 2 44  ? 31.796 37.153 33.299 1.00 8.13  ? 44  ASP H N   1 
ATOM 2022 C CA  . ASP B 2 44  ? 32.116 38.005 32.158 1.00 9.83  ? 44  ASP H CA  1 
ATOM 2023 C C   . ASP B 2 44  ? 32.667 37.241 30.948 1.00 8.20  ? 44  ASP H C   1 
ATOM 2024 O O   . ASP B 2 44  ? 33.882 37.078 30.831 1.00 5.59  ? 44  ASP H O   1 
ATOM 2025 C CB  . ASP B 2 44  ? 33.079 39.138 32.600 1.00 13.47 ? 44  ASP H CB  1 
ATOM 2026 C CG  . ASP B 2 44  ? 33.348 40.202 31.492 1.00 16.13 ? 44  ASP H CG  1 
ATOM 2027 O OD1 . ASP B 2 44  ? 34.509 40.317 31.005 1.00 11.54 ? 44  ASP H OD1 1 
ATOM 2028 O OD2 . ASP B 2 44  ? 32.404 40.951 31.138 1.00 16.31 ? 44  ASP H OD2 1 
ATOM 2029 N N   . LEU B 2 45  ? 31.773 36.733 30.085 1.00 8.47  ? 45  LEU H N   1 
ATOM 2030 C CA  . LEU B 2 45  ? 32.188 36.022 28.851 1.00 5.92  ? 45  LEU H CA  1 
ATOM 2031 C C   . LEU B 2 45  ? 32.055 36.979 27.670 1.00 2.00  ? 45  LEU H C   1 
ATOM 2032 O O   . LEU B 2 45  ? 30.983 37.128 27.117 1.00 2.00  ? 45  LEU H O   1 
ATOM 2033 C CB  . LEU B 2 45  ? 31.327 34.773 28.598 1.00 5.56  ? 45  LEU H CB  1 
ATOM 2034 C CG  . LEU B 2 45  ? 31.939 33.366 28.699 1.00 2.00  ? 45  LEU H CG  1 
ATOM 2035 C CD1 . LEU B 2 45  ? 30.929 32.377 28.263 1.00 2.00  ? 45  LEU H CD1 1 
ATOM 2036 C CD2 . LEU B 2 45  ? 33.133 33.218 27.845 1.00 2.00  ? 45  LEU H CD2 1 
ATOM 2037 N N   . LYS B 2 46  ? 33.119 37.709 27.366 1.00 2.61  ? 46  LYS H N   1 
ATOM 2038 C CA  . LYS B 2 46  ? 33.134 38.671 26.258 1.00 5.43  ? 46  LYS H CA  1 
ATOM 2039 C C   . LYS B 2 46  ? 33.885 38.184 25.004 1.00 4.28  ? 46  LYS H C   1 
ATOM 2040 O O   . LYS B 2 46  ? 34.767 37.341 25.079 1.00 7.21  ? 46  LYS H O   1 
ATOM 2041 C CB  . LYS B 2 46  ? 33.730 39.996 26.714 1.00 4.04  ? 46  LYS H CB  1 
ATOM 2042 C CG  . LYS B 2 46  ? 32.702 41.041 27.097 1.00 7.87  ? 46  LYS H CG  1 
ATOM 2043 C CD  . LYS B 2 46  ? 33.158 42.433 26.613 1.00 10.13 ? 46  LYS H CD  1 
ATOM 2044 C CE  . LYS B 2 46  ? 32.403 43.583 27.300 1.00 13.58 ? 46  LYS H CE  1 
ATOM 2045 N NZ  . LYS B 2 46  ? 30.912 43.459 27.260 1.00 12.13 ? 46  LYS H NZ  1 
ATOM 2046 N N   . TYR B 2 47  ? 33.579 38.767 23.856 1.00 4.50  ? 47  TYR H N   1 
ATOM 2047 C CA  . TYR B 2 47  ? 34.218 38.349 22.616 1.00 6.10  ? 47  TYR H CA  1 
ATOM 2048 C C   . TYR B 2 47  ? 35.270 39.376 22.154 1.00 2.99  ? 47  TYR H C   1 
ATOM 2049 O O   . TYR B 2 47  ? 34.939 40.546 21.977 1.00 2.00  ? 47  TYR H O   1 
ATOM 2050 C CB  . TYR B 2 47  ? 33.116 38.078 21.576 1.00 6.58  ? 47  TYR H CB  1 
ATOM 2051 C CG  . TYR B 2 47  ? 33.570 37.718 20.188 1.00 4.91  ? 47  TYR H CG  1 
ATOM 2052 C CD1 . TYR B 2 47  ? 34.276 36.553 19.931 1.00 2.54  ? 47  TYR H CD1 1 
ATOM 2053 C CD2 . TYR B 2 47  ? 33.320 38.580 19.137 1.00 9.42  ? 47  TYR H CD2 1 
ATOM 2054 C CE1 . TYR B 2 47  ? 34.720 36.275 18.665 1.00 5.43  ? 47  TYR H CE1 1 
ATOM 2055 C CE2 . TYR B 2 47  ? 33.753 38.307 17.870 1.00 9.32  ? 47  TYR H CE2 1 
ATOM 2056 C CZ  . TYR B 2 47  ? 34.453 37.169 17.640 1.00 7.52  ? 47  TYR H CZ  1 
ATOM 2057 O OH  . TYR B 2 47  ? 34.887 36.972 16.363 1.00 13.35 ? 47  TYR H OH  1 
ATOM 2058 N N   . VAL B 2 48  ? 36.533 38.930 22.045 1.00 2.00  ? 48  VAL H N   1 
ATOM 2059 C CA  . VAL B 2 48  ? 37.686 39.755 21.649 1.00 2.81  ? 48  VAL H CA  1 
ATOM 2060 C C   . VAL B 2 48  ? 37.768 40.065 20.161 1.00 3.44  ? 48  VAL H C   1 
ATOM 2061 O O   . VAL B 2 48  ? 37.989 41.211 19.764 1.00 7.59  ? 48  VAL H O   1 
ATOM 2062 C CB  . VAL B 2 48  ? 39.027 39.113 22.043 1.00 2.00  ? 48  VAL H CB  1 
ATOM 2063 C CG1 . VAL B 2 48  ? 40.168 40.073 21.745 1.00 2.00  ? 48  VAL H CG1 1 
ATOM 2064 C CG2 . VAL B 2 48  ? 39.024 38.705 23.502 1.00 2.00  ? 48  VAL H CG2 1 
ATOM 2065 N N   . GLY B 2 49  ? 37.626 39.039 19.338 1.00 6.45  ? 49  GLY H N   1 
ATOM 2066 C CA  . GLY B 2 49  ? 37.677 39.248 17.905 1.00 9.63  ? 49  GLY H CA  1 
ATOM 2067 C C   . GLY B 2 49  ? 38.110 37.997 17.186 1.00 10.41 ? 49  GLY H C   1 
ATOM 2068 O O   . GLY B 2 49  ? 37.978 36.891 17.739 1.00 10.55 ? 49  GLY H O   1 
ATOM 2069 N N   . TRP B 2 50  ? 38.599 38.169 15.955 1.00 7.65  ? 50  TRP H N   1 
ATOM 2070 C CA  . TRP B 2 50  ? 39.073 37.063 15.146 1.00 6.77  ? 50  TRP H CA  1 
ATOM 2071 C C   . TRP B 2 50  ? 40.124 37.556 14.193 1.00 7.32  ? 50  TRP H C   1 
ATOM 2072 O O   . TRP B 2 50  ? 40.284 38.753 14.025 1.00 10.33 ? 50  TRP H O   1 
ATOM 2073 C CB  . TRP B 2 50  ? 37.924 36.406 14.376 1.00 10.11 ? 50  TRP H CB  1 
ATOM 2074 C CG  . TRP B 2 50  ? 37.493 37.052 13.079 1.00 14.36 ? 50  TRP H CG  1 
ATOM 2075 C CD1 . TRP B 2 50  ? 38.146 37.017 11.868 1.00 19.63 ? 50  TRP H CD1 1 
ATOM 2076 C CD2 . TRP B 2 50  ? 36.270 37.739 12.829 1.00 15.05 ? 50  TRP H CD2 1 
ATOM 2077 N NE1 . TRP B 2 50  ? 37.395 37.632 10.897 1.00 16.48 ? 50  TRP H NE1 1 
ATOM 2078 C CE2 . TRP B 2 50  ? 36.240 38.085 11.472 1.00 13.73 ? 50  TRP H CE2 1 
ATOM 2079 C CE3 . TRP B 2 50  ? 35.181 38.074 13.646 1.00 20.85 ? 50  TRP H CE3 1 
ATOM 2080 C CZ2 . TRP B 2 50  ? 35.185 38.761 10.899 1.00 18.58 ? 50  TRP H CZ2 1 
ATOM 2081 C CZ3 . TRP B 2 50  ? 34.116 38.746 13.073 1.00 23.13 ? 50  TRP H CZ3 1 
ATOM 2082 C CH2 . TRP B 2 50  ? 34.126 39.083 11.713 1.00 25.12 ? 50  TRP H CH2 1 
ATOM 2083 N N   . ILE B 2 51  ? 40.867 36.623 13.609 1.00 9.44  ? 51  ILE H N   1 
ATOM 2084 C CA  . ILE B 2 51  ? 41.914 36.921 12.632 1.00 7.71  ? 51  ILE H CA  1 
ATOM 2085 C C   . ILE B 2 51  ? 41.725 35.925 11.477 1.00 12.53 ? 51  ILE H C   1 
ATOM 2086 O O   . ILE B 2 51  ? 41.413 34.748 11.694 1.00 14.31 ? 51  ILE H O   1 
ATOM 2087 C CB  . ILE B 2 51  ? 43.336 36.812 13.241 1.00 2.00  ? 51  ILE H CB  1 
ATOM 2088 C CG1 . ILE B 2 51  ? 44.394 36.922 12.161 1.00 2.00  ? 51  ILE H CG1 1 
ATOM 2089 C CG2 . ILE B 2 51  ? 43.513 35.525 14.008 1.00 2.00  ? 51  ILE H CG2 1 
ATOM 2090 C CD1 . ILE B 2 51  ? 45.784 36.744 12.690 1.00 2.00  ? 51  ILE H CD1 1 
ATOM 2091 N N   . ASN B 2 52  ? 41.794 36.427 10.251 1.00 11.47 ? 52  ASN H N   1 
ATOM 2092 C CA  . ASN B 2 52  ? 41.612 35.587 9.091  1.00 8.24  ? 52  ASN H CA  1 
ATOM 2093 C C   . ASN B 2 52  ? 42.917 34.885 8.974  1.00 4.13  ? 52  ASN H C   1 
ATOM 2094 O O   . ASN B 2 52  ? 43.930 35.533 8.822  1.00 5.26  ? 52  ASN H O   1 
ATOM 2095 C CB  . ASN B 2 52  ? 41.340 36.455 7.851  1.00 13.51 ? 52  ASN H CB  1 
ATOM 2096 C CG  . ASN B 2 52  ? 41.198 35.638 6.565  1.00 11.59 ? 52  ASN H CG  1 
ATOM 2097 O OD1 . ASN B 2 52  ? 41.643 36.066 5.504  1.00 9.47  ? 52  ASN H OD1 1 
ATOM 2098 N ND2 . ASN B 2 52  ? 40.595 34.460 6.661  1.00 13.44 ? 52  ASN H ND2 1 
ATOM 2099 N N   . THR B 2 53  A 42.904 33.574 9.132  1.00 3.02  ? 52  THR H N   1 
ATOM 2100 C CA  . THR B 2 53  A 44.120 32.784 9.047  1.00 8.79  ? 52  THR H CA  1 
ATOM 2101 C C   . THR B 2 53  A 44.768 32.791 7.653  1.00 14.75 ? 52  THR H C   1 
ATOM 2102 O O   . THR B 2 53  A 45.930 32.420 7.499  1.00 17.15 ? 52  THR H O   1 
ATOM 2103 C CB  . THR B 2 53  A 43.800 31.373 9.441  1.00 8.66  ? 52  THR H CB  1 
ATOM 2104 O OG1 . THR B 2 53  A 42.547 31.029 8.844  1.00 15.80 ? 52  THR H OG1 1 
ATOM 2105 C CG2 . THR B 2 53  A 43.669 31.257 10.964 1.00 10.90 ? 52  THR H CG2 1 
ATOM 2106 N N   . GLU B 2 54  ? 43.998 33.197 6.644  1.00 20.90 ? 53  GLU H N   1 
ATOM 2107 C CA  . GLU B 2 54  ? 44.464 33.256 5.260  1.00 24.68 ? 53  GLU H CA  1 
ATOM 2108 C C   . GLU B 2 54  ? 45.267 34.529 5.053  1.00 26.80 ? 53  GLU H C   1 
ATOM 2109 O O   . GLU B 2 54  ? 46.470 34.468 4.787  1.00 29.61 ? 53  GLU H O   1 
ATOM 2110 C CB  . GLU B 2 54  ? 43.255 33.204 4.285  1.00 29.07 ? 53  GLU H CB  1 
ATOM 2111 C CG  . GLU B 2 54  ? 43.498 33.643 2.804  1.00 30.87 ? 53  GLU H CG  1 
ATOM 2112 C CD  . GLU B 2 54  ? 42.215 33.590 1.913  1.00 34.11 ? 53  GLU H CD  1 
ATOM 2113 O OE1 . GLU B 2 54  ? 41.341 34.483 2.010  1.00 31.89 ? 53  GLU H OE1 1 
ATOM 2114 O OE2 . GLU B 2 54  ? 42.084 32.654 1.091  1.00 36.14 ? 53  GLU H OE2 1 
ATOM 2115 N N   . THR B 2 55  ? 44.597 35.674 5.191  1.00 25.72 ? 54  THR H N   1 
ATOM 2116 C CA  . THR B 2 55  ? 45.232 36.969 4.989  1.00 25.26 ? 54  THR H CA  1 
ATOM 2117 C C   . THR B 2 55  ? 45.874 37.565 6.231  1.00 27.45 ? 54  THR H C   1 
ATOM 2118 O O   . THR B 2 55  ? 46.677 38.498 6.129  1.00 32.70 ? 54  THR H O   1 
ATOM 2119 C CB  . THR B 2 55  ? 44.246 38.012 4.408  1.00 20.83 ? 54  THR H CB  1 
ATOM 2120 O OG1 . THR B 2 55  ? 43.265 38.361 5.390  1.00 20.20 ? 54  THR H OG1 1 
ATOM 2121 C CG2 . THR B 2 55  ? 43.566 37.473 3.190  1.00 20.25 ? 54  THR H CG2 1 
ATOM 2122 N N   . ASP B 2 56  ? 45.544 37.016 7.392  1.00 25.99 ? 55  ASP H N   1 
ATOM 2123 C CA  . ASP B 2 56  ? 46.061 37.513 8.663  1.00 26.16 ? 55  ASP H CA  1 
ATOM 2124 C C   . ASP B 2 56  ? 45.243 38.733 9.034  1.00 25.23 ? 55  ASP H C   1 
ATOM 2125 O O   . ASP B 2 56  ? 45.560 39.409 9.996  1.00 31.22 ? 55  ASP H O   1 
ATOM 2126 C CB  . ASP B 2 56  ? 47.534 37.967 8.588  1.00 26.73 ? 55  ASP H CB  1 
ATOM 2127 C CG  . ASP B 2 56  ? 48.525 36.822 8.540  1.00 26.49 ? 55  ASP H CG  1 
ATOM 2128 O OD1 . ASP B 2 56  ? 48.369 35.930 7.681  1.00 29.62 ? 55  ASP H OD1 1 
ATOM 2129 O OD2 . ASP B 2 56  ? 49.489 36.846 9.341  1.00 23.59 ? 55  ASP H OD2 1 
ATOM 2130 N N   . GLU B 2 57  ? 44.203 39.044 8.278  1.00 24.11 ? 56  GLU H N   1 
ATOM 2131 C CA  . GLU B 2 57  ? 43.424 40.227 8.616  1.00 28.59 ? 56  GLU H CA  1 
ATOM 2132 C C   . GLU B 2 57  ? 42.538 40.127 9.861  1.00 26.81 ? 56  GLU H C   1 
ATOM 2133 O O   . GLU B 2 57  ? 41.504 39.443 9.868  1.00 29.78 ? 56  GLU H O   1 
ATOM 2134 C CB  . GLU B 2 57  ? 42.672 40.737 7.393  1.00 31.03 ? 56  GLU H CB  1 
ATOM 2135 C CG  . GLU B 2 57  ? 43.611 41.463 6.445  1.00 29.15 ? 56  GLU H CG  1 
ATOM 2136 C CD  . GLU B 2 57  ? 43.184 41.342 5.027  1.00 28.71 ? 56  GLU H CD  1 
ATOM 2137 O OE1 . GLU B 2 57  ? 41.988 41.551 4.766  1.00 31.68 ? 56  GLU H OE1 1 
ATOM 2138 O OE2 . GLU B 2 57  ? 44.036 41.027 4.173  1.00 29.18 ? 56  GLU H OE2 1 
ATOM 2139 N N   . PRO B 2 58  ? 42.952 40.814 10.937 1.00 22.18 ? 57  PRO H N   1 
ATOM 2140 C CA  . PRO B 2 58  ? 42.255 40.846 12.219 1.00 20.55 ? 57  PRO H CA  1 
ATOM 2141 C C   . PRO B 2 58  ? 40.996 41.689 12.233 1.00 17.14 ? 57  PRO H C   1 
ATOM 2142 O O   . PRO B 2 58  ? 40.897 42.677 11.522 1.00 17.85 ? 57  PRO H O   1 
ATOM 2143 C CB  . PRO B 2 58  ? 43.312 41.432 13.149 1.00 23.87 ? 57  PRO H CB  1 
ATOM 2144 C CG  . PRO B 2 58  ? 44.027 42.376 12.272 1.00 22.27 ? 57  PRO H CG  1 
ATOM 2145 C CD  . PRO B 2 58  ? 44.206 41.582 11.016 1.00 21.19 ? 57  PRO H CD  1 
ATOM 2146 N N   . THR B 2 59  ? 40.063 41.318 13.099 1.00 14.26 ? 58  THR H N   1 
ATOM 2147 C CA  . THR B 2 59  ? 38.809 42.023 13.250 1.00 10.50 ? 58  THR H CA  1 
ATOM 2148 C C   . THR B 2 59  ? 38.532 42.094 14.734 1.00 11.19 ? 58  THR H C   1 
ATOM 2149 O O   . THR B 2 59  ? 38.439 41.057 15.395 1.00 9.11  ? 58  THR H O   1 
ATOM 2150 C CB  . THR B 2 59  ? 37.687 41.301 12.521 1.00 9.88  ? 58  THR H CB  1 
ATOM 2151 O OG1 . THR B 2 59  ? 37.904 41.417 11.110 1.00 11.16 ? 58  THR H OG1 1 
ATOM 2152 C CG2 . THR B 2 59  ? 36.353 41.906 12.872 1.00 11.05 ? 58  THR H CG2 1 
ATOM 2153 N N   . PHE B 2 60  ? 38.503 43.325 15.257 1.00 11.73 ? 59  PHE H N   1 
ATOM 2154 C CA  . PHE B 2 60  ? 38.265 43.578 16.674 1.00 8.68  ? 59  PHE H CA  1 
ATOM 2155 C C   . PHE B 2 60  ? 36.925 44.185 17.006 1.00 11.66 ? 59  PHE H C   1 
ATOM 2156 O O   . PHE B 2 60  ? 36.439 45.075 16.297 1.00 9.92  ? 59  PHE H O   1 
ATOM 2157 C CB  . PHE B 2 60  ? 39.343 44.476 17.241 1.00 2.04  ? 59  PHE H CB  1 
ATOM 2158 C CG  . PHE B 2 60  ? 40.652 43.810 17.360 1.00 5.28  ? 59  PHE H CG  1 
ATOM 2159 C CD1 . PHE B 2 60  ? 41.768 44.329 16.727 1.00 6.76  ? 59  PHE H CD1 1 
ATOM 2160 C CD2 . PHE B 2 60  ? 40.776 42.635 18.085 1.00 6.21  ? 59  PHE H CD2 1 
ATOM 2161 C CE1 . PHE B 2 60  ? 42.992 43.679 16.807 1.00 6.90  ? 59  PHE H CE1 1 
ATOM 2162 C CE2 . PHE B 2 60  ? 41.994 41.980 18.171 1.00 4.38  ? 59  PHE H CE2 1 
ATOM 2163 C CZ  . PHE B 2 60  ? 43.102 42.504 17.531 1.00 7.23  ? 59  PHE H CZ  1 
ATOM 2164 N N   . ALA B 2 61  ? 36.327 43.682 18.086 1.00 13.36 ? 60  ALA H N   1 
ATOM 2165 C CA  . ALA B 2 61  ? 35.050 44.186 18.570 1.00 7.89  ? 60  ALA H CA  1 
ATOM 2166 C C   . ALA B 2 61  ? 35.367 45.501 19.255 1.00 6.31  ? 60  ALA H C   1 
ATOM 2167 O O   . ALA B 2 61  ? 36.242 45.575 20.103 1.00 2.00  ? 60  ALA H O   1 
ATOM 2168 C CB  . ALA B 2 61  ? 34.440 43.219 19.535 1.00 9.88  ? 60  ALA H CB  1 
ATOM 2169 N N   . ASP B 2 62  ? 34.710 46.548 18.788 1.00 11.59 ? 61  ASP H N   1 
ATOM 2170 C CA  . ASP B 2 62  ? 34.878 47.912 19.274 1.00 12.95 ? 61  ASP H CA  1 
ATOM 2171 C C   . ASP B 2 62  ? 35.744 48.165 20.500 1.00 11.90 ? 61  ASP H C   1 
ATOM 2172 O O   . ASP B 2 62  ? 36.622 49.015 20.443 1.00 12.68 ? 61  ASP H O   1 
ATOM 2173 C CB  . ASP B 2 62  ? 33.509 48.587 19.425 1.00 14.49 ? 61  ASP H CB  1 
ATOM 2174 C CG  . ASP B 2 62  ? 33.594 49.932 20.127 1.00 23.14 ? 61  ASP H CG  1 
ATOM 2175 O OD1 . ASP B 2 62  ? 33.056 50.060 21.256 1.00 26.50 ? 61  ASP H OD1 1 
ATOM 2176 O OD2 . ASP B 2 62  ? 34.209 50.864 19.561 1.00 28.35 ? 61  ASP H OD2 1 
ATOM 2177 N N   . ASP B 2 63  ? 35.531 47.407 21.576 1.00 12.32 ? 62  ASP H N   1 
ATOM 2178 C CA  . ASP B 2 63  ? 36.255 47.583 22.843 1.00 9.37  ? 62  ASP H CA  1 
ATOM 2179 C C   . ASP B 2 63  ? 37.675 47.068 22.877 1.00 6.60  ? 62  ASP H C   1 
ATOM 2180 O O   . ASP B 2 63  ? 38.487 47.576 23.633 1.00 8.47  ? 62  ASP H O   1 
ATOM 2181 C CB  . ASP B 2 63  ? 35.491 46.938 24.000 1.00 12.95 ? 62  ASP H CB  1 
ATOM 2182 C CG  . ASP B 2 63  ? 34.119 47.565 24.242 1.00 18.70 ? 62  ASP H CG  1 
ATOM 2183 O OD1 . ASP B 2 63  ? 33.263 46.872 24.838 1.00 22.56 ? 62  ASP H OD1 1 
ATOM 2184 O OD2 . ASP B 2 63  ? 33.879 48.734 23.854 1.00 20.78 ? 62  ASP H OD2 1 
ATOM 2185 N N   . PHE B 2 64  ? 37.972 46.031 22.102 1.00 6.68  ? 63  PHE H N   1 
ATOM 2186 C CA  . PHE B 2 64  ? 39.329 45.475 22.057 1.00 5.09  ? 63  PHE H CA  1 
ATOM 2187 C C   . PHE B 2 64  ? 40.030 46.151 20.901 1.00 4.40  ? 63  PHE H C   1 
ATOM 2188 O O   . PHE B 2 64  ? 40.906 45.585 20.268 1.00 8.67  ? 63  PHE H O   1 
ATOM 2189 C CB  . PHE B 2 64  ? 39.289 43.940 21.891 1.00 5.35  ? 63  PHE H CB  1 
ATOM 2190 C CG  . PHE B 2 64  ? 38.495 43.247 22.979 1.00 4.21  ? 63  PHE H CG  1 
ATOM 2191 C CD1 . PHE B 2 64  ? 37.140 43.012 22.829 1.00 2.00  ? 63  PHE H CD1 1 
ATOM 2192 C CD2 . PHE B 2 64  ? 39.079 42.956 24.205 1.00 5.55  ? 63  PHE H CD2 1 
ATOM 2193 C CE1 . PHE B 2 64  ? 36.396 42.519 23.880 1.00 2.17  ? 63  PHE H CE1 1 
ATOM 2194 C CE2 . PHE B 2 64  ? 38.331 42.462 25.253 1.00 2.00  ? 63  PHE H CE2 1 
ATOM 2195 C CZ  . PHE B 2 64  ? 36.997 42.248 25.092 1.00 2.00  ? 63  PHE H CZ  1 
ATOM 2196 N N   . LYS B 2 65  ? 39.647 47.397 20.657 1.00 6.07  ? 64  LYS H N   1 
ATOM 2197 C CA  . LYS B 2 65  ? 40.203 48.197 19.583 1.00 9.10  ? 64  LYS H CA  1 
ATOM 2198 C C   . LYS B 2 65  ? 41.263 49.167 20.106 1.00 13.86 ? 64  LYS H C   1 
ATOM 2199 O O   . LYS B 2 65  ? 41.262 50.342 19.752 1.00 19.09 ? 64  LYS H O   1 
ATOM 2200 C CB  . LYS B 2 65  ? 39.073 48.960 18.895 1.00 5.85  ? 64  LYS H CB  1 
ATOM 2201 C CG  . LYS B 2 65  ? 38.779 48.454 17.513 1.00 7.88  ? 64  LYS H CG  1 
ATOM 2202 C CD  . LYS B 2 65  ? 37.355 48.718 17.074 1.00 6.28  ? 64  LYS H CD  1 
ATOM 2203 C CE  . LYS B 2 65  ? 37.134 48.187 15.650 1.00 5.27  ? 64  LYS H CE  1 
ATOM 2204 N NZ  . LYS B 2 65  ? 35.692 48.143 15.274 1.00 7.23  ? 64  LYS H NZ  1 
ATOM 2205 N N   . GLY B 2 66  ? 42.191 48.665 20.918 1.00 16.85 ? 65  GLY H N   1 
ATOM 2206 C CA  . GLY B 2 66  ? 43.223 49.524 21.472 1.00 11.93 ? 65  GLY H CA  1 
ATOM 2207 C C   . GLY B 2 66  ? 44.584 48.880 21.696 1.00 8.34  ? 65  GLY H C   1 
ATOM 2208 O O   . GLY B 2 66  ? 45.564 49.257 21.056 1.00 7.37  ? 65  GLY H O   1 
ATOM 2209 N N   . ARG B 2 67  ? 44.665 47.901 22.583 1.00 3.69  ? 66  ARG H N   1 
ATOM 2210 C CA  . ARG B 2 67  ? 45.959 47.297 22.844 1.00 7.42  ? 66  ARG H CA  1 
ATOM 2211 C C   . ARG B 2 67  ? 46.073 45.820 22.441 1.00 10.28 ? 66  ARG H C   1 
ATOM 2212 O O   . ARG B 2 67  ? 47.140 45.205 22.610 1.00 8.90  ? 66  ARG H O   1 
ATOM 2213 C CB  . ARG B 2 67  ? 46.328 47.511 24.305 1.00 6.37  ? 66  ARG H CB  1 
ATOM 2214 C CG  . ARG B 2 67  ? 45.640 48.715 24.887 1.00 3.12  ? 66  ARG H CG  1 
ATOM 2215 C CD  . ARG B 2 67  ? 45.929 48.856 26.348 1.00 8.24  ? 66  ARG H CD  1 
ATOM 2216 N NE  . ARG B 2 67  ? 45.421 47.758 27.169 1.00 6.08  ? 66  ARG H NE  1 
