data_1CL8
# 
_entry.id   1CL8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1CL8         
NDB   PD0054       
RCSB  RCSB001015   
WWPDB D_1000001015 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1CL8 
_pdbx_database_status.recvd_initial_deposition_date   1999-05-06 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Horvath, M.'     1 
'Rosenberg, J.M.' 2 
# 
_citation.id                        primary 
_citation.title                     'Iap (Inner-Adenine to Purine): A Cognate EcoRI-DNA Base Analog Complex' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Horvath, M.'     1 
primary 'Rosenberg, J.M.' 2 
# 
_cell.entry_id           1CL8 
_cell.length_a           117.833 
_cell.length_b           117.833 
_cell.length_c           48.989 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1CL8 
_symmetry.space_group_name_H-M             'P 3 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     trigonal 
_symmetry.Int_Tables_number                150 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 
;DNA (5'-D(*TP*CP*GP*CP*GP*AP*(PRN)P*TP*TP*CP*GP*CP*G)-3')
;
3952.570  1   ? ? ? ? 
2 polymer nat 'PROTEIN (ENDONUCLEASE)'                                    30970.184 1   ? ? ? ? 
3 water   nat water                                                       18.015    155 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes '(DT)(DC)(DG)(DC)(DG)(DA)(PRN)(DT)(DT)(DC)(DG)(DC)(DG)' TCGCGAATTCGCG B ? 
2 'polypeptide(L)'        no no  
;SNKKQSNRLTEQHKLSQGVIGIFGDYAKAHDLAVGEVSKLVKKALSNEYPQLSFRYRDSIKKTEINEALKKIDPDLGGTL
FVSNSSIKPDGGIVEVKDDYGEWRVVLVAEAKHQGKDIINIRNGLLVGKRGDQDLMAAGNAIERSHKNISEIANFMLSES
HFPYVLFLEGSNFLTENISITRPDGRVVNLEYNSGILNRLDRLTAANYGMPINSNLCINKFVNHKDKSIMLQAASIYTQG
DGREWDSKIMFEIMFDISTTSLRVLGRDLFEQLTSK
;
;SNKKQSNRLTEQHKLSQGVIGIFGDYAKAHDLAVGEVSKLVKKALSNEYPQLSFRYRDSIKKTEINEALKKIDPDLGGTL
FVSNSSIKPDGGIVEVKDDYGEWRVVLVAEAKHQGKDIINIRNGLLVGKRGDQDLMAAGNAIERSHKNISEIANFMLSES
HFPYVLFLEGSNFLTENISITRPDGRVVNLEYNSGILNRLDRLTAANYGMPINSNLCINKFVNHKDKSIMLQAASIYTQG
DGREWDSKIMFEIMFDISTTSLRVLGRDLFEQLTSK
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DT  n 
1 2   DC  n 
1 3   DG  n 
1 4   DC  n 
1 5   DG  n 
1 6   DA  n 
1 7   PRN n 
1 8   DT  n 
1 9   DT  n 
1 10  DC  n 
1 11  DG  n 
1 12  DC  n 
1 13  DG  n 
2 1   SER n 
2 2   ASN n 
2 3   LYS n 
2 4   LYS n 
2 5   GLN n 
2 6   SER n 
2 7   ASN n 
2 8   ARG n 
2 9   LEU n 
2 10  THR n 
2 11  GLU n 
2 12  GLN n 
2 13  HIS n 
2 14  LYS n 
2 15  LEU n 
2 16  SER n 
2 17  GLN n 
2 18  GLY n 
2 19  VAL n 
2 20  ILE n 
2 21  GLY n 
2 22  ILE n 
2 23  PHE n 
2 24  GLY n 
2 25  ASP n 
2 26  TYR n 
2 27  ALA n 
2 28  LYS n 
2 29  ALA n 
2 30  HIS n 
2 31  ASP n 
2 32  LEU n 
2 33  ALA n 
2 34  VAL n 
2 35  GLY n 
2 36  GLU n 
2 37  VAL n 
2 38  SER n 
2 39  LYS n 
2 40  LEU n 
2 41  VAL n 
2 42  LYS n 
2 43  LYS n 
2 44  ALA n 
2 45  LEU n 
2 46  SER n 
2 47  ASN n 
2 48  GLU n 
2 49  TYR n 
2 50  PRO n 
2 51  GLN n 
2 52  LEU n 
2 53  SER n 
2 54  PHE n 
2 55  ARG n 
2 56  TYR n 
2 57  ARG n 
2 58  ASP n 
2 59  SER n 
2 60  ILE n 
2 61  LYS n 
2 62  LYS n 
2 63  THR n 
2 64  GLU n 
2 65  ILE n 
2 66  ASN n 
2 67  GLU n 
2 68  ALA n 
2 69  LEU n 
2 70  LYS n 
2 71  LYS n 
2 72  ILE n 
2 73  ASP n 
2 74  PRO n 
2 75  ASP n 
2 76  LEU n 
2 77  GLY n 
2 78  GLY n 
2 79  THR n 
2 80  LEU n 
2 81  PHE n 
2 82  VAL n 
2 83  SER n 
2 84  ASN n 
2 85  SER n 
2 86  SER n 
2 87  ILE n 
2 88  LYS n 
2 89  PRO n 
2 90  ASP n 
2 91  GLY n 
2 92  GLY n 
2 93  ILE n 
2 94  VAL n 
2 95  GLU n 
2 96  VAL n 
2 97  LYS n 
2 98  ASP n 
2 99  ASP n 
2 100 TYR n 
2 101 GLY n 
2 102 GLU n 
2 103 TRP n 
2 104 ARG n 
2 105 VAL n 
2 106 VAL n 
2 107 LEU n 
2 108 VAL n 
2 109 ALA n 
2 110 GLU n 
2 111 ALA n 
2 112 LYS n 
2 113 HIS n 
2 114 GLN n 
2 115 GLY n 
2 116 LYS n 
2 117 ASP n 
2 118 ILE n 
2 119 ILE n 
2 120 ASN n 
2 121 ILE n 
2 122 ARG n 
2 123 ASN n 
2 124 GLY n 
2 125 LEU n 
2 126 LEU n 
2 127 VAL n 
2 128 GLY n 
2 129 LYS n 
2 130 ARG n 
2 131 GLY n 
2 132 ASP n 
2 133 GLN n 
2 134 ASP n 
2 135 LEU n 
2 136 MET n 
2 137 ALA n 
2 138 ALA n 
2 139 GLY n 
2 140 ASN n 
2 141 ALA n 
2 142 ILE n 
2 143 GLU n 
2 144 ARG n 
2 145 SER n 
2 146 HIS n 
2 147 LYS n 
2 148 ASN n 
2 149 ILE n 
2 150 SER n 
2 151 GLU n 
2 152 ILE n 
2 153 ALA n 
2 154 ASN n 
2 155 PHE n 
2 156 MET n 
2 157 LEU n 
2 158 SER n 
2 159 GLU n 
2 160 SER n 
2 161 HIS n 
2 162 PHE n 
2 163 PRO n 
2 164 TYR n 
2 165 VAL n 
2 166 LEU n 
2 167 PHE n 
2 168 LEU n 
2 169 GLU n 
2 170 GLY n 
2 171 SER n 
2 172 ASN n 
2 173 PHE n 
2 174 LEU n 
2 175 THR n 
2 176 GLU n 
2 177 ASN n 
2 178 ILE n 
2 179 SER n 
2 180 ILE n 
2 181 THR n 
2 182 ARG n 
2 183 PRO n 
2 184 ASP n 
2 185 GLY n 
2 186 ARG n 
2 187 VAL n 
2 188 VAL n 
2 189 ASN n 
2 190 LEU n 
2 191 GLU n 
2 192 TYR n 
2 193 ASN n 
2 194 SER n 
2 195 GLY n 
2 196 ILE n 
2 197 LEU n 
2 198 ASN n 
2 199 ARG n 
2 200 LEU n 
2 201 ASP n 
2 202 ARG n 
2 203 LEU n 
2 204 THR n 
2 205 ALA n 
2 206 ALA n 
2 207 ASN n 
2 208 TYR n 
2 209 GLY n 
2 210 MET n 
2 211 PRO n 
2 212 ILE n 
2 213 ASN n 
2 214 SER n 
2 215 ASN n 
2 216 LEU n 
2 217 CYS n 
2 218 ILE n 
2 219 ASN n 
2 220 LYS n 
2 221 PHE n 
2 222 VAL n 
2 223 ASN n 
2 224 HIS n 
2 225 LYS n 
2 226 ASP n 
2 227 LYS n 
2 228 SER n 
2 229 ILE n 
2 230 MET n 
2 231 LEU n 
2 232 GLN n 
2 233 ALA n 
2 234 ALA n 
2 235 SER n 
2 236 ILE n 
2 237 TYR n 
2 238 THR n 
2 239 GLN n 
2 240 GLY n 
2 241 ASP n 
2 242 GLY n 
2 243 ARG n 
2 244 GLU n 
2 245 TRP n 
2 246 ASP n 
2 247 SER n 
2 248 LYS n 
2 249 ILE n 
2 250 MET n 
2 251 PHE n 
2 252 GLU n 
2 253 ILE n 
2 254 MET n 
2 255 PHE n 
2 256 ASP n 
2 257 ILE n 
2 258 SER n 
2 259 THR n 
2 260 THR n 
2 261 SER n 
2 262 LEU n 
2 263 ARG n 
2 264 VAL n 
2 265 LEU n 
2 266 GLY n 
2 267 ARG n 
2 268 ASP n 
2 269 LEU n 
2 270 PHE n 
2 271 GLU n 
2 272 GLN n 
2 273 LEU n 
2 274 THR n 
2 275 SER n 
2 276 LYS n 
# 
_entity_src_nat.entity_id                  2 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Escherichia coli' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      562 
_entity_src_nat.genus                      Escherichia 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP T2E1_ECOLI 2 ? ? P00642 ? 
2 PDB 1CL8       1 ? ? 1CL8   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1CL8 A 1 ? 276 ? P00642 1 ? 276 ? 2 277 
2 2 1CL8 B 1 ? 13  ? 1CL8   1 ? 13  ? 1 13  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                               ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                               ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"   ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"    ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"   ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"           ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                              ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                              ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                  ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                 ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                             ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                          ? 'C9 H11 N O2'     165.189 
PRN 'DNA linking'       n 
;PURINE 2'-DEOXYRIBO-5'-MONOPHOSPHATE
;
? 'C10 H13 N4 O6 P' 316.207 
PRO 'L-peptide linking' y PROLINE                                ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                 ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                              ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                               ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                 ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1CL8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.80 
_exptl_crystal.density_percent_sol   58 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'pH 7.5, VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   1998-04-15 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             1.1 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1CL8 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             8 
_reflns.d_resolution_high            1.80 
_reflns.number_obs                   35192 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.3 
_reflns.pdbx_Rmerge_I_obs            0.1050000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        19.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              10.3 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.85 
_reflns_shell.percent_possible_all   91.0 
_reflns_shell.Rmerge_I_obs           0.4320000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.6 
_reflns_shell.pdbx_redundancy        4.0 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1CL8 
_refine.ls_number_reflns_obs                     35192 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2 
_refine.pdbx_data_cutoff_high_absF               10000000 
_refine.pdbx_data_cutoff_low_absF                0.001 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    98.3 
_refine.ls_R_factor_obs                          0.2430000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2430000 
_refine.ls_R_factor_R_free                       0.2870000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10 
_refine.ls_number_reflns_R_free                  3528 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               36.1 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               RFREE 
_refine.details                                  'DNA-RNA.PARAM WAS MODIFIED TO CONTAIN A MODIFIED RESIDUE PRN' 
_refine.pdbx_starting_model                      'PDB ENTRY 1CKQ' 
_refine.pdbx_method_to_determine_struct          OTHER 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1CL8 
_refine_analyze.Luzzati_coordinate_error_obs    .34 
_refine_analyze.Luzzati_sigma_a_obs             .28 
_refine_analyze.Luzzati_d_res_low_obs           8 
_refine_analyze.Luzzati_coordinate_error_free   .37 
_refine_analyze.Luzzati_sigma_a_free            .30 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2051 
_refine_hist.pdbx_number_atoms_nucleic_acid   262 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             158 
_refine_hist.number_atoms_total               2471 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        8 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.004 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.067 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      0.805 ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       1.80 
_refine_ls_shell.d_res_low                        1.88 
_refine_ls_shell.number_reflns_R_work             2898 
_refine_ls_shell.R_factor_R_work                  0.3568000 
_refine_ls_shell.percent_reflns_obs               91 
_refine_ls_shell.R_factor_R_free                  0.3576000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            10.1 
_refine_ls_shell.number_reflns_R_free             326 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO             TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARAM11.WAT              TOPH19.PEP   'X-RAY DIFFRACTION' 
3 'MODIFIED DNA-RNA.PARAM' TOPH11.WAT   'X-RAY DIFFRACTION' 
4 ?                        DNA-RNA.TOP  'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1CL8 
_struct.title                     
'A PRE-TRANSITION STATE ECO RI ENDONUCLEASE/COGNATE DNA (TCGCGAPTTCGCG) COMPLEX WITH DNA BASE ANALOG PURINE (P)' 
_struct.pdbx_descriptor           'ENDONUCLEASE/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1CL8 
_struct_keywords.pdbx_keywords   PROTEIN/DNA 
_struct_keywords.text            'ENDONUCLEASE/DNA, DNA BASE ANALOG, PROTEIN-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY B 18  ? HIS B 30  ? GLY A 19  HIS A 31  5 ? 13 
HELX_P HELX_P2  2  VAL B 34  ? GLU B 48  ? VAL A 35  GLU A 49  1 ? 15 
HELX_P HELX_P3  3  LYS B 62  ? ILE B 72  ? LYS A 63  ILE A 73  1 ? 11 
HELX_P HELX_P4  4  ASP B 117 ? ARG B 122 ? ASP A 118 ARG A 123 1 ? 6  
HELX_P HELX_P5  5  ALA B 141 ? PHE B 155 ? ALA A 142 PHE A 156 5 ? 15 
HELX_P HELX_P6  6  LEU B 200 ? ARG B 202 ? LEU A 201 ARG A 203 5 ? 3  
HELX_P HELX_P7  7  THR B 204 ? ASN B 207 ? THR A 205 ASN A 208 5 ? 4  
HELX_P HELX_P8  8  SER B 247 ? VAL B 264 ? SER A 248 VAL A 265 1 ? 18 
HELX_P HELX_P9  9  GLY B 266 ? ASP B 268 ? GLY A 267 ASP A 269 5 ? 3  
HELX_P HELX_P10 10 PHE B 270 ? THR B 274 ? PHE A 271 THR A 275 1 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A DA  6  "O3'" ? ? ? 1_555 A PRN 7  P  ? ? B DA  6  B PRN 7  1_555 ? ? ? ? ? ? ?             1.604 ? 
covale2  covale ? ? A PRN 7  "O3'" ? ? ? 1_555 A DT  8  P  ? ? B PRN 7  B DT  8  1_555 ? ? ? ? ? ? ?             1.609 ? 
hydrog1  hydrog ? ? A DC  2  N3    ? ? ? 1_555 A DG  13 N1 ? ? B DC  2  B DG  13 4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog2  hydrog ? ? A DC  2  N4    ? ? ? 1_555 A DG  13 O6 ? ? B DC  2  B DG  13 4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog3  hydrog ? ? A DC  2  O2    ? ? ? 1_555 A DG  13 N2 ? ? B DC  2  B DG  13 4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog4  hydrog ? ? A DG  3  N1    ? ? ? 1_555 A DC  12 N3 ? ? B DG  3  B DC  12 4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog5  hydrog ? ? A DG  3  N2    ? ? ? 1_555 A DC  12 O2 ? ? B DG  3  B DC  12 4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog6  hydrog ? ? A DG  3  O6    ? ? ? 1_555 A DC  12 N4 ? ? B DG  3  B DC  12 4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog7  hydrog ? ? A DC  4  N3    ? ? ? 1_555 A DG  11 N1 ? ? B DC  4  B DG  11 4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog8  hydrog ? ? A DC  4  N4    ? ? ? 1_555 A DG  11 O6 ? ? B DC  4  B DG  11 4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog9  hydrog ? ? A DC  4  O2    ? ? ? 1_555 A DG  11 N2 ? ? B DC  4  B DG  11 4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog10 hydrog ? ? A DG  5  N1    ? ? ? 1_555 A DC  10 N3 ? ? B DG  5  B DC  10 4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog11 hydrog ? ? A DG  5  N2    ? ? ? 1_555 A DC  10 O2 ? ? B DG  5  B DC  10 4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog12 hydrog ? ? A DG  5  O6    ? ? ? 1_555 A DC  10 N4 ? ? B DG  5  B DC  10 4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog13 hydrog ? ? A DA  6  N1    ? ? ? 1_555 A DT  9  N3 ? ? B DA  6  B DT  9  4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog14 hydrog ? ? A DA  6  N6    ? ? ? 1_555 A DT  9  O4 ? ? B DA  6  B DT  9  4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog15 hydrog ? ? A PRN 7  N1    ? ? ? 1_555 A DT  8  N3 ? ? B PRN 7  B DT  8  4_555 ? ? ? ? ? ? 'PRN-DT PAIR' ?     ? 
hydrog16 hydrog ? ? A DT  8  N3    ? ? ? 1_555 A PRN 7  N1 ? ? B DT  8  B PRN 7  4_555 ? ? ? ? ? ? 'DT-PRN PAIR' ?     ? 
hydrog17 hydrog ? ? A DT  9  N3    ? ? ? 1_555 A DA  6  N1 ? ? B DT  9  B DA  6  4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog18 hydrog ? ? A DT  9  O4    ? ? ? 1_555 A DA  6  N6 ? ? B DT  9  B DA  6  4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog19 hydrog ? ? A DC  10 N3    ? ? ? 1_555 A DG  5  N1 ? ? B DC  10 B DG  5  4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog20 hydrog ? ? A DC  10 N4    ? ? ? 1_555 A DG  5  O6 ? ? B DC  10 B DG  5  4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog21 hydrog ? ? A DC  10 O2    ? ? ? 1_555 A DG  5  N2 ? ? B DC  10 B DG  5  4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog22 hydrog ? ? A DG  11 N1    ? ? ? 1_555 A DC  4  N3 ? ? B DG  11 B DC  4  4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog23 hydrog ? ? A DG  11 N2    ? ? ? 1_555 A DC  4  O2 ? ? B DG  11 B DC  4  4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog24 hydrog ? ? A DG  11 O6    ? ? ? 1_555 A DC  4  N4 ? ? B DG  11 B DC  4  4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog25 hydrog ? ? A DC  12 N3    ? ? ? 1_555 A DG  3  N1 ? ? B DC  12 B DG  3  4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog26 hydrog ? ? A DC  12 N4    ? ? ? 1_555 A DG  3  O6 ? ? B DC  12 B DG  3  4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog27 hydrog ? ? A DC  12 O2    ? ? ? 1_555 A DG  3  N2 ? ? B DC  12 B DG  3  4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog28 hydrog ? ? A DG  13 N1    ? ? ? 1_555 A DC  2  N3 ? ? B DG  13 B DC  2  4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog29 hydrog ? ? A DG  13 N2    ? ? ? 1_555 A DC  2  O2 ? ? B DG  13 B DC  2  4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog30 hydrog ? ? A DG  13 O6    ? ? ? 1_555 A DC  2  N4 ? ? B DG  13 B DC  2  4_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE B 54  ? ARG B 57  ? PHE A 55  ARG A 58  
A 2 ILE B 93  ? LYS B 97  ? ILE A 94  LYS A 98  
A 3 TRP B 103 ? HIS B 113 ? TRP A 104 HIS A 114 
A 4 TYR B 164 ? GLU B 169 ? TYR A 165 GLU A 170 
A 5 SER B 235 ? GLN B 239 ? SER A 236 GLN A 240 
B 1 ILE B 178 ? THR B 181 ? ILE A 179 THR A 182 
B 2 VAL B 187 ? LEU B 190 ? VAL A 188 LEU A 191 
C 1 LYS B 220 ? VAL B 222 ? LYS A 221 VAL A 223 
C 2 ILE B 229 ? LEU B 231 ? ILE A 230 LEU A 232 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG B 55  ? O ARG A 56  N GLU B 95  ? N GLU A 96  
A 2 3 O VAL B 94  ? O VAL A 95  N LEU B 107 ? N LEU A 108 
A 3 4 O VAL B 108 ? O VAL A 109 N VAL B 165 ? N VAL A 166 
A 4 5 O LEU B 166 ? O LEU A 167 N SER B 235 ? N SER A 236 
B 1 2 O ILE B 178 ? O ILE A 179 N LEU B 190 ? N LEU A 191 
C 1 2 O LYS B 220 ? O LYS A 221 N LEU B 231 ? N LEU A 232 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
PER Author ? ? ? ? 6 'PROTEIN RECOGNTION RESIDUES INVOLVED IN HYDROGEN BONDING CONTACTS AT THE SITE OF PERTURBATION' 
DNA Author ? ? ? ? 6 'DNA RECOGNITION SEQUENCE'                                                                      
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  PER 6 ALA B 141 ? ALA A 142 . ? 1_555 ? 
2  PER 6 ASN B 140 ? ASN A 141 . ? 1_555 ? 
3  PER 6 DA  A 6   ? DA  B 6   . ? 1_555 ? 
4  PER 6 PRN A 7   ? PRN B 7   . ? 1_555 ? 
5  PER 6 DT  A 8   ? DT  B 8   . ? 1_555 ? 
6  PER 6 DT  A 9   ? DT  B 9   . ? 1_555 ? 
7  DNA 6 DG  A 5   ? DG  B 5   . ? 1_555 ? 
8  DNA 6 DA  A 6   ? DA  B 6   . ? 1_555 ? 
9  DNA 6 PRN A 7   ? PRN B 7   . ? 1_555 ? 
10 DNA 6 DT  A 8   ? DT  B 8   . ? 1_555 ? 
11 DNA 6 DT  A 9   ? DT  B 9   . ? 1_555 ? 
12 DNA 6 DC  A 10  ? DC  B 10  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1CL8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1CL8 
_atom_sites.fract_transf_matrix[1][1]   0.008486 
_atom_sites.fract_transf_matrix[1][2]   0.004900 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009799 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.020413 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DT  A 1 1   ? 9.931  24.101 24.127  1.00 41.30  ? 1   DT  B "O5'" 1 
ATOM   2    C "C5'" . DT  A 1 1   ? 8.687  24.561 24.660  1.00 35.35  ? 1   DT  B "C5'" 1 
ATOM   3    C "C4'" . DT  A 1 1   ? 8.751  26.016 25.062  1.00 36.03  ? 1   DT  B "C4'" 1 
ATOM   4    O "O4'" . DT  A 1 1   ? 9.858  26.205 25.974  1.00 33.50  ? 1   DT  B "O4'" 1 
ATOM   5    C "C3'" . DT  A 1 1   ? 9.004  26.986 23.910  1.00 35.35  ? 1   DT  B "C3'" 1 
ATOM   6    O "O3'" . DT  A 1 1   ? 8.407  28.251 24.201  1.00 38.93  ? 1   DT  B "O3'" 1 
ATOM   7    C "C2'" . DT  A 1 1   ? 10.514 27.111 23.900  1.00 31.12  ? 1   DT  B "C2'" 1 
ATOM   8    C "C1'" . DT  A 1 1   ? 10.852 27.029 25.379  1.00 27.22  ? 1   DT  B "C1'" 1 
ATOM   9    N N1    . DT  A 1 1   ? 12.162 26.422 25.653  1.00 25.69  ? 1   DT  B N1    1 
ATOM   10   C C2    . DT  A 1 1   ? 13.259 27.248 25.707  1.00 23.97  ? 1   DT  B C2    1 
ATOM   11   O O2    . DT  A 1 1   ? 13.192 28.455 25.548  1.00 30.20  ? 1   DT  B O2    1 
ATOM   12   N N3    . DT  A 1 1   ? 14.444 26.605 25.957  1.00 27.65  ? 1   DT  B N3    1 
ATOM   13   C C4    . DT  A 1 1   ? 14.635 25.251 26.157  1.00 27.00  ? 1   DT  B C4    1 
ATOM   14   O O4    . DT  A 1 1   ? 15.763 24.817 26.367  1.00 33.24  ? 1   DT  B O4    1 
ATOM   15   C C5    . DT  A 1 1   ? 13.439 24.446 26.095  1.00 22.89  ? 1   DT  B C5    1 
ATOM   16   C C7    . DT  A 1 1   ? 13.544 22.970 26.311  1.00 24.23  ? 1   DT  B C7    1 
ATOM   17   C C6    . DT  A 1 1   ? 12.279 25.063 25.847  1.00 23.59  ? 1   DT  B C6    1 
ATOM   18   P P     . DC  A 1 2   ? 8.087  29.275 23.007  1.00 44.26  ? 2   DC  B P     1 
ATOM   19   O OP1   . DC  A 1 2   ? 7.412  30.463 23.588  1.00 42.87  ? 2   DC  B OP1   1 
ATOM   20   O OP2   . DC  A 1 2   ? 7.422  28.506 21.922  1.00 43.70  ? 2   DC  B OP2   1 
ATOM   21   O "O5'" . DC  A 1 2   ? 9.526  29.724 22.494  1.00 42.00  ? 2   DC  B "O5'" 1 
ATOM   22   C "C5'" . DC  A 1 2   ? 10.399 30.473 23.337  1.00 38.15  ? 2   DC  B "C5'" 1 
ATOM   23   C "C4'" . DC  A 1 2   ? 11.684 30.792 22.610  1.00 33.72  ? 2   DC  B "C4'" 1 
ATOM   24   O "O4'" . DC  A 1 2   ? 12.355 29.561 22.254  1.00 33.77  ? 2   DC  B "O4'" 1 
ATOM   25   C "C3'" . DC  A 1 2   ? 11.510 31.576 21.308  1.00 29.09  ? 2   DC  B "C3'" 1 
ATOM   26   O "O3'" . DC  A 1 2   ? 12.540 32.564 21.209  1.00 28.09  ? 2   DC  B "O3'" 1 
ATOM   27   C "C2'" . DC  A 1 2   ? 11.661 30.515 20.231  1.00 27.54  ? 2   DC  B "C2'" 1 
ATOM   28   C "C1'" . DC  A 1 2   ? 12.643 29.546 20.866  1.00 26.93  ? 2   DC  B "C1'" 1 
ATOM   29   N N1    . DC  A 1 2   ? 12.529 28.155 20.402  1.00 25.71  ? 2   DC  B N1    1 
ATOM   30   C C2    . DC  A 1 2   ? 13.692 27.469 20.041  1.00 24.73  ? 2   DC  B C2    1 
ATOM   31   O O2    . DC  A 1 2   ? 14.781 28.056 20.109  1.00 26.78  ? 2   DC  B O2    1 
ATOM   32   N N3    . DC  A 1 2   ? 13.602 26.186 19.630  1.00 24.72  ? 2   DC  B N3    1 
ATOM   33   C C4    . DC  A 1 2   ? 12.412 25.587 19.570  1.00 24.19  ? 2   DC  B C4    1 
ATOM   34   N N4    . DC  A 1 2   ? 12.375 24.316 19.165  1.00 25.70  ? 2   DC  B N4    1 
ATOM   35   C C5    . DC  A 1 2   ? 11.209 26.263 19.925  1.00 23.61  ? 2   DC  B C5    1 
ATOM   36   C C6    . DC  A 1 2   ? 11.313 27.535 20.331  1.00 25.35  ? 2   DC  B C6    1 
ATOM   37   P P     . DG  A 1 3   ? 12.339 33.836 20.250  1.00 28.70  ? 3   DG  B P     1 
ATOM   38   O OP1   . DG  A 1 3   ? 12.897 35.025 20.939  1.00 28.16  ? 3   DG  B OP1   1 
ATOM   39   O OP2   . DG  A 1 3   ? 10.924 33.841 19.812  1.00 29.30  ? 3   DG  B OP2   1 
ATOM   40   O "O5'" . DG  A 1 3   ? 13.273 33.508 19.001  1.00 29.45  ? 3   DG  B "O5'" 1 
ATOM   41   C "C5'" . DG  A 1 3   ? 14.691 33.516 19.146  1.00 26.18  ? 3   DG  B "C5'" 1 
ATOM   42   C "C4'" . DG  A 1 3   ? 15.349 32.710 18.051  1.00 27.66  ? 3   DG  B "C4'" 1 
ATOM   43   O "O4'" . DG  A 1 3   ? 14.945 31.330 18.119  1.00 25.81  ? 3   DG  B "O4'" 1 
ATOM   44   C "C3'" . DG  A 1 3   ? 15.067 33.152 16.612  1.00 26.92  ? 3   DG  B "C3'" 1 
ATOM   45   O "O3'" . DG  A 1 3   ? 16.226 33.819 16.098  1.00 30.51  ? 3   DG  B "O3'" 1 
ATOM   46   C "C2'" . DG  A 1 3   ? 14.795 31.853 15.862  1.00 27.08  ? 3   DG  B "C2'" 1 
ATOM   47   C "C1'" . DG  A 1 3   ? 15.198 30.773 16.850  1.00 26.19  ? 3   DG  B "C1'" 1 
ATOM   48   N N9    . DG  A 1 3   ? 14.446 29.530 16.741  1.00 23.71  ? 3   DG  B N9    1 
ATOM   49   C C8    . DG  A 1 3   ? 13.082 29.372 16.781  1.00 22.22  ? 3   DG  B C8    1 
ATOM   50   N N7    . DG  A 1 3   ? 12.707 28.128 16.656  1.00 22.23  ? 3   DG  B N7    1 
ATOM   51   C C5    . DG  A 1 3   ? 13.897 27.423 16.528  1.00 20.49  ? 3   DG  B C5    1 
ATOM   52   C C6    . DG  A 1 3   ? 14.128 26.036 16.367  1.00 20.83  ? 3   DG  B C6    1 
ATOM   53   O O6    . DG  A 1 3   ? 13.303 25.122 16.302  1.00 25.18  ? 3   DG  B O6    1 
ATOM   54   N N1    . DG  A 1 3   ? 15.486 25.750 16.279  1.00 22.25  ? 3   DG  B N1    1 
ATOM   55   C C2    . DG  A 1 3   ? 16.492 26.681 16.338  1.00 22.27  ? 3   DG  B C2    1 
ATOM   56   N N2    . DG  A 1 3   ? 17.744 26.209 16.239  1.00 25.98  ? 3   DG  B N2    1 
ATOM   57   N N3    . DG  A 1 3   ? 16.289 27.977 16.487  1.00 21.85  ? 3   DG  B N3    1 
ATOM   58   C C4    . DG  A 1 3   ? 14.977 28.275 16.577  1.00 20.42  ? 3   DG  B C4    1 
ATOM   59   P P     . DC  A 1 4   ? 16.457 33.934 14.512  1.00 25.37  ? 4   DC  B P     1 
ATOM   60   O OP1   . DC  A 1 4   ? 17.205 35.189 14.264  1.00 28.93  ? 4   DC  B OP1   1 
ATOM   61   O OP2   . DC  A 1 4   ? 15.166 33.704 13.820  1.00 30.41  ? 4   DC  B OP2   1 
ATOM   62   O "O5'" . DC  A 1 4   ? 17.425 32.711 14.194  1.00 27.43  ? 4   DC  B "O5'" 1 
ATOM   63   C "C5'" . DC  A 1 4   ? 18.724 32.641 14.781  1.00 25.70  ? 4   DC  B "C5'" 1 
ATOM   64   C "C4'" . DC  A 1 4   ? 19.555 31.584 14.091  1.00 28.13  ? 4   DC  B "C4'" 1 
ATOM   65   O "O4'" . DC  A 1 4   ? 18.906 30.297 14.225  1.00 28.13  ? 4   DC  B "O4'" 1 
ATOM   66   C "C3'" . DC  A 1 4   ? 19.772 31.804 12.592  1.00 26.84  ? 4   DC  B "C3'" 1 
ATOM   67   O "O3'" . DC  A 1 4   ? 21.135 31.525 12.253  1.00 28.73  ? 4   DC  B "O3'" 1 
ATOM   68   C "C2'" . DC  A 1 4   ? 18.819 30.821 11.936  1.00 25.11  ? 4   DC  B "C2'" 1 
ATOM   69   C "C1'" . DC  A 1 4   ? 18.719 29.697 12.953  1.00 24.94  ? 4   DC  B "C1'" 1 
ATOM   70   N N1    . DC  A 1 4   ? 17.412 29.023 12.968  1.00 24.77  ? 4   DC  B N1    1 
ATOM   71   C C2    . DC  A 1 4   ? 17.370 27.625 12.952  1.00 23.83  ? 4   DC  B C2    1 
ATOM   72   O O2    . DC  A 1 4   ? 18.436 26.990 12.923  1.00 25.51  ? 4   DC  B O2    1 
ATOM   73   N N3    . DC  A 1 4   ? 16.170 27.000 12.967  1.00 24.65  ? 4   DC  B N3    1 
ATOM   74   C C4    . DC  A 1 4   ? 15.045 27.718 12.995  1.00 24.21  ? 4   DC  B C4    1 
ATOM   75   N N4    . DC  A 1 4   ? 13.883 27.061 13.005  1.00 25.39  ? 4   DC  B N4    1 
ATOM   76   C C5    . DC  A 1 4   ? 15.060 29.143 13.013  1.00 24.05  ? 4   DC  B C5    1 
ATOM   77   C C6    . DC  A 1 4   ? 16.254 29.747 12.999  1.00 22.52  ? 4   DC  B C6    1 
ATOM   78   P P     . DG  A 1 5   ? 21.587 31.490 10.711  1.00 26.78  ? 5   DG  B P     1 
ATOM   79   O OP1   . DG  A 1 5   ? 23.010 31.900 10.632  1.00 27.88  ? 5   DG  B OP1   1 
ATOM   80   O OP2   . DG  A 1 5   ? 20.569 32.229 9.926   1.00 31.04  ? 5   DG  B OP2   1 
ATOM   81   O "O5'" . DG  A 1 5   ? 21.493 29.946 10.338  1.00 24.04  ? 5   DG  B "O5'" 1 
ATOM   82   C "C5'" . DG  A 1 5   ? 22.238 28.976 11.074  1.00 24.89  ? 5   DG  B "C5'" 1 
ATOM   83   C "C4'" . DG  A 1 5   ? 22.019 27.596 10.499  1.00 29.59  ? 5   DG  B "C4'" 1 
ATOM   84   O "O4'" . DG  A 1 5   ? 20.647 27.188 10.712  1.00 30.80  ? 5   DG  B "O4'" 1 
ATOM   85   C "C3'" . DG  A 1 5   ? 22.276 27.473 8.995   1.00 32.25  ? 5   DG  B "C3'" 1 
ATOM   86   O "O3'" . DG  A 1 5   ? 23.038 26.292 8.739   1.00 37.64  ? 5   DG  B "O3'" 1 
ATOM   87   C "C2'" . DG  A 1 5   ? 20.885 27.345 8.398   1.00 30.01  ? 5   DG  B "C2'" 1 
ATOM   88   C "C1'" . DG  A 1 5   ? 20.116 26.662 9.510   1.00 27.93  ? 5   DG  B "C1'" 1 
ATOM   89   N N9    . DG  A 1 5   ? 18.685 26.941 9.498   1.00 25.24  ? 5   DG  B N9    1 
ATOM   90   C C8    . DG  A 1 5   ? 18.084 28.175 9.523   1.00 24.57  ? 5   DG  B C8    1 
ATOM   91   N N7    . DG  A 1 5   ? 16.781 28.112 9.492   1.00 24.66  ? 5   DG  B N7    1 
ATOM   92   C C5    . DG  A 1 5   ? 16.504 26.752 9.446   1.00 22.96  ? 5   DG  B C5    1 
ATOM   93   C C6    . DG  A 1 5   ? 15.263 26.071 9.394   1.00 21.60  ? 5   DG  B C6    1 
ATOM   94   O O6    . DG  A 1 5   ? 14.123 26.549 9.376   1.00 23.64  ? 5   DG  B O6    1 
ATOM   95   N N1    . DG  A 1 5   ? 15.438 24.691 9.361   1.00 18.51  ? 5   DG  B N1    1 
ATOM   96   C C2    . DG  A 1 5   ? 16.651 24.050 9.373   1.00 17.72  ? 5   DG  B C2    1 
ATOM   97   N N2    . DG  A 1 5   ? 16.614 22.711 9.334   1.00 20.32  ? 5   DG  B N2    1 
ATOM   98   N N3    . DG  A 1 5   ? 17.816 24.675 9.420   1.00 21.50  ? 5   DG  B N3    1 
ATOM   99   C C4    . DG  A 1 5   ? 17.668 26.015 9.453   1.00 23.54  ? 5   DG  B C4    1 
ATOM   100  P P     . DA  A 1 6   ? 23.757 26.095 7.318   1.00 35.74  ? 6   DA  B P     1 
ATOM   101  O OP1   . DA  A 1 6   ? 25.205 25.875 7.561   1.00 36.94  ? 6   DA  B OP1   1 
ATOM   102  O OP2   . DA  A 1 6   ? 23.323 27.187 6.412   1.00 38.40  ? 6   DA  B OP2   1 
ATOM   103  O "O5'" . DA  A 1 6   ? 23.132 24.736 6.779   1.00 36.25  ? 6   DA  B "O5'" 1 
ATOM   104  C "C5'" . DA  A 1 6   ? 23.233 23.535 7.539   1.00 32.68  ? 6   DA  B "C5'" 1 
ATOM   105  C "C4'" . DA  A 1 6   ? 22.363 22.463 6.927   1.00 32.09  ? 6   DA  B "C4'" 1 
ATOM   106  O "O4'" . DA  A 1 6   ? 20.972 22.814 7.104   1.00 29.58  ? 6   DA  B "O4'" 1 
ATOM   107  C "C3'" . DA  A 1 6   ? 22.578 22.286 5.422   1.00 33.91  ? 6   DA  B "C3'" 1 
ATOM   108  O "O3'" . DA  A 1 6   ? 22.741 20.904 5.105   1.00 37.58  ? 6   DA  B "O3'" 1 
ATOM   109  C "C2'" . DA  A 1 6   ? 21.314 22.845 4.793   1.00 29.79  ? 6   DA  B "C2'" 1 
ATOM   110  C "C1'" . DA  A 1 6   ? 20.276 22.658 5.881   1.00 28.17  ? 6   DA  B "C1'" 1 
ATOM   111  N N9    . DA  A 1 6   ? 19.205 23.653 5.847   1.00 23.15  ? 6   DA  B N9    1 
ATOM   112  C C8    . DA  A 1 6   ? 19.322 25.018 5.741   1.00 19.89  ? 6   DA  B C8    1 
ATOM   113  N N7    . DA  A 1 6   ? 18.174 25.647 5.731   1.00 20.73  ? 6   DA  B N7    1 
ATOM   114  C C5    . DA  A 1 6   ? 17.236 24.630 5.838   1.00 19.66  ? 6   DA  B C5    1 
ATOM   115  C C6    . DA  A 1 6   ? 15.833 24.639 5.882   1.00 17.13  ? 6   DA  B C6    1 
ATOM   116  N N6    . DA  A 1 6   ? 15.096 25.748 5.822   1.00 17.29  ? 6   DA  B N6    1 
ATOM   117  N N1    . DA  A 1 6   ? 15.203 23.452 5.991   1.00 19.80  ? 6   DA  B N1    1 
ATOM   118  C C2    . DA  A 1 6   ? 15.939 22.338 6.053   1.00 20.05  ? 6   DA  B C2    1 
ATOM   119  N N3    . DA  A 1 6   ? 17.260 22.200 6.023   1.00 24.02  ? 6   DA  B N3    1 
ATOM   120  C C4    . DA  A 1 6   ? 17.857 23.398 5.912   1.00 21.80  ? 6   DA  B C4    1 
HETATM 121  N N1    . PRN A 1 7   ? 15.542 25.233 1.991   1.00 21.69  ? 7   PRN B N1    1 
HETATM 122  C C2    . PRN A 1 7   ? 15.785 24.083 1.328   1.00 20.74  ? 7   PRN B C2    1 
HETATM 123  N N3    . PRN A 1 7   ? 16.952 23.525 1.048   1.00 22.17  ? 7   PRN B N3    1 
HETATM 124  C C4    . PRN A 1 7   ? 17.995 24.226 1.500   1.00 21.34  ? 7   PRN B C4    1 
HETATM 125  C C5    . PRN A 1 7   ? 17.865 25.428 2.200   1.00 21.86  ? 7   PRN B C5    1 
HETATM 126  C C6    . PRN A 1 7   ? 16.591 25.921 2.435   1.00 20.77  ? 7   PRN B C6    1 
HETATM 127  N N7    . PRN A 1 7   ? 19.150 25.826 2.487   1.00 22.15  ? 7   PRN B N7    1 
HETATM 128  C C8    . PRN A 1 7   ? 19.955 24.893 1.970   1.00 26.04  ? 7   PRN B C8    1 
HETATM 129  N N9    . PRN A 1 7   ? 19.322 23.913 1.368   1.00 25.91  ? 7   PRN B N9    1 
HETATM 130  C "C1'" . PRN A 1 7   ? 19.864 22.736 0.691   1.00 27.09  ? 7   PRN B "C1'" 1 
HETATM 131  C "C2'" . PRN A 1 7   ? 21.261 22.870 0.129   1.00 28.98  ? 7   PRN B "C2'" 1 
HETATM 132  C "C3'" . PRN A 1 7   ? 21.629 21.405 -0.058  1.00 30.18  ? 7   PRN B "C3'" 1 
HETATM 133  O "O3'" . PRN A 1 7   ? 21.119 20.974 -1.322  1.00 30.67  ? 7   PRN B "O3'" 1 
HETATM 134  C "C4'" . PRN A 1 7   ? 20.852 20.701 1.061   1.00 32.04  ? 7   PRN B "C4'" 1 
HETATM 135  O "O4'" . PRN A 1 7   ? 19.977 21.697 1.637   1.00 29.64  ? 7   PRN B "O4'" 1 
HETATM 136  C "C5'" . PRN A 1 7   ? 21.689 20.024 2.122   1.00 36.06  ? 7   PRN B "C5'" 1 
HETATM 137  O "O5'" . PRN A 1 7   ? 22.715 20.897 2.590   1.00 37.00  ? 7   PRN B "O5'" 1 
HETATM 138  P P     . PRN A 1 7   ? 23.623 20.483 3.833   1.00 39.69  ? 7   PRN B P     1 
HETATM 139  O OP1   . PRN A 1 7   ? 23.752 19.004 3.858   1.00 38.28  ? 7   PRN B OP1   1 
HETATM 140  O OP2   . PRN A 1 7   ? 24.846 21.326 3.828   1.00 35.74  ? 7   PRN B OP2   1 
ATOM   141  P P     . DT  A 1 8   ? 21.530 19.532 -1.905  1.00 32.32  ? 8   DT  B P     1 
ATOM   142  O OP1   . DT  A 1 8   ? 22.265 18.766 -0.865  1.00 30.12  ? 8   DT  B OP1   1 
ATOM   143  O OP2   . DT  A 1 8   ? 22.162 19.765 -3.224  1.00 28.47  ? 8   DT  B OP2   1 
ATOM   144  O "O5'" . DT  A 1 8   ? 20.126 18.823 -2.153  1.00 27.67  ? 8   DT  B "O5'" 1 
ATOM   145  C "C5'" . DT  A 1 8   ? 19.427 18.185 -1.086  1.00 23.33  ? 8   DT  B "C5'" 1 
ATOM   146  C "C4'" . DT  A 1 8   ? 17.946 18.474 -1.179  1.00 22.57  ? 8   DT  B "C4'" 1 
ATOM   147  O "O4'" . DT  A 1 8   ? 17.660 19.836 -0.804  1.00 20.52  ? 8   DT  B "O4'" 1 
ATOM   148  C "C3'" . DT  A 1 8   ? 17.334 18.329 -2.564  1.00 27.74  ? 8   DT  B "C3'" 1 
ATOM   149  O "O3'" . DT  A 1 8   ? 17.031 16.956 -2.835  1.00 33.08  ? 8   DT  B "O3'" 1 
ATOM   150  C "C2'" . DT  A 1 8   ? 16.069 19.161 -2.444  1.00 23.63  ? 8   DT  B "C2'" 1 
ATOM   151  C "C1'" . DT  A 1 8   ? 16.447 20.245 -1.428  1.00 20.75  ? 8   DT  B "C1'" 1 
ATOM   152  N N1    . DT  A 1 8   ? 16.671 21.575 -2.022  1.00 19.42  ? 8   DT  B N1    1 
ATOM   153  C C2    . DT  A 1 8   ? 15.661 22.509 -1.944  1.00 20.78  ? 8   DT  B C2    1 
ATOM   154  O O2    . DT  A 1 8   ? 14.592 22.295 -1.396  1.00 21.93  ? 8   DT  B O2    1 
ATOM   155  N N3    . DT  A 1 8   ? 15.951 23.713 -2.532  1.00 20.60  ? 8   DT  B N3    1 
ATOM   156  C C4    . DT  A 1 8   ? 17.121 24.069 -3.171  1.00 20.55  ? 8   DT  B C4    1 
ATOM   157  O O4    . DT  A 1 8   ? 17.233 25.191 -3.657  1.00 25.80  ? 8   DT  B O4    1 
ATOM   158  C C5    . DT  A 1 8   ? 18.140 23.046 -3.205  1.00 19.87  ? 8   DT  B C5    1 
ATOM   159  C C7    . DT  A 1 8   ? 19.449 23.344 -3.865  1.00 20.83  ? 8   DT  B C7    1 
