data_1CLQ
# 
_entry.id   1CLQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1CLQ         
NDB   PD0079       
RCSB  RCSB000982   
WWPDB D_1000000982 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1CLQ 
_pdbx_database_status.recvd_initial_deposition_date   1999-04-30 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    NDB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shamoo, Y.'   1 
'Steitz, T.A.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Building a replisome from interacting pieces: sliding clamp complexed to a peptide from DNA polymerase and a polymerase editing complex.
;
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            99 
_citation.page_first                155 
_citation.page_last                 166 
_citation.year                      1999 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10535734 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(00)81647-5' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Shamoo, Y.'   1 
primary 'Steitz, T.A.' 2 
# 
_cell.entry_id           1CLQ 
_cell.length_a           209.740 
_cell.length_b           209.740 
_cell.length_c           114.250 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              9 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1CLQ 
_symmetry.space_group_name_H-M             'H 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     trigonal 
_symmetry.Int_Tables_number                146 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*GP*CP*GP*GP*AP*AP*CP*TP*AP*CP*T)-3')
;
3358.211   1   ?       ? ?                ? 
2 polymer     syn 
;DNA (5'-D(*AP*GP*TP*AP*GP*TP*TP*CP*CP*GP*CP*G)-3')
;
3678.403   1   ?       ? ?                ? 
3 polymer     man 'PROTEIN (DNA POLYMERASE)'                           104743.156 1   2.7.7.7 ? 'RESIDUES 1-903' ? 
4 non-polymer syn 'CALCIUM ION'                                        40.078     9   ?       ? ?                ? 
5 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE"                           443.201    1   ?       ? ?                ? 
6 water       nat water                                                18.015     221 ?       ? ?                ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        GP43 
# 
_entity_name_sys.entity_id   3 
_entity_name_sys.name        E.C.2.7.7.7 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DG)(DC)(DG)(DG)(DA)(DA)(DC)(DT)(DA)(DC)(DT)' GCGGAACTACT E ? 
2 polydeoxyribonucleotide no no '(DA)(DG)(DT)(DA)(DG)(DT)(DT)(DC)(DC)(DG)(DC)(DG)' AGTAGTTCCGCG D ? 
3 'polypeptide(L)'        no no 
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFDIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIDVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFDIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIDVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DC  n 
1 3   DG  n 
1 4   DG  n 
1 5   DA  n 
1 6   DA  n 
1 7   DC  n 
1 8   DT  n 
1 9   DA  n 
1 10  DC  n 
1 11  DT  n 
2 1   DA  n 
2 2   DG  n 
2 3   DT  n 
2 4   DA  n 
2 5   DG  n 
2 6   DT  n 
2 7   DT  n 
2 8   DC  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DG  n 
3 1   MET n 
3 2   LYS n 
3 3   GLU n 
3 4   PHE n 
3 5   TYR n 
3 6   LEU n 
3 7   THR n 
3 8   VAL n 
3 9   GLU n 
3 10  GLN n 
3 11  ILE n 
3 12  GLY n 
3 13  ASP n 
3 14  SER n 
3 15  ILE n 
3 16  PHE n 
3 17  GLU n 
3 18  ARG n 
3 19  TYR n 
3 20  ILE n 
3 21  ASP n 
3 22  SER n 
3 23  ASN n 
3 24  GLY n 
3 25  ARG n 
3 26  GLU n 
3 27  ARG n 
3 28  THR n 
3 29  ARG n 
3 30  GLU n 
3 31  VAL n 
3 32  GLU n 
3 33  TYR n 
3 34  LYS n 
3 35  PRO n 
3 36  SER n 
3 37  LEU n 
3 38  PHE n 
3 39  ALA n 
3 40  HIS n 
3 41  CYS n 
3 42  PRO n 
3 43  GLU n 
3 44  SER n 
3 45  GLN n 
3 46  ALA n 
3 47  THR n 
3 48  LYS n 
3 49  TYR n 
3 50  PHE n 
3 51  ASP n 
3 52  ILE n 
3 53  TYR n 
3 54  GLY n 
3 55  LYS n 
3 56  PRO n 
3 57  CYS n 
3 58  THR n 
3 59  ARG n 
3 60  LYS n 
3 61  LEU n 
3 62  PHE n 
3 63  ALA n 
3 64  ASN n 
3 65  MET n 
3 66  ARG n 
3 67  ASP n 
3 68  ALA n 
3 69  SER n 
3 70  GLN n 
3 71  TRP n 
3 72  ILE n 
3 73  LYS n 
3 74  ARG n 
3 75  MET n 
3 76  GLU n 
3 77  ASP n 
3 78  ILE n 
3 79  GLY n 
3 80  LEU n 
3 81  GLU n 
3 82  ALA n 
3 83  LEU n 
3 84  GLY n 
3 85  MET n 
3 86  ASP n 
3 87  ASP n 
3 88  PHE n 
3 89  LYS n 
3 90  LEU n 
3 91  ALA n 
3 92  TYR n 
3 93  LEU n 
3 94  SER n 
3 95  ASP n 
3 96  THR n 
3 97  TYR n 
3 98  ASN n 
3 99  TYR n 
3 100 GLU n 
3 101 ILE n 
3 102 LYS n 
3 103 TYR n 
3 104 ASP n 
3 105 HIS n 
3 106 THR n 
3 107 LYS n 
3 108 ILE n 
3 109 ARG n 
3 110 VAL n 
3 111 ALA n 
3 112 ASN n 
3 113 PHE n 
3 114 ASP n 
3 115 ILE n 
3 116 GLU n 
3 117 VAL n 
3 118 THR n 
3 119 SER n 
3 120 PRO n 
3 121 ASP n 
3 122 GLY n 
3 123 PHE n 
3 124 PRO n 
3 125 GLU n 
3 126 PRO n 
3 127 SER n 
3 128 GLN n 
3 129 ALA n 
3 130 LYS n 
3 131 HIS n 
3 132 PRO n 
3 133 ILE n 
3 134 ASP n 
3 135 ALA n 
3 136 ILE n 
3 137 THR n 
3 138 HIS n 
3 139 TYR n 
3 140 ASP n 
3 141 SER n 
3 142 ILE n 
3 143 ASP n 
3 144 ASP n 
3 145 ARG n 
3 146 PHE n 
3 147 TYR n 
3 148 VAL n 
3 149 PHE n 
3 150 ASP n 
3 151 LEU n 
3 152 LEU n 
3 153 ASN n 
3 154 SER n 
3 155 PRO n 
3 156 TYR n 
3 157 GLY n 
3 158 ASN n 
3 159 VAL n 
3 160 GLU n 
3 161 GLU n 
3 162 TRP n 
3 163 SER n 
3 164 ILE n 
3 165 GLU n 
3 166 ILE n 
3 167 ALA n 
3 168 ALA n 
3 169 LYS n 
3 170 LEU n 
3 171 GLN n 
3 172 GLU n 
3 173 GLN n 
3 174 GLY n 
3 175 GLY n 
3 176 ASP n 
3 177 GLU n 
3 178 VAL n 
3 179 PRO n 
3 180 SER n 
3 181 GLU n 
3 182 ILE n 
3 183 ILE n 
3 184 ASP n 
3 185 LYS n 
3 186 ILE n 
3 187 ILE n 
3 188 TYR n 
3 189 MET n 
3 190 PRO n 
3 191 PHE n 
3 192 ASP n 
3 193 ASN n 
3 194 GLU n 
3 195 LYS n 
3 196 GLU n 
3 197 LEU n 
3 198 LEU n 
3 199 MET n 
3 200 GLU n 
3 201 TYR n 
3 202 LEU n 
3 203 ASN n 
3 204 PHE n 
3 205 TRP n 
3 206 GLN n 
3 207 GLN n 
3 208 LYS n 
3 209 THR n 
3 210 PRO n 
3 211 VAL n 
3 212 ILE n 
3 213 LEU n 
3 214 THR n 
3 215 GLY n 
3 216 TRP n 
3 217 ASN n 
3 218 VAL n 
3 219 GLU n 
3 220 SER n 
3 221 PHE n 
3 222 ASP n 
3 223 ILE n 
3 224 PRO n 
3 225 TYR n 
3 226 VAL n 
3 227 TYR n 
3 228 ASN n 
3 229 ARG n 
3 230 ILE n 
3 231 LYS n 
3 232 ASN n 
3 233 ILE n 
3 234 PHE n 
3 235 GLY n 
3 236 GLU n 
3 237 SER n 
3 238 THR n 
3 239 ALA n 
3 240 LYS n 
3 241 ARG n 
3 242 LEU n 
3 243 SER n 
3 244 PRO n 
3 245 HIS n 
3 246 ARG n 
3 247 LYS n 
3 248 THR n 
3 249 ARG n 
3 250 VAL n 
3 251 LYS n 
3 252 VAL n 
3 253 ILE n 
3 254 GLU n 
3 255 ASN n 
3 256 MET n 
3 257 TYR n 
3 258 GLY n 
3 259 SER n 
3 260 ARG n 
3 261 GLU n 
3 262 ILE n 
3 263 ILE n 
3 264 THR n 
3 265 LEU n 
3 266 PHE n 
3 267 GLY n 
3 268 ILE n 
3 269 SER n 
3 270 VAL n 
3 271 LEU n 
3 272 ASP n 
3 273 TYR n 
3 274 ILE n 
3 275 ASP n 
3 276 LEU n 
3 277 TYR n 
3 278 LYS n 
3 279 LYS n 
3 280 PHE n 
3 281 SER n 
3 282 PHE n 
3 283 THR n 
3 284 ASN n 
3 285 GLN n 
3 286 PRO n 
3 287 SER n 
3 288 TYR n 
3 289 SER n 
3 290 LEU n 
3 291 ASP n 
3 292 TYR n 
3 293 ILE n 
3 294 SER n 
3 295 GLU n 
3 296 PHE n 
3 297 GLU n 
3 298 LEU n 
3 299 ASN n 
3 300 VAL n 
3 301 GLY n 
3 302 LYS n 
3 303 LEU n 
3 304 LYS n 
3 305 TYR n 
3 306 ASP n 
3 307 GLY n 
3 308 PRO n 
3 309 ILE n 
3 310 SER n 
3 311 LYS n 
3 312 LEU n 
3 313 ARG n 
3 314 GLU n 
3 315 SER n 
3 316 ASN n 
3 317 HIS n 
3 318 GLN n 
3 319 ARG n 
3 320 TYR n 
3 321 ILE n 
3 322 SER n 
3 323 TYR n 
3 324 ASN n 
3 325 ILE n 
3 326 ILE n 
3 327 ASP n 
3 328 VAL n 
3 329 TYR n 
3 330 ARG n 
3 331 VAL n 
3 332 LEU n 
3 333 GLN n 
3 334 ILE n 
3 335 ASP n 
3 336 ALA n 
3 337 LYS n 
3 338 ARG n 
3 339 GLN n 
3 340 PHE n 
3 341 ILE n 
3 342 ASN n 
3 343 LEU n 
3 344 SER n 
3 345 LEU n 
3 346 ASP n 
3 347 MET n 
3 348 GLY n 
3 349 TYR n 
3 350 TYR n 
3 351 ALA n 
3 352 LYS n 
3 353 ILE n 
3 354 GLN n 
3 355 ILE n 
3 356 GLN n 
3 357 SER n 
3 358 VAL n 
3 359 PHE n 
3 360 SER n 
3 361 PRO n 
3 362 ILE n 
3 363 LYS n 
3 364 THR n 
3 365 TRP n 
3 366 ASP n 
3 367 ALA n 
3 368 ILE n 
3 369 ILE n 
3 370 PHE n 
3 371 ASN n 
3 372 SER n 
3 373 LEU n 
3 374 LYS n 
3 375 GLU n 
3 376 GLN n 
3 377 ASN n 
3 378 LYS n 
3 379 VAL n 
3 380 ILE n 
3 381 PRO n 
3 382 GLN n 
3 383 GLY n 
3 384 ARG n 
3 385 SER n 
3 386 HIS n 
3 387 PRO n 
3 388 VAL n 
3 389 GLN n 
3 390 PRO n 
3 391 TYR n 
3 392 PRO n 
3 393 GLY n 
3 394 ALA n 
3 395 PHE n 
3 396 VAL n 
3 397 LYS n 
3 398 GLU n 
3 399 PRO n 
3 400 ILE n 
3 401 PRO n 
3 402 ASN n 
3 403 ARG n 
3 404 TYR n 
3 405 LYS n 
3 406 TYR n 
3 407 VAL n 
3 408 MET n 
3 409 SER n 
3 410 PHE n 
3 411 ASP n 
3 412 LEU n 
3 413 THR n 
3 414 SER n 
3 415 LEU n 
3 416 TYR n 
3 417 PRO n 
3 418 SER n 
3 419 ILE n 
3 420 ILE n 
3 421 ARG n 
3 422 GLN n 
3 423 VAL n 
3 424 ASN n 
3 425 ILE n 
3 426 SER n 
3 427 PRO n 
3 428 GLU n 
3 429 THR n 
3 430 ILE n 
3 431 ALA n 
3 432 GLY n 
3 433 THR n 
3 434 PHE n 
3 435 LYS n 
3 436 VAL n 
3 437 ALA n 
3 438 PRO n 
3 439 LEU n 
3 440 HIS n 
3 441 ASP n 
3 442 TYR n 
3 443 ILE n 
3 444 ASN n 
3 445 ALA n 
3 446 VAL n 
3 447 ALA n 
3 448 GLU n 
3 449 ARG n 
3 450 PRO n 
3 451 SER n 
3 452 ASP n 
3 453 VAL n 
3 454 TYR n 
3 455 SER n 
3 456 CYS n 
3 457 SER n 
3 458 PRO n 
3 459 ASN n 
3 460 GLY n 
3 461 MET n 
3 462 MET n 
3 463 TYR n 
3 464 TYR n 
3 465 LYS n 
3 466 ASP n 
3 467 ARG n 
3 468 ASP n 
3 469 GLY n 
3 470 VAL n 
3 471 VAL n 
3 472 PRO n 
3 473 THR n 
3 474 GLU n 
3 475 ILE n 
3 476 THR n 
3 477 LYS n 
3 478 VAL n 
3 479 PHE n 
3 480 ASN n 
3 481 GLN n 
3 482 ARG n 
3 483 LYS n 
3 484 GLU n 
3 485 HIS n 
3 486 LYS n 
3 487 GLY n 
3 488 TYR n 
3 489 MET n 
3 490 LEU n 
3 491 ALA n 
3 492 ALA n 
3 493 GLN n 
3 494 ARG n 
3 495 ASN n 
3 496 GLY n 
3 497 GLU n 
3 498 ILE n 
3 499 ILE n 
3 500 LYS n 
3 501 GLU n 
3 502 ALA n 
3 503 LEU n 
3 504 HIS n 
3 505 ASN n 
3 506 PRO n 
3 507 ASN n 
3 508 LEU n 
3 509 SER n 
3 510 VAL n 
3 511 ASP n 
3 512 GLU n 
3 513 PRO n 
3 514 LEU n 
3 515 ASP n 
3 516 VAL n 
3 517 ASP n 
3 518 TYR n 
3 519 ARG n 
3 520 PHE n 
3 521 ASP n 
3 522 PHE n 
3 523 SER n 
3 524 ASP n 
3 525 GLU n 
3 526 ILE n 
3 527 LYS n 
3 528 GLU n 
3 529 LYS n 
3 530 ILE n 
3 531 LYS n 
3 532 LYS n 
3 533 LEU n 
3 534 SER n 
3 535 ALA n 
3 536 LYS n 
3 537 SER n 
3 538 LEU n 
3 539 ASN n 
3 540 GLU n 
3 541 MET n 
3 542 LEU n 
3 543 PHE n 
3 544 ARG n 
3 545 ALA n 
3 546 GLN n 
3 547 ARG n 
3 548 THR n 
3 549 GLU n 
3 550 VAL n 
3 551 ALA n 
3 552 GLY n 
3 553 MET n 
3 554 THR n 
3 555 ALA n 
3 556 GLN n 
3 557 ILE n 
3 558 ASN n 
3 559 ARG n 
3 560 LYS n 
3 561 LEU n 
3 562 LEU n 
3 563 ILE n 
3 564 ASN n 
3 565 SER n 
3 566 LEU n 
3 567 TYR n 
3 568 GLY n 
3 569 ALA n 
3 570 LEU n 
3 571 GLY n 
3 572 ASN n 
3 573 VAL n 
3 574 TRP n 
3 575 PHE n 
3 576 ARG n 
3 577 TYR n 
3 578 TYR n 
3 579 ASP n 
3 580 LEU n 
3 581 ARG n 
3 582 ASN n 
3 583 ALA n 
3 584 THR n 
3 585 ALA n 
3 586 ILE n 
3 587 THR n 
3 588 THR n 
3 589 PHE n 
3 590 GLY n 
3 591 GLN n 
3 592 MET n 
3 593 ALA n 
3 594 LEU n 
3 595 GLN n 
3 596 TRP n 
3 597 ILE n 
3 598 GLU n 
3 599 ARG n 
3 600 LYS n 
3 601 VAL n 
3 602 ASN n 
3 603 GLU n 
3 604 TYR n 
3 605 LEU n 
3 606 ASN n 
3 607 GLU n 
3 608 VAL n 
3 609 CYS n 
3 610 GLY n 
3 611 THR n 
3 612 GLU n 
3 613 GLY n 
3 614 GLU n 
3 615 ALA n 
3 616 PHE n 
3 617 VAL n 
3 618 LEU n 
3 619 TYR n 
3 620 GLY n 
3 621 ASP n 
3 622 THR n 
3 623 ASP n 
3 624 SER n 
3 625 ILE n 
3 626 TYR n 
3 627 VAL n 
3 628 SER n 
3 629 ALA n 
3 630 ASP n 
3 631 LYS n 
3 632 ILE n 
3 633 ILE n 
3 634 ASP n 
3 635 LYS n 
3 636 VAL n 
3 637 GLY n 
3 638 GLU n 
3 639 SER n 
3 640 LYS n 
3 641 PHE n 
3 642 ARG n 
3 643 ASP n 
3 644 THR n 
3 645 ASN n 
3 646 HIS n 
3 647 TRP n 
3 648 VAL n 
3 649 ASP n 
3 650 PHE n 
3 651 LEU n 
3 652 ASP n 
3 653 LYS n 
3 654 PHE n 
3 655 ALA n 
3 656 ARG n 
3 657 GLU n 
3 658 ARG n 
3 659 MET n 
3 660 GLU n 
3 661 PRO n 
3 662 ALA n 
3 663 ILE n 
3 664 ASP n 
3 665 ARG n 
3 666 GLY n 
3 667 PHE n 
3 668 ARG n 
3 669 GLU n 
3 670 MET n 
3 671 CYS n 
3 672 GLU n 
3 673 TYR n 
3 674 MET n 
3 675 ASN n 
3 676 ASN n 
3 677 LYS n 
3 678 GLN n 
3 679 HIS n 
3 680 LEU n 
3 681 MET n 
3 682 PHE n 
3 683 MET n 
3 684 ASP n 
3 685 ARG n 
3 686 GLU n 
3 687 ALA n 
3 688 ILE n 
3 689 ALA n 
3 690 GLY n 
3 691 PRO n 
3 692 PRO n 
3 693 LEU n 
3 694 GLY n 
3 695 SER n 
3 696 LYS n 
3 697 GLY n 
3 698 ILE n 
3 699 GLY n 
3 700 GLY n 
3 701 PHE n 
3 702 TRP n 
3 703 THR n 
3 704 GLY n 
3 705 LYS n 
3 706 LYS n 
3 707 ARG n 
3 708 TYR n 
3 709 ALA n 
3 710 LEU n 
3 711 ASN n 
3 712 VAL n 
3 713 TRP n 
3 714 ASP n 
3 715 MET n 
3 716 GLU n 
3 717 GLY n 
3 718 THR n 
3 719 ARG n 
3 720 TYR n 
3 721 ALA n 
3 722 GLU n 
3 723 PRO n 
3 724 LYS n 
3 725 LEU n 
3 726 LYS n 
3 727 ILE n 
3 728 MET n 
3 729 GLY n 
3 730 LEU n 
3 731 GLU n 
3 732 THR n 
3 733 GLN n 
3 734 LYS n 
3 735 SER n 
3 736 SER n 
3 737 THR n 
3 738 PRO n 
3 739 LYS n 
3 740 ALA n 
3 741 VAL n 
3 742 GLN n 
3 743 LYS n 
3 744 ALA n 
3 745 LEU n 
3 746 LYS n 
3 747 GLU n 
3 748 CYS n 
3 749 ILE n 
3 750 ARG n 
3 751 ARG n 
3 752 MET n 
3 753 LEU n 
3 754 GLN n 
3 755 GLU n 
3 756 GLY n 
3 757 GLU n 
3 758 GLU n 
3 759 SER n 
3 760 LEU n 
3 761 GLN n 
3 762 GLU n 
3 763 TYR n 
3 764 PHE n 
3 765 LYS n 
3 766 GLU n 
3 767 PHE n 
3 768 GLU n 
3 769 LYS n 
3 770 GLU n 
3 771 PHE n 
3 772 ARG n 
3 773 GLN n 
3 774 LEU n 
3 775 ASN n 
3 776 TYR n 
3 777 ILE n 
3 778 SER n 
3 779 ILE n 
3 780 ALA n 
3 781 SER n 
3 782 VAL n 
3 783 SER n 
3 784 SER n 
3 785 ALA n 
3 786 ASN n 
3 787 ASN n 
3 788 ILE n 
3 789 ALA n 
3 790 LYS n 
3 791 TYR n 
3 792 ASP n 
3 793 VAL n 
3 794 GLY n 
3 795 GLY n 
3 796 PHE n 
3 797 PRO n 
3 798 GLY n 
3 799 PRO n 
3 800 LYS n 
3 801 CYS n 
3 802 PRO n 
3 803 PHE n 
3 804 HIS n 
3 805 ILE n 
3 806 ARG n 
3 807 GLY n 
3 808 ILE n 
3 809 LEU n 
3 810 THR n 
3 811 TYR n 
3 812 ASN n 
3 813 ARG n 
3 814 ALA n 
3 815 ILE n 
3 816 LYS n 
3 817 GLY n 
3 818 ASN n 
3 819 ILE n 
3 820 ASP n 
3 821 ALA n 
3 822 PRO n 
3 823 GLN n 
3 824 VAL n 
3 825 VAL n 
3 826 GLU n 
3 827 GLY n 
3 828 GLU n 
3 829 LYS n 
3 830 VAL n 
3 831 TYR n 
3 832 VAL n 
3 833 LEU n 
3 834 PRO n 
3 835 LEU n 
3 836 ARG n 
3 837 GLU n 
3 838 GLY n 
3 839 ASN n 
3 840 PRO n 
3 841 PHE n 
3 842 GLY n 
3 843 ASP n 
3 844 LYS n 
3 845 CYS n 
3 846 ILE n 
3 847 ALA n 
3 848 TRP n 
3 849 PRO n 
3 850 SER n 
3 851 GLY n 
3 852 THR n 
3 853 GLU n 
3 854 ILE n 
3 855 THR n 
3 856 ASP n 
3 857 LEU n 
3 858 ILE n 
3 859 LYS n 
3 860 ASP n 
3 861 ASP n 
3 862 VAL n 
3 863 LEU n 
3 864 HIS n 
3 865 TRP n 
3 866 MET n 
3 867 ASP n 
3 868 TYR n 
3 869 THR n 
3 870 VAL n 
3 871 LEU n 
3 872 LEU n 
3 873 GLU n 
3 874 LYS n 
3 875 THR n 
3 876 PHE n 
3 877 ILE n 
3 878 LYS n 
3 879 PRO n 
3 880 LEU n 
3 881 GLU n 
3 882 GLY n 
3 883 PHE n 
3 884 THR n 
3 885 SER n 
3 886 ALA n 
3 887 ALA n 
3 888 LYS n 
3 889 LEU n 
3 890 ASP n 
3 891 TYR n 
3 892 GLU n 
3 893 LYS n 
3 894 LYS n 
3 895 ALA n 
3 896 SER n 
3 897 LEU n 
3 898 PHE n 
3 899 ASP n 
3 900 MET n 
3 901 PHE n 
3 902 ASP n 
3 903 PHE n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     'T4-like viruses' 
_entity_src_gen.pdbx_gene_src_gene                 'GENE 43' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage RB69' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     12353 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'PRIMER-TEMPLATE DNA' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP DPOL_BPR69 3 ? ? Q38087 ? 