ATOM 2217 C CZ  . ARG B 2 67  ? 44.154 47.644 27.548 1.00 10.00 ? 66  ARG H CZ  1 
ATOM 2218 N NH1 . ARG B 2 67  ? 43.246 48.544 27.159 1.00 12.45 ? 66  ARG H NH1 1 
ATOM 2219 N NH2 . ARG B 2 67  ? 43.825 46.720 28.431 1.00 7.60  ? 66  ARG H NH2 1 
ATOM 2220 N N   . PHE B 2 68  ? 45.002 45.272 21.865 1.00 7.60  ? 67  PHE H N   1 
ATOM 2221 C CA  . PHE B 2 68  ? 45.011 43.880 21.433 1.00 10.08 ? 67  PHE H CA  1 
ATOM 2222 C C   . PHE B 2 68  ? 45.598 43.658 20.007 1.00 8.02  ? 67  PHE H C   1 
ATOM 2223 O O   . PHE B 2 68  ? 45.460 44.502 19.125 1.00 3.44  ? 67  PHE H O   1 
ATOM 2224 C CB  . PHE B 2 68  ? 43.603 43.282 21.584 1.00 11.04 ? 67  PHE H CB  1 
ATOM 2225 C CG  . PHE B 2 68  ? 43.127 43.206 23.020 1.00 12.89 ? 67  PHE H CG  1 
ATOM 2226 C CD1 . PHE B 2 68  ? 42.963 44.355 23.782 1.00 12.81 ? 67  PHE H CD1 1 
ATOM 2227 C CD2 . PHE B 2 68  ? 42.900 41.978 23.629 1.00 15.40 ? 67  PHE H CD2 1 
ATOM 2228 C CE1 . PHE B 2 68  ? 42.590 44.270 25.123 1.00 13.45 ? 67  PHE H CE1 1 
ATOM 2229 C CE2 . PHE B 2 68  ? 42.525 41.891 24.974 1.00 13.22 ? 67  PHE H CE2 1 
ATOM 2230 C CZ  . PHE B 2 68  ? 42.374 43.033 25.716 1.00 13.60 ? 67  PHE H CZ  1 
ATOM 2231 N N   . ALA B 2 69  ? 46.304 42.549 19.804 1.00 4.46  ? 68  ALA H N   1 
ATOM 2232 C CA  . ALA B 2 69  ? 46.871 42.256 18.496 1.00 5.82  ? 68  ALA H CA  1 
ATOM 2233 C C   . ALA B 2 69  ? 46.754 40.776 18.188 1.00 8.28  ? 68  ALA H C   1 
ATOM 2234 O O   . ALA B 2 69  ? 46.944 39.937 19.081 1.00 6.35  ? 68  ALA H O   1 
ATOM 2235 C CB  . ALA B 2 69  ? 48.333 42.684 18.434 1.00 10.71 ? 68  ALA H CB  1 
ATOM 2236 N N   . PHE B 2 70  ? 46.444 40.473 16.924 1.00 8.99  ? 69  PHE H N   1 
ATOM 2237 C CA  . PHE B 2 70  ? 46.271 39.109 16.436 1.00 7.60  ? 69  PHE H CA  1 
ATOM 2238 C C   . PHE B 2 70  ? 47.313 38.863 15.372 1.00 12.56 ? 69  PHE H C   1 
ATOM 2239 O O   . PHE B 2 70  ? 47.458 39.663 14.451 1.00 16.76 ? 69  PHE H O   1 
ATOM 2240 C CB  . PHE B 2 70  ? 44.904 38.953 15.793 1.00 5.31  ? 69  PHE H CB  1 
ATOM 2241 C CG  . PHE B 2 70  ? 43.761 38.917 16.771 1.00 6.45  ? 69  PHE H CG  1 
ATOM 2242 C CD1 . PHE B 2 70  ? 43.975 38.617 18.124 1.00 4.45  ? 69  PHE H CD1 1 
ATOM 2243 C CD2 . PHE B 2 70  ? 42.459 39.162 16.335 1.00 2.73  ? 69  PHE H CD2 1 
ATOM 2244 C CE1 . PHE B 2 70  ? 42.920 38.569 19.018 1.00 2.00  ? 69  PHE H CE1 1 
ATOM 2245 C CE2 . PHE B 2 70  ? 41.404 39.111 17.225 1.00 4.80  ? 69  PHE H CE2 1 
ATOM 2246 C CZ  . PHE B 2 70  ? 41.638 38.810 18.575 1.00 3.86  ? 69  PHE H CZ  1 
ATOM 2247 N N   . SER B 2 71  ? 47.960 37.707 15.442 1.00 18.36 ? 70  SER H N   1 
ATOM 2248 C CA  . SER B 2 71  ? 49.016 37.330 14.500 1.00 19.70 ? 70  SER H CA  1 
ATOM 2249 C C   . SER B 2 71  ? 49.128 35.802 14.438 1.00 22.02 ? 70  SER H C   1 
ATOM 2250 O O   . SER B 2 71  ? 48.569 35.112 15.304 1.00 28.11 ? 70  SER H O   1 
ATOM 2251 C CB  . SER B 2 71  ? 50.325 37.912 15.016 1.00 18.37 ? 70  SER H CB  1 
ATOM 2252 O OG  . SER B 2 71  ? 50.360 37.814 16.433 1.00 12.76 ? 70  SER H OG  1 
ATOM 2253 N N   . LEU B 2 72  ? 49.826 35.254 13.444 1.00 18.52 ? 71  LEU H N   1 
ATOM 2254 C CA  . LEU B 2 72  ? 49.957 33.808 13.417 1.00 18.13 ? 71  LEU H CA  1 
ATOM 2255 C C   . LEU B 2 72  ? 51.163 33.215 12.705 1.00 21.20 ? 71  LEU H C   1 
ATOM 2256 O O   . LEU B 2 72  ? 51.773 33.863 11.853 1.00 23.88 ? 71  LEU H O   1 
ATOM 2257 C CB  . LEU B 2 72  ? 48.677 33.201 12.876 1.00 16.51 ? 71  LEU H CB  1 
ATOM 2258 C CG  . LEU B 2 72  ? 48.151 33.743 11.567 1.00 13.52 ? 71  LEU H CG  1 
ATOM 2259 C CD1 . LEU B 2 72  ? 48.649 32.856 10.437 1.00 16.96 ? 71  LEU H CD1 1 
ATOM 2260 C CD2 . LEU B 2 72  ? 46.647 33.702 11.610 1.00 15.42 ? 71  LEU H CD2 1 
ATOM 2261 N N   . ASP B 2 73  ? 51.521 31.986 13.086 1.00 21.90 ? 72  ASP H N   1 
ATOM 2262 C CA  . ASP B 2 73  ? 52.622 31.272 12.444 1.00 20.86 ? 72  ASP H CA  1 
ATOM 2263 C C   . ASP B 2 73  ? 52.012 30.072 11.735 1.00 20.69 ? 72  ASP H C   1 
ATOM 2264 O O   . ASP B 2 73  ? 51.512 29.152 12.383 1.00 24.41 ? 72  ASP H O   1 
ATOM 2265 C CB  . ASP B 2 73  ? 53.672 30.793 13.454 1.00 19.80 ? 72  ASP H CB  1 
ATOM 2266 C CG  . ASP B 2 73  ? 54.917 30.202 12.769 1.00 21.82 ? 72  ASP H CG  1 
ATOM 2267 O OD1 . ASP B 2 73  ? 54.963 30.166 11.512 1.00 26.68 ? 72  ASP H OD1 1 
ATOM 2268 O OD2 . ASP B 2 73  ? 55.859 29.780 13.482 1.00 17.56 ? 72  ASP H OD2 1 
ATOM 2269 N N   . THR B 2 74  ? 52.028 30.091 10.409 1.00 16.90 ? 73  THR H N   1 
ATOM 2270 C CA  . THR B 2 74  ? 51.466 28.989 9.644  1.00 15.99 ? 73  THR H CA  1 
ATOM 2271 C C   . THR B 2 74  ? 52.377 27.780 9.643  1.00 14.99 ? 73  THR H C   1 
ATOM 2272 O O   . THR B 2 74  ? 51.918 26.642 9.540  1.00 14.57 ? 73  THR H O   1 
ATOM 2273 C CB  . THR B 2 74  ? 51.206 29.387 8.196  1.00 17.73 ? 73  THR H CB  1 
ATOM 2274 O OG1 . THR B 2 74  ? 52.389 29.984 7.652  1.00 17.44 ? 73  THR H OG1 1 
ATOM 2275 C CG2 . THR B 2 74  ? 50.035 30.370 8.104  1.00 21.67 ? 73  THR H CG2 1 
ATOM 2276 N N   . SER B 2 75  ? 53.674 28.014 9.746  1.00 12.97 ? 74  SER H N   1 
ATOM 2277 C CA  . SER B 2 75  ? 54.591 26.887 9.759  1.00 16.41 ? 74  SER H CA  1 
ATOM 2278 C C   . SER B 2 75  ? 54.635 26.189 11.125 1.00 15.37 ? 74  SER H C   1 
ATOM 2279 O O   . SER B 2 75  ? 55.685 25.664 11.537 1.00 12.82 ? 74  SER H O   1 
ATOM 2280 C CB  . SER B 2 75  ? 55.984 27.294 9.251  1.00 16.53 ? 74  SER H CB  1 
ATOM 2281 O OG  . SER B 2 75  ? 55.971 27.432 7.829  1.00 18.86 ? 74  SER H OG  1 
ATOM 2282 N N   . THR B 2 76  ? 53.469 26.174 11.786 1.00 11.65 ? 75  THR H N   1 
ATOM 2283 C CA  . THR B 2 76  ? 53.243 25.556 13.100 1.00 11.89 ? 75  THR H CA  1 
ATOM 2284 C C   . THR B 2 76  ? 51.741 25.443 13.312 1.00 8.92  ? 75  THR H C   1 
ATOM 2285 O O   . THR B 2 76  ? 51.264 24.519 13.970 1.00 11.33 ? 75  THR H O   1 
ATOM 2286 C CB  . THR B 2 76  ? 53.769 26.402 14.315 1.00 9.25  ? 75  THR H CB  1 
ATOM 2287 O OG1 . THR B 2 76  ? 55.190 26.548 14.257 1.00 12.04 ? 75  THR H OG1 1 
ATOM 2288 C CG2 . THR B 2 76  ? 53.454 25.691 15.612 1.00 10.35 ? 75  THR H CG2 1 
ATOM 2289 N N   . SER B 2 77  ? 51.003 26.369 12.717 1.00 8.33  ? 76  SER H N   1 
ATOM 2290 C CA  . SER B 2 77  ? 49.548 26.441 12.880 1.00 10.31 ? 76  SER H CA  1 
ATOM 2291 C C   . SER B 2 77  ? 49.228 26.949 14.301 1.00 12.27 ? 76  SER H C   1 
ATOM 2292 O O   . SER B 2 77  ? 48.536 26.284 15.090 1.00 10.11 ? 76  SER H O   1 
ATOM 2293 C CB  . SER B 2 77  ? 48.879 25.095 12.655 1.00 6.44  ? 76  SER H CB  1 
ATOM 2294 O OG  . SER B 2 77  ? 49.397 24.503 11.506 1.00 4.65  ? 76  SER H OG  1 
ATOM 2295 N N   . THR B 2 78  ? 49.710 28.152 14.598 1.00 6.07  ? 77  THR H N   1 
ATOM 2296 C CA  . THR B 2 78  ? 49.497 28.728 15.887 1.00 2.00  ? 77  THR H CA  1 
ATOM 2297 C C   . THR B 2 78  ? 49.079 30.172 15.776 1.00 3.15  ? 77  THR H C   1 
ATOM 2298 O O   . THR B 2 78  ? 49.718 30.968 15.091 1.00 3.02  ? 77  THR H O   1 
ATOM 2299 C CB  . THR B 2 78  ? 50.771 28.643 16.692 1.00 5.08  ? 77  THR H CB  1 
ATOM 2300 O OG1 . THR B 2 78  ? 51.399 27.385 16.430 1.00 3.92  ? 77  THR H OG1 1 
ATOM 2301 C CG2 . THR B 2 78  ? 50.452 28.728 18.168 1.00 10.93 ? 77  THR H CG2 1 
ATOM 2302 N N   . ALA B 2 79  ? 47.977 30.493 16.438 1.00 5.73  ? 78  ALA H N   1 
ATOM 2303 C CA  . ALA B 2 79  ? 47.447 31.848 16.462 1.00 4.92  ? 78  ALA H CA  1 
ATOM 2304 C C   . ALA B 2 79  ? 48.018 32.492 17.719 1.00 6.49  ? 78  ALA H C   1 
ATOM 2305 O O   . ALA B 2 79  ? 48.563 31.807 18.602 1.00 4.70  ? 78  ALA H O   1 
ATOM 2306 C CB  . ALA B 2 79  ? 45.901 31.817 16.516 1.00 2.00  ? 78  ALA H CB  1 
ATOM 2307 N N   . PHE B 2 80  ? 47.963 33.813 17.777 1.00 9.61  ? 79  PHE H N   1 
ATOM 2308 C CA  . PHE B 2 80  ? 48.454 34.524 18.953 1.00 6.96  ? 79  PHE H CA  1 
ATOM 2309 C C   . PHE B 2 80  ? 47.548 35.701 19.269 1.00 5.73  ? 79  PHE H C   1 
ATOM 2310 O O   . PHE B 2 80  ? 46.836 36.202 18.385 1.00 6.79  ? 79  PHE H O   1 
ATOM 2311 C CB  . PHE B 2 80  ? 49.893 34.996 18.740 1.00 6.51  ? 79  PHE H CB  1 
ATOM 2312 C CG  . PHE B 2 80  ? 50.872 33.866 18.379 1.00 11.94 ? 79  PHE H CG  1 
ATOM 2313 C CD1 . PHE B 2 80  ? 50.956 33.366 17.056 1.00 9.32  ? 79  PHE H CD1 1 
ATOM 2314 C CD2 . PHE B 2 80  ? 51.746 33.343 19.344 1.00 11.88 ? 79  PHE H CD2 1 
ATOM 2315 C CE1 . PHE B 2 80  ? 51.885 32.375 16.702 1.00 6.05  ? 79  PHE H CE1 1 
ATOM 2316 C CE2 . PHE B 2 80  ? 52.677 32.352 19.000 1.00 12.13 ? 79  PHE H CE2 1 
ATOM 2317 C CZ  . PHE B 2 80  ? 52.746 31.870 17.665 1.00 9.85  ? 79  PHE H CZ  1 
ATOM 2318 N N   . LEU B 2 81  ? 47.440 36.012 20.556 1.00 4.54  ? 80  LEU H N   1 
ATOM 2319 C CA  . LEU B 2 81  ? 46.663 37.159 21.046 1.00 4.37  ? 80  LEU H CA  1 
ATOM 2320 C C   . LEU B 2 81  ? 47.649 37.919 21.895 1.00 4.49  ? 80  LEU H C   1 
ATOM 2321 O O   . LEU B 2 81  ? 48.249 37.364 22.814 1.00 6.55  ? 80  LEU H O   1 
ATOM 2322 C CB  . LEU B 2 81  ? 45.447 36.769 21.927 1.00 4.61  ? 80  LEU H CB  1 
ATOM 2323 C CG  . LEU B 2 81  ? 44.762 37.862 22.802 1.00 2.00  ? 80  LEU H CG  1 
ATOM 2324 C CD1 . LEU B 2 81  ? 43.304 38.043 22.476 1.00 2.00  ? 80  LEU H CD1 1 
ATOM 2325 C CD2 . LEU B 2 81  ? 44.886 37.529 24.257 1.00 2.00  ? 80  LEU H CD2 1 
ATOM 2326 N N   . GLN B 2 82  ? 47.893 39.162 21.555 1.00 3.72  ? 81  GLN H N   1 
ATOM 2327 C CA  . GLN B 2 82  ? 48.806 39.901 22.370 1.00 5.77  ? 81  GLN H CA  1 
ATOM 2328 C C   . GLN B 2 82  ? 48.072 41.097 22.924 1.00 6.28  ? 81  GLN H C   1 
ATOM 2329 O O   . GLN B 2 82  ? 47.077 41.542 22.350 1.00 2.16  ? 81  GLN H O   1 
ATOM 2330 C CB  . GLN B 2 82  ? 50.036 40.288 21.573 1.00 5.47  ? 81  GLN H CB  1 
ATOM 2331 C CG  . GLN B 2 82  ? 51.038 41.064 22.364 1.00 4.53  ? 81  GLN H CG  1 
ATOM 2332 C CD  . GLN B 2 82  ? 52.278 41.268 21.586 1.00 6.22  ? 81  GLN H CD  1 
ATOM 2333 O OE1 . GLN B 2 82  ? 52.821 40.333 20.986 1.00 9.29  ? 81  GLN H OE1 1 
ATOM 2334 N NE2 . GLN B 2 82  ? 52.700 42.505 21.501 1.00 10.31 ? 81  GLN H NE2 1 
ATOM 2335 N N   . ILE B 2 83  ? 48.547 41.574 24.066 1.00 8.24  ? 82  ILE H N   1 
ATOM 2336 C CA  . ILE B 2 83  ? 47.954 42.705 24.747 1.00 11.55 ? 82  ILE H CA  1 
ATOM 2337 C C   . ILE B 2 83  ? 49.052 43.676 25.179 1.00 12.25 ? 82  ILE H C   1 
ATOM 2338 O O   . ILE B 2 83  ? 50.079 43.269 25.704 1.00 15.53 ? 82  ILE H O   1 
ATOM 2339 C CB  . ILE B 2 83  ? 47.105 42.204 25.960 1.00 11.80 ? 82  ILE H CB  1 
ATOM 2340 C CG1 . ILE B 2 83  ? 46.165 41.079 25.482 1.00 12.88 ? 82  ILE H CG1 1 
ATOM 2341 C CG2 . ILE B 2 83  ? 46.301 43.354 26.571 1.00 9.02  ? 82  ILE H CG2 1 
ATOM 2342 C CD1 . ILE B 2 83  ? 45.052 40.700 26.411 1.00 12.11 ? 82  ILE H CD1 1 
ATOM 2343 N N   . ASN B 2 84  A 48.853 44.957 24.901 1.00 16.56 ? 82  ASN H N   1 
ATOM 2344 C CA  . ASN B 2 84  A 49.833 45.982 25.255 1.00 16.49 ? 82  ASN H CA  1 
ATOM 2345 C C   . ASN B 2 84  A 49.363 46.916 26.365 1.00 14.52 ? 82  ASN H C   1 
ATOM 2346 O O   . ASN B 2 84  A 48.219 46.843 26.806 1.00 15.57 ? 82  ASN H O   1 
ATOM 2347 C CB  . ASN B 2 84  A 50.159 46.832 24.028 1.00 15.29 ? 82  ASN H CB  1 
ATOM 2348 C CG  . ASN B 2 84  A 50.662 46.015 22.884 1.00 14.99 ? 82  ASN H CG  1 
ATOM 2349 O OD1 . ASN B 2 84  A 51.768 45.473 22.917 1.00 7.19  ? 82  ASN H OD1 1 
ATOM 2350 N ND2 . ASN B 2 84  A 49.844 45.910 21.853 1.00 18.78 ? 82  ASN H ND2 1 
ATOM 2351 N N   . ASN B 2 85  B 50.269 47.792 26.797 1.00 16.29 ? 82  ASN H N   1 
ATOM 2352 C CA  . ASN B 2 85  B 50.040 48.813 27.826 1.00 18.40 ? 82  ASN H CA  1 
ATOM 2353 C C   . ASN B 2 85  B 49.301 48.243 29.020 1.00 20.80 ? 82  ASN H C   1 
ATOM 2354 O O   . ASN B 2 85  B 48.733 49.021 29.781 1.00 18.27 ? 82  ASN H O   1 
ATOM 2355 C CB  . ASN B 2 85  B 49.202 50.015 27.294 1.00 21.90 ? 82  ASN H CB  1 
ATOM 2356 C CG  . ASN B 2 85  B 49.457 50.358 25.792 1.00 23.12 ? 82  ASN H CG  1 
ATOM 2357 O OD1 . ASN B 2 85  B 48.511 50.639 25.024 1.00 15.35 ? 82  ASN H OD1 1 
ATOM 2358 N ND2 . ASN B 2 85  B 50.723 50.393 25.395 1.00 23.86 ? 82  ASN H ND2 1 
ATOM 2359 N N   . LEU B 2 86  C 49.339 46.905 29.164 1.00 20.79 ? 82  LEU H N   1 
ATOM 2360 C CA  . LEU B 2 86  C 48.655 46.107 30.210 1.00 19.38 ? 82  LEU H CA  1 
ATOM 2361 C C   . LEU B 2 86  C 48.032 46.760 31.444 1.00 20.59 ? 82  LEU H C   1 
ATOM 2362 O O   . LEU B 2 86  C 48.739 47.261 32.324 1.00 21.43 ? 82  LEU H O   1 
ATOM 2363 C CB  . LEU B 2 86  C 49.539 44.950 30.682 1.00 16.02 ? 82  LEU H CB  1 
ATOM 2364 C CG  . LEU B 2 86  C 49.559 43.625 29.914 1.00 15.25 ? 82  LEU H CG  1 
ATOM 2365 C CD1 . LEU B 2 86  C 50.449 42.681 30.666 1.00 11.93 ? 82  LEU H CD1 1 
ATOM 2366 C CD2 . LEU B 2 86  C 48.178 43.026 29.791 1.00 14.93 ? 82  LEU H CD2 1 
ATOM 2367 N N   . LYS B 2 87  ? 46.704 46.686 31.527 1.00 20.61 ? 83  LYS H N   1 
ATOM 2368 C CA  . LYS B 2 87  ? 45.938 47.232 32.650 1.00 19.40 ? 83  LYS H CA  1 
ATOM 2369 C C   . LYS B 2 87  ? 45.510 46.113 33.597 1.00 19.54 ? 83  LYS H C   1 
ATOM 2370 O O   . LYS B 2 87  ? 45.579 44.927 33.264 1.00 17.07 ? 83  LYS H O   1 
ATOM 2371 C CB  . LYS B 2 87  ? 44.684 47.969 32.159 1.00 18.87 ? 83  LYS H CB  1 
ATOM 2372 C CG  . LYS B 2 87  ? 44.837 49.465 31.998 1.00 18.76 ? 83  LYS H CG  1 
ATOM 2373 C CD  . LYS B 2 87  ? 45.757 49.827 30.845 1.00 22.99 ? 83  LYS H CD  1 
ATOM 2374 C CE  . LYS B 2 87  ? 47.015 50.564 31.323 1.00 25.71 ? 83  LYS H CE  1 
ATOM 2375 N NZ  . LYS B 2 87  ? 48.004 49.696 32.058 1.00 25.02 ? 83  LYS H NZ  1 
ATOM 2376 N N   . ASN B 2 88  ? 45.002 46.514 34.756 1.00 22.50 ? 84  ASN H N   1 
ATOM 2377 C CA  . ASN B 2 88  ? 44.542 45.579 35.782 1.00 24.21 ? 84  ASN H CA  1 
ATOM 2378 C C   . ASN B 2 88  ? 43.314 44.867 35.248 1.00 21.65 ? 84  ASN H C   1 
ATOM 2379 O O   . ASN B 2 88  ? 43.258 43.652 35.237 1.00 17.83 ? 84  ASN H O   1 
ATOM 2380 C CB  . ASN B 2 88  ? 44.176 46.338 37.075 1.00 29.90 ? 84  ASN H CB  1 
ATOM 2381 C CG  . ASN B 2 88  ? 44.789 45.711 38.347 1.00 31.98 ? 84  ASN H CG  1 
ATOM 2382 O OD1 . ASN B 2 88  ? 45.602 46.356 39.024 1.00 30.74 ? 84  ASN H OD1 1 
ATOM 2383 N ND2 . ASN B 2 88  ? 44.367 44.484 38.696 1.00 30.51 ? 84  ASN H ND2 1 
ATOM 2384 N N   . GLU B 2 89  ? 42.369 45.636 34.712 1.00 22.21 ? 85  GLU H N   1 
ATOM 2385 C CA  . GLU B 2 89  ? 41.126 45.074 34.179 1.00 18.80 ? 85  GLU H CA  1 
ATOM 2386 C C   . GLU B 2 89  ? 41.339 43.897 33.237 1.00 14.19 ? 85  GLU H C   1 
ATOM 2387 O O   . GLU B 2 89  ? 40.507 43.010 33.166 1.00 14.51 ? 85  GLU H O   1 
ATOM 2388 C CB  . GLU B 2 89  ? 40.304 46.157 33.467 1.00 21.13 ? 85  GLU H CB  1 
ATOM 2389 C CG  . GLU B 2 89  ? 41.027 46.842 32.290 1.00 25.99 ? 85  GLU H CG  1 
ATOM 2390 C CD  . GLU B 2 89  ? 40.076 47.553 31.310 1.00 27.62 ? 85  GLU H CD  1 
ATOM 2391 O OE1 . GLU B 2 89  ? 40.322 48.742 30.981 1.00 26.56 ? 85  GLU H OE1 1 
ATOM 2392 O OE2 . GLU B 2 89  ? 39.099 46.915 30.847 1.00 27.44 ? 85  GLU H OE2 1 
ATOM 2393 N N   . ASP B 2 90  ? 42.486 43.863 32.574 1.00 11.96 ? 86  ASP H N   1 
ATOM 2394 C CA  . ASP B 2 90  ? 42.780 42.807 31.616 1.00 12.86 ? 86  ASP H CA  1 
ATOM 2395 C C   . ASP B 2 90  ? 42.832 41.412 32.181 1.00 11.21 ? 86  ASP H C   1 
ATOM 2396 O O   . ASP B 2 90  ? 42.663 40.440 31.429 1.00 6.88  ? 86  ASP H O   1 
ATOM 2397 C CB  . ASP B 2 90  ? 44.089 43.075 30.890 1.00 16.25 ? 86  ASP H CB  1 
ATOM 2398 C CG  . ASP B 2 90  ? 44.023 44.278 29.991 1.00 19.84 ? 86  ASP H CG  1 
ATOM 2399 O OD1 . ASP B 2 90  ? 45.077 44.939 29.851 1.00 22.20 ? 86  ASP H OD1 1 
ATOM 2400 O OD2 . ASP B 2 90  ? 42.934 44.562 29.424 1.00 19.33 ? 86  ASP H OD2 1 
ATOM 2401 N N   . THR B 2 91  ? 43.144 41.296 33.472 1.00 8.36  ? 87  THR H N   1 
ATOM 2402 C CA  . THR B 2 91  ? 43.217 39.977 34.078 1.00 7.24  ? 87  THR H CA  1 
ATOM 2403 C C   . THR B 2 91  ? 41.911 39.208 33.851 1.00 7.95  ? 87  THR H C   1 
ATOM 2404 O O   . THR B 2 91  ? 40.806 39.731 34.064 1.00 8.61  ? 87  THR H O   1 
ATOM 2405 C CB  . THR B 2 91  ? 43.640 40.005 35.574 1.00 8.09  ? 87  THR H CB  1 
ATOM 2406 O OG1 . THR B 2 91  ? 42.950 38.985 36.286 1.00 14.96 ? 87  THR H OG1 1 
ATOM 2407 C CG2 . THR B 2 91  ? 43.327 41.298 36.239 1.00 5.93  ? 87  THR H CG2 1 
ATOM 2408 N N   . ALA B 2 92  ? 42.056 37.990 33.347 1.00 5.04  ? 88  ALA H N   1 
ATOM 2409 C CA  . ALA B 2 92  ? 40.932 37.132 33.031 1.00 4.46  ? 88  ALA H CA  1 
ATOM 2410 C C   . ALA B 2 92  ? 41.497 35.963 32.274 1.00 9.59  ? 88  ALA H C   1 
ATOM 2411 O O   . ALA B 2 92  ? 42.718 35.803 32.189 1.00 16.24 ? 88  ALA H O   1 
ATOM 2412 C CB  . ALA B 2 92  ? 39.959 37.847 32.151 1.00 3.51  ? 88  ALA H CB  1 