ATOM   160  C C6    . DT  A 1 8   ? 17.865 21.866 -2.641  1.00 20.06  ? 8   DT  B C6    1 
ATOM   161  P P     . DT  A 1 9   ? 17.018 16.424 -4.353  1.00 28.58  ? 9   DT  B P     1 
ATOM   162  O OP1   . DT  A 1 9   ? 17.205 14.952 -4.326  1.00 26.05  ? 9   DT  B OP1   1 
ATOM   163  O OP2   . DT  A 1 9   ? 17.951 17.267 -5.139  1.00 24.98  ? 9   DT  B OP2   1 
ATOM   164  O "O5'" . DT  A 1 9   ? 15.536 16.733 -4.842  1.00 25.72  ? 9   DT  B "O5'" 1 
ATOM   165  C "C5'" . DT  A 1 9   ? 14.416 16.223 -4.123  1.00 28.09  ? 9   DT  B "C5'" 1 
ATOM   166  C "C4'" . DT  A 1 9   ? 13.132 16.620 -4.810  1.00 27.85  ? 9   DT  B "C4'" 1 
ATOM   167  O "O4'" . DT  A 1 9   ? 12.980 18.057 -4.745  1.00 28.51  ? 9   DT  B "O4'" 1 
ATOM   168  C "C3'" . DT  A 1 9   ? 13.072 16.249 -6.291  1.00 31.04  ? 9   DT  B "C3'" 1 
ATOM   169  O "O3'" . DT  A 1 9   ? 11.758 15.792 -6.623  1.00 34.32  ? 9   DT  B "O3'" 1 
ATOM   170  C "C2'" . DT  A 1 9   ? 13.413 17.547 -7.003  1.00 29.90  ? 9   DT  B "C2'" 1 
ATOM   171  C "C1'" . DT  A 1 9   ? 12.904 18.615 -6.048  1.00 28.55  ? 9   DT  B "C1'" 1 
ATOM   172  N N1    . DT  A 1 9   ? 13.704 19.856 -6.050  1.00 26.10  ? 9   DT  B N1    1 
ATOM   173  C C2    . DT  A 1 9   ? 13.042 21.064 -6.020  1.00 25.59  ? 9   DT  B C2    1 
ATOM   174  O O2    . DT  A 1 9   ? 11.825 21.159 -6.013  1.00 28.05  ? 9   DT  B O2    1 
ATOM   175  N N3    . DT  A 1 9   ? 13.862 22.164 -6.002  1.00 20.83  ? 9   DT  B N3    1 
ATOM   176  C C4    . DT  A 1 9   ? 15.243 22.178 -6.018  1.00 22.88  ? 9   DT  B C4    1 
ATOM   177  O O4    . DT  A 1 9   ? 15.844 23.248 -5.996  1.00 24.55  ? 9   DT  B O4    1 
ATOM   178  C C5    . DT  A 1 9   ? 15.872 20.878 -6.063  1.00 22.86  ? 9   DT  B C5    1 
ATOM   179  C C7    . DT  A 1 9   ? 17.364 20.795 -6.096  1.00 19.45  ? 9   DT  B C7    1 
ATOM   180  C C6    . DT  A 1 9   ? 15.081 19.798 -6.074  1.00 22.30  ? 9   DT  B C6    1 
ATOM   181  P P     . DC  A 1 10  ? 11.450 15.255 -8.105  1.00 31.19  ? 10  DC  B P     1 
ATOM   182  O OP1   . DC  A 1 10  ? 10.361 14.248 -8.015  1.00 33.59  ? 10  DC  B OP1   1 
ATOM   183  O OP2   . DC  A 1 10  ? 12.746 14.881 -8.720  1.00 27.62  ? 10  DC  B OP2   1 
ATOM   184  O "O5'" . DC  A 1 10  ? 10.881 16.543 -8.850  1.00 32.45  ? 10  DC  B "O5'" 1 
ATOM   185  C "C5'" . DC  A 1 10  ? 9.818  17.297 -8.272  1.00 31.13  ? 10  DC  B "C5'" 1 
ATOM   186  C "C4'" . DC  A 1 10  ? 9.660  18.625 -8.975  1.00 34.58  ? 10  DC  B "C4'" 1 
ATOM   187  O "O4'" . DC  A 1 10  ? 10.752 19.519 -8.654  1.00 34.05  ? 10  DC  B "O4'" 1 
ATOM   188  C "C3'" . DC  A 1 10  ? 9.590  18.571 -10.506 1.00 33.48  ? 10  DC  B "C3'" 1 
ATOM   189  O "O3'" . DC  A 1 10  ? 8.474  19.353 -10.932 1.00 34.67  ? 10  DC  B "O3'" 1 
ATOM   190  C "C2'" . DC  A 1 10  ? 10.870 19.262 -10.945 1.00 29.59  ? 10  DC  B "C2'" 1 
ATOM   191  C "C1'" . DC  A 1 10  ? 11.043 20.259 -9.822  1.00 33.06  ? 10  DC  B "C1'" 1 
ATOM   192  N N1    . DC  A 1 10  ? 12.382 20.851 -9.676  1.00 28.98  ? 10  DC  B N1    1 
ATOM   193  C C2    . DC  A 1 10  ? 12.478 22.205 -9.339  1.00 25.82  ? 10  DC  B C2    1 
ATOM   194  O O2    . DC  A 1 10  ? 11.435 22.856 -9.165  1.00 27.89  ? 10  DC  B O2    1 
ATOM   195  N N3    . DC  A 1 10  ? 13.696 22.769 -9.207  1.00 23.83  ? 10  DC  B N3    1 
ATOM   196  C C4    . DC  A 1 10  ? 14.793 22.036 -9.392  1.00 23.84  ? 10  DC  B C4    1 
ATOM   197  N N4    . DC  A 1 10  ? 15.971 22.637 -9.245  1.00 25.41  ? 10  DC  B N4    1 
ATOM   198  C C5    . DC  A 1 10  ? 14.728 20.653 -9.734  1.00 23.98  ? 10  DC  B C5    1 
ATOM   199  C C6    . DC  A 1 10  ? 13.512 20.106 -9.865  1.00 25.13  ? 10  DC  B C6    1 
ATOM   200  P P     . DG  A 1 11  ? 7.651  18.930 -12.241 1.00 36.22  ? 11  DG  B P     1 
ATOM   201  O OP1   . DG  A 1 11  ? 6.656  17.901 -11.853 1.00 38.67  ? 11  DG  B OP1   1 
ATOM   202  O OP2   . DG  A 1 11  ? 8.622  18.638 -13.323 1.00 37.61  ? 11  DG  B OP2   1 
ATOM   203  O "O5'" . DG  A 1 11  ? 6.868  20.267 -12.609 1.00 37.29  ? 11  DG  B "O5'" 1 
ATOM   204  C "C5'" . DG  A 1 11  ? 6.086  20.942 -11.625 1.00 35.63  ? 11  DG  B "C5'" 1 
ATOM   205  C "C4'" . DG  A 1 11  ? 6.196  22.440 -11.798 1.00 37.17  ? 11  DG  B "C4'" 1 
ATOM   206  O "O4'" . DG  A 1 11  ? 7.539  22.884 -11.493 1.00 37.30  ? 11  DG  B "O4'" 1 
ATOM   207  C "C3'" . DG  A 1 11  ? 5.873  22.960 -13.199 1.00 36.57  ? 11  DG  B "C3'" 1 
ATOM   208  O "O3'" . DG  A 1 11  ? 4.990  24.081 -13.094 1.00 39.52  ? 11  DG  B "O3'" 1 
ATOM   209  C "C2'" . DG  A 1 11  ? 7.225  23.370 -13.761 1.00 35.91  ? 11  DG  B "C2'" 1 
ATOM   210  C "C1'" . DG  A 1 11  ? 8.017  23.738 -12.518 1.00 33.46  ? 11  DG  B "C1'" 1 
ATOM   211  N N9    . DG  A 1 11  ? 9.455  23.515 -12.637 1.00 29.21  ? 11  DG  B N9    1 
ATOM   212  C C8    . DG  A 1 11  ? 10.090 22.303 -12.748 1.00 29.96  ? 11  DG  B C8    1 
ATOM   213  N N7    . DG  A 1 11  ? 11.389 22.409 -12.815 1.00 29.55  ? 11  DG  B N7    1 
ATOM   214  C C5    . DG  A 1 11  ? 11.627 23.774 -12.748 1.00 25.13  ? 11  DG  B C5    1 
ATOM   215  C C6    . DG  A 1 11  ? 12.848 24.490 -12.771 1.00 21.67  ? 11  DG  B C6    1 
ATOM   216  O O6    . DG  A 1 11  ? 13.998 24.045 -12.846 1.00 26.31  ? 11  DG  B O6    1 
ATOM   217  N N1    . DG  A 1 11  ? 12.638 25.862 -12.693 1.00 24.58  ? 11  DG  B N1    1 
ATOM   218  C C2    . DG  A 1 11  ? 11.410 26.468 -12.598 1.00 23.73  ? 11  DG  B C2    1 
ATOM   219  N N2    . DG  A 1 11  ? 11.417 27.807 -12.543 1.00 26.63  ? 11  DG  B N2    1 
ATOM   220  N N3    . DG  A 1 11  ? 10.261 25.810 -12.563 1.00 24.97  ? 11  DG  B N3    1 
ATOM   221  C C4    . DG  A 1 11  ? 10.444 24.474 -12.644 1.00 27.10  ? 11  DG  B C4    1 
ATOM   222  P P     . DC  A 1 12  ? 4.144  24.554 -14.373 1.00 41.70  ? 12  DC  B P     1 
ATOM   223  O OP1   . DC  A 1 12  ? 2.862  25.130 -13.896 1.00 42.00  ? 12  DC  B OP1   1 
ATOM   224  O OP2   . DC  A 1 12  ? 4.129  23.434 -15.347 1.00 42.64  ? 12  DC  B OP2   1 
ATOM   225  O "O5'" . DC  A 1 12  ? 5.023  25.731 -14.984 1.00 38.99  ? 12  DC  B "O5'" 1 
ATOM   226  C "C5'" . DC  A 1 12  ? 5.463  26.813 -14.164 1.00 37.98  ? 12  DC  B "C5'" 1 
ATOM   227  C "C4'" . DC  A 1 12  ? 6.450  27.670 -14.919 1.00 36.09  ? 12  DC  B "C4'" 1 
ATOM   228  O "O4'" . DC  A 1 12  ? 7.766  27.089 -14.807 1.00 33.06  ? 12  DC  B "O4'" 1 
ATOM   229  C "C3'" . DC  A 1 12  ? 6.157  27.791 -16.417 1.00 38.21  ? 12  DC  B "C3'" 1 
ATOM   230  O "O3'" . DC  A 1 12  ? 5.959  29.162 -16.761 1.00 43.98  ? 12  DC  B "O3'" 1 
ATOM   231  C "C2'" . DC  A 1 12  ? 7.392  27.225 -17.104 1.00 35.58  ? 12  DC  B "C2'" 1 
ATOM   232  C "C1'" . DC  A 1 12  ? 8.459  27.258 -16.026 1.00 32.45  ? 12  DC  B "C1'" 1 
ATOM   233  N N1    . DC  A 1 12  ? 9.451  26.177 -16.124 1.00 28.05  ? 12  DC  B N1    1 
ATOM   234  C C2    . DC  A 1 12  ? 10.811 26.506 -16.196 1.00 25.59  ? 12  DC  B C2    1 
ATOM   235  O O2    . DC  A 1 12  ? 11.141 27.702 -16.210 1.00 28.26  ? 12  DC  B O2    1 
ATOM   236  N N3    . DC  A 1 12  ? 11.727 25.513 -16.251 1.00 23.35  ? 12  DC  B N3    1 
ATOM   237  C C4    . DC  A 1 12  ? 11.331 24.238 -16.240 1.00 21.38  ? 12  DC  B C4    1 
ATOM   238  N N4    . DC  A 1 12  ? 12.269 23.292 -16.275 1.00 25.07  ? 12  DC  B N4    1 
ATOM   239  C C5    . DC  A 1 12  ? 9.955  23.877 -16.187 1.00 25.54  ? 12  DC  B C5    1 
ATOM   240  C C6    . DC  A 1 12  ? 9.057  24.869 -16.132 1.00 25.83  ? 12  DC  B C6    1 
ATOM   241  P P     . DG  A 1 13  ? 5.144  29.539 -18.091 1.00 43.31  ? 13  DG  B P     1 
ATOM   242  O OP1   . DG  A 1 13  ? 3.937  30.306 -17.698 1.00 42.91  ? 13  DG  B OP1   1 
ATOM   243  O OP2   . DG  A 1 13  ? 4.997  28.305 -18.906 1.00 44.35  ? 13  DG  B OP2   1 
ATOM   244  O "O5'" . DG  A 1 13  ? 6.133  30.530 -18.847 1.00 43.87  ? 13  DG  B "O5'" 1 
ATOM   245  C "C5'" . DG  A 1 13  ? 6.364  30.412 -20.245 1.00 46.12  ? 13  DG  B "C5'" 1 
ATOM   246  C "C4'" . DG  A 1 13  ? 7.769  30.856 -20.573 1.00 43.39  ? 13  DG  B "C4'" 1 
ATOM   247  O "O4'" . DG  A 1 13  ? 8.704  29.963 -19.912 1.00 38.13  ? 13  DG  B "O4'" 1 
ATOM   248  C "C3'" . DG  A 1 13  ? 8.117  30.789 -22.059 1.00 45.50  ? 13  DG  B "C3'" 1 
ATOM   249  O "O3'" . DG  A 1 13  ? 9.134  31.749 -22.362 1.00 50.14  ? 13  DG  B "O3'" 1 
ATOM   250  C "C2'" . DG  A 1 13  ? 8.754  29.421 -22.185 1.00 44.01  ? 13  DG  B "C2'" 1 
ATOM   251  C "C1'" . DG  A 1 13  ? 9.536  29.355 -20.887 1.00 37.50  ? 13  DG  B "C1'" 1 
ATOM   252  N N9    . DG  A 1 13  ? 9.863  28.002 -20.447 1.00 32.49  ? 13  DG  B N9    1 
ATOM   253  C C8    . DG  A 1 13  ? 9.001  26.948 -20.256 1.00 30.75  ? 13  DG  B C8    1 
ATOM   254  N N7    . DG  A 1 13  ? 9.609  25.846 -19.907 1.00 29.75  ? 13  DG  B N7    1 
ATOM   255  C C5    . DG  A 1 13  ? 10.952 26.197 -19.854 1.00 28.41  ? 13  DG  B C5    1 
ATOM   256  C C6    . DG  A 1 13  ? 12.100 25.417 -19.542 1.00 24.45  ? 13  DG  B C6    1 
ATOM   257  O O6    . DG  A 1 13  ? 12.163 24.217 -19.252 1.00 25.10  ? 13  DG  B O6    1 
ATOM   258  N N1    . DG  A 1 13  ? 13.265 26.176 -19.599 1.00 26.10  ? 13  DG  B N1    1 
ATOM   259  C C2    . DG  A 1 13  ? 13.321 27.511 -19.921 1.00 26.64  ? 13  DG  B C2    1 
ATOM   260  N N2    . DG  A 1 13  ? 14.540 28.074 -19.919 1.00 26.57  ? 13  DG  B N2    1 
ATOM   261  N N3    . DG  A 1 13  ? 12.264 28.243 -20.222 1.00 27.30  ? 13  DG  B N3    1 
ATOM   262  C C4    . DG  A 1 13  ? 11.122 27.528 -20.170 1.00 28.37  ? 13  DG  B C4    1 
ATOM   263  N N     . SER B 2 16  ? 55.118 25.000 6.259   1.00 94.20  ? 17  SER A N     1 
ATOM   264  C CA    . SER B 2 16  ? 54.868 26.465 6.172   1.00 94.21  ? 17  SER A CA    1 
ATOM   265  C C     . SER B 2 16  ? 55.710 27.233 7.187   1.00 93.28  ? 17  SER A C     1 
ATOM   266  O O     . SER B 2 16  ? 56.511 26.645 7.916   1.00 93.68  ? 17  SER A O     1 
ATOM   267  C CB    . SER B 2 16  ? 53.383 26.761 6.391   1.00 95.07  ? 17  SER A CB    1 
ATOM   268  O OG    . SER B 2 16  ? 52.585 26.144 5.396   1.00 96.33  ? 17  SER A OG    1 
ATOM   269  N N     . GLN B 2 17  ? 55.520 28.550 7.226   1.00 92.03  ? 18  GLN A N     1 
ATOM   270  C CA    . GLN B 2 17  ? 56.254 29.424 8.136   1.00 90.43  ? 18  GLN A CA    1 
ATOM   271  C C     . GLN B 2 17  ? 56.007 29.065 9.598   1.00 87.81  ? 18  GLN A C     1 
ATOM   272  O O     . GLN B 2 17  ? 54.881 29.152 10.087  1.00 88.94  ? 18  GLN A O     1 
ATOM   273  C CB    . GLN B 2 17  ? 55.871 30.889 7.873   1.00 93.15  ? 18  GLN A CB    1 
ATOM   274  C CG    . GLN B 2 17  ? 56.674 31.937 8.655   1.00 96.92  ? 18  GLN A CG    1 
ATOM   275  C CD    . GLN B 2 17  ? 56.171 32.153 10.076  1.00 99.49  ? 18  GLN A CD    1 
ATOM   276  O OE1   . GLN B 2 17  ? 56.947 32.120 11.032  1.00 100.00 ? 18  GLN A OE1   1 
ATOM   277  N NE2   . GLN B 2 17  ? 54.868 32.378 10.220  1.00 99.92  ? 18  GLN A NE2   1 
ATOM   278  N N     . GLY B 2 18  ? 57.071 28.647 10.280  1.00 83.86  ? 19  GLY A N     1 
ATOM   279  C CA    . GLY B 2 18  ? 56.982 28.290 11.685  1.00 77.51  ? 19  GLY A CA    1 
ATOM   280  C C     . GLY B 2 18  ? 56.070 27.127 12.028  1.00 73.78  ? 19  GLY A C     1 
ATOM   281  O O     . GLY B 2 18  ? 56.197 26.031 11.476  1.00 72.13  ? 19  GLY A O     1 
ATOM   282  N N     . VAL B 2 19  ? 55.141 27.380 12.945  1.00 69.43  ? 20  VAL A N     1 
ATOM   283  C CA    . VAL B 2 19  ? 54.194 26.370 13.408  1.00 65.04  ? 20  VAL A CA    1 
ATOM   284  C C     . VAL B 2 19  ? 52.965 26.182 12.517  1.00 61.51  ? 20  VAL A C     1 
ATOM   285  O O     . VAL B 2 19  ? 52.165 25.278 12.753  1.00 60.65  ? 20  VAL A O     1 
ATOM   286  C CB    . VAL B 2 19  ? 53.720 26.672 14.851  1.00 65.68  ? 20  VAL A CB    1 
ATOM   287  C CG1   . VAL B 2 19  ? 54.899 26.636 15.811  1.00 62.89  ? 20  VAL A CG1   1 
ATOM   288  C CG2   . VAL B 2 19  ? 53.024 28.028 14.910  1.00 67.17  ? 20  VAL A CG2   1 
ATOM   289  N N     . ILE B 2 20  ? 52.820 27.024 11.498  1.00 57.90  ? 21  ILE A N     1 
ATOM   290  C CA    . ILE B 2 20  ? 51.677 26.938 10.587  1.00 54.97  ? 21  ILE A CA    1 
ATOM   291  C C     . ILE B 2 20  ? 51.639 25.591 9.857   1.00 51.32  ? 21  ILE A C     1 
ATOM   292  O O     . ILE B 2 20  ? 50.566 25.101 9.494   1.00 50.18  ? 21  ILE A O     1 
ATOM   293  C CB    . ILE B 2 20  ? 51.662 28.125 9.576   1.00 56.25  ? 21  ILE A CB    1 
ATOM   294  C CG1   . ILE B 2 20  ? 51.260 29.425 10.286  1.00 58.25  ? 21  ILE A CG1   1 
ATOM   295  C CG2   . ILE B 2 20  ? 50.661 27.871 8.453   1.00 54.98  ? 21  ILE A CG2   1 
ATOM   296  C CD1   . ILE B 2 20  ? 52.221 29.911 11.357  1.00 60.10  ? 21  ILE A CD1   1 
ATOM   297  N N     . GLY B 2 21  ? 52.811 24.988 9.673   1.00 47.84  ? 22  GLY A N     1 
ATOM   298  C CA    . GLY B 2 21  ? 52.892 23.694 9.018   1.00 43.01  ? 22  GLY A CA    1 
ATOM   299  C C     . GLY B 2 21  ? 52.472 22.581 9.964   1.00 39.82  ? 22  GLY A C     1 
ATOM   300  O O     . GLY B 2 21  ? 51.895 21.578 9.540   1.00 36.18  ? 22  GLY A O     1 
ATOM   301  N N     . ILE B 2 22  ? 52.761 22.768 11.250  1.00 36.71  ? 23  ILE A N     1 
ATOM   302  C CA    . ILE B 2 22  ? 52.416 21.794 12.284  1.00 34.99  ? 23  ILE A CA    1 
ATOM   303  C C     . ILE B 2 22  ? 50.899 21.751 12.471  1.00 33.49  ? 23  ILE A C     1 
ATOM   304  O O     . ILE B 2 22  ? 50.288 20.680 12.444  1.00 32.75  ? 23  ILE A O     1 
ATOM   305  C CB    . ILE B 2 22  ? 53.060 22.165 13.642  1.00 35.48  ? 23  ILE A CB    1 
ATOM   306  C CG1   . ILE B 2 22  ? 54.558 22.436 13.478  1.00 36.00  ? 23  ILE A CG1   1 
ATOM   307  C CG2   . ILE B 2 22  ? 52.820 21.059 14.659  1.00 35.30  ? 23  ILE A CG2   1 
ATOM   308  C CD1   . ILE B 2 22  ? 55.362 21.247 13.038  1.00 35.76  ? 23  ILE A CD1   1 
ATOM   309  N N     . PHE B 2 23  ? 50.303 22.927 12.658  1.00 31.58  ? 24  PHE A N     1 
ATOM   310  C CA    . PHE B 2 23  ? 48.861 23.055 12.853  1.00 30.68  ? 24  PHE A CA    1 
ATOM   311  C C     . PHE B 2 23  ? 48.076 22.544 11.652  1.00 29.98  ? 24  PHE A C     1 
ATOM   312  O O     . PHE B 2 23  ? 47.006 21.957 11.808  1.00 27.92  ? 24  PHE A O     1 
ATOM   313  C CB    . PHE B 2 23  ? 48.485 24.514 13.128  1.00 32.67  ? 24  PHE A CB    1 
ATOM   314  C CG    . PHE B 2 23  ? 48.758 24.962 14.537  1.00 36.51  ? 24  PHE A CG    1 
ATOM   315  C CD1   . PHE B 2 23  ? 50.056 25.007 15.032  1.00 38.26  ? 24  PHE A CD1   1 
ATOM   316  C CD2   . PHE B 2 23  ? 47.712 25.344 15.369  1.00 37.52  ? 24  PHE A CD2   1 
ATOM   317  C CE1   . PHE B 2 23  ? 50.309 25.426 16.333  1.00 38.37  ? 24  PHE A CE1   1 
ATOM   318  C CE2   . PHE B 2 23  ? 47.955 25.764 16.671  1.00 39.37  ? 24  PHE A CE2   1 
ATOM   319  C CZ    . PHE B 2 23  ? 49.258 25.805 17.154  1.00 37.39  ? 24  PHE A CZ    1 
ATOM   320  N N     . GLY B 2 24  ? 48.616 22.775 10.458  1.00 29.80  ? 25  GLY A N     1 
ATOM   321  C CA    . GLY B 2 24  ? 47.961 22.331 9.240   1.00 29.78  ? 25  GLY A CA    1 
ATOM   322  C C     . GLY B 2 24  ? 47.855 20.821 9.145   1.00 31.39  ? 25  GLY A C     1 
ATOM   323  O O     . GLY B 2 24  ? 46.829 20.292 8.712   1.00 30.64  ? 25  GLY A O     1 
ATOM   324  N N     . ASP B 2 25  ? 48.911 20.125 9.559   1.00 32.19  ? 26  ASP A N     1 
ATOM   325  C CA    . ASP B 2 25  ? 48.932 18.666 9.523   1.00 32.96  ? 26  ASP A CA    1 
ATOM   326  C C     . ASP B 2 25  ? 47.974 18.079 10.557  1.00 33.13  ? 26  ASP A C     1 
ATOM   327  O O     . ASP B 2 25  ? 47.430 16.992 10.360  1.00 33.46  ? 26  ASP A O     1 
ATOM   328  C CB    . ASP B 2 25  ? 50.352 18.141 9.754   1.00 33.24  ? 26  ASP A CB    1 
ATOM   329  C CG    . ASP B 2 25  ? 50.459 16.635 9.564   1.00 35.64  ? 26  ASP A CG    1 
ATOM   330  O OD1   . ASP B 2 25  ? 50.127 16.142 8.463   1.00 30.96  ? 26  ASP A OD1   1 
ATOM   331  O OD2   . ASP B 2 25  ? 50.872 15.945 10.518  1.00 32.57  ? 26  ASP A OD2   1 
ATOM   332  N N     . TYR B 2 26  ? 47.775 18.798 11.660  1.00 31.44  ? 27  TYR A N     1 
ATOM   333  C CA    . TYR B 2 26  ? 46.866 18.355 12.713  1.00 30.31  ? 27  TYR A CA    1 
ATOM   334  C C     . TYR B 2 26  ? 45.430 18.378 12.192  1.00 30.87  ? 27  TYR A C     1 
ATOM   335  O O     . TYR B 2 26  ? 44.657 17.454 12.442  1.00 30.86  ? 27  TYR A O     1 
ATOM   336  C CB    . TYR B 2 26  ? 46.994 19.257 13.941  1.00 31.59  ? 27  TYR A CB    1 
ATOM   337  C CG    . TYR B 2 26  ? 46.068 18.888 15.079  1.00 31.34  ? 27  TYR A CG    1 
ATOM   338  C CD1   . TYR B 2 26  ? 46.348 17.801 15.905  1.00 32.10  ? 27  TYR A CD1   1 
ATOM   339  C CD2   . TYR B 2 26  ? 44.920 19.636 15.341  1.00 31.77  ? 27  TYR A CD2   1 
ATOM   340  C CE1   . TYR B 2 26  ? 45.509 17.468 16.968  1.00 31.63  ? 27  TYR A CE1   1 
ATOM   341  C CE2   . TYR B 2 26  ? 44.074 19.310 16.399  1.00 32.96  ? 27  TYR A CE2   1 
ATOM   342  C CZ    . TYR B 2 26  ? 44.376 18.227 17.208  1.00 32.07  ? 27  TYR A CZ    1 
ATOM   343  O OH    . TYR B 2 26  ? 43.552 17.904 18.259  1.00 35.01  ? 27  TYR A OH    1 
ATOM   344  N N     . ALA B 2 27  ? 45.088 19.442 11.468  1.00 31.50  ? 28  ALA A N     1 
ATOM   345  C CA    . ALA B 2 27  ? 43.756 19.595 10.888  1.00 33.74  ? 28  ALA A CA    1 
ATOM   346  C C     . ALA B 2 27  ? 43.525 18.507 9.842   1.00 35.90  ? 28  ALA A C     1 
ATOM   347  O O     . ALA B 2 27  ? 42.425 17.966 9.728   1.00 38.30  ? 28  ALA A O     1 
ATOM   348  C CB    . ALA B 2 27  ? 43.617 20.970 10.257  1.00 32.62  ? 28  ALA A CB    1 
ATOM   349  N N     . LYS B 2 28  ? 44.576 18.198 9.085   1.00 36.70  ? 29  LYS A N     1 
ATOM   350  C CA    . LYS B 2 28  ? 44.537 17.165 8.051   1.00 39.50  ? 29  LYS A CA    1 
ATOM   351  C C     . LYS B 2 28  ? 44.271 15.788 8.665   1.00 38.63  ? 29  LYS A C     1 
ATOM   352  O O     . LYS B 2 28  ? 43.445 15.022 8.164   1.00 38.32  ? 29  LYS A O     1 
ATOM   353  C CB    . LYS B 2 28  ? 45.872 17.155 7.290   1.00 42.08  ? 29  LYS A CB    1 
ATOM   354  C CG    . LYS B 2 28  ? 46.272 15.816 6.669   1.00 46.64  ? 29  LYS A CG    1 
ATOM   355  C CD    . LYS B 2 28  ? 45.442 15.456 5.446   1.00 51.39  ? 29  LYS A CD    1 
ATOM   356  C CE    . LYS B 2 28  ? 45.837 16.285 4.241   1.00 52.11  ? 29  LYS A CE    1 
ATOM   357  N NZ    . LYS B 2 28  ? 45.103 15.844 3.024   1.00 51.89  ? 29  LYS A NZ    1 
ATOM   358  N N     . ALA B 2 29  ? 44.968 15.498 9.761   1.00 36.07  ? 30  ALA A N     1 
ATOM   359  C CA    . ALA B 2 29  ? 44.850 14.224 10.462  1.00 35.82  ? 30  ALA A CA    1 
ATOM   360  C C     . ALA B 2 29  ? 43.472 13.973 11.062  1.00 36.96  ? 30  ALA A C     1 
ATOM   361  O O     . ALA B 2 29  ? 43.022 12.829 11.133  1.00 37.01  ? 30  ALA A O     1 
ATOM   362  C CB    . ALA B 2 29  ? 45.909 14.132 11.548  1.00 31.01  ? 30  ALA A CB    1 
ATOM   363  N N     . HIS B 2 30  ? 42.802 15.040 11.489  1.00 38.18  ? 31  HIS A N     1 
ATOM   364  C CA    . HIS B 2 30  ? 41.484 14.910 12.101  1.00 40.90  ? 31  HIS A CA    1 
ATOM   365  C C     . HIS B 2 30  ? 40.311 15.310 11.213  1.00 42.14  ? 31  HIS A C     1 
ATOM   366  O O     . HIS B 2 30  ? 39.156 15.193 11.629  1.00 42.43  ? 31  HIS A O     1 
ATOM   367  C CB    . HIS B 2 30  ? 41.438 15.690 13.415  1.00 39.81  ? 31  HIS A CB    1 
ATOM   368  C CG    . HIS B 2 30  ? 42.402 15.188 14.443  1.00 42.17  ? 31  HIS A CG    1 
ATOM   369  N ND1   . HIS B 2 30  ? 42.190 14.030 15.160  1.00 43.22  ? 31  HIS A ND1   1 
ATOM   370  C CD2   . HIS B 2 30  ? 43.592 15.677 14.863  1.00 40.95  ? 31  HIS A CD2   1 
ATOM   371  C CE1   . HIS B 2 30  ? 43.209 13.826 15.976  1.00 41.28  ? 31  HIS A CE1   1 
ATOM   372  N NE2   . HIS B 2 30  ? 44.073 14.812 15.815  1.00 41.22  ? 31  HIS A NE2   1 
ATOM   373  N N     . ASP B 2 31  ? 40.606 15.767 9.996   1.00 42.10  ? 32  ASP A N     1 
ATOM   374  C CA    . ASP B 2 31  ? 39.574 16.183 9.043   1.00 43.50  ? 32  ASP A CA    1 
ATOM   375  C C     . ASP B 2 31  ? 38.582 17.126 9.735   1.00 40.32  ? 32  ASP A C     1 
ATOM   376  O O     . ASP B 2 31  ? 37.368 16.924 9.693   1.00 39.05  ? 32  ASP A O     1 
ATOM   377  C CB    . ASP B 2 31  ? 38.860 14.947 8.476   1.00 49.83  ? 32  ASP A CB    1 
ATOM   378  C CG    . ASP B 2 31  ? 37.885 15.287 7.362   1.00 59.51  ? 32  ASP A CG    1 
ATOM   379  O OD1   . ASP B 2 31  ? 38.309 15.894 6.354   1.00 63.83  ? 32  ASP A OD1   1 
ATOM   380  O OD2   . ASP B 2 31  ? 36.692 14.941 7.495   1.00 64.70  ? 32  ASP A OD2   1 
ATOM   381  N N     . LEU B 2 32  ? 39.129 18.149 10.387  1.00 37.83  ? 33  LEU A N     1 
ATOM   382  C CA    . LEU B 2 32  ? 38.343 19.130 11.130  1.00 36.35  ? 33  LEU A CA    1 
ATOM   383  C C     . LEU B 2 32  ? 37.345 19.915 10.288  1.00 36.40  ? 33  LEU A C     1 
ATOM   384  O O     . LEU B 2 32  ? 37.625 20.270 9.141   1.00 37.89  ? 33  LEU A O     1 
ATOM   385  C CB    . LEU B 2 32  ? 39.271 20.114 11.850  1.00 34.12  ? 33  LEU A CB    1 
ATOM   386  C CG    . LEU B 2 32  ? 40.292 19.559 12.847  1.00 30.41  ? 33  LEU A CG    1 
ATOM   387  C CD1   . LEU B 2 32  ? 41.124 20.701 13.401  1.00 28.98  ? 33  LEU A CD1   1 
ATOM   388  C CD2   . LEU B 2 32  ? 39.590 18.818 13.970  1.00 31.43  ? 33  LEU A CD2   1 
ATOM   389  N N     . ALA B 2 33  ? 36.181 20.185 10.876  1.00 35.56  ? 34  ALA A N     1 
ATOM   390  C CA    . ALA B 2 33  ? 35.130 20.951 10.213  1.00 32.94  ? 34  ALA A CA    1 
ATOM   391  C C     . ALA B 2 33  ? 35.540 22.423 10.200  1.00 33.25  ? 34  ALA A C     1 
ATOM   392  O O     . ALA B 2 33  ? 36.428 22.826 10.952  1.00 33.06  ? 34  ALA A O     1 
ATOM   393  C CB    . ALA B 2 33  ? 33.809 20.772 10.944  1.00 29.37  ? 34  ALA A CB    1 
ATOM   394  N N     . VAL B 2 34  ? 34.888 23.222 9.359   1.00 31.42  ? 35  VAL A N     1 
ATOM   395  C CA    . VAL B 2 34  ? 35.205 24.645 9.242   1.00 29.81  ? 35  VAL A CA    1 
ATOM   396  C C     . VAL B 2 34  ? 35.170 25.383 10.584  1.00 29.39  ? 35  VAL A C     1 
ATOM   397  O O     . VAL B 2 34  ? 35.981 26.279 10.826  1.00 30.21  ? 35  VAL A O     1 
ATOM   398  C CB    . VAL B 2 34  ? 34.278 25.349 8.212   1.00 27.98  ? 35  VAL A CB    1 
ATOM   399  C CG1   . VAL B 2 34  ? 32.838 25.372 8.704   1.00 26.13  ? 35  VAL A CG1   1 
ATOM   400  C CG2   . VAL B 2 34  ? 34.777 26.756 7.925   1.00 28.68  ? 35  VAL A CG2   1 
ATOM   401  N N     . GLY B 2 35  ? 34.251 24.980 11.459  1.00 27.95  ? 36  GLY A N     1 
ATOM   402  C CA    . GLY B 2 35  ? 34.133 25.602 12.766  1.00 26.08  ? 36  GLY A CA    1 
ATOM   403  C C     . GLY B 2 35  ? 35.321 25.277 13.649  1.00 28.19  ? 36  GLY A C     1 
ATOM   404  O O     . GLY B 2 35  ? 35.824 26.144 14.364  1.00 28.06  ? 36  GLY A O     1 
ATOM   405  N N     . GLU B 2 36  ? 35.775 24.027 13.587  1.00 28.73  ? 37  GLU A N     1 
ATOM   406  C CA    . GLU B 2 36  ? 36.917 23.574 14.378  1.00 30.22  ? 37  GLU A CA    1 
ATOM   407  C C     . GLU B 2 36  ? 38.237 24.127 13.855  1.00 29.04  ? 37  GLU A C     1 
ATOM   408  O O     . GLU B 2 36  ? 39.210 24.234 14.603  1.00 29.23  ? 37  GLU A O     1 
ATOM   409  C CB    . GLU B 2 36  ? 36.969 22.045 14.427  1.00 30.94  ? 37  GLU A CB    1 
ATOM   410  C CG    . GLU B 2 36  ? 35.803 21.409 15.168  1.00 39.88  ? 37  GLU A CG    1 
ATOM   411  C CD    . GLU B 2 36  ? 35.646 21.942 16.585  1.00 48.21  ? 37  GLU A CD    1 
ATOM   412  O OE1   . GLU B 2 36  ? 36.541 21.694 17.424  1.00 49.88  ? 37  GLU A OE1   1 
ATOM   413  O OE2   . GLU B 2 36  ? 34.627 22.614 16.857  1.00 50.19  ? 37  GLU A OE2   1 
ATOM   414  N N     . VAL B 2 37  ? 38.272 24.461 12.567  1.00 26.57  ? 38  VAL A N     1 
ATOM   415  C CA    . VAL B 2 37  ? 39.474 25.022 11.962  1.00 26.02  ? 38  VAL A CA    1 
ATOM   416  C C     . VAL B 2 37  ? 39.622 26.472 12.412  1.00 24.54  ? 38  VAL A C     1 
ATOM   417  O O     . VAL B 2 37  ? 40.736 26.961 12.579  1.00 24.28  ? 38  VAL A O     1 
ATOM   418  C CB    . VAL B 2 37  ? 39.428 24.966 10.420  1.00 27.48  ? 38  VAL A CB    1 
ATOM   419  C CG1   . VAL B 2 37  ? 40.681 25.600 9.834   1.00 24.63  ? 38  VAL A CG1   1 
ATOM   420  C CG2   . VAL B 2 37  ? 39.306 23.526 9.948   1.00 28.34  ? 38  VAL A CG2   1 
ATOM   421  N N     . SER B 2 38  ? 38.492 27.149 12.609  1.00 24.87  ? 39  SER A N     1 
ATOM   422  C CA    . SER B 2 38  ? 38.496 28.538 13.059  1.00 26.32  ? 39  SER A CA    1 
ATOM   423  C C     . SER B 2 38  ? 39.067 28.613 14.470  1.00 26.94  ? 39  SER A C     1 
ATOM   424  O O     . SER B 2 38  ? 39.734 29.584 14.829  1.00 27.92  ? 39  SER A O     1 
ATOM   425  C CB    . SER B 2 38  ? 37.082 29.119 13.039  1.00 24.45  ? 39  SER A CB    1 
ATOM   426  O OG    . SER B 2 38  ? 36.579 29.205 11.719  1.00 23.61  ? 39  SER A OG    1 
ATOM   427  N N     . LYS B 2 39  ? 38.792 27.581 15.264  1.00 27.12  ? 40  LYS A N     1 
ATOM   428  C CA    . LYS B 2 39  ? 39.292 27.503 16.631  1.00 28.69  ? 40  LYS A CA    1 
ATOM   429  C C     . LYS B 2 39  ? 40.794 27.240 16.588  1.00 29.92  ? 40  LYS A C     1 
ATOM   430  O O     . LYS B 2 39  ? 41.551 27.767 17.404  1.00 31.29  ? 40  LYS A O     1 
ATOM   431  C CB    . LYS B 2 39  ? 38.586 26.384 17.397  1.00 28.24  ? 40  LYS A CB    1 
ATOM   432  C CG    . LYS B 2 39  ? 37.117 26.650 17.676  1.00 27.45  ? 40  LYS A CG    1 
ATOM   433  C CD    . LYS B 2 39  ? 36.475 25.483 18.403  1.00 28.49  ? 40  LYS A CD    1 
ATOM   434  C CE    . LYS B 2 39  ? 35.012 25.759 18.695  1.00 32.32  ? 40  LYS A CE    1 
ATOM   435  N NZ    . LYS B 2 39  ? 34.341 24.607 19.355  1.00 36.11  ? 40  LYS A NZ    1 
ATOM   436  N N     . LEU B 2 40  ? 41.213 26.439 15.612  1.00 28.49  ? 41  LEU A N     1 
ATOM   437  C CA    . LEU B 2 40  ? 42.619 26.100 15.425  1.00 29.22  ? 41  LEU A CA    1 
ATOM   438  C C     . LEU B 2 40  ? 43.393 27.337 14.967  1.00 28.40  ? 41  LEU A C     1 
ATOM   439  O O     . LEU B 2 40  ? 44.560 27.512 15.317  1.00 28.17  ? 41  LEU A O     1 
ATOM   440  C CB    . LEU B 2 40  ? 42.751 24.989 14.382  1.00 30.10  ? 41  LEU A CB    1 
ATOM   441  C CG    . LEU B 2 40  ? 44.122 24.342 14.204  1.00 31.54  ? 41  LEU A CG    1 
ATOM   442  C CD1   . LEU B 2 40  ? 44.491 23.585 15.466  1.00 31.21  ? 41  LEU A CD1   1 
ATOM   443  C CD2   . LEU B 2 40  ? 44.097 23.400 13.012  1.00 30.29  ? 41  LEU A CD2   1 
ATOM   444  N N     . VAL B 2 41  ? 42.730 28.185 14.182  1.00 27.29  ? 42  VAL A N     1 
ATOM   445  C CA    . VAL B 2 41  ? 43.332 29.415 13.671  1.00 28.96  ? 42  VAL A CA    1 
ATOM   446  C C     . VAL B 2 41  ? 43.597 30.405 14.802  1.00 30.57  ? 42  VAL A C     1 
ATOM   447  O O     . VAL B 2 41  ? 44.667 31.008 14.861  1.00 31.03  ? 42  VAL A O     1 
ATOM   448  C CB    . VAL B 2 41  ? 42.433 30.088 12.595  1.00 28.27  ? 42  VAL A CB    1 
ATOM   449  C CG1   . VAL B 2 41  ? 42.945 31.481 12.258  1.00 28.15  ? 42  VAL A CG1   1 
ATOM   450  C CG2   . VAL B 2 41  ? 42.403 29.240 11.336  1.00 26.85  ? 42  VAL A CG2   1 
ATOM   451  N N     . LYS B 2 42  ? 42.629 30.565 15.702  1.00 32.64  ? 43  LYS A N     1 
ATOM   452  C CA    . LYS B 2 42  ? 42.793 31.491 16.818  1.00 35.62  ? 43  LYS A CA    1 
ATOM   453  C C     . LYS B 2 42  ? 43.861 30.973 17.782  1.00 34.38  ? 43  LYS A C     1 
ATOM   454  O O     . LYS B 2 42  ? 44.520 31.754 18.467  1.00 34.95  ? 43  LYS A O     1 
ATOM   455  C CB    . LYS B 2 42  ? 41.455 31.730 17.533  1.00 39.10  ? 43  LYS A CB    1 
ATOM   456  C CG    . LYS B 2 42  ? 41.176 30.848 18.737  1.00 43.79  ? 43  LYS A CG    1 
ATOM   457  C CD    . LYS B 2 42  ? 41.139 31.682 20.007  1.00 42.91  ? 43  LYS A CD    1 
ATOM   458  C CE    . LYS B 2 42  ? 40.999 30.813 21.245  1.00 47.66  ? 43  LYS A CE    1 
ATOM   459  N NZ    . LYS B 2 42  ? 42.161 29.898 21.407  1.00 51.04  ? 43  LYS A NZ    1 
ATOM   460  N N     . LYS B 2 43  ? 44.041 29.653 17.801  1.00 32.50  ? 44  LYS A N     1 
ATOM   461  C CA    . LYS B 2 43  ? 45.036 29.013 18.655  1.00 34.48  ? 44  LYS A CA    1 
ATOM   462  C C     . LYS B 2 43  ? 46.420 29.302 18.065  1.00 34.38  ? 44  LYS A C     1 
ATOM   463  O O     . LYS B 2 43  ? 47.389 29.515 18.797  1.00 35.15  ? 44  LYS A O     1 
ATOM   464  C CB    . LYS B 2 43  ? 44.781 27.501 18.710  1.00 40.14  ? 44  LYS A CB    1 
ATOM   465  C CG    . LYS B 2 43  ? 45.121 26.816 20.035  1.00 45.64  ? 44  LYS A CG    1 
ATOM   466  C CD    . LYS B 2 43  ? 46.615 26.834 20.344  1.00 53.41  ? 44  LYS A CD    1 
ATOM   467  C CE    . LYS B 2 43  ? 46.972 27.905 21.367  1.00 55.11  ? 44  LYS A CE    1 
ATOM   468  N NZ    . LYS B 2 43  ? 48.443 28.007 21.574  1.00 54.03  ? 44  LYS A NZ    1 
ATOM   469  N N     . ALA B 2 44  ? 46.499 29.325 16.737  1.00 31.39  ? 45  ALA A N     1 
ATOM   470  C CA    . ALA B 2 44  ? 47.750 29.606 16.042  1.00 29.28  ? 45  ALA A CA    1 
ATOM   471  C C     . ALA B 2 44  ? 48.076 31.094 16.128  1.00 29.90  ? 45  ALA A C     1 
ATOM   472  O O     . ALA B 2 44  ? 49.245 31.475 16.167  1.00 32.12  ? 45  ALA A O     1 
ATOM   473  C CB    . ALA B 2 44  ? 47.655 29.169 14.588  1.00 26.78  ? 45  ALA A CB    1 
ATOM   474  N N     . LEU B 2 45  ? 47.038 31.928 16.163  1.00 28.89  ? 46  LEU A N     1 
ATOM   475  C CA    . LEU B 2 45  ? 47.206 33.377 16.252  1.00 26.51  ? 46  LEU A CA    1 
ATOM   476  C C     . LEU B 2 45  ? 47.727 33.791 17.621  1.00 28.44  ? 46  LEU A C     1 
ATOM   477  O O     . LEU B 2 45  ? 48.542 34.705 17.730  1.00 28.70  ? 46  LEU A O     1 
ATOM   478  C CB    . LEU B 2 45  ? 45.884 34.096 15.972  1.00 26.03  ? 46  LEU A CB    1 
ATOM   479  C CG    . LEU B 2 45  ? 45.398 34.165 14.524  1.00 24.26  ? 46  LEU A CG    1 
ATOM   480  C CD1   . LEU B 2 45  ? 44.001 34.761 14.485  1.00 24.42  ? 46  LEU A CD1   1 
ATOM   481  C CD2   . LEU B 2 45  ? 46.363 34.990 13.682  1.00 22.94  ? 46  LEU A CD2   1 
ATOM   482  N N     . SER B 2 46  ? 47.238 33.125 18.664  1.00 31.21  ? 47  SER A N     1 
ATOM   483  C CA    . SER B 2 46  ? 47.661 33.417 20.031  1.00 35.44  ? 47  SER A CA    1 
ATOM   484  C C     . SER B 2 46  ? 49.089 32.927 20.265  1.00 37.57  ? 47  SER A C     1 
ATOM   485  O O     . SER B 2 46  ? 49.774 33.390 21.177  1.00 38.64  ? 47  SER A O     1 
ATOM   486  C CB    . SER B 2 46  ? 46.702 32.772 21.036  1.00 34.32  ? 47  SER A CB    1 
ATOM   487  O OG    . SER B 2 46  ? 46.643 31.368 20.866  1.00 40.52  ? 47  SER A OG    1 
ATOM   488  N N     . ASN B 2 47  ? 49.527 31.997 19.420  1.00 40.83  ? 48  ASN A N     1 
ATOM   489  C CA    . ASN B 2 47  ? 50.868 31.423 19.486  1.00 43.56  ? 48  ASN A CA    1 
ATOM   490  C C     . ASN B 2 47  ? 51.868 32.359 18.801  1.00 43.97  ? 48  ASN A C     1 
ATOM   491  O O     . ASN B 2 47  ? 52.975 32.573 19.300  1.00 44.08  ? 48  ASN A O     1 
ATOM   492  C CB    . ASN B 2 47  ? 50.875 30.049 18.802  1.00 48.17  ? 48  ASN A CB    1 
ATOM   493  C CG    . ASN B 2 47  ? 52.213 29.341 18.910  1.00 51.64  ? 48  ASN A CG    1 
ATOM   494  O OD1   . ASN B 2 47  ? 52.441 28.557 19.833  1.00 52.30  ? 48  ASN A OD1   1 
ATOM   495  N ND2   . ASN B 2 47  ? 53.099 29.597 17.952  1.00 50.90  ? 48  ASN A ND2   1 
ATOM   496  N N     . GLU B 2 48  ? 51.465 32.914 17.660  1.00 41.45  ? 49  GLU A N     1 
ATOM   497  C CA    . GLU B 2 48  ? 52.306 33.830 16.894  1.00 39.12  ? 49  GLU A CA    1 
ATOM   498  C C     . GLU B 2 48  ? 52.349 35.220 17.522  1.00 37.45  ? 49  GLU A C     1 
ATOM   499  O O     . GLU B 2 48  ? 53.335 35.942 17.374  1.00 37.03  ? 49  GLU A O     1 
ATOM   500  C CB    . GLU B 2 48  ? 51.801 33.936 15.454  1.00 44.24  ? 49  GLU A CB    1 
ATOM   501  C CG    . GLU B 2 48  ? 51.893 32.645 14.654  1.00 56.54  ? 49  GLU A CG    1 
ATOM   502  C CD    . GLU B 2 48  ? 53.323 32.250 14.334  1.00 63.71  ? 49  GLU A CD    1 
ATOM   503  O OE1   . GLU B 2 48  ? 53.865 32.756 13.327  1.00 65.80  ? 49  GLU A OE1   1 
ATOM   504  O OE2   . GLU B 2 48  ? 53.901 31.432 15.083  1.00 68.68  ? 49  GLU A OE2   1 
ATOM   505  N N     . TYR B 2 49  ? 51.269 35.594 18.205  1.00 36.73  ? 50  TYR A N     1 
ATOM   506  C CA    . TYR B 2 49  ? 51.168 36.897 18.866  1.00 36.60  ? 50  TYR A CA    1 
ATOM   507  C C     . TYR B 2 49  ? 50.754 36.704 20.323  1.00 33.94  ? 50  TYR A C     1 
ATOM   508  O O     . TYR B 2 49  ? 49.584 36.867 20.669  1.00 33.82  ? 50  TYR A O     1 
ATOM   509  C CB    . TYR B 2 49  ? 50.139 37.787 18.155  1.00 37.57  ? 50  TYR A CB    1 
ATOM   510  C CG    . TYR B 2 49  ? 50.373 37.937 16.669  1.00 39.39  ? 50  TYR A CG    1 
ATOM   511  C CD1   . TYR B 2 49  ? 51.281 38.874 16.177  1.00 39.41  ? 50  TYR A CD1   1 
ATOM   512  C CD2   . TYR B 2 49  ? 49.704 37.122 15.757  1.00 40.06  ? 50  TYR A CD2   1 
ATOM   513  C CE1   . TYR B 2 49  ? 51.519 38.993 14.810  1.00 43.47  ? 50  TYR A CE1   1 
ATOM   514  C CE2   . TYR B 2 49  ? 49.935 37.232 14.390  1.00 44.70  ? 50  TYR A CE2   1 
ATOM   515  C CZ    . TYR B 2 49  ? 50.843 38.168 13.923  1.00 46.03  ? 50  TYR A CZ    1 
ATOM   516  O OH    . TYR B 2 49  ? 51.078 38.270 12.571  1.00 50.30  ? 50  TYR A OH    1 
ATOM   517  N N     . PRO B 2 50  ? 51.713 36.341 21.194  1.00 33.31  ? 51  PRO A N     1 
ATOM   518  C CA    . PRO B 2 50  ? 51.481 36.113 22.626  1.00 35.15  ? 51  PRO A CA    1 
ATOM   519  C C     . PRO B 2 50  ? 51.031 37.369 23.378  1.00 35.67  ? 51  PRO A C     1 
ATOM   520  O O     . PRO B 2 50  ? 50.343 37.280 24.396  1.00 36.13  ? 51  PRO A O     1 
ATOM   521  C CB    . PRO B 2 50  ? 52.852 35.648 23.122  1.00 32.15  ? 51  PRO A CB    1 
ATOM   522  C CG    . PRO B 2 50  ? 53.473 35.033 21.907  1.00 32.06  ? 51  PRO A CG    1 
ATOM   523  C CD    . PRO B 2 50  ? 53.108 36.025 20.844  1.00 31.16  ? 51  PRO A CD    1 
ATOM   524  N N     . GLN B 2 51  ? 51.419 38.533 22.861  1.00 37.68  ? 52  GLN A N     1 