2 PDB 1CLQ       1 ? ? 1CLQ   ? 
3 PDB 1CLQ       2 ? ? 1CLQ   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1CLQ A 1 ? 903 ? Q38087 1  ? 903 ? 1  903 
2 2 1CLQ E 1 ? 11  ? 1CLQ   2  ? 12  ? 2  12  
3 3 1CLQ D 1 ? 12  ? 1CLQ   12 ? 1   ? 12 1   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                        ? 'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
GDP 'RNA linking'       n "GUANOSINE-5'-DIPHOSPHATE"           ? 'C10 H15 N5 O11 P2' 443.201 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1CLQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.7 
_exptl_crystal.density_percent_sol   70.4 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            285 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'12% (W/V) PEG 350MME, 150 MM CACL2, 100 MM SODIUM CACODYLATE, PH 6.5, 12 DEGREES C, VAPOR DIFFUSION, HANGING DROP, temperature 285K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 PEG                 ? ? ? 
1 2 1 CACL2               ? ? ? 
1 3 1 'SODIUM CACODYLATE' ? ? ? 
1 4 2 PEG                 ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ADSC 
_diffrn_detector.pdbx_collection_date   1998-10-15 
_diffrn_detector.details                'SILICON 111 BENDING MIRROR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9188 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE A1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   A1 
_diffrn_source.pdbx_wavelength             0.9188 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1CLQ 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40 
_reflns.d_resolution_high            2.7 
_reflns.number_obs                   51455 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0800000 
_reflns.pdbx_netI_over_sigmaI        18.1 
_reflns.B_iso_Wilson_estimate        50.0 
_reflns.pdbx_redundancy              2.2 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1CLQ 
_refine.ls_number_reflns_obs                     50031 
_refine.ls_number_reflns_all                     50031 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           505175.56 
_refine.ls_d_res_low                             40.00 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    97.2 
_refine.ls_R_factor_obs                          0.2300000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2300000 
_refine.ls_R_factor_R_free                       0.2840000 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.7 
_refine.ls_number_reflns_R_free                  4877 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               58.4 
_refine.aniso_B[1][1]                            -4.89 
_refine.aniso_B[2][2]                            -4.89 
_refine.aniso_B[3][3]                            9.79 
_refine.aniso_B[1][2]                            4.74 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.310 
_refine.solvent_model_param_bsol                 46.43 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1WAJ 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1CLQ 
_refine_analyze.Luzzati_coordinate_error_obs    0.37 
_refine_analyze.Luzzati_sigma_a_obs             0.54 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.48 
_refine_analyze.Luzzati_sigma_a_free            0.69 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7381 
_refine_hist.pdbx_number_atoms_nucleic_acid   467 
_refine_hist.pdbx_number_atoms_ligand         37 
_refine_hist.number_atoms_solvent             221 
_refine_hist.number_atoms_total               8106 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        40.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.4   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      24.5  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.18  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             2.99  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            4.65  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             4.69  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            6.83  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.70 
_refine_ls_shell.d_res_low                        2.87 
_refine_ls_shell.number_reflns_R_work             7206 
_refine_ls_shell.R_factor_R_work                  0.3470000 
_refine_ls_shell.percent_reflns_obs               94.5 
_refine_ls_shell.R_factor_R_free                  0.3990000 
_refine_ls_shell.R_factor_R_free_error            0.014 
_refine_ls_shell.percent_reflns_R_free            10.8 
_refine_ls_shell.number_reflns_R_free             874 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 DNA-RNA.PARAM     ?           'X-RAY DIFFRACTION' 
3 ION.PARAM         ?           'X-RAY DIFFRACTION' 
4 WATER.PARAM       ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1CLQ 
_struct.title                     'CRYSTAL STRUCTURE OF A REPLICATION FORK DNA POLYMERASE EDITING COMPLEX AT 2.7 A RESOLUTION' 
_struct.pdbx_descriptor           'DNA POLYMERASE (E.C.2.7.7.7)/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1CLQ 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'DNA POLYMERASE, GP43, PROOFREADING, EDITING, REPLICATION, TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 5 ? 
N N N 6 ? 
O N N 6 ? 
P N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  MET C 65  ? ILE C 78  ? MET A 65  ILE A 78  1 ? 14 
HELX_P HELX_P2  2  PHE C 88  ? THR C 96  ? PHE A 88  THR A 96  1 ? 9  
HELX_P HELX_P3  3  HIS C 105 ? LYS C 107 ? HIS A 105 LYS A 107 5 ? 3  
HELX_P HELX_P4  4  ILE C 164 ? ALA C 168 ? ILE A 164 ALA A 168 1 ? 5  
HELX_P HELX_P5  5  GLN C 171 ? GLN C 173 ? GLN A 171 GLN A 173 5 ? 3  
HELX_P HELX_P6  6  SER C 180 ? LYS C 185 ? SER A 180 LYS A 185 1 ? 6  
HELX_P HELX_P7  7  GLU C 194 ? GLN C 207 ? GLU A 194 GLN A 207 1 ? 14 
HELX_P HELX_P8  8  ASP C 222 ? PHE C 234 ? ASP A 222 PHE A 234 1 ? 13 
HELX_P HELX_P9  9  LYS C 240 ? LEU C 242 ? LYS A 240 LEU A 242 5 ? 3  
HELX_P HELX_P10 10 TYR C 273 ? PHE C 280 ? TYR A 273 PHE A 280 1 ? 8  
HELX_P HELX_P11 11 LEU C 290 ? LEU C 298 ? LEU A 290 LEU A 298 1 ? 9  
HELX_P HELX_P12 12 ILE C 309 ? SER C 315 ? ILE A 309 SER A 315 5 ? 7  
HELX_P HELX_P13 13 HIS C 317 ? ARG C 338 ? HIS A 317 ARG A 338 1 ? 22 
HELX_P HELX_P14 14 PHE C 340 ? ALA C 351 ? PHE A 340 ALA A 351 1 ? 12 
HELX_P HELX_P15 15 ILE C 355 ? PHE C 359 ? ILE A 355 PHE A 359 5 ? 5  
HELX_P HELX_P16 16 PRO C 361 ? GLN C 376 ? PRO A 361 GLN A 376 1 ? 16 
HELX_P HELX_P17 17 LEU C 415 ? GLN C 422 ? LEU A 415 GLN A 422 1 ? 8  
HELX_P HELX_P18 18 PRO C 427 ? THR C 429 ? PRO A 427 THR A 429 5 ? 3  
HELX_P HELX_P19 19 LEU C 439 ? ILE C 443 ? LEU A 439 ILE A 443 1 ? 5  
HELX_P HELX_P20 20 VAL C 470 ? ASN C 505 ? VAL A 470 ASN A 505 1 ? 36 
HELX_P HELX_P21 21 ASP C 524 ? LYS C 532 ? ASP A 524 LYS A 532 1 ? 9  
HELX_P HELX_P22 22 ALA C 535 ? LEU C 570 ? ALA A 535 LEU A 570 1 ? 36 
HELX_P HELX_P23 23 LEU C 580 ? VAL C 608 ? LEU A 580 VAL A 608 1 ? 29 
HELX_P HELX_P24 24 ASP C 630 ? VAL C 636 ? ASP A 630 VAL A 636 1 ? 7  
HELX_P HELX_P25 25 THR C 644 ? GLU C 657 ? THR A 644 GLU A 657 1 ? 14 
HELX_P HELX_P26 26 MET C 659 ? TYR C 673 ? MET A 659 TYR A 673 1 ? 15 
HELX_P HELX_P27 27 LYS C 739 ? GLN C 754 ? LYS A 739 GLN A 754 1 ? 16 
HELX_P HELX_P28 28 GLU C 757 ? ARG C 772 ? GLU A 757 ARG A 772 1 ? 16 
HELX_P HELX_P29 29 TYR C 776 ? ILE C 779 ? TYR A 776 ILE A 779 1 ? 4  
HELX_P HELX_P30 30 ILE C 788 ? TYR C 791 ? ILE A 788 TYR A 791 1 ? 4  
HELX_P HELX_P31 31 PHE C 803 ? ALA C 814 ? PHE A 803 ALA A 814 1 ? 12 
HELX_P HELX_P32 32 LYS C 859 ? TRP C 865 ? LYS A 859 TRP A 865 1 ? 7  
HELX_P HELX_P33 33 TYR C 868 ? THR C 875 ? TYR A 868 THR A 875 1 ? 8  
HELX_P HELX_P34 34 ILE C 877 ? ALA C 887 ? ILE A 877 ALA A 887 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? G CA .  CA ? ? ? 1_555 C ASN 505 O     ? ? A CA 1001 A ASN 505  1_555 ? ? ? ? ? ? ?            2.292 ? 
metalc2  metalc ? ? G CA .  CA ? ? ? 1_555 C ASN 507 OD1   ? ? A CA 1001 A ASN 507  1_555 ? ? ? ? ? ? ?            2.428 ? 
metalc3  metalc ? ? G CA .  CA ? ? ? 1_555 C LYS 531 O     ? ? A CA 1001 A LYS 531  1_555 ? ? ? ? ? ? ?            2.206 ? 
metalc4  metalc ? ? H CA .  CA ? ? ? 1_555 B DG  12  OP1   ? ? A CA 1002 D DG  1    1_555 ? ? ? ? ? ? ?            2.316 ? 
metalc5  metalc ? ? H CA .  CA ? ? ? 1_555 C GLU 116 OE1   ? ? A CA 1002 A GLU 116  1_555 ? ? ? ? ? ? ?            3.066 ? 
metalc6  metalc ? ? H CA .  CA ? ? ? 1_555 C GLU 116 OE2   ? ? A CA 1002 A GLU 116  1_555 ? ? ? ? ? ? ?            2.661 ? 
metalc7  metalc ? ? I CA .  CA ? ? ? 1_555 C ASP 275 OD1   ? ? A CA 1004 A ASP 275  1_555 ? ? ? ? ? ? ?            2.569 ? 
metalc8  metalc ? ? I CA .  CA ? ? ? 1_555 C GLU 219 OE1   ? ? A CA 1004 A GLU 219  1_555 ? ? ? ? ? ? ?            2.342 ? 
metalc9  metalc ? ? I CA .  CA ? ? ? 1_555 C ASP 275 OD2   ? ? A CA 1004 A ASP 275  1_555 ? ? ? ? ? ? ?            2.346 ? 
metalc10 metalc ? ? J CA .  CA ? ? ? 1_555 C GLU 716 OE2   ? ? A CA 1005 A GLU 716  1_555 ? ? ? ? ? ? ?            2.999 ? 
metalc11 metalc ? ? K CA .  CA ? ? ? 1_555 C ASN 676 O     ? ? A CA 1006 A ASN 676  1_555 ? ? ? ? ? ? ?            2.457 ? 
metalc12 metalc ? ? K CA .  CA ? ? ? 1_555 C ASN 676 N     ? ? A CA 1006 A ASN 676  1_555 ? ? ? ? ? ? ?            3.327 ? 
metalc13 metalc ? ? L CA .  CA ? ? ? 1_555 C ASP 621 OD2   ? ? A CA 1025 A ASP 621  1_555 ? ? ? ? ? ? ?            2.983 ? 
metalc14 metalc ? ? L CA .  CA ? ? ? 1_555 C SER 624 OG    ? ? A CA 1025 A SER 624  1_555 ? ? ? ? ? ? ?            2.866 ? 
metalc15 metalc ? ? L CA .  CA ? ? ? 1_555 C ASP 623 OD1   ? ? A CA 1025 A ASP 623  1_555 ? ? ? ? ? ? ?            2.832 ? 
metalc16 metalc ? ? L CA .  CA ? ? ? 1_555 P HOH .   O     ? ? A CA 1025 A HOH 1071 1_555 ? ? ? ? ? ? ?            3.029 ? 
metalc17 metalc ? ? L CA .  CA ? ? ? 1_555 P HOH .   O     ? ? A CA 1025 A HOH 1150 1_555 ? ? ? ? ? ? ?            3.067 ? 
metalc18 metalc ? ? E CA .  CA ? ? ? 1_555 B DC  11  "O3'" ? ? D CA 1003 D DC  2    1_555 ? ? ? ? ? ? ?            2.900 ? 
metalc19 metalc ? ? E CA .  CA ? ? ? 1_555 B DG  12  OP1   ? ? D CA 1003 D DG  1    1_555 ? ? ? ? ? ? ?            2.664 ? 
metalc20 metalc ? ? E CA .  CA ? ? ? 1_555 P HOH .   O     ? ? D CA 1003 A HOH 1185 1_555 ? ? ? ? ? ? ?            2.699 ? 
metalc21 metalc ? ? E CA .  CA ? ? ? 1_555 C ASP 114 OD2   ? ? D CA 1003 A ASP 114  1_555 ? ? ? ? ? ? ?            2.831 ? 
metalc22 metalc ? ? E CA .  CA ? ? ? 1_555 C ASP 114 OD1   ? ? D CA 1003 A ASP 114  1_555 ? ? ? ? ? ? ?            2.052 ? 
metalc23 metalc ? ? F CA .  CA ? ? ? 1_555 B DT  6   "O5'" ? ? D CA 1009 D DT  7    1_555 ? ? ? ? ? ? ?            2.903 ? 
metalc24 metalc ? ? F CA .  CA ? ? ? 1_555 B DT  6   OP2   ? ? D CA 1009 D DT  7    1_555 ? ? ? ? ? ? ?            3.024 ? 
metalc25 metalc ? ? D CA .  CA ? ? ? 1_555 A DC  10  "O5'" ? ? E CA 1024 E DC  11   1_555 ? ? ? ? ? ? ?            2.964 ? 
metalc26 metalc ? ? D CA .  CA ? ? ? 1_555 A DA  9   "O3'" ? ? E CA 1024 E DA  10   1_555 ? ? ? ? ? ? ?            2.253 ? 
hydrog1  hydrog ? ? A DG 1  N1 ? ? ? 1_555 B DG  10  N7    ? ? E DG 2    D DG  3    1_555 ? ? ? ? ? ? TYPE_7_PAIR  ?     ? 
hydrog2  hydrog ? ? A DG 1  N2 ? ? ? 1_555 B DG  10  O6    ? ? E DG 2    D DG  3    1_555 ? ? ? ? ? ? TYPE_7_PAIR  ?     ? 
hydrog3  hydrog ? ? A DG 3  N1 ? ? ? 1_555 B DC  9   N3    ? ? E DG 4    D DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DG 3  N2 ? ? ? 1_555 B DC  9   O2    ? ? E DG 4    D DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DG 3  O6 ? ? ? 1_555 B DC  9   N4    ? ? E DG 4    D DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DG 4  N1 ? ? ? 1_555 B DC  8   N3    ? ? E DG 5    D DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DG 4  N2 ? ? ? 1_555 B DC  8   O2    ? ? E DG 5    D DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DG 4  O6 ? ? ? 1_555 B DC  8   N4    ? ? E DG 5    D DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DA 5  N1 ? ? ? 1_555 B DT  7   N3    ? ? E DA 6    D DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DA 5  N6 ? ? ? 1_555 B DT  7   O4    ? ? E DA 6    D DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DA 6  N1 ? ? ? 1_555 B DT  6   N3    ? ? E DA 7    D DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DA 6  N6 ? ? ? 1_555 B DT  6   O4    ? ? E DA 7    D DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DC 7  N3 ? ? ? 1_555 B DG  5   N1    ? ? E DC 8    D DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DC 7  N4 ? ? ? 1_555 B DG  5   O6    ? ? E DC 8    D DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DC 7  O2 ? ? ? 1_555 B DG  5   N2    ? ? E DC 8    D DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DT 8  N3 ? ? ? 1_555 B DA  4   N1    ? ? E DT 9    D DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DT 8  O4 ? ? ? 1_555 B DA  4   N6    ? ? E DT 9    D DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DA 9  N1 ? ? ? 1_555 B DG  2   N1    ? ? E DA 10   D DG  11   1_555 ? ? ? ? ? ? TYPE_8_PAIR  ?     ? 
hydrog19 hydrog ? ? A DA 9  N6 ? ? ? 1_555 B DG  2   O6    ? ? E DA 10   D DG  11   1_555 ? ? ? ? ? ? TYPE_8_PAIR  ?     ? 
hydrog20 hydrog ? ? A DA 9  N1 ? ? ? 1_555 B DT  3   N3    ? ? E DA 10   D DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DA 9  N6 ? ? ? 1_555 B DT  3   O4    ? ? E DA 10   D DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DC 10 N3 ? ? ? 1_555 B DG  2   N1    ? ? E DC 11   D DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DC 10 N4 ? ? ? 1_555 B DG  2   O6    ? ? E DC 11   D DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DC 10 O2 ? ? ? 1_555 B DG  2   N2    ? ? E DC 11   D DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DT 11 O4 ? ? ? 1_555 B DA  1   N6    ? ? E DT 12   D DA  12   1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 5 ? 
D ? 2 ? 
E ? 6 ? 
F ? 3 ? 
G ? 2 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU C 26  ? VAL C 31  ? GLU A 26  VAL A 31  
A 2 SER C 14  ? ILE C 20  ? SER A 14  ILE A 20  
A 3 PHE C 4   ? ILE C 11  ? PHE A 4   ILE A 11  
B 1 SER C 36  ? HIS C 40  ? SER A 36  HIS A 40  
B 2 CYS C 57  ? LEU C 61  ? CYS A 57  LEU A 61  
C 1 ILE C 212 ? THR C 214 ? ILE A 212 THR A 214 
C 2 VAL C 110 ? GLU C 116 ? VAL A 110 GLU A 116 
C 3 ALA C 135 ? ASP C 140 ? ALA A 135 ASP A 140 
C 4 ARG C 145 ? ASP C 150 ? ARG A 145 ASP A 150 
C 5 ILE C 186 ? PRO C 190 ? ILE A 186 PRO A 190 
D 1 THR C 248 ? ASN C 255 ? THR A 248 ASN A 255 
D 2 GLY C 258 ? LEU C 265 ? GLY A 258 LEU A 265 
E 1 LYS C 724 ? MET C 728 ? LYS A 724 MET A 728 
E 2 TYR C 708 ? MET C 715 ? TYR A 708 MET A 715 
E 3 MET C 683 ? ALA C 689 ? MET A 683 ALA A 689 
E 4 VAL C 407 ? LEU C 412 ? VAL A 407 LEU A 412 
E 5 SER C 624 ? SER C 628 ? SER A 624 SER A 628 
E 6 VAL C 617 ? GLY C 620 ? VAL A 617 GLY A 620 
F 1 SER C 781 ? SER C 784 ? SER A 781 SER A 784 
F 2 LYS C 829 ? PRO C 834 ? LYS A 829 PRO A 834 
F 3 CYS C 845 ? PRO C 849 ? CYS A 845 PRO A 849 
G 1 ILE C 430 ? THR C 433 ? ILE A 430 THR A 433 
G 2 MET C 461 ? TYR C 463 ? MET A 461 TYR A 463 
H 1 GLY C 700 ? GLY C 704 ? GLY A 700 GLY A 704 
H 2 ARG C 707 ? LEU C 710 ? ARG A 707 LEU A 710 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG C 27  ? O ARG A 27  N TYR C 19  ? N TYR A 19  
A 2 3 O SER C 14  ? O SER A 14  N ILE C 11  ? N ILE A 11  
B 1 2 O LEU C 37  ? O LEU A 37  N LYS C 60  ? N LYS A 60  
C 1 2 O ILE C 212 ? O ILE A 212 N ALA C 111 ? N ALA A 111 
C 2 3 O ASN C 112 ? O ASN A 112 N TYR C 139 ? N TYR A 139 
C 3 4 O HIS C 138 ? O HIS A 138 N TYR C 147 ? N TYR A 147 
C 4 5 O PHE C 146 ? O PHE A 146 N ILE C 187 ? N ILE A 187 
D 1 2 O ARG C 249 ? O ARG A 249 N THR C 264 ? N THR A 264 
E 1 2 O LYS C 724 ? O LYS A 724 N VAL C 712 ? N VAL A 712 
E 2 3 O TRP C 713 ? O TRP A 713 N ILE C 688 ? N ILE A 688 
E 3 4 O ASP C 684 ? O ASP A 684 N ASP C 411 ? N ASP A 411 
E 4 5 O MET C 408 ? O MET A 408 N VAL C 627 ? N VAL A 627 
E 5 6 O TYR C 626 ? O TYR A 626 N TYR C 619 ? N TYR A 619 
F 1 2 O SER C 781 ? O SER A 781 N VAL C 832 ? N VAL A 832 
F 2 3 O TYR C 831 ? O TYR A 831 N TRP C 848 ? N TRP A 848 
G 1 2 O ALA C 431 ? O ALA A 431 N MET C 462 ? N MET A 462 
H 1 2 O PHE C 701 ? O PHE A 701 N ALA C 709 ? N ALA A 709 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CA A 1001' 
AC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CA A 1002' 
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA D 1003' 
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CA A 1004' 
AC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CA A 1005' 
AC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CA A 1006' 
AC7 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CA D 1009' 
AC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CA E 1024' 
AC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 1025' 
BC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE GDP A 999' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3  ASN C 505 ? ASN A 505  . ? 1_555 ? 