ATOM 2413 N N   . THR B 2 93  ? 40.611 35.189 31.657 1.00 12.16 ? 89  THR H N   1 
ATOM 2414 C CA  . THR B 2 93  ? 40.993 33.983 30.908 1.00 9.71  ? 89  THR H CA  1 
ATOM 2415 C C   . THR B 2 93  ? 40.630 34.045 29.419 1.00 9.67  ? 89  THR H C   1 
ATOM 2416 O O   . THR B 2 93  ? 39.455 34.101 29.068 1.00 12.50 ? 89  THR H O   1 
ATOM 2417 C CB  . THR B 2 93  ? 40.349 32.756 31.589 1.00 9.72  ? 89  THR H CB  1 
ATOM 2418 O OG1 . THR B 2 93  ? 40.944 32.573 32.883 1.00 6.53  ? 89  THR H OG1 1 
ATOM 2419 C CG2 . THR B 2 93  ? 40.519 31.508 30.761 1.00 12.45 ? 89  THR H CG2 1 
ATOM 2420 N N   . TYR B 2 94  ? 41.629 33.992 28.546 1.00 8.69  ? 90  TYR H N   1 
ATOM 2421 C CA  . TYR B 2 94  ? 41.372 34.100 27.112 1.00 11.82 ? 90  TYR H CA  1 
ATOM 2422 C C   . TYR B 2 94  ? 41.319 32.767 26.359 1.00 14.30 ? 90  TYR H C   1 
ATOM 2423 O O   . TYR B 2 94  ? 42.261 31.970 26.464 1.00 20.15 ? 90  TYR H O   1 
ATOM 2424 C CB  . TYR B 2 94  ? 42.426 35.023 26.502 1.00 12.51 ? 90  TYR H CB  1 
ATOM 2425 C CG  . TYR B 2 94  ? 42.384 36.417 27.079 1.00 15.33 ? 90  TYR H CG  1 
ATOM 2426 C CD1 . TYR B 2 94  ? 41.883 37.487 26.330 1.00 19.08 ? 90  TYR H CD1 1 
ATOM 2427 C CD2 . TYR B 2 94  ? 42.819 36.673 28.383 1.00 14.75 ? 90  TYR H CD2 1 
ATOM 2428 C CE1 . TYR B 2 94  ? 41.813 38.790 26.871 1.00 17.59 ? 90  TYR H CE1 1 
ATOM 2429 C CE2 . TYR B 2 94  ? 42.748 37.968 28.931 1.00 13.34 ? 90  TYR H CE2 1 
ATOM 2430 C CZ  . TYR B 2 94  ? 42.243 39.019 28.171 1.00 13.25 ? 90  TYR H CZ  1 
ATOM 2431 O OH  . TYR B 2 94  ? 42.137 40.286 28.710 1.00 9.37  ? 90  TYR H OH  1 
ATOM 2432 N N   . PHE B 2 95  ? 40.243 32.524 25.599 1.00 10.55 ? 91  PHE H N   1 
ATOM 2433 C CA  . PHE B 2 95  ? 40.098 31.267 24.836 1.00 9.94  ? 91  PHE H CA  1 
ATOM 2434 C C   . PHE B 2 95  ? 40.042 31.486 23.318 1.00 8.63  ? 91  PHE H C   1 
ATOM 2435 O O   . PHE B 2 95  ? 39.348 32.374 22.837 1.00 12.80 ? 91  PHE H O   1 
ATOM 2436 C CB  . PHE B 2 95  ? 38.805 30.516 25.172 1.00 9.49  ? 91  PHE H CB  1 
ATOM 2437 C CG  . PHE B 2 95  ? 38.428 30.486 26.631 1.00 9.73  ? 91  PHE H CG  1 
ATOM 2438 C CD1 . PHE B 2 95  ? 37.688 31.530 27.193 1.00 7.70  ? 91  PHE H CD1 1 
ATOM 2439 C CD2 . PHE B 2 95  ? 38.670 29.355 27.401 1.00 8.58  ? 91  PHE H CD2 1 
ATOM 2440 C CE1 . PHE B 2 95  ? 37.192 31.442 28.477 1.00 5.87  ? 91  PHE H CE1 1 
ATOM 2441 C CE2 . PHE B 2 95  ? 38.173 29.259 28.698 1.00 8.10  ? 91  PHE H CE2 1 
ATOM 2442 C CZ  . PHE B 2 95  ? 37.432 30.301 29.232 1.00 7.74  ? 91  PHE H CZ  1 
ATOM 2443 N N   . CYS B 2 96  ? 40.681 30.610 22.562 1.00 6.42  ? 92  CYS H N   1 
ATOM 2444 C CA  . CYS B 2 96  ? 40.661 30.713 21.114 1.00 5.51  ? 92  CYS H CA  1 
ATOM 2445 C C   . CYS B 2 96  ? 39.618 29.704 20.646 1.00 5.85  ? 92  CYS H C   1 
ATOM 2446 O O   . CYS B 2 96  ? 39.573 28.583 21.143 1.00 5.79  ? 92  CYS H O   1 
ATOM 2447 C CB  . CYS B 2 96  ? 42.043 30.377 20.525 1.00 10.15 ? 92  CYS H CB  1 
ATOM 2448 S SG  . CYS B 2 96  ? 42.724 28.706 20.880 1.00 8.35  ? 92  CYS H SG  1 
ATOM 2449 N N   . VAL B 2 97  ? 38.745 30.091 19.730 1.00 7.64  ? 93  VAL H N   1 
ATOM 2450 C CA  . VAL B 2 97  ? 37.728 29.161 19.262 1.00 10.96 ? 93  VAL H CA  1 
ATOM 2451 C C   . VAL B 2 97  ? 37.661 29.121 17.733 1.00 14.28 ? 93  VAL H C   1 
ATOM 2452 O O   . VAL B 2 97  ? 38.438 29.793 17.034 1.00 14.62 ? 93  VAL H O   1 
ATOM 2453 C CB  . VAL B 2 97  ? 36.316 29.506 19.829 1.00 8.98  ? 93  VAL H CB  1 
ATOM 2454 C CG1 . VAL B 2 97  ? 36.412 30.136 21.181 1.00 11.33 ? 93  VAL H CG1 1 
ATOM 2455 C CG2 . VAL B 2 97  ? 35.561 30.398 18.893 1.00 10.06 ? 93  VAL H CG2 1 
ATOM 2456 N N   . ARG B 2 98  ? 36.761 28.284 17.230 1.00 16.34 ? 94  ARG H N   1 
ATOM 2457 C CA  . ARG B 2 98  ? 36.542 28.158 15.807 1.00 21.07 ? 94  ARG H CA  1 
ATOM 2458 C C   . ARG B 2 98  ? 35.196 27.504 15.479 1.00 23.67 ? 94  ARG H C   1 
ATOM 2459 O O   . ARG B 2 98  ? 34.578 26.865 16.338 1.00 23.31 ? 94  ARG H O   1 
ATOM 2460 C CB  . ARG B 2 98  ? 37.700 27.427 15.132 1.00 18.50 ? 94  ARG H CB  1 
ATOM 2461 C CG  . ARG B 2 98  ? 37.864 26.004 15.519 1.00 16.09 ? 94  ARG H CG  1 
ATOM 2462 C CD  . ARG B 2 98  ? 38.560 25.281 14.394 1.00 15.95 ? 94  ARG H CD  1 
ATOM 2463 N NE  . ARG B 2 98  ? 37.625 24.736 13.415 1.00 15.16 ? 94  ARG H NE  1 
ATOM 2464 C CZ  . ARG B 2 98  ? 37.525 23.439 13.141 1.00 14.74 ? 94  ARG H CZ  1 
ATOM 2465 N NH1 . ARG B 2 98  ? 38.299 22.574 13.775 1.00 16.61 ? 94  ARG H NH1 1 
ATOM 2466 N NH2 . ARG B 2 98  ? 36.705 23.009 12.196 1.00 14.58 ? 94  ARG H NH2 1 
ATOM 2467 N N   . ASP B 2 99  ? 34.752 27.694 14.235 1.00 26.51 ? 95  ASP H N   1 
ATOM 2468 C CA  . ASP B 2 99  ? 33.474 27.191 13.730 1.00 28.28 ? 95  ASP H CA  1 
ATOM 2469 C C   . ASP B 2 99  ? 33.578 25.859 12.964 1.00 31.10 ? 95  ASP H C   1 
ATOM 2470 O O   . ASP B 2 99  ? 34.516 25.092 13.164 1.00 33.76 ? 95  ASP H O   1 
ATOM 2471 C CB  . ASP B 2 99  ? 32.824 28.276 12.864 1.00 28.48 ? 95  ASP H CB  1 
ATOM 2472 C CG  . ASP B 2 99  ? 32.919 29.664 13.504 1.00 30.31 ? 95  ASP H CG  1 
ATOM 2473 O OD1 . ASP B 2 99  ? 32.057 29.982 14.359 1.00 31.06 ? 95  ASP H OD1 1 
ATOM 2474 O OD2 . ASP B 2 99  ? 33.857 30.434 13.163 1.00 30.01 ? 95  ASP H OD2 1 
ATOM 2475 N N   . ARG B 2 100 ? 32.637 25.619 12.053 1.00 33.56 ? 96  ARG H N   1 
ATOM 2476 C CA  . ARG B 2 100 ? 32.563 24.365 11.283 1.00 35.11 ? 96  ARG H CA  1 
ATOM 2477 C C   . ARG B 2 100 ? 32.096 24.632 9.825  1.00 36.16 ? 96  ARG H C   1 
ATOM 2478 O O   . ARG B 2 100 ? 31.415 23.810 9.214  1.00 36.26 ? 96  ARG H O   1 
ATOM 2479 C CB  . ARG B 2 100 ? 31.589 23.440 12.000 1.00 37.06 ? 96  ARG H CB  1 
ATOM 2480 C CG  . ARG B 2 100 ? 30.538 24.229 12.813 1.00 37.64 ? 96  ARG H CG  1 
ATOM 2481 C CD  . ARG B 2 100 ? 29.392 23.399 13.325 1.00 35.27 ? 96  ARG H CD  1 
ATOM 2482 N NE  . ARG B 2 100 ? 28.358 23.181 12.316 1.00 35.23 ? 96  ARG H NE  1 
ATOM 2483 C CZ  . ARG B 2 100 ? 27.056 23.176 12.587 1.00 36.90 ? 96  ARG H CZ  1 
ATOM 2484 N NH1 . ARG B 2 100 ? 26.638 23.394 13.831 1.00 35.21 ? 96  ARG H NH1 1 
ATOM 2485 N NH2 . ARG B 2 100 ? 26.174 22.874 11.640 1.00 34.58 ? 96  ARG H NH2 1 
ATOM 2486 N N   . HIS B 2 101 ? 32.521 25.778 9.282  1.00 37.35 ? 97  HIS H N   1 
ATOM 2487 C CA  . HIS B 2 101 ? 32.183 26.290 7.950  1.00 35.40 ? 97  HIS H CA  1 
ATOM 2488 C C   . HIS B 2 101 ? 30.704 26.473 7.800  1.00 32.44 ? 97  HIS H C   1 
ATOM 2489 O O   . HIS B 2 101 ? 30.071 25.935 6.905  1.00 33.43 ? 97  HIS H O   1 
ATOM 2490 C CB  . HIS B 2 101 ? 32.720 25.461 6.767  1.00 38.04 ? 97  HIS H CB  1 
ATOM 2491 C CG  . HIS B 2 101 ? 32.630 26.179 5.429  1.00 38.40 ? 97  HIS H CG  1 
ATOM 2492 N ND1 . HIS B 2 101 ? 33.147 25.662 4.253  1.00 35.70 ? 97  HIS H ND1 1 
ATOM 2493 C CD2 . HIS B 2 101 ? 32.066 27.370 5.090  1.00 37.95 ? 97  HIS H CD2 1 
ATOM 2494 C CE1 . HIS B 2 101 ? 32.901 26.499 3.255  1.00 34.84 ? 97  HIS H CE1 1 
ATOM 2495 N NE2 . HIS B 2 101 ? 32.244 27.544 3.740  1.00 32.62 ? 97  HIS H NE2 1 
ATOM 2496 N N   . ASP B 2 102 ? 30.134 27.143 8.798  1.00 29.13 ? 98  ASP H N   1 
ATOM 2497 C CA  . ASP B 2 102 ? 28.733 27.503 8.779  1.00 25.48 ? 98  ASP H CA  1 
ATOM 2498 C C   . ASP B 2 102 ? 29.077 28.963 8.601  1.00 23.83 ? 98  ASP H C   1 
ATOM 2499 O O   . ASP B 2 102 ? 30.131 29.403 9.093  1.00 30.71 ? 98  ASP H O   1 
ATOM 2500 C CB  . ASP B 2 102 ? 28.072 27.331 10.129 1.00 22.11 ? 98  ASP H CB  1 
ATOM 2501 C CG  . ASP B 2 102 ? 27.238 26.069 10.213 1.00 22.98 ? 98  ASP H CG  1 
ATOM 2502 O OD1 . ASP B 2 102 ? 27.717 24.975 9.786  1.00 24.41 ? 98  ASP H OD1 1 
ATOM 2503 O OD2 . ASP B 2 102 ? 26.120 26.170 10.750 1.00 16.98 ? 98  ASP H OD2 1 
ATOM 2504 N N   . TYR B 2 103 ? 28.300 29.719 7.855  1.00 20.14 ? 99  TYR H N   1 
ATOM 2505 C CA  . TYR B 2 103 ? 28.714 31.076 7.711  1.00 22.58 ? 99  TYR H CA  1 
ATOM 2506 C C   . TYR B 2 103 ? 28.398 31.810 9.017  1.00 22.43 ? 99  TYR H C   1 
ATOM 2507 O O   . TYR B 2 103 ? 29.302 32.353 9.674  1.00 17.56 ? 99  TYR H O   1 
ATOM 2508 C CB  . TYR B 2 103 ? 28.150 31.728 6.438  1.00 26.51 ? 99  TYR H CB  1 
ATOM 2509 C CG  . TYR B 2 103 ? 28.757 31.061 5.167  1.00 25.22 ? 99  TYR H CG  1 
ATOM 2510 C CD1 . TYR B 2 103 ? 28.935 29.683 5.147  1.00 25.29 ? 99  TYR H CD1 1 
ATOM 2511 C CD2 . TYR B 2 103 ? 29.087 31.775 3.998  1.00 20.84 ? 99  TYR H CD2 1 
ATOM 2512 C CE1 . TYR B 2 103 ? 29.386 29.032 4.063  1.00 25.37 ? 99  TYR H CE1 1 
ATOM 2513 C CE2 . TYR B 2 103 ? 29.554 31.107 2.877  1.00 25.91 ? 99  TYR H CE2 1 
ATOM 2514 C CZ  . TYR B 2 103 ? 29.690 29.731 2.924  1.00 25.79 ? 99  TYR H CZ  1 
ATOM 2515 O OH  . TYR B 2 103 ? 30.081 29.046 1.798  1.00 30.44 ? 99  TYR H OH  1 
ATOM 2516 N N   . GLY B 2 104 ? 27.173 31.636 9.493  1.00 21.81 ? 100 GLY H N   1 
ATOM 2517 C CA  . GLY B 2 104 ? 26.774 32.299 10.736 1.00 18.82 ? 100 GLY H CA  1 
ATOM 2518 C C   . GLY B 2 104 ? 27.610 31.545 11.757 1.00 18.83 ? 100 GLY H C   1 
ATOM 2519 O O   . GLY B 2 104 ? 27.820 30.338 11.548 1.00 13.58 ? 100 GLY H O   1 
ATOM 2520 N N   . GLU B 2 105 A 27.988 32.210 12.848 1.00 23.63 ? 100 GLU H N   1 
ATOM 2521 C CA  . GLU B 2 105 A 28.857 31.633 13.872 1.00 24.17 ? 100 GLU H CA  1 
ATOM 2522 C C   . GLU B 2 105 A 28.294 30.637 14.875 1.00 19.93 ? 100 GLU H C   1 
ATOM 2523 O O   . GLU B 2 105 A 27.171 30.774 15.374 1.00 15.93 ? 100 GLU H O   1 
ATOM 2524 C CB  . GLU B 2 105 A 29.508 32.742 14.674 1.00 27.39 ? 100 GLU H CB  1 
ATOM 2525 C CG  . GLU B 2 105 A 30.654 33.399 13.855 1.00 33.10 ? 100 GLU H CG  1 
ATOM 2526 C CD  . GLU B 2 105 A 30.921 34.805 14.331 1.00 37.02 ? 100 GLU H CD  1 
ATOM 2527 O OE1 . GLU B 2 105 A 30.841 34.985 15.570 1.00 39.14 ? 100 GLU H OE1 1 
ATOM 2528 O OE2 . GLU B 2 105 A 31.204 35.720 13.497 1.00 37.78 ? 100 GLU H OE2 1 
ATOM 2529 N N   . ILE B 2 106 B 29.132 29.644 15.161 1.00 17.07 ? 100 ILE H N   1 
ATOM 2530 C CA  . ILE B 2 106 B 28.877 28.559 16.109 1.00 16.75 ? 100 ILE H CA  1 
ATOM 2531 C C   . ILE B 2 106 B 30.198 28.091 16.753 1.00 14.58 ? 100 ILE H C   1 
ATOM 2532 O O   . ILE B 2 106 B 30.697 27.024 16.402 1.00 9.02  ? 100 ILE H O   1 
ATOM 2533 C CB  . ILE B 2 106 B 28.189 27.305 15.464 1.00 15.70 ? 100 ILE H CB  1 
ATOM 2534 C CG1 . ILE B 2 106 B 27.262 27.694 14.327 1.00 15.47 ? 100 ILE H CG1 1 
ATOM 2535 C CG2 . ILE B 2 106 B 27.394 26.526 16.559 1.00 15.51 ? 100 ILE H CG2 1 
ATOM 2536 C CD1 . ILE B 2 106 B 26.626 26.548 13.639 1.00 15.19 ? 100 ILE H CD1 1 
ATOM 2537 N N   . PHE B 2 107 C 30.751 28.881 17.683 1.00 14.29 ? 100 PHE H N   1 
ATOM 2538 C CA  . PHE B 2 107 C 32.005 28.539 18.378 1.00 9.30  ? 100 PHE H CA  1 
ATOM 2539 C C   . PHE B 2 107 C 31.947 27.089 18.865 1.00 8.19  ? 100 PHE H C   1 
ATOM 2540 O O   . PHE B 2 107 C 31.465 26.811 19.949 1.00 9.58  ? 100 PHE H O   1 
ATOM 2541 C CB  . PHE B 2 107 C 32.215 29.461 19.588 1.00 6.06  ? 100 PHE H CB  1 
ATOM 2542 C CG  . PHE B 2 107 C 32.400 30.905 19.246 1.00 8.59  ? 100 PHE H CG  1 
ATOM 2543 C CD1 . PHE B 2 107 C 32.355 31.342 17.936 1.00 9.82  ? 100 PHE H CD1 1 
ATOM 2544 C CD2 . PHE B 2 107 C 32.629 31.845 20.263 1.00 12.70 ? 100 PHE H CD2 1 
ATOM 2545 C CE1 . PHE B 2 107 C 32.549 32.695 17.630 1.00 13.91 ? 100 PHE H CE1 1 
ATOM 2546 C CE2 . PHE B 2 107 C 32.826 33.208 19.978 1.00 9.76  ? 100 PHE H CE2 1 
ATOM 2547 C CZ  . PHE B 2 107 C 32.781 33.631 18.660 1.00 13.85 ? 100 PHE H CZ  1 
ATOM 2548 N N   . THR B 2 108 ? 32.424 26.158 18.055 1.00 8.91  ? 101 THR H N   1 
ATOM 2549 C CA  . THR B 2 108 ? 32.366 24.756 18.430 1.00 6.17  ? 101 THR H CA  1 
ATOM 2550 C C   . THR B 2 108 ? 33.557 24.227 19.195 1.00 3.16  ? 101 THR H C   1 
ATOM 2551 O O   . THR B 2 108 ? 33.400 23.532 20.189 1.00 5.72  ? 101 THR H O   1 
ATOM 2552 C CB  . THR B 2 108 ? 32.134 23.867 17.199 1.00 7.96  ? 101 THR H CB  1 
ATOM 2553 O OG1 . THR B 2 108 ? 30.794 24.046 16.709 1.00 10.00 ? 101 THR H OG1 1 
ATOM 2554 C CG2 . THR B 2 108 ? 32.331 22.421 17.560 1.00 9.71  ? 101 THR H CG2 1 
ATOM 2555 N N   . TYR B 2 109 ? 34.753 24.477 18.698 1.00 2.58  ? 102 TYR H N   1 
ATOM 2556 C CA  . TYR B 2 109 ? 35.920 23.955 19.378 1.00 4.98  ? 102 TYR H CA  1 
ATOM 2557 C C   . TYR B 2 109 ? 36.597 25.137 20.033 1.00 7.07  ? 102 TYR H C   1 
ATOM 2558 O O   . TYR B 2 109 ? 36.834 26.125 19.357 1.00 12.88 ? 102 TYR H O   1 
ATOM 2559 C CB  . TYR B 2 109 ? 36.832 23.273 18.356 1.00 5.23  ? 102 TYR H CB  1 
ATOM 2560 C CG  . TYR B 2 109 ? 36.065 22.416 17.365 1.00 9.50  ? 102 TYR H CG  1 
ATOM 2561 C CD1 . TYR B 2 109 ? 35.415 23.002 16.276 1.00 12.55 ? 102 TYR H CD1 1 
ATOM 2562 C CD2 . TYR B 2 109 ? 35.929 21.030 17.546 1.00 11.79 ? 102 TYR H CD2 1 
ATOM 2563 C CE1 . TYR B 2 109 ? 34.646 22.249 15.393 1.00 12.27 ? 102 TYR H CE1 1 
ATOM 2564 C CE2 . TYR B 2 109 ? 35.152 20.253 16.665 1.00 9.18  ? 102 TYR H CE2 1 
ATOM 2565 C CZ  . TYR B 2 109 ? 34.517 20.878 15.591 1.00 14.16 ? 102 TYR H CZ  1 
ATOM 2566 O OH  . TYR B 2 109 ? 33.754 20.156 14.693 1.00 18.30 ? 102 TYR H OH  1 
ATOM 2567 N N   . TRP B 2 110 ? 36.785 25.067 21.358 1.00 8.61  ? 103 TRP H N   1 
ATOM 2568 C CA  . TRP B 2 110 ? 37.426 26.108 22.185 1.00 4.07  ? 103 TRP H CA  1 
ATOM 2569 C C   . TRP B 2 110 ? 38.764 25.658 22.714 1.00 4.23  ? 103 TRP H C   1 
ATOM 2570 O O   . TRP B 2 110 ? 39.070 24.466 22.730 1.00 2.00  ? 103 TRP H O   1 
ATOM 2571 C CB  . TRP B 2 110 ? 36.598 26.420 23.429 1.00 2.69  ? 103 TRP H CB  1 
ATOM 2572 C CG  . TRP B 2 110 ? 35.271 27.060 23.175 1.00 6.00  ? 103 TRP H CG  1 
ATOM 2573 C CD1 . TRP B 2 110 ? 34.205 26.533 22.481 1.00 2.00  ? 103 TRP H CD1 1 
ATOM 2574 C CD2 . TRP B 2 110 ? 34.837 28.333 23.666 1.00 4.16  ? 103 TRP H CD2 1 
ATOM 2575 N NE1 . TRP B 2 110 ? 33.141 27.403 22.525 1.00 2.47  ? 103 TRP H NE1 1 
ATOM 2576 C CE2 . TRP B 2 110 ? 33.497 28.517 23.235 1.00 3.32  ? 103 TRP H CE2 1 
ATOM 2577 C CE3 . TRP B 2 110 ? 35.453 29.339 24.422 1.00 2.00  ? 103 TRP H CE3 1 
ATOM 2578 C CZ2 . TRP B 2 110 ? 32.767 29.661 23.538 1.00 2.00  ? 103 TRP H CZ2 1 
ATOM 2579 C CZ3 . TRP B 2 110 ? 34.729 30.473 24.722 1.00 3.56  ? 103 TRP H CZ3 1 
ATOM 2580 C CH2 . TRP B 2 110 ? 33.398 30.631 24.278 1.00 4.09  ? 103 TRP H CH2 1 
ATOM 2581 N N   . GLY B 2 111 ? 39.529 26.632 23.201 1.00 8.08  ? 104 GLY H N   1 
ATOM 2582 C CA  . GLY B 2 111 ? 40.830 26.374 23.796 1.00 8.35  ? 104 GLY H CA  1 
ATOM 2583 C C   . GLY B 2 111 ? 40.561 26.114 25.271 1.00 9.14  ? 104 GLY H C   1 
ATOM 2584 O O   . GLY B 2 111 ? 39.439 26.362 25.724 1.00 13.80 ? 104 GLY H O   1 
ATOM 2585 N N   . GLN B 2 112 ? 41.519 25.573 26.025 1.00 8.63  ? 105 GLN H N   1 
ATOM 2586 C CA  . GLN B 2 112 ? 41.253 25.329 27.450 1.00 7.99  ? 105 GLN H CA  1 
ATOM 2587 C C   . GLN B 2 112 ? 41.289 26.625 28.226 1.00 8.03  ? 105 GLN H C   1 
ATOM 2588 O O   . GLN B 2 112 ? 40.673 26.727 29.287 1.00 10.60 ? 105 GLN H O   1 
ATOM 2589 C CB  . GLN B 2 112 ? 42.214 24.326 28.077 1.00 6.86  ? 105 GLN H CB  1 
ATOM 2590 C CG  . GLN B 2 112 ? 43.642 24.781 28.154 1.00 8.69  ? 105 GLN H CG  1 
ATOM 2591 C CD  . GLN B 2 112 ? 44.377 24.584 26.868 1.00 11.04 ? 105 GLN H CD  1 
ATOM 2592 O OE1 . GLN B 2 112 ? 45.416 25.194 26.634 1.00 10.67 ? 105 GLN H OE1 1 
ATOM 2593 N NE2 . GLN B 2 112 ? 43.835 23.726 26.004 1.00 14.92 ? 105 GLN H NE2 1 
ATOM 2594 N N   . GLY B 2 113 ? 41.987 27.612 27.664 1.00 5.82  ? 106 GLY H N   1 
ATOM 2595 C CA  . GLY B 2 113 ? 42.089 28.916 28.279 1.00 2.00  ? 106 GLY H CA  1 
ATOM 2596 C C   . GLY B 2 113 ? 43.455 29.165 28.868 1.00 2.00  ? 106 GLY H C   1 
ATOM 2597 O O   . GLY B 2 113 ? 44.161 28.251 29.321 1.00 2.00  ? 106 GLY H O   1 
ATOM 2598 N N   . THR B 2 114 ? 43.855 30.421 28.832 1.00 2.00  ? 107 THR H N   1 
ATOM 2599 C CA  . THR B 2 114 ? 45.133 30.791 29.396 1.00 6.58  ? 107 THR H CA  1 
ATOM 2600 C C   . THR B 2 114 ? 44.776 32.037 30.164 1.00 10.35 ? 107 THR H C   1 
ATOM 2601 O O   . THR B 2 114 ? 44.138 32.929 29.596 1.00 15.82 ? 107 THR H O   1 
ATOM 2602 C CB  . THR B 2 114 ? 46.168 31.079 28.319 1.00 2.18  ? 107 THR H CB  1 
ATOM 2603 O OG1 . THR B 2 114 ? 47.148 31.978 28.833 1.00 5.98  ? 107 THR H OG1 1 
ATOM 2604 C CG2 . THR B 2 114 ? 45.522 31.698 27.135 1.00 7.91  ? 107 THR H CG2 1 
ATOM 2605 N N   . THR B 2 115 ? 45.052 32.032 31.470 1.00 9.83  ? 108 THR H N   1 
ATOM 2606 C CA  . THR B 2 115 ? 44.724 33.163 32.330 1.00 13.14 ? 108 THR H CA  1 
ATOM 2607 C C   . THR B 2 115 ? 45.830 34.142 32.231 1.00 12.90 ? 108 THR H C   1 
ATOM 2608 O O   . THR B 2 115 ? 46.976 33.732 32.115 1.00 19.78 ? 108 THR H O   1 