ATOM   525  C CA    . GLN B 2 51  ? 51.079 39.816 23.473  1.00 36.08  ? 52  GLN A CA    1 
ATOM   526  C C     . GLN B 2 51  ? 49.613 40.195 23.275  1.00 36.51  ? 52  GLN A C     1 
ATOM   527  O O     . GLN B 2 51  ? 49.057 40.975 24.052  1.00 36.12  ? 52  GLN A O     1 
ATOM   528  C CB    . GLN B 2 51  ? 51.967 40.932 22.907  1.00 36.85  ? 52  GLN A CB    1 
ATOM   529  C CG    . GLN B 2 51  ? 53.464 40.640 22.915  1.00 40.36  ? 52  GLN A CG    1 
ATOM   530  C CD    . GLN B 2 51  ? 53.962 40.022 21.614  1.00 42.46  ? 52  GLN A CD    1 
ATOM   531  O OE1   . GLN B 2 51  ? 53.191 39.462 20.834  1.00 40.69  ? 52  GLN A OE1   1 
ATOM   532  N NE2   . GLN B 2 51  ? 55.262 40.136 21.371  1.00 43.78  ? 52  GLN A NE2   1 
ATOM   533  N N     . LEU B 2 52  ? 48.993 39.647 22.232  1.00 34.70  ? 53  LEU A N     1 
ATOM   534  C CA    . LEU B 2 52  ? 47.596 39.939 21.921  1.00 32.99  ? 53  LEU A CA    1 
ATOM   535  C C     . LEU B 2 52  ? 46.615 38.899 22.464  1.00 32.04  ? 53  LEU A C     1 
ATOM   536  O O     . LEU B 2 52  ? 46.981 37.748 22.705  1.00 31.33  ? 53  LEU A O     1 
ATOM   537  C CB    . LEU B 2 52  ? 47.412 40.090 20.408  1.00 31.53  ? 53  LEU A CB    1 
ATOM   538  C CG    . LEU B 2 52  ? 48.289 41.130 19.703  1.00 29.59  ? 53  LEU A CG    1 
ATOM   539  C CD1   . LEU B 2 52  ? 48.005 41.117 18.209  1.00 29.14  ? 53  LEU A CD1   1 
ATOM   540  C CD2   . LEU B 2 52  ? 48.047 42.511 20.282  1.00 27.33  ? 53  LEU A CD2   1 
ATOM   541  N N     . SER B 2 53  ? 45.366 39.323 22.647  1.00 32.81  ? 54  SER A N     1 
ATOM   542  C CA    . SER B 2 53  ? 44.303 38.462 23.157  1.00 32.47  ? 54  SER A CA    1 
ATOM   543  C C     . SER B 2 53  ? 43.278 38.153 22.064  1.00 31.97  ? 54  SER A C     1 
ATOM   544  O O     . SER B 2 53  ? 42.719 39.065 21.451  1.00 28.72  ? 54  SER A O     1 
ATOM   545  C CB    . SER B 2 53  ? 43.602 39.139 24.338  1.00 33.92  ? 54  SER A CB    1 
ATOM   546  O OG    . SER B 2 53  ? 44.529 39.482 25.352  1.00 41.08  ? 54  SER A OG    1 
ATOM   547  N N     . PHE B 2 54  ? 43.033 36.864 21.836  1.00 29.76  ? 55  PHE A N     1 
ATOM   548  C CA    . PHE B 2 54  ? 42.078 36.418 20.823  1.00 27.99  ? 55  PHE A CA    1 
ATOM   549  C C     . PHE B 2 54  ? 40.938 35.609 21.441  1.00 28.45  ? 55  PHE A C     1 
ATOM   550  O O     . PHE B 2 54  ? 41.113 34.967 22.480  1.00 28.23  ? 55  PHE A O     1 
ATOM   551  C CB    . PHE B 2 54  ? 42.786 35.556 19.772  1.00 26.15  ? 55  PHE A CB    1 
ATOM   552  C CG    . PHE B 2 54  ? 43.858 36.278 19.010  1.00 26.77  ? 55  PHE A CG    1 
ATOM   553  C CD1   . PHE B 2 54  ? 45.170 36.279 19.466  1.00 27.05  ? 55  PHE A CD1   1 
ATOM   554  C CD2   . PHE B 2 54  ? 43.559 36.947 17.828  1.00 25.74  ? 55  PHE A CD2   1 
ATOM   555  C CE1   . PHE B 2 54  ? 46.170 36.936 18.756  1.00 29.77  ? 55  PHE A CE1   1 
ATOM   556  C CE2   . PHE B 2 54  ? 44.553 37.607 17.110  1.00 24.72  ? 55  PHE A CE2   1 
ATOM   557  C CZ    . PHE B 2 54  ? 45.860 37.602 17.575  1.00 27.34  ? 55  PHE A CZ    1 
ATOM   558  N N     . ARG B 2 55  ? 39.778 35.627 20.786  1.00 28.13  ? 56  ARG A N     1 
ATOM   559  C CA    . ARG B 2 55  ? 38.613 34.883 21.260  1.00 27.33  ? 56  ARG A CA    1 
ATOM   560  C C     . ARG B 2 55  ? 37.803 34.315 20.098  1.00 27.19  ? 56  ARG A C     1 
ATOM   561  O O     . ARG B 2 55  ? 37.889 34.799 18.970  1.00 25.39  ? 56  ARG A O     1 
ATOM   562  C CB    . ARG B 2 55  ? 37.708 35.768 22.126  1.00 27.65  ? 56  ARG A CB    1 
ATOM   563  C CG    . ARG B 2 55  ? 36.825 36.733 21.344  1.00 29.53  ? 56  ARG A CG    1 
ATOM   564  C CD    . ARG B 2 55  ? 35.839 37.449 22.255  1.00 28.29  ? 56  ARG A CD    1 
ATOM   565  N NE    . ARG B 2 55  ? 34.949 38.327 21.500  1.00 28.65  ? 56  ARG A NE    1 
ATOM   566  C CZ    . ARG B 2 55  ? 34.127 39.220 22.044  1.00 30.71  ? 56  ARG A CZ    1 
ATOM   567  N NH1   . ARG B 2 55  ? 34.071 39.369 23.362  1.00 27.80  ? 56  ARG A NH1   1 
ATOM   568  N NH2   . ARG B 2 55  ? 33.356 39.967 21.264  1.00 28.00  ? 56  ARG A NH2   1 
ATOM   569  N N     . TYR B 2 56  ? 37.007 33.292 20.391  1.00 27.86  ? 57  TYR A N     1 
ATOM   570  C CA    . TYR B 2 56  ? 36.170 32.651 19.387  1.00 28.88  ? 57  TYR A CA    1 
ATOM   571  C C     . TYR B 2 56  ? 34.704 32.655 19.814  1.00 31.15  ? 57  TYR A C     1 
ATOM   572  O O     . TYR B 2 56  ? 34.378 32.325 20.956  1.00 34.28  ? 57  TYR A O     1 
ATOM   573  C CB    . TYR B 2 56  ? 36.640 31.211 19.138  1.00 29.13  ? 57  TYR A CB    1 
ATOM   574  C CG    . TYR B 2 56  ? 35.739 30.422 18.210  1.00 29.43  ? 57  TYR A CG    1 
ATOM   575  C CD1   . TYR B 2 56  ? 35.886 30.500 16.826  1.00 27.69  ? 57  TYR A CD1   1 
ATOM   576  C CD2   . TYR B 2 56  ? 34.715 29.624 18.717  1.00 30.74  ? 57  TYR A CD2   1 
ATOM   577  C CE1   . TYR B 2 56  ? 35.033 29.804 15.972  1.00 27.25  ? 57  TYR A CE1   1 
ATOM   578  C CE2   . TYR B 2 56  ? 33.858 28.928 17.872  1.00 32.90  ? 57  TYR A CE2   1 
ATOM   579  C CZ    . TYR B 2 56  ? 34.021 29.022 16.503  1.00 29.44  ? 57  TYR A CZ    1 
ATOM   580  O OH    . TYR B 2 56  ? 33.168 28.339 15.670  1.00 31.10  ? 57  TYR A OH    1 
ATOM   581  N N     . ARG B 2 57  ? 33.831 33.043 18.890  1.00 30.47  ? 58  ARG A N     1 
ATOM   582  C CA    . ARG B 2 57  ? 32.393 33.080 19.134  1.00 31.06  ? 58  ARG A CA    1 
ATOM   583  C C     . ARG B 2 57  ? 31.693 32.269 18.056  1.00 31.07  ? 58  ARG A C     1 
ATOM   584  O O     . ARG B 2 57  ? 32.212 32.116 16.954  1.00 31.01  ? 58  ARG A O     1 
ATOM   585  C CB    . ARG B 2 57  ? 31.865 34.517 19.121  1.00 30.83  ? 58  ARG A CB    1 
ATOM   586  C CG    . ARG B 2 57  ? 32.299 35.347 20.313  1.00 37.40  ? 58  ARG A CG    1 
ATOM   587  C CD    . ARG B 2 57  ? 31.392 36.547 20.519  1.00 37.87  ? 58  ARG A CD    1 
ATOM   588  N NE    . ARG B 2 57  ? 31.551 37.566 19.485  1.00 39.17  ? 58  ARG A NE    1 
ATOM   589  C CZ    . ARG B 2 57  ? 30.689 38.556 19.274  1.00 39.33  ? 58  ARG A CZ    1 
ATOM   590  N NH1   . ARG B 2 57  ? 29.595 38.658 20.018  1.00 36.17  ? 58  ARG A NH1   1 
ATOM   591  N NH2   . ARG B 2 57  ? 30.935 39.463 18.339  1.00 39.81  ? 58  ARG A NH2   1 
ATOM   592  N N     . ASP B 2 58  ? 30.519 31.741 18.381  1.00 31.63  ? 59  ASP A N     1 
ATOM   593  C CA    . ASP B 2 58  ? 29.754 30.939 17.432  1.00 32.78  ? 59  ASP A CA    1 
ATOM   594  C C     . ASP B 2 58  ? 28.578 31.700 16.820  1.00 31.86  ? 59  ASP A C     1 
ATOM   595  O O     . ASP B 2 58  ? 27.946 31.221 15.877  1.00 30.64  ? 59  ASP A O     1 
ATOM   596  C CB    . ASP B 2 58  ? 29.262 29.650 18.101  1.00 38.45  ? 59  ASP A CB    1 
ATOM   597  C CG    . ASP B 2 58  ? 28.582 29.903 19.435  1.00 46.43  ? 59  ASP A CG    1 
ATOM   598  O OD1   . ASP B 2 58  ? 27.401 30.313 19.440  1.00 48.05  ? 59  ASP A OD1   1 
ATOM   599  O OD2   . ASP B 2 58  ? 29.235 29.697 20.479  1.00 55.61  ? 59  ASP A OD2   1 
ATOM   600  N N     . SER B 2 59  ? 28.297 32.889 17.349  1.00 28.40  ? 60  SER A N     1 
ATOM   601  C CA    . SER B 2 59  ? 27.193 33.703 16.855  1.00 28.75  ? 60  SER A CA    1 
ATOM   602  C C     . SER B 2 59  ? 27.279 35.160 17.297  1.00 28.19  ? 60  SER A C     1 
ATOM   603  O O     . SER B 2 59  ? 28.095 35.521 18.145  1.00 29.34  ? 60  SER A O     1 
ATOM   604  C CB    . SER B 2 59  ? 25.857 33.108 17.309  1.00 32.19  ? 60  SER A CB    1 
ATOM   605  O OG    . SER B 2 59  ? 25.796 33.005 18.721  1.00 40.19  ? 60  SER A OG    1 
ATOM   606  N N     . ILE B 2 60  ? 26.433 35.990 16.695  1.00 27.66  ? 61  ILE A N     1 
ATOM   607  C CA    . ILE B 2 60  ? 26.366 37.415 16.996  1.00 28.39  ? 61  ILE A CA    1 
ATOM   608  C C     . ILE B 2 60  ? 24.896 37.823 16.993  1.00 28.68  ? 61  ILE A C     1 
ATOM   609  O O     . ILE B 2 60  ? 24.166 37.507 16.054  1.00 27.57  ? 61  ILE A O     1 
ATOM   610  C CB    . ILE B 2 60  ? 27.118 38.259 15.931  1.00 28.84  ? 61  ILE A CB    1 
ATOM   611  C CG1   . ILE B 2 60  ? 28.608 37.911 15.926  1.00 29.62  ? 61  ILE A CG1   1 
ATOM   612  C CG2   . ILE B 2 60  ? 26.937 39.747 16.207  1.00 28.58  ? 61  ILE A CG2   1 
ATOM   613  C CD1   . ILE B 2 60  ? 29.399 38.618 14.847  1.00 33.84  ? 61  ILE A CD1   1 
ATOM   614  N N     . LYS B 2 61  ? 24.460 38.505 18.049  1.00 29.41  ? 62  LYS A N     1 
ATOM   615  C CA    . LYS B 2 61  ? 23.072 38.950 18.146  1.00 28.10  ? 62  LYS A CA    1 
ATOM   616  C C     . LYS B 2 61  ? 22.795 40.146 17.247  1.00 25.50  ? 62  LYS A C     1 
ATOM   617  O O     . LYS B 2 61  ? 23.689 40.950 16.979  1.00 25.39  ? 62  LYS A O     1 
ATOM   618  C CB    . LYS B 2 61  ? 22.710 39.317 19.587  1.00 31.01  ? 62  LYS A CB    1 
ATOM   619  C CG    . LYS B 2 61  ? 22.557 38.140 20.532  1.00 36.85  ? 62  LYS A CG    1 
ATOM   620  C CD    . LYS B 2 61  ? 21.420 38.395 21.516  1.00 48.34  ? 62  LYS A CD    1 
ATOM   621  C CE    . LYS B 2 61  ? 21.587 39.725 22.247  1.00 54.66  ? 62  LYS A CE    1 
ATOM   622  N NZ    . LYS B 2 61  ? 20.379 40.092 23.041  1.00 56.12  ? 62  LYS A NZ    1 
ATOM   623  N N     . LYS B 2 62  ? 21.549 40.267 16.798  1.00 24.67  ? 63  LYS A N     1 
ATOM   624  C CA    . LYS B 2 62  ? 21.152 41.377 15.942  1.00 28.37  ? 63  LYS A CA    1 
ATOM   625  C C     . LYS B 2 62  ? 21.249 42.698 16.709  1.00 30.57  ? 63  LYS A C     1 
ATOM   626  O O     . LYS B 2 62  ? 21.359 43.768 16.109  1.00 29.57  ? 63  LYS A O     1 
ATOM   627  C CB    . LYS B 2 62  ? 19.731 41.174 15.409  1.00 29.76  ? 63  LYS A CB    1 
ATOM   628  C CG    . LYS B 2 62  ? 19.305 42.263 14.434  1.00 40.46  ? 63  LYS A CG    1 
ATOM   629  C CD    . LYS B 2 62  ? 17.903 42.076 13.884  1.00 43.10  ? 63  LYS A CD    1 
ATOM   630  C CE    . LYS B 2 62  ? 17.517 43.277 13.030  1.00 38.20  ? 63  LYS A CE    1 
ATOM   631  N NZ    . LYS B 2 62  ? 16.126 43.209 12.514  1.00 31.94  ? 63  LYS A NZ    1 
ATOM   632  N N     . THR B 2 63  ? 21.212 42.613 18.038  1.00 30.78  ? 64  THR A N     1 
ATOM   633  C CA    . THR B 2 63  ? 21.312 43.792 18.892  1.00 31.39  ? 64  THR A CA    1 
ATOM   634  C C     . THR B 2 63  ? 22.697 44.416 18.744  1.00 28.03  ? 64  THR A C     1 
ATOM   635  O O     . THR B 2 63  ? 22.828 45.639 18.685  1.00 27.30  ? 64  THR A O     1 
ATOM   636  C CB    . THR B 2 63  ? 21.069 43.435 20.379  1.00 32.92  ? 64  THR A CB    1 
ATOM   637  O OG1   . THR B 2 63  ? 19.741 42.922 20.537  1.00 35.36  ? 64  THR A OG1   1 
ATOM   638  C CG2   . THR B 2 63  ? 21.230 44.663 21.261  1.00 38.25  ? 64  THR A CG2   1 
ATOM   639  N N     . GLU B 2 64  ? 23.720 43.565 18.672  1.00 28.65  ? 65  GLU A N     1 
ATOM   640  C CA    . GLU B 2 64  ? 25.105 44.010 18.519  1.00 29.31  ? 65  GLU A CA    1 
ATOM   641  C C     . GLU B 2 64  ? 25.317 44.702 17.178  1.00 28.33  ? 65  GLU A C     1 
ATOM   642  O O     . GLU B 2 64  ? 25.987 45.733 17.104  1.00 31.33  ? 65  GLU A O     1 
ATOM   643  C CB    . GLU B 2 64  ? 26.065 42.826 18.618  1.00 31.74  ? 65  GLU A CB    1 
ATOM   644  C CG    . GLU B 2 64  ? 26.057 42.103 19.950  1.00 37.16  ? 65  GLU A CG    1 
ATOM   645  C CD    . GLU B 2 64  ? 27.053 40.960 19.986  1.00 39.44  ? 65  GLU A CD    1 
ATOM   646  O OE1   . GLU B 2 64  ? 28.262 41.223 19.799  1.00 39.10  ? 65  GLU A OE1   1 
ATOM   647  O OE2   . GLU B 2 64  ? 26.628 39.802 20.192  1.00 36.69  ? 65  GLU A OE2   1 
ATOM   648  N N     . ILE B 2 65  ? 24.761 44.116 16.121  1.00 25.82  ? 66  ILE A N     1 
ATOM   649  C CA    . ILE B 2 65  ? 24.881 44.675 14.779  1.00 24.15  ? 66  ILE A CA    1 
ATOM   650  C C     . ILE B 2 65  ? 24.152 46.015 14.712  1.00 24.54  ? 66  ILE A C     1 
ATOM   651  O O     . ILE B 2 65  ? 24.659 46.973 14.130  1.00 26.39  ? 66  ILE A O     1 
ATOM   652  C CB    . ILE B 2 65  ? 24.319 43.706 13.709  1.00 24.19  ? 66  ILE A CB    1 
ATOM   653  C CG1   . ILE B 2 65  ? 25.065 42.370 13.768  1.00 21.49  ? 66  ILE A CG1   1 
ATOM   654  C CG2   . ILE B 2 65  ? 24.455 44.316 12.317  1.00 23.97  ? 66  ILE A CG2   1 
ATOM   655  C CD1   . ILE B 2 65  ? 24.562 41.339 12.785  1.00 21.63  ? 66  ILE A CD1   1 
ATOM   656  N N     . ASN B 2 66  ? 22.978 46.084 15.336  1.00 25.79  ? 67  ASN A N     1 
ATOM   657  C CA    . ASN B 2 66  ? 22.194 47.317 15.362  1.00 27.67  ? 67  ASN A CA    1 
ATOM   658  C C     . ASN B 2 66  ? 22.937 48.418 16.109  1.00 28.69  ? 67  ASN A C     1 
ATOM   659  O O     . ASN B 2 66  ? 22.867 49.588 15.734  1.00 29.58  ? 67  ASN A O     1 
ATOM   660  C CB    . ASN B 2 66  ? 20.832 47.083 16.019  1.00 29.43  ? 67  ASN A CB    1 
ATOM   661  C CG    . ASN B 2 66  ? 19.859 46.367 15.107  1.00 31.54  ? 67  ASN A CG    1 
ATOM   662  O OD1   . ASN B 2 66  ? 20.004 46.396 13.885  1.00 34.67  ? 67  ASN A OD1   1 
ATOM   663  N ND2   . ASN B 2 66  ? 18.862 45.718 15.696  1.00 33.20  ? 67  ASN A ND2   1 
ATOM   664  N N     . GLU B 2 67  ? 23.655 48.035 17.161  1.00 31.29  ? 68  GLU A N     1 
ATOM   665  C CA    . GLU B 2 67  ? 24.412 48.993 17.955  1.00 33.06  ? 68  GLU A CA    1 
ATOM   666  C C     . GLU B 2 67  ? 25.594 49.526 17.147  1.00 30.50  ? 68  GLU A C     1 
ATOM   667  O O     . GLU B 2 67  ? 25.911 50.711 17.215  1.00 28.14  ? 68  GLU A O     1 
ATOM   668  C CB    . GLU B 2 67  ? 24.889 48.351 19.260  1.00 41.10  ? 68  GLU A CB    1 
ATOM   669  C CG    . GLU B 2 67  ? 25.266 49.356 20.344  1.00 55.90  ? 68  GLU A CG    1 
ATOM   670  C CD    . GLU B 2 67  ? 24.115 50.282 20.716  1.00 63.93  ? 68  GLU A CD    1 
ATOM   671  O OE1   . GLU B 2 67  ? 23.058 49.778 21.158  1.00 66.59  ? 68  GLU A OE1   1 
ATOM   672  O OE2   . GLU B 2 67  ? 24.266 51.514 20.562  1.00 66.34  ? 68  GLU A OE2   1 
ATOM   673  N N     . ALA B 2 68  ? 26.222 48.651 16.364  1.00 26.61  ? 69  ALA A N     1 
ATOM   674  C CA    . ALA B 2 68  ? 27.353 49.041 15.526  1.00 26.33  ? 69  ALA A CA    1 
ATOM   675  C C     . ALA B 2 68  ? 26.887 50.004 14.433  1.00 28.05  ? 69  ALA A C     1 
ATOM   676  O O     . ALA B 2 68  ? 27.626 50.900 14.027  1.00 29.41  ? 69  ALA A O     1 
ATOM   677  C CB    . ALA B 2 68  ? 27.997 47.810 14.905  1.00 23.81  ? 69  ALA A CB    1 
ATOM   678  N N     . LEU B 2 69  ? 25.652 49.810 13.975  1.00 28.25  ? 70  LEU A N     1 
ATOM   679  C CA    . LEU B 2 69  ? 25.045 50.639 12.937  1.00 30.50  ? 70  LEU A CA    1 
ATOM   680  C C     . LEU B 2 69  ? 24.696 52.038 13.434  1.00 33.09  ? 70  LEU A C     1 
ATOM   681  O O     . LEU B 2 69  ? 24.830 53.015 12.695  1.00 32.08  ? 70  LEU A O     1 
ATOM   682  C CB    . LEU B 2 69  ? 23.784 49.957 12.402  1.00 30.34  ? 70  LEU A CB    1 
ATOM   683  C CG    . LEU B 2 69  ? 23.878 49.168 11.095  1.00 32.24  ? 70  LEU A CG    1 
ATOM   684  C CD1   . LEU B 2 69  ? 25.289 48.687 10.864  1.00 36.95  ? 70  LEU A CD1   1 
ATOM   685  C CD2   . LEU B 2 69  ? 22.897 48.005 11.124  1.00 28.47  ? 70  LEU A CD2   1 
ATOM   686  N N     . LYS B 2 70  ? 24.236 52.124 14.681  1.00 33.84  ? 71  LYS A N     1 
ATOM   687  C CA    . LYS B 2 70  ? 23.864 53.400 15.288  1.00 33.24  ? 71  LYS A CA    1 
ATOM   688  C C     . LYS B 2 70  ? 25.075 54.301 15.507  1.00 32.57  ? 71  LYS A C     1 
ATOM   689  O O     . LYS B 2 70  ? 24.957 55.527 15.475  1.00 33.89  ? 71  LYS A O     1 
ATOM   690  C CB    . LYS B 2 70  ? 23.134 53.169 16.612  1.00 32.52  ? 71  LYS A CB    1 
ATOM   691  C CG    . LYS B 2 70  ? 21.769 52.527 16.457  1.00 35.61  ? 71  LYS A CG    1 
ATOM   692  C CD    . LYS B 2 70  ? 21.139 52.228 17.803  1.00 42.43  ? 71  LYS A CD    1 
ATOM   693  C CE    . LYS B 2 70  ? 19.781 51.567 17.637  1.00 43.93  ? 71  LYS A CE    1 
ATOM   694  N NZ    . LYS B 2 70  ? 19.168 51.198 18.943  1.00 52.07  ? 71  LYS A NZ    1 
ATOM   695  N N     . LYS B 2 71  ? 26.235 53.686 15.724  1.00 34.01  ? 72  LYS A N     1 
ATOM   696  C CA    . LYS B 2 71  ? 27.482 54.419 15.938  1.00 37.90  ? 72  LYS A CA    1 
ATOM   697  C C     . LYS B 2 71  ? 27.949 55.114 14.662  1.00 38.25  ? 72  LYS A C     1 
ATOM   698  O O     . LYS B 2 71  ? 28.683 56.101 14.715  1.00 40.53  ? 72  LYS A O     1 
ATOM   699  C CB    . LYS B 2 71  ? 28.573 53.475 16.452  1.00 40.94  ? 72  LYS A CB    1 
ATOM   700  C CG    . LYS B 2 71  ? 28.654 53.351 17.973  1.00 48.15  ? 72  LYS A CG    1 
ATOM   701  C CD    . LYS B 2 71  ? 27.300 53.043 18.604  1.00 54.35  ? 72  LYS A CD    1 
ATOM   702  C CE    . LYS B 2 71  ? 27.413 52.840 20.106  1.00 56.71  ? 72  LYS A CE    1 
ATOM   703  N NZ    . LYS B 2 71  ? 28.220 51.635 20.445  1.00 59.94  ? 72  LYS A NZ    1 
ATOM   704  N N     . ILE B 2 72  ? 27.516 54.586 13.521  1.00 36.33  ? 73  ILE A N     1 
ATOM   705  C CA    . ILE B 2 72  ? 27.867 55.137 12.217  1.00 35.54  ? 73  ILE A CA    1 
ATOM   706  C C     . ILE B 2 72  ? 26.879 56.236 11.822  1.00 35.86  ? 73  ILE A C     1 
ATOM   707  O O     . ILE B 2 72  ? 27.276 57.297 11.339  1.00 36.78  ? 73  ILE A O     1 
ATOM   708  C CB    . ILE B 2 72  ? 27.873 54.025 11.147  1.00 35.68  ? 73  ILE A CB    1 
ATOM   709  C CG1   . ILE B 2 72  ? 28.881 52.945 11.541  1.00 35.67  ? 73  ILE A CG1   1 
ATOM   710  C CG2   . ILE B 2 72  ? 28.226 54.593 9.781   1.00 35.34  ? 73  ILE A CG2   1 
ATOM   711  C CD1   . ILE B 2 72  ? 28.744 51.672 10.767  1.00 34.64  ? 73  ILE A CD1   1 
ATOM   712  N N     . ASP B 2 73  ? 25.595 55.974 12.052  1.00 35.35  ? 74  ASP A N     1 
ATOM   713  C CA    . ASP B 2 73  ? 24.528 56.919 11.739  1.00 35.79  ? 74  ASP A CA    1 
ATOM   714  C C     . ASP B 2 73  ? 23.337 56.575 12.631  1.00 35.95  ? 74  ASP A C     1 
ATOM   715  O O     . ASP B 2 73  ? 22.939 55.416 12.720  1.00 35.92  ? 74  ASP A O     1 
ATOM   716  C CB    . ASP B 2 73  ? 24.138 56.801 10.259  1.00 41.49  ? 74  ASP A CB    1 
ATOM   717  C CG    . ASP B 2 73  ? 23.275 57.959 9.778   1.00 45.92  ? 74  ASP A CG    1 
ATOM   718  O OD1   . ASP B 2 73  ? 22.112 58.073 10.220  1.00 46.46  ? 74  ASP A OD1   1 
ATOM   719  O OD2   . ASP B 2 73  ? 23.758 58.752 8.942   1.00 49.33  ? 74  ASP A OD2   1 
ATOM   720  N N     . PRO B 2 74  ? 22.767 57.582 13.317  1.00 38.12  ? 75  PRO A N     1 
ATOM   721  C CA    . PRO B 2 74  ? 21.620 57.438 14.222  1.00 38.07  ? 75  PRO A CA    1 
ATOM   722  C C     . PRO B 2 74  ? 20.363 56.820 13.610  1.00 37.42  ? 75  PRO A C     1 
ATOM   723  O O     . PRO B 2 74  ? 19.552 56.233 14.323  1.00 39.95  ? 75  PRO A O     1 
ATOM   724  C CB    . PRO B 2 74  ? 21.363 58.876 14.671  1.00 38.01  ? 75  PRO A CB    1 
ATOM   725  C CG    . PRO B 2 74  ? 22.731 59.476 14.654  1.00 39.35  ? 75  PRO A CG    1 
ATOM   726  C CD    . PRO B 2 74  ? 23.274 58.965 13.344  1.00 39.02  ? 75  PRO A CD    1 
ATOM   727  N N     . ASP B 2 75  ? 20.196 56.963 12.298  1.00 36.33  ? 76  ASP A N     1 
ATOM   728  C CA    . ASP B 2 75  ? 19.027 56.421 11.605  1.00 37.02  ? 76  ASP A CA    1 
ATOM   729  C C     . ASP B 2 75  ? 19.166 54.935 11.266  1.00 34.51  ? 76  ASP A C     1 
ATOM   730  O O     . ASP B 2 75  ? 18.189 54.282 10.895  1.00 32.80  ? 76  ASP A O     1 
ATOM   731  C CB    . ASP B 2 75  ? 18.757 57.210 10.318  1.00 43.25  ? 76  ASP A CB    1 
ATOM   732  C CG    . ASP B 2 75  ? 18.613 58.706 10.557  1.00 49.77  ? 76  ASP A CG    1 
ATOM   733  O OD1   . ASP B 2 75  ? 18.239 59.116 11.678  1.00 49.71  ? 76  ASP A OD1   1 
ATOM   734  O OD2   . ASP B 2 75  ? 18.872 59.474 9.607   1.00 53.93  ? 76  ASP A OD2   1 
ATOM   735  N N     . LEU B 2 76  ? 20.382 54.410 11.393  1.00 30.05  ? 77  LEU A N     1 
ATOM   736  C CA    . LEU B 2 76  ? 20.662 53.009 11.092  1.00 28.88  ? 77  LEU A CA    1 
ATOM   737  C C     . LEU B 2 76  ? 20.465 52.087 12.296  1.00 28.03  ? 77  LEU A C     1 
ATOM   738  O O     . LEU B 2 76  ? 20.546 52.526 13.441  1.00 30.80  ? 77  LEU A O     1 
ATOM   739  C CB    . LEU B 2 76  ? 22.087 52.868 10.543  1.00 26.02  ? 77  LEU A CB    1 
ATOM   740  C CG    . LEU B 2 76  ? 22.359 53.196 9.067   1.00 24.48  ? 77  LEU A CG    1 
ATOM   741  C CD1   . LEU B 2 76  ? 21.654 54.463 8.623   1.00 22.43  ? 77  LEU A CD1   1 
ATOM   742  C CD2   . LEU B 2 76  ? 23.859 53.312 8.845   1.00 21.26  ? 77  LEU A CD2   1 
ATOM   743  N N     . GLY B 2 77  ? 20.189 50.812 12.018  1.00 27.43  ? 78  GLY A N     1 
ATOM   744  C CA    . GLY B 2 77  ? 19.986 49.822 13.065  1.00 26.09  ? 78  GLY A CA    1 
ATOM   745  C C     . GLY B 2 77  ? 18.804 50.103 13.977  1.00 29.31  ? 78  GLY A C     1 
ATOM   746  O O     . GLY B 2 77  ? 18.867 49.840 15.179  1.00 29.92  ? 78  GLY A O     1 
ATOM   747  N N     . GLY B 2 78  ? 17.716 50.607 13.404  1.00 28.51  ? 79  GLY A N     1 
ATOM   748  C CA    . GLY B 2 78  ? 16.542 50.926 14.196  1.00 31.09  ? 79  GLY A CA    1 
ATOM   749  C C     . GLY B 2 78  ? 15.443 49.879 14.245  1.00 32.17  ? 79  GLY A C     1 
ATOM   750  O O     . GLY B 2 78  ? 14.462 50.059 14.968  1.00 35.86  ? 79  GLY A O     1 
ATOM   751  N N     . THR B 2 79  ? 15.587 48.795 13.487  1.00 29.30  ? 80  THR A N     1 
ATOM   752  C CA    . THR B 2 79  ? 14.571 47.745 13.473  1.00 27.20  ? 80  THR A CA    1 
ATOM   753  C C     . THR B 2 79  ? 15.002 46.461 14.175  1.00 27.42  ? 80  THR A C     1 
ATOM   754  O O     . THR B 2 79  ? 16.160 46.055 14.101  1.00 28.05  ? 80  THR A O     1 
ATOM   755  C CB    . THR B 2 79  ? 14.126 47.400 12.040  1.00 27.33  ? 80  THR A CB    1 
ATOM   756  O OG1   . THR B 2 79  ? 15.269 47.043 11.255  1.00 29.38  ? 80  THR A OG1   1 
ATOM   757  C CG2   . THR B 2 79  ? 13.419 48.583 11.401  1.00 27.53  ? 80  THR A CG2   1 
ATOM   758  N N     . LEU B 2 80  ? 14.045 45.829 14.848  1.00 27.04  ? 81  LEU A N     1 
ATOM   759  C CA    . LEU B 2 80  ? 14.264 44.584 15.580  1.00 28.29  ? 81  LEU A CA    1 
ATOM   760  C C     . LEU B 2 80  ? 12.891 44.045 15.975  1.00 30.16  ? 81  LEU A C     1 
ATOM   761  O O     . LEU B 2 80  ? 12.297 44.494 16.956  1.00 33.29  ? 81  LEU A O     1 
ATOM   762  C CB    . LEU B 2 80  ? 15.113 44.842 16.831  1.00 28.62  ? 81  LEU A CB    1 
ATOM   763  C CG    . LEU B 2 80  ? 15.467 43.645 17.718  1.00 32.43  ? 81  LEU A CG    1 
ATOM   764  C CD1   . LEU B 2 80  ? 16.330 42.662 16.952  1.00 33.16  ? 81  LEU A CD1   1 
ATOM   765  C CD2   . LEU B 2 80  ? 16.193 44.124 18.963  1.00 35.70  ? 81  LEU A CD2   1 
ATOM   766  N N     . PHE B 2 81  ? 12.381 43.101 15.188  1.00 30.11  ? 82  PHE A N     1 
ATOM   767  C CA    . PHE B 2 81  ? 11.067 42.510 15.431  1.00 30.18  ? 82  PHE A CA    1 
ATOM   768  C C     . PHE B 2 81  ? 11.099 41.367 16.435  1.00 29.50  ? 82  PHE A C     1 
ATOM   769  O O     . PHE B 2 81  ? 10.161 41.188 17.211  1.00 28.43  ? 82  PHE A O     1 
ATOM   770  C CB    . PHE B 2 81  ? 10.447 42.062 14.107  1.00 29.91  ? 82  PHE A CB    1 
ATOM   771  C CG    . PHE B 2 81  ? 10.307 43.175 13.116  1.00 30.58  ? 82  PHE A CG    1 
ATOM   772  C CD1   . PHE B 2 81  ? 11.369 43.517 12.285  1.00 31.98  ? 82  PHE A CD1   1 
ATOM   773  C CD2   . PHE B 2 81  ? 9.140  43.927 13.057  1.00 28.72  ? 82  PHE A CD2   1 
ATOM   774  C CE1   . PHE B 2 81  ? 11.272 44.596 11.410  1.00 32.75  ? 82  PHE A CE1   1 
ATOM   775  C CE2   . PHE B 2 81  ? 9.032  45.008 12.186  1.00 29.43  ? 82  PHE A CE2   1 
ATOM   776  C CZ    . PHE B 2 81  ? 10.102 45.343 11.363  1.00 32.30  ? 82  PHE A CZ    1 
ATOM   777  N N     . VAL B 2 82  ? 12.171 40.584 16.395  1.00 29.03  ? 83  VAL A N     1 
ATOM   778  C CA    . VAL B 2 82  ? 12.362 39.470 17.317  1.00 27.76  ? 83  VAL A CA    1 
ATOM   779  C C     . VAL B 2 82  ? 13.594 39.835 18.141  1.00 29.76  ? 83  VAL A C     1 
ATOM   780  O O     . VAL B 2 82  ? 14.715 39.837 17.630  1.00 31.36  ? 83  VAL A O     1 
ATOM   781  C CB    . VAL B 2 82  ? 12.588 38.141 16.560  1.00 25.51  ? 83  VAL A CB    1 
ATOM   782  C CG1   . VAL B 2 82  ? 12.893 37.016 17.536  1.00 25.70  ? 83  VAL A CG1   1 
ATOM   783  C CG2   . VAL B 2 82  ? 11.362 37.801 15.732  1.00 22.43  ? 83  VAL A CG2   1 
ATOM   784  N N     . SER B 2 83  ? 13.371 40.178 19.406  1.00 30.97  ? 84  SER A N     1 
ATOM   785  C CA    . SER B 2 83  ? 14.441 40.593 20.315  1.00 32.34  ? 84  SER A CA    1 
ATOM   786  C C     . SER B 2 83  ? 15.665 39.687 20.416  1.00 31.14  ? 84  SER A C     1 
ATOM   787  O O     . SER B 2 83  ? 16.785 40.176 20.563  1.00 30.45  ? 84  SER A O     1 
ATOM   788  C CB    . SER B 2 83  ? 13.875 40.846 21.715  1.00 34.84  ? 84  SER A CB    1 
ATOM   789  O OG    . SER B 2 83  ? 12.991 41.953 21.712  1.00 38.13  ? 84  SER A OG    1 
ATOM   790  N N     . ASN B 2 84  ? 15.453 38.377 20.331  1.00 31.31  ? 85  ASN A N     1 
ATOM   791  C CA    . ASN B 2 84  ? 16.544 37.411 20.433  1.00 34.14  ? 85  ASN A CA    1 
ATOM   792  C C     . ASN B 2 84  ? 17.094 36.958 19.077  1.00 30.51  ? 85  ASN A C     1 
ATOM   793  O O     . ASN B 2 84  ? 17.652 35.866 18.964  1.00 29.76  ? 85  ASN A O     1 
ATOM   794  C CB    . ASN B 2 84  ? 16.087 36.190 21.239  1.00 42.56  ? 85  ASN A CB    1 
ATOM   795  C CG    . ASN B 2 84  ? 15.429 36.569 22.552  1.00 52.20  ? 85  ASN A CG    1 
ATOM   796  O OD1   . ASN B 2 84  ? 14.273 36.994 22.579  1.00 60.69  ? 85  ASN A OD1   1 
ATOM   797  N ND2   . ASN B 2 84  ? 16.162 36.416 23.649  1.00 52.94  ? 85  ASN A ND2   1 
ATOM   798  N N     . SER B 2 85  ? 16.940 37.797 18.056  1.00 27.15  ? 86  SER A N     1 
ATOM   799  C CA    . SER B 2 85  ? 17.428 37.476 16.715  1.00 26.09  ? 86  SER A CA    1 
ATOM   800  C C     . SER B 2 85  ? 18.948 37.417 16.654  1.00 24.51  ? 86  SER A C     1 
ATOM   801  O O     . SER B 2 85  ? 19.631 38.161 17.354  1.00 23.73  ? 86  SER A O     1 
ATOM   802  C CB    . SER B 2 85  ? 16.924 38.503 15.704  1.00 24.88  ? 86  SER A CB    1 
ATOM   803  O OG    . SER B 2 85  ? 15.539 38.348 15.482  1.00 37.14  ? 86  SER A OG    1 
ATOM   804  N N     . SER B 2 86  ? 19.471 36.536 15.803  1.00 24.84  ? 87  SER A N     1 
ATOM   805  C CA    . SER B 2 86  ? 20.915 36.392 15.652  1.00 27.80  ? 87  SER A CA    1 
ATOM   806  C C     . SER B 2 86  ? 21.325 35.610 14.404  1.00 27.39  ? 87  SER A C     1 
ATOM   807  O O     . SER B 2 86  ? 20.488 35.018 13.717  1.00 24.77  ? 87  SER A O     1 
ATOM   808  C CB    . SER B 2 86  ? 21.515 35.710 16.887  1.00 27.59  ? 87  SER A CB    1 
ATOM   809  O OG    . SER B 2 86  ? 21.071 34.369 17.004  1.00 28.14  ? 87  SER A OG    1 
ATOM   810  N N     . ILE B 2 87  ? 22.620 35.658 14.100  1.00 28.03  ? 88  ILE A N     1 
ATOM   811  C CA    . ILE B 2 87  ? 23.180 34.931 12.968  1.00 28.75  ? 88  ILE A CA    1 
ATOM   812  C C     . ILE B 2 87  ? 24.216 33.971 13.537  1.00 28.54  ? 88  ILE A C     1 
ATOM   813  O O     . ILE B 2 87  ? 24.918 34.298 14.494  1.00 29.35  ? 88  ILE A O     1 
ATOM   814  C CB    . ILE B 2 87  ? 23.843 35.865 11.923  1.00 27.73  ? 88  ILE A CB    1 
ATOM   815  C CG1   . ILE B 2 87  ? 25.018 36.628 12.541  1.00 26.72  ? 88  ILE A CG1   1 
ATOM   816  C CG2   . ILE B 2 87  ? 22.809 36.821 11.346  1.00 26.95  ? 88  ILE A CG2   1 
ATOM   817  C CD1   . ILE B 2 87  ? 25.829 37.415 11.534  1.00 29.70  ? 88  ILE A CD1   1 
ATOM   818  N N     . LYS B 2 88  ? 24.297 32.782 12.958  1.00 28.75  ? 89  LYS A N     1 
ATOM   819  C CA    . LYS B 2 88  ? 25.232 31.777 13.433  1.00 30.79  ? 89  LYS A CA    1 
ATOM   820  C C     . LYS B 2 88  ? 26.018 31.121 12.302  1.00 29.29  ? 89  LYS A C     1 
ATOM   821  O O     . LYS B 2 88  ? 25.599 30.105 11.748  1.00 29.19  ? 89  LYS A O     1 
ATOM   822  C CB    . LYS B 2 88  ? 24.472 30.725 14.254  1.00 34.66  ? 89  LYS A CB    1 
ATOM   823  C CG    . LYS B 2 88  ? 25.311 29.560 14.754  1.00 41.26  ? 89  LYS A CG    1 
ATOM   824  C CD    . LYS B 2 88  ? 24.490 28.635 15.643  1.00 47.49  ? 89  LYS A CD    1 
ATOM   825  C CE    . LYS B 2 88  ? 25.131 27.257 15.767  1.00 50.08  ? 89  LYS A CE    1 
ATOM   826  N NZ    . LYS B 2 88  ? 26.540 27.308 16.245  1.00 51.10  ? 89  LYS A NZ    1 
ATOM   827  N N     . PRO B 2 89  ? 27.152 31.729 11.911  1.00 28.91  ? 90  PRO A N     1 
ATOM   828  C CA    . PRO B 2 89  ? 27.995 31.188 10.840  1.00 28.04  ? 90  PRO A CA    1 
ATOM   829  C C     . PRO B 2 89  ? 28.545 29.847 11.308  1.00 26.55  ? 90  PRO A C     1 
ATOM   830  O O     . PRO B 2 89  ? 29.081 29.756 12.411  1.00 26.22  ? 90  PRO A O     1 
ATOM   831  C CB    . PRO B 2 89  ? 29.116 32.224 10.737  1.00 27.61  ? 90  PRO A CB    1 
ATOM   832  C CG    . PRO B 2 89  ? 28.458 33.487 11.180  1.00 29.48  ? 90  PRO A CG    1 
ATOM   833  C CD    . PRO B 2 89  ? 27.668 33.029 12.372  1.00 28.17  ? 90  PRO A CD    1 
ATOM   834  N N     . ASP B 2 90  ? 28.412 28.809 10.485  1.00 28.15  ? 91  ASP A N     1 
ATOM   835  C CA    . ASP B 2 90  ? 28.898 27.483 10.863  1.00 31.38  ? 91  ASP A CA    1 
ATOM   836  C C     . ASP B 2 90  ? 30.403 27.430 11.129  1.00 28.22  ? 91  ASP A C     1 
ATOM   837  O O     . ASP B 2 90  ? 30.905 26.469 11.712  1.00 28.62  ? 91  ASP A O     1 
ATOM   838  C CB    . ASP B 2 90  ? 28.479 26.419 9.832   1.00 38.93  ? 91  ASP A CB    1 
ATOM   839  C CG    . ASP B 2 90  ? 29.092 26.639 8.454   1.00 43.25  ? 91  ASP A CG    1 
ATOM   840  O OD1   . ASP B 2 90  ? 29.679 27.711 8.202   1.00 46.22  ? 91  ASP A OD1   1 
ATOM   841  O OD2   . ASP B 2 90  ? 28.976 25.723 7.613   1.00 43.47  ? 91  ASP A OD2   1 
ATOM   842  N N     . GLY B 2 91  ? 31.111 28.475 10.708  1.00 26.93  ? 92  GLY A N     1 
ATOM   843  C CA    . GLY B 2 91  ? 32.544 28.549 10.923  1.00 26.10  ? 92  GLY A CA    1 
ATOM   844  C C     . GLY B 2 91  ? 32.893 29.381 12.144  1.00 24.98  ? 92  GLY A C     1 
ATOM   845  O O     . GLY B 2 91  ? 34.006 29.299 12.659  1.00 28.00  ? 92  GLY A O     1 
ATOM   846  N N     . GLY B 2 92  ? 31.943 30.191 12.602  1.00 25.35  ? 93  GLY A N     1 
ATOM   847  C CA    . GLY B 2 92  ? 32.176 31.026 13.766  1.00 23.10  ? 93  GLY A CA    1 
ATOM   848  C C     . GLY B 2 92  ? 32.854 32.347 13.454  1.00 23.64  ? 93  GLY A C     1 
ATOM   849  O O     . GLY B 2 92  ? 32.984 32.733 12.292  1.00 22.67  ? 93  GLY A O     1 
ATOM   850  N N     . ILE B 2 93  ? 33.284 33.042 14.504  1.00 21.75  ? 94  ILE A N     1 
ATOM   851  C CA    . ILE B 2 93  ? 33.946 34.336 14.379  1.00 23.35  ? 94  ILE A CA    1 
ATOM   852  C C     . ILE B 2 93  ? 35.160 34.394 15.309  1.00 24.39  ? 94  ILE A C     1 
ATOM   853  O O     . ILE B 2 93  ? 35.108 33.904 16.435  1.00 25.87  ? 94  ILE A O     1 
ATOM   854  C CB    . ILE B 2 93  ? 32.994 35.511 14.773  1.00 24.08  ? 94  ILE A CB    1 
ATOM   855  C CG1   . ILE B 2 93  ? 31.704 35.481 13.947  1.00 24.80  ? 94  ILE A CG1   1 
ATOM   856  C CG2   . ILE B 2 93  ? 33.683 36.852 14.581  1.00 22.10  ? 94  ILE A CG2   1 
ATOM   857  C CD1   . ILE B 2 93  ? 30.597 34.640 14.556  1.00 26.78  ? 94  ILE A CD1   1 
ATOM   858  N N     . VAL B 2 94  ? 36.257 34.967 14.821  1.00 24.36  ? 95  VAL A N     1 
ATOM   859  C CA    . VAL B 2 94  ? 37.476 35.123 15.612  1.00 23.70  ? 95  VAL A CA    1 
ATOM   860  C C     . VAL B 2 94  ? 37.696 36.627 15.770  1.00 25.46  ? 95  VAL A C     1 
ATOM   861  O O     . VAL B 2 94  ? 37.472 37.384 14.829  1.00 25.30  ? 95  VAL A O     1 
ATOM   862  C CB    . VAL B 2 94  ? 38.704 34.497 14.911  1.00 23.57  ? 95  VAL A CB    1 
ATOM   863  C CG1   . VAL B 2 94  ? 39.944 34.652 15.782  1.00 20.77  ? 95  VAL A CG1   1 
ATOM   864  C CG2   . VAL B 2 94  ? 38.450 33.026 14.609  1.00 21.96  ? 95  VAL A CG2   1 
ATOM   865  N N     . GLU B 2 95  ? 38.110 37.058 16.959  1.00 27.16  ? 96  GLU A N     1 
ATOM   866  C CA    . GLU B 2 95  ? 38.330 38.479 17.226  1.00 25.92  ? 96  GLU A CA    1 
ATOM   867  C C     . GLU B 2 95  ? 39.592 38.738 18.041  1.00 25.45  ? 96  GLU A C     1 
ATOM   868  O O     . GLU B 2 95  ? 40.121 37.838 18.693  1.00 24.00  ? 96  GLU A O     1 
ATOM   869  C CB    . GLU B 2 95  ? 37.126 39.064 17.970  1.00 30.07  ? 96  GLU A CB    1 
ATOM   870  C CG    . GLU B 2 95  ? 35.824 39.040 17.186  1.00 35.31  ? 96  GLU A CG    1 
ATOM   871  C CD    . GLU B 2 95  ? 34.602 39.047 18.083  1.00 41.33  ? 96  GLU A CD    1 
ATOM   872  O OE1   . GLU B 2 95  ? 34.302 37.990 18.676  1.00 42.62  ? 96  GLU A OE1   1 
ATOM   873  O OE2   . GLU B 2 95  ? 33.941 40.100 18.194  1.00 41.98  ? 96  GLU A OE2   1 
ATOM   874  N N     . VAL B 2 96  ? 40.062 39.981 17.994  1.00 24.41  ? 97  VAL A N     1 
ATOM   875  C CA    . VAL B 2 96  ? 41.251 40.404 18.727  1.00 24.10  ? 97  VAL A CA    1 
ATOM   876  C C     . VAL B 2 96  ? 40.939 41.720 19.441  1.00 24.33  ? 97  VAL A C     1 
ATOM   877  O O     . VAL B 2 96  ? 40.248 42.581 18.901  1.00 25.97  ? 97  VAL A O     1 
ATOM   878  C CB    . VAL B 2 96  ? 42.474 40.588 17.781  1.00 22.26  ? 97  VAL A CB    1 
ATOM   879  C CG1   . VAL B 2 96  ? 42.256 41.757 16.831  1.00 20.22  ? 97  VAL A CG1   1 
ATOM   880  C CG2   . VAL B 2 96  ? 43.748 40.782 18.589  1.00 20.77  ? 97  VAL A CG2   1 
ATOM   881  N N     . LYS B 2 97  ? 41.416 41.856 20.670  1.00 25.39  ? 98  LYS A N     1 
ATOM   882  C CA    . LYS B 2 97  ? 41.182 43.068 21.445  1.00 27.94  ? 98  LYS A CA    1 
ATOM   883  C C     . LYS B 2 97  ? 42.195 44.141 21.053  1.00 27.45  ? 98  LYS A C     1 
ATOM   884  O O     . LYS B 2 97  ? 43.389 43.870 20.974  1.00 29.20  ? 98  LYS A O     1 
ATOM   885  C CB    . LYS B 2 97  ? 41.269 42.743 22.940  1.00 31.65  ? 98  LYS A CB    1 
ATOM   886  C CG    . LYS B 2 97  ? 40.983 43.909 23.875  1.00 39.26  ? 98  LYS A CG    1 
ATOM   887  C CD    . LYS B 2 97  ? 40.466 43.428 25.231  1.00 44.09  ? 98  LYS A CD    1 
ATOM   888  C CE    . LYS B 2 97  ? 41.415 42.441 25.902  1.00 47.01  ? 98  LYS A CE    1 
ATOM   889  N NZ    . LYS B 2 97  ? 42.739 43.039 26.229  1.00 53.64  ? 98  LYS A NZ    1 