2  AC1 3  ASN C 507 ? ASN A 507  . ? 1_555 ? 
3  AC1 3  LYS C 531 ? LYS A 531  . ? 1_555 ? 
4  AC2 2  GLU C 116 ? GLU A 116  . ? 1_555 ? 
5  AC2 2  DG  B 12  ? DG  D 1    . ? 1_555 ? 
6  AC3 4  ASP C 114 ? ASP A 114  . ? 1_555 ? 
7  AC3 4  HOH P .   ? HOH A 1185 . ? 1_555 ? 
8  AC3 4  DG  B 12  ? DG  D 1    . ? 1_555 ? 
9  AC3 4  DC  B 11  ? DC  D 2    . ? 1_555 ? 
10 AC4 2  GLU C 219 ? GLU A 219  . ? 1_555 ? 
11 AC4 2  ASP C 275 ? ASP A 275  . ? 1_555 ? 
12 AC5 1  GLU C 716 ? GLU A 716  . ? 1_555 ? 
13 AC6 2  CYS C 671 ? CYS A 671  . ? 1_555 ? 
14 AC6 2  ASN C 676 ? ASN A 676  . ? 1_555 ? 
15 AC7 1  DT  B 6   ? DT  D 7    . ? 1_555 ? 
16 AC8 2  DA  A 9   ? DA  E 10   . ? 1_555 ? 
17 AC8 2  DC  A 10  ? DC  E 11   . ? 1_555 ? 
18 AC9 5  ASP C 621 ? ASP A 621  . ? 1_555 ? 
19 AC9 5  ASP C 623 ? ASP A 623  . ? 1_555 ? 
20 AC9 5  SER C 624 ? SER A 624  . ? 1_555 ? 
21 AC9 5  HOH P .   ? HOH A 1071 . ? 1_555 ? 
22 AC9 5  HOH P .   ? HOH A 1150 . ? 1_555 ? 
23 BC1 12 TYR C 33  ? TYR A 33   . ? 1_555 ? 
24 BC1 12 SER C 36  ? SER A 36   . ? 1_555 ? 
25 BC1 12 PHE C 38  ? PHE A 38   . ? 1_555 ? 
26 BC1 12 LYS C 48  ? LYS A 48   . ? 1_555 ? 
27 BC1 12 TYR C 49  ? TYR A 49   . ? 1_555 ? 
28 BC1 12 GLY C 84  ? GLY A 84   . ? 1_555 ? 
29 BC1 12 MET C 85  ? MET A 85   . ? 1_555 ? 
30 BC1 12 ALA C 91  ? ALA A 91   . ? 1_555 ? 
31 BC1 12 ASP C 95  ? ASP A 95   . ? 1_555 ? 
32 BC1 12 LYS C 378 ? LYS A 378  . ? 1_555 ? 
33 BC1 12 VAL C 379 ? VAL A 379  . ? 1_555 ? 
34 BC1 12 ILE C 380 ? ILE A 380  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1CLQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1CLQ 
_atom_sites.fract_transf_matrix[1][1]   0.004768 
_atom_sites.fract_transf_matrix[1][2]   0.002753 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005505 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008753 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DG  A 1 1   ? 47.765  -53.163 28.731  1.00 103.29 ? 2    DG  E "O5'" 1 
ATOM   2    C  "C5'" . DG  A 1 1   ? 49.115  -53.085 29.193  1.00 88.50  ? 2    DG  E "C5'" 1 
ATOM   3    C  "C4'" . DG  A 1 1   ? 49.277  -51.605 29.412  1.00 78.26  ? 2    DG  E "C4'" 1 
ATOM   4    O  "O4'" . DG  A 1 1   ? 50.420  -51.347 30.253  1.00 72.72  ? 2    DG  E "O4'" 1 
ATOM   5    C  "C3'" . DG  A 1 1   ? 49.477  -50.783 28.130  1.00 76.00  ? 2    DG  E "C3'" 1 
ATOM   6    O  "O3'" . DG  A 1 1   ? 48.617  -49.637 28.180  1.00 76.92  ? 2    DG  E "O3'" 1 
ATOM   7    C  "C2'" . DG  A 1 1   ? 50.928  -50.356 28.230  1.00 71.93  ? 2    DG  E "C2'" 1 
ATOM   8    C  "C1'" . DG  A 1 1   ? 51.028  -50.199 29.728  1.00 68.58  ? 2    DG  E "C1'" 1 
ATOM   9    N  N9    . DG  A 1 1   ? 52.362  -50.036 30.290  1.00 65.87  ? 2    DG  E N9    1 
ATOM   10   C  C8    . DG  A 1 1   ? 52.944  -48.821 30.525  1.00 55.32  ? 2    DG  E C8    1 
ATOM   11   N  N7    . DG  A 1 1   ? 54.148  -48.910 31.007  1.00 55.15  ? 2    DG  E N7    1 
ATOM   12   C  C5    . DG  A 1 1   ? 54.385  -50.272 31.111  1.00 60.75  ? 2    DG  E C5    1 
ATOM   13   C  C6    . DG  A 1 1   ? 55.536  -50.958 31.565  1.00 63.42  ? 2    DG  E C6    1 
ATOM   14   O  O6    . DG  A 1 1   ? 56.599  -50.484 31.976  1.00 60.99  ? 2    DG  E O6    1 
ATOM   15   N  N1    . DG  A 1 1   ? 55.367  -52.337 31.504  1.00 66.73  ? 2    DG  E N1    1 
ATOM   16   C  C2    . DG  A 1 1   ? 54.232  -52.975 31.061  1.00 65.75  ? 2    DG  E C2    1 
ATOM   17   N  N2    . DG  A 1 1   ? 54.265  -54.317 31.089  1.00 63.56  ? 2    DG  E N2    1 
ATOM   18   N  N3    . DG  A 1 1   ? 53.147  -52.341 30.623  1.00 66.65  ? 2    DG  E N3    1 
ATOM   19   C  C4    . DG  A 1 1   ? 53.293  -50.994 30.678  1.00 64.82  ? 2    DG  E C4    1 
ATOM   20   P  P     . DC  A 1 2   ? 48.585  -48.584 26.963  1.00 81.86  ? 3    DC  E P     1 
ATOM   21   O  OP1   . DC  A 1 2   ? 47.159  -48.348 26.598  1.00 83.25  ? 3    DC  E OP1   1 
ATOM   22   O  OP2   . DC  A 1 2   ? 49.546  -49.006 25.914  1.00 77.34  ? 3    DC  E OP2   1 
ATOM   23   O  "O5'" . DC  A 1 2   ? 49.157  -47.257 27.638  1.00 86.72  ? 3    DC  E "O5'" 1 
ATOM   24   C  "C5'" . DC  A 1 2   ? 50.419  -47.266 28.308  1.00 87.67  ? 3    DC  E "C5'" 1 
ATOM   25   C  "C4'" . DC  A 1 2   ? 51.265  -46.114 27.822  1.00 90.33  ? 3    DC  E "C4'" 1 
ATOM   26   O  "O4'" . DC  A 1 2   ? 52.610  -46.272 28.331  1.00 90.17  ? 3    DC  E "O4'" 1 
ATOM   27   C  "C3'" . DC  A 1 2   ? 51.395  -46.068 26.301  1.00 91.45  ? 3    DC  E "C3'" 1 
ATOM   28   O  "O3'" . DC  A 1 2   ? 51.391  -44.707 25.856  1.00 96.28  ? 3    DC  E "O3'" 1 
ATOM   29   C  "C2'" . DC  A 1 2   ? 52.725  -46.751 26.033  1.00 87.68  ? 3    DC  E "C2'" 1 
ATOM   30   C  "C1'" . DC  A 1 2   ? 53.537  -46.396 27.263  1.00 86.71  ? 3    DC  E "C1'" 1 
ATOM   31   N  N1    . DC  A 1 2   ? 54.588  -47.338 27.703  1.00 82.56  ? 3    DC  E N1    1 
ATOM   32   C  C2    . DC  A 1 2   ? 54.580  -48.666 27.255  1.00 80.22  ? 3    DC  E C2    1 
ATOM   33   O  O2    . DC  A 1 2   ? 53.710  -49.036 26.469  1.00 87.57  ? 3    DC  E O2    1 
ATOM   34   N  N3    . DC  A 1 2   ? 55.526  -49.516 27.702  1.00 78.48  ? 3    DC  E N3    1 
ATOM   35   C  C4    . DC  A 1 2   ? 56.452  -49.092 28.561  1.00 78.65  ? 3    DC  E C4    1 
ATOM   36   N  N4    . DC  A 1 2   ? 57.359  -49.974 28.990  1.00 78.62  ? 3    DC  E N4    1 
ATOM   37   C  C5    . DC  A 1 2   ? 56.491  -47.745 29.021  1.00 75.75  ? 3    DC  E C5    1 
ATOM   38   C  C6    . DC  A 1 2   ? 55.553  -46.910 28.566  1.00 76.44  ? 3    DC  E C6    1 
ATOM   39   P  P     . DG  A 1 3   ? 51.180  -44.378 24.301  1.00 101.01 ? 4    DG  E P     1 
ATOM   40   O  OP1   . DG  A 1 3   ? 50.958  -42.912 24.209  1.00 101.06 ? 4    DG  E OP1   1 
ATOM   41   O  OP2   . DG  A 1 3   ? 50.171  -45.320 23.738  1.00 101.75 ? 4    DG  E OP2   1 
ATOM   42   O  "O5'" . DG  A 1 3   ? 52.602  -44.701 23.666  1.00 98.91  ? 4    DG  E "O5'" 1 
ATOM   43   C  "C5'" . DG  A 1 3   ? 53.762  -44.022 24.130  1.00 97.11  ? 4    DG  E "C5'" 1 
ATOM   44   C  "C4'" . DG  A 1 3   ? 54.962  -44.430 23.310  1.00 96.43  ? 4    DG  E "C4'" 1 
ATOM   45   O  "O4'" . DG  A 1 3   ? 55.279  -45.816 23.586  1.00 97.65  ? 4    DG  E "O4'" 1 
ATOM   46   C  "C3'" . DG  A 1 3   ? 54.693  -44.370 21.811  1.00 95.62  ? 4    DG  E "C3'" 1 
ATOM   47   O  "O3'" . DG  A 1 3   ? 55.943  -44.108 21.146  1.00 102.77 ? 4    DG  E "O3'" 1 
ATOM   48   C  "C2'" . DG  A 1 3   ? 54.136  -45.754 21.522  1.00 91.79  ? 4    DG  E "C2'" 1 
ATOM   49   C  "C1'" . DG  A 1 3   ? 54.940  -46.639 22.474  1.00 92.51  ? 4    DG  E "C1'" 1 
ATOM   50   N  N9    . DG  A 1 3   ? 54.219  -47.799 22.992  1.00 87.64  ? 4    DG  E N9    1 
ATOM   51   C  C8    . DG  A 1 3   ? 52.872  -47.861 23.238  1.00 84.70  ? 4    DG  E C8    1 
ATOM   52   N  N7    . DG  A 1 3   ? 52.495  -48.993 23.766  1.00 86.05  ? 4    DG  E N7    1 
ATOM   53   C  C5    . DG  A 1 3   ? 53.661  -49.741 23.860  1.00 81.58  ? 4    DG  E C5    1 
ATOM   54   C  C6    . DG  A 1 3   ? 53.868  -51.057 24.369  1.00 78.27  ? 4    DG  E C6    1 
ATOM   55   O  O6    . DG  A 1 3   ? 53.038  -51.837 24.860  1.00 73.47  ? 4    DG  E O6    1 
ATOM   56   N  N1    . DG  A 1 3   ? 55.199  -51.438 24.269  1.00 75.27  ? 4    DG  E N1    1 
ATOM   57   C  C2    . DG  A 1 3   ? 56.206  -50.659 23.756  1.00 80.30  ? 4    DG  E C2    1 
ATOM   58   N  N2    . DG  A 1 3   ? 57.424  -51.222 23.742  1.00 82.20  ? 4    DG  E N2    1 
ATOM   59   N  N3    . DG  A 1 3   ? 56.030  -49.423 23.288  1.00 80.51  ? 4    DG  E N3    1 
ATOM   60   C  C4    . DG  A 1 3   ? 54.737  -49.030 23.371  1.00 83.42  ? 4    DG  E C4    1 
ATOM   61   P  P     . DG  A 1 4   ? 56.032  -44.064 19.533  1.00 107.74 ? 5    DG  E P     1 
ATOM   62   O  OP1   . DG  A 1 4   ? 56.983  -42.995 19.130  1.00 104.80 ? 5    DG  E OP1   1 
ATOM   63   O  OP2   . DG  A 1 4   ? 54.651  -44.073 18.979  1.00 106.79 ? 5    DG  E OP2   1 
ATOM   64   O  "O5'" . DG  A 1 4   ? 56.722  -45.450 19.171  1.00 104.22 ? 5    DG  E "O5'" 1 
ATOM   65   C  "C5'" . DG  A 1 4   ? 56.323  -46.630 19.838  1.00 103.58 ? 5    DG  E "C5'" 1 
ATOM   66   C  "C4'" . DG  A 1 4   ? 57.242  -47.765 19.494  1.00 103.58 ? 5    DG  E "C4'" 1 
ATOM   67   O  "O4'" . DG  A 1 4   ? 56.836  -48.896 20.299  1.00 103.59 ? 5    DG  E "O4'" 1 
ATOM   68   C  "C3'" . DG  A 1 4   ? 57.020  -48.194 18.051  1.00 105.46 ? 5    DG  E "C3'" 1 
ATOM   69   O  "O3'" . DG  A 1 4   ? 58.205  -48.784 17.549  1.00 110.36 ? 5    DG  E "O3'" 1 
ATOM   70   C  "C2'" . DG  A 1 4   ? 55.915  -49.219 18.168  1.00 105.09 ? 5    DG  E "C2'" 1 
ATOM   71   C  "C1'" . DG  A 1 4   ? 56.217  -49.884 19.492  1.00 103.41 ? 5    DG  E "C1'" 1 
ATOM   72   N  N9    . DG  A 1 4   ? 55.039  -50.392 20.160  1.00 102.04 ? 5    DG  E N9    1 
ATOM   73   C  C8    . DG  A 1 4   ? 53.748  -49.846 20.189  1.00 102.13 ? 5    DG  E C8    1 
ATOM   74   N  N7    . DG  A 1 4   ? 52.881  -50.601 20.780  1.00 103.69 ? 5    DG  E N7    1 
ATOM   75   C  C5    . DG  A 1 4   ? 53.609  -51.705 21.205  1.00 102.71 ? 5    DG  E C5    1 
ATOM   76   C  C6    . DG  A 1 4   ? 53.198  -52.833 21.885  1.00 105.02 ? 5    DG  E C6    1 
ATOM   77   O  O6    . DG  A 1 4   ? 52.043  -53.100 22.273  1.00 106.45 ? 5    DG  E O6    1 
ATOM   78   N  N1    . DG  A 1 4   ? 54.263  -53.702 22.121  1.00 103.88 ? 5    DG  E N1    1 
ATOM   79   C  C2    . DG  A 1 4   ? 55.554  -53.474 21.737  1.00 102.63 ? 5    DG  E C2    1 
ATOM   80   N  N2    . DG  A 1 4   ? 56.420  -54.410 22.044  1.00 103.60 ? 5    DG  E N2    1 
ATOM   81   N  N3    . DG  A 1 4   ? 55.951  -52.407 21.096  1.00 104.08 ? 5    DG  E N3    1 
ATOM   82   C  C4    . DG  A 1 4   ? 54.929  -51.564 20.858  1.00 102.75 ? 5    DG  E C4    1 
ATOM   83   P  P     . DA  A 1 5   ? 58.484  -48.783 15.979  1.00 114.35 ? 6    DA  E P     1 
ATOM   84   O  OP1   . DA  A 1 5   ? 59.044  -47.436 15.693  1.00 114.61 ? 6    DA  E OP1   1 
ATOM   85   O  OP2   . DA  A 1 5   ? 57.255  -49.236 15.272  1.00 116.98 ? 6    DA  E OP2   1 
ATOM   86   O  "O5'" . DA  A 1 5   ? 59.622  -49.880 15.806  1.00 114.83 ? 6    DA  E "O5'" 1 
ATOM   87   C  "C5'" . DA  A 1 5   ? 60.889  -49.684 16.416  1.00 111.63 ? 6    DA  E "C5'" 1 
ATOM   88   C  "C4'" . DA  A 1 5   ? 61.206  -50.815 17.365  1.00 109.93 ? 6    DA  E "C4'" 1 
ATOM   89   O  "O4'" . DA  A 1 5   ? 59.997  -51.220 18.055  1.00 106.28 ? 6    DA  E "O4'" 1 
ATOM   90   C  "C3'" . DA  A 1 5   ? 61.670  -52.076 16.633  1.00 111.37 ? 6    DA  E "C3'" 1 
ATOM   91   O  "O3'" . DA  A 1 5   ? 62.469  -52.835 17.551  1.00 118.21 ? 6    DA  E "O3'" 1 
ATOM   92   C  "C2'" . DA  A 1 5   ? 60.373  -52.803 16.343  1.00 104.97 ? 6    DA  E "C2'" 1 
ATOM   93   C  "C1'" . DA  A 1 5   ? 59.626  -52.522 17.625  1.00 101.61 ? 6    DA  E "C1'" 1 
ATOM   94   N  N9    . DA  A 1 5   ? 58.172  -52.642 17.612  1.00 97.08  ? 6    DA  E N9    1 
ATOM   95   C  C8    . DA  A 1 5   ? 57.220  -51.891 16.966  1.00 94.89  ? 6    DA  E C8    1 
ATOM   96   N  N7    . DA  A 1 5   ? 55.990  -52.286 17.197  1.00 90.74  ? 6    DA  E N7    1 
ATOM   97   C  C5    . DA  A 1 5   ? 56.145  -53.372 18.046  1.00 91.85  ? 6    DA  E C5    1 
ATOM   98   C  C6    . DA  A 1 5   ? 55.219  -54.230 18.649  1.00 93.87  ? 6    DA  E C6    1 
ATOM   99   N  N6    . DA  A 1 5   ? 53.912  -54.102 18.483  1.00 94.35  ? 6    DA  E N6    1 
ATOM   100  N  N1    . DA  A 1 5   ? 55.689  -55.231 19.435  1.00 94.87  ? 6    DA  E N1    1 
ATOM   101  C  C2    . DA  A 1 5   ? 57.020  -55.336 19.594  1.00 96.38  ? 6    DA  E C2    1 
ATOM   102  N  N3    . DA  A 1 5   ? 57.993  -54.577 19.082  1.00 94.38  ? 6    DA  E N3    1 
ATOM   103  C  C4    . DA  A 1 5   ? 57.479  -53.605 18.308  1.00 93.67  ? 6    DA  E C4    1 
ATOM   104  P  P     . DA  A 1 6   ? 62.925  -54.338 17.190  1.00 121.36 ? 7    DA  E P     1 
ATOM   105  O  OP1   . DA  A 1 6   ? 63.700  -54.827 18.370  1.00 121.53 ? 7    DA  E OP1   1 
ATOM   106  O  OP2   . DA  A 1 6   ? 63.557  -54.331 15.844  1.00 120.66 ? 7    DA  E OP2   1 
ATOM   107  O  "O5'" . DA  A 1 6   ? 61.569  -55.181 17.127  1.00 116.08 ? 7    DA  E "O5'" 1 
ATOM   108  C  "C5'" . DA  A 1 6   ? 61.388  -56.338 17.957  1.00 109.38 ? 7    DA  E "C5'" 1 
ATOM   109  C  "C4'" . DA  A 1 6   ? 60.734  -57.461 17.180  1.00 103.09 ? 7    DA  E "C4'" 1 
ATOM   110  O  "O4'" . DA  A 1 6   ? 59.306  -57.214 17.079  1.00 99.62  ? 7    DA  E "O4'" 1 
ATOM   111  C  "C3'" . DA  A 1 6   ? 61.261  -57.465 15.738  1.00 100.55 ? 7    DA  E "C3'" 1 
ATOM   112  O  "O3'" . DA  A 1 6   ? 61.077  -58.736 15.087  1.00 99.58  ? 7    DA  E "O3'" 1 
ATOM   113  C  "C2'" . DA  A 1 6   ? 60.289  -56.526 15.047  1.00 100.78 ? 7    DA  E "C2'" 1 
ATOM   114  C  "C1'" . DA  A 1 6   ? 58.999  -56.949 15.726  1.00 101.28 ? 7    DA  E "C1'" 1 
ATOM   115  N  N9    . DA  A 1 6   ? 57.811  -56.101 15.621  1.00 102.67 ? 7    DA  E N9    1 
ATOM   116  C  C8    . DA  A 1 6   ? 57.705  -54.873 15.012  1.00 104.74 ? 7    DA  E C8    1 
ATOM   117  N  N7    . DA  A 1 6   ? 56.476  -54.420 14.947  1.00 106.37 ? 7    DA  E N7    1 
ATOM   118  C  C5    . DA  A 1 6   ? 55.723  -55.400 15.583  1.00 103.66 ? 7    DA  E C5    1 
ATOM   119  C  C6    . DA  A 1 6   ? 54.335  -55.521 15.835  1.00 105.52 ? 7    DA  E C6    1 
ATOM   120  N  N6    . DA  A 1 6   ? 53.433  -54.614 15.454  1.00 104.97 ? 7    DA  E N6    1 
ATOM   121  N  N1    . DA  A 1 6   ? 53.907  -56.621 16.497  1.00 105.60 ? 7    DA  E N1    1 
ATOM   122  C  C2    . DA  A 1 6   ? 54.818  -57.530 16.875  1.00 104.25 ? 7    DA  E C2    1 
ATOM   123  N  N3    . DA  A 1 6   ? 56.143  -57.530 16.694  1.00 102.34 ? 7    DA  E N3    1 
ATOM   124  C  C4    . DA  A 1 6   ? 56.536  -56.425 16.033  1.00 102.43 ? 7    DA  E C4    1 
ATOM   125  P  P     . DC  A 1 7   ? 61.911  -60.038 15.540  1.00 96.44  ? 8    DC  E P     1 
ATOM   126  O  OP1   . DC  A 1 7   ? 62.713  -59.720 16.750  1.00 95.62  ? 8    DC  E OP1   1 
ATOM   127  O  OP2   . DC  A 1 7   ? 62.591  -60.538 14.320  1.00 89.88  ? 8    DC  E OP2   1 
ATOM   128  O  "O5'" . DC  A 1 7   ? 60.739  -61.060 15.920  1.00 97.70  ? 8    DC  E "O5'" 1 
ATOM   129  C  "C5'" . DC  A 1 7   ? 59.379  -60.589 15.951  1.00 103.12 ? 8    DC  E "C5'" 1 
ATOM   130  C  "C4'" . DC  A 1 7   ? 58.395  -61.705 16.227  1.00 104.42 ? 8    DC  E "C4'" 1 
ATOM   131  O  "O4'" . DC  A 1 7   ? 57.064  -61.126 16.290  1.00 106.45 ? 8    DC  E "O4'" 1 
ATOM   132  C  "C3'" . DC  A 1 7   ? 58.327  -62.715 15.079  1.00 108.93 ? 8    DC  E "C3'" 1 
ATOM   133  O  "O3'" . DC  A 1 7   ? 57.844  -63.987 15.540  1.00 115.54 ? 8    DC  E "O3'" 1 
ATOM   134  C  "C2'" . DC  A 1 7   ? 57.286  -62.108 14.161  1.00 108.85 ? 8    DC  E "C2'" 1 
ATOM   135  C  "C1'" . DC  A 1 7   ? 56.298  -61.547 15.170  1.00 108.91 ? 8    DC  E "C1'" 1 
ATOM   136  N  N1    . DC  A 1 7   ? 55.493  -60.417 14.710  1.00 109.92 ? 8    DC  E N1    1 
ATOM   137  C  C2    . DC  A 1 7   ? 54.079  -60.526 14.588  1.00 111.73 ? 8    DC  E C2    1 
ATOM   138  O  O2    . DC  A 1 7   ? 53.484  -61.535 14.927  1.00 111.06 ? 8    DC  E O2    1 
ATOM   139  N  N3    . DC  A 1 7   ? 53.406  -59.497 14.072  1.00 112.96 ? 8    DC  E N3    1 