ATOM 2609 C CB  . THR B 2 115 ? 44.752 32.800 33.818 1.00 14.24 ? 108 THR H CB  1 
ATOM 2610 O OG1 . THR B 2 115 ? 44.406 31.419 33.996 1.00 24.10 ? 108 THR H OG1 1 
ATOM 2611 C CG2 . THR B 2 115 ? 43.816 33.702 34.618 1.00 11.28 ? 108 THR H CG2 1 
ATOM 2612 N N   . VAL B 2 116 ? 45.509 35.423 32.192 1.00 12.54 ? 109 VAL H N   1 
ATOM 2613 C CA  . VAL B 2 116 ? 46.565 36.415 32.232 1.00 14.89 ? 109 VAL H CA  1 
ATOM 2614 C C   . VAL B 2 116 ? 46.220 37.172 33.511 1.00 17.23 ? 109 VAL H C   1 
ATOM 2615 O O   . VAL B 2 116 ? 45.045 37.508 33.743 1.00 17.22 ? 109 VAL H O   1 
ATOM 2616 C CB  . VAL B 2 116 ? 46.590 37.357 31.029 1.00 12.15 ? 109 VAL H CB  1 
ATOM 2617 C CG1 . VAL B 2 116 ? 47.645 38.433 31.251 1.00 11.45 ? 109 VAL H CG1 1 
ATOM 2618 C CG2 . VAL B 2 116 ? 46.903 36.593 29.760 1.00 10.26 ? 109 VAL H CG2 1 
ATOM 2619 N N   . THR B 2 117 ? 47.202 37.298 34.401 1.00 16.94 ? 110 THR H N   1 
ATOM 2620 C CA  . THR B 2 117 ? 47.016 38.008 35.657 1.00 15.86 ? 110 THR H CA  1 
ATOM 2621 C C   . THR B 2 117 ? 47.866 39.259 35.729 1.00 15.92 ? 110 THR H C   1 
ATOM 2622 O O   . THR B 2 117 ? 49.081 39.212 35.508 1.00 17.85 ? 110 THR H O   1 
ATOM 2623 C CB  . THR B 2 117 ? 47.382 37.160 36.828 1.00 15.46 ? 110 THR H CB  1 
ATOM 2624 O OG1 . THR B 2 117 ? 46.529 36.012 36.856 1.00 19.91 ? 110 THR H OG1 1 
ATOM 2625 C CG2 . THR B 2 117 ? 47.202 37.968 38.099 1.00 17.56 ? 110 THR H CG2 1 
ATOM 2626 N N   . VAL B 2 118 ? 47.226 40.359 36.108 1.00 12.53 ? 111 VAL H N   1 
ATOM 2627 C CA  . VAL B 2 118 ? 47.883 41.639 36.203 1.00 11.82 ? 111 VAL H CA  1 
ATOM 2628 C C   . VAL B 2 118 ? 47.894 42.056 37.663 1.00 14.96 ? 111 VAL H C   1 
ATOM 2629 O O   . VAL B 2 118 ? 46.864 42.008 38.334 1.00 17.98 ? 111 VAL H O   1 
ATOM 2630 C CB  . VAL B 2 118 ? 47.138 42.676 35.364 1.00 11.27 ? 111 VAL H CB  1 
ATOM 2631 C CG1 . VAL B 2 118 ? 48.015 43.859 35.108 1.00 11.37 ? 111 VAL H CG1 1 
ATOM 2632 C CG2 . VAL B 2 118 ? 46.683 42.069 34.045 1.00 11.27 ? 111 VAL H CG2 1 
ATOM 2633 N N   . SER B 2 119 ? 49.070 42.410 38.165 1.00 17.36 ? 112 SER H N   1 
ATOM 2634 C CA  . SER B 2 119 ? 49.223 42.825 39.547 1.00 19.72 ? 112 SER H CA  1 
ATOM 2635 C C   . SER B 2 119 ? 50.641 43.345 39.771 1.00 23.36 ? 112 SER H C   1 
ATOM 2636 O O   . SER B 2 119 ? 51.624 42.767 39.288 1.00 22.65 ? 112 SER H O   1 
ATOM 2637 C CB  . SER B 2 119 ? 48.936 41.654 40.490 1.00 20.32 ? 112 SER H CB  1 
ATOM 2638 O OG  . SER B 2 119 ? 49.097 42.024 41.854 1.00 19.90 ? 112 SER H OG  1 
ATOM 2639 N N   . SER B 2 120 ? 50.721 44.464 40.489 1.00 26.28 ? 113 SER H N   1 
ATOM 2640 C CA  . SER B 2 120 ? 51.982 45.125 40.821 1.00 23.69 ? 113 SER H CA  1 
ATOM 2641 C C   . SER B 2 120 ? 52.830 44.171 41.652 1.00 22.85 ? 113 SER H C   1 
ATOM 2642 O O   . SER B 2 120 ? 54.051 44.110 41.509 1.00 24.99 ? 113 SER H O   1 
ATOM 2643 C CB  . SER B 2 120 ? 51.697 46.395 41.642 1.00 23.33 ? 113 SER H CB  1 
ATOM 2644 O OG  . SER B 2 120 ? 50.593 47.136 41.122 1.00 20.06 ? 113 SER H OG  1 
ATOM 2645 N N   . ALA B 2 121 ? 52.154 43.426 42.515 1.00 18.83 ? 114 ALA H N   1 
ATOM 2646 C CA  . ALA B 2 121 ? 52.787 42.475 43.400 1.00 17.66 ? 114 ALA H CA  1 
ATOM 2647 C C   . ALA B 2 121 ? 53.825 41.612 42.710 1.00 21.11 ? 114 ALA H C   1 
ATOM 2648 O O   . ALA B 2 121 ? 53.638 41.215 41.550 1.00 22.42 ? 114 ALA H O   1 
ATOM 2649 C CB  . ALA B 2 121 ? 51.738 41.594 44.008 1.00 15.51 ? 114 ALA H CB  1 
ATOM 2650 N N   . LYS B 2 122 ? 54.932 41.373 43.419 1.00 20.13 ? 115 LYS H N   1 
ATOM 2651 C CA  . LYS B 2 122 ? 56.012 40.498 42.961 1.00 19.37 ? 115 LYS H CA  1 
ATOM 2652 C C   . LYS B 2 122 ? 55.892 39.332 43.976 1.00 16.78 ? 115 LYS H C   1 
ATOM 2653 O O   . LYS B 2 122 ? 55.673 39.595 45.152 1.00 17.35 ? 115 LYS H O   1 
ATOM 2654 C CB  . LYS B 2 122 ? 57.364 41.203 43.082 1.00 21.18 ? 115 LYS H CB  1 
ATOM 2655 C CG  . LYS B 2 122 ? 57.293 42.729 43.268 1.00 29.29 ? 115 LYS H CG  1 
ATOM 2656 C CD  . LYS B 2 122 ? 57.072 43.511 41.968 1.00 31.13 ? 115 LYS H CD  1 
ATOM 2657 C CE  . LYS B 2 122 ? 57.354 45.009 42.155 1.00 30.08 ? 115 LYS H CE  1 
ATOM 2658 N NZ  . LYS B 2 122 ? 57.256 45.801 40.888 1.00 29.81 ? 115 LYS H NZ  1 
ATOM 2659 N N   . THR B 2 123 ? 55.983 38.075 43.516 1.00 14.93 ? 116 THR H N   1 
ATOM 2660 C CA  . THR B 2 123 ? 55.817 36.877 44.353 1.00 9.41  ? 116 THR H CA  1 
ATOM 2661 C C   . THR B 2 123 ? 56.181 37.070 45.794 1.00 11.85 ? 116 THR H C   1 
ATOM 2662 O O   . THR B 2 123 ? 57.350 37.019 46.180 1.00 12.88 ? 116 THR H O   1 
ATOM 2663 C CB  . THR B 2 123 ? 56.563 35.647 43.818 1.00 8.73  ? 116 THR H CB  1 
ATOM 2664 O OG1 . THR B 2 123 ? 56.043 35.303 42.527 1.00 8.77  ? 116 THR H OG1 1 
ATOM 2665 C CG2 . THR B 2 123 ? 56.395 34.453 44.772 1.00 3.82  ? 116 THR H CG2 1 
ATOM 2666 N N   . THR B 2 124 ? 55.132 37.233 46.586 1.00 12.41 ? 117 THR H N   1 
ATOM 2667 C CA  . THR B 2 124 ? 55.227 37.471 48.003 1.00 10.08 ? 117 THR H CA  1 
ATOM 2668 C C   . THR B 2 124 ? 54.462 36.389 48.747 1.00 8.53  ? 117 THR H C   1 
ATOM 2669 O O   . THR B 2 124 ? 53.278 36.164 48.471 1.00 5.97  ? 117 THR H O   1 
ATOM 2670 C CB  . THR B 2 124 ? 54.605 38.849 48.315 1.00 10.62 ? 117 THR H CB  1 
ATOM 2671 O OG1 . THR B 2 124 ? 55.426 39.871 47.748 1.00 6.61  ? 117 THR H OG1 1 
ATOM 2672 C CG2 . THR B 2 124 ? 54.452 39.068 49.820 1.00 12.42 ? 117 THR H CG2 1 
ATOM 2673 N N   . PRO B 2 125 ? 55.113 35.736 49.730 1.00 7.96  ? 118 PRO H N   1 
ATOM 2674 C CA  . PRO B 2 125 ? 54.549 34.667 50.562 1.00 8.45  ? 118 PRO H CA  1 
ATOM 2675 C C   . PRO B 2 125 ? 53.564 35.193 51.629 1.00 8.91  ? 118 PRO H C   1 
ATOM 2676 O O   . PRO B 2 125 ? 53.710 36.304 52.171 1.00 8.65  ? 118 PRO H O   1 
ATOM 2677 C CB  . PRO B 2 125 ? 55.791 34.035 51.177 1.00 6.66  ? 118 PRO H CB  1 
ATOM 2678 C CG  . PRO B 2 125 ? 56.644 35.225 51.433 1.00 8.40  ? 118 PRO H CG  1 
ATOM 2679 C CD  . PRO B 2 125 ? 56.504 36.015 50.139 1.00 8.44  ? 118 PRO H CD  1 
ATOM 2680 N N   . PRO B 2 126 ? 52.533 34.404 51.921 1.00 2.08  ? 119 PRO H N   1 
ATOM 2681 C CA  . PRO B 2 126 ? 51.491 34.730 52.900 1.00 4.62  ? 119 PRO H CA  1 
ATOM 2682 C C   . PRO B 2 126 ? 51.986 34.794 54.326 1.00 4.52  ? 119 PRO H C   1 
ATOM 2683 O O   . PRO B 2 126 ? 52.905 34.064 54.676 1.00 10.36 ? 119 PRO H O   1 
ATOM 2684 C CB  . PRO B 2 126 ? 50.542 33.551 52.758 1.00 6.87  ? 119 PRO H CB  1 
ATOM 2685 C CG  . PRO B 2 126 ? 51.474 32.419 52.432 1.00 4.95  ? 119 PRO H CG  1 
ATOM 2686 C CD  . PRO B 2 126 ? 52.354 33.043 51.387 1.00 2.00  ? 119 PRO H CD  1 
ATOM 2687 N N   . SER B 2 127 ? 51.360 35.615 55.163 1.00 2.00  ? 120 SER H N   1 
ATOM 2688 C CA  . SER B 2 127 ? 51.749 35.668 56.572 1.00 2.00  ? 120 SER H CA  1 
ATOM 2689 C C   . SER B 2 127 ? 50.669 34.838 57.236 1.00 2.94  ? 120 SER H C   1 
ATOM 2690 O O   . SER B 2 127 ? 49.511 35.057 56.961 1.00 7.36  ? 120 SER H O   1 
ATOM 2691 C CB  . SER B 2 127 ? 51.688 37.090 57.134 1.00 2.00  ? 120 SER H CB  1 
ATOM 2692 O OG  . SER B 2 127 ? 51.680 38.098 56.130 1.00 2.25  ? 120 SER H OG  1 
ATOM 2693 N N   . VAL B 2 128 ? 50.987 33.858 58.063 1.00 7.06  ? 121 VAL H N   1 
ATOM 2694 C CA  . VAL B 2 128 ? 49.875 33.115 58.642 1.00 9.71  ? 121 VAL H CA  1 
ATOM 2695 C C   . VAL B 2 128 ? 49.516 33.543 60.071 1.00 12.60 ? 121 VAL H C   1 
ATOM 2696 O O   . VAL B 2 128 ? 50.402 33.803 60.880 1.00 10.41 ? 121 VAL H O   1 
ATOM 2697 C CB  . VAL B 2 128 ? 50.084 31.595 58.496 1.00 8.86  ? 121 VAL H CB  1 
ATOM 2698 C CG1 . VAL B 2 128 ? 48.775 30.841 58.755 1.00 7.80  ? 121 VAL H CG1 1 
ATOM 2699 C CG2 . VAL B 2 128 ? 50.558 31.298 57.083 1.00 8.01  ? 121 VAL H CG2 1 
ATOM 2700 N N   . TYR B 2 129 ? 48.215 33.690 60.339 1.00 16.04 ? 122 TYR H N   1 
ATOM 2701 C CA  . TYR B 2 129 ? 47.702 34.087 61.660 1.00 14.53 ? 122 TYR H CA  1 
ATOM 2702 C C   . TYR B 2 129 ? 46.664 33.082 62.087 1.00 14.45 ? 122 TYR H C   1 
ATOM 2703 O O   . TYR B 2 129 ? 45.845 32.695 61.258 1.00 17.39 ? 122 TYR H O   1 
ATOM 2704 C CB  . TYR B 2 129 ? 47.046 35.451 61.569 1.00 15.41 ? 122 TYR H CB  1 
ATOM 2705 C CG  . TYR B 2 129 ? 48.049 36.477 61.179 1.00 16.17 ? 122 TYR H CG  1 
ATOM 2706 C CD1 . TYR B 2 129 ? 49.119 36.754 62.027 1.00 15.46 ? 122 TYR H CD1 1 
ATOM 2707 C CD2 . TYR B 2 129 ? 48.003 37.095 59.923 1.00 12.36 ? 122 TYR H CD2 1 
ATOM 2708 C CE1 . TYR B 2 129 ? 50.135 37.592 61.636 1.00 17.26 ? 122 TYR H CE1 1 
ATOM 2709 C CE2 . TYR B 2 129 ? 49.019 37.941 59.520 1.00 12.21 ? 122 TYR H CE2 1 
ATOM 2710 C CZ  . TYR B 2 129 ? 50.083 38.185 60.389 1.00 15.77 ? 122 TYR H CZ  1 
ATOM 2711 O OH  . TYR B 2 129 ? 51.128 38.994 60.038 1.00 17.38 ? 122 TYR H OH  1 
ATOM 2712 N N   . PRO B 2 130 ? 46.759 32.559 63.333 1.00 15.09 ? 123 PRO H N   1 
ATOM 2713 C CA  . PRO B 2 130 ? 45.820 31.568 63.888 1.00 14.19 ? 123 PRO H CA  1 
ATOM 2714 C C   . PRO B 2 130 ? 44.572 32.213 64.454 1.00 15.88 ? 123 PRO H C   1 
ATOM 2715 O O   . PRO B 2 130 ? 44.639 33.168 65.236 1.00 17.50 ? 123 PRO H O   1 
ATOM 2716 C CB  . PRO B 2 130 ? 46.630 30.891 64.981 1.00 13.58 ? 123 PRO H CB  1 
ATOM 2717 C CG  . PRO B 2 130 ? 47.523 31.987 65.446 1.00 14.79 ? 123 PRO H CG  1 
ATOM 2718 C CD  . PRO B 2 130 ? 47.958 32.674 64.182 1.00 13.02 ? 123 PRO H CD  1 
ATOM 2719 N N   . LEU B 2 131 ? 43.431 31.675 64.043 1.00 14.22 ? 124 LEU H N   1 
ATOM 2720 C CA  . LEU B 2 131 ? 42.128 32.170 64.444 1.00 9.00  ? 124 LEU H CA  1 
ATOM 2721 C C   . LEU B 2 131 ? 41.591 31.351 65.611 1.00 6.15  ? 124 LEU H C   1 
ATOM 2722 O O   . LEU B 2 131 ? 40.684 30.551 65.454 1.00 6.06  ? 124 LEU H O   1 
ATOM 2723 C CB  . LEU B 2 131 ? 41.190 32.091 63.239 1.00 6.37  ? 124 LEU H CB  1 
ATOM 2724 C CG  . LEU B 2 131 ? 40.780 33.323 62.426 1.00 9.90  ? 124 LEU H CG  1 
ATOM 2725 C CD1 . LEU B 2 131 ? 41.758 34.474 62.587 1.00 10.36 ? 124 LEU H CD1 1 
ATOM 2726 C CD2 . LEU B 2 131 ? 40.585 32.924 60.964 1.00 8.36  ? 124 LEU H CD2 1 
ATOM 2727 N N   . ALA B 2 132 ? 42.226 31.491 66.763 1.00 7.65  ? 125 ALA H N   1 
ATOM 2728 C CA  . ALA B 2 132 ? 41.806 30.791 67.977 1.00 11.30 ? 125 ALA H CA  1 
ATOM 2729 C C   . ALA B 2 132 ? 40.500 31.444 68.478 1.00 12.16 ? 125 ALA H C   1 
ATOM 2730 O O   . ALA B 2 132 ? 40.328 32.656 68.356 1.00 17.47 ? 125 ALA H O   1 
ATOM 2731 C CB  . ALA B 2 132 ? 42.922 30.891 69.053 1.00 7.38  ? 125 ALA H CB  1 
ATOM 2732 N N   . PRO B 2 133 ? 39.579 30.667 69.065 1.00 13.78 ? 126 PRO H N   1 
ATOM 2733 C CA  . PRO B 2 133 ? 38.336 31.278 69.532 1.00 15.12 ? 126 PRO H CA  1 
ATOM 2734 C C   . PRO B 2 133 ? 38.587 32.397 70.517 1.00 20.03 ? 126 PRO H C   1 
ATOM 2735 O O   . PRO B 2 133 ? 39.452 32.296 71.382 1.00 20.17 ? 126 PRO H O   1 
ATOM 2736 C CB  . PRO B 2 133 ? 37.605 30.112 70.180 1.00 19.12 ? 126 PRO H CB  1 
ATOM 2737 C CG  . PRO B 2 133 ? 38.107 28.916 69.407 1.00 19.74 ? 126 PRO H CG  1 
ATOM 2738 C CD  . PRO B 2 133 ? 39.586 29.222 69.339 1.00 16.85 ? 126 PRO H CD  1 
ATOM 2739 N N   . GLY B 2 134 ? 37.858 33.492 70.339 1.00 26.69 ? 127 GLY H N   1 
ATOM 2740 C CA  . GLY B 2 134 ? 38.016 34.628 71.224 1.00 32.94 ? 127 GLY H CA  1 
ATOM 2741 C C   . GLY B 2 134 ? 36.746 34.858 72.019 1.00 36.85 ? 127 GLY H C   1 
ATOM 2742 O O   . GLY B 2 134 ? 36.769 34.765 73.254 1.00 35.63 ? 127 GLY H O   1 
ATOM 2743 N N   . SER B 2 135 ? 35.657 35.160 71.307 1.00 39.81 ? 128 SER H N   1 
ATOM 2744 C CA  . SER B 2 135 ? 34.331 35.404 71.907 1.00 45.73 ? 128 SER H CA  1 
ATOM 2745 C C   . SER B 2 135 ? 34.325 35.879 73.384 1.00 46.35 ? 128 SER H C   1 
ATOM 2746 O O   . SER B 2 135 ? 34.934 36.948 73.662 1.00 46.46 ? 128 SER H O   1 
ATOM 2747 C CB  . SER B 2 135 ? 33.421 34.162 71.727 1.00 46.13 ? 128 SER H CB  1 
ATOM 2748 O OG  . SER B 2 135 ? 32.570 34.266 70.586 1.00 46.26 ? 128 SER H OG  1 
ATOM 2749 O OXT . SER B 2 135 ? 33.726 35.189 74.254 1.00 45.14 ? 128 SER H OXT 1 
ATOM 2750 N N   . SER C 3 1   ? 28.541 20.080 71.383 1.00 29.32 ? 141 SER I N   1 
ATOM 2751 C CA  . SER C 3 1   ? 29.707 21.015 71.463 1.00 30.23 ? 141 SER I CA  1 
ATOM 2752 C C   . SER C 3 1   ? 30.831 20.827 70.420 1.00 29.47 ? 141 SER I C   1 
ATOM 2753 O O   . SER C 3 1   ? 31.599 19.859 70.467 1.00 26.05 ? 141 SER I O   1 
ATOM 2754 C CB  . SER C 3 1   ? 30.257 21.050 72.882 1.00 31.15 ? 141 SER I CB  1 
ATOM 2755 O OG  . SER C 3 1   ? 29.780 22.217 73.530 1.00 33.00 ? 141 SER I OG  1 
ATOM 2756 N N   . MET C 3 2   ? 30.922 21.805 69.512 1.00 28.93 ? 142 MET I N   1 
ATOM 2757 C CA  . MET C 3 2   ? 31.881 21.840 68.405 1.00 23.75 ? 142 MET I CA  1 
ATOM 2758 C C   . MET C 3 2   ? 32.741 23.093 68.493 1.00 19.07 ? 142 MET I C   1 
ATOM 2759 O O   . MET C 3 2   ? 32.256 24.128 68.904 1.00 21.65 ? 142 MET I O   1 
ATOM 2760 C CB  . MET C 3 2   ? 31.114 21.870 67.085 1.00 25.60 ? 142 MET I CB  1 
ATOM 2761 C CG  . MET C 3 2   ? 30.359 20.591 66.788 1.00 26.74 ? 142 MET I CG  1 
ATOM 2762 S SD  . MET C 3 2   ? 31.502 19.226 66.545 1.00 25.01 ? 142 MET I SD  1 
ATOM 2763 C CE  . MET C 3 2   ? 31.786 19.429 64.754 1.00 22.88 ? 142 MET I CE  1 
ATOM 2764 N N   . VAL C 3 3   ? 34.019 22.980 68.150 1.00 15.69 ? 143 VAL I N   1 
ATOM 2765 C CA  . VAL C 3 3   ? 34.947 24.096 68.178 1.00 12.45 ? 143 VAL I CA  1 
ATOM 2766 C C   . VAL C 3 3   ? 35.441 24.458 66.779 1.00 15.00 ? 143 VAL I C   1 
ATOM 2767 O O   . VAL C 3 3   ? 36.103 23.663 66.112 1.00 11.45 ? 143 VAL I O   1 
ATOM 2768 C CB  . VAL C 3 3   ? 36.188 23.772 68.990 1.00 8.21  ? 143 VAL I CB  1 
ATOM 2769 C CG1 . VAL C 3 3   ? 36.932 25.027 69.316 1.00 14.42 ? 143 VAL I CG1 1 
ATOM 2770 C CG2 . VAL C 3 3   ? 35.832 23.063 70.228 1.00 13.91 ? 143 VAL I CG2 1 
ATOM 2771 N N   . THR C 3 4   ? 35.141 25.685 66.363 1.00 18.05 ? 144 THR I N   1 
ATOM 2772 C CA  . THR C 3 4   ? 35.564 26.206 65.074 1.00 17.18 ? 144 THR I CA  1 
ATOM 2773 C C   . THR C 3 4   ? 36.813 27.044 65.272 1.00 17.97 ? 144 THR I C   1 
ATOM 2774 O O   . THR C 3 4   ? 36.776 28.038 66.007 1.00 22.00 ? 144 THR I O   1 
ATOM 2775 C CB  . THR C 3 4   ? 34.502 27.144 64.440 1.00 12.20 ? 144 THR I CB  1 
ATOM 2776 O OG1 . THR C 3 4   ? 33.322 26.402 64.114 1.00 14.97 ? 144 THR I OG1 1 
ATOM 2777 C CG2 . THR C 3 4   ? 35.045 27.786 63.175 1.00 9.77  ? 144 THR I CG2 1 
ATOM 2778 N N   . LEU C 3 5   ? 37.931 26.581 64.720 1.00 15.26 ? 145 LEU I N   1 
ATOM 2779 C CA  . LEU C 3 5   ? 39.166 27.353 64.761 1.00 11.67 ? 145 LEU I CA  1 
ATOM 2780 C C   . LEU C 3 5   ? 39.240 27.913 63.343 1.00 10.04 ? 145 LEU I C   1 
ATOM 2781 O O   . LEU C 3 5   ? 38.374 27.621 62.517 1.00 12.42 ? 145 LEU I O   1 
ATOM 2782 C CB  . LEU C 3 5   ? 40.383 26.469 65.056 1.00 10.99 ? 145 LEU I CB  1 
ATOM 2783 C CG  . LEU C 3 5   ? 40.465 25.645 66.339 1.00 9.10  ? 145 LEU I CG  1 
ATOM 2784 C CD1 . LEU C 3 5   ? 39.505 26.258 67.359 1.00 10.27 ? 145 LEU I CD1 1 
ATOM 2785 C CD2 . LEU C 3 5   ? 40.124 24.177 66.057 1.00 2.11  ? 145 LEU I CD2 1 
ATOM 2786 N N   . GLY C 3 6   ? 40.253 28.705 63.047 1.00 9.05  ? 146 GLY I N   1 
ATOM 2787 C CA  . GLY C 3 6   ? 40.366 29.257 61.715 1.00 16.65 ? 146 GLY I CA  1 
ATOM 2788 C C   . GLY C 3 6   ? 41.817 29.540 61.417 1.00 21.89 ? 146 GLY I C   1 
ATOM 2789 O O   . GLY C 3 6   ? 42.683 29.232 62.246 1.00 28.03 ? 146 GLY I O   1 
ATOM 2790 N N   . CYS C 3 7   ? 42.104 30.171 60.280 1.00 19.67 ? 147 CYS I N   1 
ATOM 2791 C CA  . CYS C 3 7   ? 43.492 30.455 59.931 1.00 12.05 ? 147 CYS I CA  1 
ATOM 2792 C C   . CYS C 3 7   ? 43.520 31.577 58.956 1.00 7.54  ? 147 CYS I C   1 
ATOM 2793 O O   . CYS C 3 7   ? 42.968 31.429 57.881 1.00 13.11 ? 147 CYS I O   1 
ATOM 2794 C CB  . CYS C 3 7   ? 44.082 29.242 59.260 1.00 13.88 ? 147 CYS I CB  1 
ATOM 2795 S SG  . CYS C 3 7   ? 45.879 29.263 59.176 1.00 23.35 ? 147 CYS I SG  1 
ATOM 2796 N N   . LEU C 3 8   ? 44.095 32.711 59.331 1.00 2.00  ? 148 LEU I N   1 
ATOM 2797 C CA  . LEU C 3 8   ? 44.159 33.855 58.428 1.00 6.71  ? 148 LEU I CA  1 
ATOM 2798 C C   . LEU C 3 8   ? 45.454 33.883 57.606 1.00 9.15  ? 148 LEU I C   1 
ATOM 2799 O O   . LEU C 3 8   ? 46.532 34.227 58.137 1.00 4.64  ? 148 LEU I O   1 
ATOM 2800 C CB  . LEU C 3 8   ? 43.987 35.170 59.199 1.00 7.58  ? 148 LEU I CB  1 
ATOM 2801 C CG  . LEU C 3 8   ? 44.190 36.488 58.439 1.00 7.52  ? 148 LEU I CG  1 
ATOM 2802 C CD1 . LEU C 3 8   ? 43.350 36.511 57.158 1.00 10.35 ? 148 LEU I CD1 1 
ATOM 2803 C CD2 . LEU C 3 8   ? 43.838 37.657 59.330 1.00 4.63  ? 148 LEU I CD2 1 
ATOM 2804 N N   . VAL C 3 9   ? 45.328 33.499 56.324 1.00 7.69  ? 149 VAL I N   1 