ATOM   890  N N     . ASP B 2 98  ? 41.716 45.344 20.752  1.00 24.56  ? 99  ASP A N     1 
ATOM   891  C CA    . ASP B 2 98  ? 42.612 46.430 20.371  1.00 29.05  ? 99  ASP A CA    1 
ATOM   892  C C     . ASP B 2 98  ? 43.140 47.191 21.590  1.00 33.24  ? 99  ASP A C     1 
ATOM   893  O O     . ASP B 2 98  ? 42.879 46.803 22.730  1.00 33.96  ? 99  ASP A O     1 
ATOM   894  C CB    . ASP B 2 98  ? 41.939 47.377 19.360  1.00 28.74  ? 99  ASP A CB    1 
ATOM   895  C CG    . ASP B 2 98  ? 40.731 48.118 19.930  1.00 30.93  ? 99  ASP A CG    1 
ATOM   896  O OD1   . ASP B 2 98  ? 40.424 47.976 21.130  1.00 35.02  ? 99  ASP A OD1   1 
ATOM   897  O OD2   . ASP B 2 98  ? 40.081 48.858 19.162  1.00 29.76  ? 99  ASP A OD2   1 
ATOM   898  N N     . ASP B 2 99  ? 43.872 48.274 21.344  1.00 34.66  ? 100 ASP A N     1 
ATOM   899  C CA    . ASP B 2 99  ? 44.445 49.087 22.417  1.00 36.53  ? 100 ASP A CA    1 
ATOM   900  C C     . ASP B 2 99  ? 43.392 49.849 23.222  1.00 37.15  ? 100 ASP A C     1 
ATOM   901  O O     . ASP B 2 99  ? 43.670 50.318 24.326  1.00 38.06  ? 100 ASP A O     1 
ATOM   902  C CB    . ASP B 2 99  ? 45.463 50.081 21.846  1.00 36.13  ? 100 ASP A CB    1 
ATOM   903  C CG    . ASP B 2 99  ? 46.640 49.400 21.163  1.00 36.87  ? 100 ASP A CG    1 
ATOM   904  O OD1   . ASP B 2 99  ? 46.966 48.243 21.510  1.00 32.88  ? 100 ASP A OD1   1 
ATOM   905  O OD2   . ASP B 2 99  ? 47.250 50.037 20.277  1.00 35.63  ? 100 ASP A OD2   1 
ATOM   906  N N     . TYR B 2 100 ? 42.191 49.973 22.664  1.00 36.92  ? 101 TYR A N     1 
ATOM   907  C CA    . TYR B 2 100 ? 41.102 50.685 23.324  1.00 35.29  ? 101 TYR A CA    1 
ATOM   908  C C     . TYR B 2 100 ? 40.186 49.752 24.115  1.00 34.63  ? 101 TYR A C     1 
ATOM   909  O O     . TYR B 2 100 ? 39.201 50.198 24.704  1.00 36.06  ? 101 TYR A O     1 
ATOM   910  C CB    . TYR B 2 100 ? 40.279 51.460 22.292  1.00 39.36  ? 101 TYR A CB    1 
ATOM   911  C CG    . TYR B 2 100 ? 41.091 52.400 21.429  1.00 44.11  ? 101 TYR A CG    1 
ATOM   912  C CD1   . TYR B 2 100 ? 41.755 51.937 20.293  1.00 47.58  ? 101 TYR A CD1   1 
ATOM   913  C CD2   . TYR B 2 100 ? 41.183 53.755 21.738  1.00 47.45  ? 101 TYR A CD2   1 
ATOM   914  C CE1   . TYR B 2 100 ? 42.489 52.800 19.485  1.00 48.70  ? 101 TYR A CE1   1 
ATOM   915  C CE2   . TYR B 2 100 ? 41.915 54.628 20.935  1.00 49.92  ? 101 TYR A CE2   1 
ATOM   916  C CZ    . TYR B 2 100 ? 42.564 54.143 19.810  1.00 49.53  ? 101 TYR A CZ    1 
ATOM   917  O OH    . TYR B 2 100 ? 43.276 55.003 19.007  1.00 54.87  ? 101 TYR A OH    1 
ATOM   918  N N     . GLY B 2 101 ? 40.506 48.461 24.114  1.00 33.04  ? 102 GLY A N     1 
ATOM   919  C CA    . GLY B 2 101 ? 39.702 47.492 24.839  1.00 33.41  ? 102 GLY A CA    1 
ATOM   920  C C     . GLY B 2 101 ? 38.552 46.885 24.052  1.00 33.69  ? 102 GLY A C     1 
ATOM   921  O O     . GLY B 2 101 ? 37.849 46.011 24.557  1.00 35.15  ? 102 GLY A O     1 
ATOM   922  N N     . GLU B 2 102 ? 38.349 47.356 22.824  1.00 33.69  ? 103 GLU A N     1 
ATOM   923  C CA    . GLU B 2 102 ? 37.282 46.857 21.960  1.00 33.87  ? 103 GLU A CA    1 
ATOM   924  C C     . GLU B 2 102 ? 37.703 45.648 21.129  1.00 32.60  ? 103 GLU A C     1 
ATOM   925  O O     . GLU B 2 102 ? 38.835 45.573 20.654  1.00 31.36  ? 103 GLU A O     1 
ATOM   926  C CB    . GLU B 2 102 ? 36.797 47.969 21.029  1.00 37.65  ? 103 GLU A CB    1 
ATOM   927  C CG    . GLU B 2 102 ? 35.371 48.431 21.293  1.00 49.20  ? 103 GLU A CG    1 
ATOM   928  C CD    . GLU B 2 102 ? 35.167 48.946 22.706  1.00 53.25  ? 103 GLU A CD    1 
ATOM   929  O OE1   . GLU B 2 102 ? 35.877 49.894 23.107  1.00 56.76  ? 103 GLU A OE1   1 
ATOM   930  O OE2   . GLU B 2 102 ? 34.292 48.404 23.414  1.00 57.36  ? 103 GLU A OE2   1 
ATOM   931  N N     . TRP B 2 103 ? 36.782 44.705 20.954  1.00 32.09  ? 104 TRP A N     1 
ATOM   932  C CA    . TRP B 2 103 ? 37.052 43.507 20.168  1.00 30.55  ? 104 TRP A CA    1 
ATOM   933  C C     . TRP B 2 103 ? 36.785 43.758 18.688  1.00 30.08  ? 104 TRP A C     1 
ATOM   934  O O     . TRP B 2 103 ? 35.687 44.166 18.303  1.00 28.74  ? 104 TRP A O     1 
ATOM   935  C CB    . TRP B 2 103 ? 36.212 42.331 20.668  1.00 29.66  ? 104 TRP A CB    1 
ATOM   936  C CG    . TRP B 2 103 ? 36.593 41.870 22.043  1.00 31.18  ? 104 TRP A CG    1 
ATOM   937  C CD1   . TRP B 2 103 ? 36.083 42.317 23.229  1.00 30.27  ? 104 TRP A CD1   1 
ATOM   938  C CD2   . TRP B 2 103 ? 37.563 40.868 22.375  1.00 31.30  ? 104 TRP A CD2   1 
ATOM   939  N NE1   . TRP B 2 103 ? 36.675 41.655 24.277  1.00 31.01  ? 104 TRP A NE1   1 
ATOM   940  C CE2   . TRP B 2 103 ? 37.586 40.761 23.783  1.00 30.83  ? 104 TRP A CE2   1 
ATOM   941  C CE3   . TRP B 2 103 ? 38.414 40.051 21.619  1.00 30.61  ? 104 TRP A CE3   1 
ATOM   942  C CZ2   . TRP B 2 103 ? 38.429 39.867 24.453  1.00 29.73  ? 104 TRP A CZ2   1 
ATOM   943  C CZ3   . TRP B 2 103 ? 39.253 39.161 22.287  1.00 30.26  ? 104 TRP A CZ3   1 
ATOM   944  C CH2   . TRP B 2 103 ? 39.252 39.078 23.691  1.00 31.72  ? 104 TRP A CH2   1 
ATOM   945  N N     . ARG B 2 104 ? 37.810 43.525 17.873  1.00 29.42  ? 105 ARG A N     1 
ATOM   946  C CA    . ARG B 2 104 ? 37.741 43.719 16.429  1.00 27.22  ? 105 ARG A CA    1 
ATOM   947  C C     . ARG B 2 104 ? 37.753 42.358 15.741  1.00 26.55  ? 105 ARG A C     1 
ATOM   948  O O     . ARG B 2 104 ? 38.621 41.528 16.014  1.00 23.46  ? 105 ARG A O     1 
ATOM   949  C CB    . ARG B 2 104 ? 38.945 44.539 15.955  1.00 25.65  ? 105 ARG A CB    1 
ATOM   950  C CG    . ARG B 2 104 ? 39.277 45.741 16.831  1.00 21.76  ? 105 ARG A CG    1 
ATOM   951  C CD    . ARG B 2 104 ? 38.230 46.843 16.726  1.00 22.48  ? 105 ARG A CD    1 
ATOM   952  N NE    . ARG B 2 104 ? 38.351 47.610 15.487  1.00 24.98  ? 105 ARG A NE    1 
ATOM   953  C CZ    . ARG B 2 104 ? 39.343 48.455 15.223  1.00 28.44  ? 105 ARG A CZ    1 
ATOM   954  N NH1   . ARG B 2 104 ? 40.314 48.649 16.107  1.00 30.01  ? 105 ARG A NH1   1 
ATOM   955  N NH2   . ARG B 2 104 ? 39.362 49.120 14.076  1.00 29.56  ? 105 ARG A NH2   1 
ATOM   956  N N     . VAL B 2 105 ? 36.793 42.130 14.849  1.00 25.76  ? 106 VAL A N     1 
ATOM   957  C CA    . VAL B 2 105 ? 36.709 40.859 14.136  1.00 25.33  ? 106 VAL A CA    1 
ATOM   958  C C     . VAL B 2 105 ? 37.856 40.631 13.147  1.00 25.32  ? 106 VAL A C     1 
ATOM   959  O O     . VAL B 2 105 ? 38.172 41.481 12.310  1.00 23.05  ? 106 VAL A O     1 
ATOM   960  C CB    . VAL B 2 105 ? 35.314 40.653 13.474  1.00 25.45  ? 106 VAL A CB    1 
ATOM   961  C CG1   . VAL B 2 105 ? 34.816 41.935 12.872  1.00 30.61  ? 106 VAL A CG1   1 
ATOM   962  C CG2   . VAL B 2 105 ? 35.368 39.553 12.418  1.00 23.36  ? 106 VAL A CG2   1 
ATOM   963  N N     . VAL B 2 106 ? 38.497 39.478 13.302  1.00 24.23  ? 107 VAL A N     1 
ATOM   964  C CA    . VAL B 2 106 ? 39.629 39.069 12.483  1.00 27.41  ? 107 VAL A CA    1 
ATOM   965  C C     . VAL B 2 106 ? 39.248 38.022 11.431  1.00 26.38  ? 107 VAL A C     1 
ATOM   966  O O     . VAL B 2 106 ? 39.871 37.954 10.369  1.00 25.75  ? 107 VAL A O     1 
ATOM   967  C CB    . VAL B 2 106 ? 40.756 38.497 13.382  1.00 28.44  ? 107 VAL A CB    1 
ATOM   968  C CG1   . VAL B 2 106 ? 41.928 38.028 12.551  1.00 34.35  ? 107 VAL A CG1   1 
ATOM   969  C CG2   . VAL B 2 106 ? 41.214 39.545 14.368  1.00 30.36  ? 107 VAL A CG2   1 
ATOM   970  N N     . LEU B 2 107 ? 38.216 37.229 11.717  1.00 24.26  ? 108 LEU A N     1 
ATOM   971  C CA    . LEU B 2 107 ? 37.784 36.179 10.794  1.00 22.60  ? 108 LEU A CA    1 
ATOM   972  C C     . LEU B 2 107 ? 36.337 35.724 10.971  1.00 24.00  ? 108 LEU A C     1 
ATOM   973  O O     . LEU B 2 107 ? 35.818 35.680 12.084  1.00 23.90  ? 108 LEU A O     1 
ATOM   974  C CB    . LEU B 2 107 ? 38.700 34.959 10.940  1.00 21.91  ? 108 LEU A CB    1 
ATOM   975  C CG    . LEU B 2 107 ? 38.427 33.732 10.064  1.00 24.28  ? 108 LEU A CG    1 
ATOM   976  C CD1   . LEU B 2 107 ? 38.773 34.048 8.620   1.00 25.34  ? 108 LEU A CD1   1 
ATOM   977  C CD2   . LEU B 2 107 ? 39.246 32.550 10.557  1.00 24.69  ? 108 LEU A CD2   1 
ATOM   978  N N     . VAL B 2 108 ? 35.698 35.395 9.850   1.00 25.03  ? 109 VAL A N     1 
ATOM   979  C CA    . VAL B 2 108 ? 34.325 34.886 9.820   1.00 23.34  ? 109 VAL A CA    1 
ATOM   980  C C     . VAL B 2 108 ? 34.289 33.844 8.700   1.00 24.82  ? 109 VAL A C     1 
ATOM   981  O O     . VAL B 2 108 ? 34.393 34.185 7.523   1.00 24.59  ? 109 VAL A O     1 
ATOM   982  C CB    . VAL B 2 108 ? 33.275 35.991 9.526   1.00 22.21  ? 109 VAL A CB    1 
ATOM   983  C CG1   . VAL B 2 108 ? 31.881 35.379 9.462   1.00 18.84  ? 109 VAL A CG1   1 
ATOM   984  C CG2   . VAL B 2 108 ? 33.308 37.066 10.603  1.00 20.15  ? 109 VAL A CG2   1 
ATOM   985  N N     . ALA B 2 109 ? 34.180 32.573 9.076   1.00 25.87  ? 110 ALA A N     1 
ATOM   986  C CA    . ALA B 2 109 ? 34.158 31.484 8.107   1.00 22.98  ? 110 ALA A CA    1 
ATOM   987  C C     . ALA B 2 109 ? 32.778 30.870 7.904   1.00 23.31  ? 110 ALA A C     1 
ATOM   988  O O     . ALA B 2 109 ? 31.930 30.903 8.793   1.00 26.14  ? 110 ALA A O     1 
ATOM   989  C CB    . ALA B 2 109 ? 35.155 30.411 8.509   1.00 20.33  ? 110 ALA A CB    1 
ATOM   990  N N     . GLU B 2 110 ? 32.579 30.285 6.728   1.00 24.49  ? 111 GLU A N     1 
ATOM   991  C CA    . GLU B 2 110 ? 31.318 29.652 6.364   1.00 26.25  ? 111 GLU A CA    1 
ATOM   992  C C     . GLU B 2 110 ? 31.596 28.609 5.281   1.00 25.64  ? 111 GLU A C     1 
ATOM   993  O O     . GLU B 2 110 ? 32.443 28.820 4.415   1.00 23.20  ? 111 GLU A O     1 
ATOM   994  C CB    . GLU B 2 110 ? 30.341 30.703 5.829   1.00 27.83  ? 111 GLU A CB    1 
ATOM   995  C CG    . GLU B 2 110 ? 28.911 30.219 5.646   1.00 34.30  ? 111 GLU A CG    1 
ATOM   996  C CD    . GLU B 2 110 ? 28.047 30.442 6.875   1.00 39.17  ? 111 GLU A CD    1 
ATOM   997  O OE1   . GLU B 2 110 ? 27.876 31.613 7.281   1.00 41.33  ? 111 GLU A OE1   1 
ATOM   998  O OE2   . GLU B 2 110 ? 27.522 29.451 7.425   1.00 42.66  ? 111 GLU A OE2   1 
ATOM   999  N N     . ALA B 2 111 ? 30.896 27.480 5.343   1.00 25.42  ? 112 ALA A N     1 
ATOM   1000 C CA    . ALA B 2 111 ? 31.067 26.411 4.363   1.00 25.07  ? 112 ALA A CA    1 
ATOM   1001 C C     . ALA B 2 111 ? 29.706 25.893 3.916   1.00 27.13  ? 112 ALA A C     1 
ATOM   1002 O O     . ALA B 2 111 ? 28.891 25.480 4.740   1.00 29.39  ? 112 ALA A O     1 
ATOM   1003 C CB    . ALA B 2 111 ? 31.895 25.283 4.952   1.00 22.54  ? 112 ALA A CB    1 
ATOM   1004 N N     . LYS B 2 112 ? 29.462 25.931 2.609   1.00 27.24  ? 113 LYS A N     1 
ATOM   1005 C CA    . LYS B 2 112 ? 28.194 25.477 2.045   1.00 28.08  ? 113 LYS A CA    1 
ATOM   1006 C C     . LYS B 2 112 ? 28.359 24.300 1.084   1.00 26.05  ? 113 LYS A C     1 
ATOM   1007 O O     . LYS B 2 112 ? 29.446 24.060 0.554   1.00 23.72  ? 113 LYS A O     1 
ATOM   1008 C CB    . LYS B 2 112 ? 27.482 26.635 1.335   1.00 30.37  ? 113 LYS A CB    1 
ATOM   1009 C CG    . LYS B 2 112 ? 27.082 27.794 2.247   1.00 35.41  ? 113 LYS A CG    1 
ATOM   1010 C CD    . LYS B 2 112 ? 26.130 27.339 3.348   1.00 38.00  ? 113 LYS A CD    1 
ATOM   1011 C CE    . LYS B 2 112 ? 25.664 28.503 4.215   1.00 38.39  ? 113 LYS A CE    1 
ATOM   1012 N NZ    . LYS B 2 112 ? 24.820 29.468 3.457   1.00 38.67  ? 113 LYS A NZ    1 
ATOM   1013 N N     . HIS B 2 113 ? 27.268 23.567 0.877   1.00 25.24  ? 114 HIS A N     1 
ATOM   1014 C CA    . HIS B 2 113 ? 27.259 22.406 -0.009  1.00 28.52  ? 114 HIS A CA    1 
ATOM   1015 C C     . HIS B 2 113 ? 26.009 22.437 -0.884  1.00 26.49  ? 114 HIS A C     1 
ATOM   1016 O O     . HIS B 2 113 ? 24.950 22.893 -0.448  1.00 27.59  ? 114 HIS A O     1 
ATOM   1017 C CB    . HIS B 2 113 ? 27.239 21.101 0.801   1.00 35.83  ? 114 HIS A CB    1 
ATOM   1018 C CG    . HIS B 2 113 ? 28.275 21.030 1.881   1.00 47.18  ? 114 HIS A CG    1 
ATOM   1019 N ND1   . HIS B 2 113 ? 29.521 20.477 1.684   1.00 51.30  ? 114 HIS A ND1   1 
ATOM   1020 C CD2   . HIS B 2 113 ? 28.241 21.426 3.176   1.00 51.70  ? 114 HIS A CD2   1 
ATOM   1021 C CE1   . HIS B 2 113 ? 30.211 20.534 2.809   1.00 53.96  ? 114 HIS A CE1   1 
ATOM   1022 N NE2   . HIS B 2 113 ? 29.456 21.105 3.730   1.00 53.84  ? 114 HIS A NE2   1 
ATOM   1023 N N     . GLN B 2 114 ? 26.139 21.951 -2.115  1.00 26.13  ? 115 GLN A N     1 
ATOM   1024 C CA    . GLN B 2 114 ? 25.015 21.885 -3.046  1.00 24.00  ? 115 GLN A CA    1 
ATOM   1025 C C     . GLN B 2 114 ? 25.402 21.084 -4.286  1.00 23.78  ? 115 GLN A C     1 
ATOM   1026 O O     . GLN B 2 114 ? 26.474 21.287 -4.860  1.00 23.26  ? 115 GLN A O     1 
ATOM   1027 C CB    . GLN B 2 114 ? 24.530 23.285 -3.446  1.00 21.94  ? 115 GLN A CB    1 
ATOM   1028 C CG    . GLN B 2 114 ? 23.128 23.288 -4.054  1.00 19.44  ? 115 GLN A CG    1 
ATOM   1029 C CD    . GLN B 2 114 ? 22.635 24.674 -4.422  1.00 22.44  ? 115 GLN A CD    1 
ATOM   1030 O OE1   . GLN B 2 114 ? 22.370 25.503 -3.553  1.00 21.51  ? 115 GLN A OE1   1 
ATOM   1031 N NE2   . GLN B 2 114 ? 22.492 24.926 -5.718  1.00 23.61  ? 115 GLN A NE2   1 
ATOM   1032 N N     . GLY B 2 115 ? 24.525 20.164 -4.677  1.00 23.89  ? 116 GLY A N     1 
ATOM   1033 C CA    . GLY B 2 115 ? 24.771 19.332 -5.840  1.00 28.83  ? 116 GLY A CA    1 
ATOM   1034 C C     . GLY B 2 115 ? 25.348 17.977 -5.478  1.00 31.09  ? 116 GLY A C     1 
ATOM   1035 O O     . GLY B 2 115 ? 26.537 17.859 -5.187  1.00 33.56  ? 116 GLY A O     1 
ATOM   1036 N N     . LYS B 2 116 ? 24.507 16.951 -5.492  1.00 33.00  ? 117 LYS A N     1 
ATOM   1037 C CA    . LYS B 2 116 ? 24.951 15.603 -5.160  1.00 37.35  ? 117 LYS A CA    1 
ATOM   1038 C C     . LYS B 2 116 ? 24.952 14.675 -6.373  1.00 37.87  ? 117 LYS A C     1 
ATOM   1039 O O     . LYS B 2 116 ? 24.732 13.469 -6.251  1.00 39.06  ? 117 LYS A O     1 
ATOM   1040 C CB    . LYS B 2 116 ? 24.101 15.026 -4.021  1.00 37.74  ? 117 LYS A CB    1 
ATOM   1041 C CG    . LYS B 2 116 ? 22.602 15.146 -4.215  1.00 38.65  ? 117 LYS A CG    1 
ATOM   1042 C CD    . LYS B 2 116 ? 21.864 14.570 -3.026  1.00 40.99  ? 117 LYS A CD    1 
ATOM   1043 C CE    . LYS B 2 116 ? 20.363 14.661 -3.212  1.00 45.58  ? 117 LYS A CE    1 
ATOM   1044 N NZ    . LYS B 2 116 ? 19.631 14.006 -2.091  1.00 52.70  ? 117 LYS A NZ    1 
ATOM   1045 N N     . ASP B 2 117 ? 25.245 15.245 -7.538  1.00 39.33  ? 118 ASP A N     1 
ATOM   1046 C CA    . ASP B 2 117 ? 25.285 14.491 -8.787  1.00 38.97  ? 118 ASP A CA    1 
ATOM   1047 C C     . ASP B 2 117 ? 26.449 13.511 -8.838  1.00 39.62  ? 118 ASP A C     1 
ATOM   1048 O O     . ASP B 2 117 ? 26.308 12.413 -9.370  1.00 40.82  ? 118 ASP A O     1 
ATOM   1049 C CB    . ASP B 2 117 ? 25.360 15.443 -9.981  1.00 38.21  ? 118 ASP A CB    1 
ATOM   1050 C CG    . ASP B 2 117 ? 24.222 16.439 -10.000 1.00 38.22  ? 118 ASP A CG    1 
ATOM   1051 O OD1   . ASP B 2 117 ? 23.073 16.027 -10.260 1.00 35.82  ? 118 ASP A OD1   1 
ATOM   1052 O OD2   . ASP B 2 117 ? 24.474 17.633 -9.741  1.00 41.93  ? 118 ASP A OD2   1 
ATOM   1053 N N     . ILE B 2 118 ? 27.594 13.906 -8.284  1.00 38.83  ? 119 ILE A N     1 
ATOM   1054 C CA    . ILE B 2 118 ? 28.776 13.045 -8.272  1.00 40.12  ? 119 ILE A CA    1 
ATOM   1055 C C     . ILE B 2 118 ? 28.461 11.748 -7.537  1.00 41.84  ? 119 ILE A C     1 
ATOM   1056 O O     . ILE B 2 118 ? 28.799 10.662 -8.005  1.00 41.25  ? 119 ILE A O     1 
ATOM   1057 C CB    . ILE B 2 118 ? 29.984 13.726 -7.579  1.00 41.12  ? 119 ILE A CB    1 
ATOM   1058 C CG1   . ILE B 2 118 ? 30.286 15.076 -8.232  1.00 38.87  ? 119 ILE A CG1   1 
ATOM   1059 C CG2   . ILE B 2 118 ? 31.215 12.827 -7.653  1.00 41.69  ? 119 ILE A CG2   1 
ATOM   1060 C CD1   . ILE B 2 118 ? 30.573 14.993 -9.705  1.00 39.61  ? 119 ILE A CD1   1 
ATOM   1061 N N     . ILE B 2 119 ? 27.782 11.876 -6.400  1.00 43.57  ? 120 ILE A N     1 
ATOM   1062 C CA    . ILE B 2 119 ? 27.401 10.732 -5.577  1.00 45.66  ? 120 ILE A CA    1 
ATOM   1063 C C     . ILE B 2 119 ? 26.378 9.848  -6.289  1.00 46.13  ? 120 ILE A C     1 
ATOM   1064 O O     . ILE B 2 119 ? 26.498 8.624  -6.285  1.00 46.73  ? 120 ILE A O     1 
ATOM   1065 C CB    . ILE B 2 119 ? 26.817 11.196 -4.221  1.00 46.95  ? 120 ILE A CB    1 
ATOM   1066 C CG1   . ILE B 2 119 ? 27.829 12.088 -3.495  1.00 48.82  ? 120 ILE A CG1   1 
ATOM   1067 C CG2   . ILE B 2 119 ? 26.458 9.993  -3.358  1.00 44.33  ? 120 ILE A CG2   1 
ATOM   1068 C CD1   . ILE B 2 119 ? 27.313 12.690 -2.201  1.00 51.36  ? 120 ILE A CD1   1 
ATOM   1069 N N     . ASN B 2 120 ? 25.379 10.474 -6.905  1.00 47.73  ? 121 ASN A N     1 
ATOM   1070 C CA    . ASN B 2 120 ? 24.337 9.742  -7.621  1.00 48.02  ? 121 ASN A CA    1 
ATOM   1071 C C     . ASN B 2 120 ? 24.899 8.947  -8.795  1.00 48.40  ? 121 ASN A C     1 
ATOM   1072 O O     . ASN B 2 120 ? 24.421 7.854  -9.092  1.00 48.03  ? 121 ASN A O     1 
ATOM   1073 C CB    . ASN B 2 120 ? 23.250 10.700 -8.121  1.00 48.32  ? 121 ASN A CB    1 
ATOM   1074 C CG    . ASN B 2 120 ? 22.481 11.358 -6.989  1.00 49.65  ? 121 ASN A CG    1 
ATOM   1075 O OD1   . ASN B 2 120 ? 22.202 10.734 -5.965  1.00 51.22  ? 121 ASN A OD1   1 
ATOM   1076 N ND2   . ASN B 2 120 ? 22.132 12.627 -7.172  1.00 49.48  ? 121 ASN A ND2   1 
ATOM   1077 N N     . ILE B 2 121 ? 25.913 9.501  -9.456  1.00 49.62  ? 122 ILE A N     1 
ATOM   1078 C CA    . ILE B 2 121 ? 26.534 8.840  -10.601 1.00 49.46  ? 122 ILE A CA    1 
ATOM   1079 C C     . ILE B 2 121 ? 27.484 7.730  -10.161 1.00 51.33  ? 122 ILE A C     1 
ATOM   1080 O O     . ILE B 2 121 ? 27.630 6.732  -10.865 1.00 52.82  ? 122 ILE A O     1 
ATOM   1081 C CB    . ILE B 2 121 ? 27.269 9.844  -11.519 1.00 45.44  ? 122 ILE A CB    1 
ATOM   1082 C CG1   . ILE B 2 121 ? 26.294 10.919 -12.004 1.00 42.97  ? 122 ILE A CG1   1 
ATOM   1083 C CG2   . ILE B 2 121 ? 27.837 9.124  -12.734 1.00 44.36  ? 122 ILE A CG2   1 
ATOM   1084 C CD1   . ILE B 2 121 ? 26.953 12.046 -12.765 1.00 43.57  ? 122 ILE A CD1   1 
ATOM   1085 N N     . ARG B 2 122 ? 28.120 7.898  -9.001  1.00 53.79  ? 123 ARG A N     1 
ATOM   1086 C CA    . ARG B 2 122 ? 29.025 6.875  -8.469  1.00 54.74  ? 123 ARG A CA    1 
ATOM   1087 C C     . ARG B 2 122 ? 28.193 5.616  -8.254  1.00 55.38  ? 123 ARG A C     1 
ATOM   1088 O O     . ARG B 2 122 ? 28.692 4.496  -8.355  1.00 55.26  ? 123 ARG A O     1 
ATOM   1089 C CB    . ARG B 2 122 ? 29.637 7.316  -7.135  1.00 56.02  ? 123 ARG A CB    1 
ATOM   1090 C CG    . ARG B 2 122 ? 30.663 8.435  -7.232  1.00 56.56  ? 123 ARG A CG    1 
ATOM   1091 C CD    . ARG B 2 122 ? 31.900 8.006  -7.998  1.00 58.82  ? 123 ARG A CD    1 
ATOM   1092 N NE    . ARG B 2 122 ? 32.911 9.060  -8.020  1.00 64.95  ? 123 ARG A NE    1 
ATOM   1093 C CZ    . ARG B 2 122 ? 33.989 9.053  -8.800  1.00 68.94  ? 123 ARG A CZ    1 
ATOM   1094 N NH1   . ARG B 2 122 ? 34.208 8.045  -9.635  1.00 71.47  ? 123 ARG A NH1   1 
ATOM   1095 N NH2   . ARG B 2 122 ? 34.850 10.061 -8.747  1.00 68.58  ? 123 ARG A NH2   1 
ATOM   1096 N N     . ASN B 2 123 ? 26.918 5.828  -7.938  1.00 57.51  ? 124 ASN A N     1 
ATOM   1097 C CA    . ASN B 2 123 ? 25.962 4.748  -7.731  1.00 60.10  ? 124 ASN A CA    1 
ATOM   1098 C C     . ASN B 2 123 ? 25.100 4.686  -8.993  1.00 61.62  ? 124 ASN A C     1 
ATOM   1099 O O     . ASN B 2 123 ? 25.271 5.494  -9.908  1.00 62.57  ? 124 ASN A O     1 
ATOM   1100 C CB    . ASN B 2 123 ? 25.080 5.046  -6.513  1.00 59.68  ? 124 ASN A CB    1 
ATOM   1101 C CG    . ASN B 2 123 ? 25.888 5.380  -5.264  1.00 61.28  ? 124 ASN A CG    1 
ATOM   1102 O OD1   . ASN B 2 123 ? 25.434 6.139  -4.408  1.00 60.49  ? 124 ASN A OD1   1 
ATOM   1103 N ND2   . ASN B 2 123 ? 27.087 4.813  -5.154  1.00 60.40  ? 124 ASN A ND2   1 
ATOM   1104 N N     . GLY B 2 124 ? 24.185 3.727  -9.054  1.00 63.07  ? 125 GLY A N     1 
ATOM   1105 C CA    . GLY B 2 124 ? 23.328 3.616  -10.221 1.00 64.18  ? 125 GLY A CA    1 
ATOM   1106 C C     . GLY B 2 124 ? 22.017 4.360  -10.050 1.00 63.31  ? 125 GLY A C     1 
ATOM   1107 O O     . GLY B 2 124 ? 21.000 3.966  -10.621 1.00 65.24  ? 125 GLY A O     1 
ATOM   1108 N N     . LEU B 2 125 ? 22.045 5.447  -9.283  1.00 61.18  ? 126 LEU A N     1 
ATOM   1109 C CA    . LEU B 2 125 ? 20.847 6.238  -9.021  1.00 59.23  ? 126 LEU A CA    1 
ATOM   1110 C C     . LEU B 2 125 ? 20.445 7.235  -10.099 1.00 57.52  ? 126 LEU A C     1 
ATOM   1111 O O     . LEU B 2 125 ? 21.188 8.168  -10.415 1.00 56.48  ? 126 LEU A O     1 
ATOM   1112 C CB    . LEU B 2 125 ? 20.967 6.962  -7.679  1.00 59.51  ? 126 LEU A CB    1 
ATOM   1113 C CG    . LEU B 2 125 ? 20.186 6.352  -6.515  1.00 60.96  ? 126 LEU A CG    1 
ATOM   1114 C CD1   . LEU B 2 125 ? 20.439 7.152  -5.248  1.00 62.49  ? 126 LEU A CD1   1 
ATOM   1115 C CD2   . LEU B 2 125 ? 18.699 6.332  -6.844  1.00 60.43  ? 126 LEU A CD2   1 
ATOM   1116 N N     . LEU B 2 126 ? 19.259 7.020  -10.659 1.00 54.47  ? 127 LEU A N     1 
ATOM   1117 C CA    . LEU B 2 126 ? 18.706 7.903  -11.677 1.00 52.39  ? 127 LEU A CA    1 
ATOM   1118 C C     . LEU B 2 126 ? 17.694 8.797  -10.972 1.00 51.08  ? 127 LEU A C     1 
ATOM   1119 O O     . LEU B 2 126 ? 16.746 8.306  -10.355 1.00 50.88  ? 127 LEU A O     1 
ATOM   1120 C CB    . LEU B 2 126 ? 18.010 7.107  -12.787 1.00 53.05  ? 127 LEU A CB    1 
ATOM   1121 C CG    . LEU B 2 126 ? 18.850 6.354  -13.825 1.00 52.98  ? 127 LEU A CG    1 
ATOM   1122 C CD1   . LEU B 2 126 ? 19.787 7.323  -14.524 1.00 51.85  ? 127 LEU A CD1   1 
ATOM   1123 C CD2   . LEU B 2 126 ? 19.631 5.224  -13.177 1.00 55.32  ? 127 LEU A CD2   1 
ATOM   1124 N N     . VAL B 2 127 ? 17.919 10.105 -11.036 1.00 48.87  ? 128 VAL A N     1 
ATOM   1125 C CA    . VAL B 2 127 ? 17.032 11.070 -10.393 1.00 44.67  ? 128 VAL A CA    1 
ATOM   1126 C C     . VAL B 2 127 ? 15.943 11.588 -11.332 1.00 43.91  ? 128 VAL A C     1 
ATOM   1127 O O     . VAL B 2 127 ? 15.839 11.151 -12.478 1.00 43.95  ? 128 VAL A O     1 
ATOM   1128 C CB    . VAL B 2 127 ? 17.828 12.266 -9.825  1.00 41.45  ? 128 VAL A CB    1 
ATOM   1129 C CG1   . VAL B 2 127 ? 18.827 11.782 -8.787  1.00 38.56  ? 128 VAL A CG1   1 
ATOM   1130 C CG2   . VAL B 2 127 ? 18.538 13.008 -10.943 1.00 41.21  ? 128 VAL A CG2   1 
ATOM   1131 N N     . GLY B 2 128 ? 15.131 12.517 -10.833 1.00 42.46  ? 129 GLY A N     1 
ATOM   1132 C CA    . GLY B 2 128 ? 14.065 13.080 -11.638 1.00 42.49  ? 129 GLY A CA    1 
ATOM   1133 C C     . GLY B 2 128 ? 12.692 12.571 -11.254 1.00 43.93  ? 129 GLY A C     1 
ATOM   1134 O O     . GLY B 2 128 ? 12.562 11.565 -10.555 1.00 44.24  ? 129 GLY A O     1 
ATOM   1135 N N     . LYS B 2 129 ? 11.663 13.266 -11.732 1.00 45.58  ? 130 LYS A N     1 
ATOM   1136 C CA    . LYS B 2 129 ? 10.272 12.908 -11.452 1.00 50.34  ? 130 LYS A CA    1 
ATOM   1137 C C     . LYS B 2 129 ? 9.877  11.568 -12.068 1.00 52.66  ? 130 LYS A C     1 
ATOM   1138 O O     . LYS B 2 129 ? 8.879  10.965 -11.672 1.00 51.36  ? 130 LYS A O     1 
ATOM   1139 C CB    . LYS B 2 129 ? 9.308  14.013 -11.921 1.00 50.22  ? 130 LYS A CB    1 
ATOM   1140 C CG    . LYS B 2 129 ? 9.803  14.864 -13.087 1.00 55.77  ? 130 LYS A CG    1 
ATOM   1141 C CD    . LYS B 2 129 ? 10.739 15.974 -12.603 1.00 57.95  ? 130 LYS A CD    1 
ATOM   1142 C CE    . LYS B 2 129 ? 11.515 16.613 -13.746 1.00 58.39  ? 130 LYS A CE    1 
ATOM   1143 N NZ    . LYS B 2 129 ? 10.648 17.317 -14.732 1.00 57.46  ? 130 LYS A NZ    1 
ATOM   1144 N N     . ARG B 2 130 ? 10.669 11.109 -13.032 1.00 57.13  ? 131 ARG A N     1 
ATOM   1145 C CA    . ARG B 2 130 ? 10.420 9.837  -13.701 1.00 61.82  ? 131 ARG A CA    1 
ATOM   1146 C C     . ARG B 2 130 ? 11.490 8.801  -13.358 1.00 61.11  ? 131 ARG A C     1 
ATOM   1147 O O     . ARG B 2 130 ? 11.342 7.619  -13.677 1.00 61.31  ? 131 ARG A O     1 
ATOM   1148 C CB    . ARG B 2 130 ? 10.371 10.034 -15.216 1.00 67.34  ? 131 ARG A CB    1 
ATOM   1149 C CG    . ARG B 2 130 ? 9.157  10.791 -15.726 1.00 74.91  ? 131 ARG A CG    1 
ATOM   1150 C CD    . ARG B 2 130 ? 9.244  10.947 -17.234 1.00 83.60  ? 131 ARG A CD    1 
ATOM   1151 N NE    . ARG B 2 130 ? 7.994  11.411 -17.828 1.00 90.18  ? 131 ARG A NE    1 
ATOM   1152 C CZ    . ARG B 2 130 ? 7.736  11.397 -19.134 1.00 93.16  ? 131 ARG A CZ    1 
ATOM   1153 N NH1   . ARG B 2 130 ? 8.642  10.943 -19.991 1.00 94.16  ? 131 ARG A NH1   1 
ATOM   1154 N NH2   . ARG B 2 130 ? 6.563  11.821 -19.583 1.00 93.44  ? 131 ARG A NH2   1 
ATOM   1155 N N     . GLY B 2 131 ? 12.561 9.248  -12.706 1.00 60.17  ? 132 GLY A N     1 
ATOM   1156 C CA    . GLY B 2 131 ? 13.643 8.350  -12.340 1.00 58.67  ? 132 GLY A CA    1 
ATOM   1157 C C     . GLY B 2 131 ? 14.387 7.866  -13.569 1.00 58.21  ? 132 GLY A C     1 
ATOM   1158 O O     . GLY B 2 131 ? 14.542 6.663  -13.779 1.00 59.21  ? 132 GLY A O     1 
ATOM   1159 N N     . ASP B 2 132 ? 14.859 8.812  -14.375 1.00 56.89  ? 133 ASP A N     1 
ATOM   1160 C CA    . ASP B 2 132 ? 15.578 8.496  -15.604 1.00 54.47  ? 133 ASP A CA    1 
ATOM   1161 C C     . ASP B 2 132 ? 16.710 9.475  -15.913 1.00 51.68  ? 133 ASP A C     1 
ATOM   1162 O O     . ASP B 2 132 ? 17.536 9.222  -16.791 1.00 51.50  ? 133 ASP A O     1 
ATOM   1163 C CB    . ASP B 2 132 ? 14.596 8.433  -16.785 1.00 56.84  ? 133 ASP A CB    1 
ATOM   1164 C CG    . ASP B 2 132 ? 13.715 9.680  -16.904 1.00 58.64  ? 133 ASP A CG    1 
ATOM   1165 O OD1   . ASP B 2 132 ? 13.797 10.591 -16.050 1.00 59.67  ? 133 ASP A OD1   1 
ATOM   1166 O OD2   . ASP B 2 132 ? 12.922 9.744  -17.867 1.00 60.14  ? 133 ASP A OD2   1 
ATOM   1167 N N     . GLN B 2 133 ? 16.742 10.586 -15.184 1.00 47.92  ? 134 GLN A N     1 
ATOM   1168 C CA    . GLN B 2 133 ? 17.762 11.612 -15.373 1.00 44.57  ? 134 GLN A CA    1 
ATOM   1169 C C     . GLN B 2 133 ? 19.075 11.248 -14.687 1.00 42.65  ? 134 GLN A C     1 
ATOM   1170 O O     . GLN B 2 133 ? 19.078 10.661 -13.606 1.00 40.91  ? 134 GLN A O     1 
ATOM   1171 C CB    . GLN B 2 133 ? 17.270 12.946 -14.813 1.00 43.11  ? 134 GLN A CB    1 
ATOM   1172 C CG    . GLN B 2 133 ? 15.965 13.449 -15.404 1.00 43.21  ? 134 GLN A CG    1 
ATOM   1173 C CD    . GLN B 2 133 ? 15.381 14.620 -14.628 1.00 44.79  ? 134 GLN A CD    1 
ATOM   1174 O OE1   . GLN B 2 133 ? 14.168 14.837 -14.633 1.00 42.79  ? 134 GLN A OE1   1 
ATOM   1175 N NE2   . GLN B 2 133 ? 16.240 15.379 -13.952 1.00 43.48  ? 134 GLN A NE2   1 
ATOM   1176 N N     . ASP B 2 134 ? 20.187 11.596 -15.327 1.00 42.71  ? 135 ASP A N     1 
ATOM   1177 C CA    . ASP B 2 134 ? 21.509 11.338 -14.763 1.00 44.26  ? 135 ASP A CA    1 
ATOM   1178 C C     . ASP B 2 134 ? 21.865 12.488 -13.827 1.00 42.20  ? 135 ASP A C     1 
ATOM   1179 O O     . ASP B 2 134 ? 22.540 12.298 -12.813 1.00 39.48  ? 135 ASP A O     1 
ATOM   1180 C CB    . ASP B 2 134 ? 22.567 11.238 -15.869 1.00 48.49  ? 135 ASP A CB    1 
ATOM   1181 C CG    . ASP B 2 134 ? 22.450 9.963  -16.683 1.00 51.72  ? 135 ASP A CG    1 
ATOM   1182 O OD1   . ASP B 2 134 ? 22.472 8.864  -16.087 1.00 52.88  ? 135 ASP A OD1   1 
ATOM   1183 O OD2   . ASP B 2 134 ? 22.351 10.061 -17.924 1.00 53.25  ? 135 ASP A OD2   1 
ATOM   1184 N N     . LEU B 2 135 ? 21.394 13.681 -14.180 1.00 38.48  ? 136 LEU A N     1 
ATOM   1185 C CA    . LEU B 2 135 ? 21.648 14.884 -13.399 1.00 34.51  ? 136 LEU A CA    1 
ATOM   1186 C C     . LEU B 2 135 ? 20.364 15.494 -12.850 1.00 32.59  ? 136 LEU A C     1 
ATOM   1187 O O     . LEU B 2 135 ? 19.273 15.259 -13.370 1.00 34.14  ? 136 LEU A O     1 
ATOM   1188 C CB    . LEU B 2 135 ? 22.371 15.925 -14.259 1.00 32.13  ? 136 LEU A CB    1 
ATOM   1189 C CG    . LEU B 2 135 ? 23.732 15.531 -14.833 1.00 30.84  ? 136 LEU A CG    1 
ATOM   1190 C CD1   . LEU B 2 135 ? 24.234 16.611 -15.776 1.00 31.14  ? 136 LEU A CD1   1 
ATOM   1191 C CD2   . LEU B 2 135 ? 24.716 15.300 -13.699 1.00 31.09  ? 136 LEU A CD2   1 
ATOM   1192 N N     . MET B 2 136 ? 20.512 16.278 -11.789 1.00 31.01  ? 137 MET A N     1 
ATOM   1193 C CA    . MET B 2 136 ? 19.396 16.961 -11.149 1.00 27.79  ? 137 MET A CA    1 
ATOM   1194 C C     . MET B 2 136 ? 19.543 18.449 -11.446 1.00 25.42  ? 137 MET A C     1 
ATOM   1195 O O     . MET B 2 136 ? 20.643 18.996 -11.348 1.00 26.40  ? 137 MET A O     1 
ATOM   1196 C CB    . MET B 2 136 ? 19.439 16.719 -9.634  1.00 30.52  ? 137 MET A CB    1 
ATOM   1197 C CG    . MET B 2 136 ? 18.540 17.628 -8.792  1.00 27.35  ? 137 MET A CG    1 
ATOM   1198 S SD    . MET B 2 136 ? 16.778 17.433 -9.103  1.00 28.99  ? 137 MET A SD    1 
ATOM   1199 C CE    . MET B 2 136 ? 16.470 15.861 -8.322  1.00 27.67  ? 137 MET A CE    1 
ATOM   1200 N N     . ALA B 2 137 ? 18.450 19.093 -11.848 1.00 24.22  ? 138 ALA A N     1 
ATOM   1201 C CA    . ALA B 2 137 ? 18.480 20.524 -12.138 1.00 25.13  ? 138 ALA A CA    1 
ATOM   1202 C C     . ALA B 2 137 ? 18.906 21.240 -10.859 1.00 26.50  ? 138 ALA A C     1 
ATOM   1203 O O     . ALA B 2 137 ? 18.257 21.103 -9.823  1.00 29.96  ? 138 ALA A O     1 
ATOM   1204 C CB    . ALA B 2 137 ? 17.108 21.002 -12.583 1.00 24.66  ? 138 ALA A CB    1 
ATOM   1205 N N     . ALA B 2 138 ? 20.019 21.964 -10.929 1.00 25.92  ? 139 ALA A N     1 
ATOM   1206 C CA    . ALA B 2 138 ? 20.550 22.678 -9.771  1.00 26.24  ? 139 ALA A CA    1 
ATOM   1207 C C     . ALA B 2 138 ? 19.587 23.705 -9.181  1.00 26.80  ? 139 ALA A C     1 
ATOM   1208 O O     . ALA B 2 138 ? 18.977 24.492 -9.908  1.00 28.12  ? 139 ALA A O     1 
ATOM   1209 C CB    . ALA B 2 138 ? 21.871 23.334 -10.121 1.00 25.44  ? 139 ALA A CB    1 
ATOM   1210 N N     . GLY B 2 139 ? 19.463 23.681 -7.856  1.00 24.79  ? 140 GLY A N     1 
ATOM   1211 C CA    . GLY B 2 139 ? 18.581 24.597 -7.154  1.00 20.65  ? 140 GLY A CA    1 
ATOM   1212 C C     . GLY B 2 139 ? 19.196 25.960 -6.900  1.00 20.45  ? 140 GLY A C     1 
ATOM   1213 O O     . GLY B 2 139 ? 20.218 26.302 -7.493  1.00 20.39  ? 140 GLY A O     1 
ATOM   1214 N N     . ASN B 2 140 ? 18.607 26.714 -5.974  1.00 20.94  ? 141 ASN A N     1 
ATOM   1215 C CA    . ASN B 2 140 ? 19.081 28.060 -5.656  1.00 20.87  ? 141 ASN A CA    1 
ATOM   1216 C C     . ASN B 2 140 ? 19.238 28.366 -4.164  1.00 21.09  ? 141 ASN A C     1 
ATOM   1217 O O     . ASN B 2 140 ? 19.409 29.526 -3.786  1.00 20.59  ? 141 ASN A O     1 
ATOM   1218 C CB    . ASN B 2 140 ? 18.131 29.090 -6.278  1.00 19.35  ? 141 ASN A CB    1 
ATOM   1219 C CG    . ASN B 2 140 ? 16.703 28.947 -5.778  1.00 17.59  ? 141 ASN A CG    1 
ATOM   1220 O OD1   . ASN B 2 140 ? 16.418 28.136 -4.897  1.00 18.22  ? 141 ASN A OD1   1 
ATOM   1221 N ND2   . ASN B 2 140 ? 15.797 29.731 -6.345  1.00 17.64  ? 141 ASN A ND2   1 
ATOM   1222 N N     . ALA B 2 141 ? 19.196 27.336 -3.323  1.00 20.14  ? 142 ALA A N     1 
ATOM   1223 C CA    . ALA B 2 141 ? 19.317 27.515 -1.875  1.00 22.47  ? 142 ALA A CA    1 
ATOM   1224 C C     . ALA B 2 141 ? 20.618 28.178 -1.423  1.00 24.60  ? 142 ALA A C     1 
ATOM   1225 O O     . ALA B 2 141 ? 20.697 28.709 -0.316  1.00 26.73  ? 142 ALA A O     1 
ATOM   1226 C CB    . ALA B 2 141 ? 19.138 26.184 -1.168  1.00 21.63  ? 142 ALA A CB    1 
ATOM   1227 N N     . ILE B 2 142 ? 21.632 28.150 -2.281  1.00 24.83  ? 143 ILE A N     1 
ATOM   1228 C CA    . ILE B 2 142 ? 22.923 28.746 -1.957  1.00 22.06  ? 143 ILE A CA    1 
ATOM   1229 C C     . ILE B 2 142 ? 22.876 30.277 -1.899  1.00 22.23  ? 143 ILE A C     1 
ATOM   1230 O O     . ILE B 2 142 ? 23.741 30.913 -1.288  1.00 20.89  ? 143 ILE A O     1 
ATOM   1231 C CB    . ILE B 2 142 ? 24.010 28.307 -2.962  1.00 25.57  ? 143 ILE A CB    1 
ATOM   1232 C CG1   . ILE B 2 142 ? 25.382 28.753 -2.457  1.00 25.88  ? 143 ILE A CG1   1 
ATOM   1233 C CG2   . ILE B 2 142 ? 23.704 28.849 -4.362  1.00 17.05  ? 143 ILE A CG2   1 
ATOM   1234 C CD1   . ILE B 2 142 ? 26.436 28.751 -3.497  1.00 33.90  ? 143 ILE A CD1   1 
ATOM   1235 N N     . GLU B 2 143 ? 21.857 30.859 -2.527  1.00 19.86  ? 144 GLU A N     1 
ATOM   1236 C CA    . GLU B 2 143 ? 21.688 32.309 -2.553  1.00 20.33  ? 144 GLU A CA    1 
ATOM   1237 C C     . GLU B 2 143 ? 21.481 32.913 -1.163  1.00 19.66  ? 144 GLU A C     1 
ATOM   1238 O O     . GLU B 2 143 ? 21.630 34.122 -0.979  1.00 17.28  ? 144 GLU A O     1 
ATOM   1239 C CB    . GLU B 2 143 ? 20.529 32.684 -3.476  1.00 21.31  ? 144 GLU A CB    1 
ATOM   1240 C CG    . GLU B 2 143 ? 20.744 32.262 -4.923  1.00 22.49  ? 144 GLU A CG    1 
ATOM   1241 C CD    . GLU B 2 143 ? 19.547 32.537 -5.812  1.00 27.56  ? 144 GLU A CD    1 
ATOM   1242 O OE1   . GLU B 2 143 ? 18.522 33.050 -5.315  1.00 27.72  ? 144 GLU A OE1   1 
ATOM   1243 O OE2   . GLU B 2 143 ? 19.632 32.234 -7.019  1.00 29.51  ? 144 GLU A OE2   1 
ATOM   1244 N N     . ARG B 2 144 ? 21.151 32.066 -0.188  1.00 20.24  ? 145 ARG A N     1 
ATOM   1245 C CA    . ARG B 2 144 ? 20.949 32.506 1.192   1.00 21.28  ? 145 ARG A CA    1 
ATOM   1246 C C     . ARG B 2 144 ? 22.247 33.042 1.795   1.00 22.03  ? 145 ARG A C     1 
ATOM   1247 O O     . ARG B 2 144 ? 22.219 33.819 2.747   1.00 21.71  ? 145 ARG A O     1 
ATOM   1248 C CB    . ARG B 2 144 ? 20.458 31.350 2.067   1.00 18.91  ? 145 ARG A CB    1 
ATOM   1249 C CG    . ARG B 2 144 ? 19.088 30.810 1.723   1.00 18.76  ? 145 ARG A CG    1 
ATOM   1250 C CD    . ARG B 2 144 ? 18.576 29.898 2.832   1.00 21.66  ? 145 ARG A CD    1 
ATOM   1251 N NE    . ARG B 2 144 ? 19.464 28.766 3.095   1.00 25.25  ? 145 ARG A NE    1 
ATOM   1252 C CZ    . ARG B 2 144 ? 20.292 28.678 4.135   1.00 23.62  ? 145 ARG A CZ    1 
ATOM   1253 N NH1   . ARG B 2 144 ? 20.358 29.659 5.027   1.00 22.73  ? 145 ARG A NH1   1 