ATOM   140  C  C4    . DC  A 1 7   ? 54.039  -58.401 13.693  1.00 113.46 ? 8    DC  E C4    1 
ATOM   141  N  N4    . DC  A 1 7   ? 53.311  -57.412 13.199  1.00 116.66 ? 8    DC  E N4    1 
ATOM   142  C  C5    . DC  A 1 7   ? 55.445  -58.260 13.815  1.00 109.47 ? 8    DC  E C5    1 
ATOM   143  C  C6    . DC  A 1 7   ? 56.123  -59.272 14.351  1.00 108.04 ? 8    DC  E C6    1 
ATOM   144  P  P     . DT  A 1 8   ? 57.326  -65.090 14.469  1.00 119.67 ? 9    DT  E P     1 
ATOM   145  O  OP1   . DT  A 1 8   ? 57.658  -66.419 15.053  1.00 114.13 ? 9    DT  E OP1   1 
ATOM   146  O  OP2   . DT  A 1 8   ? 57.856  -64.720 13.120  1.00 115.44 ? 9    DT  E OP2   1 
ATOM   147  O  "O5'" . DT  A 1 8   ? 55.726  -64.940 14.433  1.00 119.67 ? 9    DT  E "O5'" 1 
ATOM   148  C  "C5'" . DT  A 1 8   ? 54.916  -65.697 13.502  1.00 120.05 ? 9    DT  E "C5'" 1 
ATOM   149  C  "C4'" . DT  A 1 8   ? 53.474  -65.771 13.972  1.00 120.06 ? 9    DT  E "C4'" 1 
ATOM   150  O  "O4'" . DT  A 1 8   ? 52.947  -64.422 13.933  1.00 119.33 ? 9    DT  E "O4'" 1 
ATOM   151  C  "C3'" . DT  A 1 8   ? 52.551  -66.573 13.039  1.00 120.36 ? 9    DT  E "C3'" 1 
ATOM   152  O  "O3'" . DT  A 1 8   ? 51.514  -67.334 13.714  1.00 122.06 ? 9    DT  E "O3'" 1 
ATOM   153  C  "C2'" . DT  A 1 8   ? 52.058  -65.548 12.046  1.00 117.00 ? 9    DT  E "C2'" 1 
ATOM   154  C  "C1'" . DT  A 1 8   ? 51.990  -64.282 12.880  1.00 116.61 ? 9    DT  E "C1'" 1 
ATOM   155  N  N1    . DT  A 1 8   ? 52.377  -63.140 12.061  1.00 113.55 ? 9    DT  E N1    1 
ATOM   156  C  C2    . DT  A 1 8   ? 51.406  -62.266 11.625  1.00 111.51 ? 9    DT  E C2    1 
ATOM   157  O  O2    . DT  A 1 8   ? 50.230  -62.349 11.953  1.00 110.16 ? 9    DT  E O2    1 
ATOM   158  N  N3    . DT  A 1 8   ? 51.870  -61.290 10.776  1.00 111.72 ? 9    DT  E N3    1 
ATOM   159  C  C4    . DT  A 1 8   ? 53.179  -61.114 10.345  1.00 112.48 ? 9    DT  E C4    1 
ATOM   160  O  O4    . DT  A 1 8   ? 53.466  -60.221 9.562   1.00 112.68 ? 9    DT  E O4    1 
ATOM   161  C  C5    . DT  A 1 8   ? 54.131  -62.040 10.872  1.00 112.75 ? 9    DT  E C5    1 
ATOM   162  C  C7    . DT  A 1 8   ? 55.561  -61.903 10.461  1.00 110.48 ? 9    DT  E C7    1 
ATOM   163  C  C6    . DT  A 1 8   ? 53.695  -62.990 11.701  1.00 112.72 ? 9    DT  E C6    1 
ATOM   164  P  P     . DA  A 1 9   ? 50.030  -66.711 13.991  1.00 122.09 ? 10   DA  E P     1 
ATOM   165  O  OP1   . DA  A 1 9   ? 50.169  -65.599 14.979  1.00 122.09 ? 10   DA  E OP1   1 
ATOM   166  O  OP2   . DA  A 1 9   ? 49.159  -67.880 14.326  1.00 120.06 ? 10   DA  E OP2   1 
ATOM   167  O  "O5'" . DA  A 1 9   ? 49.452  -66.078 12.632  1.00 122.09 ? 10   DA  E "O5'" 1 
ATOM   168  C  "C5'" . DA  A 1 9   ? 48.274  -65.227 12.695  1.00 122.09 ? 10   DA  E "C5'" 1 
ATOM   169  C  "C4'" . DA  A 1 9   ? 47.476  -65.216 11.402  1.00 121.00 ? 10   DA  E "C4'" 1 
ATOM   170  O  "O4'" . DA  A 1 9   ? 47.939  -64.173 10.515  1.00 118.09 ? 10   DA  E "O4'" 1 
ATOM   171  C  "C3'" . DA  A 1 9   ? 47.584  -66.510 10.594  1.00 120.84 ? 10   DA  E "C3'" 1 
ATOM   172  O  "O3'" . DA  A 1 9   ? 46.502  -66.603 9.647   1.00 122.09 ? 10   DA  E "O3'" 1 
ATOM   173  C  "C2'" . DA  A 1 9   ? 48.803  -66.231 9.736   1.00 118.34 ? 10   DA  E "C2'" 1 
ATOM   174  C  "C1'" . DA  A 1 9   ? 48.542  -64.774 9.386   1.00 116.15 ? 10   DA  E "C1'" 1 
ATOM   175  N  N9    . DA  A 1 9   ? 49.677  -63.967 8.965   1.00 115.68 ? 10   DA  E N9    1 
ATOM   176  C  C8    . DA  A 1 9   ? 51.010  -64.219 9.142   1.00 115.93 ? 10   DA  E C8    1 
ATOM   177  N  N7    . DA  A 1 9   ? 51.790  -63.324 8.590   1.00 115.87 ? 10   DA  E N7    1 
ATOM   178  C  C5    . DA  A 1 9   ? 50.908  -62.415 8.026   1.00 116.63 ? 10   DA  E C5    1 
ATOM   179  C  C6    . DA  A 1 9   ? 51.118  -61.242 7.297   1.00 117.17 ? 10   DA  E C6    1 
ATOM   180  N  N6    . DA  A 1 9   ? 52.333  -60.789 7.007   1.00 115.38 ? 10   DA  E N6    1 
ATOM   181  N  N1    . DA  A 1 9   ? 50.032  -60.551 6.873   1.00 117.51 ? 10   DA  E N1    1 
ATOM   182  C  C2    . DA  A 1 9   ? 48.815  -61.037 7.174   1.00 119.08 ? 10   DA  E C2    1 
ATOM   183  N  N3    . DA  A 1 9   ? 48.493  -62.141 7.856   1.00 118.23 ? 10   DA  E N3    1 
ATOM   184  C  C4    . DA  A 1 9   ? 49.602  -62.791 8.258   1.00 116.74 ? 10   DA  E C4    1 
ATOM   185  P  P     . DC  A 1 10  ? 44.965  -66.576 10.128  1.00 122.09 ? 11   DC  E P     1 
ATOM   186  O  OP1   . DC  A 1 10  ? 44.932  -66.169 11.564  1.00 122.09 ? 11   DC  E OP1   1 
ATOM   187  O  OP2   . DC  A 1 10  ? 44.353  -67.877 9.723   1.00 122.09 ? 11   DC  E OP2   1 
ATOM   188  O  "O5'" . DC  A 1 10  ? 44.301  -65.427 9.215   1.00 122.09 ? 11   DC  E "O5'" 1 
ATOM   189  C  "C5'" . DC  A 1 10  ? 45.104  -64.523 8.408   1.00 118.55 ? 11   DC  E "C5'" 1 
ATOM   190  C  "C4'" . DC  A 1 10  ? 44.360  -64.105 7.150   1.00 117.30 ? 11   DC  E "C4'" 1 
ATOM   191  O  "O4'" . DC  A 1 10  ? 45.212  -63.206 6.386   1.00 114.55 ? 11   DC  E "O4'" 1 
ATOM   192  C  "C3'" . DC  A 1 10  ? 44.089  -65.291 6.218   1.00 117.86 ? 11   DC  E "C3'" 1 
ATOM   193  O  "O3'" . DC  A 1 10  ? 43.014  -65.081 5.292   1.00 121.86 ? 11   DC  E "O3'" 1 
ATOM   194  C  "C2'" . DC  A 1 10  ? 45.332  -65.320 5.354   1.00 117.67 ? 11   DC  E "C2'" 1 
ATOM   195  C  "C1'" . DC  A 1 10  ? 45.646  -63.839 5.187   1.00 114.79 ? 11   DC  E "C1'" 1 
ATOM   196  N  N1    . DC  A 1 10  ? 47.088  -63.605 5.003   1.00 113.63 ? 11   DC  E N1    1 
ATOM   197  C  C2    . DC  A 1 10  ? 47.579  -62.351 4.531   1.00 114.53 ? 11   DC  E C2    1 
ATOM   198  O  O2    . DC  A 1 10  ? 46.792  -61.401 4.331   1.00 115.46 ? 11   DC  E O2    1 
ATOM   199  N  N3    . DC  A 1 10  ? 48.912  -62.221 4.313   1.00 112.55 ? 11   DC  E N3    1 
ATOM   200  C  C4    . DC  A 1 10  ? 49.731  -63.257 4.551   1.00 112.07 ? 11   DC  E C4    1 
ATOM   201  N  N4    . DC  A 1 10  ? 51.022  -63.108 4.314   1.00 110.35 ? 11   DC  E N4    1 
ATOM   202  C  C5    . DC  A 1 10  ? 49.260  -64.503 5.043   1.00 110.88 ? 11   DC  E C5    1 
ATOM   203  C  C6    . DC  A 1 10  ? 47.956  -64.630 5.256   1.00 112.17 ? 11   DC  E C6    1 
ATOM   204  P  P     . DT  A 1 11  ? 41.677  -64.307 5.732   1.00 122.09 ? 12   DT  E P     1 
ATOM   205  O  OP1   . DT  A 1 11  ? 41.863  -63.536 6.997   1.00 122.09 ? 12   DT  E OP1   1 
ATOM   206  O  OP2   . DT  A 1 11  ? 40.540  -65.263 5.602   1.00 122.09 ? 12   DT  E OP2   1 
ATOM   207  O  "O5'" . DT  A 1 11  ? 41.490  -63.265 4.544   1.00 122.09 ? 12   DT  E "O5'" 1 
ATOM   208  C  "C5'" . DT  A 1 11  ? 41.284  -63.725 3.216   1.00 122.09 ? 12   DT  E "C5'" 1 
ATOM   209  C  "C4'" . DT  A 1 11  ? 41.127  -62.551 2.284   1.00 122.09 ? 12   DT  E "C4'" 1 
ATOM   210  O  "O4'" . DT  A 1 11  ? 42.352  -61.765 2.361   1.00 122.09 ? 12   DT  E "O4'" 1 
ATOM   211  C  "C3'" . DT  A 1 11  ? 41.055  -63.092 0.847   1.00 122.09 ? 12   DT  E "C3'" 1 
ATOM   212  O  "O3'" . DT  A 1 11  ? 40.589  -62.225 -0.194  1.00 122.09 ? 12   DT  E "O3'" 1 
ATOM   213  C  "C2'" . DT  A 1 11  ? 42.507  -63.144 0.452   1.00 122.09 ? 12   DT  E "C2'" 1 
ATOM   214  C  "C1'" . DT  A 1 11  ? 42.986  -61.878 1.111   1.00 122.09 ? 12   DT  E "C1'" 1 
ATOM   215  N  N1    . DT  A 1 11  ? 44.435  -61.796 1.185   1.00 122.09 ? 12   DT  E N1    1 
ATOM   216  C  C2    . DT  A 1 11  ? 45.194  -62.908 1.513   1.00 122.09 ? 12   DT  E C2    1 
ATOM   217  O  O2    . DT  A 1 11  ? 44.746  -63.884 2.121   1.00 121.05 ? 12   DT  E O2    1 
ATOM   218  N  N3    . DT  A 1 11  ? 46.495  -62.834 1.058   1.00 122.05 ? 12   DT  E N3    1 
ATOM   219  C  C4    . DT  A 1 11  ? 47.050  -61.795 0.349   1.00 122.09 ? 12   DT  E C4    1 
ATOM   220  O  O4    . DT  A 1 11  ? 48.112  -61.938 -0.174  1.00 122.09 ? 12   DT  E O4    1 
ATOM   221  C  C5    . DT  A 1 11  ? 46.248  -60.610 0.228   1.00 122.09 ? 12   DT  E C5    1 
ATOM   222  C  C7    . DT  A 1 11  ? 46.823  -59.410 -0.452  1.00 122.09 ? 12   DT  E C7    1 
ATOM   223  C  C6    . DT  A 1 11  ? 45.009  -60.650 0.696   1.00 122.09 ? 12   DT  E C6    1 
ATOM   224  O  "O5'" . DA  B 2 1   ? 57.253  -61.992 -0.544  1.00 117.97 ? 12   DA  D "O5'" 1 
ATOM   225  C  "C5'" . DA  B 2 1   ? 57.447  -61.049 -1.619  1.00 120.06 ? 12   DA  D "C5'" 1 
ATOM   226  C  "C4'" . DA  B 2 1   ? 56.212  -60.189 -1.578  1.00 122.09 ? 12   DA  D "C4'" 1 
ATOM   227  O  "O4'" . DA  B 2 1   ? 55.088  -61.095 -1.431  1.00 122.09 ? 12   DA  D "O4'" 1 
ATOM   228  C  "C3'" . DA  B 2 1   ? 56.193  -59.244 -0.360  1.00 122.09 ? 12   DA  D "C3'" 1 
ATOM   229  O  "O3'" . DA  B 2 1   ? 55.679  -57.956 -0.705  1.00 122.09 ? 12   DA  D "O3'" 1 
ATOM   230  C  "C2'" . DA  B 2 1   ? 55.383  -59.973 0.710   1.00 122.09 ? 12   DA  D "C2'" 1 
ATOM   231  C  "C1'" . DA  B 2 1   ? 54.568  -60.901 -0.144  1.00 122.09 ? 12   DA  D "C1'" 1 
ATOM   232  N  N9    . DA  B 2 1   ? 53.641  -61.943 0.293   1.00 122.09 ? 12   DA  D N9    1 
ATOM   233  C  C8    . DA  B 2 1   ? 53.592  -63.296 0.675   1.00 122.09 ? 12   DA  D C8    1 
ATOM   234  N  N7    . DA  B 2 1   ? 52.407  -63.697 1.027   1.00 122.09 ? 12   DA  D N7    1 
ATOM   235  C  C5    . DA  B 2 1   ? 51.648  -62.522 0.878   1.00 122.09 ? 12   DA  D C5    1 
ATOM   236  C  C6    . DA  B 2 1   ? 50.290  -62.250 1.103   1.00 122.09 ? 12   DA  D C6    1 
ATOM   237  N  N6    . DA  B 2 1   ? 49.433  -63.180 1.501   1.00 122.09 ? 12   DA  D N6    1 
ATOM   238  N  N1    . DA  B 2 1   ? 49.855  -60.973 0.861   1.00 122.09 ? 12   DA  D N1    1 
ATOM   239  C  C2    . DA  B 2 1   ? 50.735  -60.076 0.425   1.00 122.09 ? 12   DA  D C2    1 
ATOM   240  N  N3    . DA  B 2 1   ? 52.029  -60.220 0.194   1.00 122.09 ? 12   DA  D N3    1 
ATOM   241  C  C4    . DA  B 2 1   ? 52.392  -61.477 0.435   1.00 122.09 ? 12   DA  D C4    1 
ATOM   242  P  P     . DG  B 2 2   ? 56.544  -56.988 -1.644  1.00 122.09 ? 11   DG  D P     1 
ATOM   243  O  OP1   . DG  B 2 2   ? 56.150  -57.308 -3.047  1.00 122.09 ? 11   DG  D OP1   1 
ATOM   244  O  OP2   . DG  B 2 2   ? 57.963  -57.153 -1.216  1.00 122.09 ? 11   DG  D OP2   1 
ATOM   245  O  "O5'" . DG  B 2 2   ? 55.999  -55.516 -1.329  1.00 122.09 ? 11   DG  D "O5'" 1 
ATOM   246  C  "C5'" . DG  B 2 2   ? 55.648  -55.096 -0.008  1.00 122.09 ? 11   DG  D "C5'" 1 
ATOM   247  C  "C4'" . DG  B 2 2   ? 54.215  -54.597 0.023   1.00 122.09 ? 11   DG  D "C4'" 1 
ATOM   248  O  "O4'" . DG  B 2 2   ? 53.317  -55.733 0.188   1.00 122.09 ? 11   DG  D "O4'" 1 
ATOM   249  C  "C3'" . DG  B 2 2   ? 53.936  -53.682 1.210   1.00 122.09 ? 11   DG  D "C3'" 1 
ATOM   250  O  "O3'" . DG  B 2 2   ? 53.213  -52.524 0.806   1.00 122.09 ? 11   DG  D "O3'" 1 
ATOM   251  C  "C2'" . DG  B 2 2   ? 53.292  -54.559 2.272   1.00 122.09 ? 11   DG  D "C2'" 1 
ATOM   252  C  "C1'" . DG  B 2 2   ? 52.697  -55.703 1.459   1.00 122.09 ? 11   DG  D "C1'" 1 
ATOM   253  N  N9    . DG  B 2 2   ? 52.867  -56.996 2.108   1.00 122.09 ? 11   DG  D N9    1 
ATOM   254  C  C8    . DG  B 2 2   ? 54.064  -57.611 2.385   1.00 122.09 ? 11   DG  D C8    1 
ATOM   255  N  N7    . DG  B 2 2   ? 53.925  -58.752 2.998   1.00 122.09 ? 11   DG  D N7    1 
ATOM   256  C  C5    . DG  B 2 2   ? 52.551  -58.908 3.135   1.00 122.09 ? 11   DG  D C5    1 
ATOM   257  C  C6    . DG  B 2 2   ? 51.818  -59.956 3.725   1.00 122.09 ? 11   DG  D C6    1 
ATOM   258  O  O6    . DG  B 2 2   ? 52.254  -60.971 4.255   1.00 122.04 ? 11   DG  D O6    1 
ATOM   259  N  N1    . DG  B 2 2   ? 50.445  -59.736 3.661   1.00 122.09 ? 11   DG  D N1    1 
ATOM   260  C  C2    . DG  B 2 2   ? 49.844  -58.640 3.101   1.00 122.09 ? 11   DG  D C2    1 
ATOM   261  N  N2    . DG  B 2 2   ? 48.488  -58.646 3.164   1.00 120.48 ? 11   DG  D N2    1 
ATOM   262  N  N3    . DG  B 2 2   ? 50.522  -57.630 2.534   1.00 122.09 ? 11   DG  D N3    1 
ATOM   263  C  C4    . DG  B 2 2   ? 51.873  -57.837 2.588   1.00 122.09 ? 11   DG  D C4    1 
ATOM   264  P  P     . DT  B 2 3   ? 52.169  -51.821 1.819   1.00 122.09 ? 10   DT  D P     1 
ATOM   265  O  OP1   . DT  B 2 3   ? 51.307  -50.920 0.998   1.00 122.09 ? 10   DT  D OP1   1 
ATOM   266  O  OP2   . DT  B 2 3   ? 52.958  -51.263 2.954   1.00 122.09 ? 10   DT  D OP2   1 
ATOM   267  O  "O5'" . DT  B 2 3   ? 51.237  -53.000 2.371   1.00 122.09 ? 10   DT  D "O5'" 1 
ATOM   268  C  "C5'" . DT  B 2 3   ? 50.161  -53.512 1.584   1.00 120.49 ? 10   DT  D "C5'" 1 
ATOM   269  C  "C4'" . DT  B 2 3   ? 48.930  -53.791 2.433   1.00 121.01 ? 10   DT  D "C4'" 1 
ATOM   270  O  "O4'" . DT  B 2 3   ? 49.050  -55.090 3.077   1.00 120.49 ? 10   DT  D "O4'" 1 
ATOM   271  C  "C3'" . DT  B 2 3   ? 48.719  -52.781 3.559   1.00 122.09 ? 10   DT  D "C3'" 1 
ATOM   272  O  "O3'" . DT  B 2 3   ? 47.394  -52.226 3.557   1.00 122.09 ? 10   DT  D "O3'" 1 
ATOM   273  C  "C2'" . DT  B 2 3   ? 49.260  -53.458 4.820   1.00 122.09 ? 10   DT  D "C2'" 1 
ATOM   274  C  "C1'" . DT  B 2 3   ? 49.140  -54.943 4.480   1.00 122.09 ? 10   DT  D "C1'" 1 
ATOM   275  N  N1    . DT  B 2 3   ? 50.184  -55.840 5.012   1.00 122.09 ? 10   DT  D N1    1 
ATOM   276  C  C2    . DT  B 2 3   ? 49.770  -57.011 5.628   1.00 122.09 ? 10   DT  D C2    1 
ATOM   277  O  O2    . DT  B 2 3   ? 48.592  -57.332 5.738   1.00 122.09 ? 10   DT  D O2    1 
ATOM   278  N  N3    . DT  B 2 3   ? 50.791  -57.797 6.104   1.00 122.09 ? 10   DT  D N3    1 
ATOM   279  C  C4    . DT  B 2 3   ? 52.147  -57.535 6.029   1.00 122.09 ? 10   DT  D C4    1 
ATOM   280  O  O4    . DT  B 2 3   ? 52.953  -58.331 6.496   1.00 122.09 ? 10   DT  D O4    1 
ATOM   281  C  C5    . DT  B 2 3   ? 52.507  -56.296 5.378   1.00 122.09 ? 10   DT  D C5    1 
ATOM   282  C  C7    . DT  B 2 3   ? 53.956  -55.943 5.257   1.00 122.03 ? 10   DT  D C7    1 
ATOM   283  C  C6    . DT  B 2 3   ? 51.520  -55.519 4.909   1.00 122.09 ? 10   DT  D C6    1 
ATOM   284  P  P     . DA  B 2 4   ? 46.791  -51.521 4.887   1.00 122.09 ? 9    DA  D P     1 
ATOM   285  O  OP1   . DA  B 2 4   ? 45.801  -50.498 4.447   1.00 122.09 ? 9    DA  D OP1   1 
ATOM   286  O  OP2   . DA  B 2 4   ? 47.921  -51.119 5.775   1.00 122.09 ? 9    DA  D OP2   1 
ATOM   287  O  "O5'" . DA  B 2 4   ? 45.985  -52.688 5.619   1.00 122.09 ? 9    DA  D "O5'" 1 
ATOM   288  C  "C5'" . DA  B 2 4   ? 46.662  -53.873 5.985   1.00 121.19 ? 9    DA  D "C5'" 1 
ATOM   289  C  "C4'" . DA  B 2 4   ? 45.751  -54.872 6.639   1.00 122.09 ? 9    DA  D "C4'" 1 
ATOM   290  O  "O4'" . DA  B 2 4   ? 46.558  -56.043 6.882   1.00 122.09 ? 9    DA  D "O4'" 1 
ATOM   291  C  "C3'" . DA  B 2 4   ? 45.206  -54.436 7.996   1.00 121.80 ? 9    DA  D "C3'" 1 
ATOM   292  O  "O3'" . DA  B 2 4   ? 43.858  -54.867 8.180   1.00 122.09 ? 9    DA  D "O3'" 1 
ATOM   293  C  "C2'" . DA  B 2 4   ? 46.160  -55.025 9.018   1.00 122.09 ? 9    DA  D "C2'" 1 
ATOM   294  C  "C1'" . DA  B 2 4   ? 46.802  -56.178 8.257   1.00 122.09 ? 9    DA  D "C1'" 1 
ATOM   295  N  N9    . DA  B 2 4   ? 48.237  -56.251 8.474   1.00 122.09 ? 9    DA  D N9    1 
ATOM   296  C  C8    . DA  B 2 4   ? 49.239  -55.339 8.224   1.00 122.09 ? 9    DA  D C8    1 
ATOM   297  N  N7    . DA  B 2 4   ? 50.424  -55.752 8.604   1.00 122.09 ? 9    DA  D N7    1 