ATOM 2805 C CA  . VAL C 3 9   ? 46.438 33.459 55.364 1.00 4.78  ? 149 VAL I CA  1 
ATOM 2806 C C   . VAL C 3 9   ? 46.274 34.809 54.683 1.00 2.29  ? 149 VAL I C   1 
ATOM 2807 O O   . VAL C 3 9   ? 45.230 35.070 54.086 1.00 6.70  ? 149 VAL I O   1 
ATOM 2808 C CB  . VAL C 3 9   ? 46.278 32.290 54.358 1.00 2.00  ? 149 VAL I CB  1 
ATOM 2809 C CG1 . VAL C 3 9   ? 47.576 32.027 53.654 1.00 2.00  ? 149 VAL I CG1 1 
ATOM 2810 C CG2 . VAL C 3 9   ? 45.851 31.024 55.068 1.00 2.00  ? 149 VAL I CG2 1 
ATOM 2811 N N   . LYS C 3 10  ? 47.288 35.664 54.773 1.00 2.00  ? 150 LYS I N   1 
ATOM 2812 C CA  . LYS C 3 10  ? 47.160 37.009 54.262 1.00 2.77  ? 150 LYS I CA  1 
ATOM 2813 C C   . LYS C 3 10  ? 48.400 37.673 53.678 1.00 8.19  ? 150 LYS I C   1 
ATOM 2814 O O   . LYS C 3 10  ? 49.503 37.521 54.207 1.00 11.33 ? 150 LYS I O   1 
ATOM 2815 C CB  . LYS C 3 10  ? 46.619 37.868 55.396 1.00 3.66  ? 150 LYS I CB  1 
ATOM 2816 C CG  . LYS C 3 10  ? 46.490 39.312 55.075 1.00 9.25  ? 150 LYS I CG  1 
ATOM 2817 C CD  . LYS C 3 10  ? 45.344 39.958 55.832 1.00 10.72 ? 150 LYS I CD  1 
ATOM 2818 C CE  . LYS C 3 10  ? 45.314 41.445 55.511 1.00 14.09 ? 150 LYS I CE  1 
ATOM 2819 N NZ  . LYS C 3 10  ? 46.706 42.007 55.330 1.00 14.31 ? 150 LYS I NZ  1 
ATOM 2820 N N   . GLY C 3 11  ? 48.204 38.396 52.570 1.00 6.99  ? 151 GLY I N   1 
ATOM 2821 C CA  . GLY C 3 11  ? 49.286 39.123 51.922 1.00 6.13  ? 151 GLY I CA  1 
ATOM 2822 C C   . GLY C 3 11  ? 50.188 38.365 50.965 1.00 10.08 ? 151 GLY I C   1 
ATOM 2823 O O   . GLY C 3 11  ? 51.314 38.804 50.694 1.00 13.69 ? 151 GLY I O   1 
ATOM 2824 N N   . TYR C 3 12  ? 49.679 37.281 50.385 1.00 10.66 ? 152 TYR I N   1 
ATOM 2825 C CA  . TYR C 3 12  ? 50.471 36.459 49.472 1.00 7.01  ? 152 TYR I CA  1 
ATOM 2826 C C   . TYR C 3 12  ? 50.167 36.733 48.014 1.00 7.98  ? 152 TYR I C   1 
ATOM 2827 O O   . TYR C 3 12  ? 49.090 37.212 47.660 1.00 7.65  ? 152 TYR I O   1 
ATOM 2828 C CB  . TYR C 3 12  ? 50.225 34.973 49.761 1.00 6.40  ? 152 TYR I CB  1 
ATOM 2829 C CG  . TYR C 3 12  ? 48.869 34.452 49.317 1.00 6.17  ? 152 TYR I CG  1 
ATOM 2830 C CD1 . TYR C 3 12  ? 48.718 33.854 48.065 1.00 6.51  ? 152 TYR I CD1 1 
ATOM 2831 C CD2 . TYR C 3 12  ? 47.740 34.579 50.122 1.00 4.24  ? 152 TYR I CD2 1 
ATOM 2832 C CE1 . TYR C 3 12  ? 47.482 33.399 47.617 1.00 5.30  ? 152 TYR I CE1 1 
ATOM 2833 C CE2 . TYR C 3 12  ? 46.486 34.125 49.676 1.00 5.65  ? 152 TYR I CE2 1 
ATOM 2834 C CZ  . TYR C 3 12  ? 46.368 33.540 48.414 1.00 3.27  ? 152 TYR I CZ  1 
ATOM 2835 O OH  . TYR C 3 12  ? 45.150 33.139 47.908 1.00 2.00  ? 152 TYR I OH  1 
ATOM 2836 N N   . PHE C 3 13  ? 51.119 36.378 47.167 1.00 11.71 ? 153 PHE I N   1 
ATOM 2837 C CA  . PHE C 3 13  ? 51.013 36.528 45.713 1.00 13.27 ? 153 PHE I CA  1 
ATOM 2838 C C   . PHE C 3 13  ? 52.093 35.605 45.123 1.00 13.56 ? 153 PHE I C   1 
ATOM 2839 O O   . PHE C 3 13  ? 53.174 35.439 45.697 1.00 14.51 ? 153 PHE I O   1 
ATOM 2840 C CB  . PHE C 3 13  ? 51.203 37.990 45.255 1.00 9.69  ? 153 PHE I CB  1 
ATOM 2841 C CG  . PHE C 3 13  ? 50.984 38.184 43.790 1.00 8.73  ? 153 PHE I CG  1 
ATOM 2842 C CD1 . PHE C 3 13  ? 52.063 38.185 42.898 1.00 8.25  ? 153 PHE I CD1 1 
ATOM 2843 C CD2 . PHE C 3 13  ? 49.684 38.246 43.278 1.00 12.16 ? 153 PHE I CD2 1 
ATOM 2844 C CE1 . PHE C 3 13  ? 51.854 38.230 41.508 1.00 6.10  ? 153 PHE I CE1 1 
ATOM 2845 C CE2 . PHE C 3 13  ? 49.448 38.292 41.879 1.00 9.66  ? 153 PHE I CE2 1 
ATOM 2846 C CZ  . PHE C 3 13  ? 50.538 38.280 40.999 1.00 10.70 ? 153 PHE I CZ  1 
ATOM 2847 N N   . PRO C 3 14  ? 51.769 34.901 44.037 1.00 12.56 ? 154 PRO I N   1 
ATOM 2848 C CA  . PRO C 3 14  ? 50.470 34.926 43.378 1.00 11.58 ? 154 PRO I CA  1 
ATOM 2849 C C   . PRO C 3 14  ? 49.643 33.868 44.068 1.00 13.65 ? 154 PRO I C   1 
ATOM 2850 O O   . PRO C 3 14  ? 49.521 33.875 45.293 1.00 13.43 ? 154 PRO I O   1 
ATOM 2851 C CB  . PRO C 3 14  ? 50.815 34.513 41.951 1.00 10.25 ? 154 PRO I CB  1 
ATOM 2852 C CG  . PRO C 3 14  ? 52.348 34.355 41.936 1.00 11.39 ? 154 PRO I CG  1 
ATOM 2853 C CD  . PRO C 3 14  ? 52.673 33.998 43.329 1.00 10.08 ? 154 PRO I CD  1 
ATOM 2854 N N   . GLU C 3 15  ? 49.079 32.952 43.298 1.00 14.09 ? 155 GLU I N   1 
ATOM 2855 C CA  . GLU C 3 15  ? 48.323 31.870 43.894 1.00 17.62 ? 155 GLU I CA  1 
ATOM 2856 C C   . GLU C 3 15  ? 48.986 30.524 43.532 1.00 19.43 ? 155 GLU I C   1 
ATOM 2857 O O   . GLU C 3 15  ? 50.011 30.468 42.838 1.00 21.88 ? 155 GLU I O   1 
ATOM 2858 C CB  . GLU C 3 15  ? 46.849 31.940 43.463 1.00 15.06 ? 155 GLU I CB  1 
ATOM 2859 C CG  . GLU C 3 15  ? 46.112 33.133 44.064 1.00 14.01 ? 155 GLU I CG  1 
ATOM 2860 C CD  . GLU C 3 15  ? 44.605 33.130 43.808 1.00 14.79 ? 155 GLU I CD  1 
ATOM 2861 O OE1 . GLU C 3 15  ? 43.835 32.945 44.776 1.00 19.84 ? 155 GLU I OE1 1 
ATOM 2862 O OE2 . GLU C 3 15  ? 44.182 33.347 42.655 1.00 8.72  ? 155 GLU I OE2 1 
ATOM 2863 N N   . PRO C 3 16  ? 48.529 29.449 44.148 1.00 20.04 ? 156 PRO I N   1 
ATOM 2864 C CA  . PRO C 3 16  ? 47.461 29.413 45.142 1.00 22.24 ? 156 PRO I CA  1 
ATOM 2865 C C   . PRO C 3 16  ? 48.065 29.068 46.505 1.00 22.50 ? 156 PRO I C   1 
ATOM 2866 O O   . PRO C 3 16  ? 49.288 29.110 46.658 1.00 25.11 ? 156 PRO I O   1 
ATOM 2867 C CB  . PRO C 3 16  ? 46.574 28.312 44.597 1.00 29.02 ? 156 PRO I CB  1 
ATOM 2868 C CG  . PRO C 3 16  ? 47.588 27.292 44.055 1.00 25.01 ? 156 PRO I CG  1 
ATOM 2869 C CD  . PRO C 3 16  ? 48.702 28.141 43.483 1.00 22.87 ? 156 PRO I CD  1 
ATOM 2870 N N   . VAL C 3 17  ? 47.231 28.782 47.504 1.00 22.04 ? 157 VAL I N   1 
ATOM 2871 C CA  . VAL C 3 17  ? 47.742 28.406 48.827 1.00 23.29 ? 157 VAL I CA  1 
ATOM 2872 C C   . VAL C 3 17  ? 46.922 27.281 49.434 1.00 22.40 ? 157 VAL I C   1 
ATOM 2873 O O   . VAL C 3 17  ? 45.776 27.468 49.817 1.00 25.73 ? 157 VAL I O   1 
ATOM 2874 C CB  . VAL C 3 17  ? 47.822 29.582 49.835 1.00 22.54 ? 157 VAL I CB  1 
ATOM 2875 C CG1 . VAL C 3 17  ? 48.849 30.599 49.373 1.00 20.92 ? 157 VAL I CG1 1 
ATOM 2876 C CG2 . VAL C 3 17  ? 46.451 30.223 50.043 1.00 22.94 ? 157 VAL I CG2 1 
ATOM 2877 N N   . THR C 3 18  ? 47.518 26.105 49.532 1.00 20.27 ? 158 THR I N   1 
ATOM 2878 C CA  . THR C 3 18  ? 46.807 24.971 50.067 1.00 14.42 ? 158 THR I CA  1 
ATOM 2879 C C   . THR C 3 18  ? 46.754 24.958 51.586 1.00 13.18 ? 158 THR I C   1 
ATOM 2880 O O   . THR C 3 18  ? 47.772 24.857 52.261 1.00 15.62 ? 158 THR I O   1 
ATOM 2881 C CB  . THR C 3 18  ? 47.327 23.639 49.445 1.00 12.64 ? 158 THR I CB  1 
ATOM 2882 O OG1 . THR C 3 18  ? 48.762 23.558 49.517 1.00 6.03  ? 158 THR I OG1 1 
ATOM 2883 C CG2 . THR C 3 18  ? 46.910 23.584 47.984 1.00 7.95  ? 158 THR I CG2 1 
ATOM 2884 N N   . VAL C 3 19  ? 45.563 25.182 52.114 1.00 12.38 ? 159 VAL I N   1 
ATOM 2885 C CA  . VAL C 3 19  ? 45.365 25.169 53.551 1.00 12.25 ? 159 VAL I CA  1 
ATOM 2886 C C   . VAL C 3 19  ? 44.849 23.776 53.892 1.00 11.91 ? 159 VAL I C   1 
ATOM 2887 O O   . VAL C 3 19  ? 43.818 23.336 53.376 1.00 10.59 ? 159 VAL I O   1 
ATOM 2888 C CB  . VAL C 3 19  ? 44.311 26.216 54.031 1.00 11.24 ? 159 VAL I CB  1 
ATOM 2889 C CG1 . VAL C 3 19  ? 44.377 26.387 55.534 1.00 11.21 ? 159 VAL I CG1 1 
ATOM 2890 C CG2 . VAL C 3 19  ? 44.527 27.540 53.381 1.00 14.72 ? 159 VAL I CG2 1 
ATOM 2891 N N   . THR C 3 20  ? 45.612 23.083 54.725 1.00 13.24 ? 160 THR I N   1 
ATOM 2892 C CA  . THR C 3 20  ? 45.290 21.752 55.212 1.00 16.08 ? 160 THR I CA  1 
ATOM 2893 C C   . THR C 3 20  ? 45.146 21.920 56.738 1.00 16.45 ? 160 THR I C   1 
ATOM 2894 O O   . THR C 3 20  ? 45.487 22.979 57.298 1.00 12.43 ? 160 THR I O   1 
ATOM 2895 C CB  . THR C 3 20  ? 46.438 20.720 54.840 1.00 17.64 ? 160 THR I CB  1 
ATOM 2896 O OG1 . THR C 3 20  ? 46.170 20.100 53.574 1.00 16.69 ? 160 THR I OG1 1 
ATOM 2897 C CG2 . THR C 3 20  ? 46.580 19.624 55.858 1.00 20.49 ? 160 THR I CG2 1 
ATOM 2898 N N   . TRP C 3 21  ? 44.566 20.922 57.396 1.00 12.98 ? 161 TRP I N   1 
ATOM 2899 C CA  . TRP C 3 21  ? 44.416 20.969 58.836 1.00 12.93 ? 161 TRP I CA  1 
ATOM 2900 C C   . TRP C 3 21  ? 44.767 19.610 59.408 1.00 13.84 ? 161 TRP I C   1 
ATOM 2901 O O   . TRP C 3 21  ? 44.234 18.589 58.972 1.00 17.86 ? 161 TRP I O   1 
ATOM 2902 C CB  . TRP C 3 21  ? 42.990 21.327 59.215 1.00 14.75 ? 161 TRP I CB  1 
ATOM 2903 C CG  . TRP C 3 21  ? 42.604 22.725 58.905 1.00 15.75 ? 161 TRP I CG  1 
ATOM 2904 C CD1 . TRP C 3 21  ? 42.094 23.193 57.728 1.00 15.49 ? 161 TRP I CD1 1 
ATOM 2905 C CD2 . TRP C 3 21  ? 42.629 23.840 59.799 1.00 16.95 ? 161 TRP I CD2 1 
ATOM 2906 N NE1 . TRP C 3 21  ? 41.798 24.523 57.833 1.00 14.12 ? 161 TRP I NE1 1 
ATOM 2907 C CE2 . TRP C 3 21  ? 42.116 24.948 59.097 1.00 17.98 ? 161 TRP I CE2 1 
ATOM 2908 C CE3 . TRP C 3 21  ? 43.033 24.005 61.132 1.00 18.33 ? 161 TRP I CE3 1 
ATOM 2909 C CZ2 . TRP C 3 21  ? 41.989 26.213 59.682 1.00 18.14 ? 161 TRP I CZ2 1 
ATOM 2910 C CZ3 . TRP C 3 21  ? 42.907 25.270 61.713 1.00 19.18 ? 161 TRP I CZ3 1 
ATOM 2911 C CH2 . TRP C 3 21  ? 42.390 26.354 60.985 1.00 17.18 ? 161 TRP I CH2 1 
ATOM 2912 N N   . ASN C 3 22  ? 45.676 19.594 60.376 1.00 15.18 ? 162 ASN I N   1 
ATOM 2913 C CA  . ASN C 3 22  ? 46.103 18.354 61.019 1.00 11.89 ? 162 ASN I CA  1 
ATOM 2914 C C   . ASN C 3 22  ? 46.713 17.421 59.991 1.00 17.32 ? 162 ASN I C   1 
ATOM 2915 O O   . ASN C 3 22  ? 46.324 16.256 59.879 1.00 13.36 ? 162 ASN I O   1 
ATOM 2916 C CB  . ASN C 3 22  ? 44.932 17.674 61.721 1.00 11.89 ? 162 ASN I CB  1 
ATOM 2917 C CG  . ASN C 3 22  ? 44.687 18.216 63.102 1.00 10.04 ? 162 ASN I CG  1 
ATOM 2918 O OD1 . ASN C 3 22  ? 43.585 18.627 63.450 1.00 7.37  ? 162 ASN I OD1 1 
ATOM 2919 N ND2 . ASN C 3 22  ? 45.715 18.222 63.906 1.00 7.28  ? 162 ASN I ND2 1 
ATOM 2920 N N   . SER C 3 23  ? 47.636 17.977 59.202 1.00 22.26 ? 163 SER I N   1 
ATOM 2921 C CA  . SER C 3 23  ? 48.361 17.260 58.139 1.00 23.87 ? 163 SER I CA  1 
ATOM 2922 C C   . SER C 3 23  ? 47.445 16.523 57.154 1.00 23.62 ? 163 SER I C   1 
ATOM 2923 O O   . SER C 3 23  ? 47.845 15.561 56.495 1.00 24.53 ? 163 SER I O   1 
ATOM 2924 C CB  . SER C 3 23  ? 49.426 16.313 58.727 1.00 22.06 ? 163 SER I CB  1 
ATOM 2925 O OG  . SER C 3 23  ? 50.486 17.034 59.347 1.00 20.62 ? 163 SER I OG  1 
ATOM 2926 N N   . GLY C 3 24  ? 46.211 17.001 57.065 1.00 22.24 ? 164 GLY I N   1 
ATOM 2927 C CA  . GLY C 3 24  ? 45.246 16.407 56.174 1.00 21.24 ? 164 GLY I CA  1 
ATOM 2928 C C   . GLY C 3 24  ? 44.351 15.439 56.901 1.00 21.37 ? 164 GLY I C   1 
ATOM 2929 O O   . GLY C 3 24  ? 43.526 14.796 56.262 1.00 26.99 ? 164 GLY I O   1 
ATOM 2930 N N   . SER C 3 25  ? 44.467 15.360 58.225 1.00 20.66 ? 165 SER I N   1 
ATOM 2931 C CA  . SER C 3 25  ? 43.644 14.432 58.989 1.00 19.12 ? 165 SER I CA  1 
ATOM 2932 C C   . SER C 3 25  ? 42.286 14.999 59.409 1.00 19.55 ? 165 SER I C   1 
ATOM 2933 O O   . SER C 3 25  ? 41.466 14.289 59.985 1.00 23.29 ? 165 SER I O   1 
ATOM 2934 C CB  . SER C 3 25  ? 44.419 13.860 60.174 1.00 20.26 ? 165 SER I CB  1 
ATOM 2935 O OG  . SER C 3 25  ? 44.830 14.876 61.060 1.00 19.31 ? 165 SER I OG  1 
ATOM 2936 N N   . LEU C 3 26  ? 42.050 16.283 59.161 1.00 17.34 ? 166 LEU I N   1 
ATOM 2937 C CA  . LEU C 3 26  ? 40.750 16.869 59.474 1.00 13.58 ? 166 LEU I CA  1 
ATOM 2938 C C   . LEU C 3 26  ? 40.116 17.159 58.118 1.00 17.33 ? 166 LEU I C   1 
ATOM 2939 O O   . LEU C 3 26  ? 40.272 18.257 57.603 1.00 19.56 ? 166 LEU I O   1 
ATOM 2940 C CB  . LEU C 3 26  ? 40.888 18.182 60.261 1.00 10.48 ? 166 LEU I CB  1 
ATOM 2941 C CG  . LEU C 3 26  ? 41.423 18.204 61.702 1.00 7.66  ? 166 LEU I CG  1 
ATOM 2942 C CD1 . LEU C 3 26  ? 41.466 19.593 62.311 1.00 2.95  ? 166 LEU I CD1 1 
ATOM 2943 C CD2 . LEU C 3 26  ? 40.543 17.337 62.533 1.00 7.49  ? 166 LEU I CD2 1 
ATOM 2944 N N   . SER C 3 27  ? 39.453 16.165 57.519 1.00 21.13 ? 167 SER I N   1 
ATOM 2945 C CA  . SER C 3 27  ? 38.808 16.333 56.205 1.00 22.22 ? 167 SER I CA  1 
ATOM 2946 C C   . SER C 3 27  ? 37.309 16.559 56.379 1.00 22.06 ? 167 SER I C   1 
ATOM 2947 O O   . SER C 3 27  ? 36.525 16.478 55.419 1.00 20.72 ? 167 SER I O   1 
ATOM 2948 C CB  . SER C 3 27  ? 39.030 15.092 55.342 1.00 20.21 ? 167 SER I CB  1 
ATOM 2949 O OG  . SER C 3 27  ? 38.249 14.026 55.849 1.00 25.87 ? 167 SER I OG  1 
ATOM 2950 N N   . SER C 3 28  ? 36.920 16.743 57.633 1.00 21.58 ? 168 SER I N   1 
ATOM 2951 C CA  . SER C 3 28  ? 35.542 16.989 58.001 1.00 24.26 ? 168 SER I CA  1 
ATOM 2952 C C   . SER C 3 28  ? 35.477 18.485 58.330 1.00 25.78 ? 168 SER I C   1 
ATOM 2953 O O   . SER C 3 28  ? 36.493 19.078 58.686 1.00 26.31 ? 168 SER I O   1 
ATOM 2954 C CB  . SER C 3 28  ? 35.186 16.143 59.237 1.00 23.81 ? 168 SER I CB  1 
ATOM 2955 O OG  . SER C 3 28  ? 33.838 16.327 59.665 1.00 29.08 ? 168 SER I OG  1 
ATOM 2956 N N   . GLY C 3 29  ? 34.297 19.086 58.164 1.00 26.48 ? 169 GLY I N   1 
ATOM 2957 C CA  . GLY C 3 29  ? 34.086 20.495 58.473 1.00 20.48 ? 169 GLY I CA  1 
ATOM 2958 C C   . GLY C 3 29  ? 35.303 21.376 58.374 1.00 14.76 ? 169 GLY I C   1 
ATOM 2959 O O   . GLY C 3 29  ? 35.809 21.850 59.380 1.00 12.68 ? 169 GLY I O   1 
ATOM 2960 N N   . VAL C 3 30  ? 35.788 21.528 57.148 1.00 14.14 ? 170 VAL I N   1 
ATOM 2961 C CA  . VAL C 3 30  ? 36.943 22.355 56.819 1.00 9.03  ? 170 VAL I CA  1 
ATOM 2962 C C   . VAL C 3 30  ? 36.625 23.152 55.530 1.00 4.89  ? 170 VAL I C   1 
ATOM 2963 O O   . VAL C 3 30  ? 36.259 22.577 54.522 1.00 2.00  ? 170 VAL I O   1 
ATOM 2964 C CB  . VAL C 3 30  ? 38.244 21.463 56.685 1.00 8.39  ? 170 VAL I CB  1 
ATOM 2965 C CG1 . VAL C 3 30  ? 37.855 20.034 56.393 1.00 7.53  ? 170 VAL I CG1 1 
ATOM 2966 C CG2 . VAL C 3 30  ? 39.202 21.987 55.597 1.00 3.83  ? 170 VAL I CG2 1 
ATOM 2967 N N   . HIS C 3 31  ? 36.641 24.480 55.601 1.00 3.35  ? 171 HIS I N   1 
ATOM 2968 C CA  . HIS C 3 31  ? 36.359 25.283 54.418 1.00 2.00  ? 171 HIS I CA  1 
ATOM 2969 C C   . HIS C 3 31  ? 37.476 26.266 54.192 1.00 2.53  ? 171 HIS I C   1 
ATOM 2970 O O   . HIS C 3 31  ? 37.781 27.052 55.087 1.00 6.78  ? 171 HIS I O   1 
ATOM 2971 C CB  . HIS C 3 31  ? 35.092 26.124 54.572 1.00 2.15  ? 171 HIS I CB  1 
ATOM 2972 C CG  . HIS C 3 31  ? 33.890 25.356 55.009 1.00 8.54  ? 171 HIS I CG  1 
ATOM 2973 N ND1 . HIS C 3 31  ? 32.640 25.933 55.063 1.00 8.53  ? 171 HIS I ND1 1 
ATOM 2974 C CD2 . HIS C 3 31  ? 33.740 24.087 55.463 1.00 10.43 ? 171 HIS I CD2 1 
ATOM 2975 C CE1 . HIS C 3 31  ? 31.772 25.051 55.534 1.00 10.67 ? 171 HIS I CE1 1 
ATOM 2976 N NE2 . HIS C 3 31  ? 32.413 23.923 55.785 1.00 11.74 ? 171 HIS I NE2 1 
ATOM 2977 N N   . THR C 3 32  ? 38.114 26.201 53.031 1.00 2.00  ? 172 THR I N   1 
ATOM 2978 C CA  . THR C 3 32  ? 39.150 27.161 52.682 1.00 2.00  ? 172 THR I CA  1 
ATOM 2979 C C   . THR C 3 32  ? 38.371 28.037 51.710 1.00 6.98  ? 172 THR I C   1 
ATOM 2980 O O   . THR C 3 32  ? 37.728 27.528 50.777 1.00 8.12  ? 172 THR I O   1 
ATOM 2981 C CB  . THR C 3 32  ? 40.339 26.516 51.979 1.00 6.78  ? 172 THR I CB  1 
ATOM 2982 O OG1 . THR C 3 32  ? 41.005 25.625 52.883 1.00 6.56  ? 172 THR I OG1 1 
ATOM 2983 C CG2 . THR C 3 32  ? 41.329 27.591 51.485 1.00 7.21  ? 172 THR I CG2 1 
ATOM 2984 N N   . PHE C 3 33  ? 38.327 29.334 52.001 1.00 7.83  ? 173 PHE I N   1 
ATOM 2985 C CA  . PHE C 3 33  ? 37.555 30.261 51.197 1.00 2.00  ? 173 PHE I CA  1 
ATOM 2986 C C   . PHE C 3 33  ? 38.319 30.840 50.065 1.00 3.95  ? 173 PHE I C   1 
ATOM 2987 O O   . PHE C 3 33  ? 39.546 30.815 50.043 1.00 3.57  ? 173 PHE I O   1 
ATOM 2988 C CB  . PHE C 3 33  ? 36.992 31.360 52.065 1.00 2.00  ? 173 PHE I CB  1 
ATOM 2989 C CG  . PHE C 3 33  ? 35.935 30.883 53.014 1.00 2.07  ? 173 PHE I CG  1 
ATOM 2990 C CD1 . PHE C 3 33  ? 36.251 30.594 54.341 1.00 2.00  ? 173 PHE I CD1 1 
ATOM 2991 C CD2 . PHE C 3 33  ? 34.601 30.805 52.605 1.00 3.93  ? 173 PHE I CD2 1 
ATOM 2992 C CE1 . PHE C 3 33  ? 35.257 30.250 55.256 1.00 2.00  ? 173 PHE I CE1 1 
ATOM 2993 C CE2 . PHE C 3 33  ? 33.583 30.458 53.521 1.00 5.33  ? 173 PHE I CE2 1 
ATOM 2994 C CZ  . PHE C 3 33  ? 33.912 30.185 54.853 1.00 3.50  ? 173 PHE I CZ  1 
ATOM 2995 N N   . PRO C 3 34  ? 37.595 31.271 49.040 1.00 4.95  ? 174 PRO I N   1 
ATOM 2996 C CA  . PRO C 3 34  ? 38.218 31.863 47.864 1.00 6.84  ? 174 PRO I CA  1 
ATOM 2997 C C   . PRO C 3 34  ? 38.983 33.171 48.161 1.00 8.49  ? 174 PRO I C   1 
ATOM 2998 O O   . PRO C 3 34  ? 38.504 34.062 48.865 1.00 9.55  ? 174 PRO I O   1 
ATOM 2999 C CB  . PRO C 3 34  ? 37.020 32.070 46.933 1.00 5.69  ? 174 PRO I CB  1 
ATOM 3000 C CG  . PRO C 3 34  ? 36.127 30.945 47.284 1.00 3.59  ? 174 PRO I CG  1 