ATOM   1254 N NH2   . ARG B 2 144 ? 21.055 27.603 4.284   1.00 22.76  ? 145 ARG A NH2   1 
ATOM   1255 N N     . SER B 2 145 ? 23.377 32.613 1.233   1.00 21.71  ? 146 SER A N     1 
ATOM   1256 C CA    . SER B 2 145 ? 24.703 33.024 1.694   1.00 20.28  ? 146 SER A CA    1 
ATOM   1257 C C     . SER B 2 145 ? 24.877 34.538 1.737   1.00 20.74  ? 146 SER A C     1 
ATOM   1258 O O     . SER B 2 145 ? 25.641 35.062 2.548   1.00 20.26  ? 146 SER A O     1 
ATOM   1259 C CB    . SER B 2 145 ? 25.781 32.414 0.795   1.00 22.40  ? 146 SER A CB    1 
ATOM   1260 O OG    . SER B 2 145 ? 25.726 30.999 0.819   1.00 26.14  ? 146 SER A OG    1 
ATOM   1261 N N     . HIS B 2 146 ? 24.163 35.235 0.860   1.00 20.25  ? 147 HIS A N     1 
ATOM   1262 C CA    . HIS B 2 146 ? 24.227 36.687 0.788   1.00 21.94  ? 147 HIS A CA    1 
ATOM   1263 C C     . HIS B 2 146 ? 23.715 37.401 2.037   1.00 21.27  ? 147 HIS A C     1 
ATOM   1264 O O     . HIS B 2 146 ? 24.097 38.540 2.292   1.00 21.09  ? 147 HIS A O     1 
ATOM   1265 C CB    . HIS B 2 146 ? 23.466 37.188 -0.441  1.00 24.10  ? 147 HIS A CB    1 
ATOM   1266 C CG    . HIS B 2 146 ? 24.140 36.869 -1.737  1.00 25.63  ? 147 HIS A CG    1 
ATOM   1267 N ND1   . HIS B 2 146 ? 24.990 37.750 -2.368  1.00 28.53  ? 147 HIS A ND1   1 
ATOM   1268 C CD2   . HIS B 2 146 ? 24.098 35.763 -2.518  1.00 25.23  ? 147 HIS A CD2   1 
ATOM   1269 C CE1   . HIS B 2 146 ? 25.444 37.203 -3.481  1.00 26.48  ? 147 HIS A CE1   1 
ATOM   1270 N NE2   . HIS B 2 146 ? 24.918 35.997 -3.594  1.00 24.03  ? 147 HIS A NE2   1 
ATOM   1271 N N     . LYS B 2 147 ? 22.858 36.738 2.812   1.00 19.02  ? 148 LYS A N     1 
ATOM   1272 C CA    . LYS B 2 147 ? 22.309 37.346 4.023   1.00 19.69  ? 148 LYS A CA    1 
ATOM   1273 C C     . LYS B 2 147 ? 23.365 37.578 5.101   1.00 18.31  ? 148 LYS A C     1 
ATOM   1274 O O     . LYS B 2 147 ? 23.534 38.702 5.569   1.00 19.44  ? 148 LYS A O     1 
ATOM   1275 C CB    . LYS B 2 147 ? 21.167 36.508 4.602   1.00 20.17  ? 148 LYS A CB    1 
ATOM   1276 C CG    . LYS B 2 147 ? 20.345 37.267 5.641   1.00 23.80  ? 148 LYS A CG    1 
ATOM   1277 C CD    . LYS B 2 147 ? 19.823 36.357 6.741   1.00 27.47  ? 148 LYS A CD    1 
ATOM   1278 C CE    . LYS B 2 147 ? 20.956 35.846 7.608   1.00 25.32  ? 148 LYS A CE    1 
ATOM   1279 N NZ    . LYS B 2 147 ? 20.490 34.911 8.663   1.00 22.87  ? 148 LYS A NZ    1 
ATOM   1280 N N     . ASN B 2 148 ? 24.062 36.517 5.503   1.00 18.53  ? 149 ASN A N     1 
ATOM   1281 C CA    . ASN B 2 148 ? 25.098 36.634 6.528   1.00 19.28  ? 149 ASN A CA    1 
ATOM   1282 C C     . ASN B 2 148 ? 26.240 37.539 6.087   1.00 20.80  ? 149 ASN A C     1 
ATOM   1283 O O     . ASN B 2 148 ? 26.894 38.169 6.918   1.00 19.42  ? 149 ASN A O     1 
ATOM   1284 C CB    . ASN B 2 148 ? 25.634 35.257 6.931   1.00 21.36  ? 149 ASN A CB    1 
ATOM   1285 C CG    . ASN B 2 148 ? 24.691 34.510 7.857   1.00 24.63  ? 149 ASN A CG    1 
ATOM   1286 O OD1   . ASN B 2 148 ? 23.756 35.089 8.411   1.00 25.11  ? 149 ASN A OD1   1 
ATOM   1287 N ND2   . ASN B 2 148 ? 24.935 33.217 8.033   1.00 27.45  ? 149 ASN A ND2   1 
ATOM   1288 N N     . ILE B 2 149 ? 26.478 37.603 4.779   1.00 20.69  ? 150 ILE A N     1 
ATOM   1289 C CA    . ILE B 2 149 ? 27.530 38.456 4.238   1.00 19.59  ? 150 ILE A CA    1 
ATOM   1290 C C     . ILE B 2 149 ? 27.128 39.922 4.420   1.00 19.98  ? 150 ILE A C     1 
ATOM   1291 O O     . ILE B 2 149 ? 27.969 40.764 4.730   1.00 20.66  ? 150 ILE A O     1 
ATOM   1292 C CB    . ILE B 2 149 ? 27.813 38.133 2.749   1.00 20.13  ? 150 ILE A CB    1 
ATOM   1293 C CG1   . ILE B 2 149 ? 28.446 36.743 2.640   1.00 20.57  ? 150 ILE A CG1   1 
ATOM   1294 C CG2   . ILE B 2 149 ? 28.731 39.180 2.133   1.00 16.90  ? 150 ILE A CG2   1 
ATOM   1295 C CD1   . ILE B 2 149 ? 28.715 36.284 1.227   1.00 22.11  ? 150 ILE A CD1   1 
ATOM   1296 N N     . SER B 2 150 ? 25.835 40.207 4.271   1.00 19.55  ? 151 SER A N     1 
ATOM   1297 C CA    . SER B 2 150 ? 25.316 41.565 4.446   1.00 22.90  ? 151 SER A CA    1 
ATOM   1298 C C     . SER B 2 150 ? 25.360 41.976 5.915   1.00 19.75  ? 151 SER A C     1 
ATOM   1299 O O     . SER B 2 150 ? 25.677 43.119 6.237   1.00 19.16  ? 151 SER A O     1 
ATOM   1300 C CB    . SER B 2 150 ? 23.874 41.663 3.948   1.00 23.75  ? 151 SER A CB    1 
ATOM   1301 O OG    . SER B 2 150 ? 23.798 41.432 2.558   1.00 41.86  ? 151 SER A OG    1 
ATOM   1302 N N     . GLU B 2 151 ? 25.017 41.036 6.794   1.00 21.20  ? 152 GLU A N     1 
ATOM   1303 C CA    . GLU B 2 151 ? 25.009 41.266 8.237   1.00 21.97  ? 152 GLU A CA    1 
ATOM   1304 C C     . GLU B 2 151 ? 26.397 41.622 8.744   1.00 22.24  ? 152 GLU A C     1 
ATOM   1305 O O     . GLU B 2 151 ? 26.565 42.598 9.473   1.00 25.13  ? 152 GLU A O     1 
ATOM   1306 C CB    . GLU B 2 151 ? 24.512 40.018 8.970   1.00 23.40  ? 152 GLU A CB    1 
ATOM   1307 C CG    . GLU B 2 151 ? 23.075 39.622 8.657   1.00 32.19  ? 152 GLU A CG    1 
ATOM   1308 C CD    . GLU B 2 151 ? 22.036 40.456 9.392   1.00 36.66  ? 152 GLU A CD    1 
ATOM   1309 O OE1   . GLU B 2 151 ? 22.373 41.529 9.939   1.00 38.24  ? 152 GLU A OE1   1 
ATOM   1310 O OE2   . GLU B 2 151 ? 20.866 40.023 9.427   1.00 39.86  ? 152 GLU A OE2   1 
ATOM   1311 N N     . ILE B 2 152 ? 27.388 40.823 8.358   1.00 20.97  ? 153 ILE A N     1 
ATOM   1312 C CA    . ILE B 2 152 ? 28.767 41.052 8.767   1.00 19.10  ? 153 ILE A CA    1 
ATOM   1313 C C     . ILE B 2 152 ? 29.295 42.351 8.168   1.00 22.12  ? 153 ILE A C     1 
ATOM   1314 O O     . ILE B 2 152 ? 30.063 43.068 8.809   1.00 23.42  ? 153 ILE A O     1 
ATOM   1315 C CB    . ILE B 2 152 ? 29.674 39.868 8.365   1.00 21.96  ? 153 ILE A CB    1 
ATOM   1316 C CG1   . ILE B 2 152 ? 29.244 38.604 9.117   1.00 24.21  ? 153 ILE A CG1   1 
ATOM   1317 C CG2   . ILE B 2 152 ? 31.136 40.180 8.669   1.00 22.48  ? 153 ILE A CG2   1 
ATOM   1318 C CD1   . ILE B 2 152 ? 29.362 38.705 10.630  1.00 27.41  ? 153 ILE A CD1   1 
ATOM   1319 N N     . ALA B 2 153 ? 28.859 42.663 6.950   1.00 21.17  ? 154 ALA A N     1 
ATOM   1320 C CA    . ALA B 2 153 ? 29.279 43.890 6.276   1.00 21.32  ? 154 ALA A CA    1 
ATOM   1321 C C     . ALA B 2 153 ? 28.786 45.108 7.050   1.00 20.57  ? 154 ALA A C     1 
ATOM   1322 O O     . ALA B 2 153 ? 29.516 46.083 7.219   1.00 21.90  ? 154 ALA A O     1 
ATOM   1323 C CB    . ALA B 2 153 ? 28.753 43.919 4.848   1.00 17.34  ? 154 ALA A CB    1 
ATOM   1324 N N     . ASN B 2 154 ? 27.547 45.039 7.528   1.00 20.91  ? 155 ASN A N     1 
ATOM   1325 C CA    . ASN B 2 154 ? 26.958 46.129 8.299   1.00 22.30  ? 155 ASN A CA    1 
ATOM   1326 C C     . ASN B 2 154 ? 27.631 46.226 9.665   1.00 22.05  ? 155 ASN A C     1 
ATOM   1327 O O     . ASN B 2 154 ? 27.871 47.318 10.177  1.00 25.53  ? 155 ASN A O     1 
ATOM   1328 C CB    . ASN B 2 154 ? 25.453 45.906 8.464   1.00 23.20  ? 155 ASN A CB    1 
ATOM   1329 C CG    . ASN B 2 154 ? 24.685 46.134 7.176   1.00 24.23  ? 155 ASN A CG    1 
ATOM   1330 O OD1   . ASN B 2 154 ? 25.263 46.493 6.148   1.00 23.65  ? 155 ASN A OD1   1 
ATOM   1331 N ND2   . ASN B 2 154 ? 23.372 45.943 7.230   1.00 22.53  ? 155 ASN A ND2   1 
ATOM   1332 N N     . PHE B 2 155 ? 27.966 45.068 10.224  1.00 23.63  ? 156 PHE A N     1 
ATOM   1333 C CA    . PHE B 2 155 ? 28.622 44.980 11.523  1.00 24.12  ? 156 PHE A CA    1 
ATOM   1334 C C     . PHE B 2 155 ? 30.041 45.549 11.446  1.00 25.03  ? 156 PHE A C     1 
ATOM   1335 O O     . PHE B 2 155 ? 30.561 46.075 12.431  1.00 25.43  ? 156 PHE A O     1 
ATOM   1336 C CB    . PHE B 2 155 ? 28.661 43.513 11.970  1.00 22.49  ? 156 PHE A CB    1 
ATOM   1337 C CG    . PHE B 2 155 ? 29.174 43.307 13.367  1.00 25.10  ? 156 PHE A CG    1 
ATOM   1338 C CD1   . PHE B 2 155 ? 28.602 43.980 14.442  1.00 26.07  ? 156 PHE A CD1   1 
ATOM   1339 C CD2   . PHE B 2 155 ? 30.216 42.420 13.610  1.00 24.41  ? 156 PHE A CD2   1 
ATOM   1340 C CE1   . PHE B 2 155 ? 29.060 43.772 15.741  1.00 25.25  ? 156 PHE A CE1   1 
ATOM   1341 C CE2   . PHE B 2 155 ? 30.682 42.205 14.905  1.00 29.86  ? 156 PHE A CE2   1 
ATOM   1342 C CZ    . PHE B 2 155 ? 30.101 42.883 15.974  1.00 26.27  ? 156 PHE A CZ    1 
ATOM   1343 N N     . MET B 2 156 ? 30.643 45.471 10.262  1.00 22.29  ? 157 MET A N     1 
ATOM   1344 C CA    . MET B 2 156 ? 32.002 45.959 10.040  1.00 23.38  ? 157 MET A CA    1 
ATOM   1345 C C     . MET B 2 156 ? 32.057 47.142 9.075   1.00 22.19  ? 157 MET A C     1 
ATOM   1346 O O     . MET B 2 156 ? 33.073 47.369 8.417   1.00 24.98  ? 157 MET A O     1 
ATOM   1347 C CB    . MET B 2 156 ? 32.878 44.823 9.504   1.00 23.87  ? 157 MET A CB    1 
ATOM   1348 C CG    . MET B 2 156 ? 33.002 43.640 10.440  1.00 22.57  ? 157 MET A CG    1 
ATOM   1349 S SD    . MET B 2 156 ? 34.106 42.379 9.802   1.00 27.13  ? 157 MET A SD    1 
ATOM   1350 C CE    . MET B 2 156 ? 35.687 43.220 9.961   1.00 22.56  ? 157 MET A CE    1 
ATOM   1351 N N     . LEU B 2 157 ? 30.978 47.914 9.024   1.00 21.64  ? 158 LEU A N     1 
ATOM   1352 C CA    . LEU B 2 157 ? 30.893 49.066 8.132   1.00 23.39  ? 158 LEU A CA    1 
ATOM   1353 C C     . LEU B 2 157 ? 31.914 50.164 8.459   1.00 25.03  ? 158 LEU A C     1 
ATOM   1354 O O     . LEU B 2 157 ? 32.294 50.949 7.588   1.00 25.12  ? 158 LEU A O     1 
ATOM   1355 C CB    . LEU B 2 157 ? 29.468 49.623 8.155   1.00 20.91  ? 158 LEU A CB    1 
ATOM   1356 C CG    . LEU B 2 157 ? 29.023 50.562 7.037   1.00 23.74  ? 158 LEU A CG    1 
ATOM   1357 C CD1   . LEU B 2 157 ? 29.207 49.889 5.685   1.00 20.89  ? 158 LEU A CD1   1 
ATOM   1358 C CD2   . LEU B 2 157 ? 27.565 50.942 7.254   1.00 21.61  ? 158 LEU A CD2   1 
ATOM   1359 N N     . SER B 2 158 ? 32.379 50.192 9.706   1.00 25.74  ? 159 SER A N     1 
ATOM   1360 C CA    . SER B 2 158 ? 33.357 51.184 10.150  1.00 26.17  ? 159 SER A CA    1 
ATOM   1361 C C     . SER B 2 158 ? 34.793 50.705 9.936   1.00 27.23  ? 159 SER A C     1 
ATOM   1362 O O     . SER B 2 158 ? 35.741 51.470 10.111  1.00 29.79  ? 159 SER A O     1 
ATOM   1363 C CB    . SER B 2 158 ? 33.147 51.502 11.632  1.00 28.08  ? 159 SER A CB    1 
ATOM   1364 O OG    . SER B 2 158 ? 33.469 50.385 12.445  1.00 29.17  ? 159 SER A OG    1 
ATOM   1365 N N     . GLU B 2 159 ? 34.941 49.435 9.571   1.00 27.04  ? 160 GLU A N     1 
ATOM   1366 C CA    . GLU B 2 159 ? 36.250 48.831 9.346   1.00 24.73  ? 160 GLU A CA    1 
ATOM   1367 C C     . GLU B 2 159 ? 36.772 49.038 7.927   1.00 25.14  ? 160 GLU A C     1 
ATOM   1368 O O     . GLU B 2 159 ? 36.023 49.401 7.021   1.00 24.62  ? 160 GLU A O     1 
ATOM   1369 C CB    . GLU B 2 159 ? 36.190 47.332 9.656   1.00 24.46  ? 160 GLU A CB    1 
ATOM   1370 C CG    . GLU B 2 159 ? 35.734 46.988 11.074  1.00 29.20  ? 160 GLU A CG    1 
ATOM   1371 C CD    . GLU B 2 159 ? 36.823 47.159 12.121  1.00 35.58  ? 160 GLU A CD    1 
ATOM   1372 O OE1   . GLU B 2 159 ? 37.654 48.082 11.997  1.00 38.94  ? 160 GLU A OE1   1 
ATOM   1373 O OE2   . GLU B 2 159 ? 36.850 46.360 13.079  1.00 39.41  ? 160 GLU A OE2   1 
ATOM   1374 N N     . SER B 2 160 ? 38.071 48.813 7.753   1.00 25.87  ? 161 SER A N     1 
ATOM   1375 C CA    . SER B 2 160 ? 38.727 48.947 6.458   1.00 24.32  ? 161 SER A CA    1 
ATOM   1376 C C     . SER B 2 160 ? 39.071 47.571 5.887   1.00 25.49  ? 161 SER A C     1 
ATOM   1377 O O     . SER B 2 160 ? 39.765 47.462 4.873   1.00 25.14  ? 161 SER A O     1 
ATOM   1378 C CB    . SER B 2 160 ? 39.990 49.801 6.583   1.00 22.53  ? 161 SER A CB    1 
ATOM   1379 O OG    . SER B 2 160 ? 39.668 51.134 6.939   1.00 28.14  ? 161 SER A OG    1 
ATOM   1380 N N     . HIS B 2 161 ? 38.591 46.523 6.552   1.00 24.07  ? 162 HIS A N     1 
ATOM   1381 C CA    . HIS B 2 161 ? 38.819 45.151 6.110   1.00 23.43  ? 162 HIS A CA    1 
ATOM   1382 C C     . HIS B 2 161 ? 37.540 44.335 6.291   1.00 21.68  ? 162 HIS A C     1 
ATOM   1383 O O     . HIS B 2 161 ? 36.708 44.648 7.140   1.00 23.24  ? 162 HIS A O     1 
ATOM   1384 C CB    . HIS B 2 161 ? 39.987 44.512 6.872   1.00 22.20  ? 162 HIS A CB    1 
ATOM   1385 C CG    . HIS B 2 161 ? 39.709 44.266 8.320   1.00 25.56  ? 162 HIS A CG    1 
ATOM   1386 N ND1   . HIS B 2 161 ? 39.423 45.281 9.208   1.00 24.85  ? 162 HIS A ND1   1 
ATOM   1387 C CD2   . HIS B 2 161 ? 39.668 43.119 9.038   1.00 23.62  ? 162 HIS A CD2   1 
ATOM   1388 C CE1   . HIS B 2 161 ? 39.219 44.770 10.409  1.00 24.20  ? 162 HIS A CE1   1 
ATOM   1389 N NE2   . HIS B 2 161 ? 39.362 43.459 10.332  1.00 24.08  ? 162 HIS A NE2   1 
ATOM   1390 N N     . PHE B 2 162 ? 37.389 43.294 5.478   1.00 22.54  ? 163 PHE A N     1 
ATOM   1391 C CA    . PHE B 2 162 ? 36.216 42.427 5.513   1.00 19.65  ? 163 PHE A CA    1 
ATOM   1392 C C     . PHE B 2 162 ? 36.701 40.983 5.349   1.00 20.81  ? 163 PHE A C     1 
ATOM   1393 O O     . PHE B 2 162 ? 36.741 40.449 4.242   1.00 22.31  ? 163 PHE A O     1 
ATOM   1394 C CB    . PHE B 2 162 ? 35.271 42.823 4.371   1.00 19.79  ? 163 PHE A CB    1 
ATOM   1395 C CG    . PHE B 2 162 ? 33.950 42.110 4.385   1.00 21.94  ? 163 PHE A CG    1 
ATOM   1396 C CD1   . PHE B 2 162 ? 33.073 42.259 5.453   1.00 21.50  ? 163 PHE A CD1   1 
ATOM   1397 C CD2   . PHE B 2 162 ? 33.571 41.307 3.314   1.00 20.40  ? 163 PHE A CD2   1 
ATOM   1398 C CE1   . PHE B 2 162 ? 31.836 41.620 5.452   1.00 20.09  ? 163 PHE A CE1   1 
ATOM   1399 C CE2   . PHE B 2 162 ? 32.338 40.665 3.305   1.00 20.04  ? 163 PHE A CE2   1 
ATOM   1400 C CZ    . PHE B 2 162 ? 31.468 40.823 4.378   1.00 19.24  ? 163 PHE A CZ    1 
ATOM   1401 N N     . PRO B 2 163 ? 37.083 40.335 6.463   1.00 19.62  ? 164 PRO A N     1 
ATOM   1402 C CA    . PRO B 2 163 ? 37.584 38.958 6.505   1.00 19.25  ? 164 PRO A CA    1 
ATOM   1403 C C     . PRO B 2 163 ? 36.538 37.842 6.435   1.00 20.39  ? 164 PRO A C     1 
ATOM   1404 O O     . PRO B 2 163 ? 36.584 36.898 7.228   1.00 20.62  ? 164 PRO A O     1 
ATOM   1405 C CB    . PRO B 2 163 ? 38.328 38.929 7.833   1.00 20.71  ? 164 PRO A CB    1 
ATOM   1406 C CG    . PRO B 2 163 ? 37.442 39.761 8.696   1.00 19.53  ? 164 PRO A CG    1 
ATOM   1407 C CD    . PRO B 2 163 ? 37.127 40.941 7.806   1.00 21.79  ? 164 PRO A CD    1 
ATOM   1408 N N     . TYR B 2 164 ? 35.616 37.933 5.479   1.00 21.16  ? 165 TYR A N     1 
ATOM   1409 C CA    . TYR B 2 164 ? 34.586 36.911 5.324   1.00 20.37  ? 165 TYR A CA    1 
ATOM   1410 C C     . TYR B 2 164 ? 35.034 35.869 4.299   1.00 22.96  ? 165 TYR A C     1 
ATOM   1411 O O     . TYR B 2 164 ? 35.325 36.207 3.153   1.00 23.22  ? 165 TYR A O     1 
ATOM   1412 C CB    . TYR B 2 164 ? 33.262 37.541 4.890   1.00 17.13  ? 165 TYR A CB    1 
ATOM   1413 C CG    . TYR B 2 164 ? 32.059 36.660 5.147   1.00 19.14  ? 165 TYR A CG    1 
ATOM   1414 C CD1   . TYR B 2 164 ? 31.855 35.486 4.421   1.00 22.40  ? 165 TYR A CD1   1 
ATOM   1415 C CD2   . TYR B 2 164 ? 31.133 36.992 6.132   1.00 20.54  ? 165 TYR A CD2   1 
ATOM   1416 C CE1   . TYR B 2 164 ? 30.760 34.663 4.673   1.00 22.16  ? 165 TYR A CE1   1 
ATOM   1417 C CE2   . TYR B 2 164 ? 30.036 36.179 6.391   1.00 23.31  ? 165 TYR A CE2   1 
ATOM   1418 C CZ    . TYR B 2 164 ? 29.855 35.017 5.661   1.00 25.11  ? 165 TYR A CZ    1 
ATOM   1419 O OH    . TYR B 2 164 ? 28.773 34.210 5.925   1.00 29.55  ? 165 TYR A OH    1 
ATOM   1420 N N     . VAL B 2 165 ? 35.082 34.607 4.720   1.00 23.56  ? 166 VAL A N     1 
ATOM   1421 C CA    . VAL B 2 165 ? 35.499 33.511 3.846   1.00 25.53  ? 166 VAL A CA    1 
ATOM   1422 C C     . VAL B 2 165 ? 34.354 32.527 3.625   1.00 25.92  ? 166 VAL A C     1 
ATOM   1423 O O     . VAL B 2 165 ? 33.708 32.095 4.580   1.00 26.64  ? 166 VAL A O     1 
ATOM   1424 C CB    . VAL B 2 165 ? 36.685 32.719 4.442   1.00 28.53  ? 166 VAL A CB    1 
ATOM   1425 C CG1   . VAL B 2 165 ? 37.449 32.004 3.336   1.00 29.06  ? 166 VAL A CG1   1 
ATOM   1426 C CG2   . VAL B 2 165 ? 37.596 33.630 5.237   1.00 30.07  ? 166 VAL A CG2   1 
ATOM   1427 N N     . LEU B 2 166 ? 34.135 32.148 2.369   1.00 25.72  ? 167 LEU A N     1 
ATOM   1428 C CA    . LEU B 2 166 ? 33.074 31.209 2.012   1.00 23.76  ? 167 LEU A CA    1 
ATOM   1429 C C     . LEU B 2 166 ? 33.634 30.037 1.211   1.00 24.98  ? 167 LEU A C     1 
ATOM   1430 O O     . LEU B 2 166 ? 34.163 30.222 0.116   1.00 27.13  ? 167 LEU A O     1 
ATOM   1431 C CB    . LEU B 2 166 ? 31.985 31.924 1.201   1.00 22.69  ? 167 LEU A CB    1 
ATOM   1432 C CG    . LEU B 2 166 ? 30.821 31.097 0.641   1.00 23.05  ? 167 LEU A CG    1 
ATOM   1433 C CD1   . LEU B 2 166 ? 30.087 30.369 1.759   1.00 27.88  ? 167 LEU A CD1   1 
ATOM   1434 C CD2   . LEU B 2 166 ? 29.865 32.005 -0.116  1.00 21.60  ? 167 LEU A CD2   1 
ATOM   1435 N N     . PHE B 2 167 ? 33.533 28.837 1.774   1.00 22.99  ? 168 PHE A N     1 
ATOM   1436 C CA    . PHE B 2 167 ? 34.015 27.626 1.117   1.00 24.70  ? 168 PHE A CA    1 
ATOM   1437 C C     . PHE B 2 167 ? 32.857 26.896 0.438   1.00 27.66  ? 168 PHE A C     1 
ATOM   1438 O O     . PHE B 2 167 ? 31.816 26.659 1.052   1.00 26.42  ? 168 PHE A O     1 
ATOM   1439 C CB    . PHE B 2 167 ? 34.695 26.702 2.131   1.00 26.05  ? 168 PHE A CB    1 
ATOM   1440 C CG    . PHE B 2 167 ? 35.979 27.250 2.689   1.00 25.77  ? 168 PHE A CG    1 
ATOM   1441 C CD1   . PHE B 2 167 ? 37.166 27.140 1.973   1.00 25.92  ? 168 PHE A CD1   1 
ATOM   1442 C CD2   . PHE B 2 167 ? 36.004 27.875 3.931   1.00 25.44  ? 168 PHE A CD2   1 
ATOM   1443 C CE1   . PHE B 2 167 ? 38.360 27.646 2.485   1.00 27.49  ? 168 PHE A CE1   1 
ATOM   1444 C CE2   . PHE B 2 167 ? 37.192 28.383 4.450   1.00 25.26  ? 168 PHE A CE2   1 
ATOM   1445 C CZ    . PHE B 2 167 ? 38.372 28.268 3.725   1.00 26.03  ? 168 PHE A CZ    1 
ATOM   1446 N N     . LEU B 2 168 ? 33.041 26.550 -0.834  1.00 27.65  ? 169 LEU A N     1 
ATOM   1447 C CA    . LEU B 2 168 ? 32.011 25.854 -1.601  1.00 27.63  ? 169 LEU A CA    1 
ATOM   1448 C C     . LEU B 2 168 ? 32.491 24.499 -2.096  1.00 28.06  ? 169 LEU A C     1 
ATOM   1449 O O     . LEU B 2 168 ? 33.671 24.320 -2.406  1.00 28.54  ? 169 LEU A O     1 
ATOM   1450 C CB    . LEU B 2 168 ? 31.581 26.677 -2.825  1.00 26.22  ? 169 LEU A CB    1 
ATOM   1451 C CG    . LEU B 2 168 ? 30.891 28.038 -2.718  1.00 27.43  ? 169 LEU A CG    1 
ATOM   1452 C CD1   . LEU B 2 168 ? 29.717 27.958 -1.757  1.00 27.39  ? 169 LEU A CD1   1 
ATOM   1453 C CD2   . LEU B 2 168 ? 31.876 29.093 -2.276  1.00 33.75  ? 169 LEU A CD2   1 
ATOM   1454 N N     . GLU B 2 169 ? 31.567 23.546 -2.162  1.00 30.36  ? 170 GLU A N     1 
ATOM   1455 C CA    . GLU B 2 169 ? 31.872 22.213 -2.664  1.00 31.90  ? 170 GLU A CA    1 
ATOM   1456 C C     . GLU B 2 169 ? 30.600 21.490 -3.086  1.00 30.54  ? 170 GLU A C     1 
ATOM   1457 O O     . GLU B 2 169 ? 29.528 21.704 -2.517  1.00 27.30  ? 170 GLU A O     1 
ATOM   1458 C CB    . GLU B 2 169 ? 32.673 21.383 -1.654  1.00 36.47  ? 170 GLU A CB    1 
ATOM   1459 C CG    . GLU B 2 169 ? 31.907 20.876 -0.459  1.00 42.80  ? 170 GLU A CG    1 
ATOM   1460 C CD    . GLU B 2 169 ? 32.639 19.744 0.238   1.00 49.29  ? 170 GLU A CD    1 
ATOM   1461 O OE1   . GLU B 2 169 ? 32.421 18.576 -0.145  1.00 51.47  ? 170 GLU A OE1   1 
ATOM   1462 O OE2   . GLU B 2 169 ? 33.440 20.020 1.156   1.00 51.73  ? 170 GLU A OE2   1 
ATOM   1463 N N     . GLY B 2 170 ? 30.725 20.676 -4.129  1.00 29.88  ? 171 GLY A N     1 
ATOM   1464 C CA    . GLY B 2 170 ? 29.592 19.937 -4.648  1.00 30.27  ? 171 GLY A CA    1 
ATOM   1465 C C     . GLY B 2 170 ? 29.563 19.981 -6.165  1.00 28.80  ? 171 GLY A C     1 
ATOM   1466 O O     . GLY B 2 170 ? 30.405 20.627 -6.793  1.00 27.84  ? 171 GLY A O     1 
ATOM   1467 N N     . SER B 2 171 ? 28.575 19.313 -6.751  1.00 28.86  ? 172 SER A N     1 
ATOM   1468 C CA    . SER B 2 171 ? 28.420 19.253 -8.200  1.00 30.72  ? 172 SER A CA    1 
ATOM   1469 C C     . SER B 2 171 ? 28.023 20.590 -8.812  1.00 28.99  ? 172 SER A C     1 
ATOM   1470 O O     . SER B 2 171 ? 28.165 20.790 -10.019 1.00 30.67  ? 172 SER A O     1 
ATOM   1471 C CB    . SER B 2 171 ? 27.370 18.208 -8.572  1.00 29.36  ? 172 SER A CB    1 
ATOM   1472 O OG    . SER B 2 171 ? 27.717 16.934 -8.066  1.00 40.77  ? 172 SER A OG    1 
ATOM   1473 N N     . ASN B 2 172 ? 27.521 21.497 -7.980  1.00 26.54  ? 173 ASN A N     1 
ATOM   1474 C CA    . ASN B 2 172 ? 27.086 22.806 -8.451  1.00 23.34  ? 173 ASN A CA    1 
ATOM   1475 C C     . ASN B 2 172 ? 28.152 23.899 -8.405  1.00 23.13  ? 173 ASN A C     1 
ATOM   1476 O O     . ASN B 2 172 ? 27.863 25.053 -8.721  1.00 23.77  ? 173 ASN A O     1 
ATOM   1477 C CB    . ASN B 2 172 ? 25.842 23.260 -7.676  1.00 23.19  ? 173 ASN A CB    1 
ATOM   1478 C CG    . ASN B 2 172 ? 24.637 22.344 -7.886  1.00 22.31  ? 173 ASN A CG    1 
ATOM   1479 O OD1   . ASN B 2 172 ? 23.624 22.481 -7.203  1.00 22.34  ? 173 ASN A OD1   1 
ATOM   1480 N ND2   . ASN B 2 172 ? 24.738 21.417 -8.836  1.00 24.61  ? 173 ASN A ND2   1 
ATOM   1481 N N     . PHE B 2 173 ? 29.383 23.545 -8.037  1.00 23.90  ? 174 PHE A N     1 
ATOM   1482 C CA    . PHE B 2 173 ? 30.460 24.535 -7.955  1.00 28.30  ? 174 PHE A CA    1 
ATOM   1483 C C     . PHE B 2 173 ? 31.747 24.101 -8.658  1.00 29.28  ? 174 PHE A C     1 
ATOM   1484 O O     . PHE B 2 173 ? 32.844 24.229 -8.111  1.00 29.39  ? 174 PHE A O     1 
ATOM   1485 C CB    . PHE B 2 173 ? 30.749 24.877 -6.490  1.00 26.36  ? 174 PHE A CB    1 
ATOM   1486 C CG    . PHE B 2 173 ? 29.518 25.186 -5.693  1.00 24.65  ? 174 PHE A CG    1 
ATOM   1487 C CD1   . PHE B 2 173 ? 28.693 26.244 -6.049  1.00 22.47  ? 174 PHE A CD1   1 
ATOM   1488 C CD2   . PHE B 2 173 ? 29.151 24.382 -4.620  1.00 26.10  ? 174 PHE A CD2   1 
ATOM   1489 C CE1   . PHE B 2 173 ? 27.522 26.491 -5.355  1.00 24.34  ? 174 PHE A CE1   1 
ATOM   1490 C CE2   . PHE B 2 173 ? 27.981 24.623 -3.918  1.00 25.04  ? 174 PHE A CE2   1 
ATOM   1491 C CZ    . PHE B 2 173 ? 27.164 25.677 -4.286  1.00 24.97  ? 174 PHE A CZ    1 
ATOM   1492 N N     . LEU B 2 174 ? 31.603 23.622 -9.889  1.00 32.15  ? 175 LEU A N     1 
ATOM   1493 C CA    . LEU B 2 174 ? 32.738 23.163 -10.687 1.00 33.57  ? 175 LEU A CA    1 
ATOM   1494 C C     . LEU B 2 174 ? 33.435 24.286 -11.452 1.00 31.80  ? 175 LEU A C     1 
ATOM   1495 O O     . LEU B 2 174 ? 32.787 25.219 -11.932 1.00 28.56  ? 175 LEU A O     1 
ATOM   1496 C CB    . LEU B 2 174 ? 32.284 22.080 -11.674 1.00 34.26  ? 175 LEU A CB    1 
ATOM   1497 C CG    . LEU B 2 174 ? 32.215 20.613 -11.235 1.00 34.04  ? 175 LEU A CG    1 
ATOM   1498 C CD1   . LEU B 2 174 ? 31.595 20.469 -9.861  1.00 38.87  ? 175 LEU A CD1   1 
ATOM   1499 C CD2   . LEU B 2 174 ? 31.429 19.824 -12.268 1.00 34.99  ? 175 LEU A CD2   1 
ATOM   1500 N N     . THR B 2 175 ? 34.760 24.189 -11.547 1.00 32.64  ? 176 THR A N     1 
ATOM   1501 C CA    . THR B 2 175 ? 35.567 25.169 -12.276 1.00 35.12  ? 176 THR A CA    1 
ATOM   1502 C C     . THR B 2 175 ? 36.399 24.460 -13.349 1.00 37.13  ? 176 THR A C     1 
ATOM   1503 O O     . THR B 2 175 ? 37.192 25.088 -14.052 1.00 36.31  ? 176 THR A O     1 
ATOM   1504 C CB    . THR B 2 175 ? 36.512 25.970 -11.343 1.00 34.02  ? 176 THR A CB    1 
ATOM   1505 O OG1   . THR B 2 175 ? 37.374 25.073 -10.634 1.00 34.51  ? 176 THR A OG1   1 
ATOM   1506 C CG2   . THR B 2 175 ? 35.713 26.796 -10.348 1.00 32.97  ? 176 THR A CG2   1 
ATOM   1507 N N     . GLU B 2 176 ? 36.198 23.149 -13.466 1.00 37.25  ? 177 GLU A N     1 
ATOM   1508 C CA    . GLU B 2 176 ? 36.895 22.322 -14.447 1.00 39.92  ? 177 GLU A CA    1 
ATOM   1509 C C     . GLU B 2 176 ? 36.023 21.117 -14.789 1.00 40.95  ? 177 GLU A C     1 
ATOM   1510 O O     . GLU B 2 176 ? 35.213 20.679 -13.969 1.00 41.21  ? 177 GLU A O     1 
ATOM   1511 C CB    . GLU B 2 176 ? 38.246 21.852 -13.896 1.00 42.16  ? 177 GLU A CB    1 
ATOM   1512 C CG    . GLU B 2 176 ? 38.153 20.995 -12.638 1.00 48.72  ? 177 GLU A CG    1 
ATOM   1513 C CD    . GLU B 2 176 ? 39.505 20.485 -12.166 1.00 52.63  ? 177 GLU A CD    1 
ATOM   1514 O OE1   . GLU B 2 176 ? 40.325 21.304 -11.697 1.00 53.61  ? 177 GLU A OE1   1 
ATOM   1515 O OE2   . GLU B 2 176 ? 39.745 19.262 -12.259 1.00 53.08  ? 177 GLU A OE2   1 
ATOM   1516 N N     . ASN B 2 177 ? 36.183 20.590 -16.001 1.00 41.17  ? 178 ASN A N     1 
ATOM   1517 C CA    . ASN B 2 177 ? 35.407 19.434 -16.448 1.00 40.51  ? 178 ASN A CA    1 
ATOM   1518 C C     . ASN B 2 177 ? 35.846 18.148 -15.749 1.00 38.50  ? 178 ASN A C     1 
ATOM   1519 O O     . ASN B 2 177 ? 37.033 17.951 -15.480 1.00 37.46  ? 178 ASN A O     1 
ATOM   1520 C CB    . ASN B 2 177 ? 35.524 19.262 -17.966 1.00 42.57  ? 178 ASN A CB    1 
ATOM   1521 C CG    . ASN B 2 177 ? 35.029 20.475 -18.735 1.00 45.24  ? 178 ASN A CG    1 
ATOM   1522 O OD1   . ASN B 2 177 ? 35.630 20.878 -19.731 1.00 48.31  ? 178 ASN A OD1   1 
ATOM   1523 N ND2   . ASN B 2 177 ? 33.925 21.057 -18.282 1.00 44.77  ? 178 ASN A ND2   1 
ATOM   1524 N N     . ILE B 2 178 ? 34.882 17.281 -15.451 1.00 38.43  ? 179 ILE A N     1 
ATOM   1525 C CA    . ILE B 2 178 ? 35.164 16.010 -14.786 1.00 41.98  ? 179 ILE A CA    1 
ATOM   1526 C C     . ILE B 2 178 ? 34.340 14.873 -15.384 1.00 44.65  ? 179 ILE A C     1 
ATOM   1527 O O     . ILE B 2 178 ? 33.322 15.108 -16.035 1.00 43.83  ? 179 ILE A O     1 
ATOM   1528 C CB    . ILE B 2 178 ? 34.877 16.076 -13.261 1.00 39.34  ? 179 ILE A CB    1 
ATOM   1529 C CG1   . ILE B 2 178 ? 33.423 16.480 -13.010 1.00 38.13  ? 179 ILE A CG1   1 
ATOM   1530 C CG2   . ILE B 2 178 ? 35.836 17.042 -12.578 1.00 40.15  ? 179 ILE A CG2   1 
ATOM   1531 C CD1   . ILE B 2 178 ? 33.042 16.511 -11.554 1.00 36.65  ? 179 ILE A CD1   1 
ATOM   1532 N N     . SER B 2 179 ? 34.796 13.643 -15.164 1.00 48.91  ? 180 SER A N     1 
ATOM   1533 C CA    . SER B 2 179 ? 34.107 12.457 -15.668 1.00 53.27  ? 180 SER A CA    1 
ATOM   1534 C C     . SER B 2 179 ? 33.832 11.492 -14.522 1.00 53.39  ? 180 SER A C     1 
ATOM   1535 O O     . SER B 2 179 ? 34.740 11.129 -13.773 1.00 56.05  ? 180 SER A O     1 
ATOM   1536 C CB    . SER B 2 179 ? 34.946 11.763 -16.744 1.00 53.80  ? 180 SER A CB    1 
ATOM   1537 O OG    . SER B 2 179 ? 35.124 12.602 -17.871 1.00 56.97  ? 180 SER A OG    1 
ATOM   1538 N N     . ILE B 2 180 ? 32.575 11.085 -14.385 1.00 52.96  ? 181 ILE A N     1 
ATOM   1539 C CA    . ILE B 2 180 ? 32.183 10.170 -13.320 1.00 54.16  ? 181 ILE A CA    1 
ATOM   1540 C C     . ILE B 2 180 ? 31.686 8.851  -13.903 1.00 57.09  ? 181 ILE A C     1 
ATOM   1541 O O     . ILE B 2 180 ? 30.788 8.835  -14.744 1.00 55.57  ? 181 ILE A O     1 
ATOM   1542 C CB    . ILE B 2 180 ? 31.076 10.784 -12.435 1.00 53.26  ? 181 ILE A CB    1 
ATOM   1543 C CG1   . ILE B 2 180 ? 31.439 12.220 -12.045 1.00 53.56  ? 181 ILE A CG1   1 
ATOM   1544 C CG2   . ILE B 2 180 ? 30.882 9.945  -11.182 1.00 52.48  ? 181 ILE A CG2   1 
ATOM   1545 C CD1   . ILE B 2 180 ? 32.740 12.348 -11.271 1.00 56.07  ? 181 ILE A CD1   1 
ATOM   1546 N N     . THR B 2 181 ? 32.277 7.749  -13.450 1.00 60.96  ? 182 THR A N     1 
ATOM   1547 C CA    . THR B 2 181 ? 31.904 6.420  -13.928 1.00 62.27  ? 182 THR A CA    1 
ATOM   1548 C C     . THR B 2 181 ? 30.924 5.723  -12.987 1.00 63.29  ? 182 THR A C     1 
ATOM   1549 O O     . THR B 2 181 ? 31.167 5.617  -11.783 1.00 63.94  ? 182 THR A O     1 
ATOM   1550 C CB    . THR B 2 181 ? 33.146 5.518  -14.103 1.00 62.59  ? 182 THR A CB    1 
ATOM   1551 O OG1   . THR B 2 181 ? 34.126 6.198  -14.895 1.00 62.62  ? 182 THR A OG1   1 
ATOM   1552 C CG2   . THR B 2 181 ? 32.766 4.218  -14.795 1.00 60.89  ? 182 THR A CG2   1 
ATOM   1553 N N     . ARG B 2 182 ? 29.823 5.241  -13.554 1.00 64.31  ? 183 ARG A N     1 
ATOM   1554 C CA    . ARG B 2 182 ? 28.791 4.538  -12.795 1.00 66.54  ? 183 ARG A CA    1 
ATOM   1555 C C     . ARG B 2 182 ? 29.091 3.037  -12.715 1.00 68.46  ? 183 ARG A C     1 
ATOM   1556 O O     . ARG B 2 182 ? 29.993 2.546  -13.396 1.00 69.56  ? 183 ARG A O     1 
ATOM   1557 C CB    . ARG B 2 182 ? 27.418 4.793  -13.430 1.00 65.54  ? 183 ARG A CB    1 
ATOM   1558 C CG    . ARG B 2 182 ? 27.369 4.571  -14.929 1.00 66.35  ? 183 ARG A CG    1 
ATOM   1559 C CD    . ARG B 2 182 ? 26.073 5.088  -15.530 1.00 67.30  ? 183 ARG A CD    1 
ATOM   1560 N NE    . ARG B 2 182 ? 24.928 4.245  -15.200 1.00 70.51  ? 183 ARG A NE    1 
ATOM   1561 C CZ    . ARG B 2 182 ? 23.924 4.612  -14.409 1.00 72.88  ? 183 ARG A CZ    1 
ATOM   1562 N NH1   . ARG B 2 182 ? 23.911 5.816  -13.852 1.00 74.75  ? 183 ARG A NH1   1 
ATOM   1563 N NH2   . ARG B 2 182 ? 22.924 3.772  -14.180 1.00 74.50  ? 183 ARG A NH2   1 
ATOM   1564 N N     . PRO B 2 183 ? 28.367 2.296  -11.851 1.00 70.73  ? 184 PRO A N     1 
ATOM   1565 C CA    . PRO B 2 183 ? 28.568 0.849  -11.694 1.00 72.27  ? 184 PRO A CA    1 
ATOM   1566 C C     . PRO B 2 183 ? 28.402 0.076  -13.001 1.00 73.91  ? 184 PRO A C     1 
ATOM   1567 O O     . PRO B 2 183 ? 28.892 -1.046 -13.133 1.00 75.67  ? 184 PRO A O     1 
ATOM   1568 C CB    . PRO B 2 183 ? 27.484 0.470  -10.687 1.00 71.83  ? 184 PRO A CB    1 
ATOM   1569 C CG    . PRO B 2 183 ? 27.395 1.684  -9.834  1.00 71.91  ? 184 PRO A CG    1 
ATOM   1570 C CD    . PRO B 2 183 ? 27.387 2.785  -10.865 1.00 72.73  ? 184 PRO A CD    1 
ATOM   1571 N N     . ASP B 2 184 ? 27.698 0.682  -13.953 1.00 74.26  ? 185 ASP A N     1 
ATOM   1572 C CA    . ASP B 2 184 ? 27.461 0.078  -15.260 1.00 72.43  ? 185 ASP A CA    1 
ATOM   1573 C C     . ASP B 2 184 ? 28.726 0.142  -16.112 1.00 70.70  ? 185 ASP A C     1 
ATOM   1574 O O     . ASP B 2 184 ? 29.050 -0.805 -16.829 1.00 70.73  ? 185 ASP A O     1 
ATOM   1575 C CB    . ASP B 2 184 ? 26.321 0.806  -15.979 1.00 74.02  ? 185 ASP A CB    1 
ATOM   1576 C CG    . ASP B 2 184 ? 25.011 0.739  -15.217 1.00 77.65  ? 185 ASP A CG    1 
ATOM   1577 O OD1   . ASP B 2 184 ? 24.929 1.318  -14.111 1.00 79.74  ? 185 ASP A OD1   1 
ATOM   1578 O OD2   . ASP B 2 184 ? 24.061 0.110  -15.726 1.00 80.04  ? 185 ASP A OD2   1 
ATOM   1579 N N     . GLY B 2 185 ? 29.436 1.263  -16.019 1.00 68.55  ? 186 GLY A N     1 
ATOM   1580 C CA    . GLY B 2 185 ? 30.657 1.445  -16.781 1.00 65.78  ? 186 GLY A CA    1 
ATOM   1581 C C     . GLY B 2 185 ? 30.620 2.697  -17.637 1.00 65.25  ? 186 GLY A C     1 
ATOM   1582 O O     . GLY B 2 185 ? 31.662 3.194  -18.066 1.00 65.53  ? 186 GLY A O     1 
ATOM   1583 N N     . ARG B 2 186 ? 29.416 3.204  -17.885 1.00 64.39  ? 187 ARG A N     1 
ATOM   1584 C CA    . ARG B 2 186 ? 29.223 4.405  -18.693 1.00 64.34  ? 187 ARG A CA    1 
ATOM   1585 C C     . ARG B 2 186 ? 29.736 5.652  -17.973 1.00 64.79  ? 187 ARG A C     1 
ATOM   1586 O O     . ARG B 2 186 ? 29.427 5.877  -16.801 1.00 65.97  ? 187 ARG A O     1 
ATOM   1587 C CB    . ARG B 2 186 ? 27.740 4.559  -19.046 1.00 63.40  ? 187 ARG A CB    1 
ATOM   1588 C CG    . ARG B 2 186 ? 27.375 5.855  -19.755 1.00 63.14  ? 187 ARG A CG    1 
ATOM   1589 C CD    . ARG B 2 186 ? 25.938 5.816  -20.265 1.00 63.90  ? 187 ARG A CD    1 
ATOM   1590 N NE    . ARG B 2 186 ? 24.974 5.460  -19.224 1.00 65.31  ? 187 ARG A NE    1 
ATOM   1591 C CZ    . ARG B 2 186 ? 24.377 6.332  -18.417 1.00 67.15  ? 187 ARG A CZ    1 
ATOM   1592 N NH1   . ARG B 2 186 ? 24.639 7.629  -18.517 1.00 70.50  ? 187 ARG A NH1   1 
ATOM   1593 N NH2   . ARG B 2 186 ? 23.509 5.908  -17.509 1.00 63.59  ? 187 ARG A NH2   1 
ATOM   1594 N N     . VAL B 2 187 ? 30.534 6.448  -18.678 1.00 64.08  ? 188 VAL A N     1 
ATOM   1595 C CA    . VAL B 2 187 ? 31.097 7.670  -18.112 1.00 62.72  ? 188 VAL A CA    1 
ATOM   1596 C C     . VAL B 2 187 ? 30.262 8.915  -18.417 1.00 62.68  ? 188 VAL A C     1 
ATOM   1597 O O     . VAL B 2 187 ? 30.046 9.267  -19.579 1.00 64.91  ? 188 VAL A O     1 
ATOM   1598 C CB    . VAL B 2 187 ? 32.560 7.891  -18.577 1.00 61.40  ? 188 VAL A CB    1 
ATOM   1599 C CG1   . VAL B 2 187 ? 33.457 6.808  -18.006 1.00 60.06  ? 188 VAL A CG1   1 
ATOM   1600 C CG2   . VAL B 2 187 ? 32.648 7.891  -20.098 1.00 62.99  ? 188 VAL A CG2   1 
ATOM   1601 N N     . VAL B 2 188 ? 29.769 9.558  -17.361 1.00 59.87  ? 189 VAL A N     1 
ATOM   1602 C CA    . VAL B 2 188 ? 28.964 10.768 -17.495 1.00 56.28  ? 189 VAL A CA    1 
ATOM   1603 C C     . VAL B 2 188 ? 29.874 11.992 -17.404 1.00 55.92  ? 189 VAL A C     1 
ATOM   1604 O O     . VAL B 2 188 ? 30.357 12.342 -16.325 1.00 55.53  ? 189 VAL A O     1 
ATOM   1605 C CB    . VAL B 2 188 ? 27.877 10.845 -16.398 1.00 54.73  ? 189 VAL A CB    1 
ATOM   1606 C CG1   . VAL B 2 188 ? 27.010 12.079 -16.596 1.00 53.15  ? 189 VAL A CG1   1 
ATOM   1607 C CG2   . VAL B 2 188 ? 27.018 9.587  -16.419 1.00 52.49  ? 189 VAL A CG2   1 
ATOM   1608 N N     . ASN B 2 189 ? 30.120 12.622 -18.548 1.00 56.47  ? 190 ASN A N     1 
ATOM   1609 C CA    . ASN B 2 189 ? 30.980 13.800 -18.617 1.00 57.56  ? 190 ASN A CA    1 
ATOM   1610 C C     . ASN B 2 189 ? 30.234 15.071 -18.221 1.00 57.13  ? 190 ASN A C     1 
ATOM   1611 O O     . ASN B 2 189 ? 29.232 15.435 -18.838 1.00 58.21  ? 190 ASN A O     1 
ATOM   1612 C CB    . ASN B 2 189 ? 31.563 13.950 -20.025 1.00 58.96  ? 190 ASN A CB    1 
ATOM   1613 C CG    . ASN B 2 189 ? 32.341 12.724 -20.466 1.00 60.18  ? 190 ASN A CG    1 
ATOM   1614 O OD1   . ASN B 2 189 ? 33.561 12.663 -20.320 1.00 60.38  ? 190 ASN A OD1   1 
ATOM   1615 N ND2   . ASN B 2 189 ? 31.633 11.737 -21.002 1.00 61.07  ? 190 ASN A ND2   1 
ATOM   1616 N N     . LEU B 2 190 ? 30.734 15.739 -17.186 1.00 55.06  ? 191 LEU A N     1 
ATOM   1617 C CA    . LEU B 2 190 ? 30.122 16.965 -16.691 1.00 52.77  ? 191 LEU A CA    1 
ATOM   1618 C C     . LEU B 2 190 ? 30.921 18.204 -17.077 1.00 51.55  ? 191 LEU A C     1 