ATOM   298  C  C5    . DA  B 2 4   ? 50.181  -57.018 9.126   1.00 122.09 ? 9    DA  D C5    1 
ATOM   299  C  C6    . DA  B 2 4   ? 51.014  -57.981 9.704   1.00 121.23 ? 9    DA  D C6    1 
ATOM   300  N  N6    . DA  B 2 4   ? 52.328  -57.818 9.859   1.00 119.96 ? 9    DA  D N6    1 
ATOM   301  N  N1    . DA  B 2 4   ? 50.441  -59.132 10.129  1.00 121.93 ? 9    DA  D N1    1 
ATOM   302  C  C2    . DA  B 2 4   ? 49.122  -59.294 9.974   1.00 121.13 ? 9    DA  D C2    1 
ATOM   303  N  N3    . DA  B 2 4   ? 48.238  -58.465 9.448   1.00 120.79 ? 9    DA  D N3    1 
ATOM   304  C  C4    . DA  B 2 4   ? 48.840  -57.334 9.042   1.00 122.09 ? 9    DA  D C4    1 
ATOM   305  P  P     . DG  B 2 5   ? 43.220  -54.912 9.666   1.00 122.09 ? 8    DG  D P     1 
ATOM   306  O  OP1   . DG  B 2 5   ? 41.764  -55.174 9.529   1.00 122.09 ? 8    DG  D OP1   1 
ATOM   307  O  OP2   . DG  B 2 5   ? 43.690  -53.694 10.380  1.00 122.09 ? 8    DG  D OP2   1 
ATOM   308  O  "O5'" . DG  B 2 5   ? 43.834  -56.189 10.407  1.00 121.30 ? 8    DG  D "O5'" 1 
ATOM   309  C  "C5'" . DG  B 2 5   ? 43.702  -56.323 11.833  1.00 122.09 ? 8    DG  D "C5'" 1 
ATOM   310  C  "C4'" . DG  B 2 5   ? 43.973  -57.742 12.278  1.00 120.83 ? 8    DG  D "C4'" 1 
ATOM   311  O  "O4'" . DG  B 2 5   ? 45.229  -58.153 11.690  1.00 117.25 ? 8    DG  D "O4'" 1 
ATOM   312  C  "C3'" . DG  B 2 5   ? 44.142  -57.886 13.794  1.00 118.93 ? 8    DG  D "C3'" 1 
ATOM   313  O  "O3'" . DG  B 2 5   ? 43.306  -58.838 14.466  1.00 117.77 ? 8    DG  D "O3'" 1 
ATOM   314  C  "C2'" . DG  B 2 5   ? 45.638  -57.883 14.050  1.00 117.77 ? 8    DG  D "C2'" 1 
ATOM   315  C  "C1'" . DG  B 2 5   ? 46.217  -58.242 12.687  1.00 116.69 ? 8    DG  D "C1'" 1 
ATOM   316  N  N9    . DG  B 2 5   ? 47.312  -57.339 12.361  1.00 115.03 ? 8    DG  D N9    1 
ATOM   317  C  C8    . DG  B 2 5   ? 47.301  -56.124 11.719  1.00 114.82 ? 8    DG  D C8    1 
ATOM   318  N  N7    . DG  B 2 5   ? 48.494  -55.590 11.624  1.00 113.12 ? 8    DG  D N7    1 
ATOM   319  C  C5    . DG  B 2 5   ? 49.320  -56.520 12.243  1.00 112.65 ? 8    DG  D C5    1 
ATOM   320  C  C6    . DG  B 2 5   ? 50.731  -56.537 12.467  1.00 110.95 ? 8    DG  D C6    1 
ATOM   321  O  O6    . DG  B 2 5   ? 51.581  -55.719 12.150  1.00 109.27 ? 8    DG  D O6    1 
ATOM   322  N  N1    . DG  B 2 5   ? 51.122  -57.687 13.141  1.00 109.14 ? 8    DG  D N1    1 
ATOM   323  C  C2    . DG  B 2 5   ? 50.283  -58.689 13.549  1.00 107.92 ? 8    DG  D C2    1 
ATOM   324  N  N2    . DG  B 2 5   ? 50.818  -59.723 14.190  1.00 106.35 ? 8    DG  D N2    1 
ATOM   325  N  N3    . DG  B 2 5   ? 49.000  -58.690 13.344  1.00 110.26 ? 8    DG  D N3    1 
ATOM   326  C  C4    . DG  B 2 5   ? 48.590  -57.594 12.698  1.00 113.83 ? 8    DG  D C4    1 
ATOM   327  P  P     . DT  B 2 6   ? 43.935  -59.854 15.563  1.00 117.89 ? 7    DT  D P     1 
ATOM   328  O  OP1   . DT  B 2 6   ? 45.300  -60.255 15.126  1.00 119.86 ? 7    DT  D OP1   1 
ATOM   329  O  OP2   . DT  B 2 6   ? 42.912  -60.905 15.806  1.00 117.15 ? 7    DT  D OP2   1 
ATOM   330  O  "O5'" . DT  B 2 6   ? 44.084  -59.012 16.912  1.00 119.43 ? 7    DT  D "O5'" 1 
ATOM   331  C  "C5'" . DT  B 2 6   ? 45.378  -58.699 17.469  1.00 119.36 ? 7    DT  D "C5'" 1 
ATOM   332  C  "C4'" . DT  B 2 6   ? 46.138  -59.965 17.856  1.00 116.74 ? 7    DT  D "C4'" 1 
ATOM   333  O  "O4'" . DT  B 2 6   ? 47.306  -60.079 16.994  1.00 114.47 ? 7    DT  D "O4'" 1 
ATOM   334  C  "C3'" . DT  B 2 6   ? 46.687  -59.999 19.279  1.00 113.09 ? 7    DT  D "C3'" 1 
ATOM   335  O  "O3'" . DT  B 2 6   ? 46.260  -61.091 20.107  1.00 108.20 ? 7    DT  D "O3'" 1 
ATOM   336  C  "C2'" . DT  B 2 6   ? 48.150  -59.567 19.189  1.00 111.51 ? 7    DT  D "C2'" 1 
ATOM   337  C  "C1'" . DT  B 2 6   ? 48.493  -59.786 17.712  1.00 112.04 ? 7    DT  D "C1'" 1 
ATOM   338  N  N1    . DT  B 2 6   ? 49.106  -58.596 17.086  1.00 109.37 ? 7    DT  D N1    1 
ATOM   339  C  C2    . DT  B 2 6   ? 50.475  -58.439 17.117  1.00 108.59 ? 7    DT  D C2    1 
ATOM   340  O  O2    . DT  B 2 6   ? 51.228  -59.234 17.646  1.00 109.87 ? 7    DT  D O2    1 
ATOM   341  N  N3    . DT  B 2 6   ? 50.936  -57.302 16.495  1.00 107.86 ? 7    DT  D N3    1 
ATOM   342  C  C4    . DT  B 2 6   ? 50.178  -56.336 15.863  1.00 109.02 ? 7    DT  D C4    1 
ATOM   343  O  O4    . DT  B 2 6   ? 50.723  -55.372 15.342  1.00 108.75 ? 7    DT  D O4    1 
ATOM   344  C  C5    . DT  B 2 6   ? 48.756  -56.563 15.874  1.00 108.19 ? 7    DT  D C5    1 
ATOM   345  C  C7    . DT  B 2 6   ? 47.859  -55.565 15.213  1.00 109.10 ? 7    DT  D C7    1 
ATOM   346  C  C6    . DT  B 2 6   ? 48.298  -57.664 16.476  1.00 108.57 ? 7    DT  D C6    1 
ATOM   347  P  P     . DT  B 2 7   ? 47.165  -62.417 20.220  1.00 107.54 ? 6    DT  D P     1 
ATOM   348  O  OP1   . DT  B 2 7   ? 48.161  -62.334 19.121  1.00 111.58 ? 6    DT  D OP1   1 
ATOM   349  O  OP2   . DT  B 2 7   ? 46.266  -63.590 20.310  1.00 108.24 ? 6    DT  D OP2   1 
ATOM   350  O  "O5'" . DT  B 2 7   ? 47.953  -62.311 21.604  1.00 109.18 ? 6    DT  D "O5'" 1 
ATOM   351  C  "C5'" . DT  B 2 7   ? 48.970  -61.326 21.783  1.00 103.77 ? 6    DT  D "C5'" 1 
ATOM   352  C  "C4'" . DT  B 2 7   ? 50.354  -61.951 21.846  1.00 90.12  ? 6    DT  D "C4'" 1 
ATOM   353  O  "O4'" . DT  B 2 7   ? 51.195  -61.245 20.906  1.00 84.39  ? 6    DT  D "O4'" 1 
ATOM   354  C  "C3'" . DT  B 2 7   ? 50.996  -61.771 23.220  1.00 84.75  ? 6    DT  D "C3'" 1 
ATOM   355  O  "O3'" . DT  B 2 7   ? 51.729  -62.945 23.641  1.00 83.75  ? 6    DT  D "O3'" 1 
ATOM   356  C  "C2'" . DT  B 2 7   ? 51.822  -60.504 23.078  1.00 82.51  ? 6    DT  D "C2'" 1 
ATOM   357  C  "C1'" . DT  B 2 7   ? 52.141  -60.462 21.590  1.00 81.15  ? 6    DT  D "C1'" 1 
ATOM   358  N  N1    . DT  B 2 7   ? 52.125  -59.114 21.036  1.00 76.71  ? 6    DT  D N1    1 
ATOM   359  C  C2    . DT  B 2 7   ? 53.324  -58.529 20.665  1.00 80.71  ? 6    DT  D C2    1 
ATOM   360  O  O2    . DT  B 2 7   ? 54.403  -59.080 20.786  1.00 87.84  ? 6    DT  D O2    1 
ATOM   361  N  N3    . DT  B 2 7   ? 53.204  -57.269 20.141  1.00 79.83  ? 6    DT  D N3    1 
ATOM   362  C  C4    . DT  B 2 7   ? 52.030  -56.567 19.961  1.00 79.32  ? 6    DT  D C4    1 
ATOM   363  O  O4    . DT  B 2 7   ? 52.057  -55.456 19.477  1.00 82.12  ? 6    DT  D O4    1 
ATOM   364  C  C5    . DT  B 2 7   ? 50.825  -57.241 20.379  1.00 78.70  ? 6    DT  D C5    1 
ATOM   365  C  C7    . DT  B 2 7   ? 49.515  -56.543 20.215  1.00 79.41  ? 6    DT  D C7    1 
ATOM   366  C  C6    . DT  B 2 7   ? 50.932  -58.463 20.891  1.00 73.96  ? 6    DT  D C6    1 
ATOM   367  P  P     . DC  B 2 8   ? 52.523  -62.968 25.067  1.00 85.76  ? 5    DC  D P     1 
ATOM   368  O  OP1   . DC  B 2 8   ? 52.862  -64.366 25.440  1.00 85.80  ? 5    DC  D OP1   1 
ATOM   369  O  OP2   . DC  B 2 8   ? 51.733  -62.141 26.009  1.00 90.18  ? 5    DC  D OP2   1 
ATOM   370  O  "O5'" . DC  B 2 8   ? 53.918  -62.217 24.828  1.00 88.34  ? 5    DC  D "O5'" 1 
ATOM   371  C  "C5'" . DC  B 2 8   ? 53.930  -60.945 24.206  1.00 88.85  ? 5    DC  D "C5'" 1 
ATOM   372  C  "C4'" . DC  B 2 8   ? 55.212  -60.184 24.400  1.00 84.21  ? 5    DC  D "C4'" 1 
ATOM   373  O  "O4'" . DC  B 2 8   ? 55.048  -58.935 23.702  1.00 83.80  ? 5    DC  D "O4'" 1 
ATOM   374  C  "C3'" . DC  B 2 8   ? 55.533  -59.824 25.838  1.00 82.80  ? 5    DC  D "C3'" 1 
ATOM   375  O  "O3'" . DC  B 2 8   ? 56.944  -59.868 25.959  1.00 85.18  ? 5    DC  D "O3'" 1 
ATOM   376  C  "C2'" . DC  B 2 8   ? 54.952  -58.434 26.041  1.00 82.12  ? 5    DC  D "C2'" 1 
ATOM   377  C  "C1'" . DC  B 2 8   ? 54.894  -57.891 24.623  1.00 80.15  ? 5    DC  D "C1'" 1 
ATOM   378  N  N1    . DC  B 2 8   ? 53.679  -57.154 24.309  1.00 74.07  ? 5    DC  D N1    1 
ATOM   379  C  C2    . DC  B 2 8   ? 53.853  -55.951 23.707  1.00 73.19  ? 5    DC  D C2    1 
ATOM   380  O  O2    . DC  B 2 8   ? 55.027  -55.621 23.470  1.00 80.17  ? 5    DC  D O2    1 
ATOM   381  N  N3    . DC  B 2 8   ? 52.772  -55.188 23.405  1.00 71.72  ? 5    DC  D N3    1 
ATOM   382  C  C4    . DC  B 2 8   ? 51.548  -55.635 23.708  1.00 73.91  ? 5    DC  D C4    1 
ATOM   383  N  N4    . DC  B 2 8   ? 50.488  -54.869 23.422  1.00 80.79  ? 5    DC  D N4    1 
ATOM   384  C  C5    . DC  B 2 8   ? 51.347  -56.896 24.328  1.00 74.92  ? 5    DC  D C5    1 
ATOM   385  C  C6    . DC  B 2 8   ? 52.433  -57.619 24.609  1.00 73.89  ? 5    DC  D C6    1 
ATOM   386  P  P     . DC  B 2 9   ? 57.621  -60.560 27.230  1.00 84.84  ? 4    DC  D P     1 
ATOM   387  O  OP1   . DC  B 2 9   ? 57.583  -62.024 26.961  1.00 79.05  ? 4    DC  D OP1   1 
ATOM   388  O  OP2   . DC  B 2 9   ? 56.952  -60.000 28.443  1.00 75.91  ? 4    DC  D OP2   1 
ATOM   389  O  "O5'" . DC  B 2 9   ? 59.137  -60.060 27.168  1.00 74.27  ? 4    DC  D "O5'" 1 
ATOM   390  C  "C5'" . DC  B 2 9   ? 59.557  -58.865 27.830  1.00 69.52  ? 4    DC  D "C5'" 1 
ATOM   391  C  "C4'" . DC  B 2 9   ? 60.120  -57.885 26.835  1.00 59.61  ? 4    DC  D "C4'" 1 
ATOM   392  O  "O4'" . DC  B 2 9   ? 59.019  -57.228 26.156  1.00 60.26  ? 4    DC  D "O4'" 1 
ATOM   393  C  "C3'" . DC  B 2 9   ? 60.900  -56.784 27.544  1.00 60.73  ? 4    DC  D "C3'" 1 
ATOM   394  O  "O3'" . DC  B 2 9   ? 62.116  -56.524 26.846  1.00 58.34  ? 4    DC  D "O3'" 1 
ATOM   395  C  "C2'" . DC  B 2 9   ? 59.930  -55.608 27.662  1.00 56.99  ? 4    DC  D "C2'" 1 
ATOM   396  C  "C1'" . DC  B 2 9   ? 58.973  -55.861 26.504  1.00 56.90  ? 4    DC  D "C1'" 1 
ATOM   397  N  N1    . DC  B 2 9   ? 57.573  -55.408 26.621  1.00 49.84  ? 4    DC  D N1    1 
ATOM   398  C  C2    . DC  B 2 9   ? 57.188  -54.269 25.905  1.00 49.24  ? 4    DC  D C2    1 
ATOM   399  O  O2    . DC  B 2 9   ? 58.042  -53.658 25.248  1.00 60.91  ? 4    DC  D O2    1 
ATOM   400  N  N3    . DC  B 2 9   ? 55.901  -53.862 25.943  1.00 47.19  ? 4    DC  D N3    1 
ATOM   401  C  C4    . DC  B 2 9   ? 55.014  -54.539 26.664  1.00 39.77  ? 4    DC  D C4    1 
ATOM   402  N  N4    . DC  B 2 9   ? 53.754  -54.113 26.653  1.00 39.08  ? 4    DC  D N4    1 
ATOM   403  C  C5    . DC  B 2 9   ? 55.380  -55.686 27.427  1.00 41.81  ? 4    DC  D C5    1 
ATOM   404  C  C6    . DC  B 2 9   ? 56.662  -56.081 27.381  1.00 43.94  ? 4    DC  D C6    1 
ATOM   405  P  P     . DG  B 2 10  ? 63.528  -56.619 27.606  1.00 61.62  ? 3    DG  D P     1 
ATOM   406  O  OP1   . DG  B 2 10  ? 64.433  -55.611 26.992  1.00 53.91  ? 3    DG  D OP1   1 
ATOM   407  O  OP2   . DG  B 2 10  ? 63.920  -58.054 27.598  1.00 59.87  ? 3    DG  D OP2   1 
ATOM   408  O  "O5'" . DG  B 2 10  ? 63.201  -56.191 29.114  1.00 57.06  ? 3    DG  D "O5'" 1 
ATOM   409  C  "C5'" . DG  B 2 10  ? 64.120  -55.409 29.880  1.00 51.25  ? 3    DG  D "C5'" 1 
ATOM   410  C  "C4'" . DG  B 2 10  ? 63.473  -54.974 31.179  1.00 50.70  ? 3    DG  D "C4'" 1 
ATOM   411  O  "O4'" . DG  B 2 10  ? 62.107  -54.595 30.914  1.00 49.78  ? 3    DG  D "O4'" 1 
ATOM   412  C  "C3'" . DG  B 2 10  ? 63.397  -56.001 32.305  1.00 45.48  ? 3    DG  D "C3'" 1 
ATOM   413  O  "O3'" . DG  B 2 10  ? 64.496  -55.748 33.176  1.00 41.19  ? 3    DG  D "O3'" 1 
ATOM   414  C  "C2'" . DG  B 2 10  ? 62.106  -55.660 33.051  1.00 43.70  ? 3    DG  D "C2'" 1 
ATOM   415  C  "C1'" . DG  B 2 10  ? 61.370  -54.729 32.100  1.00 50.99  ? 3    DG  D "C1'" 1 
ATOM   416  N  N9    . DG  B 2 10  ? 59.973  -54.984 31.781  1.00 56.90  ? 3    DG  D N9    1 
ATOM   417  C  C8    . DG  B 2 10  ? 59.007  -54.016 31.746  1.00 60.27  ? 3    DG  D C8    1 
ATOM   418  N  N7    . DG  B 2 10  ? 57.847  -54.462 31.362  1.00 68.50  ? 3    DG  D N7    1 
ATOM   419  C  C5    . DG  B 2 10  ? 58.049  -55.816 31.142  1.00 65.63  ? 3    DG  D C5    1 
ATOM   420  C  C6    . DG  B 2 10  ? 57.146  -56.810 30.699  1.00 65.85  ? 3    DG  D C6    1 
ATOM   421  O  O6    . DG  B 2 10  ? 55.956  -56.688 30.393  1.00 71.47  ? 3    DG  D O6    1 
ATOM   422  N  N1    . DG  B 2 10  ? 57.752  -58.053 30.622  1.00 67.00  ? 3    DG  D N1    1 
ATOM   423  C  C2    . DG  B 2 10  ? 59.060  -58.312 30.930  1.00 66.42  ? 3    DG  D C2    1 
ATOM   424  N  N2    . DG  B 2 10  ? 59.439  -59.589 30.799  1.00 68.64  ? 3    DG  D N2    1 
ATOM   425  N  N3    . DG  B 2 10  ? 59.926  -57.390 31.336  1.00 63.36  ? 3    DG  D N3    1 
ATOM   426  C  C4    . DG  B 2 10  ? 59.354  -56.168 31.419  1.00 62.43  ? 3    DG  D C4    1 
ATOM   427  P  P     . DC  B 2 11  ? 64.934  -56.835 34.275  1.00 45.94  ? 2    DC  D P     1 
ATOM   428  O  OP1   . DC  B 2 11  ? 66.408  -56.652 34.460  1.00 48.82  ? 2    DC  D OP1   1 
ATOM   429  O  OP2   . DC  B 2 11  ? 64.418  -58.153 33.836  1.00 51.77  ? 2    DC  D OP2   1 
ATOM   430  O  "O5'" . DC  B 2 11  ? 64.158  -56.427 35.622  1.00 44.83  ? 2    DC  D "O5'" 1 
ATOM   431  C  "C5'" . DC  B 2 11  ? 62.799  -56.061 35.564  1.00 43.80  ? 2    DC  D "C5'" 1 
ATOM   432  C  "C4'" . DC  B 2 11  ? 62.143  -55.949 36.917  1.00 37.97  ? 2    DC  D "C4'" 1 
ATOM   433  O  "O4'" . DC  B 2 11  ? 60.828  -55.404 36.613  1.00 45.06  ? 2    DC  D "O4'" 1 
ATOM   434  C  "C3'" . DC  B 2 11  ? 61.904  -57.235 37.715  1.00 37.75  ? 2    DC  D "C3'" 1 
ATOM   435  O  "O3'" . DC  B 2 11  ? 62.856  -57.240 38.788  1.00 38.32  ? 2    DC  D "O3'" 1 
ATOM   436  C  "C2'" . DC  B 2 11  ? 60.474  -57.064 38.252  1.00 43.69  ? 2    DC  D "C2'" 1 
ATOM   437  C  "C1'" . DC  B 2 11  ? 59.819  -56.188 37.183  1.00 48.27  ? 2    DC  D "C1'" 1 
ATOM   438  N  N1    . DC  B 2 11  ? 59.133  -56.906 36.085  1.00 53.56  ? 2    DC  D N1    1 
ATOM   439  C  C2    . DC  B 2 11  ? 58.067  -56.296 35.547  1.00 53.12  ? 2    DC  D C2    1 
ATOM   440  O  O2    . DC  B 2 11  ? 57.754  -55.183 35.989  1.00 63.88  ? 2    DC  D O2    1 
ATOM   441  N  N3    . DC  B 2 11  ? 57.378  -56.915 34.569  1.00 50.43  ? 2    DC  D N3    1 
ATOM   442  C  C4    . DC  B 2 11  ? 57.756  -58.091 34.138  1.00 54.48  ? 2    DC  D C4    1 
ATOM   443  N  N4    . DC  B 2 11  ? 57.017  -58.648 33.166  1.00 58.62  ? 2    DC  D N4    1 
ATOM   444  C  C5    . DC  B 2 11  ? 58.871  -58.750 34.692  1.00 52.92  ? 2    DC  D C5    1 
ATOM   445  C  C6    . DC  B 2 11  ? 59.540  -58.128 35.656  1.00 54.02  ? 2    DC  D C6    1 
ATOM   446  P  P     . DG  B 2 12  ? 63.285  -58.619 39.530  1.00 49.11  ? 1    DG  D P     1 
ATOM   447  O  OP1   . DG  B 2 12  ? 64.039  -58.284 40.774  1.00 58.96  ? 1    DG  D OP1   1 
ATOM   448  O  OP2   . DG  B 2 12  ? 63.915  -59.540 38.554  1.00 60.10  ? 1    DG  D OP2   1 
ATOM   449  O  "O5'" . DG  B 2 12  ? 61.912  -59.286 40.006  1.00 54.18  ? 1    DG  D "O5'" 1 
ATOM   450  C  "C5'" . DG  B 2 12  ? 61.201  -58.794 41.153  1.00 55.18  ? 1    DG  D "C5'" 1 
ATOM   451  C  "C4'" . DG  B 2 12  ? 60.560  -59.930 41.927  1.00 63.35  ? 1    DG  D "C4'" 1 
ATOM   452  O  "O4'" . DG  B 2 12  ? 59.756  -60.740 41.026  1.00 66.24  ? 1    DG  D "O4'" 1 
ATOM   453  C  "C3'" . DG  B 2 12  ? 61.509  -60.904 42.638  1.00 66.48  ? 1    DG  D "C3'" 1 
ATOM   454  O  "O3'" . DG  B 2 12  ? 60.939  -61.478 43.820  1.00 72.19  ? 1    DG  D "O3'" 1 
ATOM   455  C  "C2'" . DG  B 2 12  ? 61.574  -62.087 41.690  1.00 69.09  ? 1    DG  D "C2'" 1 