ATOM 3001 C CD  . PRO C 3 34  ? 36.177 30.967 48.788 1.00 7.01  ? 174 PRO I CD  1 
ATOM 3002 N N   . ALA C 3 35  ? 40.186 33.274 47.627 1.00 5.16  ? 175 ALA I N   1 
ATOM 3003 C CA  . ALA C 3 35  ? 40.977 34.461 47.838 1.00 10.92 ? 175 ALA I CA  1 
ATOM 3004 C C   . ALA C 3 35  ? 40.355 35.660 47.137 1.00 11.18 ? 175 ALA I C   1 
ATOM 3005 O O   . ALA C 3 35  ? 39.557 35.487 46.224 1.00 16.19 ? 175 ALA I O   1 
ATOM 3006 C CB  . ALA C 3 35  ? 42.371 34.220 47.306 1.00 15.89 ? 175 ALA I CB  1 
ATOM 3007 N N   . VAL C 3 36  ? 40.671 36.866 47.604 1.00 11.60 ? 176 VAL I N   1 
ATOM 3008 C CA  . VAL C 3 36  ? 40.206 38.107 46.966 1.00 12.76 ? 176 VAL I CA  1 
ATOM 3009 C C   . VAL C 3 36  ? 41.443 38.965 46.778 1.00 19.02 ? 176 VAL I C   1 
ATOM 3010 O O   . VAL C 3 36  ? 42.537 38.434 46.588 1.00 20.67 ? 176 VAL I O   1 
ATOM 3011 C CB  . VAL C 3 36  ? 39.229 38.904 47.834 1.00 10.34 ? 176 VAL I CB  1 
ATOM 3012 C CG1 . VAL C 3 36  ? 37.882 38.213 47.880 1.00 14.98 ? 176 VAL I CG1 1 
ATOM 3013 C CG2 . VAL C 3 36  ? 39.805 39.105 49.223 1.00 9.21  ? 176 VAL I CG2 1 
ATOM 3014 N N   . LEU C 3 37  ? 41.277 40.285 46.831 1.00 24.24 ? 177 LEU I N   1 
ATOM 3015 C CA  . LEU C 3 37  ? 42.400 41.216 46.720 1.00 27.79 ? 177 LEU I CA  1 
ATOM 3016 C C   . LEU C 3 37  ? 42.135 42.357 47.708 1.00 33.32 ? 177 LEU I C   1 
ATOM 3017 O O   . LEU C 3 37  ? 41.223 43.174 47.488 1.00 32.62 ? 177 LEU I O   1 
ATOM 3018 C CB  . LEU C 3 37  ? 42.558 41.817 45.310 1.00 24.39 ? 177 LEU I CB  1 
ATOM 3019 C CG  . LEU C 3 37  ? 42.821 41.132 43.959 1.00 21.08 ? 177 LEU I CG  1 
ATOM 3020 C CD1 . LEU C 3 37  ? 44.044 40.277 43.965 1.00 15.96 ? 177 LEU I CD1 1 
ATOM 3021 C CD2 . LEU C 3 37  ? 41.614 40.351 43.518 1.00 27.73 ? 177 LEU I CD2 1 
ATOM 3022 N N   . GLN C 3 38  ? 42.884 42.374 48.818 1.00 38.54 ? 178 GLN I N   1 
ATOM 3023 C CA  . GLN C 3 38  ? 42.760 43.430 49.842 1.00 40.70 ? 178 GLN I CA  1 
ATOM 3024 C C   . GLN C 3 38  ? 43.151 44.763 49.170 1.00 39.83 ? 178 GLN I C   1 
ATOM 3025 O O   . GLN C 3 38  ? 42.807 45.862 49.650 1.00 38.16 ? 178 GLN I O   1 
ATOM 3026 C CB  . GLN C 3 38  ? 43.693 43.139 51.035 1.00 44.59 ? 178 GLN I CB  1 
ATOM 3027 C CG  . GLN C 3 38  ? 43.306 43.815 52.364 1.00 48.13 ? 178 GLN I CG  1 
ATOM 3028 C CD  . GLN C 3 38  ? 42.056 43.199 53.005 1.00 51.75 ? 178 GLN I CD  1 
ATOM 3029 O OE1 . GLN C 3 38  ? 41.918 41.966 53.089 1.00 49.45 ? 178 GLN I OE1 1 
ATOM 3030 N NE2 . GLN C 3 38  ? 41.141 44.058 53.467 1.00 51.89 ? 178 GLN I NE2 1 
ATOM 3031 N N   . SER C 3 39  ? 43.917 44.615 48.080 1.00 34.71 ? 179 SER I N   1 
ATOM 3032 C CA  . SER C 3 39  ? 44.403 45.687 47.205 1.00 28.60 ? 179 SER I CA  1 
ATOM 3033 C C   . SER C 3 39  ? 45.193 44.943 46.152 1.00 21.63 ? 179 SER I C   1 
ATOM 3034 O O   . SER C 3 39  ? 44.600 44.438 45.213 1.00 21.82 ? 179 SER I O   1 
ATOM 3035 C CB  . SER C 3 39  ? 45.273 46.747 47.916 1.00 28.16 ? 179 SER I CB  1 
ATOM 3036 O OG  . SER C 3 39  ? 45.527 47.853 47.050 1.00 19.86 ? 179 SER I OG  1 
ATOM 3037 N N   . ASP C 3 40  ? 46.502 44.804 46.327 1.00 17.08 ? 180 ASP I N   1 
ATOM 3038 C CA  . ASP C 3 40  ? 47.277 44.095 45.323 1.00 18.92 ? 180 ASP I CA  1 
ATOM 3039 C C   . ASP C 3 40  ? 47.820 42.712 45.693 1.00 17.79 ? 180 ASP I C   1 
ATOM 3040 O O   . ASP C 3 40  ? 48.585 42.108 44.941 1.00 17.19 ? 180 ASP I O   1 
ATOM 3041 C CB  . ASP C 3 40  ? 48.363 44.996 44.741 1.00 20.00 ? 180 ASP I CB  1 
ATOM 3042 C CG  . ASP C 3 40  ? 48.003 45.513 43.347 1.00 19.82 ? 180 ASP I CG  1 
ATOM 3043 O OD1 . ASP C 3 40  ? 46.985 45.057 42.759 1.00 16.17 ? 180 ASP I OD1 1 
ATOM 3044 O OD2 . ASP C 3 40  ? 48.748 46.382 42.844 1.00 20.46 ? 180 ASP I OD2 1 
ATOM 3045 N N   . LEU C 3 41  ? 47.407 42.218 46.852 1.00 14.66 ? 181 LEU I N   1 
ATOM 3046 C CA  . LEU C 3 41  ? 47.806 40.900 47.310 1.00 7.86  ? 181 LEU I CA  1 
ATOM 3047 C C   . LEU C 3 41  ? 46.516 40.110 47.611 1.00 5.46  ? 181 LEU I C   1 
ATOM 3048 O O   . LEU C 3 41  ? 45.447 40.686 47.859 1.00 2.00  ? 181 LEU I O   1 
ATOM 3049 C CB  . LEU C 3 41  ? 48.670 41.007 48.582 1.00 8.02  ? 181 LEU I CB  1 
ATOM 3050 C CG  . LEU C 3 41  ? 50.041 41.682 48.671 1.00 2.60  ? 181 LEU I CG  1 
ATOM 3051 C CD1 . LEU C 3 41  ? 51.130 40.799 48.161 1.00 2.31  ? 181 LEU I CD1 1 
ATOM 3052 C CD2 . LEU C 3 41  ? 50.003 42.984 47.916 1.00 6.12  ? 181 LEU I CD2 1 
ATOM 3053 N N   . TYR C 3 42  ? 46.622 38.788 47.599 1.00 5.43  ? 182 TYR I N   1 
ATOM 3054 C CA  . TYR C 3 42  ? 45.486 37.933 47.875 1.00 3.25  ? 182 TYR I CA  1 
ATOM 3055 C C   . TYR C 3 42  ? 45.315 37.550 49.326 1.00 5.36  ? 182 TYR I C   1 
ATOM 3056 O O   . TYR C 3 42  ? 46.275 37.239 50.047 1.00 5.09  ? 182 TYR I O   1 
ATOM 3057 C CB  . TYR C 3 42  ? 45.581 36.658 47.071 1.00 4.58  ? 182 TYR I CB  1 
ATOM 3058 C CG  . TYR C 3 42  ? 45.288 36.814 45.605 1.00 5.80  ? 182 TYR I CG  1 
ATOM 3059 C CD1 . TYR C 3 42  ? 43.991 36.763 45.135 1.00 3.46  ? 182 TYR I CD1 1 
ATOM 3060 C CD2 . TYR C 3 42  ? 46.323 36.932 44.677 1.00 6.91  ? 182 TYR I CD2 1 
ATOM 3061 C CE1 . TYR C 3 42  ? 43.724 36.813 43.786 1.00 9.66  ? 182 TYR I CE1 1 
ATOM 3062 C CE2 . TYR C 3 42  ? 46.068 36.980 43.306 1.00 9.92  ? 182 TYR I CE2 1 
ATOM 3063 C CZ  . TYR C 3 42  ? 44.760 36.915 42.859 1.00 10.07 ? 182 TYR I CZ  1 
ATOM 3064 O OH  . TYR C 3 42  ? 44.476 36.891 41.499 1.00 8.05  ? 182 TYR I OH  1 
ATOM 3065 N N   . THR C 3 43  ? 44.071 37.548 49.758 1.00 4.88  ? 183 THR I N   1 
ATOM 3066 C CA  . THR C 3 43  ? 43.779 37.151 51.106 1.00 6.64  ? 183 THR I CA  1 
ATOM 3067 C C   . THR C 3 43  ? 42.771 36.027 51.063 1.00 8.42  ? 183 THR I C   1 
ATOM 3068 O O   . THR C 3 43  ? 41.884 36.009 50.197 1.00 9.11  ? 183 THR I O   1 
ATOM 3069 C CB  . THR C 3 43  ? 43.284 38.299 51.922 1.00 8.75  ? 183 THR I CB  1 
ATOM 3070 O OG1 . THR C 3 43  ? 44.282 39.326 51.887 1.00 17.02 ? 183 THR I OG1 1 
ATOM 3071 C CG2 . THR C 3 43  ? 43.060 37.853 53.376 1.00 10.32 ? 183 THR I CG2 1 
ATOM 3072 N N   . LEU C 3 44  ? 42.932 35.087 51.991 1.00 7.04  ? 184 LEU I N   1 
ATOM 3073 C CA  . LEU C 3 44  ? 42.094 33.918 52.078 1.00 2.00  ? 184 LEU I CA  1 
ATOM 3074 C C   . LEU C 3 44  ? 42.077 33.472 53.523 1.00 2.15  ? 184 LEU I C   1 
ATOM 3075 O O   . LEU C 3 44  ? 42.914 33.909 54.317 1.00 4.07  ? 184 LEU I O   1 
ATOM 3076 C CB  . LEU C 3 44  ? 42.694 32.837 51.177 1.00 3.57  ? 184 LEU I CB  1 
ATOM 3077 C CG  . LEU C 3 44  ? 42.322 31.359 51.252 1.00 3.51  ? 184 LEU I CG  1 
ATOM 3078 C CD1 . LEU C 3 44  ? 42.727 30.804 49.945 1.00 5.54  ? 184 LEU I CD1 1 
ATOM 3079 C CD2 . LEU C 3 44  ? 42.989 30.579 52.394 1.00 2.00  ? 184 LEU I CD2 1 
ATOM 3080 N N   . SER C 3 45  ? 41.116 32.602 53.838 1.00 4.89  ? 185 SER I N   1 
ATOM 3081 C CA  . SER C 3 45  ? 40.908 32.038 55.168 1.00 2.00  ? 185 SER I CA  1 
ATOM 3082 C C   . SER C 3 45  ? 40.447 30.577 55.099 1.00 3.62  ? 185 SER I C   1 
ATOM 3083 O O   . SER C 3 45  ? 40.099 30.063 54.036 1.00 2.15  ? 185 SER I O   1 
ATOM 3084 C CB  . SER C 3 45  ? 39.862 32.853 55.912 1.00 2.59  ? 185 SER I CB  1 
ATOM 3085 O OG  . SER C 3 45  ? 40.239 34.217 55.988 1.00 6.31  ? 185 SER I OG  1 
ATOM 3086 N N   . SER C 3 46  ? 40.421 29.920 56.247 1.00 3.78  ? 186 SER I N   1 
ATOM 3087 C CA  . SER C 3 46  ? 40.019 28.533 56.304 1.00 4.26  ? 186 SER I CA  1 
ATOM 3088 C C   . SER C 3 46  ? 39.477 28.180 57.704 1.00 9.76  ? 186 SER I C   1 
ATOM 3089 O O   . SER C 3 46  ? 40.029 28.627 58.730 1.00 12.35 ? 186 SER I O   1 
ATOM 3090 C CB  . SER C 3 46  ? 41.212 27.666 55.952 1.00 2.50  ? 186 SER I CB  1 
ATOM 3091 O OG  . SER C 3 46  ? 40.871 26.300 56.048 1.00 9.65  ? 186 SER I OG  1 
ATOM 3092 N N   . SER C 3 47  ? 38.413 27.374 57.743 1.00 4.72  ? 187 SER I N   1 
ATOM 3093 C CA  . SER C 3 47  ? 37.785 26.994 59.000 1.00 5.38  ? 187 SER I CA  1 
ATOM 3094 C C   . SER C 3 47  ? 37.708 25.485 59.206 1.00 7.83  ? 187 SER I C   1 
ATOM 3095 O O   . SER C 3 47  ? 37.573 24.734 58.247 1.00 3.90  ? 187 SER I O   1 
ATOM 3096 C CB  . SER C 3 47  ? 36.366 27.585 59.077 1.00 2.40  ? 187 SER I CB  1 
ATOM 3097 O OG  . SER C 3 47  ? 35.376 26.764 58.463 1.00 2.00  ? 187 SER I OG  1 
ATOM 3098 N N   . VAL C 3 48  ? 37.687 25.070 60.473 1.00 11.22 ? 188 VAL I N   1 
ATOM 3099 C CA  . VAL C 3 48  ? 37.587 23.664 60.852 1.00 11.36 ? 188 VAL I CA  1 
ATOM 3100 C C   . VAL C 3 48  ? 36.891 23.604 62.207 1.00 13.41 ? 188 VAL I C   1 
ATOM 3101 O O   . VAL C 3 48  ? 37.378 24.190 63.167 1.00 15.95 ? 188 VAL I O   1 
ATOM 3102 C CB  . VAL C 3 48  ? 38.995 22.967 60.899 1.00 10.33 ? 188 VAL I CB  1 
ATOM 3103 C CG1 . VAL C 3 48  ? 39.788 23.328 62.155 1.00 5.54  ? 188 VAL I CG1 1 
ATOM 3104 C CG2 . VAL C 3 48  ? 38.850 21.477 60.751 1.00 7.70  ? 188 VAL I CG2 1 
ATOM 3105 N N   . THR C 3 49  ? 35.679 23.048 62.254 1.00 16.02 ? 189 THR I N   1 
ATOM 3106 C CA  . THR C 3 49  ? 34.966 22.946 63.532 1.00 14.61 ? 189 THR I CA  1 
ATOM 3107 C C   . THR C 3 49  ? 35.253 21.524 63.969 1.00 13.24 ? 189 THR I C   1 
ATOM 3108 O O   . THR C 3 49  ? 34.927 20.573 63.263 1.00 16.56 ? 189 THR I O   1 
ATOM 3109 C CB  . THR C 3 49  ? 33.394 23.251 63.464 1.00 10.51 ? 189 THR I CB  1 
ATOM 3110 O OG1 . THR C 3 49  ? 32.652 22.052 63.241 1.00 10.66 ? 189 THR I OG1 1 
ATOM 3111 C CG2 . THR C 3 49  ? 33.031 24.230 62.366 1.00 4.04  ? 189 THR I CG2 1 
ATOM 3112 N N   . VAL C 3 50  ? 36.068 21.400 65.000 1.00 16.24 ? 190 VAL I N   1 
ATOM 3113 C CA  . VAL C 3 50  ? 36.428 20.094 65.534 1.00 21.11 ? 190 VAL I CA  1 
ATOM 3114 C C   . VAL C 3 50  ? 35.616 19.832 66.797 1.00 24.58 ? 190 VAL I C   1 
ATOM 3115 O O   . VAL C 3 50  ? 34.927 20.728 67.279 1.00 21.28 ? 190 VAL I O   1 
ATOM 3116 C CB  . VAL C 3 50  ? 37.919 20.037 65.889 1.00 19.03 ? 190 VAL I CB  1 
ATOM 3117 C CG1 . VAL C 3 50  ? 38.743 20.219 64.660 1.00 20.71 ? 190 VAL I CG1 1 
ATOM 3118 C CG2 . VAL C 3 50  ? 38.264 21.095 66.911 1.00 19.91 ? 190 VAL I CG2 1 
ATOM 3119 N N   . PRO C 3 51  ? 35.639 18.587 67.324 1.00 28.38 ? 191 PRO I N   1 
ATOM 3120 C CA  . PRO C 3 51  ? 34.856 18.360 68.544 1.00 29.04 ? 191 PRO I CA  1 
ATOM 3121 C C   . PRO C 3 51  ? 35.436 19.225 69.666 1.00 27.68 ? 191 PRO I C   1 
ATOM 3122 O O   . PRO C 3 51  ? 36.627 19.557 69.652 1.00 29.28 ? 191 PRO I O   1 
ATOM 3123 C CB  . PRO C 3 51  ? 35.064 16.867 68.821 1.00 26.65 ? 191 PRO I CB  1 
ATOM 3124 C CG  . PRO C 3 51  ? 35.348 16.298 67.462 1.00 27.59 ? 191 PRO I CG  1 
ATOM 3125 C CD  . PRO C 3 51  ? 36.246 17.326 66.845 1.00 28.78 ? 191 PRO I CD  1 
ATOM 3126 N N   . SER C 3 52  ? 34.602 19.611 70.618 1.00 24.35 ? 192 SER I N   1 
ATOM 3127 C CA  . SER C 3 52  ? 35.097 20.427 71.689 1.00 23.00 ? 192 SER I CA  1 
ATOM 3128 C C   . SER C 3 52  ? 36.202 19.703 72.407 1.00 25.16 ? 192 SER I C   1 
ATOM 3129 O O   . SER C 3 52  ? 37.346 20.132 72.342 1.00 26.01 ? 192 SER I O   1 
ATOM 3130 C CB  . SER C 3 52  ? 33.976 20.834 72.622 1.00 23.47 ? 192 SER I CB  1 
ATOM 3131 O OG  . SER C 3 52  ? 33.052 21.659 71.932 1.00 18.25 ? 192 SER I OG  1 
ATOM 3132 N N   . SER C 3 53  ? 35.885 18.528 72.944 1.00 28.65 ? 193 SER I N   1 
ATOM 3133 C CA  . SER C 3 53  ? 36.843 17.703 73.700 1.00 31.44 ? 193 SER I CA  1 
ATOM 3134 C C   . SER C 3 53  ? 38.300 17.585 73.222 1.00 31.31 ? 193 SER I C   1 
ATOM 3135 O O   . SER C 3 53  ? 39.225 17.880 73.985 1.00 29.47 ? 193 SER I O   1 
ATOM 3136 C CB  . SER C 3 53  ? 36.263 16.303 73.923 1.00 30.80 ? 193 SER I CB  1 
ATOM 3137 O OG  . SER C 3 53  ? 35.481 15.911 72.799 1.00 29.99 ? 193 SER I OG  1 
ATOM 3138 N N   . PRO C 3 54  ? 38.526 17.139 71.975 1.00 31.93 ? 194 PRO I N   1 
ATOM 3139 C CA  . PRO C 3 54  ? 39.885 16.991 71.452 1.00 32.03 ? 194 PRO I CA  1 
ATOM 3140 C C   . PRO C 3 54  ? 40.716 18.234 71.119 1.00 30.83 ? 194 PRO I C   1 
ATOM 3141 O O   . PRO C 3 54  ? 41.952 18.200 71.273 1.00 27.31 ? 194 PRO I O   1 
ATOM 3142 C CB  . PRO C 3 54  ? 39.671 16.131 70.205 1.00 33.97 ? 194 PRO I CB  1 
ATOM 3143 C CG  . PRO C 3 54  ? 38.372 16.578 69.715 1.00 32.48 ? 194 PRO I CG  1 
ATOM 3144 C CD  . PRO C 3 54  ? 37.566 16.572 71.012 1.00 32.78 ? 194 PRO I CD  1 
ATOM 3145 N N   . ARG C 3 55  ? 40.073 19.306 70.651 1.00 27.85 ? 195 ARG I N   1 
ATOM 3146 C CA  . ARG C 3 55  ? 40.838 20.495 70.291 1.00 29.25 ? 195 ARG I CA  1 
ATOM 3147 C C   . ARG C 3 55  ? 41.729 20.954 71.444 1.00 31.22 ? 195 ARG I C   1 
ATOM 3148 O O   . ARG C 3 55  ? 42.952 20.974 71.315 1.00 29.14 ? 195 ARG I O   1 
ATOM 3149 C CB  . ARG C 3 55  ? 39.954 21.641 69.774 1.00 27.83 ? 195 ARG I CB  1 
ATOM 3150 C CG  . ARG C 3 55  ? 40.758 22.880 69.284 1.00 28.39 ? 195 ARG I CG  1 
ATOM 3151 C CD  . ARG C 3 55  ? 40.743 24.007 70.325 1.00 28.90 ? 195 ARG I CD  1 
ATOM 3152 N NE  . ARG C 3 55  ? 41.910 24.897 70.307 1.00 26.24 ? 195 ARG I NE  1 
ATOM 3153 C CZ  . ARG C 3 55  ? 41.862 26.174 70.690 1.00 24.66 ? 195 ARG I CZ  1 
ATOM 3154 N NH1 . ARG C 3 55  ? 40.708 26.700 71.102 1.00 22.48 ? 195 ARG I NH1 1 
ATOM 3155 N NH2 . ARG C 3 55  ? 42.970 26.909 70.731 1.00 20.24 ? 195 ARG I NH2 1 
ATOM 3156 N N   . PRO C 3 56  ? 41.130 21.319 72.589 1.00 34.41 ? 196 PRO I N   1 
ATOM 3157 C CA  . PRO C 3 56  ? 41.915 21.768 73.747 1.00 33.18 ? 196 PRO I CA  1 
ATOM 3158 C C   . PRO C 3 56  ? 42.931 20.692 74.151 1.00 29.44 ? 196 PRO I C   1 
ATOM 3159 O O   . PRO C 3 56  ? 44.043 21.000 74.594 1.00 25.03 ? 196 PRO I O   1 
ATOM 3160 C CB  . PRO C 3 56  ? 40.845 21.947 74.828 1.00 36.22 ? 196 PRO I CB  1 
ATOM 3161 C CG  . PRO C 3 56  ? 39.620 22.322 74.043 1.00 36.94 ? 196 PRO I CG  1 
ATOM 3162 C CD  . PRO C 3 56  ? 39.687 21.361 72.883 1.00 36.03 ? 196 PRO I CD  1 
ATOM 3163 N N   . SER C 3 57  ? 42.515 19.434 74.014 1.00 27.26 ? 197 SER I N   1 
ATOM 3164 C CA  . SER C 3 57  ? 43.364 18.307 74.329 1.00 24.73 ? 197 SER I CA  1 
ATOM 3165 C C   . SER C 3 57  ? 44.697 18.560 73.647 1.00 25.17 ? 197 SER I C   1 
ATOM 3166 O O   . SER C 3 57  ? 45.710 18.705 74.330 1.00 21.90 ? 197 SER I O   1 
ATOM 3167 C CB  . SER C 3 57  ? 42.713 17.015 73.851 1.00 26.23 ? 197 SER I CB  1 
ATOM 3168 O OG  . SER C 3 57  ? 41.459 16.837 74.505 1.00 27.70 ? 197 SER I OG  1 
ATOM 3169 N N   . GLU C 3 58  ? 44.678 18.717 72.321 1.00 27.68 ? 198 GLU I N   1 
ATOM 3170 C CA  . GLU C 3 58  ? 45.891 19.009 71.545 1.00 27.25 ? 198 GLU I CA  1 
ATOM 3171 C C   . GLU C 3 58  ? 45.676 18.954 70.046 1.00 25.92 ? 198 GLU I C   1 
ATOM 3172 O O   . GLU C 3 58  ? 44.600 19.239 69.558 1.00 26.63 ? 198 GLU I O   1 
ATOM 3173 C CB  . GLU C 3 58  ? 47.042 18.066 71.917 1.00 29.24 ? 198 GLU I CB  1 
ATOM 3174 C CG  . GLU C 3 58  ? 48.123 18.689 72.818 1.00 33.33 ? 198 GLU I CG  1 
ATOM 3175 C CD  . GLU C 3 58  ? 49.162 19.536 72.073 1.00 34.09 ? 198 GLU I CD  1 
ATOM 3176 O OE1 . GLU C 3 58  ? 50.377 19.306 72.312 1.00 30.92 ? 198 GLU I OE1 1 
ATOM 3177 O OE2 . GLU C 3 58  ? 48.765 20.429 71.278 1.00 34.23 ? 198 GLU I OE2 1 
ATOM 3178 N N   . THR C 3 59  ? 46.764 18.673 69.339 1.00 27.56 ? 199 THR I N   1 
ATOM 3179 C CA  . THR C 3 59  ? 46.837 18.516 67.881 1.00 28.52 ? 199 THR I CA  1 
ATOM 3180 C C   . THR C 3 59  ? 45.833 19.256 66.981 1.00 26.16 ? 199 THR I C   1 
ATOM 3181 O O   . THR C 3 59  ? 44.921 18.639 66.415 1.00 25.74 ? 199 THR I O   1 
ATOM 3182 C CB  . THR C 3 59  ? 46.906 16.965 67.437 1.00 28.97 ? 199 THR I CB  1 
ATOM 3183 O OG1 . THR C 3 59  ? 47.854 16.245 68.240 1.00 29.93 ? 199 THR I OG1 1 
ATOM 3184 C CG2 . THR C 3 59  ? 47.411 16.825 66.004 1.00 28.49 ? 199 THR I CG2 1 
ATOM 3185 N N   . VAL C 3 60  ? 46.005 20.571 66.843 1.00 23.85 ? 200 VAL I N   1 
ATOM 3186 C CA  . VAL C 3 60  ? 45.172 21.387 65.939 1.00 19.01 ? 200 VAL I CA  1 
ATOM 3187 C C   . VAL C 3 60  ? 46.046 22.461 65.266 1.00 15.87 ? 200 VAL I C   1 
ATOM 3188 O O   . VAL C 3 60  ? 46.257 23.558 65.778 1.00 11.57 ? 200 VAL I O   1 
ATOM 3189 C CB  . VAL C 3 60  ? 43.952 22.020 66.625 1.00 19.52 ? 200 VAL I CB  1 
ATOM 3190 C CG1 . VAL C 3 60  ? 43.386 23.103 65.723 1.00 22.55 ? 200 VAL I CG1 1 
ATOM 3191 C CG2 . VAL C 3 60  ? 42.868 20.962 66.891 1.00 15.45 ? 200 VAL I CG2 1 
ATOM 3192 N N   . THR C 3 61  ? 46.599 22.087 64.126 1.00 15.40 ? 201 THR I N   1 
ATOM 3193 C CA  . THR C 3 61  ? 47.490 22.940 63.369 1.00 16.42 ? 201 THR I CA  1 
ATOM 3194 C C   . THR C 3 61  ? 46.995 23.272 61.958 1.00 17.92 ? 201 THR I C   1 
ATOM 3195 O O   . THR C 3 61  ? 46.477 22.414 61.238 1.00 15.05 ? 201 THR I O   1 
ATOM 3196 C CB  . THR C 3 61  ? 48.854 22.266 63.288 1.00 14.59 ? 201 THR I CB  1 