ATOM   1619 O O     . LEU B 2 190 ? 32.118 18.292 -16.800 1.00 50.39  ? 191 LEU A O     1 
ATOM   1620 C CB    . LEU B 2 190 ? 29.982 16.909 -15.168 1.00 52.88  ? 191 LEU A CB    1 
ATOM   1621 C CG    . LEU B 2 190 ? 29.263 15.699 -14.569 1.00 53.34  ? 191 LEU A CG    1 
ATOM   1622 C CD1   . LEU B 2 190 ? 29.177 15.846 -13.060 1.00 52.01  ? 191 LEU A CD1   1 
ATOM   1623 C CD2   . LEU B 2 190 ? 27.878 15.572 -15.172 1.00 55.87  ? 191 LEU A CD2   1 
ATOM   1624 N N     . GLU B 2 191 ? 30.254 19.152 -17.729 1.00 51.54  ? 192 GLU A N     1 
ATOM   1625 C CA    . GLU B 2 191 ? 30.896 20.397 -18.131 1.00 51.79  ? 192 GLU A CA    1 
ATOM   1626 C C     . GLU B 2 191 ? 30.585 21.472 -17.098 1.00 48.41  ? 192 GLU A C     1 
ATOM   1627 O O     . GLU B 2 191 ? 29.420 21.772 -16.835 1.00 49.76  ? 192 GLU A O     1 
ATOM   1628 C CB    . GLU B 2 191 ? 30.425 20.833 -19.518 1.00 57.89  ? 192 GLU A CB    1 
ATOM   1629 C CG    . GLU B 2 191 ? 30.872 19.907 -20.637 1.00 67.09  ? 192 GLU A CG    1 
ATOM   1630 C CD    . GLU B 2 191 ? 30.619 20.489 -22.013 1.00 73.20  ? 192 GLU A CD    1 
ATOM   1631 O OE1   . GLU B 2 191 ? 29.476 20.385 -22.505 1.00 76.39  ? 192 GLU A OE1   1 
ATOM   1632 O OE2   . GLU B 2 191 ? 31.567 21.052 -22.603 1.00 76.83  ? 192 GLU A OE2   1 
ATOM   1633 N N     . TYR B 2 192 ? 31.635 22.045 -16.518 1.00 45.16  ? 193 TYR A N     1 
ATOM   1634 C CA    . TYR B 2 192 ? 31.496 23.070 -15.489 1.00 44.25  ? 193 TYR A CA    1 
ATOM   1635 C C     . TYR B 2 192 ? 30.758 24.331 -15.936 1.00 43.20  ? 193 TYR A C     1 
ATOM   1636 O O     . TYR B 2 192 ? 30.073 24.968 -15.138 1.00 42.81  ? 193 TYR A O     1 
ATOM   1637 C CB    . TYR B 2 192 ? 32.870 23.447 -14.924 1.00 42.85  ? 193 TYR A CB    1 
ATOM   1638 C CG    . TYR B 2 192 ? 33.680 24.384 -15.792 1.00 45.77  ? 193 TYR A CG    1 
ATOM   1639 C CD1   . TYR B 2 192 ? 34.494 23.897 -16.811 1.00 48.87  ? 193 TYR A CD1   1 
ATOM   1640 C CD2   . TYR B 2 192 ? 33.643 25.763 -15.582 1.00 47.31  ? 193 TYR A CD2   1 
ATOM   1641 C CE1   . TYR B 2 192 ? 35.256 24.757 -17.598 1.00 50.63  ? 193 TYR A CE1   1 
ATOM   1642 C CE2   . TYR B 2 192 ? 34.398 26.632 -16.362 1.00 49.93  ? 193 TYR A CE2   1 
ATOM   1643 C CZ    . TYR B 2 192 ? 35.202 26.122 -17.368 1.00 50.28  ? 193 TYR A CZ    1 
ATOM   1644 O OH    . TYR B 2 192 ? 35.956 26.979 -18.136 1.00 50.50  ? 193 TYR A OH    1 
ATOM   1645 N N     . ASN B 2 193 ? 30.907 24.688 -17.208 1.00 42.16  ? 194 ASN A N     1 
ATOM   1646 C CA    . ASN B 2 193 ? 30.268 25.881 -17.755 1.00 40.12  ? 194 ASN A CA    1 
ATOM   1647 C C     . ASN B 2 193 ? 28.788 25.716 -18.100 1.00 37.01  ? 194 ASN A C     1 
ATOM   1648 O O     . ASN B 2 193 ? 28.180 26.614 -18.686 1.00 36.63  ? 194 ASN A O     1 
ATOM   1649 C CB    . ASN B 2 193 ? 31.050 26.395 -18.973 1.00 44.21  ? 194 ASN A CB    1 
ATOM   1650 C CG    . ASN B 2 193 ? 31.273 25.323 -20.026 1.00 49.27  ? 194 ASN A CG    1 
ATOM   1651 O OD1   . ASN B 2 193 ? 32.063 24.397 -19.831 1.00 51.63  ? 194 ASN A OD1   1 
ATOM   1652 N ND2   . ASN B 2 193 ? 30.585 25.452 -21.153 1.00 51.98  ? 194 ASN A ND2   1 
ATOM   1653 N N     . SER B 2 194 ? 28.205 24.581 -17.726 1.00 32.42  ? 195 SER A N     1 
ATOM   1654 C CA    . SER B 2 194 ? 26.794 24.324 -17.998 1.00 31.04  ? 195 SER A CA    1 
ATOM   1655 C C     . SER B 2 194 ? 25.892 24.936 -16.928 1.00 29.47  ? 195 SER A C     1 
ATOM   1656 O O     . SER B 2 194 ? 26.040 24.654 -15.739 1.00 28.54  ? 195 SER A O     1 
ATOM   1657 C CB    . SER B 2 194 ? 26.533 22.821 -18.099 1.00 29.96  ? 195 SER A CB    1 
ATOM   1658 O OG    . SER B 2 194 ? 25.160 22.555 -18.337 1.00 30.21  ? 195 SER A OG    1 
ATOM   1659 N N     . GLY B 2 195 ? 24.943 25.756 -17.371 1.00 29.23  ? 196 GLY A N     1 
ATOM   1660 C CA    . GLY B 2 195 ? 24.013 26.404 -16.462 1.00 28.77  ? 196 GLY A CA    1 
ATOM   1661 C C     . GLY B 2 195 ? 23.000 25.480 -15.811 1.00 28.30  ? 196 GLY A C     1 
ATOM   1662 O O     . GLY B 2 195 ? 22.136 25.936 -15.064 1.00 28.24  ? 196 GLY A O     1 
ATOM   1663 N N     . ILE B 2 196 ? 23.074 24.187 -16.117 1.00 28.85  ? 197 ILE A N     1 
ATOM   1664 C CA    . ILE B 2 196 ? 22.161 23.215 -15.528 1.00 28.53  ? 197 ILE A CA    1 
ATOM   1665 C C     . ILE B 2 196 ? 22.650 22.822 -14.137 1.00 26.88  ? 197 ILE A C     1 
ATOM   1666 O O     . ILE B 2 196 ? 21.852 22.450 -13.276 1.00 26.57  ? 197 ILE A O     1 
ATOM   1667 C CB    . ILE B 2 196 ? 22.026 21.951 -16.413 1.00 31.32  ? 197 ILE A CB    1 
ATOM   1668 C CG1   . ILE B 2 196 ? 21.365 22.318 -17.744 1.00 34.46  ? 197 ILE A CG1   1 
ATOM   1669 C CG2   . ILE B 2 196 ? 21.208 20.877 -15.700 1.00 32.00  ? 197 ILE A CG2   1 
ATOM   1670 C CD1   . ILE B 2 196 ? 21.193 21.148 -18.688 1.00 34.91  ? 197 ILE A CD1   1 
ATOM   1671 N N     . LEU B 2 197 ? 23.959 22.939 -13.914 1.00 27.81  ? 198 LEU A N     1 
ATOM   1672 C CA    . LEU B 2 197 ? 24.556 22.592 -12.627 1.00 27.45  ? 198 LEU A CA    1 
ATOM   1673 C C     . LEU B 2 197 ? 25.277 23.748 -11.933 1.00 28.29  ? 198 LEU A C     1 
ATOM   1674 O O     . LEU B 2 197 ? 25.057 23.995 -10.749 1.00 30.44  ? 198 LEU A O     1 
ATOM   1675 C CB    . LEU B 2 197 ? 25.534 21.424 -12.782 1.00 26.77  ? 198 LEU A CB    1 
ATOM   1676 C CG    . LEU B 2 197 ? 25.010 20.061 -13.240 1.00 30.86  ? 198 LEU A CG    1 
ATOM   1677 C CD1   . LEU B 2 197 ? 26.147 19.050 -13.183 1.00 30.60  ? 198 LEU A CD1   1 
ATOM   1678 C CD2   . LEU B 2 197 ? 23.855 19.606 -12.361 1.00 27.00  ? 198 LEU A CD2   1 
ATOM   1679 N N     . ASN B 2 198 ? 26.132 24.451 -12.672 1.00 26.34  ? 199 ASN A N     1 
ATOM   1680 C CA    . ASN B 2 198 ? 26.913 25.557 -12.122 1.00 24.80  ? 199 ASN A CA    1 
ATOM   1681 C C     . ASN B 2 198 ? 26.087 26.686 -11.512 1.00 24.74  ? 199 ASN A C     1 
ATOM   1682 O O     . ASN B 2 198 ? 25.246 27.292 -12.178 1.00 24.42  ? 199 ASN A O     1 
ATOM   1683 C CB    . ASN B 2 198 ? 27.867 26.112 -13.181 1.00 27.45  ? 199 ASN A CB    1 
ATOM   1684 C CG    . ASN B 2 198 ? 29.028 26.880 -12.578 1.00 29.76  ? 199 ASN A CG    1 
ATOM   1685 O OD1   . ASN B 2 198 ? 28.921 28.072 -12.298 1.00 34.46  ? 199 ASN A OD1   1 
ATOM   1686 N ND2   . ASN B 2 198 ? 30.149 26.196 -12.378 1.00 29.48  ? 199 ASN A ND2   1 
ATOM   1687 N N     . ARG B 2 199 ? 26.355 26.965 -10.238 1.00 24.43  ? 200 ARG A N     1 
ATOM   1688 C CA    . ARG B 2 199 ? 25.662 28.012 -9.491  1.00 22.10  ? 200 ARG A CA    1 
ATOM   1689 C C     . ARG B 2 199 ? 26.649 29.013 -8.898  1.00 23.84  ? 200 ARG A C     1 
ATOM   1690 O O     . ARG B 2 199 ? 26.301 29.800 -8.016  1.00 23.12  ? 200 ARG A O     1 
ATOM   1691 C CB    . ARG B 2 199 ? 24.813 27.393 -8.380  1.00 17.46  ? 200 ARG A CB    1 
ATOM   1692 C CG    . ARG B 2 199 ? 23.639 26.577 -8.885  1.00 19.51  ? 200 ARG A CG    1 
ATOM   1693 C CD    . ARG B 2 199 ? 22.667 27.456 -9.645  1.00 18.78  ? 200 ARG A CD    1 
ATOM   1694 N NE    . ARG B 2 199 ? 21.596 26.694 -10.278 1.00 22.61  ? 200 ARG A NE    1 
ATOM   1695 C CZ    . ARG B 2 199 ? 21.528 26.444 -11.582 1.00 20.94  ? 200 ARG A CZ    1 
ATOM   1696 N NH1   . ARG B 2 199 ? 22.472 26.892 -12.396 1.00 23.70  ? 200 ARG A NH1   1 
ATOM   1697 N NH2   . ARG B 2 199 ? 20.507 25.757 -12.073 1.00 19.82  ? 200 ARG A NH2   1 
ATOM   1698 N N     . LEU B 2 200 ? 27.877 28.988 -9.409  1.00 23.56  ? 201 LEU A N     1 
ATOM   1699 C CA    . LEU B 2 200 ? 28.944 29.877 -8.959  1.00 24.66  ? 201 LEU A CA    1 
ATOM   1700 C C     . LEU B 2 200 ? 28.617 31.346 -9.227  1.00 25.82  ? 201 LEU A C     1 
ATOM   1701 O O     . LEU B 2 200 ? 29.050 32.234 -8.489  1.00 25.28  ? 201 LEU A O     1 
ATOM   1702 C CB    . LEU B 2 200 ? 30.249 29.494 -9.660  1.00 27.67  ? 201 LEU A CB    1 
ATOM   1703 C CG    . LEU B 2 200 ? 31.491 29.175 -8.828  1.00 30.13  ? 201 LEU A CG    1 
ATOM   1704 C CD1   . LEU B 2 200 ? 31.147 28.319 -7.627  1.00 30.52  ? 201 LEU A CD1   1 
ATOM   1705 C CD2   . LEU B 2 200 ? 32.499 28.468 -9.711  1.00 29.41  ? 201 LEU A CD2   1 
ATOM   1706 N N     . ASP B 2 201 ? 27.840 31.596 -10.277 1.00 26.72  ? 202 ASP A N     1 
ATOM   1707 C CA    . ASP B 2 201 ? 27.451 32.955 -10.644 1.00 28.80  ? 202 ASP A CA    1 
ATOM   1708 C C     . ASP B 2 201 ? 26.418 33.541 -9.677  1.00 28.45  ? 202 ASP A C     1 
ATOM   1709 O O     . ASP B 2 201 ? 26.162 34.747 -9.686  1.00 28.53  ? 202 ASP A O     1 
ATOM   1710 C CB    . ASP B 2 201 ? 26.917 32.984 -12.077 1.00 30.24  ? 202 ASP A CB    1 
ATOM   1711 C CG    . ASP B 2 201 ? 27.907 32.413 -13.079 1.00 37.86  ? 202 ASP A CG    1 
ATOM   1712 O OD1   . ASP B 2 201 ? 28.734 33.181 -13.613 1.00 32.01  ? 202 ASP A OD1   1 
ATOM   1713 O OD2   . ASP B 2 201 ? 27.861 31.190 -13.327 1.00 43.57  ? 202 ASP A OD2   1 
ATOM   1714 N N     . ARG B 2 202 ? 25.833 32.683 -8.842  1.00 26.52  ? 203 ARG A N     1 
ATOM   1715 C CA    . ARG B 2 202 ? 24.845 33.112 -7.855  1.00 24.91  ? 203 ARG A CA    1 
ATOM   1716 C C     . ARG B 2 202 ? 25.547 33.676 -6.616  1.00 25.39  ? 203 ARG A C     1 
ATOM   1717 O O     . ARG B 2 202 ? 24.890 34.010 -5.631  1.00 26.21  ? 203 ARG A O     1 
ATOM   1718 C CB    . ARG B 2 202 ? 23.965 31.933 -7.424  1.00 21.31  ? 203 ARG A CB    1 
ATOM   1719 C CG    . ARG B 2 202 ? 23.272 31.189 -8.550  1.00 22.33  ? 203 ARG A CG    1 
ATOM   1720 C CD    . ARG B 2 202 ? 22.206 32.030 -9.229  1.00 20.90  ? 203 ARG A CD    1 
ATOM   1721 N NE    . ARG B 2 202 ? 21.587 31.302 -10.334 1.00 21.50  ? 203 ARG A NE    1 
ATOM   1722 C CZ    . ARG B 2 202 ? 20.653 30.365 -10.190 1.00 23.36  ? 203 ARG A CZ    1 
ATOM   1723 N NH1   . ARG B 2 202 ? 20.207 30.037 -8.983  1.00 19.53  ? 203 ARG A NH1   1 
ATOM   1724 N NH2   . ARG B 2 202 ? 20.200 29.717 -11.255 1.00 20.97  ? 203 ARG A NH2   1 
ATOM   1725 N N     . LEU B 2 203 ? 26.876 33.778 -6.671  1.00 24.93  ? 204 LEU A N     1 
ATOM   1726 C CA    . LEU B 2 203 ? 27.668 34.282 -5.548  1.00 23.38  ? 204 LEU A CA    1 
ATOM   1727 C C     . LEU B 2 203 ? 28.631 35.402 -5.916  1.00 23.84  ? 204 LEU A C     1 
ATOM   1728 O O     . LEU B 2 203 ? 29.110 36.121 -5.037  1.00 21.71  ? 204 LEU A O     1 
ATOM   1729 C CB    . LEU B 2 203 ? 28.493 33.152 -4.934  1.00 21.42  ? 204 LEU A CB    1 
ATOM   1730 C CG    . LEU B 2 203 ? 27.807 31.918 -4.358  1.00 25.15  ? 204 LEU A CG    1 
ATOM   1731 C CD1   . LEU B 2 203 ? 28.882 30.964 -3.885  1.00 24.94  ? 204 LEU A CD1   1 
ATOM   1732 C CD2   . LEU B 2 203 ? 26.879 32.301 -3.213  1.00 26.27  ? 204 LEU A CD2   1 
ATOM   1733 N N     . THR B 2 204 ? 28.932 35.533 -7.206  1.00 23.29  ? 205 THR A N     1 
ATOM   1734 C CA    . THR B 2 204 ? 29.875 36.542 -7.687  1.00 22.63  ? 205 THR A CA    1 
ATOM   1735 C C     . THR B 2 204 ? 29.556 37.991 -7.329  1.00 20.98  ? 205 THR A C     1 
ATOM   1736 O O     . THR B 2 204 ? 30.432 38.855 -7.401  1.00 23.29  ? 205 THR A O     1 
ATOM   1737 C CB    . THR B 2 204 ? 30.094 36.423 -9.202  1.00 22.19  ? 205 THR A CB    1 
ATOM   1738 O OG1   . THR B 2 204 ? 28.829 36.438 -9.871  1.00 25.93  ? 205 THR A OG1   1 
ATOM   1739 C CG2   . THR B 2 204 ? 30.825 35.130 -9.530  1.00 24.11  ? 205 THR A CG2   1 
ATOM   1740 N N     . ALA B 2 205 ? 28.311 38.261 -6.949  1.00 20.70  ? 206 ALA A N     1 
ATOM   1741 C CA    . ALA B 2 205 ? 27.916 39.611 -6.564  1.00 21.67  ? 206 ALA A CA    1 
ATOM   1742 C C     . ALA B 2 205 ? 28.532 39.963 -5.206  1.00 21.23  ? 206 ALA A C     1 
ATOM   1743 O O     . ALA B 2 205 ? 28.811 41.129 -4.923  1.00 21.66  ? 206 ALA A O     1 
ATOM   1744 C CB    . ALA B 2 205 ? 26.400 39.722 -6.508  1.00 18.58  ? 206 ALA A CB    1 
ATOM   1745 N N     . ALA B 2 206 ? 28.778 38.935 -4.395  1.00 23.11  ? 207 ALA A N     1 
ATOM   1746 C CA    . ALA B 2 206 ? 29.361 39.094 -3.064  1.00 24.95  ? 207 ALA A CA    1 
ATOM   1747 C C     . ALA B 2 206 ? 30.765 39.691 -3.067  1.00 25.43  ? 207 ALA A C     1 
ATOM   1748 O O     . ALA B 2 206 ? 31.193 40.272 -2.066  1.00 25.52  ? 207 ALA A O     1 
ATOM   1749 C CB    . ALA B 2 206 ? 29.360 37.763 -2.325  1.00 25.29  ? 207 ALA A CB    1 
ATOM   1750 N N     . ASN B 2 207 ? 31.493 39.520 -4.169  1.00 22.43  ? 208 ASN A N     1 
ATOM   1751 C CA    . ASN B 2 207 ? 32.840 40.073 -4.266  1.00 21.87  ? 208 ASN A CA    1 
ATOM   1752 C C     . ASN B 2 207 ? 33.049 40.983 -5.473  1.00 20.29  ? 208 ASN A C     1 
ATOM   1753 O O     . ASN B 2 207 ? 34.178 41.205 -5.904  1.00 24.83  ? 208 ASN A O     1 
ATOM   1754 C CB    . ASN B 2 207 ? 33.908 38.973 -4.206  1.00 20.36  ? 208 ASN A CB    1 
ATOM   1755 C CG    . ASN B 2 207 ? 33.786 37.961 -5.321  1.00 20.09  ? 208 ASN A CG    1 
ATOM   1756 O OD1   . ASN B 2 207 ? 32.933 38.078 -6.199  1.00 23.74  ? 208 ASN A OD1   1 
ATOM   1757 N ND2   . ASN B 2 207 ? 34.649 36.954 -5.292  1.00 20.35  ? 208 ASN A ND2   1 
ATOM   1758 N N     . TYR B 2 208 ? 31.948 41.514 -5.998  1.00 20.42  ? 209 TYR A N     1 
ATOM   1759 C CA    . TYR B 2 208 ? 31.960 42.436 -7.134  1.00 21.74  ? 209 TYR A CA    1 
ATOM   1760 C C     . TYR B 2 208 ? 32.641 41.908 -8.394  1.00 22.73  ? 209 TYR A C     1 
ATOM   1761 O O     . TYR B 2 208 ? 33.196 42.679 -9.176  1.00 23.50  ? 209 TYR A O     1 
ATOM   1762 C CB    . TYR B 2 208 ? 32.594 43.771 -6.724  1.00 23.11  ? 209 TYR A CB    1 
ATOM   1763 C CG    . TYR B 2 208 ? 31.993 44.381 -5.479  1.00 27.53  ? 209 TYR A CG    1 
ATOM   1764 C CD1   . TYR B 2 208 ? 32.491 44.061 -4.216  1.00 27.27  ? 209 TYR A CD1   1 
ATOM   1765 C CD2   . TYR B 2 208 ? 30.922 45.269 -5.560  1.00 29.77  ? 209 TYR A CD2   1 
ATOM   1766 C CE1   . TYR B 2 208 ? 31.939 44.608 -3.066  1.00 31.63  ? 209 TYR A CE1   1 
ATOM   1767 C CE2   . TYR B 2 208 ? 30.361 45.824 -4.411  1.00 32.59  ? 209 TYR A CE2   1 
ATOM   1768 C CZ    . TYR B 2 208 ? 30.876 45.488 -3.168  1.00 32.75  ? 209 TYR A CZ    1 
ATOM   1769 O OH    . TYR B 2 208 ? 30.334 46.033 -2.027  1.00 38.75  ? 209 TYR A OH    1 
ATOM   1770 N N     . GLY B 2 209 ? 32.593 40.596 -8.591  1.00 22.79  ? 210 GLY A N     1 
ATOM   1771 C CA    . GLY B 2 209 ? 33.207 40.006 -9.765  1.00 23.51  ? 210 GLY A CA    1 
ATOM   1772 C C     . GLY B 2 209 ? 34.715 39.862 -9.697  1.00 25.17  ? 210 GLY A C     1 
ATOM   1773 O O     . GLY B 2 209 ? 35.346 39.506 -10.692 1.00 27.14  ? 210 GLY A O     1 
ATOM   1774 N N     . MET B 2 210 ? 35.304 40.168 -8.544  1.00 25.05  ? 211 MET A N     1 
ATOM   1775 C CA    . MET B 2 210 ? 36.747 40.035 -8.377  1.00 27.02  ? 211 MET A CA    1 
ATOM   1776 C C     . MET B 2 210 ? 37.071 38.538 -8.389  1.00 26.83  ? 211 MET A C     1 
ATOM   1777 O O     . MET B 2 210 ? 36.197 37.711 -8.130  1.00 25.90  ? 211 MET A O     1 
ATOM   1778 C CB    . MET B 2 210 ? 37.204 40.718 -7.081  1.00 28.67  ? 211 MET A CB    1 
ATOM   1779 C CG    . MET B 2 210 ? 37.080 42.244 -7.119  1.00 31.59  ? 211 MET A CG    1 
ATOM   1780 S SD    . MET B 2 210 ? 37.481 43.080 -5.561  1.00 37.67  ? 211 MET A SD    1 
ATOM   1781 C CE    . MET B 2 210 ? 39.241 43.264 -5.730  1.00 39.71  ? 211 MET A CE    1 
ATOM   1782 N N     . PRO B 2 211 ? 38.324 38.168 -8.705  1.00 28.86  ? 212 PRO A N     1 
ATOM   1783 C CA    . PRO B 2 211 ? 38.722 36.756 -8.756  1.00 27.08  ? 212 PRO A CA    1 
ATOM   1784 C C     . PRO B 2 211 ? 38.416 35.912 -7.523  1.00 26.99  ? 212 PRO A C     1 
ATOM   1785 O O     . PRO B 2 211 ? 38.603 36.353 -6.389  1.00 27.16  ? 212 PRO A O     1 
ATOM   1786 C CB    . PRO B 2 211 ? 40.224 36.836 -9.039  1.00 29.09  ? 212 PRO A CB    1 
ATOM   1787 C CG    . PRO B 2 211 ? 40.619 38.155 -8.452  1.00 30.42  ? 212 PRO A CG    1 
ATOM   1788 C CD    . PRO B 2 211 ? 39.495 39.041 -8.898  1.00 29.17  ? 212 PRO A CD    1 
ATOM   1789 N N     . ILE B 2 212 ? 37.913 34.703 -7.764  1.00 25.30  ? 213 ILE A N     1 
ATOM   1790 C CA    . ILE B 2 212 ? 37.594 33.765 -6.689  1.00 24.06  ? 213 ILE A CA    1 
ATOM   1791 C C     . ILE B 2 212 ? 38.881 33.085 -6.222  1.00 23.19  ? 213 ILE A C     1 
ATOM   1792 O O     . ILE B 2 212 ? 39.938 33.254 -6.836  1.00 24.05  ? 213 ILE A O     1 
ATOM   1793 C CB    . ILE B 2 212 ? 36.581 32.675 -7.140  1.00 25.13  ? 213 ILE A CB    1 
ATOM   1794 C CG1   . ILE B 2 212 ? 37.165 31.831 -8.279  1.00 26.31  ? 213 ILE A CG1   1 
ATOM   1795 C CG2   . ILE B 2 212 ? 35.264 33.315 -7.554  1.00 25.96  ? 213 ILE A CG2   1 
ATOM   1796 C CD1   . ILE B 2 212 ? 36.358 30.591 -8.600  1.00 23.16  ? 213 ILE A CD1   1 
ATOM   1797 N N     . ASN B 2 213 ? 38.785 32.317 -5.139  1.00 24.10  ? 214 ASN A N     1 
ATOM   1798 C CA    . ASN B 2 213 ? 39.932 31.610 -4.571  1.00 23.84  ? 214 ASN A CA    1 
ATOM   1799 C C     . ASN B 2 213 ? 41.069 32.574 -4.228  1.00 22.33  ? 214 ASN A C     1 
ATOM   1800 O O     . ASN B 2 213 ? 42.244 32.209 -4.283  1.00 23.39  ? 214 ASN A O     1 
ATOM   1801 C CB    . ASN B 2 213 ? 40.431 30.528 -5.536  1.00 25.29  ? 214 ASN A CB    1 
ATOM   1802 C CG    . ASN B 2 213 ? 39.361 29.508 -5.874  1.00 28.16  ? 214 ASN A CG    1 
ATOM   1803 O OD1   . ASN B 2 213 ? 38.531 29.159 -5.038  1.00 28.18  ? 214 ASN A OD1   1 
ATOM   1804 N ND2   . ASN B 2 213 ? 39.376 29.026 -7.111  1.00 32.43  ? 214 ASN A ND2   1 
ATOM   1805 N N     . SER B 2 214 ? 40.706 33.799 -3.859  1.00 22.38  ? 215 SER A N     1 
ATOM   1806 C CA    . SER B 2 214 ? 41.685 34.825 -3.516  1.00 24.23  ? 215 SER A CA    1 
ATOM   1807 C C     . SER B 2 214 ? 41.344 35.535 -2.209  1.00 26.19  ? 215 SER A C     1 
ATOM   1808 O O     . SER B 2 214 ? 40.190 35.555 -1.780  1.00 25.93  ? 215 SER A O     1 
ATOM   1809 C CB    . SER B 2 214 ? 41.783 35.859 -4.641  1.00 24.93  ? 215 SER A CB    1 
ATOM   1810 O OG    . SER B 2 214 ? 42.106 35.251 -5.880  1.00 33.35  ? 215 SER A OG    1 
ATOM   1811 N N     . ASN B 2 215 ? 42.366 36.114 -1.585  1.00 27.71  ? 216 ASN A N     1 
ATOM   1812 C CA    . ASN B 2 215 ? 42.217 36.848 -0.334  1.00 26.02  ? 216 ASN A CA    1 
ATOM   1813 C C     . ASN B 2 215 ? 41.814 38.284 -0.678  1.00 25.37  ? 216 ASN A C     1 
ATOM   1814 O O     . ASN B 2 215 ? 42.640 39.082 -1.126  1.00 25.38  ? 216 ASN A O     1 
ATOM   1815 C CB    . ASN B 2 215 ? 43.547 36.829 0.431   1.00 27.59  ? 216 ASN A CB    1 
ATOM   1816 C CG    . ASN B 2 215 ? 43.467 37.515 1.787   1.00 27.85  ? 216 ASN A CG    1 
ATOM   1817 O OD1   . ASN B 2 215 ? 42.507 38.222 2.090   1.00 29.41  ? 216 ASN A OD1   1 
ATOM   1818 N ND2   . ASN B 2 215 ? 44.486 37.304 2.610   1.00 25.73  ? 216 ASN A ND2   1 
ATOM   1819 N N     . LEU B 2 216 ? 40.534 38.593 -0.485  1.00 22.79  ? 217 LEU A N     1 
ATOM   1820 C CA    . LEU B 2 216 ? 39.988 39.919 -0.775  1.00 22.26  ? 217 LEU A CA    1 
ATOM   1821 C C     . LEU B 2 216 ? 39.654 40.682 0.506   1.00 23.98  ? 217 LEU A C     1 
ATOM   1822 O O     . LEU B 2 216 ? 38.746 41.515 0.523   1.00 22.52  ? 217 LEU A O     1 
ATOM   1823 C CB    . LEU B 2 216 ? 38.725 39.781 -1.636  1.00 23.84  ? 217 LEU A CB    1 
ATOM   1824 C CG    . LEU B 2 216 ? 38.829 39.659 -3.162  1.00 26.62  ? 217 LEU A CG    1 
ATOM   1825 C CD1   . LEU B 2 216 ? 39.895 38.674 -3.582  1.00 31.92  ? 217 LEU A CD1   1 
ATOM   1826 C CD2   . LEU B 2 216 ? 37.480 39.250 -3.722  1.00 22.37  ? 217 LEU A CD2   1 
ATOM   1827 N N     . CYS B 2 217 ? 40.422 40.422 1.562   1.00 27.00  ? 218 CYS A N     1 
ATOM   1828 C CA    . CYS B 2 217 ? 40.206 41.049 2.866   1.00 28.06  ? 218 CYS A CA    1 
ATOM   1829 C C     . CYS B 2 217 ? 40.302 42.573 2.909   1.00 27.55  ? 218 CYS A C     1 
ATOM   1830 O O     . CYS B 2 217 ? 39.431 43.227 3.476   1.00 27.43  ? 218 CYS A O     1 
ATOM   1831 C CB    . CYS B 2 217 ? 41.146 40.441 3.907   1.00 27.37  ? 218 CYS A CB    1 
ATOM   1832 S SG    . CYS B 2 217 ? 40.853 41.034 5.585   1.00 29.54  ? 218 CYS A SG    1 
ATOM   1833 N N     . ILE B 2 218 ? 41.358 43.139 2.330   1.00 27.28  ? 219 ILE A N     1 
ATOM   1834 C CA    . ILE B 2 218 ? 41.533 44.591 2.322   1.00 26.76  ? 219 ILE A CA    1 
ATOM   1835 C C     . ILE B 2 218 ? 40.484 45.250 1.424   1.00 26.48  ? 219 ILE A C     1 
ATOM   1836 O O     . ILE B 2 218 ? 40.408 44.958 0.231   1.00 25.82  ? 219 ILE A O     1 
ATOM   1837 C CB    . ILE B 2 218 ? 42.948 44.994 1.835   1.00 26.52  ? 219 ILE A CB    1 
ATOM   1838 C CG1   . ILE B 2 218 ? 44.016 44.282 2.667   1.00 27.53  ? 219 ILE A CG1   1 
ATOM   1839 C CG2   . ILE B 2 218 ? 43.138 46.503 1.952   1.00 24.86  ? 219 ILE A CG2   1 
ATOM   1840 C CD1   . ILE B 2 218 ? 45.435 44.591 2.239   1.00 29.14  ? 219 ILE A CD1   1 
ATOM   1841 N N     . ASN B 2 219 ? 39.679 46.135 2.010   1.00 26.38  ? 220 ASN A N     1 
ATOM   1842 C CA    . ASN B 2 219 ? 38.625 46.839 1.280   1.00 25.96  ? 220 ASN A CA    1 
ATOM   1843 C C     . ASN B 2 219 ? 39.167 47.778 0.214   1.00 27.85  ? 220 ASN A C     1 
ATOM   1844 O O     . ASN B 2 219 ? 40.131 48.508 0.443   1.00 26.97  ? 220 ASN A O     1 
ATOM   1845 C CB    . ASN B 2 219 ? 37.744 47.645 2.238   1.00 25.43  ? 220 ASN A CB    1 
ATOM   1846 C CG    . ASN B 2 219 ? 36.994 46.775 3.223   1.00 24.95  ? 220 ASN A CG    1 
ATOM   1847 O OD1   . ASN B 2 219 ? 37.012 45.547 3.133   1.00 23.47  ? 220 ASN A OD1   1 
ATOM   1848 N ND2   . ASN B 2 219 ? 36.333 47.412 4.182   1.00 20.11  ? 220 ASN A ND2   1 
ATOM   1849 N N     . LYS B 2 220 ? 38.519 47.766 -0.945  1.00 29.81  ? 221 LYS A N     1 
ATOM   1850 C CA    . LYS B 2 220 ? 38.905 48.618 -2.062  1.00 34.33  ? 221 LYS A CA    1 
ATOM   1851 C C     . LYS B 2 220 ? 38.050 49.882 -2.038  1.00 36.29  ? 221 LYS A C     1 
ATOM   1852 O O     . LYS B 2 220 ? 36.913 49.863 -1.567  1.00 36.06  ? 221 LYS A O     1 
ATOM   1853 C CB    . LYS B 2 220 ? 38.698 47.875 -3.387  1.00 35.53  ? 221 LYS A CB    1 
ATOM   1854 C CG    . LYS B 2 220 ? 38.957 48.715 -4.633  1.00 41.48  ? 221 LYS A CG    1 
ATOM   1855 C CD    . LYS B 2 220 ? 38.442 48.028 -5.892  1.00 47.66  ? 221 LYS A CD    1 
ATOM   1856 C CE    . LYS B 2 220 ? 39.333 46.879 -6.331  1.00 49.19  ? 221 LYS A CE    1 
ATOM   1857 N NZ    . LYS B 2 220 ? 40.626 47.367 -6.882  1.00 55.48  ? 221 LYS A NZ    1 
ATOM   1858 N N     . PHE B 2 221 ? 38.614 50.986 -2.516  1.00 38.96  ? 222 PHE A N     1 
ATOM   1859 C CA    . PHE B 2 221 ? 37.897 52.253 -2.567  1.00 39.20  ? 222 PHE A CA    1 
ATOM   1860 C C     . PHE B 2 221 ? 37.784 52.715 -4.013  1.00 42.03  ? 222 PHE A C     1 
ATOM   1861 O O     . PHE B 2 221 ? 38.793 52.926 -4.688  1.00 43.01  ? 222 PHE A O     1 
ATOM   1862 C CB    . PHE B 2 221 ? 38.610 53.315 -1.726  1.00 38.95  ? 222 PHE A CB    1 
ATOM   1863 C CG    . PHE B 2 221 ? 38.533 53.070 -0.247  1.00 37.70  ? 222 PHE A CG    1 
ATOM   1864 C CD1   . PHE B 2 221 ? 37.442 53.521 0.487   1.00 36.71  ? 222 PHE A CD1   1 
ATOM   1865 C CD2   . PHE B 2 221 ? 39.547 52.382 0.413   1.00 39.30  ? 222 PHE A CD2   1 
ATOM   1866 C CE1   . PHE B 2 221 ? 37.360 53.291 1.858   1.00 35.37  ? 222 PHE A CE1   1 
ATOM   1867 C CE2   . PHE B 2 221 ? 39.473 52.147 1.785   1.00 39.23  ? 222 PHE A CE2   1 
ATOM   1868 C CZ    . PHE B 2 221 ? 38.377 52.603 2.508   1.00 36.27  ? 222 PHE A CZ    1 
ATOM   1869 N N     . VAL B 2 222 ? 36.551 52.826 -4.495  1.00 43.73  ? 223 VAL A N     1 
ATOM   1870 C CA    . VAL B 2 222 ? 36.294 53.261 -5.864  1.00 47.85  ? 223 VAL A CA    1 
ATOM   1871 C C     . VAL B 2 222 ? 35.502 54.561 -5.869  1.00 53.88  ? 223 VAL A C     1 
ATOM   1872 O O     . VAL B 2 222 ? 35.289 55.172 -4.821  1.00 51.60  ? 223 VAL A O     1 
ATOM   1873 C CB    . VAL B 2 222 ? 35.503 52.198 -6.665  1.00 44.78  ? 223 VAL A CB    1 
ATOM   1874 C CG1   . VAL B 2 222 ? 36.314 50.925 -6.803  1.00 45.17  ? 223 VAL A CG1   1 
ATOM   1875 C CG2   . VAL B 2 222 ? 34.168 51.914 -5.998  1.00 45.31  ? 223 VAL A CG2   1 
ATOM   1876 N N     . ASN B 2 223 ? 35.082 54.976 -7.062  1.00 62.72  ? 224 ASN A N     1 
ATOM   1877 C CA    . ASN B 2 223 ? 34.300 56.194 -7.254  1.00 71.25  ? 224 ASN A CA    1 
ATOM   1878 C C     . ASN B 2 223 ? 34.060 56.407 -8.741  1.00 77.44  ? 224 ASN A C     1 
ATOM   1879 O O     . ASN B 2 223 ? 34.918 56.086 -9.566  1.00 80.07  ? 224 ASN A O     1 
ATOM   1880 C CB    . ASN B 2 223 ? 35.026 57.417 -6.670  1.00 71.97  ? 224 ASN A CB    1 
ATOM   1881 C CG    . ASN B 2 223 ? 36.295 57.782 -7.435  1.00 71.90  ? 224 ASN A CG    1 
ATOM   1882 O OD1   . ASN B 2 223 ? 36.531 58.952 -7.731  1.00 73.08  ? 224 ASN A OD1   1 
ATOM   1883 N ND2   . ASN B 2 223 ? 37.117 56.785 -7.748  1.00 72.34  ? 224 ASN A ND2   1 
ATOM   1884 N N     . HIS B 2 224 ? 32.878 56.906 -9.086  1.00 84.83  ? 225 HIS A N     1 
ATOM   1885 C CA    . HIS B 2 224 ? 32.557 57.178 -10.482 1.00 92.09  ? 225 HIS A CA    1 
ATOM   1886 C C     . HIS B 2 224 ? 32.773 58.675 -10.677 1.00 94.32  ? 225 HIS A C     1 
ATOM   1887 O O     . HIS B 2 224 ? 33.458 59.106 -11.608 1.00 94.65  ? 225 HIS A O     1 
ATOM   1888 C CB    . HIS B 2 224 ? 31.111 56.792 -10.795 1.00 94.86  ? 225 HIS A CB    1 
ATOM   1889 C CG    . HIS B 2 224 ? 30.901 56.356 -12.212 1.00 98.15  ? 225 HIS A CG    1 
ATOM   1890 N ND1   . HIS B 2 224 ? 30.071 57.025 -13.085 1.00 100.00 ? 225 HIS A ND1   1 
ATOM   1891 C CD2   . HIS B 2 224 ? 31.419 55.316 -12.909 1.00 99.14  ? 225 HIS A CD2   1 
ATOM   1892 C CE1   . HIS B 2 224 ? 30.086 56.418 -14.258 1.00 100.00 ? 225 HIS A CE1   1 
ATOM   1893 N NE2   . HIS B 2 224 ? 30.897 55.378 -14.177 1.00 100.00 ? 225 HIS A NE2   1 
ATOM   1894 N N     . LYS B 2 225 ? 32.181 59.457 -9.777  1.00 95.55  ? 226 LYS A N     1 
ATOM   1895 C CA    . LYS B 2 225 ? 32.313 60.910 -9.779  1.00 95.89  ? 226 LYS A CA    1 
ATOM   1896 C C     . LYS B 2 225 ? 33.000 61.226 -8.451  1.00 95.15  ? 226 LYS A C     1 
ATOM   1897 O O     . LYS B 2 225 ? 33.425 60.305 -7.749  1.00 96.64  ? 226 LYS A O     1 
ATOM   1898 C CB    . LYS B 2 225 ? 30.932 61.580 -9.825  1.00 96.69  ? 226 LYS A CB    1 
ATOM   1899 C CG    . LYS B 2 225 ? 29.943 60.977 -10.826 1.00 98.91  ? 226 LYS A CG    1 
ATOM   1900 C CD    . LYS B 2 225 ? 30.530 60.824 -12.228 1.00 99.13  ? 226 LYS A CD    1 
ATOM   1901 C CE    . LYS B 2 225 ? 30.927 62.154 -12.846 1.00 100.00 ? 226 LYS A CE    1 
ATOM   1902 N NZ    . LYS B 2 225 ? 31.593 61.948 -14.162 1.00 99.77  ? 226 LYS A NZ    1 
ATOM   1903 N N     . ASP B 2 226 ? 33.141 62.505 -8.112  1.00 93.58  ? 227 ASP A N     1 
ATOM   1904 C CA    . ASP B 2 226 ? 33.766 62.874 -6.843  1.00 92.53  ? 227 ASP A CA    1 
ATOM   1905 C C     . ASP B 2 226 ? 32.779 62.445 -5.758  1.00 90.35  ? 227 ASP A C     1 
ATOM   1906 O O     . ASP B 2 226 ? 31.952 63.237 -5.300  1.00 90.54  ? 227 ASP A O     1 
ATOM   1907 C CB    . ASP B 2 226 ? 34.023 64.384 -6.785  1.00 95.36  ? 227 ASP A CB    1 
ATOM   1908 C CG    . ASP B 2 226 ? 34.946 64.781 -5.640  1.00 98.60  ? 227 ASP A CG    1 
ATOM   1909 O OD1   . ASP B 2 226 ? 35.716 63.923 -5.152  1.00 100.00 ? 227 ASP A OD1   1 
ATOM   1910 O OD2   . ASP B 2 226 ? 34.909 65.962 -5.234  1.00 100.00 ? 227 ASP A OD2   1 
ATOM   1911 N N     . LYS B 2 227 ? 32.887 61.182 -5.352  1.00 87.51  ? 228 LYS A N     1 
ATOM   1912 C CA    . LYS B 2 227 ? 31.980 60.593 -4.374  1.00 82.14  ? 228 LYS A CA    1 
ATOM   1913 C C     . LYS B 2 227 ? 32.681 59.774 -3.287  1.00 77.69  ? 228 LYS A C     1 
ATOM   1914 O O     . LYS B 2 227 ? 32.531 60.063 -2.099  1.00 76.63  ? 228 LYS A O     1 
ATOM   1915 C CB    . LYS B 2 227 ? 30.980 59.704 -5.121  1.00 81.29  ? 228 LYS A CB    1 
ATOM   1916 C CG    . LYS B 2 227 ? 29.897 59.073 -4.269  1.00 77.96  ? 228 LYS A CG    1 
ATOM   1917 C CD    . LYS B 2 227 ? 29.179 57.969 -5.036  1.00 72.80  ? 228 LYS A CD    1 
ATOM   1918 C CE    . LYS B 2 227 ? 28.560 58.475 -6.329  1.00 67.55  ? 228 LYS A CE    1 
ATOM   1919 N NZ    . LYS B 2 227 ? 27.963 57.361 -7.113  1.00 60.83  ? 228 LYS A NZ    1 
ATOM   1920 N N     . SER B 2 228 ? 33.417 58.745 -3.711  1.00 72.67  ? 229 SER A N     1 
ATOM   1921 C CA    . SER B 2 228 ? 34.146 57.829 -2.824  1.00 66.89  ? 229 SER A CA    1 
ATOM   1922 C C     . SER B 2 228 ? 33.231 56.796 -2.162  1.00 62.76  ? 229 SER A C     1 
ATOM   1923 O O     . SER B 2 228 ? 32.320 57.145 -1.409  1.00 63.06  ? 229 SER A O     1 
ATOM   1924 C CB    . SER B 2 228 ? 34.942 58.591 -1.759  1.00 66.92  ? 229 SER A CB    1 
ATOM   1925 O OG    . SER B 2 228 ? 35.601 57.693 -0.881  1.00 63.99  ? 229 SER A OG    1 
ATOM   1926 N N     . ILE B 2 229 ? 33.487 55.522 -2.455  1.00 55.80  ? 230 ILE A N     1 
ATOM   1927 C CA    . ILE B 2 229 ? 32.704 54.413 -1.910  1.00 48.53  ? 230 ILE A CA    1 
ATOM   1928 C C     . ILE B 2 229 ? 33.646 53.309 -1.430  1.00 44.50  ? 230 ILE A C     1 
ATOM   1929 O O     . ILE B 2 229 ? 34.716 53.108 -2.005  1.00 42.18  ? 230 ILE A O     1 
ATOM   1930 C CB    . ILE B 2 229 ? 31.783 53.787 -2.988  1.00 47.83  ? 230 ILE A CB    1 
ATOM   1931 C CG1   . ILE B 2 229 ? 30.978 54.865 -3.711  1.00 46.51  ? 230 ILE A CG1   1 
ATOM   1932 C CG2   . ILE B 2 229 ? 30.835 52.779 -2.350  1.00 51.44  ? 230 ILE A CG2   1 
ATOM   1933 C CD1   . ILE B 2 229 ? 30.168 54.336 -4.874  1.00 45.29  ? 230 ILE A CD1   1 
ATOM   1934 N N     . MET B 2 230 ? 33.246 52.597 -0.380  1.00 39.27  ? 231 MET A N     1 
ATOM   1935 C CA    . MET B 2 230 ? 34.051 51.499 0.144   1.00 34.66  ? 231 MET A CA    1 
ATOM   1936 C C     . MET B 2 230 ? 33.389 50.167 -0.189  1.00 32.18  ? 231 MET A C     1 
ATOM   1937 O O     . MET B 2 230 ? 32.227 49.938 0.150   1.00 33.65  ? 231 MET A O     1 
ATOM   1938 C CB    . MET B 2 230 ? 34.234 51.623 1.658   1.00 34.72  ? 231 MET A CB    1 
ATOM   1939 C CG    . MET B 2 230 ? 35.073 50.501 2.258   1.00 32.38  ? 231 MET A CG    1 
ATOM   1940 S SD    . MET B 2 230 ? 35.295 50.626 4.036   1.00 32.09  ? 231 MET A SD    1 
ATOM   1941 C CE    . MET B 2 230 ? 33.816 49.807 4.618   1.00 26.58  ? 231 MET A CE    1 
ATOM   1942 N N     . LEU B 2 231 ? 34.135 49.293 -0.858  1.00 29.11  ? 232 LEU A N     1 
ATOM   1943 C CA    . LEU B 2 231 ? 33.627 47.983 -1.242  1.00 26.85  ? 232 LEU A CA    1 
ATOM   1944 C C     . LEU B 2 231 ? 34.018 46.920 -0.224  1.00 26.57  ? 232 LEU A C     1 
ATOM   1945 O O     . LEU B 2 231 ? 35.150 46.894 0.260   1.00 27.73  ? 232 LEU A O     1 
ATOM   1946 C CB    . LEU B 2 231 ? 34.162 47.582 -2.618  1.00 27.42  ? 232 LEU A CB    1 
ATOM   1947 C CG    . LEU B 2 231 ? 33.993 48.565 -3.776  1.00 27.10  ? 232 LEU A CG    1 
ATOM   1948 C CD1   . LEU B 2 231 ? 34.524 47.923 -5.043  1.00 27.71  ? 232 LEU A CD1   1 
ATOM   1949 C CD2   . LEU B 2 231 ? 32.532 48.961 -3.940  1.00 26.16  ? 232 LEU A CD2   1 
ATOM   1950 N N     . GLN B 2 232 ? 33.067 46.052 0.104   1.00 24.13  ? 233 GLN A N     1 
ATOM   1951 C CA    . GLN B 2 232 ? 33.305 44.969 1.050   1.00 24.85  ? 233 GLN A CA    1 
ATOM   1952 C C     . GLN B 2 232 ? 33.138 43.651 0.303   1.00 26.17  ? 233 GLN A C     1 
ATOM   1953 O O     . GLN B 2 232 ? 32.033 43.112 0.198   1.00 28.57  ? 233 GLN A O     1 
ATOM   1954 C CB    . GLN B 2 232 ? 32.333 45.067 2.228   1.00 22.49  ? 233 GLN A CB    1 
ATOM   1955 C CG    . GLN B 2 232 ? 32.505 46.339 3.042   1.00 20.73  ? 233 GLN A CG    1 
ATOM   1956 C CD    . GLN B 2 232 ? 31.434 46.518 4.095   1.00 21.25  ? 233 GLN A CD    1 
ATOM   1957 O OE1   . GLN B 2 232 ? 30.300 46.878 3.788   1.00 22.81  ? 233 GLN A OE1   1 
ATOM   1958 N NE2   . GLN B 2 232 ? 31.792 46.275 5.347   1.00 21.41  ? 233 GLN A NE2   1 
ATOM   1959 N N     . ALA B 2 233 ? 34.246 43.168 -0.254  1.00 26.69  ? 234 ALA A N     1 
ATOM   1960 C CA    . ALA B 2 233 ? 34.269 41.931 -1.025  1.00 24.24  ? 234 ALA A CA    1 
ATOM   1961 C C     . ALA B 2 233 ? 34.609 40.706 -0.188  1.00 24.01  ? 234 ALA A C     1 
ATOM   1962 O O     . ALA B 2 233 ? 35.597 40.696 0.545   1.00 24.01  ? 234 ALA A O     1 
ATOM   1963 C CB    . ALA B 2 233 ? 35.255 42.062 -2.181  1.00 20.87  ? 234 ALA A CB    1 
ATOM   1964 N N     . ALA B 2 234 ? 33.787 39.669 -0.318  1.00 22.98  ? 235 ALA A N     1 
ATOM   1965 C CA    . ALA B 2 234 ? 33.994 38.424 0.412   1.00 24.53  ? 235 ALA A CA    1 
ATOM   1966 C C     . ALA B 2 234 ? 34.895 37.487 -0.384  1.00 24.81  ? 235 ALA A C     1 
ATOM   1967 O O     . ALA B 2 234 ? 34.868 37.492 -1.613  1.00 25.22  ? 235 ALA A O     1 
ATOM   1968 C CB    . ALA B 2 234 ? 32.656 37.751 0.685   1.00 19.81  ? 235 ALA A CB    1 
ATOM   1969 N N     . SER B 2 235 ? 35.721 36.718 0.318   1.00 25.42  ? 236 SER A N     1 
ATOM   1970 C CA    . SER B 2 235 ? 36.612 35.757 -0.326  1.00 24.90  ? 236 SER A CA    1 
ATOM   1971 C C     . SER B 2 235 ? 35.802 34.494 -0.599  1.00 24.88  ? 236 SER A C     1 
ATOM   1972 O O     . SER B 2 235 ? 35.308 33.853 0.328   1.00 24.93  ? 236 SER A O     1 
ATOM   1973 C CB    . SER B 2 235 ? 37.806 35.435 0.578   1.00 22.56  ? 236 SER A CB    1 
ATOM   1974 O OG    . SER B 2 235 ? 38.582 36.591 0.835   1.00 22.59  ? 236 SER A OG    1 
ATOM   1975 N N     . ILE B 2 236 ? 35.646 34.154 -1.875  1.00 24.25  ? 237 ILE A N     1 
ATOM   1976 C CA    . ILE B 2 236 ? 34.867 32.983 -2.262  1.00 24.57  ? 237 ILE A CA    1 
ATOM   1977 C C     . ILE B 2 236 ? 35.731 31.851 -2.805  1.00 26.98  ? 237 ILE A C     1 
ATOM   1978 O O     . ILE B 2 236 ? 36.192 31.900 -3.945  1.00 28.72  ? 237 ILE A O     1 
ATOM   1979 C CB    . ILE B 2 236 ? 33.793 33.362 -3.306  1.00 23.86  ? 237 ILE A CB    1 
ATOM   1980 C CG1   . ILE B 2 236 ? 32.884 34.460 -2.744  1.00 21.64  ? 237 ILE A CG1   1 
ATOM   1981 C CG2   . ILE B 2 236 ? 32.970 32.142 -3.686  1.00 23.30  ? 237 ILE A CG2   1 
ATOM   1982 C CD1   . ILE B 2 236 ? 31.862 34.974 -3.731  1.00 27.66  ? 237 ILE A CD1   1 
ATOM   1983 N N     . TYR B 2 237 ? 35.949 30.836 -1.973  1.00 26.51  ? 238 TYR A N     1 