ATOM   456  C  "C1'" . DG  B 2 12  ? 60.193  -62.097 41.047  1.00 72.48  ? 1    DG  D "C1'" 1 
ATOM   457  N  N9    . DG  B 2 12  ? 60.239  -62.572 39.666  1.00 81.63  ? 1    DG  D N9    1 
ATOM   458  C  C8    . DG  B 2 12  ? 60.869  -61.962 38.608  1.00 82.51  ? 1    DG  D C8    1 
ATOM   459  N  N7    . DG  B 2 12  ? 60.793  -62.650 37.503  1.00 85.74  ? 1    DG  D N7    1 
ATOM   460  C  C5    . DG  B 2 12  ? 60.058  -63.774 37.849  1.00 89.35  ? 1    DG  D C5    1 
ATOM   461  C  C6    . DG  B 2 12  ? 59.666  -64.882 37.065  1.00 92.56  ? 1    DG  D C6    1 
ATOM   462  O  O6    . DG  B 2 12  ? 59.910  -65.104 35.872  1.00 94.07  ? 1    DG  D O6    1 
ATOM   463  N  N1    . DG  B 2 12  ? 58.926  -65.795 37.806  1.00 95.14  ? 1    DG  D N1    1 
ATOM   464  C  C2    . DG  B 2 12  ? 58.610  -65.665 39.136  1.00 94.45  ? 1    DG  D C2    1 
ATOM   465  N  N2    . DG  B 2 12  ? 57.892  -66.661 39.673  1.00 97.75  ? 1    DG  D N2    1 
ATOM   466  N  N3    . DG  B 2 12  ? 58.975  -64.637 39.882  1.00 92.90  ? 1    DG  D N3    1 
ATOM   467  C  C4    . DG  B 2 12  ? 59.693  -63.736 39.178  1.00 88.12  ? 1    DG  D C4    1 
ATOM   468  N  N     . MET C 3 1   ? 74.945  -20.818 49.796  1.00 71.19  ? 1    MET A N     1 
ATOM   469  C  CA    . MET C 3 1   ? 74.975  -19.920 48.610  1.00 73.43  ? 1    MET A CA    1 
ATOM   470  C  C     . MET C 3 1   ? 73.541  -19.570 48.231  1.00 71.02  ? 1    MET A C     1 
ATOM   471  O  O     . MET C 3 1   ? 72.680  -19.446 49.105  1.00 69.64  ? 1    MET A O     1 
ATOM   472  C  CB    . MET C 3 1   ? 75.667  -20.624 47.438  1.00 80.22  ? 1    MET A CB    1 
ATOM   473  C  CG    . MET C 3 1   ? 75.987  -19.705 46.264  1.00 89.82  ? 1    MET A CG    1 
ATOM   474  S  SD    . MET C 3 1   ? 76.888  -20.525 44.918  1.00 99.68  ? 1    MET A SD    1 
ATOM   475  C  CE    . MET C 3 1   ? 78.589  -20.586 45.596  1.00 95.79  ? 1    MET A CE    1 
ATOM   476  N  N     . LYS C 3 2   ? 73.288  -19.397 46.935  1.00 66.82  ? 2    LYS A N     1 
ATOM   477  C  CA    . LYS C 3 2   ? 71.945  -19.091 46.469  1.00 65.72  ? 2    LYS A CA    1 
ATOM   478  C  C     . LYS C 3 2   ? 71.133  -20.368 46.630  1.00 63.14  ? 2    LYS A C     1 
ATOM   479  O  O     . LYS C 3 2   ? 71.626  -21.465 46.360  1.00 60.47  ? 2    LYS A O     1 
ATOM   480  C  CB    . LYS C 3 2   ? 71.958  -18.661 45.003  1.00 69.78  ? 2    LYS A CB    1 
ATOM   481  C  CG    . LYS C 3 2   ? 72.357  -17.216 44.788  1.00 76.55  ? 2    LYS A CG    1 
ATOM   482  C  CD    . LYS C 3 2   ? 72.103  -16.774 43.347  1.00 79.97  ? 2    LYS A CD    1 
ATOM   483  C  CE    . LYS C 3 2   ? 72.954  -17.558 42.350  1.00 81.42  ? 2    LYS A CE    1 
ATOM   484  N  NZ    . LYS C 3 2   ? 74.410  -17.403 42.630  1.00 77.70  ? 2    LYS A NZ    1 
ATOM   485  N  N     . GLU C 3 3   ? 69.891  -20.231 47.075  1.00 57.27  ? 3    GLU A N     1 
ATOM   486  C  CA    . GLU C 3 3   ? 69.075  -21.401 47.278  1.00 54.27  ? 3    GLU A CA    1 
ATOM   487  C  C     . GLU C 3 3   ? 68.436  -21.906 46.001  1.00 50.80  ? 3    GLU A C     1 
ATOM   488  O  O     . GLU C 3 3   ? 68.238  -21.151 45.053  1.00 52.25  ? 3    GLU A O     1 
ATOM   489  C  CB    . GLU C 3 3   ? 68.025  -21.124 48.343  1.00 58.77  ? 3    GLU A CB    1 
ATOM   490  C  CG    . GLU C 3 3   ? 67.298  -19.809 48.216  1.00 70.57  ? 3    GLU A CG    1 
ATOM   491  C  CD    . GLU C 3 3   ? 66.312  -19.591 49.374  1.00 78.68  ? 3    GLU A CD    1 
ATOM   492  O  OE1   . GLU C 3 3   ? 66.773  -19.515 50.538  1.00 74.52  ? 3    GLU A OE1   1 
ATOM   493  O  OE2   . GLU C 3 3   ? 65.085  -19.504 49.126  1.00 78.36  ? 3    GLU A OE2   1 
ATOM   494  N  N     . PHE C 3 4   ? 68.158  -23.204 45.967  1.00 43.84  ? 4    PHE A N     1 
ATOM   495  C  CA    . PHE C 3 4   ? 67.537  -23.816 44.804  1.00 41.82  ? 4    PHE A CA    1 
ATOM   496  C  C     . PHE C 3 4   ? 66.459  -24.752 45.281  1.00 37.35  ? 4    PHE A C     1 
ATOM   497  O  O     . PHE C 3 4   ? 66.462  -25.183 46.433  1.00 36.64  ? 4    PHE A O     1 
ATOM   498  C  CB    . PHE C 3 4   ? 68.560  -24.576 43.926  1.00 44.20  ? 4    PHE A CB    1 
ATOM   499  C  CG    . PHE C 3 4   ? 69.449  -25.538 44.684  1.00 45.08  ? 4    PHE A CG    1 
ATOM   500  C  CD1   . PHE C 3 4   ? 70.387  -25.073 45.599  1.00 35.88  ? 4    PHE A CD1   1 
ATOM   501  C  CD2   . PHE C 3 4   ? 69.342  -26.909 44.483  1.00 44.52  ? 4    PHE A CD2   1 
ATOM   502  C  CE1   . PHE C 3 4   ? 71.198  -25.953 46.298  1.00 37.94  ? 4    PHE A CE1   1 
ATOM   503  C  CE2   . PHE C 3 4   ? 70.154  -27.798 45.182  1.00 42.65  ? 4    PHE A CE2   1 
ATOM   504  C  CZ    . PHE C 3 4   ? 71.080  -27.318 46.090  1.00 44.66  ? 4    PHE A CZ    1 
ATOM   505  N  N     . TYR C 3 5   ? 65.528  -25.056 44.391  1.00 35.04  ? 5    TYR A N     1 
ATOM   506  C  CA    . TYR C 3 5   ? 64.431  -25.936 44.728  1.00 35.13  ? 5    TYR A CA    1 
ATOM   507  C  C     . TYR C 3 5   ? 64.733  -27.413 44.506  1.00 32.80  ? 5    TYR A C     1 
ATOM   508  O  O     . TYR C 3 5   ? 65.595  -27.783 43.724  1.00 35.12  ? 5    TYR A O     1 
ATOM   509  C  CB    . TYR C 3 5   ? 63.183  -25.537 43.926  1.00 35.77  ? 5    TYR A CB    1 
ATOM   510  C  CG    . TYR C 3 5   ? 63.274  -25.734 42.421  1.00 33.91  ? 5    TYR A CG    1 
ATOM   511  C  CD1   . TYR C 3 5   ? 63.856  -24.778 41.598  1.00 34.29  ? 5    TYR A CD1   1 
ATOM   512  C  CD2   . TYR C 3 5   ? 62.761  -26.882 41.823  1.00 43.00  ? 5    TYR A CD2   1 
ATOM   513  C  CE1   . TYR C 3 5   ? 63.924  -24.965 40.218  1.00 32.72  ? 5    TYR A CE1   1 
ATOM   514  C  CE2   . TYR C 3 5   ? 62.822  -27.082 40.451  1.00 33.17  ? 5    TYR A CE2   1 
ATOM   515  C  CZ    . TYR C 3 5   ? 63.401  -26.129 39.661  1.00 36.30  ? 5    TYR A CZ    1 
ATOM   516  O  OH    . TYR C 3 5   ? 63.454  -26.374 38.313  1.00 35.29  ? 5    TYR A OH    1 
ATOM   517  N  N     . LEU C 3 6   ? 64.017  -28.256 45.225  1.00 34.61  ? 6    LEU A N     1 
ATOM   518  C  CA    . LEU C 3 6   ? 64.154  -29.690 45.065  1.00 33.57  ? 6    LEU A CA    1 
ATOM   519  C  C     . LEU C 3 6   ? 62.915  -30.161 44.295  1.00 36.37  ? 6    LEU A C     1 
ATOM   520  O  O     . LEU C 3 6   ? 63.051  -30.822 43.278  1.00 31.21  ? 6    LEU A O     1 
ATOM   521  C  CB    . LEU C 3 6   ? 64.230  -30.351 46.430  1.00 30.56  ? 6    LEU A CB    1 
ATOM   522  C  CG    . LEU C 3 6   ? 65.393  -29.815 47.253  1.00 29.45  ? 6    LEU A CG    1 
ATOM   523  C  CD1   . LEU C 3 6   ? 65.247  -30.166 48.730  1.00 26.03  ? 6    LEU A CD1   1 
ATOM   524  C  CD2   . LEU C 3 6   ? 66.664  -30.386 46.658  1.00 24.71  ? 6    LEU A CD2   1 
ATOM   525  N  N     . THR C 3 7   ? 61.718  -29.796 44.779  1.00 41.22  ? 7    THR A N     1 
ATOM   526  C  CA    . THR C 3 7   ? 60.445  -30.149 44.124  1.00 45.91  ? 7    THR A CA    1 
ATOM   527  C  C     . THR C 3 7   ? 59.395  -29.037 44.217  1.00 50.04  ? 7    THR A C     1 
ATOM   528  O  O     . THR C 3 7   ? 59.363  -28.291 45.193  1.00 52.76  ? 7    THR A O     1 
ATOM   529  C  CB    . THR C 3 7   ? 59.812  -31.420 44.719  1.00 40.17  ? 7    THR A CB    1 
ATOM   530  O  OG1   . THR C 3 7   ? 59.825  -31.329 46.142  1.00 49.50  ? 7    THR A OG1   1 
ATOM   531  C  CG2   . THR C 3 7   ? 60.576  -32.653 44.315  1.00 41.09  ? 7    THR A CG2   1 
ATOM   532  N  N     . VAL C 3 8   ? 58.546  -28.928 43.192  1.00 54.83  ? 8    VAL A N     1 
ATOM   533  C  CA    . VAL C 3 8   ? 57.468  -27.926 43.146  1.00 50.72  ? 8    VAL A CA    1 
ATOM   534  C  C     . VAL C 3 8   ? 56.179  -28.685 42.881  1.00 50.87  ? 8    VAL A C     1 
ATOM   535  O  O     . VAL C 3 8   ? 56.149  -29.566 42.033  1.00 49.88  ? 8    VAL A O     1 
ATOM   536  C  CB    . VAL C 3 8   ? 57.621  -26.939 41.986  1.00 51.96  ? 8    VAL A CB    1 
ATOM   537  C  CG1   . VAL C 3 8   ? 56.931  -25.643 42.332  1.00 46.46  ? 8    VAL A CG1   1 
ATOM   538  C  CG2   . VAL C 3 8   ? 59.075  -26.722 41.667  1.00 63.15  ? 8    VAL A CG2   1 
ATOM   539  N  N     . GLU C 3 9   ? 55.101  -28.328 43.565  1.00 50.19  ? 9    GLU A N     1 
ATOM   540  C  CA    . GLU C 3 9   ? 53.849  -29.051 43.375  1.00 44.27  ? 9    GLU A CA    1 
ATOM   541  C  C     . GLU C 3 9   ? 52.619  -28.166 43.595  1.00 39.70  ? 9    GLU A C     1 
ATOM   542  O  O     . GLU C 3 9   ? 52.624  -27.303 44.463  1.00 44.50  ? 9    GLU A O     1 
ATOM   543  C  CB    . GLU C 3 9   ? 53.831  -30.234 44.341  1.00 37.74  ? 9    GLU A CB    1 
ATOM   544  C  CG    . GLU C 3 9   ? 53.107  -31.451 43.825  1.00 51.02  ? 9    GLU A CG    1 
ATOM   545  C  CD    . GLU C 3 9   ? 53.955  -32.357 42.924  1.00 54.85  ? 9    GLU A CD    1 
ATOM   546  O  OE1   . GLU C 3 9   ? 54.943  -32.957 43.417  1.00 51.96  ? 9    GLU A OE1   1 
ATOM   547  O  OE2   . GLU C 3 9   ? 53.619  -32.488 41.722  1.00 54.59  ? 9    GLU A OE2   1 
ATOM   548  N  N     . GLN C 3 10  ? 51.575  -28.354 42.796  1.00 37.35  ? 10   GLN A N     1 
ATOM   549  C  CA    . GLN C 3 10  ? 50.357  -27.569 42.986  1.00 38.53  ? 10   GLN A CA    1 
ATOM   550  C  C     . GLN C 3 10  ? 49.295  -28.433 43.623  1.00 38.49  ? 10   GLN A C     1 
ATOM   551  O  O     . GLN C 3 10  ? 48.775  -29.346 42.993  1.00 42.88  ? 10   GLN A O     1 
ATOM   552  C  CB    . GLN C 3 10  ? 49.776  -27.025 41.682  1.00 37.87  ? 10   GLN A CB    1 
ATOM   553  C  CG    . GLN C 3 10  ? 48.524  -26.186 41.971  1.00 38.02  ? 10   GLN A CG    1 
ATOM   554  C  CD    . GLN C 3 10  ? 47.793  -25.688 40.742  1.00 40.30  ? 10   GLN A CD    1 
ATOM   555  O  OE1   . GLN C 3 10  ? 48.345  -25.620 39.652  1.00 46.44  ? 10   GLN A OE1   1 
ATOM   556  N  NE2   . GLN C 3 10  ? 46.536  -25.314 40.925  1.00 42.05  ? 10   GLN A NE2   1 
ATOM   557  N  N     . ILE C 3 11  ? 48.974  -28.150 44.876  1.00 37.01  ? 11   ILE A N     1 
ATOM   558  C  CA    . ILE C 3 11  ? 47.956  -28.913 45.572  1.00 36.22  ? 11   ILE A CA    1 
ATOM   559  C  C     . ILE C 3 11  ? 46.793  -27.976 45.882  1.00 36.05  ? 11   ILE A C     1 
ATOM   560  O  O     . ILE C 3 11  ? 46.663  -27.413 46.970  1.00 38.13  ? 11   ILE A O     1 
ATOM   561  C  CB    . ILE C 3 11  ? 48.534  -29.579 46.860  1.00 35.47  ? 11   ILE A CB    1 
ATOM   562  C  CG1   . ILE C 3 11  ? 49.623  -30.579 46.462  1.00 28.50  ? 11   ILE A CG1   1 
ATOM   563  C  CG2   . ILE C 3 11  ? 47.420  -30.271 47.660  1.00 26.75  ? 11   ILE A CG2   1 
ATOM   564  C  CD1   . ILE C 3 11  ? 50.220  -31.335 47.622  1.00 32.00  ? 11   ILE A CD1   1 
ATOM   565  N  N     . GLY C 3 12  ? 45.959  -27.783 44.879  1.00 34.89  ? 12   GLY A N     1 
ATOM   566  C  CA    . GLY C 3 12  ? 44.811  -26.936 45.073  1.00 37.93  ? 12   GLY A CA    1 
ATOM   567  C  C     . GLY C 3 12  ? 45.084  -25.463 44.936  1.00 38.77  ? 12   GLY A C     1 
ATOM   568  O  O     . GLY C 3 12  ? 45.295  -24.998 43.828  1.00 44.53  ? 12   GLY A O     1 
ATOM   569  N  N     . ASP C 3 13  ? 45.076  -24.726 46.046  1.00 39.50  ? 13   ASP A N     1 
ATOM   570  C  CA    . ASP C 3 13  ? 45.291  -23.285 45.987  1.00 44.35  ? 13   ASP A CA    1 
ATOM   571  C  C     . ASP C 3 13  ? 46.649  -22.865 46.478  1.00 44.52  ? 13   ASP A C     1 
ATOM   572  O  O     . ASP C 3 13  ? 47.013  -21.698 46.383  1.00 44.44  ? 13   ASP A O     1 
ATOM   573  C  CB    . ASP C 3 13  ? 44.207  -22.539 46.776  1.00 49.09  ? 13   ASP A CB    1 
ATOM   574  C  CG    . ASP C 3 13  ? 42.899  -22.440 46.011  1.00 52.98  ? 13   ASP A CG    1 
ATOM   575  O  OD1   . ASP C 3 13  ? 42.963  -22.119 44.799  1.00 48.67  ? 13   ASP A OD1   1 
ATOM   576  O  OD2   . ASP C 3 13  ? 41.816  -22.672 46.615  1.00 55.30  ? 13   ASP A OD2   1 
ATOM   577  N  N     . SER C 3 14  ? 47.400  -23.813 47.014  1.00 43.30  ? 14   SER A N     1 
ATOM   578  C  CA    . SER C 3 14  ? 48.734  -23.492 47.477  1.00 45.25  ? 14   SER A CA    1 
ATOM   579  C  C     . SER C 3 14  ? 49.795  -24.287 46.733  1.00 42.72  ? 14   SER A C     1 
ATOM   580  O  O     . SER C 3 14  ? 49.529  -25.362 46.200  1.00 38.43  ? 14   SER A O     1 
ATOM   581  C  CB    . SER C 3 14  ? 48.851  -23.720 48.995  1.00 45.46  ? 14   SER A CB    1 
ATOM   582  O  OG    . SER C 3 14  ? 48.365  -24.985 49.380  1.00 45.33  ? 14   SER A OG    1 
ATOM   583  N  N     . ILE C 3 15  ? 50.992  -23.714 46.671  1.00 40.26  ? 15   ILE A N     1 
ATOM   584  C  CA    . ILE C 3 15  ? 52.136  -24.352 46.044  1.00 34.77  ? 15   ILE A CA    1 
ATOM   585  C  C     . ILE C 3 15  ? 52.964  -24.959 47.175  1.00 36.42  ? 15   ILE A C     1 
ATOM   586  O  O     . ILE C 3 15  ? 53.251  -24.299 48.171  1.00 36.17  ? 15   ILE A O     1 
ATOM   587  C  CB    . ILE C 3 15  ? 53.010  -23.336 45.299  1.00 29.72  ? 15   ILE A CB    1 
ATOM   588  C  CG1   . ILE C 3 15  ? 52.249  -22.744 44.120  1.00 29.58  ? 15   ILE A CG1   1 
ATOM   589  C  CG2   . ILE C 3 15  ? 54.266  -24.002 44.809  1.00 38.05  ? 15   ILE A CG2   1 
ATOM   590  C  CD1   . ILE C 3 15  ? 51.851  -23.757 43.072  1.00 35.80  ? 15   ILE A CD1   1 
ATOM   591  N  N     . PHE C 3 16  ? 53.318  -26.229 47.032  1.00 36.48  ? 16   PHE A N     1 
ATOM   592  C  CA    . PHE C 3 16  ? 54.135  -26.914 48.027  1.00 36.14  ? 16   PHE A CA    1 
ATOM   593  C  C     . PHE C 3 16  ? 55.540  -27.095 47.454  1.00 42.00  ? 16   PHE A C     1 
ATOM   594  O  O     . PHE C 3 16  ? 55.729  -27.885 46.532  1.00 40.60  ? 16   PHE A O     1 
ATOM   595  C  CB    . PHE C 3 16  ? 53.543  -28.281 48.339  1.00 33.70  ? 16   PHE A CB    1 
ATOM   596  C  CG    . PHE C 3 16  ? 52.356  -28.230 49.241  1.00 40.44  ? 16   PHE A CG    1 
ATOM   597  C  CD1   . PHE C 3 16  ? 51.310  -27.349 49.001  1.00 44.36  ? 16   PHE A CD1   1 
ATOM   598  C  CD2   . PHE C 3 16  ? 52.301  -29.040 50.365  1.00 42.26  ? 16   PHE A CD2   1 
ATOM   599  C  CE1   . PHE C 3 16  ? 50.232  -27.274 49.876  1.00 44.68  ? 16   PHE A CE1   1 
ATOM   600  C  CE2   . PHE C 3 16  ? 51.225  -28.974 51.250  1.00 43.60  ? 16   PHE A CE2   1 
ATOM   601  C  CZ    . PHE C 3 16  ? 50.190  -28.089 51.010  1.00 40.47  ? 16   PHE A CZ    1 
ATOM   602  N  N     . GLU C 3 17  ? 56.532  -26.374 47.974  1.00 45.56  ? 17   GLU A N     1 
ATOM   603  C  CA    . GLU C 3 17  ? 57.877  -26.552 47.438  1.00 46.13  ? 17   GLU A CA    1 
ATOM   604  C  C     . GLU C 3 17  ? 58.923  -26.981 48.448  1.00 42.69  ? 17   GLU A C     1 
ATOM   605  O  O     . GLU C 3 17  ? 58.949  -26.502 49.573  1.00 45.18  ? 17   GLU A O     1 
ATOM   606  C  CB    . GLU C 3 17  ? 58.363  -25.288 46.714  1.00 44.53  ? 17   GLU A CB    1 
ATOM   607  C  CG    . GLU C 3 17  ? 59.294  -24.407 47.526  1.00 60.76  ? 17   GLU A CG    1 
ATOM   608  C  CD    . GLU C 3 17  ? 60.075  -23.390 46.677  1.00 62.38  ? 17   GLU A CD    1 
ATOM   609  O  OE1   . GLU C 3 17  ? 60.828  -23.806 45.767  1.00 55.09  ? 17   GLU A OE1   1 
ATOM   610  O  OE2   . GLU C 3 17  ? 59.940  -22.172 46.934  1.00 65.23  ? 17   GLU A OE2   1 
ATOM   611  N  N     . ARG C 3 18  ? 59.765  -27.919 48.030  1.00 44.72  ? 18   ARG A N     1 
ATOM   612  C  CA    . ARG C 3 18  ? 60.881  -28.397 48.838  1.00 42.85  ? 18   ARG A CA    1 
ATOM   613  C  C     . ARG C 3 18  ? 62.135  -27.745 48.223  1.00 42.99  ? 18   ARG A C     1 
ATOM   614  O  O     . ARG C 3 18  ? 62.333  -27.777 47.005  1.00 44.57  ? 18   ARG A O     1 