ATOM 3197 O OG1 . THR C 3 61  ? 49.242 21.860 64.612 1.00 15.65 ? 201 THR I OG1 1 
ATOM 3198 C CG2 . THR C 3 61  ? 49.893 23.222 62.699 1.00 14.05 ? 201 THR I CG2 1 
ATOM 3199 N N   . CYS C 3 62  ? 47.154 24.535 61.580 1.00 20.12 ? 202 CYS I N   1 
ATOM 3200 C CA  . CYS C 3 62  ? 46.748 25.030 60.268 1.00 21.41 ? 202 CYS I CA  1 
ATOM 3201 C C   . CYS C 3 62  ? 47.938 24.873 59.322 1.00 21.87 ? 202 CYS I C   1 
ATOM 3202 O O   . CYS C 3 62  ? 49.038 25.309 59.639 1.00 20.04 ? 202 CYS I O   1 
ATOM 3203 C CB  . CYS C 3 62  ? 46.344 26.497 60.378 1.00 21.31 ? 202 CYS I CB  1 
ATOM 3204 S SG  . CYS C 3 62  ? 46.316 27.323 58.771 1.00 21.64 ? 202 CYS I SG  1 
ATOM 3205 N N   . ASN C 3 63  ? 47.718 24.265 58.161 1.00 22.03 ? 203 ASN I N   1 
ATOM 3206 C CA  . ASN C 3 63  ? 48.804 24.015 57.213 1.00 21.77 ? 203 ASN I CA  1 
ATOM 3207 C C   . ASN C 3 63  ? 48.665 24.741 55.869 1.00 20.28 ? 203 ASN I C   1 
ATOM 3208 O O   . ASN C 3 63  ? 48.000 24.221 54.976 1.00 24.13 ? 203 ASN I O   1 
ATOM 3209 C CB  . ASN C 3 63  ? 48.882 22.500 56.921 1.00 22.21 ? 203 ASN I CB  1 
ATOM 3210 C CG  . ASN C 3 63  ? 48.660 21.629 58.166 1.00 21.96 ? 203 ASN I CG  1 
ATOM 3211 O OD1 . ASN C 3 63  ? 47.547 21.175 58.429 1.00 19.47 ? 203 ASN I OD1 1 
ATOM 3212 N ND2 . ASN C 3 63  ? 49.728 21.365 58.906 1.00 19.31 ? 203 ASN I ND2 1 
ATOM 3213 N N   . VAL C 3 64  ? 49.278 25.905 55.679 1.00 13.55 ? 204 VAL I N   1 
ATOM 3214 C CA  . VAL C 3 64  ? 49.152 26.556 54.365 1.00 14.04 ? 204 VAL I CA  1 
ATOM 3215 C C   . VAL C 3 64  ? 50.399 26.398 53.454 1.00 14.27 ? 204 VAL I C   1 
ATOM 3216 O O   . VAL C 3 64  ? 51.515 26.715 53.872 1.00 13.40 ? 204 VAL I O   1 
ATOM 3217 C CB  . VAL C 3 64  ? 48.734 28.054 54.486 1.00 13.14 ? 204 VAL I CB  1 
ATOM 3218 C CG1 . VAL C 3 64  ? 48.094 28.297 55.816 1.00 15.83 ? 204 VAL I CG1 1 
ATOM 3219 C CG2 . VAL C 3 64  ? 49.907 29.007 54.270 1.00 11.69 ? 204 VAL I CG2 1 
ATOM 3220 N N   . ALA C 3 65  ? 50.216 25.900 52.226 1.00 11.38 ? 205 ALA I N   1 
ATOM 3221 C CA  . ALA C 3 65  ? 51.328 25.732 51.274 1.00 8.12  ? 205 ALA I CA  1 
ATOM 3222 C C   . ALA C 3 65  ? 51.197 26.754 50.143 1.00 5.64  ? 205 ALA I C   1 
ATOM 3223 O O   . ALA C 3 65  ? 50.132 26.912 49.571 1.00 5.90  ? 205 ALA I O   1 
ATOM 3224 C CB  . ALA C 3 65  ? 51.335 24.325 50.705 1.00 7.59  ? 205 ALA I CB  1 
ATOM 3225 N N   . HIS C 3 66  ? 52.251 27.488 49.844 1.00 2.00  ? 206 HIS I N   1 
ATOM 3226 C CA  . HIS C 3 66  ? 52.155 28.478 48.776 1.00 6.86  ? 206 HIS I CA  1 
ATOM 3227 C C   . HIS C 3 66  ? 53.284 28.201 47.770 1.00 12.34 ? 206 HIS I C   1 
ATOM 3228 O O   . HIS C 3 66  ? 54.391 28.794 47.830 1.00 12.49 ? 206 HIS I O   1 
ATOM 3229 C CB  . HIS C 3 66  ? 52.233 29.879 49.380 1.00 9.45  ? 206 HIS I CB  1 
ATOM 3230 C CG  . HIS C 3 66  ? 52.227 30.990 48.369 1.00 7.36  ? 206 HIS I CG  1 
ATOM 3231 N ND1 . HIS C 3 66  ? 51.264 31.109 47.405 1.00 9.09  ? 206 HIS I ND1 1 
ATOM 3232 C CD2 . HIS C 3 66  ? 53.035 32.061 48.235 1.00 6.22  ? 206 HIS I CD2 1 
ATOM 3233 C CE1 . HIS C 3 66  ? 51.466 32.213 46.707 1.00 8.47  ? 206 HIS I CE1 1 
ATOM 3234 N NE2 . HIS C 3 66  ? 52.549 32.815 47.198 1.00 4.86  ? 206 HIS I NE2 1 
ATOM 3235 N N   . PRO C 3 67  ? 53.009 27.278 46.827 1.00 13.61 ? 207 PRO I N   1 
ATOM 3236 C CA  . PRO C 3 67  ? 53.853 26.772 45.733 1.00 8.95  ? 207 PRO I CA  1 
ATOM 3237 C C   . PRO C 3 67  ? 54.872 27.728 45.127 1.00 7.92  ? 207 PRO I C   1 
ATOM 3238 O O   . PRO C 3 67  ? 56.011 27.343 44.922 1.00 5.14  ? 207 PRO I O   1 
ATOM 3239 C CB  . PRO C 3 67  ? 52.825 26.285 44.725 1.00 10.87 ? 207 PRO I CB  1 
ATOM 3240 C CG  . PRO C 3 67  ? 51.755 25.677 45.654 1.00 10.11 ? 207 PRO I CG  1 
ATOM 3241 C CD  . PRO C 3 67  ? 51.629 26.752 46.715 1.00 11.26 ? 207 PRO I CD  1 
ATOM 3242 N N   . ALA C 3 68  ? 54.475 28.972 44.862 1.00 11.34 ? 208 ALA I N   1 
ATOM 3243 C CA  . ALA C 3 68  ? 55.391 29.974 44.302 1.00 8.69  ? 208 ALA I CA  1 
ATOM 3244 C C   . ALA C 3 68  ? 56.560 30.241 45.233 1.00 10.89 ? 208 ALA I C   1 
ATOM 3245 O O   . ALA C 3 68  ? 57.700 29.987 44.883 1.00 15.89 ? 208 ALA I O   1 
ATOM 3246 C CB  . ALA C 3 68  ? 54.660 31.266 44.011 1.00 5.92  ? 208 ALA I CB  1 
ATOM 3247 N N   . SER C 3 69  ? 56.284 30.708 46.443 1.00 17.50 ? 209 SER I N   1 
ATOM 3248 C CA  . SER C 3 69  ? 57.364 30.986 47.392 1.00 24.63 ? 209 SER I CA  1 
ATOM 3249 C C   . SER C 3 69  ? 58.041 29.682 47.840 1.00 26.99 ? 209 SER I C   1 
ATOM 3250 O O   . SER C 3 69  ? 58.974 29.712 48.672 1.00 26.79 ? 209 SER I O   1 
ATOM 3251 C CB  . SER C 3 69  ? 56.843 31.723 48.637 1.00 24.45 ? 209 SER I CB  1 
ATOM 3252 O OG  . SER C 3 69  ? 55.733 32.535 48.328 1.00 25.39 ? 209 SER I OG  1 
ATOM 3253 N N   . SER C 3 70  ? 57.529 28.547 47.343 1.00 24.29 ? 210 SER I N   1 
ATOM 3254 C CA  . SER C 3 70  ? 58.052 27.221 47.698 1.00 21.06 ? 210 SER I CA  1 
ATOM 3255 C C   . SER C 3 70  ? 58.100 27.139 49.221 1.00 20.00 ? 210 SER I C   1 
ATOM 3256 O O   . SER C 3 70  ? 58.908 26.411 49.813 1.00 17.43 ? 210 SER I O   1 
ATOM 3257 C CB  . SER C 3 70  ? 59.436 27.028 47.094 1.00 18.06 ? 210 SER I CB  1 
ATOM 3258 O OG  . SER C 3 70  ? 59.376 27.313 45.705 1.00 21.47 ? 210 SER I OG  1 
ATOM 3259 N N   . THR C 3 71  ? 57.173 27.887 49.821 1.00 18.38 ? 211 THR I N   1 
ATOM 3260 C CA  . THR C 3 71  ? 57.034 28.029 51.258 1.00 16.28 ? 211 THR I CA  1 
ATOM 3261 C C   . THR C 3 71  ? 55.940 27.156 51.810 1.00 14.43 ? 211 THR I C   1 
ATOM 3262 O O   . THR C 3 71  ? 54.866 27.022 51.209 1.00 17.09 ? 211 THR I O   1 
ATOM 3263 C CB  . THR C 3 71  ? 56.712 29.510 51.632 1.00 15.04 ? 211 THR I CB  1 
ATOM 3264 O OG1 . THR C 3 71  ? 57.829 30.342 51.279 1.00 16.56 ? 211 THR I OG1 1 
ATOM 3265 C CG2 . THR C 3 71  ? 56.378 29.664 53.125 1.00 6.01  ? 211 THR I CG2 1 
ATOM 3266 N N   . LYS C 3 72  ? 56.260 26.505 52.914 1.00 11.84 ? 212 LYS I N   1 
ATOM 3267 C CA  . LYS C 3 72  ? 55.304 25.682 53.623 1.00 12.89 ? 212 LYS I CA  1 
ATOM 3268 C C   . LYS C 3 72  ? 55.422 26.298 55.014 1.00 6.45  ? 212 LYS I C   1 
ATOM 3269 O O   . LYS C 3 72  ? 56.517 26.565 55.488 1.00 2.00  ? 212 LYS I O   1 
ATOM 3270 C CB  . LYS C 3 72  ? 55.706 24.190 53.640 1.00 19.39 ? 212 LYS I CB  1 
ATOM 3271 C CG  . LYS C 3 72  ? 56.008 23.545 52.277 1.00 19.60 ? 212 LYS I CG  1 
ATOM 3272 C CD  . LYS C 3 72  ? 54.761 23.287 51.449 1.00 22.03 ? 212 LYS I CD  1 
ATOM 3273 C CE  . LYS C 3 72  ? 55.120 22.901 50.015 1.00 23.51 ? 212 LYS I CE  1 
ATOM 3274 N NZ  . LYS C 3 72  ? 56.193 23.791 49.470 1.00 21.14 ? 212 LYS I NZ  1 
ATOM 3275 N N   . VAL C 3 73  ? 54.283 26.634 55.589 1.00 5.22  ? 213 VAL I N   1 
ATOM 3276 C CA  . VAL C 3 73  ? 54.189 27.249 56.901 1.00 9.31  ? 213 VAL I CA  1 
ATOM 3277 C C   . VAL C 3 73  ? 52.894 26.772 57.492 1.00 11.62 ? 213 VAL I C   1 
ATOM 3278 O O   . VAL C 3 73  ? 51.844 26.827 56.855 1.00 14.32 ? 213 VAL I O   1 
ATOM 3279 C CB  . VAL C 3 73  ? 54.055 28.787 56.839 1.00 9.31  ? 213 VAL I CB  1 
ATOM 3280 C CG1 . VAL C 3 73  ? 53.691 29.333 58.217 1.00 9.09  ? 213 VAL I CG1 1 
ATOM 3281 C CG2 . VAL C 3 73  ? 55.344 29.410 56.357 1.00 13.21 ? 213 VAL I CG2 1 
ATOM 3282 N N   . ASP C 3 74  ? 52.947 26.381 58.746 1.00 14.79 ? 214 ASP I N   1 
ATOM 3283 C CA  . ASP C 3 74  ? 51.758 25.903 59.402 1.00 17.29 ? 214 ASP I CA  1 
ATOM 3284 C C   . ASP C 3 74  ? 51.790 26.362 60.850 1.00 16.88 ? 214 ASP I C   1 
ATOM 3285 O O   . ASP C 3 74  ? 52.858 26.455 61.453 1.00 17.84 ? 214 ASP I O   1 
ATOM 3286 C CB  . ASP C 3 74  ? 51.672 24.380 59.250 1.00 18.35 ? 214 ASP I CB  1 
ATOM 3287 C CG  . ASP C 3 74  ? 53.025 23.709 59.375 1.00 18.75 ? 214 ASP I CG  1 
ATOM 3288 O OD1 . ASP C 3 74  ? 53.351 23.278 60.502 1.00 17.23 ? 214 ASP I OD1 1 
ATOM 3289 O OD2 . ASP C 3 74  ? 53.755 23.625 58.355 1.00 19.12 ? 214 ASP I OD2 1 
ATOM 3290 N N   . LYS C 3 75  ? 50.627 26.704 61.388 1.00 15.92 ? 215 LYS I N   1 
ATOM 3291 C CA  . LYS C 3 75  ? 50.539 27.188 62.755 1.00 13.10 ? 215 LYS I CA  1 
ATOM 3292 C C   . LYS C 3 75  ? 49.519 26.482 63.597 1.00 12.84 ? 215 LYS I C   1 
ATOM 3293 O O   . LYS C 3 75  ? 48.393 26.244 63.178 1.00 8.54  ? 215 LYS I O   1 
ATOM 3294 C CB  . LYS C 3 75  ? 50.279 28.699 62.786 1.00 12.52 ? 215 LYS I CB  1 
ATOM 3295 C CG  . LYS C 3 75  ? 51.564 29.495 62.625 1.00 10.78 ? 215 LYS I CG  1 
ATOM 3296 C CD  . LYS C 3 75  ? 51.375 30.976 62.662 1.00 6.15  ? 215 LYS I CD  1 
ATOM 3297 C CE  . LYS C 3 75  ? 52.741 31.633 62.620 1.00 8.63  ? 215 LYS I CE  1 
ATOM 3298 N NZ  . LYS C 3 75  ? 52.697 33.110 62.288 1.00 14.87 ? 215 LYS I NZ  1 
ATOM 3299 N N   . LYS C 3 76  ? 49.956 26.090 64.781 1.00 16.43 ? 216 LYS I N   1 
ATOM 3300 C CA  . LYS C 3 76  ? 49.074 25.426 65.723 1.00 19.72 ? 216 LYS I CA  1 
ATOM 3301 C C   . LYS C 3 76  ? 48.260 26.541 66.411 1.00 18.35 ? 216 LYS I C   1 
ATOM 3302 O O   . LYS C 3 76  ? 48.745 27.679 66.576 1.00 14.24 ? 216 LYS I O   1 
ATOM 3303 C CB  . LYS C 3 76  ? 49.887 24.607 66.746 1.00 20.30 ? 216 LYS I CB  1 
ATOM 3304 C CG  . LYS C 3 76  ? 51.054 25.382 67.412 1.00 25.73 ? 216 LYS I CG  1 
ATOM 3305 C CD  . LYS C 3 76  ? 51.681 24.649 68.603 1.00 24.47 ? 216 LYS I CD  1 
ATOM 3306 C CE  . LYS C 3 76  ? 50.691 24.516 69.757 1.00 27.60 ? 216 LYS I CE  1 
ATOM 3307 N NZ  . LYS C 3 76  ? 51.113 23.492 70.772 1.00 31.25 ? 216 LYS I NZ  1 
ATOM 3308 N N   . ILE C 3 77  ? 47.007 26.232 66.727 1.00 13.89 ? 217 ILE I N   1 
ATOM 3309 C CA  . ILE C 3 77  ? 46.127 27.174 67.382 1.00 12.51 ? 217 ILE I CA  1 
ATOM 3310 C C   . ILE C 3 77  ? 46.246 27.073 68.911 1.00 15.94 ? 217 ILE I C   1 
ATOM 3311 O O   . ILE C 3 77  ? 46.176 25.988 69.503 1.00 16.48 ? 217 ILE I O   1 
ATOM 3312 C CB  . ILE C 3 77  ? 44.653 26.976 66.886 1.00 12.93 ? 217 ILE I CB  1 
ATOM 3313 C CG1 . ILE C 3 77  ? 44.484 27.580 65.486 1.00 10.34 ? 217 ILE I CG1 1 
ATOM 3314 C CG2 . ILE C 3 77  ? 43.644 27.615 67.835 1.00 10.91 ? 217 ILE I CG2 1 
ATOM 3315 C CD1 . ILE C 3 77  ? 45.101 26.780 64.367 1.00 8.56  ? 217 ILE I CD1 1 
ATOM 3316 N N   . VAL C 3 78  ? 46.439 28.225 69.539 1.00 19.49 ? 218 VAL I N   1 
ATOM 3317 C CA  . VAL C 3 78  ? 46.567 28.326 70.987 1.00 20.69 ? 218 VAL I CA  1 
ATOM 3318 C C   . VAL C 3 78  ? 45.518 29.303 71.528 1.00 24.22 ? 218 VAL I C   1 
ATOM 3319 O O   . VAL C 3 78  ? 45.386 30.418 71.018 1.00 21.57 ? 218 VAL I O   1 
ATOM 3320 C CB  . VAL C 3 78  ? 47.944 28.836 71.368 1.00 21.50 ? 218 VAL I CB  1 
ATOM 3321 C CG1 . VAL C 3 78  ? 48.967 27.741 71.127 1.00 20.97 ? 218 VAL I CG1 1 
ATOM 3322 C CG2 . VAL C 3 78  ? 48.273 30.130 70.579 1.00 20.30 ? 218 VAL I CG2 1 
ATOM 3323 N N   . PRO C 3 79  ? 44.822 28.920 72.616 1.00 24.34 ? 219 PRO I N   1 
ATOM 3324 C CA  . PRO C 3 79  ? 43.761 29.637 73.340 1.00 26.25 ? 219 PRO I CA  1 
ATOM 3325 C C   . PRO C 3 79  ? 43.923 31.150 73.510 1.00 30.39 ? 219 PRO I C   1 
ATOM 3326 O O   . PRO C 3 79  ? 42.945 31.916 73.415 1.00 28.74 ? 219 PRO I O   1 
ATOM 3327 C CB  . PRO C 3 79  ? 43.774 28.948 74.701 1.00 23.76 ? 219 PRO I CB  1 
ATOM 3328 C CG  . PRO C 3 79  ? 44.105 27.565 74.351 1.00 24.16 ? 219 PRO I CG  1 
ATOM 3329 C CD  . PRO C 3 79  ? 45.237 27.731 73.383 1.00 23.94 ? 219 PRO I CD  1 
ATOM 3330 N N   . ARG C 3 80  ? 45.155 31.553 73.815 1.00 33.51 ? 220 ARG I N   1 
ATOM 3331 C CA  . ARG C 3 80  ? 45.535 32.945 74.069 1.00 34.47 ? 220 ARG I CA  1 
ATOM 3332 C C   . ARG C 3 80  ? 45.112 33.291 75.495 1.00 39.10 ? 220 ARG I C   1 
ATOM 3333 O O   . ARG C 3 80  ? 45.915 33.843 76.266 1.00 40.65 ? 220 ARG I O   1 
ATOM 3334 C CB  . ARG C 3 80  ? 44.935 33.907 73.045 1.00 28.60 ? 220 ARG I CB  1 
ATOM 3335 C CG  . ARG C 3 80  ? 45.965 34.820 72.354 1.00 25.94 ? 220 ARG I CG  1 
ATOM 3336 C CD  . ARG C 3 80  ? 47.120 34.081 71.683 1.00 21.46 ? 220 ARG I CD  1 
ATOM 3337 N NE  . ARG C 3 80  ? 48.343 34.195 72.478 1.00 27.96 ? 220 ARG I NE  1 
ATOM 3338 C CZ  . ARG C 3 80  ? 49.584 34.265 71.987 1.00 27.91 ? 220 ARG I CZ  1 
ATOM 3339 N NH1 . ARG C 3 80  ? 49.796 34.224 70.676 1.00 30.75 ? 220 ARG I NH1 1 
ATOM 3340 N NH2 . ARG C 3 80  ? 50.616 34.455 72.806 1.00 21.99 ? 220 ARG I NH2 1 
ATOM 3341 N N   . ASP C 3 81  ? 43.905 32.854 75.870 1.00 39.32 ? 221 ASP I N   1 
ATOM 3342 C CA  . ASP C 3 81  ? 43.368 33.076 77.206 1.00 40.31 ? 221 ASP I CA  1 
ATOM 3343 C C   . ASP C 3 81  ? 43.314 34.566 77.452 1.00 44.71 ? 221 ASP I C   1 
ATOM 3344 O O   . ASP C 3 81  ? 42.662 35.283 76.695 1.00 49.43 ? 221 ASP I O   1 
ATOM 3345 C CB  . ASP C 3 81  ? 44.227 32.387 78.280 1.00 38.46 ? 221 ASP I CB  1 
ATOM 3346 C CG  . ASP C 3 81  ? 44.260 30.878 78.125 1.00 35.98 ? 221 ASP I CG  1 
ATOM 3347 O OD1 . ASP C 3 81  ? 43.378 30.338 77.427 1.00 34.89 ? 221 ASP I OD1 1 
ATOM 3348 O OD2 . ASP C 3 81  ? 45.165 30.235 78.696 1.00 30.90 ? 221 ASP I OD2 1 
ATOM 3349 N N   . CYS C 3 82  ? 44.042 35.050 78.453 1.00 46.13 ? 222 CYS I N   1 
ATOM 3350 C CA  . CYS C 3 82  ? 44.016 36.470 78.753 1.00 47.93 ? 222 CYS I CA  1 
ATOM 3351 C C   . CYS C 3 82  ? 45.367 36.993 79.236 1.00 48.75 ? 222 CYS I C   1 
ATOM 3352 O O   . CYS C 3 82  ? 46.359 36.230 79.143 1.00 51.20 ? 222 CYS I O   1 
ATOM 3353 C CB  . CYS C 3 82  ? 42.929 36.749 79.784 1.00 47.11 ? 222 CYS I CB  1 
ATOM 3354 S SG  . CYS C 3 82  ? 42.649 38.492 79.992 1.00 49.04 ? 222 CYS I SG  1 
ATOM 3355 O OXT . CYS C 3 82  ? 45.417 38.153 79.706 1.00 47.32 ? 222 CYS I OXT 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   1   ASP ASP L . n 
A 1 2   VAL 2   2   2   VAL VAL L . n 
A 1 3   LEU 3   3   3   LEU LEU L . n 
A 1 4   MET 4   4   4   MET MET L . n 
A 1 5   THR 5   5   5   THR THR L . n 
A 1 6   GLN 6   6   6   GLN GLN L . n 
A 1 7   THR 7   7   7   THR THR L . n 
A 1 8   PRO 8   8   8   PRO PRO L . n 
A 1 9   LEU 9   9   9   LEU LEU L . n 
A 1 10  TYR 10  10  10  TYR TYR L . n 
A 1 11  LEU 11  11  11  LEU LEU L . n 
A 1 12  PRO 12  12  12  PRO PRO L . n 
A 1 13  VAL 13  13  13  VAL VAL L . n 
A 1 14  SER 14  14  14  SER SER L . n 
A 1 15  LEU 15  15  15  LEU LEU L . n 
A 1 16  GLY 16  16  16  GLY GLY L . n 
A 1 17  ASP 17  17  17  ASP ASP L . n 
A 1 18  GLN 18  18  18  GLN GLN L . n 
A 1 19  ALA 19  19  19  ALA ALA L . n 
A 1 20  SER 20  20  20  SER SER L . n 
A 1 21  ILE 21  21  21  ILE ILE L . n 
A 1 22  SER 22  22  22  SER SER L . n 
A 1 23  CYS 23  23  23  CYS CYS L . n 
A 1 24  ARG 24  24  24  ARG ARG L . n 
A 1 25  SER 25  25  25  SER SER L . n 
A 1 26  SER 26  26  26  SER SER L . n 
A 1 27  GLN 27  27  27  GLN GLN L . n 
A 1 28  THR 28  27  27  THR THR L A n 
A 1 29  ILE 29  27  27  ILE ILE L B n 
A 1 30  VAL 30  27  27  VAL VAL L C n 
A 1 31  HIS 31  27  27  HIS HIS L D n 
A 1 32  ASN 32  27  27  ASN ASN L E n 
A 1 33  ASN 33  28  28  ASN ASN L . n 
A 1 34  GLY 34  29  29  GLY GLY L . n 
A 1 35  ASN 35  30  30  ASN ASN L . n 
A 1 36  THR 36  31  31  THR THR L . n 
A 1 37  TYR 37  32  32  TYR TYR L . n 
A 1 38  LEU 38  33  33  LEU LEU L . n 
A 1 39  GLU 39  34  34  GLU GLU L . n 
A 1 40  TRP 40  35  35  TRP TRP L . n 
A 1 41  TYR 41  36  36  TYR TYR L . n 
A 1 42  LEU 42  37  37  LEU LEU L . n 
A 1 43  GLN 43  38  38  GLN GLN L . n 
A 1 44  LYS 44  39  39  LYS LYS L . n 
A 1 45  PRO 45  40  40  PRO PRO L . n 
A 1 46  GLY 46  41  41  GLY GLY L . n 
A 1 47  GLN 47  42  42  GLN GLN L . n 
A 1 48  SER 48  43  43  SER SER L . n 
A 1 49  PRO 49  44  44  PRO PRO L . n 
A 1 50  GLN 50  45  45  GLN GLN L . n 
A 1 51  LEU 51  46  46  LEU LEU L . n 
A 1 52  LEU 52  47  47  LEU LEU L . n 
A 1 53  ILE 53  48  48  ILE ILE L . n 
A 1 54  TYR 54  49  49  TYR TYR L . n 
A 1 55  LYS 55  50  50  LYS LYS L . n 
A 1 56  VAL 56  51  51  VAL VAL L . n 
A 1 57  SER 57  52  52  SER SER L . n 
A 1 58  ASN 58  53  53  ASN ASN L . n 
A 1 59  ARG 59  54  54  ARG ARG L . n 
A 1 60  PHE 60  55  55  PHE PHE L . n 
A 1 61  SER 61  56  56  SER SER L . n 
A 1 62  GLY 62  57  57  GLY GLY L . n 
A 1 63  VAL 63  58  58  VAL VAL L . n 
A 1 64  PRO 64  59  59  PRO PRO L . n 
A 1 65  ASP 65  60  60  ASP ASP L . n 
A 1 66  ARG 66  61  61  ARG ARG L . n 
A 1 67  PHE 67  62  62  PHE PHE L . n 
A 1 68  SER 68  63  63  SER SER L . n 
A 1 69  GLY 69  64  64  GLY GLY L . n 
A 1 70  SER 70  65  65  SER SER L . n 
A 1 71  GLY 71  66  66  GLY GLY L . n 
A 1 72  SER 72  67  67  SER SER L . n 
A 1 73  GLY 73  68  68  GLY GLY L . n 
A 1 74  THR 74  69  69  THR THR L . n 
A 1 75  ASP 75  70  70  ASP ASP L . n 
A 1 76  PHE 76  71  71  PHE PHE L . n 
A 1 77  THR 77  72  72  THR THR L . n 
A 1 78  LEU 78  73  73  LEU LEU L . n 