ATOM   1984 C CA    . TYR B 2 237 ? 36.752 29.677 -2.347  1.00 25.77  ? 238 TYR A CA    1 
ATOM   1985 C C     . TYR B 2 237 ? 35.883 28.482 -2.720  1.00 26.68  ? 238 TYR A C     1 
ATOM   1986 O O     . TYR B 2 237 ? 34.871 28.215 -2.079  1.00 27.18  ? 238 TYR A O     1 
ATOM   1987 C CB    . TYR B 2 237 ? 37.700 29.297 -1.207  1.00 22.62  ? 238 TYR A CB    1 
ATOM   1988 C CG    . TYR B 2 237 ? 38.815 30.292 -0.988  1.00 25.74  ? 238 TYR A CG    1 
ATOM   1989 C CD1   . TYR B 2 237 ? 38.573 31.523 -0.378  1.00 26.93  ? 238 TYR A CD1   1 
ATOM   1990 C CD2   . TYR B 2 237 ? 40.114 30.009 -1.402  1.00 25.31  ? 238 TYR A CD2   1 
ATOM   1991 C CE1   . TYR B 2 237 ? 39.598 32.448 -0.187  1.00 26.71  ? 238 TYR A CE1   1 
ATOM   1992 C CE2   . TYR B 2 237 ? 41.146 30.927 -1.214  1.00 28.92  ? 238 TYR A CE2   1 
ATOM   1993 C CZ    . TYR B 2 237 ? 40.880 32.144 -0.608  1.00 26.39  ? 238 TYR A CZ    1 
ATOM   1994 O OH    . TYR B 2 237 ? 41.899 33.049 -0.420  1.00 29.76  ? 238 TYR A OH    1 
ATOM   1995 N N     . THR B 2 238 ? 36.294 27.755 -3.752  1.00 28.62  ? 239 THR A N     1 
ATOM   1996 C CA    . THR B 2 238 ? 35.546 26.592 -4.205  1.00 29.95  ? 239 THR A CA    1 
ATOM   1997 C C     . THR B 2 238 ? 36.444 25.420 -4.570  1.00 31.14  ? 239 THR A C     1 
ATOM   1998 O O     . THR B 2 238 ? 37.610 25.595 -4.931  1.00 30.27  ? 239 THR A O     1 
ATOM   1999 C CB    . THR B 2 238 ? 34.667 26.928 -5.435  1.00 32.86  ? 239 THR A CB    1 
ATOM   2000 O OG1   . THR B 2 238 ? 34.000 25.742 -5.888  1.00 32.45  ? 239 THR A OG1   1 
ATOM   2001 C CG2   . THR B 2 238 ? 35.516 27.484 -6.574  1.00 33.70  ? 239 THR A CG2   1 
ATOM   2002 N N     . GLN B 2 239 ? 35.892 24.220 -4.436  1.00 32.81  ? 240 GLN A N     1 
ATOM   2003 C CA    . GLN B 2 239 ? 36.600 23.000 -4.786  1.00 34.06  ? 240 GLN A CA    1 
ATOM   2004 C C     . GLN B 2 239 ? 35.996 22.591 -6.130  1.00 34.78  ? 240 GLN A C     1 
ATOM   2005 O O     . GLN B 2 239 ? 35.001 21.866 -6.184  1.00 32.93  ? 240 GLN A O     1 
ATOM   2006 C CB    . GLN B 2 239 ? 36.359 21.924 -3.723  1.00 33.85  ? 240 GLN A CB    1 
ATOM   2007 C CG    . GLN B 2 239 ? 37.233 20.691 -3.874  1.00 34.95  ? 240 GLN A CG    1 
ATOM   2008 C CD    . GLN B 2 239 ? 38.708 21.005 -3.743  1.00 38.41  ? 240 GLN A CD    1 
ATOM   2009 O OE1   . GLN B 2 239 ? 39.130 21.684 -2.806  1.00 40.43  ? 240 GLN A OE1   1 
ATOM   2010 N NE2   . GLN B 2 239 ? 39.503 20.514 -4.687  1.00 41.40  ? 240 GLN A NE2   1 
ATOM   2011 N N     . GLY B 2 240 ? 36.574 23.118 -7.207  1.00 35.15  ? 241 GLY A N     1 
ATOM   2012 C CA    . GLY B 2 240 ? 36.084 22.841 -8.547  1.00 37.87  ? 241 GLY A CA    1 
ATOM   2013 C C     . GLY B 2 240 ? 36.217 21.416 -9.047  1.00 39.46  ? 241 GLY A C     1 
ATOM   2014 O O     . GLY B 2 240 ? 35.721 21.091 -10.124 1.00 40.02  ? 241 GLY A O     1 
ATOM   2015 N N     . ASP B 2 241 ? 36.887 20.571 -8.272  1.00 43.25  ? 242 ASP A N     1 
ATOM   2016 C CA    . ASP B 2 241 ? 37.088 19.173 -8.636  1.00 48.11  ? 242 ASP A CA    1 
ATOM   2017 C C     . ASP B 2 241 ? 35.830 18.353 -8.379  1.00 48.67  ? 242 ASP A C     1 
ATOM   2018 O O     . ASP B 2 241 ? 35.538 17.403 -9.104  1.00 50.85  ? 242 ASP A O     1 
ATOM   2019 C CB    . ASP B 2 241 ? 38.236 18.569 -7.817  1.00 52.66  ? 242 ASP A CB    1 
ATOM   2020 C CG    . ASP B 2 241 ? 39.575 19.246 -8.072  1.00 60.44  ? 242 ASP A CG    1 
ATOM   2021 O OD1   . ASP B 2 241 ? 39.606 20.369 -8.625  1.00 65.85  ? 242 ASP A OD1   1 
ATOM   2022 O OD2   . ASP B 2 241 ? 40.608 18.648 -7.705  1.00 63.31  ? 242 ASP A OD2   1 
ATOM   2023 N N     . GLY B 2 242 ? 35.082 18.744 -7.352  1.00 49.16  ? 243 GLY A N     1 
ATOM   2024 C CA    . GLY B 2 242 ? 33.881 18.020 -6.977  1.00 49.55  ? 243 GLY A CA    1 
ATOM   2025 C C     . GLY B 2 242 ? 34.191 17.195 -5.739  1.00 50.64  ? 243 GLY A C     1 
ATOM   2026 O O     . GLY B 2 242 ? 33.322 16.515 -5.190  1.00 50.99  ? 243 GLY A O     1 
ATOM   2027 N N     . ARG B 2 243 ? 35.448 17.268 -5.306  1.00 51.09  ? 244 ARG A N     1 
ATOM   2028 C CA    . ARG B 2 243 ? 35.937 16.553 -4.132  1.00 51.47  ? 244 ARG A CA    1 
ATOM   2029 C C     . ARG B 2 243 ? 35.689 17.337 -2.846  1.00 49.19  ? 244 ARG A C     1 
ATOM   2030 O O     . ARG B 2 243 ? 35.282 18.499 -2.880  1.00 47.15  ? 244 ARG A O     1 
ATOM   2031 C CB    . ARG B 2 243 ? 37.438 16.278 -4.279  1.00 55.49  ? 244 ARG A CB    1 
ATOM   2032 C CG    . ARG B 2 243 ? 37.786 15.150 -5.239  1.00 61.97  ? 244 ARG A CG    1 
ATOM   2033 C CD    . ARG B 2 243 ? 37.913 13.806 -4.520  1.00 70.70  ? 244 ARG A CD    1 
ATOM   2034 N NE    . ARG B 2 243 ? 36.688 13.401 -3.831  1.00 76.02  ? 244 ARG A NE    1 
ATOM   2035 C CZ    . ARG B 2 243 ? 36.550 13.355 -2.508  1.00 78.06  ? 244 ARG A CZ    1 
ATOM   2036 N NH1   . ARG B 2 243 ? 37.560 13.689 -1.713  1.00 78.37  ? 244 ARG A NH1   1 
ATOM   2037 N NH2   . ARG B 2 243 ? 35.395 12.977 -1.976  1.00 77.86  ? 244 ARG A NH2   1 
ATOM   2038 N N     . GLU B 2 244 ? 35.944 16.690 -1.714  1.00 47.72  ? 245 GLU A N     1 
ATOM   2039 C CA    . GLU B 2 244 ? 35.763 17.311 -0.407  1.00 45.26  ? 245 GLU A CA    1 
ATOM   2040 C C     . GLU B 2 244 ? 36.919 18.270 -0.140  1.00 40.03  ? 245 GLU A C     1 
ATOM   2041 O O     . GLU B 2 244 ? 37.999 18.123 -0.717  1.00 37.87  ? 245 GLU A O     1 
ATOM   2042 C CB    . GLU B 2 244 ? 35.734 16.240 0.689   1.00 51.25  ? 245 GLU A CB    1 
ATOM   2043 C CG    . GLU B 2 244 ? 34.797 15.065 0.424   1.00 62.21  ? 245 GLU A CG    1 
ATOM   2044 C CD    . GLU B 2 244 ? 33.338 15.474 0.319   1.00 70.87  ? 245 GLU A CD    1 
ATOM   2045 O OE1   . GLU B 2 244 ? 32.724 15.773 1.366   1.00 74.83  ? 245 GLU A OE1   1 
ATOM   2046 O OE2   . GLU B 2 244 ? 32.803 15.486 -0.811  1.00 73.51  ? 245 GLU A OE2   1 
ATOM   2047 N N     . TRP B 2 245 ? 36.689 19.252 0.725   1.00 35.99  ? 246 TRP A N     1 
ATOM   2048 C CA    . TRP B 2 245 ? 37.725 20.221 1.073   1.00 32.64  ? 246 TRP A CA    1 
ATOM   2049 C C     . TRP B 2 245 ? 38.784 19.615 1.986   1.00 32.88  ? 246 TRP A C     1 
ATOM   2050 O O     . TRP B 2 245 ? 38.479 18.799 2.858   1.00 35.86  ? 246 TRP A O     1 
ATOM   2051 C CB    . TRP B 2 245 ? 37.114 21.447 1.756   1.00 29.05  ? 246 TRP A CB    1 
ATOM   2052 C CG    . TRP B 2 245 ? 36.826 22.588 0.828   1.00 26.97  ? 246 TRP A CG    1 
ATOM   2053 C CD1   . TRP B 2 245 ? 35.607 22.963 0.341   1.00 27.11  ? 246 TRP A CD1   1 
ATOM   2054 C CD2   . TRP B 2 245 ? 37.776 23.522 0.295   1.00 25.90  ? 246 TRP A CD2   1 
ATOM   2055 N NE1   . TRP B 2 245 ? 35.737 24.072 -0.458  1.00 26.47  ? 246 TRP A NE1   1 
ATOM   2056 C CE2   . TRP B 2 245 ? 37.057 24.436 -0.505  1.00 27.29  ? 246 TRP A CE2   1 
ATOM   2057 C CE3   . TRP B 2 245 ? 39.164 23.675 0.416   1.00 22.39  ? 246 TRP A CE3   1 
ATOM   2058 C CZ2   . TRP B 2 245 ? 37.679 25.491 -1.182  1.00 24.48  ? 246 TRP A CZ2   1 
ATOM   2059 C CZ3   . TRP B 2 245 ? 39.783 24.724 -0.258  1.00 22.13  ? 246 TRP A CZ3   1 
ATOM   2060 C CH2   . TRP B 2 245 ? 39.038 25.618 -1.047  1.00 23.51  ? 246 TRP A CH2   1 
ATOM   2061 N N     . ASP B 2 246 ? 40.032 20.017 1.769   1.00 31.84  ? 247 ASP A N     1 
ATOM   2062 C CA    . ASP B 2 246 ? 41.155 19.545 2.570   1.00 32.74  ? 247 ASP A CA    1 
ATOM   2063 C C     . ASP B 2 246 ? 41.281 20.498 3.758   1.00 30.33  ? 247 ASP A C     1 
ATOM   2064 O O     . ASP B 2 246 ? 41.459 21.700 3.575   1.00 30.40  ? 247 ASP A O     1 
ATOM   2065 C CB    . ASP B 2 246 ? 42.436 19.576 1.727   1.00 37.37  ? 247 ASP A CB    1 
ATOM   2066 C CG    . ASP B 2 246 ? 43.586 18.804 2.357   1.00 43.25  ? 247 ASP A CG    1 
ATOM   2067 O OD1   . ASP B 2 246 ? 43.769 18.864 3.592   1.00 45.80  ? 247 ASP A OD1   1 
ATOM   2068 O OD2   . ASP B 2 246 ? 44.322 18.142 1.597   1.00 45.60  ? 247 ASP A OD2   1 
ATOM   2069 N N     . SER B 2 247 ? 41.182 19.960 4.971   1.00 31.08  ? 248 SER A N     1 
ATOM   2070 C CA    . SER B 2 247 ? 41.275 20.775 6.180   1.00 30.46  ? 248 SER A CA    1 
ATOM   2071 C C     . SER B 2 247 ? 42.585 21.547 6.310   1.00 31.69  ? 248 SER A C     1 
ATOM   2072 O O     . SER B 2 247 ? 42.601 22.652 6.854   1.00 31.58  ? 248 SER A O     1 
ATOM   2073 C CB    . SER B 2 247 ? 41.044 19.918 7.424   1.00 27.78  ? 248 SER A CB    1 
ATOM   2074 O OG    . SER B 2 247 ? 39.704 19.468 7.477   1.00 32.41  ? 248 SER A OG    1 
ATOM   2075 N N     . LYS B 2 248 ? 43.675 20.967 5.810   1.00 32.21  ? 249 LYS A N     1 
ATOM   2076 C CA    . LYS B 2 248 ? 44.982 21.614 5.868   1.00 31.62  ? 249 LYS A CA    1 
ATOM   2077 C C     . LYS B 2 248 ? 44.989 22.914 5.072   1.00 30.98  ? 249 LYS A C     1 
ATOM   2078 O O     . LYS B 2 248 ? 45.483 23.934 5.551   1.00 30.28  ? 249 LYS A O     1 
ATOM   2079 C CB    . LYS B 2 248 ? 46.078 20.683 5.341   1.00 35.49  ? 249 LYS A CB    1 
ATOM   2080 C CG    . LYS B 2 248 ? 47.472 21.309 5.332   1.00 40.94  ? 249 LYS A CG    1 
ATOM   2081 C CD    . LYS B 2 248 ? 48.507 20.384 4.707   1.00 51.40  ? 249 LYS A CD    1 
ATOM   2082 C CE    . LYS B 2 248 ? 48.696 19.115 5.526   1.00 57.47  ? 249 LYS A CE    1 
ATOM   2083 N NZ    . LYS B 2 248 ? 49.653 18.165 4.889   1.00 59.94  ? 249 LYS A NZ    1 
ATOM   2084 N N     . ILE B 2 249 ? 44.443 22.877 3.858   1.00 28.64  ? 250 ILE A N     1 
ATOM   2085 C CA    . ILE B 2 249 ? 44.406 24.071 3.024   1.00 29.75  ? 250 ILE A CA    1 
ATOM   2086 C C     . ILE B 2 249 ? 43.361 25.079 3.494   1.00 28.97  ? 250 ILE A C     1 
ATOM   2087 O O     . ILE B 2 249 ? 43.527 26.280 3.290   1.00 28.28  ? 250 ILE A O     1 
ATOM   2088 C CB    . ILE B 2 249 ? 44.225 23.744 1.520   1.00 32.68  ? 250 ILE A CB    1 
ATOM   2089 C CG1   . ILE B 2 249 ? 42.890 23.055 1.262   1.00 37.12  ? 250 ILE A CG1   1 
ATOM   2090 C CG2   . ILE B 2 249 ? 45.372 22.870 1.032   1.00 33.60  ? 250 ILE A CG2   1 
ATOM   2091 C CD1   . ILE B 2 249 ? 42.651 22.753 -0.197  1.00 43.78  ? 250 ILE A CD1   1 
ATOM   2092 N N     . MET B 2 250 ? 42.295 24.598 4.132   1.00 28.71  ? 251 MET A N     1 
ATOM   2093 C CA    . MET B 2 250 ? 41.266 25.494 4.654   1.00 28.57  ? 251 MET A CA    1 
ATOM   2094 C C     . MET B 2 250 ? 41.904 26.330 5.757   1.00 26.73  ? 251 MET A C     1 
ATOM   2095 O O     . MET B 2 250 ? 41.667 27.533 5.856   1.00 27.08  ? 251 MET A O     1 
ATOM   2096 C CB    . MET B 2 250 ? 40.083 24.718 5.237   1.00 32.15  ? 251 MET A CB    1 
ATOM   2097 C CG    . MET B 2 250 ? 39.143 24.105 4.219   1.00 37.23  ? 251 MET A CG    1 
ATOM   2098 S SD    . MET B 2 250 ? 37.492 23.847 4.918   1.00 45.25  ? 251 MET A SD    1 
ATOM   2099 C CE    . MET B 2 250 ? 37.841 22.637 6.191   1.00 44.09  ? 251 MET A CE    1 
ATOM   2100 N N     . PHE B 2 251 ? 42.733 25.677 6.569   1.00 26.43  ? 252 PHE A N     1 
ATOM   2101 C CA    . PHE B 2 251 ? 43.437 26.327 7.669   1.00 25.35  ? 252 PHE A CA    1 
ATOM   2102 C C     . PHE B 2 251 ? 44.392 27.404 7.160   1.00 25.16  ? 252 PHE A C     1 
ATOM   2103 O O     . PHE B 2 251 ? 44.432 28.507 7.702   1.00 27.52  ? 252 PHE A O     1 
ATOM   2104 C CB    . PHE B 2 251 ? 44.212 25.287 8.491   1.00 25.35  ? 252 PHE A CB    1 
ATOM   2105 C CG    . PHE B 2 251 ? 45.146 25.887 9.505   1.00 27.50  ? 252 PHE A CG    1 
ATOM   2106 C CD1   . PHE B 2 251 ? 44.656 26.408 10.699  1.00 29.96  ? 252 PHE A CD1   1 
ATOM   2107 C CD2   . PHE B 2 251 ? 46.513 25.958 9.252   1.00 28.99  ? 252 PHE A CD2   1 
ATOM   2108 C CE1   . PHE B 2 251 ? 45.515 26.994 11.629  1.00 32.00  ? 252 PHE A CE1   1 
ATOM   2109 C CE2   . PHE B 2 251 ? 47.381 26.541 10.174  1.00 33.42  ? 252 PHE A CE2   1 
ATOM   2110 C CZ    . PHE B 2 251 ? 46.880 27.061 11.365  1.00 34.13  ? 252 PHE A CZ    1 
ATOM   2111 N N     . GLU B 2 252 ? 45.160 27.077 6.123   1.00 23.43  ? 253 GLU A N     1 
ATOM   2112 C CA    . GLU B 2 252 ? 46.121 28.013 5.545   1.00 25.86  ? 253 GLU A CA    1 
ATOM   2113 C C     . GLU B 2 252 ? 45.436 29.242 4.958   1.00 24.44  ? 253 GLU A C     1 
ATOM   2114 O O     . GLU B 2 252 ? 45.935 30.361 5.083   1.00 24.66  ? 253 GLU A O     1 
ATOM   2115 C CB    . GLU B 2 252 ? 46.956 27.317 4.468   1.00 28.39  ? 253 GLU A CB    1 
ATOM   2116 C CG    . GLU B 2 252 ? 47.764 26.135 4.984   1.00 38.70  ? 253 GLU A CG    1 
ATOM   2117 C CD    . GLU B 2 252 ? 48.587 25.466 3.899   1.00 45.54  ? 253 GLU A CD    1 
ATOM   2118 O OE1   . GLU B 2 252 ? 48.008 25.071 2.864   1.00 48.88  ? 253 GLU A OE1   1 
ATOM   2119 O OE2   . GLU B 2 252 ? 49.815 25.329 4.085   1.00 50.12  ? 253 GLU A OE2   1 
ATOM   2120 N N     . ILE B 2 253 ? 44.284 29.023 4.332   1.00 25.13  ? 254 ILE A N     1 
ATOM   2121 C CA    . ILE B 2 253 ? 43.512 30.099 3.722   1.00 23.96  ? 254 ILE A CA    1 
ATOM   2122 C C     . ILE B 2 253 ? 42.923 31.024 4.785   1.00 24.74  ? 254 ILE A C     1 
ATOM   2123 O O     . ILE B 2 253 ? 42.989 32.246 4.656   1.00 26.85  ? 254 ILE A O     1 
ATOM   2124 C CB    . ILE B 2 253 ? 42.379 29.530 2.835   1.00 25.15  ? 254 ILE A CB    1 
ATOM   2125 C CG1   . ILE B 2 253 ? 42.976 28.837 1.605   1.00 24.58  ? 254 ILE A CG1   1 
ATOM   2126 C CG2   . ILE B 2 253 ? 41.419 30.634 2.420   1.00 24.38  ? 254 ILE A CG2   1 
ATOM   2127 C CD1   . ILE B 2 253 ? 41.990 27.994 0.825   1.00 22.01  ? 254 ILE A CD1   1 
ATOM   2128 N N     . MET B 2 254 ? 42.365 30.433 5.838   1.00 22.50  ? 255 MET A N     1 
ATOM   2129 C CA    . MET B 2 254 ? 41.765 31.199 6.925   1.00 22.37  ? 255 MET A CA    1 
ATOM   2130 C C     . MET B 2 254 ? 42.804 31.945 7.754   1.00 23.29  ? 255 MET A C     1 
ATOM   2131 O O     . MET B 2 254 ? 42.560 33.068 8.192   1.00 23.84  ? 255 MET A O     1 
ATOM   2132 C CB    . MET B 2 254 ? 40.927 30.288 7.821   1.00 22.26  ? 255 MET A CB    1 
ATOM   2133 C CG    . MET B 2 254 ? 39.635 29.817 7.182   1.00 25.59  ? 255 MET A CG    1 
ATOM   2134 S SD    . MET B 2 254 ? 38.668 28.767 8.277   1.00 34.98  ? 255 MET A SD    1 
ATOM   2135 C CE    . MET B 2 254 ? 38.717 27.253 7.411   1.00 32.80  ? 255 MET A CE    1 
ATOM   2136 N N     . PHE B 2 255 ? 43.963 31.324 7.959   1.00 23.45  ? 256 PHE A N     1 
ATOM   2137 C CA    . PHE B 2 255 ? 45.039 31.944 8.725   1.00 25.22  ? 256 PHE A CA    1 
ATOM   2138 C C     . PHE B 2 255 ? 45.595 33.137 7.953   1.00 27.22  ? 256 PHE A C     1 
ATOM   2139 O O     . PHE B 2 255 ? 45.929 34.165 8.538   1.00 28.85  ? 256 PHE A O     1 
ATOM   2140 C CB    . PHE B 2 255 ? 46.157 30.937 9.007   1.00 25.62  ? 256 PHE A CB    1 
ATOM   2141 C CG    . PHE B 2 255 ? 47.241 31.475 9.900   1.00 28.91  ? 256 PHE A CG    1 
ATOM   2142 C CD1   . PHE B 2 255 ? 47.057 31.535 11.278  1.00 28.12  ? 256 PHE A CD1   1 
ATOM   2143 C CD2   . PHE B 2 255 ? 48.438 31.937 9.364   1.00 29.31  ? 256 PHE A CD2   1 
ATOM   2144 C CE1   . PHE B 2 255 ? 48.049 32.050 12.110  1.00 26.76  ? 256 PHE A CE1   1 
ATOM   2145 C CE2   . PHE B 2 255 ? 49.437 32.455 10.189  1.00 32.73  ? 256 PHE A CE2   1 
ATOM   2146 C CZ    . PHE B 2 255 ? 49.240 32.511 11.566  1.00 27.44  ? 256 PHE A CZ    1 
ATOM   2147 N N     . ASP B 2 256 ? 45.685 32.987 6.634   1.00 27.38  ? 257 ASP A N     1 
ATOM   2148 C CA    . ASP B 2 256 ? 46.184 34.041 5.758   1.00 28.60  ? 257 ASP A CA    1 
ATOM   2149 C C     . ASP B 2 256 ? 45.290 35.278 5.833   1.00 27.50  ? 257 ASP A C     1 
ATOM   2150 O O     . ASP B 2 256 ? 45.780 36.401 5.938   1.00 27.76  ? 257 ASP A O     1 
ATOM   2151 C CB    . ASP B 2 256 ? 46.253 33.527 4.315   1.00 30.66  ? 257 ASP A CB    1 
ATOM   2152 C CG    . ASP B 2 256 ? 46.588 34.618 3.313   1.00 36.01  ? 257 ASP A CG    1 
ATOM   2153 O OD1   . ASP B 2 256 ? 47.573 35.355 3.528   1.00 39.02  ? 257 ASP A OD1   1 
ATOM   2154 O OD2   . ASP B 2 256 ? 45.863 34.733 2.304   1.00 40.31  ? 257 ASP A OD2   1 
ATOM   2155 N N     . ILE B 2 257 ? 43.979 35.060 5.782   1.00 26.62  ? 258 ILE A N     1 
ATOM   2156 C CA    . ILE B 2 257 ? 43.014 36.152 5.843   1.00 24.99  ? 258 ILE A CA    1 
ATOM   2157 C C     . ILE B 2 257 ? 43.033 36.809 7.219   1.00 24.72  ? 258 ILE A C     1 
ATOM   2158 O O     . ILE B 2 257 ? 42.893 38.028 7.332   1.00 24.95  ? 258 ILE A O     1 
ATOM   2159 C CB    . ILE B 2 257 ? 41.592 35.659 5.484   1.00 22.37  ? 258 ILE A CB    1 
ATOM   2160 C CG1   . ILE B 2 257 ? 41.569 35.213 4.020   1.00 23.03  ? 258 ILE A CG1   1 
ATOM   2161 C CG2   . ILE B 2 257 ? 40.566 36.758 5.709   1.00 22.51  ? 258 ILE A CG2   1 
ATOM   2162 C CD1   . ILE B 2 257 ? 40.239 34.698 3.545   1.00 25.49  ? 258 ILE A CD1   1 
ATOM   2163 N N     . SER B 2 258 ? 43.254 36.002 8.255   1.00 24.62  ? 259 SER A N     1 
ATOM   2164 C CA    . SER B 2 258 ? 43.312 36.502 9.626   1.00 23.39  ? 259 SER A CA    1 
ATOM   2165 C C     . SER B 2 258 ? 44.505 37.429 9.838   1.00 22.95  ? 259 SER A C     1 
ATOM   2166 O O     . SER B 2 258 ? 44.379 38.466 10.487  1.00 22.80  ? 259 SER A O     1 
ATOM   2167 C CB    . SER B 2 258 ? 43.376 35.341 10.620  1.00 22.86  ? 259 SER A CB    1 
ATOM   2168 O OG    . SER B 2 258 ? 42.143 34.649 10.673  1.00 27.41  ? 259 SER A OG    1 
ATOM   2169 N N     . THR B 2 259 ? 45.657 37.058 9.283   1.00 24.29  ? 260 THR A N     1 
ATOM   2170 C CA    . THR B 2 259 ? 46.866 37.869 9.413   1.00 25.03  ? 260 THR A CA    1 
ATOM   2171 C C     . THR B 2 259 ? 46.736 39.177 8.640   1.00 23.77  ? 260 THR A C     1 
ATOM   2172 O O     . THR B 2 259 ? 47.288 40.201 9.042   1.00 23.99  ? 260 THR A O     1 
ATOM   2173 C CB    . THR B 2 259 ? 48.128 37.105 8.954   1.00 26.98  ? 260 THR A CB    1 
ATOM   2174 O OG1   . THR B 2 259 ? 47.919 36.561 7.646   1.00 35.31  ? 260 THR A OG1   1 
ATOM   2175 C CG2   . THR B 2 259 ? 48.444 35.979 9.920   1.00 28.54  ? 260 THR A CG2   1 
ATOM   2176 N N     . THR B 2 260 ? 45.985 39.139 7.542   1.00 22.41  ? 261 THR A N     1 
ATOM   2177 C CA    . THR B 2 260 ? 45.757 40.325 6.726   1.00 23.14  ? 261 THR A CA    1 
ATOM   2178 C C     . THR B 2 260 ? 44.911 41.307 7.534   1.00 23.88  ? 261 THR A C     1 
ATOM   2179 O O     . THR B 2 260 ? 45.134 42.517 7.486   1.00 24.31  ? 261 THR A O     1 
ATOM   2180 C CB    . THR B 2 260 ? 45.027 39.971 5.415   1.00 23.14  ? 261 THR A CB    1 
ATOM   2181 O OG1   . THR B 2 260 ? 45.803 39.021 4.679   1.00 26.49  ? 261 THR A OG1   1 
ATOM   2182 C CG2   . THR B 2 260 ? 44.830 41.211 4.560   1.00 25.17  ? 261 THR A CG2   1 
ATOM   2183 N N     . SER B 2 261 ? 43.956 40.771 8.293   1.00 23.39  ? 262 SER A N     1 
ATOM   2184 C CA    . SER B 2 261 ? 43.083 41.581 9.138   1.00 22.95  ? 262 SER A CA    1 
ATOM   2185 C C     . SER B 2 261 ? 43.908 42.298 10.203  1.00 24.53  ? 262 SER A C     1 
ATOM   2186 O O     . SER B 2 261 ? 43.610 43.435 10.570  1.00 24.59  ? 262 SER A O     1 
ATOM   2187 C CB    . SER B 2 261 ? 42.029 40.703 9.815   1.00 21.55  ? 262 SER A CB    1 
ATOM   2188 O OG    . SER B 2 261 ? 41.151 40.124 8.868   1.00 22.05  ? 262 SER A OG    1 
ATOM   2189 N N     . LEU B 2 262 ? 44.946 41.622 10.690  1.00 25.59  ? 263 LEU A N     1 
ATOM   2190 C CA    . LEU B 2 262 ? 45.832 42.183 11.703  1.00 26.56  ? 263 LEU A CA    1 
ATOM   2191 C C     . LEU B 2 262 ? 46.666 43.325 11.132  1.00 29.04  ? 263 LEU A C     1 
ATOM   2192 O O     . LEU B 2 262 ? 46.947 44.299 11.830  1.00 27.58  ? 263 LEU A O     1 
ATOM   2193 C CB    . LEU B 2 262 ? 46.738 41.095 12.285  1.00 26.84  ? 263 LEU A CB    1 
ATOM   2194 C CG    . LEU B 2 262 ? 46.273 40.403 13.571  1.00 25.61  ? 263 LEU A CG    1 
ATOM   2195 C CD1   . LEU B 2 262 ? 44.796 40.077 13.519  1.00 32.16  ? 263 LEU A CD1   1 
ATOM   2196 C CD2   . LEU B 2 262 ? 47.090 39.148 13.798  1.00 26.17  ? 263 LEU A CD2   1 
ATOM   2197 N N     . ARG B 2 263 ? 47.047 43.209 9.861   1.00 29.33  ? 264 ARG A N     1 
ATOM   2198 C CA    . ARG B 2 263 ? 47.836 44.248 9.204   1.00 31.06  ? 264 ARG A CA    1 
ATOM   2199 C C     . ARG B 2 263 ? 47.033 45.537 9.090   1.00 29.30  ? 264 ARG A C     1 
ATOM   2200 O O     . ARG B 2 263 ? 47.563 46.628 9.301   1.00 29.35  ? 264 ARG A O     1 
ATOM   2201 C CB    . ARG B 2 263 ? 48.285 43.803 7.811   1.00 32.75  ? 264 ARG A CB    1 
ATOM   2202 C CG    . ARG B 2 263 ? 49.282 42.663 7.807   1.00 42.34  ? 264 ARG A CG    1 
ATOM   2203 C CD    . ARG B 2 263 ? 49.981 42.553 6.460   1.00 52.51  ? 264 ARG A CD    1 
ATOM   2204 N NE    . ARG B 2 263 ? 49.054 42.322 5.354   1.00 61.15  ? 264 ARG A NE    1 
ATOM   2205 C CZ    . ARG B 2 263 ? 48.995 41.196 4.649   1.00 64.99  ? 264 ARG A CZ    1 
ATOM   2206 N NH1   . ARG B 2 263 ? 49.808 40.186 4.930   1.00 65.73  ? 264 ARG A NH1   1 
ATOM   2207 N NH2   . ARG B 2 263 ? 48.127 41.083 3.652   1.00 64.77  ? 264 ARG A NH2   1 
ATOM   2208 N N     . VAL B 2 264 ? 45.752 45.397 8.755   1.00 28.20  ? 265 VAL A N     1 
ATOM   2209 C CA    . VAL B 2 264 ? 44.848 46.536 8.613   1.00 26.10  ? 265 VAL A CA    1 
ATOM   2210 C C     . VAL B 2 264 ? 44.581 47.157 9.985   1.00 26.01  ? 265 VAL A C     1 
ATOM   2211 O O     . VAL B 2 264 ? 44.464 48.375 10.115  1.00 26.26  ? 265 VAL A O     1 
ATOM   2212 C CB    . VAL B 2 264 ? 43.503 46.102 7.980   1.00 26.22  ? 265 VAL A CB    1 
ATOM   2213 C CG1   . VAL B 2 264 ? 42.601 47.306 7.769   1.00 25.82  ? 265 VAL A CG1   1 
ATOM   2214 C CG2   . VAL B 2 264 ? 43.746 45.386 6.660   1.00 26.59  ? 265 VAL A CG2   1 
ATOM   2215 N N     . LEU B 2 265 ? 44.506 46.301 11.000  1.00 24.44  ? 266 LEU A N     1 
ATOM   2216 C CA    . LEU B 2 265 ? 44.260 46.712 12.381  1.00 27.53  ? 266 LEU A CA    1 
ATOM   2217 C C     . LEU B 2 265 ? 45.543 47.135 13.098  1.00 29.74  ? 266 LEU A C     1 
ATOM   2218 O O     . LEU B 2 265 ? 45.499 47.570 14.247  1.00 31.15  ? 266 LEU A O     1 
ATOM   2219 C CB    . LEU B 2 265 ? 43.627 45.545 13.145  1.00 28.14  ? 266 LEU A CB    1 
ATOM   2220 C CG    . LEU B 2 265 ? 42.148 45.570 13.533  1.00 30.88  ? 266 LEU A CG    1 
ATOM   2221 C CD1   . LEU B 2 265 ? 41.313 46.314 12.514  1.00 31.08  ? 266 LEU A CD1   1 
ATOM   2222 C CD2   . LEU B 2 265 ? 41.668 44.139 13.699  1.00 27.89  ? 266 LEU A CD2   1 
ATOM   2223 N N     . GLY B 2 266 ? 46.673 47.012 12.404  1.00 30.56  ? 267 GLY A N     1 
ATOM   2224 C CA    . GLY B 2 266 ? 47.973 47.342 12.967  1.00 29.50  ? 267 GLY A CA    1 
ATOM   2225 C C     . GLY B 2 266 ? 48.100 48.563 13.858  1.00 31.36  ? 267 GLY A C     1 
ATOM   2226 O O     . GLY B 2 266 ? 48.709 48.489 14.926  1.00 30.92  ? 267 GLY A O     1 
ATOM   2227 N N     . ARG B 2 267 ? 47.522 49.680 13.427  1.00 31.25  ? 268 ARG A N     1 
ATOM   2228 C CA    . ARG B 2 267 ? 47.587 50.931 14.181  1.00 32.42  ? 268 ARG A CA    1 
ATOM   2229 C C     . ARG B 2 267 ? 46.963 50.863 15.576  1.00 33.70  ? 268 ARG A C     1 
ATOM   2230 O O     . ARG B 2 267 ? 47.419 51.543 16.496  1.00 34.88  ? 268 ARG A O     1 
ATOM   2231 C CB    . ARG B 2 267 ? 46.952 52.063 13.369  1.00 30.53  ? 268 ARG A CB    1 
ATOM   2232 C CG    . ARG B 2 267 ? 45.495 51.834 12.997  1.00 29.87  ? 268 ARG A CG    1 
ATOM   2233 C CD    . ARG B 2 267 ? 45.042 52.824 11.939  1.00 30.60  ? 268 ARG A CD    1 
ATOM   2234 N NE    . ARG B 2 267 ? 45.768 52.640 10.685  1.00 30.67  ? 268 ARG A NE    1 
ATOM   2235 C CZ    . ARG B 2 267 ? 45.771 53.512 9.681   1.00 33.22  ? 268 ARG A CZ    1 
ATOM   2236 N NH1   . ARG B 2 267 ? 45.084 54.643 9.770   1.00 34.72  ? 268 ARG A NH1   1 
ATOM   2237 N NH2   . ARG B 2 267 ? 46.472 53.256 8.585   1.00 34.29  ? 268 ARG A NH2   1 
ATOM   2238 N N     . ASP B 2 268 ? 45.936 50.031 15.731  1.00 31.73  ? 269 ASP A N     1 
ATOM   2239 C CA    . ASP B 2 268 ? 45.247 49.877 17.012  1.00 29.50  ? 269 ASP A CA    1 
ATOM   2240 C C     . ASP B 2 268 ? 45.707 48.661 17.811  1.00 28.81  ? 269 ASP A C     1 
ATOM   2241 O O     . ASP B 2 268 ? 45.010 48.211 18.717  1.00 29.85  ? 269 ASP A O     1 
ATOM   2242 C CB    . ASP B 2 268 ? 43.732 49.799 16.792  1.00 28.22  ? 269 ASP A CB    1 
ATOM   2243 C CG    . ASP B 2 268 ? 43.157 51.069 16.188  1.00 31.05  ? 269 ASP A CG    1 
ATOM   2244 O OD1   . ASP B 2 268 ? 43.828 52.123 16.228  1.00 34.01  ? 269 ASP A OD1   1 
ATOM   2245 O OD2   . ASP B 2 268 ? 42.020 51.012 15.677  1.00 31.39  ? 269 ASP A OD2   1 
ATOM   2246 N N     . LEU B 2 269 ? 46.881 48.134 17.480  1.00 28.72  ? 270 LEU A N     1 
ATOM   2247 C CA    . LEU B 2 269 ? 47.426 46.966 18.170  1.00 29.02  ? 270 LEU A CA    1 
ATOM   2248 C C     . LEU B 2 269 ? 48.852 47.222 18.658  1.00 30.70  ? 270 LEU A C     1 
ATOM   2249 O O     . LEU B 2 269 ? 49.401 46.436 19.432  1.00 30.27  ? 270 LEU A O     1 
ATOM   2250 C CB    . LEU B 2 269 ? 47.420 45.748 17.236  1.00 30.29  ? 270 LEU A CB    1 
ATOM   2251 C CG    . LEU B 2 269 ? 46.200 44.825 17.122  1.00 28.10  ? 270 LEU A CG    1 
ATOM   2252 C CD1   . LEU B 2 269 ? 44.912 45.597 16.948  1.00 30.73  ? 270 LEU A CD1   1 
ATOM   2253 C CD2   . LEU B 2 269 ? 46.409 43.878 15.951  1.00 27.91  ? 270 LEU A CD2   1 
ATOM   2254 N N     . PHE B 2 270 ? 49.427 48.340 18.221  1.00 31.86  ? 271 PHE A N     1 
ATOM   2255 C CA    . PHE B 2 270 ? 50.794 48.720 18.567  1.00 33.85  ? 271 PHE A CA    1 
ATOM   2256 C C     . PHE B 2 270 ? 51.128 48.772 20.058  1.00 35.66  ? 271 PHE A C     1 
ATOM   2257 O O     . PHE B 2 270 ? 52.160 48.248 20.479  1.00 33.64  ? 271 PHE A O     1 
ATOM   2258 C CB    . PHE B 2 270 ? 51.145 50.062 17.920  1.00 34.72  ? 271 PHE A CB    1 
ATOM   2259 C CG    . PHE B 2 270 ? 52.551 50.518 18.193  1.00 35.38  ? 271 PHE A CG    1 
ATOM   2260 C CD1   . PHE B 2 270 ? 53.617 49.994 17.469  1.00 36.59  ? 271 PHE A CD1   1 
ATOM   2261 C CD2   . PHE B 2 270 ? 52.812 51.462 19.184  1.00 35.37  ? 271 PHE A CD2   1 
ATOM   2262 C CE1   . PHE B 2 270 ? 54.922 50.401 17.727  1.00 38.09  ? 271 PHE A CE1   1 
ATOM   2263 C CE2   . PHE B 2 270 ? 54.112 51.876 19.451  1.00 35.81  ? 271 PHE A CE2   1 
ATOM   2264 C CZ    . PHE B 2 270 ? 55.170 51.345 18.721  1.00 39.50  ? 271 PHE A CZ    1 
ATOM   2265 N N     . GLU B 2 271 ? 50.276 49.424 20.845  1.00 38.24  ? 272 GLU A N     1 
ATOM   2266 C CA    . GLU B 2 271 ? 50.508 49.550 22.282  1.00 41.98  ? 272 GLU A CA    1 
ATOM   2267 C C     . GLU B 2 271 ? 50.634 48.224 23.020  1.00 42.00  ? 272 GLU A C     1 
ATOM   2268 O O     . GLU B 2 271 ? 51.316 48.143 24.040  1.00 43.66  ? 272 GLU A O     1 
ATOM   2269 C CB    . GLU B 2 271 ? 49.425 50.413 22.931  1.00 46.46  ? 272 GLU A CB    1 
ATOM   2270 C CG    . GLU B 2 271 ? 49.571 51.903 22.657  1.00 54.49  ? 272 GLU A CG    1 
ATOM   2271 C CD    . GLU B 2 271 ? 50.857 52.478 23.230  1.00 59.99  ? 272 GLU A CD    1 
ATOM   2272 O OE1   . GLU B 2 271 ? 50.997 52.512 24.473  1.00 61.06  ? 272 GLU A OE1   1 
ATOM   2273 O OE2   . GLU B 2 271 ? 51.728 52.895 22.437  1.00 61.80  ? 272 GLU A OE2   1 
ATOM   2274 N N     . GLN B 2 272 ? 49.985 47.186 22.504  1.00 41.52  ? 273 GLN A N     1 
ATOM   2275 C CA    . GLN B 2 272 ? 50.046 45.871 23.131  1.00 42.73  ? 273 GLN A CA    1 
ATOM   2276 C C     . GLN B 2 272 ? 51.277 45.075 22.713  1.00 44.41  ? 273 GLN A C     1 
ATOM   2277 O O     . GLN B 2 272 ? 51.866 44.372 23.528  1.00 45.36  ? 273 GLN A O     1 
ATOM   2278 C CB    . GLN B 2 272 ? 48.768 45.084 22.852  1.00 42.39  ? 273 GLN A CB    1 
ATOM   2279 C CG    . GLN B 2 272 ? 47.553 45.638 23.572  1.00 40.78  ? 273 GLN A CG    1 
ATOM   2280 C CD    . GLN B 2 272 ? 46.286 44.887 23.237  1.00 41.04  ? 273 GLN A CD    1 
ATOM   2281 O OE1   . GLN B 2 272 ? 45.923 43.924 23.912  1.00 39.64  ? 273 GLN A OE1   1 
ATOM   2282 N NE2   . GLN B 2 272 ? 45.599 45.329 22.192  1.00 40.49  ? 273 GLN A NE2   1 
ATOM   2283 N N     . LEU B 2 273 ? 51.668 45.188 21.448  1.00 49.03  ? 274 LEU A N     1 
ATOM   2284 C CA    . LEU B 2 273 ? 52.848 44.485 20.950  1.00 54.98  ? 274 LEU A CA    1 
ATOM   2285 C C     . LEU B 2 273 ? 54.127 45.131 21.474  1.00 59.41  ? 274 LEU A C     1 
ATOM   2286 O O     . LEU B 2 273 ? 55.191 44.511 21.479  1.00 60.71  ? 274 LEU A O     1 
ATOM   2287 C CB    . LEU B 2 273 ? 52.870 44.486 19.422  1.00 56.43  ? 274 LEU A CB    1 
ATOM   2288 C CG    . LEU B 2 273 ? 51.817 43.640 18.710  1.00 58.65  ? 274 LEU A CG    1 
ATOM   2289 C CD1   . LEU B 2 273 ? 51.966 43.811 17.214  1.00 59.45  ? 274 LEU A CD1   1 
ATOM   2290 C CD2   . LEU B 2 273 ? 51.974 42.176 19.093  1.00 60.49  ? 274 LEU A CD2   1 
ATOM   2291 N N     . THR B 2 274 ? 54.010 46.384 21.905  1.00 65.47  ? 275 THR A N     1 
ATOM   2292 C CA    . THR B 2 274 ? 55.139 47.145 22.428  1.00 71.42  ? 275 THR A CA    1 
ATOM   2293 C C     . THR B 2 274 ? 55.160 47.152 23.956  1.00 76.07  ? 275 THR A C     1 
ATOM   2294 O O     . THR B 2 274 ? 56.045 46.559 24.574  1.00 76.87  ? 275 THR A O     1 
ATOM   2295 C CB    . THR B 2 274 ? 55.106 48.600 21.907  1.00 70.24  ? 275 THR A CB    1 
ATOM   2296 O OG1   . THR B 2 274 ? 55.228 48.598 20.480  1.00 68.57  ? 275 THR A OG1   1 
ATOM   2297 C CG2   . THR B 2 274 ? 56.237 49.423 22.509  1.00 72.99  ? 275 THR A CG2   1 
ATOM   2298 N N     . SER B 2 275 ? 54.184 47.829 24.555  1.00 81.48  ? 276 SER A N     1 
ATOM   2299 C CA    . SER B 2 275 ? 54.085 47.930 26.008  1.00 87.16  ? 276 SER A CA    1 
ATOM   2300 C C     . SER B 2 275 ? 53.508 46.661 26.634  1.00 89.62  ? 276 SER A C     1 
ATOM   2301 O O     . SER B 2 275 ? 52.360 46.643 27.084  1.00 90.30  ? 276 SER A O     1 
ATOM   2302 C CB    . SER B 2 275 ? 53.232 49.145 26.393  1.00 88.98  ? 276 SER A CB    1 
ATOM   2303 O OG    . SER B 2 275 ? 53.730 50.332 25.798  1.00 90.01  ? 276 SER A OG    1 
ATOM   2304 N N     . LYS B 2 276 ? 54.322 45.608 26.668  1.00 92.33  ? 277 LYS A N     1 
ATOM   2305 C CA    . LYS B 2 276 ? 53.932 44.314 27.232  1.00 95.63  ? 277 LYS A CA    1 
ATOM   2306 C C     . LYS B 2 276 ? 55.154 43.458 27.570  1.00 96.17  ? 277 LYS A C     1 
ATOM   2307 O O     . LYS B 2 276 ? 56.286 43.885 27.257  1.00 96.64  ? 277 LYS A O     1 
ATOM   2308 C CB    . LYS B 2 276 ? 53.023 43.554 26.258  1.00 97.21  ? 277 LYS A CB    1 
ATOM   2309 C CG    . LYS B 2 276 ? 51.529 43.807 26.446  1.00 98.01  ? 277 LYS A CG    1 
ATOM   2310 C CD    . LYS B 2 276 ? 50.898 42.811 27.406  1.00 98.95  ? 277 LYS A CD    1 
ATOM   2311 C CE    . LYS B 2 276 ? 50.928 41.405 26.825  1.00 99.16  ? 277 LYS A CE    1 
ATOM   2312 N NZ    . LYS B 2 276 ? 50.179 40.423 27.654  1.00 100.00 ? 277 LYS A NZ    1 
ATOM   2313 O OXT   . LYS B 2 276 ? 54.965 42.366 28.148  1.00 96.34  ? 277 LYS A OXT   1 
HETATM 2314 O O     . HOH C 3 .   ? 20.959 27.293 14.496  1.00 45.91  ? 14  HOH B O     1 
HETATM 2315 O O     . HOH C 3 .   ? 13.473 16.655 -10.805 1.00 29.87  ? 15  HOH B O     1 
HETATM 2316 O O     . HOH C 3 .   ? 17.538 19.856 2.814   1.00 37.15  ? 16  HOH B O     1 
HETATM 2317 O O     . HOH C 3 .   ? 20.095 18.946 -5.190  1.00 25.48  ? 17  HOH B O     1 
HETATM 2318 O O     . HOH C 3 .   ? 24.560 23.971 3.207   1.00 23.53  ? 18  HOH B O     1 
HETATM 2319 O O     . HOH C 3 .   ? 14.589 12.980 -7.654  1.00 23.17  ? 19  HOH B O     1 
HETATM 2320 O O     . HOH C 3 .   ? 19.019 30.638 8.133   1.00 21.40  ? 20  HOH B O     1 
HETATM 2321 O O     A HOH C 3 .   ? 19.818 22.609 9.994   0.50 20.08  ? 21  HOH B O     1 
HETATM 2322 O O     B HOH C 3 .   ? 20.068 21.172 11.616  0.50 16.99  ? 21  HOH B O     1 
HETATM 2323 O O     . HOH C 3 .   ? 14.150 20.725 2.606   1.00 24.92  ? 22  HOH B O     1 
HETATM 2324 O O     . HOH C 3 .   ? 19.862 15.136 -6.609  1.00 35.30  ? 23  HOH B O     1 
HETATM 2325 O O     . HOH C 3 .   ? 26.087 20.812 6.662   1.00 44.19  ? 24  HOH B O     1 
HETATM 2326 O O     . HOH C 3 .   ? 23.192 22.852 15.133  1.00 50.98  ? 25  HOH B O     1 
HETATM 2327 O O     . HOH C 3 .   ? 21.971 24.260 11.682  1.00 51.98  ? 26  HOH B O     1 
HETATM 2328 O O     A HOH C 3 .   ? 25.066 18.460 -1.154  0.50 15.48  ? 27  HOH B O     1 
HETATM 2329 O O     B HOH C 3 .   ? 26.661 18.167 -2.082  0.50 16.36  ? 27  HOH B O     1 
HETATM 2330 O O     . HOH C 3 .   ? 17.138 19.674 8.736   1.00 53.44  ? 28  HOH B O     1 
HETATM 2331 O O     . HOH C 3 .   ? 9.110  22.958 -19.614 1.00 47.76  ? 29  HOH B O     1 
HETATM 2332 O O     . HOH C 3 .   ? 22.994 30.121 6.556   1.00 40.59  ? 30  HOH B O     1 
HETATM 2333 O O     . HOH C 3 .   ? 16.542 11.746 -5.578  1.00 48.44  ? 31  HOH B O     1 
HETATM 2334 O O     . HOH C 3 .   ? 22.567 16.389 0.816   1.00 39.58  ? 32  HOH B O     1 
HETATM 2335 O O     . HOH C 3 .   ? 25.643 17.708 1.736   1.00 49.68  ? 33  HOH B O     1 
HETATM 2336 O O     . HOH C 3 .   ? 24.691 12.503 0.137   1.00 39.61  ? 34  HOH B O     1 
HETATM 2337 O O     . HOH C 3 .   ? 8.342  36.675 26.023  1.00 40.53  ? 35  HOH B O     1 
HETATM 2338 O O     . HOH C 3 .   ? 8.364  24.110 21.313  1.00 35.50  ? 36  HOH B O     1 
HETATM 2339 O O     . HOH D 3 .   ? 43.174 54.497 14.746  1.00 40.28  ? 278 HOH A O     1 
HETATM 2340 O O     . HOH D 3 .   ? 34.557 46.111 6.397   1.00 19.77  ? 279 HOH A O     1 
HETATM 2341 O O     . HOH D 3 .   ? 34.687 44.801 14.237  1.00 32.37  ? 280 HOH A O     1 
HETATM 2342 O O     . HOH D 3 .   ? 38.176 27.877 21.153  1.00 54.35  ? 281 HOH A O     1 
HETATM 2343 O O     . HOH D 3 .   ? 24.888 30.174 8.824   1.00 25.27  ? 282 HOH A O     1 
HETATM 2344 O O     . HOH D 3 .   ? 52.641 16.809 4.735   1.00 41.46  ? 283 HOH A O     1 
HETATM 2345 O O     . HOH D 3 .   ? 35.616 18.421 13.364  1.00 35.85  ? 284 HOH A O     1 
HETATM 2346 O O     . HOH D 3 .   ? 20.965 21.407 -6.584  1.00 24.93  ? 285 HOH A O     1 
HETATM 2347 O O     . HOH D 3 .   ? 37.893 35.536 -3.659  1.00 19.65  ? 286 HOH A O     1 
HETATM 2348 O O     . HOH D 3 .   ? 9.473  43.512 19.182  1.00 41.13  ? 287 HOH A O     1 