ATOM   615  C  CB    . ARG C 3 18  ? 60.976  -29.917 48.770  1.00 39.40  ? 18   ARG A CB    1 
ATOM   616  C  CG    . ARG C 3 18  ? 59.712  -30.600 49.249  1.00 45.95  ? 18   ARG A CG    1 
ATOM   617  C  CD    . ARG C 3 18  ? 59.788  -32.095 49.041  1.00 37.80  ? 18   ARG A CD    1 
ATOM   618  N  NE    . ARG C 3 18  ? 60.932  -32.662 49.749  1.00 40.60  ? 18   ARG A NE    1 
ATOM   619  C  CZ    . ARG C 3 18  ? 61.372  -33.905 49.583  1.00 42.86  ? 18   ARG A CZ    1 
ATOM   620  N  NH1   . ARG C 3 18  ? 60.763  -34.720 48.727  1.00 47.55  ? 18   ARG A NH1   1 
ATOM   621  N  NH2   . ARG C 3 18  ? 62.419  -34.337 50.272  1.00 37.14  ? 18   ARG A NH2   1 
ATOM   622  N  N     . TYR C 3 19  ? 62.963  -27.126 49.056  1.00 41.59  ? 19   TYR A N     1 
ATOM   623  C  CA    . TYR C 3 19  ? 64.153  -26.466 48.556  1.00 41.96  ? 19   TYR A CA    1 
ATOM   624  C  C     . TYR C 3 19  ? 65.337  -26.546 49.512  1.00 41.91  ? 19   TYR A C     1 
ATOM   625  O  O     . TYR C 3 19  ? 65.228  -27.026 50.646  1.00 38.64  ? 19   TYR A O     1 
ATOM   626  C  CB    . TYR C 3 19  ? 63.846  -24.996 48.258  1.00 39.83  ? 19   TYR A CB    1 
ATOM   627  C  CG    . TYR C 3 19  ? 63.483  -24.188 49.485  1.00 42.27  ? 19   TYR A CG    1 
ATOM   628  C  CD1   . TYR C 3 19  ? 62.288  -24.415 50.180  1.00 46.13  ? 19   TYR A CD1   1 
ATOM   629  C  CD2   . TYR C 3 19  ? 64.348  -23.215 49.978  1.00 44.77  ? 19   TYR A CD2   1 
ATOM   630  C  CE1   . TYR C 3 19  ? 61.970  -23.689 51.347  1.00 42.60  ? 19   TYR A CE1   1 
ATOM   631  C  CE2   . TYR C 3 19  ? 64.043  -22.485 51.138  1.00 42.42  ? 19   TYR A CE2   1 
ATOM   632  C  CZ    . TYR C 3 19  ? 62.859  -22.728 51.816  1.00 42.02  ? 19   TYR A CZ    1 
ATOM   633  O  OH    . TYR C 3 19  ? 62.585  -22.023 52.961  1.00 39.63  ? 19   TYR A OH    1 
ATOM   634  N  N     . ILE C 3 20  ? 66.479  -26.089 49.011  1.00 39.23  ? 20   ILE A N     1 
ATOM   635  C  CA    . ILE C 3 20  ? 67.702  -26.035 49.784  1.00 39.39  ? 20   ILE A CA    1 
ATOM   636  C  C     . ILE C 3 20  ? 67.929  -24.568 50.179  1.00 38.34  ? 20   ILE A C     1 
ATOM   637  O  O     . ILE C 3 20  ? 67.961  -23.670 49.336  1.00 29.43  ? 20   ILE A O     1 
ATOM   638  C  CB    . ILE C 3 20  ? 68.900  -26.579 48.970  1.00 40.93  ? 20   ILE A CB    1 
ATOM   639  C  CG1   . ILE C 3 20  ? 68.808  -28.105 48.896  1.00 39.15  ? 20   ILE A CG1   1 
ATOM   640  C  CG2   . ILE C 3 20  ? 70.214  -26.132 49.588  1.00 31.57  ? 20   ILE A CG2   1 
ATOM   641  C  CD1   . ILE C 3 20  ? 68.811  -28.803 50.248  1.00 26.90  ? 20   ILE A CD1   1 
ATOM   642  N  N     . ASP C 3 21  ? 68.040  -24.368 51.484  1.00 36.53  ? 21   ASP A N     1 
ATOM   643  C  CA    . ASP C 3 21  ? 68.250  -23.079 52.137  1.00 45.64  ? 21   ASP A CA    1 
ATOM   644  C  C     . ASP C 3 21  ? 69.593  -22.428 51.759  1.00 47.66  ? 21   ASP A C     1 
ATOM   645  O  O     . ASP C 3 21  ? 70.518  -23.104 51.310  1.00 49.39  ? 21   ASP A O     1 
ATOM   646  C  CB    . ASP C 3 21  ? 68.173  -23.343 53.649  1.00 51.78  ? 21   ASP A CB    1 
ATOM   647  C  CG    . ASP C 3 21  ? 68.477  -22.133 54.485  1.00 65.03  ? 21   ASP A CG    1 
ATOM   648  O  OD1   . ASP C 3 21  ? 69.560  -21.539 54.305  1.00 74.35  ? 21   ASP A OD1   1 
ATOM   649  O  OD2   . ASP C 3 21  ? 67.634  -21.791 55.340  1.00 75.15  ? 21   ASP A OD2   1 
ATOM   650  N  N     . SER C 3 22  ? 69.695  -21.112 51.937  1.00 52.10  ? 22   SER A N     1 
ATOM   651  C  CA    . SER C 3 22  ? 70.936  -20.377 51.646  1.00 53.96  ? 22   SER A CA    1 
ATOM   652  C  C     . SER C 3 22  ? 72.088  -20.840 52.546  1.00 54.39  ? 22   SER A C     1 
ATOM   653  O  O     . SER C 3 22  ? 73.242  -20.505 52.301  1.00 57.51  ? 22   SER A O     1 
ATOM   654  C  CB    . SER C 3 22  ? 70.734  -18.881 51.853  1.00 49.93  ? 22   SER A CB    1 
ATOM   655  O  OG    . SER C 3 22  ? 70.332  -18.633 53.188  1.00 57.72  ? 22   SER A OG    1 
ATOM   656  N  N     . ASN C 3 23  ? 71.772  -21.589 53.596  1.00 52.81  ? 23   ASN A N     1 
ATOM   657  C  CA    . ASN C 3 23  ? 72.794  -22.103 54.498  1.00 56.28  ? 23   ASN A CA    1 
ATOM   658  C  C     . ASN C 3 23  ? 72.949  -23.603 54.278  1.00 57.93  ? 23   ASN A C     1 
ATOM   659  O  O     . ASN C 3 23  ? 73.533  -24.319 55.103  1.00 55.40  ? 23   ASN A O     1 
ATOM   660  C  CB    . ASN C 3 23  ? 72.434  -21.807 55.953  1.00 62.07  ? 23   ASN A CB    1 
ATOM   661  C  CG    . ASN C 3 23  ? 72.372  -20.316 56.241  1.00 69.35  ? 23   ASN A CG    1 
ATOM   662  O  OD1   . ASN C 3 23  ? 73.267  -19.560 55.852  1.00 71.82  ? 23   ASN A OD1   1 
ATOM   663  N  ND2   . ASN C 3 23  ? 71.318  -19.886 56.931  1.00 68.40  ? 23   ASN A ND2   1 
ATOM   664  N  N     . GLY C 3 24  ? 72.401  -24.065 53.153  1.00 57.40  ? 24   GLY A N     1 
ATOM   665  C  CA    . GLY C 3 24  ? 72.494  -25.464 52.765  1.00 54.20  ? 24   GLY A CA    1 
ATOM   666  C  C     . GLY C 3 24  ? 71.534  -26.479 53.351  1.00 54.45  ? 24   GLY A C     1 
ATOM   667  O  O     . GLY C 3 24  ? 71.644  -27.651 53.012  1.00 57.07  ? 24   GLY A O     1 
ATOM   668  N  N     . ARG C 3 25  ? 70.601  -26.058 54.206  1.00 55.17  ? 25   ARG A N     1 
ATOM   669  C  CA    . ARG C 3 25  ? 69.650  -26.986 54.830  1.00 51.89  ? 25   ARG A CA    1 
ATOM   670  C  C     . ARG C 3 25  ? 68.422  -27.248 53.951  1.00 46.42  ? 25   ARG A C     1 
ATOM   671  O  O     . ARG C 3 25  ? 67.989  -26.375 53.202  1.00 44.74  ? 25   ARG A O     1 
ATOM   672  C  CB    . ARG C 3 25  ? 69.217  -26.439 56.195  1.00 58.65  ? 25   ARG A CB    1 
ATOM   673  C  CG    . ARG C 3 25  ? 68.742  -27.494 57.188  1.00 75.94  ? 25   ARG A CG    1 
ATOM   674  C  CD    . ARG C 3 25  ? 68.301  -26.865 58.513  1.00 90.28  ? 25   ARG A CD    1 
ATOM   675  N  NE    . ARG C 3 25  ? 67.955  -27.871 59.521  1.00 102.90 ? 25   ARG A NE    1 
ATOM   676  C  CZ    . ARG C 3 25  ? 67.309  -27.610 60.657  1.00 105.72 ? 25   ARG A CZ    1 
ATOM   677  N  NH1   . ARG C 3 25  ? 66.928  -26.369 60.943  1.00 105.05 ? 25   ARG A NH1   1 
ATOM   678  N  NH2   . ARG C 3 25  ? 67.036  -28.594 61.508  1.00 104.77 ? 25   ARG A NH2   1 
ATOM   679  N  N     . GLU C 3 26  ? 67.881  -28.461 54.030  1.00 43.49  ? 26   GLU A N     1 
ATOM   680  C  CA    . GLU C 3 26  ? 66.697  -28.842 53.247  1.00 42.94  ? 26   GLU A CA    1 
ATOM   681  C  C     . GLU C 3 26  ? 65.474  -28.304 53.967  1.00 41.41  ? 26   GLU A C     1 
ATOM   682  O  O     . GLU C 3 26  ? 65.309  -28.546 55.165  1.00 37.29  ? 26   GLU A O     1 
ATOM   683  C  CB    . GLU C 3 26  ? 66.575  -30.374 53.138  1.00 48.05  ? 26   GLU A CB    1 
ATOM   684  C  CG    . GLU C 3 26  ? 65.555  -30.871 52.108  1.00 49.85  ? 26   GLU A CG    1 
ATOM   685  C  CD    . GLU C 3 26  ? 65.356  -32.387 52.124  1.00 50.37  ? 26   GLU A CD    1 
ATOM   686  O  OE1   . GLU C 3 26  ? 66.359  -33.132 52.103  1.00 50.98  ? 26   GLU A OE1   1 
ATOM   687  O  OE2   . GLU C 3 26  ? 64.185  -32.832 52.144  1.00 48.56  ? 26   GLU A OE2   1 
ATOM   688  N  N     . ARG C 3 27  ? 64.613  -27.594 53.241  1.00 43.04  ? 27   ARG A N     1 
ATOM   689  C  CA    . ARG C 3 27  ? 63.415  -26.991 53.836  1.00 48.69  ? 27   ARG A CA    1 
ATOM   690  C  C     . ARG C 3 27  ? 62.156  -27.227 53.004  1.00 49.13  ? 27   ARG A C     1 
ATOM   691  O  O     . ARG C 3 27  ? 62.249  -27.496 51.814  1.00 52.37  ? 27   ARG A O     1 
ATOM   692  C  CB    . ARG C 3 27  ? 63.619  -25.481 53.957  1.00 53.95  ? 27   ARG A CB    1 
ATOM   693  C  CG    . ARG C 3 27  ? 65.025  -25.073 54.285  1.00 59.68  ? 27   ARG A CG    1 
ATOM   694  C  CD    . ARG C 3 27  ? 65.217  -24.913 55.770  1.00 66.82  ? 27   ARG A CD    1 
ATOM   695  N  NE    . ARG C 3 27  ? 64.457  -23.775 56.271  1.00 74.90  ? 27   ARG A NE    1 
ATOM   696  C  CZ    . ARG C 3 27  ? 64.499  -23.341 57.526  1.00 77.76  ? 27   ARG A CZ    1 
ATOM   697  N  NH1   . ARG C 3 27  ? 65.272  -23.953 58.418  1.00 76.10  ? 27   ARG A NH1   1 
ATOM   698  N  NH2   . ARG C 3 27  ? 63.769  -22.292 57.886  1.00 78.92  ? 27   ARG A NH2   1 
ATOM   699  N  N     . THR C 3 28  ? 60.984  -27.114 53.633  1.00 51.08  ? 28   THR A N     1 
ATOM   700  C  CA    . THR C 3 28  ? 59.709  -27.258 52.923  1.00 52.15  ? 28   THR A CA    1 
ATOM   701  C  C     . THR C 3 28  ? 58.960  -25.942 53.039  1.00 53.74  ? 28   THR A C     1 
ATOM   702  O  O     . THR C 3 28  ? 59.256  -25.128 53.908  1.00 55.84  ? 28   THR A O     1 
ATOM   703  C  CB    . THR C 3 28  ? 58.817  -28.350 53.501  1.00 50.87  ? 28   THR A CB    1 
ATOM   704  O  OG1   . THR C 3 28  ? 59.547  -29.577 53.562  1.00 68.66  ? 28   THR A OG1   1 
ATOM   705  C  CG2   . THR C 3 28  ? 57.590  -28.545 52.614  1.00 49.73  ? 28   THR A CG2   1 
ATOM   706  N  N     . ARG C 3 29  ? 57.963  -25.745 52.189  1.00 53.63  ? 29   ARG A N     1 
ATOM   707  C  CA    . ARG C 3 29  ? 57.243  -24.489 52.193  1.00 46.81  ? 29   ARG A CA    1 
ATOM   708  C  C     . ARG C 3 29  ? 55.861  -24.659 51.561  1.00 47.95  ? 29   ARG A C     1 
ATOM   709  O  O     . ARG C 3 29  ? 55.671  -25.522 50.711  1.00 56.85  ? 29   ARG A O     1 
ATOM   710  C  CB    . ARG C 3 29  ? 58.078  -23.501 51.391  1.00 42.95  ? 29   ARG A CB    1 
ATOM   711  C  CG    . ARG C 3 29  ? 57.717  -22.072 51.528  1.00 47.80  ? 29   ARG A CG    1 
ATOM   712  C  CD    . ARG C 3 29  ? 58.385  -21.246 50.436  1.00 49.96  ? 29   ARG A CD    1 
ATOM   713  N  NE    . ARG C 3 29  ? 59.783  -21.601 50.203  1.00 50.22  ? 29   ARG A NE    1 
ATOM   714  C  CZ    . ARG C 3 29  ? 60.635  -20.838 49.524  1.00 55.93  ? 29   ARG A CZ    1 
ATOM   715  N  NH1   . ARG C 3 29  ? 60.230  -19.684 49.025  1.00 62.86  ? 29   ARG A NH1   1 
ATOM   716  N  NH2   . ARG C 3 29  ? 61.883  -21.226 49.328  1.00 54.36  ? 29   ARG A NH2   1 
ATOM   717  N  N     . GLU C 3 30  ? 54.903  -23.840 51.992  1.00 47.94  ? 30   GLU A N     1 
ATOM   718  C  CA    . GLU C 3 30  ? 53.533  -23.838 51.461  1.00 42.85  ? 30   GLU A CA    1 
ATOM   719  C  C     . GLU C 3 30  ? 53.211  -22.382 51.111  1.00 41.16  ? 30   GLU A C     1 
ATOM   720  O  O     . GLU C 3 30  ? 53.393  -21.489 51.935  1.00 44.37  ? 30   GLU A O     1 
ATOM   721  C  CB    . GLU C 3 30  ? 52.529  -24.327 52.505  1.00 44.85  ? 30   GLU A CB    1 
ATOM   722  C  CG    . GLU C 3 30  ? 52.650  -25.788 52.912  1.00 55.53  ? 30   GLU A CG    1 
ATOM   723  C  CD    . GLU C 3 30  ? 51.597  -26.200 53.949  1.00 63.54  ? 30   GLU A CD    1 
ATOM   724  O  OE1   . GLU C 3 30  ? 50.612  -25.450 54.163  1.00 54.42  ? 30   GLU A OE1   1 
ATOM   725  O  OE2   . GLU C 3 30  ? 51.757  -27.288 54.545  1.00 63.50  ? 30   GLU A OE2   1 
ATOM   726  N  N     . VAL C 3 31  ? 52.721  -22.131 49.906  1.00 35.46  ? 31   VAL A N     1 
ATOM   727  C  CA    . VAL C 3 31  ? 52.440  -20.763 49.507  1.00 36.57  ? 31   VAL A CA    1 
ATOM   728  C  C     . VAL C 3 31  ? 51.155  -20.616 48.727  1.00 38.07  ? 31   VAL A C     1 
ATOM   729  O  O     . VAL C 3 31  ? 51.055  -21.143 47.625  1.00 41.94  ? 31   VAL A O     1 
ATOM   730  C  CB    . VAL C 3 31  ? 53.546  -20.219 48.586  1.00 41.16  ? 31   VAL A CB    1 
ATOM   731  C  CG1   . VAL C 3 31  ? 53.165  -18.833 48.100  1.00 42.97  ? 31   VAL A CG1   1 
ATOM   732  C  CG2   . VAL C 3 31  ? 54.877  -20.204 49.297  1.00 40.11  ? 31   VAL A CG2   1 
ATOM   733  N  N     . GLU C 3 32  ? 50.190  -19.877 49.263  1.00 35.20  ? 32   GLU A N     1 
ATOM   734  C  CA    . GLU C 3 32  ? 48.927  -19.666 48.556  1.00 38.31  ? 32   GLU A CA    1 
ATOM   735  C  C     . GLU C 3 32  ? 49.212  -18.695 47.405  1.00 35.94  ? 32   GLU A C     1 
ATOM   736  O  O     . GLU C 3 32  ? 48.742  -17.568 47.388  1.00 39.59  ? 32   GLU A O     1 
ATOM   737  C  CB    . GLU C 3 32  ? 47.853  -19.122 49.527  1.00 38.97  ? 32   GLU A CB    1 
ATOM   738  C  CG    . GLU C 3 32  ? 46.455  -18.869 48.922  1.00 49.20  ? 32   GLU A CG    1 
ATOM   739  C  CD    . GLU C 3 32  ? 45.318  -18.871 49.967  1.00 55.41  ? 32   GLU A CD    1 
ATOM   740  O  OE1   . GLU C 3 32  ? 45.504  -18.303 51.068  1.00 51.28  ? 32   GLU A OE1   1 
ATOM   741  O  OE2   . GLU C 3 32  ? 44.227  -19.432 49.679  1.00 53.48  ? 32   GLU A OE2   1 
ATOM   742  N  N     . TYR C 3 33  ? 49.996  -19.171 46.442  1.00 37.26  ? 33   TYR A N     1 
ATOM   743  C  CA    . TYR C 3 33  ? 50.405  -18.406 45.263  1.00 39.88  ? 33   TYR A CA    1 
ATOM   744  C  C     . TYR C 3 33  ? 49.275  -17.691 44.516  1.00 41.67  ? 33   TYR A C     1 
ATOM   745  O  O     . TYR C 3 33  ? 48.242  -18.275 44.221  1.00 41.92  ? 33   TYR A O     1 
ATOM   746  C  CB    . TYR C 3 33  ? 51.147  -19.335 44.302  1.00 38.77  ? 33   TYR A CB    1 
ATOM   747  C  CG    . TYR C 3 33  ? 51.654  -18.669 43.038  1.00 36.81  ? 33   TYR A CG    1 
ATOM   748  C  CD1   . TYR C 3 33  ? 52.654  -17.706 43.088  1.00 36.17  ? 33   TYR A CD1   1 
ATOM   749  C  CD2   . TYR C 3 33  ? 51.143  -19.020 41.791  1.00 35.05  ? 33   TYR A CD2   1 
ATOM   750  C  CE1   . TYR C 3 33  ? 53.136  -17.109 41.938  1.00 32.00  ? 33   TYR A CE1   1 
ATOM   751  C  CE2   . TYR C 3 33  ? 51.618  -18.431 40.634  1.00 35.44  ? 33   TYR A CE2   1 
ATOM   752  C  CZ    . TYR C 3 33  ? 52.621  -17.469 40.716  1.00 36.02  ? 33   TYR A CZ    1 
ATOM   753  O  OH    . TYR C 3 33  ? 53.109  -16.863 39.581  1.00 34.40  ? 33   TYR A OH    1 
ATOM   754  N  N     . LYS C 3 34  ? 49.500  -16.425 44.185  1.00 45.12  ? 34   LYS A N     1 
ATOM   755  C  CA    . LYS C 3 34  ? 48.504  -15.619 43.486  1.00 47.12  ? 34   LYS A CA    1 
ATOM   756  C  C     . LYS C 3 34  ? 48.986  -15.286 42.089  1.00 44.54  ? 34   LYS A C     1 
ATOM   757  O  O     . LYS C 3 34  ? 49.749  -14.345 41.884  1.00 49.40  ? 34   LYS A O     1 
ATOM   758  C  CB    . LYS C 3 34  ? 48.225  -14.348 44.288  1.00 55.93  ? 34   LYS A CB    1 
ATOM   759  C  CG    . LYS C 3 34  ? 47.698  -14.663 45.686  1.00 64.85  ? 34   LYS A CG    1 
ATOM   760  C  CD    . LYS C 3 34  ? 47.451  -13.434 46.535  1.00 68.46  ? 34   LYS A CD    1 
ATOM   761  C  CE    . LYS C 3 34  ? 47.027  -13.844 47.949  1.00 77.35  ? 34   LYS A CE    1 
ATOM   762  N  NZ    . LYS C 3 34  ? 45.810  -14.727 47.971  1.00 75.05  ? 34   LYS A NZ    1 
ATOM   763  N  N     . PRO C 3 35  ? 48.525  -16.061 41.105  1.00 36.99  ? 35   PRO A N     1 
ATOM   764  C  CA    . PRO C 3 35  ? 48.835  -15.968 39.683  1.00 33.98  ? 35   PRO A CA    1 
ATOM   765  C  C     . PRO C 3 35  ? 48.262  -14.779 38.945  1.00 33.55  ? 35   PRO A C     1 
ATOM   766  O  O     . PRO C 3 35  ? 47.388  -14.095 39.442  1.00 36.32  ? 35   PRO A O     1 
ATOM   767  C  CB    . PRO C 3 35  ? 48.287  -17.271 39.140  1.00 36.49  ? 35   PRO A CB    1 
ATOM   768  C  CG    . PRO C 3 35  ? 47.035  -17.420 39.949  1.00 44.24  ? 35   PRO A CG    1 
ATOM   769  C  CD    . PRO C 3 35  ? 47.540  -17.125 41.348  1.00 38.65  ? 35   PRO A CD    1 
ATOM   770  N  N     . SER C 3 36  ? 48.775  -14.564 37.736  1.00 33.15  ? 36   SER A N     1 
ATOM   771  C  CA    . SER C 3 36  ? 48.361  -13.486 36.852  1.00 31.76  ? 36   SER A CA    1 
ATOM   772  C  C     . SER C 3 36  ? 48.169  -14.064 35.467  1.00 35.40  ? 36   SER A C     1 