A 1 79  LYS 79  74  74  LYS LYS L . n 
A 1 80  ILE 80  75  75  ILE ILE L . n 
A 1 81  SER 81  76  76  SER SER L . n 
A 1 82  ARG 82  77  77  ARG ARG L . n 
A 1 83  VAL 83  78  78  VAL VAL L . n 
A 1 84  GLU 84  79  79  GLU GLU L . n 
A 1 85  ALA 85  80  80  ALA ALA L . n 
A 1 86  GLU 86  81  81  GLU GLU L . n 
A 1 87  ASP 87  82  82  ASP ASP L . n 
A 1 88  LEU 88  83  83  LEU LEU L . n 
A 1 89  GLY 89  84  84  GLY GLY L . n 
A 1 90  ILE 90  85  85  ILE ILE L . n 
A 1 91  TYR 91  86  86  TYR TYR L . n 
A 1 92  TYR 92  87  87  TYR TYR L . n 
A 1 93  CYS 93  88  88  CYS CYS L . n 
A 1 94  PHE 94  89  89  PHE PHE L . n 
A 1 95  GLN 95  90  90  GLN GLN L . n 
A 1 96  GLY 96  91  91  GLY GLY L . n 
A 1 97  SER 97  92  92  SER SER L . n 
A 1 98  HIS 98  93  93  HIS HIS L . n 
A 1 99  PHE 99  94  94  PHE PHE L . n 
A 1 100 PRO 100 95  95  PRO PRO L . n 
A 1 101 PRO 101 96  96  PRO PRO L . n 
A 1 102 THR 102 97  97  THR THR L . n 
A 1 103 PHE 103 98  98  PHE PHE L . n 
A 1 104 GLY 104 99  99  GLY GLY L . n 
A 1 105 GLY 105 100 100 GLY GLY L . n 
A 1 106 GLY 106 101 101 GLY GLY L . n 
A 1 107 THR 107 102 102 THR THR L . n 
A 1 108 LYS 108 103 103 LYS LYS L . n 
A 1 109 LEU 109 104 104 LEU LEU L . n 
A 1 110 GLU 110 105 105 GLU GLU L . n 
A 1 111 ILE 111 106 106 ILE ILE L . n 
A 1 112 LYS 112 107 107 LYS LYS L . n 
A 1 113 ARG 113 108 108 ARG ARG L . n 
A 1 114 ALA 114 109 109 ALA ALA L . n 
A 1 115 ASP 115 110 110 ASP ASP L . n 
A 1 116 ALA 116 111 111 ALA ALA L . n 
A 1 117 ALA 117 112 112 ALA ALA L . n 
A 1 118 PRO 118 113 113 PRO PRO L . n 
A 1 119 THR 119 114 114 THR THR L . n 
A 1 120 VAL 120 115 115 VAL VAL L . n 
A 1 121 SER 121 116 116 SER SER L . n 
A 1 122 ILE 122 117 117 ILE ILE L . n 
A 1 123 PHE 123 118 118 PHE PHE L . n 
A 1 124 PRO 124 119 119 PRO PRO L . n 
A 1 125 PRO 125 120 120 PRO PRO L . n 
A 1 126 SER 126 121 121 SER SER L . n 
A 1 127 SER 127 122 122 SER SER L . n 
A 1 128 GLU 128 123 123 GLU GLU L . n 
A 1 129 GLN 129 124 124 GLN GLN L . n 
A 1 130 LEU 130 125 125 LEU LEU L . n 
A 1 131 THR 131 126 126 THR THR L . n 
A 1 132 SER 132 127 127 SER SER L . n 
A 1 133 GLY 133 128 128 GLY GLY L . n 
A 1 134 GLY 134 129 129 GLY GLY L . n 
A 1 135 ALA 135 130 130 ALA ALA L . n 
A 1 136 SER 136 131 131 SER SER L . n 
A 1 137 VAL 137 132 132 VAL VAL L . n 
A 1 138 VAL 138 133 133 VAL VAL L . n 
A 1 139 CYS 139 134 134 CYS CYS L . n 
A 1 140 PHE 140 135 135 PHE PHE L . n 
A 1 141 LEU 141 136 136 LEU LEU L . n 
A 1 142 ASN 142 137 137 ASN ASN L . n 
A 1 143 ASN 143 138 138 ASN ASN L . n 
A 1 144 PHE 144 139 139 PHE PHE L . n 
A 1 145 TYR 145 140 140 TYR TYR L . n 
A 1 146 PRO 146 141 141 PRO PRO L . n 
A 1 147 LYS 147 142 142 LYS LYS L . n 
A 1 148 ASP 148 143 143 ASP ASP L . n 
A 1 149 ILE 149 144 144 ILE ILE L . n 
A 1 150 ASN 150 145 145 ASN ASN L . n 
A 1 151 VAL 151 146 146 VAL VAL L . n 
A 1 152 LYS 152 147 147 LYS LYS L . n 
A 1 153 TRP 153 148 148 TRP TRP L . n 
A 1 154 LYS 154 149 149 LYS LYS L . n 
A 1 155 ILE 155 150 150 ILE ILE L . n 
A 1 156 ASP 156 151 151 ASP ASP L . n 
A 1 157 GLY 157 152 152 GLY GLY L . n 
A 1 158 SER 158 153 153 SER SER L . n 
A 1 159 GLU 159 154 154 GLU GLU L . n 
A 1 160 ARG 160 155 155 ARG ARG L . n 
A 1 161 GLN 161 156 156 GLN GLN L . n 
A 1 162 ASN 162 157 157 ASN ASN L . n 
A 1 163 GLY 163 158 158 GLY GLY L . n 
A 1 164 VAL 164 159 159 VAL VAL L . n 
A 1 165 LEU 165 160 160 LEU LEU L . n 
A 1 166 ASN 166 161 161 ASN ASN L . n 
A 1 167 SER 167 162 162 SER SER L . n 
A 1 168 TRP 168 163 163 TRP TRP L . n 
A 1 169 THR 169 164 164 THR THR L . n 
A 1 170 ASP 170 165 165 ASP ASP L . n 
A 1 171 GLN 171 166 166 GLN GLN L . n 
A 1 172 ASP 172 167 167 ASP ASP L . n 
A 1 173 SER 173 168 168 SER SER L . n 
A 1 174 LYS 174 169 169 LYS LYS L . n 
A 1 175 ASP 175 170 170 ASP ASP L . n 
A 1 176 SER 176 171 171 SER SER L . n 
A 1 177 THR 177 172 172 THR THR L . n 
A 1 178 TYR 178 173 173 TYR TYR L . n 
A 1 179 SER 179 174 174 SER SER L . n 
A 1 180 MET 180 175 175 MET MET L . n 
A 1 181 SER 181 176 176 SER SER L . n 
A 1 182 SER 182 177 177 SER SER L . n 
A 1 183 THR 183 178 178 THR THR L . n 
A 1 184 LEU 184 179 179 LEU LEU L . n 
A 1 185 THR 185 180 180 THR THR L . n 
A 1 186 LEU 186 181 181 LEU LEU L . n 
A 1 187 THR 187 182 182 THR THR L . n 
A 1 188 LYS 188 183 183 LYS LYS L . n 
A 1 189 ASP 189 184 184 ASP ASP L . n 
A 1 190 GLU 190 185 185 GLU GLU L . n 
A 1 191 TYR 191 186 186 TYR TYR L . n 
A 1 192 GLU 192 187 187 GLU GLU L . n 
A 1 193 ARG 193 188 188 ARG ARG L . n 
A 1 194 HIS 194 189 189 HIS HIS L . n 
A 1 195 ASN 195 190 190 ASN ASN L . n 
A 1 196 SER 196 191 191 SER SER L . n 
A 1 197 TYR 197 192 192 TYR TYR L . n 
A 1 198 THR 198 193 193 THR THR L . n 
A 1 199 CYS 199 194 194 CYS CYS L . n 
A 1 200 GLU 200 195 195 GLU GLU L . n 
A 1 201 ALA 201 196 196 ALA ALA L . n 
A 1 202 THR 202 197 197 THR THR L . n 
A 1 203 HIS 203 198 198 HIS HIS L . n 
A 1 204 LYS 204 199 199 LYS LYS L . n 
A 1 205 THR 205 200 200 THR THR L . n 
A 1 206 SER 206 201 201 SER SER L . n 
A 1 207 THR 207 202 202 THR THR L . n 
A 1 208 SER 208 203 203 SER SER L . n 
A 1 209 PRO 209 204 204 PRO PRO L . n 
A 1 210 ILE 210 205 205 ILE ILE L . n 
A 1 211 VAL 211 206 206 VAL VAL L . n 
A 1 212 LYS 212 207 207 LYS LYS L . n 
A 1 213 SER 213 208 208 SER SER L . n 
A 1 214 PHE 214 209 209 PHE PHE L . n 
A 1 215 ASN 215 210 210 ASN ASN L . n 
A 1 216 ARG 216 211 211 ARG ARG L . n 
B 2 1   GLN 1   1   1   GLN GLN H . n 
B 2 2   ILE 2   2   2   ILE ILE H . n 
B 2 3   GLN 3   3   3   GLN GLN H . n 
B 2 4   LEU 4   4   4   LEU LEU H . n 
B 2 5   GLN 5   5   5   GLN GLN H . n 
B 2 6   GLN 6   6   6   GLN GLN H . n 
B 2 7   SER 7   7   7   SER SER H . n 
B 2 8   GLY 8   8   8   GLY GLY H . n 
B 2 9   PRO 9   9   9   PRO PRO H . n 
B 2 10  GLU 10  10  10  GLU GLU H . n 
B 2 11  LEU 11  11  11  LEU LEU H . n 
B 2 12  LYS 12  12  12  LYS LYS H . n 
B 2 13  LYS 13  13  13  LYS LYS H . n 
B 2 14  PRO 14  14  14  PRO PRO H . n 
B 2 15  GLY 15  15  15  GLY GLY H . n 
B 2 16  GLU 16  16  16  GLU GLU H . n 
B 2 17  THR 17  17  17  THR THR H . n 
B 2 18  VAL 18  18  18  VAL VAL H . n 
B 2 19  LYS 19  19  19  LYS LYS H . n 
B 2 20  ILE 20  20  20  ILE ILE H . n 
B 2 21  SER 21  21  21  SER SER H . n 
B 2 22  CYS 22  22  22  CYS CYS H . n 
B 2 23  LYS 23  23  23  LYS LYS H . n 
B 2 24  ALA 24  24  24  ALA ALA H . n 
B 2 25  THR 25  25  25  THR THR H . n 
B 2 26  ASN 26  26  26  ASN ASN H . n 
B 2 27  TYR 27  27  27  TYR TYR H . n 
B 2 28  ALA 28  28  28  ALA ALA H . n 
B 2 29  PHE 29  29  29  PHE PHE H . n 
B 2 30  THR 30  30  30  THR THR H . n 
B 2 31  ASP 31  31  31  ASP ASP H . n 
B 2 32  TYR 32  32  32  TYR TYR H . n 
B 2 33  SER 33  33  33  SER SER H . n 
B 2 34  MET 34  34  34  MET MET H . n 
B 2 35  HIS 35  35  35  HIS HIS H . n 
B 2 36  TRP 36  36  36  TRP TRP H . n 
B 2 37  VAL 37  37  37  VAL VAL H . n 
B 2 38  LYS 38  38  38  LYS LYS H . n 
B 2 39  GLN 39  39  39  GLN GLN H . n 
B 2 40  ALA 40  40  40  ALA ALA H . n 
B 2 41  PRO 41  41  41  PRO PRO H . n 
B 2 42  GLY 42  42  42  GLY GLY H . n 
B 2 43  GLY 43  43  43  GLY GLY H . n 
B 2 44  ASP 44  44  44  ASP ASP H . n 
B 2 45  LEU 45  45  45  LEU LEU H . n 
B 2 46  LYS 46  46  46  LYS LYS H . n 
B 2 47  TYR 47  47  47  TYR TYR H . n 
B 2 48  VAL 48  48  48  VAL VAL H . n 
B 2 49  GLY 49  49  49  GLY GLY H . n 
B 2 50  TRP 50  50  50  TRP TRP H . n 
B 2 51  ILE 51  51  51  ILE ILE H . n 
B 2 52  ASN 52  52  52  ASN ASN H . n 
B 2 53  THR 53  52  52  THR THR H A n 
B 2 54  GLU 54  53  53  GLU GLU H . n 
B 2 55  THR 55  54  54  THR THR H . n 
B 2 56  ASP 56  55  55  ASP ASP H . n 
B 2 57  GLU 57  56  56  GLU GLU H . n 
B 2 58  PRO 58  57  57  PRO PRO H . n 
B 2 59  THR 59  58  58  THR THR H . n 
B 2 60  PHE 60  59  59  PHE PHE H . n 
B 2 61  ALA 61  60  60  ALA ALA H . n 
B 2 62  ASP 62  61  61  ASP ASP H . n 
B 2 63  ASP 63  62  62  ASP ASP H . n 
B 2 64  PHE 64  63  63  PHE PHE H . n 
B 2 65  LYS 65  64  64  LYS LYS H . n 
B 2 66  GLY 66  65  65  GLY GLY H . n 
B 2 67  ARG 67  66  66  ARG ARG H . n 
B 2 68  PHE 68  67  67  PHE PHE H . n 
B 2 69  ALA 69  68  68  ALA ALA H . n 
B 2 70  PHE 70  69  69  PHE PHE H . n 
B 2 71  SER 71  70  70  SER SER H . n 
B 2 72  LEU 72  71  71  LEU LEU H . n 
B 2 73  ASP 73  72  72  ASP ASP H . n 
B 2 74  THR 74  73  73  THR THR H . n 
B 2 75  SER 75  74  74  SER SER H . n 
B 2 76  THR 76  75  75  THR THR H . n 
B 2 77  SER 77  76  76  SER SER H . n 
B 2 78  THR 78  77  77  THR THR H . n 
B 2 79  ALA 79  78  78  ALA ALA H . n 
B 2 80  PHE 80  79  79  PHE PHE H . n 
B 2 81  LEU 81  80  80  LEU LEU H . n 
B 2 82  GLN 82  81  81  GLN GLN H . n 
B 2 83  ILE 83  82  82  ILE ILE H . n 
B 2 84  ASN 84  82  82  ASN ASN H A n 
B 2 85  ASN 85  82  82  ASN ASN H B n 
B 2 86  LEU 86  82  82  LEU LEU H C n 
B 2 87  LYS 87  83  83  LYS LYS H . n 
B 2 88  ASN 88  84  84  ASN ASN H . n 
B 2 89  GLU 89  85  85  GLU GLU H . n 
B 2 90  ASP 90  86  86  ASP ASP H . n 
B 2 91  THR 91  87  87  THR THR H . n 
B 2 92  ALA 92  88  88  ALA ALA H . n 
B 2 93  THR 93  89  89  THR THR H . n 
B 2 94  TYR 94  90  90  TYR TYR H . n 
B 2 95  PHE 95  91  91  PHE PHE H . n 
B 2 96  CYS 96  92  92  CYS CYS H . n 
B 2 97  VAL 97  93  93  VAL VAL H . n 
B 2 98  ARG 98  94  94  ARG ARG H . n 
B 2 99  ASP 99  95  95  ASP ASP H . n 
B 2 100 ARG 100 96  96  ARG ARG H . n 
B 2 101 HIS 101 97  97  HIS HIS H . n 
B 2 102 ASP 102 98  98  ASP ASP H . n 
B 2 103 TYR 103 99  99  TYR TYR H . n 
B 2 104 GLY 104 100 100 GLY GLY H . n 
B 2 105 GLU 105 100 100 GLU GLU H A n 
B 2 106 ILE 106 100 100 ILE ILE H B n 
B 2 107 PHE 107 100 100 PHE PHE H C n 
B 2 108 THR 108 101 101 THR THR H . n 
B 2 109 TYR 109 102 102 TYR TYR H . n 
B 2 110 TRP 110 103 103 TRP TRP H . n 
B 2 111 GLY 111 104 104 GLY GLY H . n 
B 2 112 GLN 112 105 105 GLN GLN H . n 
B 2 113 GLY 113 106 106 GLY GLY H . n 
B 2 114 THR 114 107 107 THR THR H . n 
B 2 115 THR 115 108 108 THR THR H . n 
B 2 116 VAL 116 109 109 VAL VAL H . n 
B 2 117 THR 117 110 110 THR THR H . n 
B 2 118 VAL 118 111 111 VAL VAL H . n 
B 2 119 SER 119 112 112 SER SER H . n 
B 2 120 SER 120 113 113 SER SER H . n 
B 2 121 ALA 121 114 114 ALA ALA H . n 
B 2 122 LYS 122 115 115 LYS LYS H . n 
B 2 123 THR 123 116 116 THR THR H . n 
B 2 124 THR 124 117 117 THR THR H . n 
B 2 125 PRO 125 118 118 PRO PRO H . n 
B 2 126 PRO 126 119 119 PRO PRO H . n 
B 2 127 SER 127 120 120 SER SER H . n 
B 2 128 VAL 128 121 121 VAL VAL H . n 
B 2 129 TYR 129 122 122 TYR TYR H . n 
B 2 130 PRO 130 123 123 PRO PRO H . n 
B 2 131 LEU 131 124 124 LEU LEU H . n 
B 2 132 ALA 132 125 125 ALA ALA H . n 
B 2 133 PRO 133 126 126 PRO PRO H . n 
B 2 134 GLY 134 127 127 GLY GLY H . n 
B 2 135 SER 135 128 128 SER SER H . n 
C 3 1   SER 1   141 141 SER SER I . n 
C 3 2   MET 2   142 142 MET MET I . n 
C 3 3   VAL 3   143 143 VAL VAL I . n 
C 3 4   THR 4   144 144 THR THR I . n 
C 3 5   LEU 5   145 145 LEU LEU I . n 
C 3 6   GLY 6   146 146 GLY GLY I . n 
C 3 7   CYS 7   147 147 CYS CYS I . n 
C 3 8   LEU 8   148 148 LEU LEU I . n 
C 3 9   VAL 9   149 149 VAL VAL I . n 
C 3 10  LYS 10  150 150 LYS LYS I . n 
C 3 11  GLY 11  151 151 GLY GLY I . n 
C 3 12  TYR 12  152 152 TYR TYR I . n 
C 3 13  PHE 13  153 153 PHE PHE I . n 
C 3 14  PRO 14  154 154 PRO PRO I . n 
C 3 15  GLU 15  155 155 GLU GLU I . n 
C 3 16  PRO 16  156 156 PRO PRO I . n 
C 3 17  VAL 17  157 157 VAL VAL I . n 
C 3 18  THR 18  158 158 THR THR I . n 
C 3 19  VAL 19  159 159 VAL VAL I . n 
C 3 20  THR 20  160 160 THR THR I . n 
C 3 21  TRP 21  161 161 TRP TRP I . n 
C 3 22  ASN 22  162 162 ASN ASN I . n 
C 3 23  SER 23  163 163 SER SER I . n 
C 3 24  GLY 24  164 164 GLY GLY I . n 
C 3 25  SER 25  165 165 SER SER I . n 
C 3 26  LEU 26  166 166 LEU LEU I . n 
C 3 27  SER 27  167 167 SER SER I . n 
C 3 28  SER 28  168 168 SER SER I . n 
C 3 29  GLY 29  169 169 GLY GLY I . n 
C 3 30  VAL 30  170 170 VAL VAL I . n 
C 3 31  HIS 31  171 171 HIS HIS I . n 
C 3 32  THR 32  172 172 THR THR I . n 
C 3 33  PHE 33  173 173 PHE PHE I . n 
C 3 34  PRO 34  174 174 PRO PRO I . n 
C 3 35  ALA 35  175 175 ALA ALA I . n 
C 3 36  VAL 36  176 176 VAL VAL I . n 
C 3 37  LEU 37  177 177 LEU LEU I . n 
C 3 38  GLN 38  178 178 GLN GLN I . n 
C 3 39  SER 39  179 179 SER SER I . n 
C 3 40  ASP 40  180 180 ASP ASP I . n 
C 3 41  LEU 41  181 181 LEU LEU I . n 
C 3 42  TYR 42  182 182 TYR TYR I . n 
C 3 43  THR 43  183 183 THR THR I . n 
C 3 44  LEU 44  184 184 LEU LEU I . n 
C 3 45  SER 45  185 185 SER SER I . n 
C 3 46  SER 46  186 186 SER SER I . n 
C 3 47  SER 47  187 187 SER SER I . n 
C 3 48  VAL 48  188 188 VAL VAL I . n 
C 3 49  THR 49  189 189 THR THR I . n 
C 3 50  VAL 50  190 190 VAL VAL I . n 
C 3 51  PRO 51  191 191 PRO PRO I . n 
C 3 52  SER 52  192 192 SER SER I . n 
C 3 53  SER 53  193 193 SER SER I . n 
C 3 54  PRO 54  194 194 PRO PRO I . n 
C 3 55  ARG 55  195 195 ARG ARG I . n 
C 3 56  PRO 56  196 196 PRO PRO I . n 
C 3 57  SER 57  197 197 SER SER I . n 
C 3 58  GLU 58  198 198 GLU GLU I . n 
C 3 59  THR 59  199 199 THR THR I . n 
C 3 60  VAL 60  200 200 VAL VAL I . n 
C 3 61  THR 61  201 201 THR THR I . n 
C 3 62  CYS 62  202 202 CYS CYS I . n 
C 3 63  ASN 63  203 203 ASN ASN I . n 
C 3 64  VAL 64  204 204 VAL VAL I . n 
C 3 65  ALA 65  205 205 ALA ALA I . n 
C 3 66  HIS 66  206 206 HIS HIS I . n 
C 3 67  PRO 67  207 207 PRO PRO I . n 
C 3 68  ALA 68  208 208 ALA ALA I . n 
C 3 69  SER 69  209 209 SER SER I . n 
C 3 70  SER 70  210 210 SER SER I . n 
C 3 71  THR 71  211 211 THR THR I . n 
C 3 72  LYS 72  212 212 LYS LYS I . n 
C 3 73  VAL 73  213 213 VAL VAL I . n 
C 3 74  ASP 74  214 214 ASP ASP I . n 
C 3 75  LYS 75  215 215 LYS LYS I . n 
C 3 76  LYS 76  216 216 LYS LYS I . n 
C 3 77  ILE 77  217 217 ILE ILE I . n 
C 3 78  VAL 78  218 218 VAL VAL I . n 
C 3 79  PRO 79  219 219 PRO PRO I . n 
C 3 80  ARG 80  220 220 ARG ARG I . n 
C 3 81  ASP 81  221 221 ASP ASP I . n 
C 3 82  CYS 82  222 222 CYS CYS I . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5540  ? 
1 MORE         -38   ? 
1 'SSA (A^2)'  19270 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-01-12 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .     ? 1 
SCALEPACK 'data scaling'   .     ? 2 
AMoRE     phasing          .     ? 3 
X-PLOR    refinement       3.843 ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA L LEU 181 ? ? CB L LEU 181 ? ? CG L LEU 181 ? ? 129.64 115.30 14.34  2.30 N 
2 1 N  H ASP 98  ? ? CA H ASP 98  ? ? C  H ASP 98  ? ? 91.23  111.00 -19.77 2.70 N 
3 1 CA I LEU 177 ? ? CB I LEU 177 ? ? CG I LEU 177 ? ? 130.38 115.30 15.08  2.30 N 
4 1 C  I HIS 206 ? ? N  I PRO 207 ? ? CA I PRO 207 ? ? 129.69 119.30 10.39  1.50 Y 
5 1 C  I VAL 218 ? ? N  I PRO 219 ? ? CA I PRO 219 ? ? 129.16 119.30 9.86   1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR L 32  ? ? -110.80 54.03   
2  1 VAL L 51  ? ? 90.20   -52.52  
3  1 SER L 67  ? ? 177.30  109.36  
4  1 VAL L 78  ? ? -38.74  110.04  
5  1 ALA L 80  ? ? -64.75  12.35   
6  1 THR L 114 ? ? -118.46 75.55   
7  1 ASN L 137 ? ? -27.91  148.74  
8  1 TYR L 140 ? ? 178.78  131.82  
9  1 ILE L 144 ? ? -176.48 147.85  
10 1 ARG L 188 ? ? -57.41  5.17    
11 1 LYS L 199 ? ? -57.46  -9.77   
12 1 SER L 208 ? ? -161.62 -166.10 
13 1 ASN L 210 ? ? -110.04 -166.11 
14 1 PRO H 14  ? ? -39.99  122.32  
15 1 ASP H 44  ? ? 10.02   86.54   
16 1 ASP H 61  ? ? -7.12   -48.78  
17 1 PHE H 63  ? ? -93.75  31.65   
18 1 LYS H 64  ? ? -100.00 47.96   
19 1 SER H 74  ? ? -78.19  34.24   
20 1 THR H 75  ? ? -165.34 -29.75  
21 1 SER H 76  ? ? 72.32   59.82   
22 1 ASN H 82  B ? 45.08   19.86   
23 1 LEU H 82  C ? -12.69  113.49  
24 1 ALA H 88  ? ? 170.42  -167.03 
25 1 ASP H 95  ? ? -96.64  -153.79 
26 1 ARG H 96  ? ? -143.34 35.10   
27 1 PHE H 100 C ? -47.33  91.83   
28 1 SER H 112 ? ? -172.42 136.41  
29 1 THR H 116 ? ? -27.85  101.34  
30 1 PRO I 154 ? ? -88.22  -126.40 
31 1 PRO I 156 ? ? -110.82 -169.73 
32 1 VAL I 176 ? ? -129.46 -148.99 
33 1 SER I 179 ? ? -179.52 -94.21  
34 1 GLU I 198 ? ? 171.86  -154.05 
35 1 THR I 199 ? ? 27.60   73.46   
36 1 ARG I 220 ? ? 79.20   -42.66  
37 1 ASP I 221 ? ? 58.88   -118.33 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    TYR 
_pdbx_validate_planes.auth_asym_id    L 
_pdbx_validate_planes.auth_seq_id     36 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.078 
_pdbx_validate_planes.type            'SIDE CHAIN' 
#