HETATM 2349 O O     . HOH D 3 .   ? 39.896 48.013 10.021  1.00 24.31  ? 288 HOH A O     1 
HETATM 2350 O O     . HOH D 3 .   ? 44.604 50.448 8.032   1.00 31.74  ? 289 HOH A O     1 
HETATM 2351 O O     . HOH D 3 .   ? 26.337 45.427 1.620   1.00 43.94  ? 290 HOH A O     1 
HETATM 2352 O O     . HOH D 3 .   ? 18.099 46.594 12.042  1.00 26.64  ? 291 HOH A O     1 
HETATM 2353 O O     . HOH D 3 .   ? 30.420 51.166 14.342  1.00 34.27  ? 292 HOH A O     1 
HETATM 2354 O O     . HOH D 3 .   ? 29.641 40.127 -9.973  1.00 33.66  ? 293 HOH A O     1 
HETATM 2355 O O     . HOH D 3 .   ? 42.381 49.919 -0.612  1.00 38.59  ? 294 HOH A O     1 
HETATM 2356 O O     . HOH D 3 .   ? 35.930 32.315 11.932  1.00 45.43  ? 295 HOH A O     1 
HETATM 2357 O O     . HOH D 3 .   ? 36.870 43.655 1.122   1.00 21.09  ? 296 HOH A O     1 
HETATM 2358 O O     . HOH D 3 .   ? 19.155 23.809 -13.854 1.00 28.01  ? 297 HOH A O     1 
HETATM 2359 O O     . HOH D 3 .   ? 23.563 25.415 -0.679  1.00 33.82  ? 298 HOH A O     1 
HETATM 2360 O O     . HOH D 3 .   ? 45.360 56.402 13.292  1.00 56.54  ? 299 HOH A O     1 
HETATM 2361 O O     . HOH D 3 .   ? 33.660 20.112 -4.443  1.00 31.55  ? 300 HOH A O     1 
HETATM 2362 O O     . HOH D 3 .   ? 14.106 15.043 -18.125 1.00 49.89  ? 301 HOH A O     1 
HETATM 2363 O O     . HOH D 3 .   ? 25.800 36.677 -7.558  1.00 27.13  ? 302 HOH A O     1 
HETATM 2364 O O     A HOH D 3 .   ? 17.581 22.152 -15.883 0.50 17.71  ? 303 HOH A O     1 
HETATM 2365 O O     B HOH D 3 .   ? 15.442 21.482 -15.584 0.50 32.74  ? 303 HOH A O     1 
HETATM 2366 O O     . HOH D 3 .   ? 26.548 40.229 -2.010  1.00 28.18  ? 304 HOH A O     1 
HETATM 2367 O O     . HOH D 3 .   ? 39.131 43.505 -1.719  1.00 26.33  ? 305 HOH A O     1 
HETATM 2368 O O     . HOH D 3 .   ? 30.856 48.904 12.199  1.00 33.71  ? 306 HOH A O     1 
HETATM 2369 O O     . HOH D 3 .   ? 41.026 49.311 3.124   1.00 19.82  ? 307 HOH A O     1 
HETATM 2370 O O     . HOH D 3 .   ? 39.119 19.751 -16.591 1.00 46.87  ? 308 HOH A O     1 
HETATM 2371 O O     . HOH D 3 .   ? 36.871 45.322 -1.509  1.00 20.81  ? 309 HOH A O     1 
HETATM 2372 O O     . HOH D 3 .   ? 33.201 42.815 17.527  1.00 35.22  ? 310 HOH A O     1 
HETATM 2373 O O     . HOH D 3 .   ? 18.455 27.408 -9.848  1.00 26.23  ? 311 HOH A O     1 
HETATM 2374 O O     . HOH D 3 .   ? 16.227 49.995 17.838  1.00 51.64  ? 312 HOH A O     1 
HETATM 2375 O O     . HOH D 3 .   ? 37.354 38.941 2.065   1.00 23.63  ? 313 HOH A O     1 
HETATM 2376 O O     . HOH D 3 .   ? 39.861 40.196 27.904  1.00 47.38  ? 314 HOH A O     1 
HETATM 2377 O O     . HOH D 3 .   ? 24.752 30.192 -12.294 1.00 39.28  ? 315 HOH A O     1 
HETATM 2378 O O     . HOH D 3 .   ? 22.571 41.937 -0.295  1.00 34.73  ? 316 HOH A O     1 
HETATM 2379 O O     . HOH D 3 .   ? 40.148 29.659 -10.049 1.00 40.12  ? 317 HOH A O     1 
HETATM 2380 O O     . HOH D 3 .   ? 28.862 28.492 14.883  1.00 37.00  ? 318 HOH A O     1 
HETATM 2381 O O     . HOH D 3 .   ? 33.719 36.636 -8.515  1.00 20.96  ? 319 HOH A O     1 
HETATM 2382 O O     . HOH D 3 .   ? 38.381 33.800 -11.063 1.00 37.09  ? 320 HOH A O     1 
HETATM 2383 O O     . HOH D 3 .   ? 22.702 27.340 1.354   1.00 47.27  ? 321 HOH A O     1 
HETATM 2384 O O     . HOH D 3 .   ? 38.941 36.437 -12.749 1.00 28.51  ? 322 HOH A O     1 
HETATM 2385 O O     . HOH D 3 .   ? 27.279 41.651 -9.603  1.00 25.40  ? 323 HOH A O     1 
HETATM 2386 O O     . HOH D 3 .   ? 37.784 31.655 22.912  1.00 29.20  ? 324 HOH A O     1 
HETATM 2387 O O     . HOH D 3 .   ? 26.622 24.017 5.494   1.00 40.67  ? 325 HOH A O     1 
HETATM 2388 O O     . HOH D 3 .   ? 46.153 53.646 5.518   1.00 40.32  ? 326 HOH A O     1 
HETATM 2389 O O     . HOH D 3 .   ? 33.908 45.073 21.822  1.00 43.10  ? 327 HOH A O     1 
HETATM 2390 O O     . HOH D 3 .   ? 38.198 51.275 11.876  1.00 36.04  ? 328 HOH A O     1 
HETATM 2391 O O     . HOH D 3 .   ? 41.792 41.728 -7.454  1.00 41.32  ? 329 HOH A O     1 
HETATM 2392 O O     . HOH D 3 .   ? 22.213 19.242 -9.131  1.00 27.68  ? 330 HOH A O     1 
HETATM 2393 O O     . HOH D 3 .   ? 29.980 22.983 7.773   1.00 40.31  ? 331 HOH A O     1 
HETATM 2394 O O     . HOH D 3 .   ? 41.454 23.427 -3.798  1.00 39.41  ? 332 HOH A O     1 
HETATM 2395 O O     . HOH D 3 .   ? 25.724 27.249 11.954  1.00 30.05  ? 333 HOH A O     1 
HETATM 2396 O O     . HOH D 3 .   ? 17.777 55.320 19.155  1.00 41.05  ? 334 HOH A O     1 
HETATM 2397 O O     . HOH D 3 .   ? 52.665 35.115 10.957  1.00 58.56  ? 335 HOH A O     1 
HETATM 2398 O O     . HOH D 3 .   ? 10.951 20.293 -15.731 1.00 49.36  ? 336 HOH A O     1 
HETATM 2399 O O     . HOH D 3 .   ? 43.508 54.151 7.028   1.00 51.81  ? 337 HOH A O     1 
HETATM 2400 O O     . HOH D 3 .   ? 22.823 46.373 1.627   1.00 43.10  ? 338 HOH A O     1 
HETATM 2401 O O     . HOH D 3 .   ? 17.317 34.799 -7.263  1.00 30.58  ? 339 HOH A O     1 
HETATM 2402 O O     . HOH D 3 .   ? 19.964 14.477 -16.988 1.00 30.85  ? 340 HOH A O     1 
HETATM 2403 O O     . HOH D 3 .   ? 13.605 19.664 -13.361 1.00 56.46  ? 341 HOH A O     1 
HETATM 2404 O O     . HOH D 3 .   ? 28.421 46.388 18.779  1.00 30.66  ? 342 HOH A O     1 
HETATM 2405 O O     . HOH D 3 .   ? 33.005 22.150 7.139   1.00 26.96  ? 343 HOH A O     1 
HETATM 2406 O O     . HOH D 3 .   ? 19.494 37.512 10.220  1.00 34.87  ? 344 HOH A O     1 
HETATM 2407 O O     . HOH D 3 .   ? 35.390 37.653 25.577  1.00 40.25  ? 345 HOH A O     1 
HETATM 2408 O O     . HOH D 3 .   ? 35.754 18.743 5.593   1.00 44.91  ? 346 HOH A O     1 
HETATM 2409 O O     . HOH D 3 .   ? 28.889 22.977 -11.500 1.00 25.78  ? 347 HOH A O     1 
HETATM 2410 O O     . HOH D 3 .   ? 15.528 54.494 14.632  1.00 45.37  ? 348 HOH A O     1 
HETATM 2411 O O     . HOH D 3 .   ? 41.279 51.515 12.979  1.00 42.42  ? 349 HOH A O     1 
HETATM 2412 O O     . HOH D 3 .   ? 25.465 31.785 5.184   1.00 31.43  ? 350 HOH A O     1 
HETATM 2413 O O     . HOH D 3 .   ? 25.537 19.653 -17.422 1.00 38.25  ? 351 HOH A O     1 
HETATM 2414 O O     . HOH D 3 .   ? 47.075 35.795 -0.213  1.00 44.05  ? 352 HOH A O     1 
HETATM 2415 O O     . HOH D 3 .   ? 26.063 25.860 26.364  1.00 48.81  ? 353 HOH A O     1 
HETATM 2416 O O     . HOH D 3 .   ? 27.011 46.370 21.482  1.00 36.57  ? 354 HOH A O     1 
HETATM 2417 O O     . HOH D 3 .   ? 21.851 17.328 -7.050  1.00 28.87  ? 355 HOH A O     1 
HETATM 2418 O O     . HOH D 3 .   ? 10.816 38.723 20.499  1.00 31.89  ? 356 HOH A O     1 
HETATM 2419 O O     . HOH D 3 .   ? 45.074 42.097 21.744  1.00 34.99  ? 357 HOH A O     1 
HETATM 2420 O O     . HOH D 3 .   ? 23.450 33.291 -12.198 1.00 27.99  ? 358 HOH A O     1 
HETATM 2421 O O     . HOH D 3 .   ? 38.851 25.922 -8.035  1.00 33.97  ? 359 HOH A O     1 
HETATM 2422 O O     . HOH D 3 .   ? 15.274 4.723  -11.858 1.00 36.48  ? 360 HOH A O     1 
HETATM 2423 O O     . HOH D 3 .   ? 15.621 17.901 -12.217 1.00 28.38  ? 361 HOH A O     1 
HETATM 2424 O O     . HOH D 3 .   ? 38.013 22.431 -18.084 1.00 48.28  ? 362 HOH A O     1 
HETATM 2425 O O     . HOH D 3 .   ? 37.726 57.599 -3.021  1.00 38.20  ? 363 HOH A O     1 
HETATM 2426 O O     . HOH D 3 .   ? 26.797 21.537 27.152  1.00 55.64  ? 364 HOH A O     1 
HETATM 2427 O O     . HOH D 3 .   ? 44.024 29.920 -3.705  1.00 44.43  ? 365 HOH A O     1 
HETATM 2428 O O     . HOH D 3 .   ? 14.748 52.259 11.807  1.00 26.69  ? 366 HOH A O     1 
HETATM 2429 O O     . HOH D 3 .   ? 34.331 46.914 18.119  1.00 49.42  ? 367 HOH A O     1 
HETATM 2430 O O     . HOH D 3 .   ? 34.824 45.502 24.863  1.00 32.02  ? 368 HOH A O     1 
HETATM 2431 O O     . HOH D 3 .   ? 23.150 33.515 5.186   1.00 23.86  ? 369 HOH A O     1 
HETATM 2432 O O     . HOH D 3 .   ? 21.794 13.433 -10.105 1.00 33.97  ? 370 HOH A O     1 
HETATM 2433 O O     . HOH D 3 .   ? 41.975 49.770 10.735  1.00 27.03  ? 371 HOH A O     1 
HETATM 2434 O O     . HOH D 3 .   ? 28.356 15.604 -5.312  1.00 35.19  ? 372 HOH A O     1 
HETATM 2435 O O     . HOH D 3 .   ? 44.701 30.071 22.541  1.00 49.07  ? 373 HOH A O     1 
HETATM 2436 O O     . HOH D 3 .   ? 15.603 55.312 11.709  1.00 41.08  ? 374 HOH A O     1 
HETATM 2437 O O     . HOH D 3 .   ? 42.018 37.123 -12.815 1.00 56.93  ? 375 HOH A O     1 
HETATM 2438 O O     . HOH D 3 .   ? 27.507 33.151 3.758   1.00 34.85  ? 376 HOH A O     1 
HETATM 2439 O O     . HOH D 3 .   ? 21.195 43.964 12.675  1.00 44.71  ? 377 HOH A O     1 
HETATM 2440 O O     . HOH D 3 .   ? 19.492 42.024 10.938  1.00 35.41  ? 378 HOH A O     1 
HETATM 2441 O O     . HOH D 3 .   ? 18.280 46.969 18.709  1.00 34.52  ? 379 HOH A O     1 
HETATM 2442 O O     . HOH D 3 .   ? 11.532 49.783 14.633  1.00 55.64  ? 380 HOH A O     1 
HETATM 2443 O O     . HOH D 3 .   ? 10.981 46.801 14.988  1.00 46.83  ? 381 HOH A O     1 
HETATM 2444 O O     . HOH D 3 .   ? 45.093 34.943 -2.334  1.00 29.06  ? 382 HOH A O     1 
HETATM 2445 O O     . HOH D 3 .   ? 43.221 41.547 0.323   1.00 27.10  ? 383 HOH A O     1 
HETATM 2446 O O     . HOH D 3 .   ? 24.539 45.072 3.822   1.00 36.15  ? 384 HOH A O     1 
HETATM 2447 O O     . HOH D 3 .   ? 27.422 42.521 1.194   1.00 39.17  ? 385 HOH A O     1 
HETATM 2448 O O     . HOH D 3 .   ? 41.102 16.812 5.309   1.00 41.78  ? 386 HOH A O     1 
HETATM 2449 O O     . HOH D 3 .   ? 40.420 15.621 1.592   1.00 46.84  ? 387 HOH A O     1 
HETATM 2450 O O     . HOH D 3 .   ? 40.583 17.073 -1.379  1.00 43.66  ? 388 HOH A O     1 
HETATM 2451 O O     . HOH D 3 .   ? 40.949 20.422 -1.092  1.00 52.62  ? 389 HOH A O     1 
HETATM 2452 O O     . HOH D 3 .   ? 46.327 41.106 0.980   1.00 39.10  ? 390 HOH A O     1 
HETATM 2453 O O     . HOH D 3 .   ? 37.852 12.115 11.685  1.00 39.16  ? 391 HOH A O     1 
HETATM 2454 O O     . HOH D 3 .   ? 47.397 54.526 16.297  1.00 46.46  ? 392 HOH A O     1 
HETATM 2455 O O     . HOH D 3 .   ? 40.980 32.789 -9.702  1.00 26.56  ? 393 HOH A O     1 
HETATM 2456 O O     . HOH D 3 .   ? 44.357 39.252 -11.909 1.00 51.99  ? 394 HOH A O     1 
HETATM 2457 O O     . HOH D 3 .   ? 31.121 26.582 16.867  1.00 59.77  ? 395 HOH A O     1 
HETATM 2458 O O     . HOH D 3 .   ? 39.262 25.316 -15.971 1.00 32.28  ? 396 HOH A O     1 
HETATM 2459 O O     . HOH D 3 .   ? 48.826 37.433 4.982   1.00 34.75  ? 397 HOH A O     1 
HETATM 2460 O O     . HOH D 3 .   ? 52.309 30.933 7.429   1.00 45.53  ? 398 HOH A O     1 
HETATM 2461 O O     . HOH D 3 .   ? 16.519 57.614 14.809  1.00 47.99  ? 399 HOH A O     1 
HETATM 2462 O O     . HOH D 3 .   ? 35.803 50.720 14.582  1.00 44.36  ? 400 HOH A O     1 
HETATM 2463 O O     . HOH D 3 .   ? 18.969 40.474 18.858  1.00 26.47  ? 401 HOH A O     1 
HETATM 2464 O O     . HOH D 3 .   ? 31.623 23.642 11.484  1.00 34.31  ? 402 HOH A O     1 
HETATM 2465 O O     . HOH D 3 .   ? 43.679 50.707 4.006   1.00 40.86  ? 403 HOH A O     1 
HETATM 2466 O O     . HOH D 3 .   ? 18.535 53.834 15.129  1.00 30.32  ? 404 HOH A O     1 
HETATM 2467 O O     . HOH D 3 .   ? 19.017 33.260 18.999  1.00 42.58  ? 405 HOH A O     1 
HETATM 2468 O O     . HOH D 3 .   ? 17.313 41.828 22.873  1.00 37.48  ? 406 HOH A O     1 
HETATM 2469 O O     . HOH D 3 .   ? 22.365 30.968 17.497  1.00 51.09  ? 407 HOH A O     1 
HETATM 2470 O O     . HOH D 3 .   ? 42.373 54.238 -2.554  1.00 38.85  ? 408 HOH A O     1 
HETATM 2471 O O     . HOH D 3 .   ? 28.131 16.217 3.716   1.00 41.76  ? 409 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DT  1   1   1   DT  T   B . n 
A 1 2   DC  2   2   2   DC  C   B . n 
A 1 3   DG  3   3   3   DG  G   B . n 
A 1 4   DC  4   4   4   DC  C   B . n 
A 1 5   DG  5   5   5   DG  G   B . n 
A 1 6   DA  6   6   6   DA  A   B . n 
A 1 7   PRN 7   7   7   PRN PRN B . n 
A 1 8   DT  8   8   8   DT  T   B . n 
A 1 9   DT  9   9   9   DT  T   B . n 
A 1 10  DC  10  10  10  DC  C   B . n 
A 1 11  DG  11  11  11  DG  G   B . n 
A 1 12  DC  12  12  12  DC  C   B . n 
A 1 13  DG  13  13  13  DG  G   B . n 
B 2 1   SER 1   2   ?   ?   ?   A . n 
B 2 2   ASN 2   3   ?   ?   ?   A . n 
B 2 3   LYS 3   4   ?   ?   ?   A . n 
B 2 4   LYS 4   5   ?   ?   ?   A . n 
B 2 5   GLN 5   6   ?   ?   ?   A . n 
B 2 6   SER 6   7   ?   ?   ?   A . n 
B 2 7   ASN 7   8   ?   ?   ?   A . n 
B 2 8   ARG 8   9   ?   ?   ?   A . n 
B 2 9   LEU 9   10  ?   ?   ?   A . n 
B 2 10  THR 10  11  ?   ?   ?   A . n 
B 2 11  GLU 11  12  ?   ?   ?   A . n 
B 2 12  GLN 12  13  ?   ?   ?   A . n 
B 2 13  HIS 13  14  ?   ?   ?   A . n 
B 2 14  LYS 14  15  ?   ?   ?   A . n 
B 2 15  LEU 15  16  ?   ?   ?   A . n 
B 2 16  SER 16  17  17  SER SER A . n 
B 2 17  GLN 17  18  18  GLN GLN A . n 
B 2 18  GLY 18  19  19  GLY GLY A . n 
B 2 19  VAL 19  20  20  VAL VAL A . n 
B 2 20  ILE 20  21  21  ILE ILE A . n 
B 2 21  GLY 21  22  22  GLY GLY A . n 
B 2 22  ILE 22  23  23  ILE ILE A . n 
B 2 23  PHE 23  24  24  PHE PHE A . n 
B 2 24  GLY 24  25  25  GLY GLY A . n 
B 2 25  ASP 25  26  26  ASP ASP A . n 
B 2 26  TYR 26  27  27  TYR TYR A . n 
B 2 27  ALA 27  28  28  ALA ALA A . n 
B 2 28  LYS 28  29  29  LYS LYS A . n 
B 2 29  ALA 29  30  30  ALA ALA A . n 
B 2 30  HIS 30  31  31  HIS HIS A . n 
B 2 31  ASP 31  32  32  ASP ASP A . n 
B 2 32  LEU 32  33  33  LEU LEU A . n 
B 2 33  ALA 33  34  34  ALA ALA A . n 
B 2 34  VAL 34  35  35  VAL VAL A . n 
B 2 35  GLY 35  36  36  GLY GLY A . n 
B 2 36  GLU 36  37  37  GLU GLU A . n 
B 2 37  VAL 37  38  38  VAL VAL A . n 
B 2 38  SER 38  39  39  SER SER A . n 
B 2 39  LYS 39  40  40  LYS LYS A . n 
B 2 40  LEU 40  41  41  LEU LEU A . n 
B 2 41  VAL 41  42  42  VAL VAL A . n 
B 2 42  LYS 42  43  43  LYS LYS A . n 
B 2 43  LYS 43  44  44  LYS LYS A . n 
B 2 44  ALA 44  45  45  ALA ALA A . n 
B 2 45  LEU 45  46  46  LEU LEU A . n 
B 2 46  SER 46  47  47  SER SER A . n 
B 2 47  ASN 47  48  48  ASN ASN A . n 
B 2 48  GLU 48  49  49  GLU GLU A . n 
B 2 49  TYR 49  50  50  TYR TYR A . n 
B 2 50  PRO 50  51  51  PRO PRO A . n 
B 2 51  GLN 51  52  52  GLN GLN A . n 
B 2 52  LEU 52  53  53  LEU LEU A . n 
B 2 53  SER 53  54  54  SER SER A . n 
B 2 54  PHE 54  55  55  PHE PHE A . n 
B 2 55  ARG 55  56  56  ARG ARG A . n 
B 2 56  TYR 56  57  57  TYR TYR A . n 
B 2 57  ARG 57  58  58  ARG ARG A . n 
B 2 58  ASP 58  59  59  ASP ASP A . n 
B 2 59  SER 59  60  60  SER SER A . n 
B 2 60  ILE 60  61  61  ILE ILE A . n 
B 2 61  LYS 61  62  62  LYS LYS A . n 
B 2 62  LYS 62  63  63  LYS LYS A . n 
B 2 63  THR 63  64  64  THR THR A . n 
B 2 64  GLU 64  65  65  GLU GLU A . n 
B 2 65  ILE 65  66  66  ILE ILE A . n 
B 2 66  ASN 66  67  67  ASN ASN A . n 
B 2 67  GLU 67  68  68  GLU GLU A . n 
B 2 68  ALA 68  69  69  ALA ALA A . n 
B 2 69  LEU 69  70  70  LEU LEU A . n 
B 2 70  LYS 70  71  71  LYS LYS A . n 
B 2 71  LYS 71  72  72  LYS LYS A . n 
B 2 72  ILE 72  73  73  ILE ILE A . n 
B 2 73  ASP 73  74  74  ASP ASP A . n 
B 2 74  PRO 74  75  75  PRO PRO A . n 
B 2 75  ASP 75  76  76  ASP ASP A . n 
B 2 76  LEU 76  77  77  LEU LEU A . n 
B 2 77  GLY 77  78  78  GLY GLY A . n 
B 2 78  GLY 78  79  79  GLY GLY A . n 
B 2 79  THR 79  80  80  THR THR A . n 
B 2 80  LEU 80  81  81  LEU LEU A . n 
B 2 81  PHE 81  82  82  PHE PHE A . n 
B 2 82  VAL 82  83  83  VAL VAL A . n 
B 2 83  SER 83  84  84  SER SER A . n 
B 2 84  ASN 84  85  85  ASN ASN A . n 
B 2 85  SER 85  86  86  SER SER A . n 
B 2 86  SER 86  87  87  SER SER A . n 
B 2 87  ILE 87  88  88  ILE ILE A . n 
B 2 88  LYS 88  89  89  LYS LYS A . n 
B 2 89  PRO 89  90  90  PRO PRO A . n 
B 2 90  ASP 90  91  91  ASP ASP A . n 
B 2 91  GLY 91  92  92  GLY GLY A . n 
B 2 92  GLY 92  93  93  GLY GLY A . n 
B 2 93  ILE 93  94  94  ILE ILE A . n 
B 2 94  VAL 94  95  95  VAL VAL A . n 
B 2 95  GLU 95  96  96  GLU GLU A . n 
B 2 96  VAL 96  97  97  VAL VAL A . n 
B 2 97  LYS 97  98  98  LYS LYS A . n 
B 2 98  ASP 98  99  99  ASP ASP A . n 
B 2 99  ASP 99  100 100 ASP ASP A . n 
B 2 100 TYR 100 101 101 TYR TYR A . n 
B 2 101 GLY 101 102 102 GLY GLY A . n 
B 2 102 GLU 102 103 103 GLU GLU A . n 
B 2 103 TRP 103 104 104 TRP TRP A . n 
B 2 104 ARG 104 105 105 ARG ARG A . n 
B 2 105 VAL 105 106 106 VAL VAL A . n 
B 2 106 VAL 106 107 107 VAL VAL A . n 
B 2 107 LEU 107 108 108 LEU LEU A . n 
B 2 108 VAL 108 109 109 VAL VAL A . n 
B 2 109 ALA 109 110 110 ALA ALA A . n 
B 2 110 GLU 110 111 111 GLU GLU A . n 
B 2 111 ALA 111 112 112 ALA ALA A . n 
B 2 112 LYS 112 113 113 LYS LYS A . n 
B 2 113 HIS 113 114 114 HIS HIS A . n 
B 2 114 GLN 114 115 115 GLN GLN A . n 
B 2 115 GLY 115 116 116 GLY GLY A . n 
B 2 116 LYS 116 117 117 LYS LYS A . n 
B 2 117 ASP 117 118 118 ASP ASP A . n 
B 2 118 ILE 118 119 119 ILE ILE A . n 
B 2 119 ILE 119 120 120 ILE ILE A . n 
B 2 120 ASN 120 121 121 ASN ASN A . n 
B 2 121 ILE 121 122 122 ILE ILE A . n 
B 2 122 ARG 122 123 123 ARG ARG A . n 
B 2 123 ASN 123 124 124 ASN ASN A . n 
B 2 124 GLY 124 125 125 GLY GLY A . n 
B 2 125 LEU 125 126 126 LEU LEU A . n 
B 2 126 LEU 126 127 127 LEU LEU A . n 
B 2 127 VAL 127 128 128 VAL VAL A . n 
B 2 128 GLY 128 129 129 GLY GLY A . n 
B 2 129 LYS 129 130 130 LYS LYS A . n 
B 2 130 ARG 130 131 131 ARG ARG A . n 
B 2 131 GLY 131 132 132 GLY GLY A . n 
B 2 132 ASP 132 133 133 ASP ASP A . n 
B 2 133 GLN 133 134 134 GLN GLN A . n 
B 2 134 ASP 134 135 135 ASP ASP A . n 
B 2 135 LEU 135 136 136 LEU LEU A . n 
B 2 136 MET 136 137 137 MET MET A . n 
B 2 137 ALA 137 138 138 ALA ALA A . n 
B 2 138 ALA 138 139 139 ALA ALA A . n 
B 2 139 GLY 139 140 140 GLY GLY A . n 
B 2 140 ASN 140 141 141 ASN ASN A . n 
B 2 141 ALA 141 142 142 ALA ALA A . n 
B 2 142 ILE 142 143 143 ILE ILE A . n 
B 2 143 GLU 143 144 144 GLU GLU A . n 
B 2 144 ARG 144 145 145 ARG ARG A . n 
B 2 145 SER 145 146 146 SER SER A . n 
B 2 146 HIS 146 147 147 HIS HIS A . n 
B 2 147 LYS 147 148 148 LYS LYS A . n 
B 2 148 ASN 148 149 149 ASN ASN A . n 
B 2 149 ILE 149 150 150 ILE ILE A . n 
B 2 150 SER 150 151 151 SER SER A . n 
B 2 151 GLU 151 152 152 GLU GLU A . n 
B 2 152 ILE 152 153 153 ILE ILE A . n 
B 2 153 ALA 153 154 154 ALA ALA A . n 
B 2 154 ASN 154 155 155 ASN ASN A . n 
B 2 155 PHE 155 156 156 PHE PHE A . n 
B 2 156 MET 156 157 157 MET MET A . n 
B 2 157 LEU 157 158 158 LEU LEU A . n 
B 2 158 SER 158 159 159 SER SER A . n 
B 2 159 GLU 159 160 160 GLU GLU A . n 
B 2 160 SER 160 161 161 SER SER A . n 
B 2 161 HIS 161 162 162 HIS HIS A . n 
B 2 162 PHE 162 163 163 PHE PHE A . n 
B 2 163 PRO 163 164 164 PRO PRO A . n 
B 2 164 TYR 164 165 165 TYR TYR A . n 
B 2 165 VAL 165 166 166 VAL VAL A . n 
B 2 166 LEU 166 167 167 LEU LEU A . n 
B 2 167 PHE 167 168 168 PHE PHE A . n 
B 2 168 LEU 168 169 169 LEU LEU A . n 
B 2 169 GLU 169 170 170 GLU GLU A . n 
B 2 170 GLY 170 171 171 GLY GLY A . n 
B 2 171 SER 171 172 172 SER SER A . n 
B 2 172 ASN 172 173 173 ASN ASN A . n 
B 2 173 PHE 173 174 174 PHE PHE A . n 
B 2 174 LEU 174 175 175 LEU LEU A . n 
B 2 175 THR 175 176 176 THR THR A . n 
B 2 176 GLU 176 177 177 GLU GLU A . n 
B 2 177 ASN 177 178 178 ASN ASN A . n 
B 2 178 ILE 178 179 179 ILE ILE A . n 
B 2 179 SER 179 180 180 SER SER A . n 
B 2 180 ILE 180 181 181 ILE ILE A . n 
B 2 181 THR 181 182 182 THR THR A . n 
B 2 182 ARG 182 183 183 ARG ARG A . n 
B 2 183 PRO 183 184 184 PRO PRO A . n 
B 2 184 ASP 184 185 185 ASP ASP A . n 
B 2 185 GLY 185 186 186 GLY GLY A . n 
B 2 186 ARG 186 187 187 ARG ARG A . n 
B 2 187 VAL 187 188 188 VAL VAL A . n 
B 2 188 VAL 188 189 189 VAL VAL A . n 
B 2 189 ASN 189 190 190 ASN ASN A . n 
B 2 190 LEU 190 191 191 LEU LEU A . n 
B 2 191 GLU 191 192 192 GLU GLU A . n 
B 2 192 TYR 192 193 193 TYR TYR A . n 
B 2 193 ASN 193 194 194 ASN ASN A . n 
B 2 194 SER 194 195 195 SER SER A . n 
B 2 195 GLY 195 196 196 GLY GLY A . n 
B 2 196 ILE 196 197 197 ILE ILE A . n 
B 2 197 LEU 197 198 198 LEU LEU A . n 
B 2 198 ASN 198 199 199 ASN ASN A . n 
B 2 199 ARG 199 200 200 ARG ARG A . n 
B 2 200 LEU 200 201 201 LEU LEU A . n 
B 2 201 ASP 201 202 202 ASP ASP A . n 
B 2 202 ARG 202 203 203 ARG ARG A . n 
B 2 203 LEU 203 204 204 LEU LEU A . n 
B 2 204 THR 204 205 205 THR THR A . n 
B 2 205 ALA 205 206 206 ALA ALA A . n 
B 2 206 ALA 206 207 207 ALA ALA A . n 
B 2 207 ASN 207 208 208 ASN ASN A . n 
B 2 208 TYR 208 209 209 TYR TYR A . n 
B 2 209 GLY 209 210 210 GLY GLY A . n 
B 2 210 MET 210 211 211 MET MET A . n 
B 2 211 PRO 211 212 212 PRO PRO A . n 
B 2 212 ILE 212 213 213 ILE ILE A . n 
B 2 213 ASN 213 214 214 ASN ASN A . n 
B 2 214 SER 214 215 215 SER SER A . n 
B 2 215 ASN 215 216 216 ASN ASN A . n 
B 2 216 LEU 216 217 217 LEU LEU A . n 
B 2 217 CYS 217 218 218 CYS CYS A . n 
B 2 218 ILE 218 219 219 ILE ILE A . n 
B 2 219 ASN 219 220 220 ASN ASN A . n 
B 2 220 LYS 220 221 221 LYS LYS A . n 
B 2 221 PHE 221 222 222 PHE PHE A . n 
B 2 222 VAL 222 223 223 VAL VAL A . n 
B 2 223 ASN 223 224 224 ASN ASN A . n 
B 2 224 HIS 224 225 225 HIS HIS A . n 
B 2 225 LYS 225 226 226 LYS LYS A . n 
B 2 226 ASP 226 227 227 ASP ASP A . n 
B 2 227 LYS 227 228 228 LYS LYS A . n 
B 2 228 SER 228 229 229 SER SER A . n 
B 2 229 ILE 229 230 230 ILE ILE A . n 
B 2 230 MET 230 231 231 MET MET A . n 
B 2 231 LEU 231 232 232 LEU LEU A . n 
B 2 232 GLN 232 233 233 GLN GLN A . n 
B 2 233 ALA 233 234 234 ALA ALA A . n 
B 2 234 ALA 234 235 235 ALA ALA A . n 
B 2 235 SER 235 236 236 SER SER A . n 
B 2 236 ILE 236 237 237 ILE ILE A . n 
B 2 237 TYR 237 238 238 TYR TYR A . n 
B 2 238 THR 238 239 239 THR THR A . n 
B 2 239 GLN 239 240 240 GLN GLN A . n 
B 2 240 GLY 240 241 241 GLY GLY A . n 
B 2 241 ASP 241 242 242 ASP ASP A . n 
B 2 242 GLY 242 243 243 GLY GLY A . n 
B 2 243 ARG 243 244 244 ARG ARG A . n 
B 2 244 GLU 244 245 245 GLU GLU A . n 
B 2 245 TRP 245 246 246 TRP TRP A . n 
B 2 246 ASP 246 247 247 ASP ASP A . n 
B 2 247 SER 247 248 248 SER SER A . n 
B 2 248 LYS 248 249 249 LYS LYS A . n 
B 2 249 ILE 249 250 250 ILE ILE A . n 
B 2 250 MET 250 251 251 MET MET A . n 
B 2 251 PHE 251 252 252 PHE PHE A . n 
B 2 252 GLU 252 253 253 GLU GLU A . n 
B 2 253 ILE 253 254 254 ILE ILE A . n 
B 2 254 MET 254 255 255 MET MET A . n 
B 2 255 PHE 255 256 256 PHE PHE A . n 
B 2 256 ASP 256 257 257 ASP ASP A . n 
B 2 257 ILE 257 258 258 ILE ILE A . n 
B 2 258 SER 258 259 259 SER SER A . n 
B 2 259 THR 259 260 260 THR THR A . n 
B 2 260 THR 260 261 261 THR THR A . n 
B 2 261 SER 261 262 262 SER SER A . n 
B 2 262 LEU 262 263 263 LEU LEU A . n 
B 2 263 ARG 263 264 264 ARG ARG A . n 
B 2 264 VAL 264 265 265 VAL VAL A . n 
B 2 265 LEU 265 266 266 LEU LEU A . n 
B 2 266 GLY 266 267 267 GLY GLY A . n 
B 2 267 ARG 267 268 268 ARG ARG A . n 
B 2 268 ASP 268 269 269 ASP ASP A . n 
B 2 269 LEU 269 270 270 LEU LEU A . n 
B 2 270 PHE 270 271 271 PHE PHE A . n 
B 2 271 GLU 271 272 272 GLU GLU A . n 
B 2 272 GLN 272 273 273 GLN GLN A . n 
B 2 273 LEU 273 274 274 LEU LEU A . n 
B 2 274 THR 274 275 275 THR THR A . n 
B 2 275 SER 275 276 276 SER SER A . n 
B 2 276 LYS 276 277 277 LYS LYS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1   14  5   HOH HOH B . 
C 3 HOH 2   15  14  HOH HOH B . 
C 3 HOH 3   16  17  HOH HOH B . 
C 3 HOH 4   17  30  HOH HOH B . 
C 3 HOH 5   18  31  HOH HOH B . 
C 3 HOH 6   19  37  HOH HOH B . 
C 3 HOH 7   20  40  HOH HOH B . 
C 3 HOH 8   21  41  HOH HOH B . 
C 3 HOH 9   22  45  HOH HOH B . 
C 3 HOH 10  23  55  HOH HOH B . 
C 3 HOH 11  24  59  HOH HOH B . 
C 3 HOH 12  25  65  HOH HOH B . 
C 3 HOH 13  26  66  HOH HOH B . 
C 3 HOH 14  27  67  HOH HOH B . 
C 3 HOH 15  28  97  HOH HOH B . 
C 3 HOH 16  29  102 HOH HOH B . 
C 3 HOH 17  30  108 HOH HOH B . 
C 3 HOH 18  31  112 HOH HOH B . 
C 3 HOH 19  32  126 HOH HOH B . 
C 3 HOH 20  33  148 HOH HOH B . 
C 3 HOH 21  34  149 HOH HOH B . 
C 3 HOH 22  35  153 HOH HOH B . 
C 3 HOH 23  36  154 HOH HOH B . 
D 3 HOH 1   278 1   HOH HOH A . 
D 3 HOH 2   279 2   HOH HOH A . 
D 3 HOH 3   280 3   HOH HOH A . 
D 3 HOH 4   281 4   HOH HOH A . 
D 3 HOH 5   282 6   HOH HOH A . 
D 3 HOH 6   283 7   HOH HOH A . 
D 3 HOH 7   284 8   HOH HOH A . 
D 3 HOH 8   285 9   HOH HOH A . 
D 3 HOH 9   286 10  HOH HOH A . 
D 3 HOH 10  287 11  HOH HOH A . 
D 3 HOH 11  288 12  HOH HOH A . 
D 3 HOH 12  289 13  HOH HOH A . 
D 3 HOH 13  290 15  HOH HOH A . 
D 3 HOH 14  291 16  HOH HOH A . 
D 3 HOH 15  292 18  HOH HOH A . 
D 3 HOH 16  293 19  HOH HOH A . 
D 3 HOH 17  294 20  HOH HOH A . 
D 3 HOH 18  295 21  HOH HOH A . 
D 3 HOH 19  296 22  HOH HOH A . 
D 3 HOH 20  297 23  HOH HOH A . 
D 3 HOH 21  298 24  HOH HOH A . 
D 3 HOH 22  299 25  HOH HOH A . 
D 3 HOH 23  300 26  HOH HOH A . 
D 3 HOH 24  301 27  HOH HOH A . 
D 3 HOH 25  302 28  HOH HOH A . 
D 3 HOH 26  303 29  HOH HOH A . 
D 3 HOH 27  304 32  HOH HOH A . 
D 3 HOH 28  305 33  HOH HOH A . 
D 3 HOH 29  306 34  HOH HOH A . 
D 3 HOH 30  307 35  HOH HOH A . 
D 3 HOH 31  308 36  HOH HOH A . 
D 3 HOH 32  309 38  HOH HOH A . 
D 3 HOH 33  310 39  HOH HOH A . 
D 3 HOH 34  311 42  HOH HOH A . 
D 3 HOH 35  312 43  HOH HOH A . 
D 3 HOH 36  313 44  HOH HOH A . 
D 3 HOH 37  314 46  HOH HOH A . 
D 3 HOH 38  315 47  HOH HOH A . 
D 3 HOH 39  316 48  HOH HOH A . 
D 3 HOH 40  317 49  HOH HOH A . 
D 3 HOH 41  318 50  HOH HOH A . 
D 3 HOH 42  319 51  HOH HOH A . 
D 3 HOH 43  320 52  HOH HOH A . 
D 3 HOH 44  321 53  HOH HOH A . 
D 3 HOH 45  322 54  HOH HOH A . 
D 3 HOH 46  323 56  HOH HOH A . 
D 3 HOH 47  324 57  HOH HOH A . 
D 3 HOH 48  325 58  HOH HOH A . 
D 3 HOH 49  326 60  HOH HOH A . 
D 3 HOH 50  327 61  HOH HOH A . 
D 3 HOH 51  328 62  HOH HOH A . 
D 3 HOH 52  329 63  HOH HOH A . 
D 3 HOH 53  330 64  HOH HOH A . 
D 3 HOH 54  331 68  HOH HOH A . 
D 3 HOH 55  332 69  HOH HOH A . 
D 3 HOH 56  333 70  HOH HOH A . 
D 3 HOH 57  334 71  HOH HOH A . 
D 3 HOH 58  335 72  HOH HOH A . 
D 3 HOH 59  336 73  HOH HOH A . 
D 3 HOH 60  337 74  HOH HOH A . 
D 3 HOH 61  338 75  HOH HOH A . 
D 3 HOH 62  339 76  HOH HOH A . 
D 3 HOH 63  340 77  HOH HOH A . 
D 3 HOH 64  341 78  HOH HOH A . 
D 3 HOH 65  342 79  HOH HOH A . 
D 3 HOH 66  343 80  HOH HOH A . 
D 3 HOH 67  344 81  HOH HOH A . 
D 3 HOH 68  345 82  HOH HOH A . 
D 3 HOH 69  346 83  HOH HOH A . 
D 3 HOH 70  347 84  HOH HOH A . 
D 3 HOH 71  348 85  HOH HOH A . 
D 3 HOH 72  349 86  HOH HOH A . 
D 3 HOH 73  350 87  HOH HOH A . 
D 3 HOH 74  351 88  HOH HOH A . 
D 3 HOH 75  352 89  HOH HOH A . 
D 3 HOH 76  353 90  HOH HOH A . 
D 3 HOH 77  354 91  HOH HOH A . 
D 3 HOH 78  355 92  HOH HOH A . 
D 3 HOH 79  356 93  HOH HOH A . 
D 3 HOH 80  357 94  HOH HOH A . 
D 3 HOH 81  358 95  HOH HOH A . 
D 3 HOH 82  359 96  HOH HOH A . 
D 3 HOH 83  360 98  HOH HOH A . 
D 3 HOH 84  361 99  HOH HOH A . 
D 3 HOH 85  362 100 HOH HOH A . 
D 3 HOH 86  363 101 HOH HOH A . 
D 3 HOH 87  364 103 HOH HOH A . 
D 3 HOH 88  365 104 HOH HOH A . 
D 3 HOH 89  366 105 HOH HOH A . 
D 3 HOH 90  367 106 HOH HOH A . 
D 3 HOH 91  368 107 HOH HOH A . 
D 3 HOH 92  369 109 HOH HOH A . 
D 3 HOH 93  370 110 HOH HOH A . 
D 3 HOH 94  371 111 HOH HOH A . 
D 3 HOH 95  372 113 HOH HOH A . 
D 3 HOH 96  373 114 HOH HOH A . 
D 3 HOH 97  374 115 HOH HOH A . 
D 3 HOH 98  375 116 HOH HOH A . 
D 3 HOH 99  376 117 HOH HOH A . 
D 3 HOH 100 377 118 HOH HOH A . 
D 3 HOH 101 378 119 HOH HOH A . 
D 3 HOH 102 379 120 HOH HOH A . 
D 3 HOH 103 380 121 HOH HOH A . 
D 3 HOH 104 381 122 HOH HOH A . 
D 3 HOH 105 382 123 HOH HOH A . 
D 3 HOH 106 383 124 HOH HOH A . 
D 3 HOH 107 384 125 HOH HOH A . 
D 3 HOH 108 385 127 HOH HOH A . 
D 3 HOH 109 386 128 HOH HOH A . 
D 3 HOH 110 387 129 HOH HOH A . 
D 3 HOH 111 388 130 HOH HOH A . 
D 3 HOH 112 389 131 HOH HOH A . 
D 3 HOH 113 390 132 HOH HOH A . 
D 3 HOH 114 391 133 HOH HOH A . 
D 3 HOH 115 392 134 HOH HOH A . 
D 3 HOH 116 393 135 HOH HOH A . 
D 3 HOH 117 394 136 HOH HOH A . 
D 3 HOH 118 395 137 HOH HOH A . 
D 3 HOH 119 396 138 HOH HOH A . 
D 3 HOH 120 397 139 HOH HOH A . 
D 3 HOH 121 398 140 HOH HOH A . 
D 3 HOH 122 399 141 HOH HOH A . 
D 3 HOH 123 400 142 HOH HOH A . 
D 3 HOH 124 401 143 HOH HOH A . 
D 3 HOH 125 402 144 HOH HOH A . 
D 3 HOH 126 403 145 HOH HOH A . 
D 3 HOH 127 404 146 HOH HOH A . 
D 3 HOH 128 405 147 HOH HOH A . 
D 3 HOH 129 406 150 HOH HOH A . 
D 3 HOH 130 407 151 HOH HOH A . 
D 3 HOH 131 408 152 HOH HOH A . 
D 3 HOH 132 409 155 HOH HOH A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    PRN 
_pdbx_struct_mod_residue.label_seq_id     7 
_pdbx_struct_mod_residue.auth_asym_id     B 
_pdbx_struct_mod_residue.auth_comp_id     PRN 
_pdbx_struct_mod_residue.auth_seq_id      7 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   DA 
_pdbx_struct_mod_residue.details          
;PURINE 2'-DEOXYRIBO-5'-MONOPHOSPHATE
;
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z  1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 4_555 y,x,-z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-05-19 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    'model building' .     ? 1 
X-PLOR    refinement       3.851 ? 2 
DENZO     'data reduction' .     ? 3 
SCALEPACK 'data scaling'   .     ? 4 
X-PLOR    phasing          .     ? 5 
# 
_pdbx_entry_details.entry_id             1CL8 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   'PRN IS ADENINE WITH THE N6 AMINO GROUP REMOVED' 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 81  ? ? -169.11 98.06  
2 1 GLN A 115 ? ? -170.88 132.93 
3 1 ASP A 133 ? ? -144.20 -11.43 
4 1 PRO A 164 ? ? -79.07  48.50  
5 1 ASN A 224 ? ? 176.81  143.23 
6 1 ASP A 227 ? ? -69.19  86.31  
7 1 LYS A 228 ? ? -134.77 -58.89 
8 1 SER A 229 ? ? 77.61   118.09 
9 1 THR A 275 ? ? -99.32  -68.49 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 2  ? B SER 1  
2  1 Y 1 A ASN 3  ? B ASN 2  
3  1 Y 1 A LYS 4  ? B LYS 3  
4  1 Y 1 A LYS 5  ? B LYS 4  
5  1 Y 1 A GLN 6  ? B GLN 5  
6  1 Y 1 A SER 7  ? B SER 6  
7  1 Y 1 A ASN 8  ? B ASN 7  
8  1 Y 1 A ARG 9  ? B ARG 8  
9  1 Y 1 A LEU 10 ? B LEU 9  
10 1 Y 1 A THR 11 ? B THR 10 
11 1 Y 1 A GLU 12 ? B GLU 11 
12 1 Y 1 A GLN 13 ? B GLN 12 
13 1 Y 1 A HIS 14 ? B HIS 13 
14 1 Y 1 A LYS 15 ? B LYS 14 
15 1 Y 1 A LEU 16 ? B LEU 15 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1CL8 'double helix'        
1CL8 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC  2  1_555 A DG  13 4_555 0.050  0.029  0.439  -26.879 0.983  3.080  1  B_DC2:DG13_B B 2  ? B 13 ? 19 1 
1 A DG  3  1_555 A DC  12 4_555 -0.170 -0.097 0.159  -4.079  -1.376 0.110  2  B_DG3:DC12_B B 3  ? B 12 ? 19 1 
1 A DC  4  1_555 A DG  11 4_555 0.193  0.039  -0.197 -0.201  -3.250 -5.502 3  B_DC4:DG11_B B 4  ? B 11 ? 19 1 
1 A DG  5  1_555 A DC  10 4_555 -0.323 -0.137 -0.665 -15.627 -2.966 -1.865 4  B_DG5:DC10_B B 5  ? B 10 ? 19 1 
1 A DA  6  1_555 A DT  9  4_555 0.256  -0.013 -0.040 1.062   -4.243 -3.180 5  B_DA6:DT9_B  B 6  ? B 9  ? 20 1 
1 A PRN 7  1_555 A DT  8  4_555 0.226  0.128  0.521  4.064   0.351  3.057  6  B_PRN7:DT8_B B 7  ? B 8  ? ?  ? 
1 A DT  8  1_555 A PRN 7  4_555 -0.226 0.128  0.521  -4.063  0.351  3.057  7  B_DT8:PRN7_B B 8  ? B 7  ? ?  ? 
1 A DT  9  1_555 A DA  6  4_555 -0.256 -0.013 -0.040 -1.062  -4.243 -3.180 8  B_DT9:DA6_B  B 9  ? B 6  ? 20 1 
1 A DC  10 1_555 A DG  5  4_555 0.323  -0.137 -0.665 15.627  -2.966 -1.865 9  B_DC10:DG5_B B 10 ? B 5  ? 19 1 
1 A DG  11 1_555 A DC  4  4_555 -0.193 0.039  -0.197 0.201   -3.250 -5.502 10 B_DG11:DC4_B B 11 ? B 4  ? 19 1 
1 A DC  12 1_555 A DG  3  4_555 0.170  -0.097 0.159  4.079   -1.376 0.110  11 B_DC12:DG3_B B 12 ? B 3  ? 19 1 
1 A DG  13 1_555 A DC  2  4_555 -0.050 0.029  0.439  26.879  0.983  3.080  12 B_DG13:DC2_B B 13 ? B 2  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC  2  1_555 A DG  13 4_555 A DG  3  1_555 A DC  12 4_555 0.101  0.151  2.871 0.566  9.034   26.729 -1.561 -0.091 2.774 18.867 
-1.183 28.194 1  BB_DC2DG3:DC12DG13_BB B 2  ? B 13 ? B 3  ? B 12 ? 
1 A DG  3  1_555 A DC  12 4_555 A DC  4  1_555 A DG  11 4_555 -0.582 -0.386 3.397 3.149  0.777   36.335 -0.727 1.379  3.328 1.243 
-5.038 36.474 2  BB_DG3DC4:DG11DC12_BB B 3  ? B 12 ? B 4  ? B 11 ? 
1 A DC  4  1_555 A DG  11 4_555 A DG  5  1_555 A DC  10 4_555 0.830  -0.187 3.905 4.416  0.629   35.532 -0.414 -0.582 3.972 1.026 
-7.201 35.802 3  BB_DC4DG5:DC10DG11_BB B 4  ? B 11 ? B 5  ? B 10 ? 
1 A DG  5  1_555 A DC  10 4_555 A DA  6  1_555 A DT  9  4_555 -0.979 -0.084 3.077 -3.508 -1.280  32.175 0.065  1.164  3.164 -2.300 
6.303  32.386 4  BB_DG5DA6:DT9DC10_BB  B 5  ? B 10 ? B 6  ? B 9  ? 
1 A DA  6  1_555 A DT  9  4_555 A PRN 7  1_555 A DT  8  4_555 0.947  0.417  3.764 -5.400 32.018  21.630 -4.144 -2.228 2.333 56.407 
9.513  38.853 5  BB_DA6PRN7:DT8DT9_BB  B 6  ? B 9  ? B 7  ? B 8  ? 
1 A PRN 7  1_555 A DT  8  4_555 A DT  8  1_555 A PRN 7  4_555 0.000  0.662  5.045 0.000  -55.332 42.621 3.795  0.000  2.739 
-55.269 0.000  68.800 6  BB_PRN7DT8:PRN7DT8_BB B 7  ? B 8  ? B 8  ? B 7  ? 
1 A DT  8  1_555 A PRN 7  4_555 A DT  9  1_555 A DA  6  4_555 -0.947 0.417  3.764 5.400  32.018  21.630 -4.144 2.228  2.333 56.407 
-9.513 38.853 7  BB_DT8DT9:DA6PRN7_BB  B 8  ? B 7  ? B 9  ? B 6  ? 
1 A DT  9  1_555 A DA  6  4_555 A DC  10 1_555 A DG  5  4_555 0.979  -0.084 3.077 3.508  -1.280  32.175 0.065  -1.164 3.164 -2.300 
-6.303 32.386 8  BB_DT9DC10:DG5DA6_BB  B 9  ? B 6  ? B 10 ? B 5  ? 
1 A DC  10 1_555 A DG  5  4_555 A DG  11 1_555 A DC  4  4_555 -0.830 -0.187 3.905 -4.416 0.629   35.532 -0.414 0.582  3.972 1.026 
7.201  35.802 9  BB_DC10DG11:DC4DG5_BB B 10 ? B 5  ? B 11 ? B 4  ? 
1 A DG  11 1_555 A DC  4  4_555 A DC  12 1_555 A DG  3  4_555 0.582  -0.386 3.397 -3.149 0.777   36.335 -0.727 -1.379 3.328 1.243 
5.038  36.474 10 BB_DG11DC12:DG3DC4_BB B 11 ? B 4  ? B 12 ? B 3  ? 
1 A DC  12 1_555 A DG  3  4_555 A DG  13 1_555 A DC  2  4_555 -0.101 0.151  2.871 -0.566 9.034   26.729 -1.561 0.091  2.774 18.867 
1.183  28.194 11 BB_DC12DG13:DC2DG3_BB B 12 ? B 3  ? B 13 ? B 2  ? 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#