ATOM   773  O  O     . SER C 3 36  ? 48.853  -15.002 35.088  1.00 38.92  ? 36   SER A O     1 
ATOM   774  C  CB    . SER C 3 36  ? 49.443  -12.407 36.754  1.00 29.61  ? 36   SER A CB    1 
ATOM   775  O  OG    . SER C 3 36  ? 49.826  -11.931 38.030  1.00 37.37  ? 36   SER A OG    1 
ATOM   776  N  N     . LEU C 3 37  ? 47.233  -13.507 34.714  1.00 37.03  ? 37   LEU A N     1 
ATOM   777  C  CA    . LEU C 3 37  ? 46.999  -13.944 33.349  1.00 34.90  ? 37   LEU A CA    1 
ATOM   778  C  C     . LEU C 3 37  ? 46.790  -12.671 32.555  1.00 33.24  ? 37   LEU A C     1 
ATOM   779  O  O     . LEU C 3 37  ? 46.801  -11.587 33.124  1.00 34.54  ? 37   LEU A O     1 
ATOM   780  C  CB    . LEU C 3 37  ? 45.793  -14.889 33.270  1.00 40.09  ? 37   LEU A CB    1 
ATOM   781  C  CG    . LEU C 3 37  ? 46.071  -16.288 33.843  1.00 34.35  ? 37   LEU A CG    1 
ATOM   782  C  CD1   . LEU C 3 37  ? 44.798  -17.129 33.874  1.00 28.75  ? 37   LEU A CD1   1 
ATOM   783  C  CD2   . LEU C 3 37  ? 47.155  -16.957 33.004  1.00 30.74  ? 37   LEU A CD2   1 
ATOM   784  N  N     . PHE C 3 38  ? 46.606  -12.777 31.251  1.00 31.48  ? 38   PHE A N     1 
ATOM   785  C  CA    . PHE C 3 38  ? 46.481  -11.572 30.458  1.00 31.90  ? 38   PHE A CA    1 
ATOM   786  C  C     . PHE C 3 38  ? 45.353  -11.593 29.480  1.00 31.94  ? 38   PHE A C     1 
ATOM   787  O  O     . PHE C 3 38  ? 44.838  -12.641 29.138  1.00 36.84  ? 38   PHE A O     1 
ATOM   788  C  CB    . PHE C 3 38  ? 47.791  -11.331 29.701  1.00 33.94  ? 38   PHE A CB    1 
ATOM   789  C  CG    . PHE C 3 38  ? 48.959  -11.114 30.595  1.00 29.15  ? 38   PHE A CG    1 
ATOM   790  C  CD1   . PHE C 3 38  ? 49.548  -12.186 31.251  1.00 31.61  ? 38   PHE A CD1   1 
ATOM   791  C  CD2   . PHE C 3 38  ? 49.425  -9.835  30.851  1.00 31.12  ? 38   PHE A CD2   1 
ATOM   792  C  CE1   . PHE C 3 38  ? 50.576  -11.989 32.154  1.00 26.08  ? 38   PHE A CE1   1 
ATOM   793  C  CE2   . PHE C 3 38  ? 50.463  -9.631  31.757  1.00 32.77  ? 38   PHE A CE2   1 
ATOM   794  C  CZ    . PHE C 3 38  ? 51.037  -10.713 32.410  1.00 23.23  ? 38   PHE A CZ    1 
ATOM   795  N  N     . ALA C 3 39  ? 44.995  -10.410 29.011  1.00 29.84  ? 39   ALA A N     1 
ATOM   796  C  CA    . ALA C 3 39  ? 43.925  -10.267 28.054  1.00 28.64  ? 39   ALA A CA    1 
ATOM   797  C  C     . ALA C 3 39  ? 44.275  -9.123  27.136  1.00 29.60  ? 39   ALA A C     1 
ATOM   798  O  O     . ALA C 3 39  ? 44.929  -8.166  27.556  1.00 33.56  ? 39   ALA A O     1 
ATOM   799  C  CB    . ALA C 3 39  ? 42.623  -9.977  28.771  1.00 23.43  ? 39   ALA A CB    1 
ATOM   800  N  N     . HIS C 3 40  ? 43.865  -9.227  25.878  1.00 34.34  ? 40   HIS A N     1 
ATOM   801  C  CA    . HIS C 3 40  ? 44.122  -8.163  24.924  1.00 41.05  ? 40   HIS A CA    1 
ATOM   802  C  C     . HIS C 3 40  ? 43.298  -6.984  25.391  1.00 44.72  ? 40   HIS A C     1 
ATOM   803  O  O     . HIS C 3 40  ? 42.287  -7.166  26.075  1.00 46.66  ? 40   HIS A O     1 
ATOM   804  C  CB    . HIS C 3 40  ? 43.668  -8.548  23.509  1.00 45.28  ? 40   HIS A CB    1 
ATOM   805  C  CG    . HIS C 3 40  ? 44.555  -9.542  22.829  1.00 52.49  ? 40   HIS A CG    1 
ATOM   806  N  ND1   . HIS C 3 40  ? 44.418  -10.901 23.004  1.00 52.58  ? 40   HIS A ND1   1 
ATOM   807  C  CD2   . HIS C 3 40  ? 45.606  -9.374  21.990  1.00 55.39  ? 40   HIS A CD2   1 
ATOM   808  C  CE1   . HIS C 3 40  ? 45.348  -11.528 22.304  1.00 54.43  ? 40   HIS A CE1   1 
ATOM   809  N  NE2   . HIS C 3 40  ? 46.082  -10.625 21.680  1.00 52.21  ? 40   HIS A NE2   1 
ATOM   810  N  N     . CYS C 3 41  ? 43.748  -5.783  25.035  1.00 47.45  ? 41   CYS A N     1 
ATOM   811  C  CA    . CYS C 3 41  ? 43.064  -4.528  25.365  1.00 51.17  ? 41   CYS A CA    1 
ATOM   812  C  C     . CYS C 3 41  ? 43.289  -3.557  24.200  1.00 54.96  ? 41   CYS A C     1 
ATOM   813  O  O     . CYS C 3 41  ? 44.113  -3.818  23.323  1.00 60.64  ? 41   CYS A O     1 
ATOM   814  C  CB    . CYS C 3 41  ? 43.624  -3.940  26.656  1.00 48.95  ? 41   CYS A CB    1 
ATOM   815  S  SG    . CYS C 3 41  ? 45.375  -3.478  26.596  1.00 56.34  ? 41   CYS A SG    1 
ATOM   816  N  N     . PRO C 3 42  ? 42.560  -2.431  24.164  1.00 56.57  ? 42   PRO A N     1 
ATOM   817  C  CA    . PRO C 3 42  ? 42.760  -1.490  23.054  1.00 56.13  ? 42   PRO A CA    1 
ATOM   818  C  C     . PRO C 3 42  ? 44.104  -0.757  23.084  1.00 57.11  ? 42   PRO A C     1 
ATOM   819  O  O     . PRO C 3 42  ? 44.745  -0.661  24.132  1.00 55.03  ? 42   PRO A O     1 
ATOM   820  C  CB    . PRO C 3 42  ? 41.563  -0.551  23.177  1.00 51.48  ? 42   PRO A CB    1 
ATOM   821  C  CG    . PRO C 3 42  ? 41.308  -0.550  24.643  1.00 56.86  ? 42   PRO A CG    1 
ATOM   822  C  CD    . PRO C 3 42  ? 41.450  -1.998  25.028  1.00 55.91  ? 42   PRO A CD    1 
ATOM   823  N  N     . GLU C 3 43  ? 44.517  -0.247  21.923  1.00 61.22  ? 43   GLU A N     1 
ATOM   824  C  CA    . GLU C 3 43  ? 45.790  0.462   21.766  1.00 66.63  ? 43   GLU A CA    1 
ATOM   825  C  C     . GLU C 3 43  ? 45.891  1.767   22.564  1.00 65.99  ? 43   GLU A C     1 
ATOM   826  O  O     . GLU C 3 43  ? 46.771  2.585   22.302  1.00 66.67  ? 43   GLU A O     1 
ATOM   827  C  CB    . GLU C 3 43  ? 46.043  0.762   20.276  1.00 71.93  ? 43   GLU A CB    1 
ATOM   828  C  CG    . GLU C 3 43  ? 47.172  -0.037  19.608  1.00 79.59  ? 43   GLU A CG    1 
ATOM   829  C  CD    . GLU C 3 43  ? 46.844  -1.516  19.393  1.00 85.87  ? 43   GLU A CD    1 
ATOM   830  O  OE1   . GLU C 3 43  ? 45.796  -1.827  18.781  1.00 89.50  ? 43   GLU A OE1   1 
ATOM   831  O  OE2   . GLU C 3 43  ? 47.649  -2.368  19.826  1.00 85.19  ? 43   GLU A OE2   1 
ATOM   832  N  N     . SER C 3 44  ? 44.996  1.963   23.529  1.00 63.54  ? 44   SER A N     1 
ATOM   833  C  CA    . SER C 3 44  ? 45.004  3.179   24.343  1.00 56.71  ? 44   SER A CA    1 
ATOM   834  C  C     . SER C 3 44  ? 45.128  2.816   25.813  1.00 56.63  ? 44   SER A C     1 
ATOM   835  O  O     . SER C 3 44  ? 45.343  3.681   26.665  1.00 59.22  ? 44   SER A O     1 
ATOM   836  C  CB    . SER C 3 44  ? 43.710  3.974   24.139  1.00 53.58  ? 44   SER A CB    1 
ATOM   837  O  OG    . SER C 3 44  ? 42.667  3.491   24.972  1.00 54.35  ? 44   SER A OG    1 
ATOM   838  N  N     . GLN C 3 45  ? 44.980  1.533   26.107  1.00 53.84  ? 45   GLN A N     1 
ATOM   839  C  CA    . GLN C 3 45  ? 45.067  1.061   27.473  1.00 59.44  ? 45   GLN A CA    1 
ATOM   840  C  C     . GLN C 3 45  ? 46.385  0.353   27.626  1.00 61.25  ? 45   GLN A C     1 
ATOM   841  O  O     . GLN C 3 45  ? 46.696  -0.187  28.695  1.00 61.94  ? 45   GLN A O     1 
ATOM   842  C  CB    . GLN C 3 45  ? 43.925  0.084   27.779  1.00 64.76  ? 45   GLN A CB    1 
ATOM   843  C  CG    . GLN C 3 45  ? 42.535  0.697   27.688  1.00 67.24  ? 45   GLN A CG    1 
ATOM   844  C  CD    . GLN C 3 45  ? 42.394  1.939   28.558  1.00 70.14  ? 45   GLN A CD    1 
ATOM   845  O  OE1   . GLN C 3 45  ? 42.575  1.882   29.787  1.00 65.37  ? 45   GLN A OE1   1 
ATOM   846  N  NE2   . GLN C 3 45  ? 42.072  3.070   27.926  1.00 63.03  ? 45   GLN A NE2   1 
ATOM   847  N  N     . ALA C 3 46  ? 47.153  0.364   26.538  1.00 63.11  ? 46   ALA A N     1 
ATOM   848  C  CA    . ALA C 3 46  ? 48.454  -0.300  26.481  1.00 62.93  ? 46   ALA A CA    1 
ATOM   849  C  C     . ALA C 3 46  ? 49.389  0.215   27.547  1.00 60.49  ? 46   ALA A C     1 
ATOM   850  O  O     . ALA C 3 46  ? 49.362  1.386   27.900  1.00 63.87  ? 46   ALA A O     1 
ATOM   851  C  CB    . ALA C 3 46  ? 49.085  -0.118  25.094  1.00 63.14  ? 46   ALA A CB    1 
ATOM   852  N  N     . THR C 3 47  ? 50.213  -0.683  28.060  1.00 61.05  ? 47   THR A N     1 
ATOM   853  C  CA    . THR C 3 47  ? 51.168  -0.341  29.091  1.00 58.54  ? 47   THR A CA    1 
ATOM   854  C  C     . THR C 3 47  ? 52.551  -0.831  28.660  1.00 57.25  ? 47   THR A C     1 
ATOM   855  O  O     . THR C 3 47  ? 53.156  -0.269  27.744  1.00 57.29  ? 47   THR A O     1 
ATOM   856  C  CB    . THR C 3 47  ? 50.739  -0.971  30.450  1.00 60.94  ? 47   THR A CB    1 
ATOM   857  O  OG1   . THR C 3 47  ? 49.599  -0.264  30.956  1.00 68.05  ? 47   THR A OG1   1 
ATOM   858  C  CG2   . THR C 3 47  ? 51.859  -0.898  31.476  1.00 65.88  ? 47   THR A CG2   1 
ATOM   859  N  N     . LYS C 3 48  ? 53.033  -1.891  29.297  1.00 54.79  ? 48   LYS A N     1 
ATOM   860  C  CA    . LYS C 3 48  ? 54.345  -2.443  28.992  1.00 48.98  ? 48   LYS A CA    1 
ATOM   861  C  C     . LYS C 3 48  ? 54.275  -3.886  28.513  1.00 47.20  ? 48   LYS A C     1 
ATOM   862  O  O     . LYS C 3 48  ? 55.258  -4.436  28.027  1.00 47.88  ? 48   LYS A O     1 
ATOM   863  C  CB    . LYS C 3 48  ? 55.216  -2.378  30.229  1.00 48.45  ? 48   LYS A CB    1 
ATOM   864  C  CG    . LYS C 3 48  ? 54.706  -3.212  31.370  1.00 46.69  ? 48   LYS A CG    1 
ATOM   865  C  CD    . LYS C 3 48  ? 55.669  -3.128  32.514  1.00 47.46  ? 48   LYS A CD    1 
ATOM   866  C  CE    . LYS C 3 48  ? 55.157  -3.860  33.716  1.00 48.99  ? 48   LYS A CE    1 
ATOM   867  N  NZ    . LYS C 3 48  ? 55.883  -3.340  34.896  1.00 52.54  ? 48   LYS A NZ    1 
ATOM   868  N  N     . TYR C 3 49  ? 53.107  -4.493  28.668  1.00 45.93  ? 49   TYR A N     1 
ATOM   869  C  CA    . TYR C 3 49  ? 52.894  -5.863  28.261  1.00 43.22  ? 49   TYR A CA    1 
ATOM   870  C  C     . TYR C 3 49  ? 52.409  -6.023  26.822  1.00 46.99  ? 49   TYR A C     1 
ATOM   871  O  O     . TYR C 3 49  ? 51.442  -5.388  26.403  1.00 49.41  ? 49   TYR A O     1 
ATOM   872  C  CB    . TYR C 3 49  ? 51.892  -6.513  29.191  1.00 42.47  ? 49   TYR A CB    1 
ATOM   873  C  CG    . TYR C 3 49  ? 52.338  -6.570  30.628  1.00 44.07  ? 49   TYR A CG    1 
ATOM   874  C  CD1   . TYR C 3 49  ? 53.495  -7.258  30.999  1.00 42.39  ? 49   TYR A CD1   1 
ATOM   875  C  CD2   . TYR C 3 49  ? 51.574  -5.986  31.628  1.00 38.56  ? 49   TYR A CD2   1 
ATOM   876  C  CE1   . TYR C 3 49  ? 53.865  -7.364  32.339  1.00 43.57  ? 49   TYR A CE1   1 
ATOM   877  C  CE2   . TYR C 3 49  ? 51.932  -6.089  32.963  1.00 40.34  ? 49   TYR A CE2   1 
ATOM   878  C  CZ    . TYR C 3 49  ? 53.073  -6.777  33.319  1.00 44.26  ? 49   TYR A CZ    1 
ATOM   879  O  OH    . TYR C 3 49  ? 53.401  -6.906  34.651  1.00 48.69  ? 49   TYR A OH    1 
ATOM   880  N  N     . PHE C 3 50  ? 53.099  -6.878  26.071  1.00 48.11  ? 50   PHE A N     1 
ATOM   881  C  CA    . PHE C 3 50  ? 52.739  -7.170  24.687  1.00 50.65  ? 50   PHE A CA    1 
ATOM   882  C  C     . PHE C 3 50  ? 52.880  -8.658  24.380  1.00 51.09  ? 50   PHE A C     1 
ATOM   883  O  O     . PHE C 3 50  ? 53.663  -9.354  25.026  1.00 53.45  ? 50   PHE A O     1 
ATOM   884  C  CB    . PHE C 3 50  ? 53.613  -6.351  23.742  1.00 44.25  ? 50   PHE A CB    1 
ATOM   885  C  CG    . PHE C 3 50  ? 53.445  -4.880  23.921  1.00 51.43  ? 50   PHE A CG    1 
ATOM   886  C  CD1   . PHE C 3 50  ? 53.996  -4.239  25.026  1.00 49.67  ? 50   PHE A CD1   1 
ATOM   887  C  CD2   . PHE C 3 50  ? 52.671  -4.139  23.027  1.00 51.95  ? 50   PHE A CD2   1 
ATOM   888  C  CE1   . PHE C 3 50  ? 53.779  -2.883  25.250  1.00 53.46  ? 50   PHE A CE1   1 
ATOM   889  C  CE2   . PHE C 3 50  ? 52.445  -2.777  23.240  1.00 55.63  ? 50   PHE A CE2   1 
ATOM   890  C  CZ    . PHE C 3 50  ? 52.999  -2.146  24.357  1.00 53.99  ? 50   PHE A CZ    1 
ATOM   891  N  N     . ASP C 3 51  ? 52.092  -9.160  23.434  1.00 48.86  ? 51   ASP A N     1 
ATOM   892  C  CA    . ASP C 3 51  ? 52.207  -10.568 23.061  1.00 50.38  ? 51   ASP A CA    1 
ATOM   893  C  C     . ASP C 3 51  ? 53.297  -10.646 21.997  1.00 52.19  ? 51   ASP A C     1 
ATOM   894  O  O     . ASP C 3 51  ? 53.898  -9.627  21.655  1.00 52.46  ? 51   ASP A O     1 
ATOM   895  C  CB    . ASP C 3 51  ? 50.870  -11.124 22.532  1.00 47.46  ? 51   ASP A CB    1 
ATOM   896  C  CG    . ASP C 3 51  ? 50.427  -10.482 21.228  1.00 50.28  ? 51   ASP A CG    1 
ATOM   897  O  OD1   . ASP C 3 51  ? 51.191  -9.680  20.649  1.00 49.71  ? 51   ASP A OD1   1 
ATOM   898  O  OD2   . ASP C 3 51  ? 49.301  -10.790 20.771  1.00 52.99  ? 51   ASP A OD2   1 
ATOM   899  N  N     . ILE C 3 52  ? 53.570  -11.838 21.473  1.00 51.17  ? 52   ILE A N     1 
ATOM   900  C  CA    . ILE C 3 52  ? 54.626  -11.972 20.459  1.00 44.09  ? 52   ILE A CA    1 
ATOM   901  C  C     . ILE C 3 52  ? 54.249  -11.322 19.128  1.00 42.87  ? 52   ILE A C     1 
ATOM   902  O  O     . ILE C 3 52  ? 55.100  -11.132 18.258  1.00 42.71  ? 52   ILE A O     1 
ATOM   903  C  CB    . ILE C 3 52  ? 54.968  -13.444 20.204  1.00 36.88  ? 52   ILE A CB    1 
ATOM   904  C  CG1   . ILE C 3 52  ? 53.732  -14.189 19.712  1.00 34.51  ? 52   ILE A CG1   1 
ATOM   905  C  CG2   . ILE C 3 52  ? 55.459  -14.088 21.484  1.00 38.07  ? 52   ILE A CG2   1 
ATOM   906  C  CD1   . ILE C 3 52  ? 53.968  -15.651 19.516  1.00 35.37  ? 52   ILE A CD1   1 
ATOM   907  N  N     . TYR C 3 53  ? 52.972  -10.981 18.985  1.00 40.27  ? 53   TYR A N     1 
ATOM   908  C  CA    . TYR C 3 53  ? 52.464  -10.360 17.775  1.00 40.46  ? 53   TYR A CA    1 
ATOM   909  C  C     . TYR C 3 53  ? 52.507  -8.861  17.879  1.00 42.79  ? 53   TYR A C     1 
ATOM   910  O  O     . TYR C 3 53  ? 52.234  -8.173  16.903  1.00 46.43  ? 53   TYR A O     1 
ATOM   911  C  CB    . TYR C 3 53  ? 51.026  -10.788 17.514  1.00 43.60  ? 53   TYR A CB    1 
ATOM   912  C  CG    . TYR C 3 53  ? 50.865  -12.249 17.185  1.00 43.01  ? 53   TYR A CG    1 
ATOM   913  C  CD1   . TYR C 3 53  ? 51.080  -12.719 15.895  1.00 38.96  ? 53   TYR A CD1   1 
ATOM   914  C  CD2   . TYR C 3 53  ? 50.483  -13.164 18.167  1.00 44.23  ? 53   TYR A CD2   1 
ATOM   915  C  CE1   . TYR C 3 53  ? 50.913  -14.071 15.584  1.00 41.49  ? 53   TYR A CE1   1 
ATOM   916  C  CE2   . TYR C 3 53  ? 50.318  -14.523 17.869  1.00 47.33  ? 53   TYR A CE2   1 
ATOM   917  C  CZ    . TYR C 3 53  ? 50.534  -14.968 16.571  1.00 46.28  ? 53   TYR A CZ    1 
ATOM   918  O  OH    . TYR C 3 53  ? 50.380  -16.304 16.259  1.00 50.63  ? 53   TYR A OH    1 
ATOM   919  N  N     . GLY C 3 54  ? 52.833  -8.351  19.065  1.00 47.41  ? 54   GLY A N     1 
ATOM   920  C  CA    . GLY C 3 54  ? 52.915  -6.906  19.267  1.00 55.12  ? 54   GLY A CA    1 
ATOM   921  C  C     . GLY C 3 54  ? 51.694  -6.225  19.878  1.00 58.37  ? 54   GLY A C     1 
ATOM   922  O  O     . GLY C 3 54  ? 51.769  -5.092  20.356  1.00 60.90  ? 54   GLY A O     1 
ATOM   923  N  N     . LYS C 3 55  ? 50.560  -6.909  19.854  1.00 58.57  ? 55   LYS A N     1 
ATOM   924  C  CA    . LYS C 3 55  ? 49.335  -6.355  20.407  1.00 54.13  ? 55   LYS A CA    1 
ATOM   925  C  C     . LYS C 3 55  ? 49.413  -6.279  21.932  1.00 51.83  ? 55   LYS A C     1 
ATOM   926  O  O     . LYS C 3 55  ? 49.824  -7.233  22.595  1.00 57.54  ? 55   LYS A O     1 
ATOM   927  C  CB    . LYS C 3 55  ? 48.155  -7.211  19.949  1.00 52.48  ? 55   LYS A CB    1 
ATOM   928  C  CG    . LYS C 3 55  ? 47.869  -7.077  18.456  1.00 52.18  ? 55   LYS A CG    1 
ATOM   929  C  CD    . LYS C 3 55  ? 47.074  -8.263  17.932  1.00 66.47  ? 55   LYS A CD    1 
ATOM   930  C  CE    . LYS C 3 55  ? 46.569  -8.028  16.503  1.00 74.09  ? 55   LYS A CE    1 
ATOM   931  N  NZ    . LYS C 3 55  ? 45.323  -7.184  16.464  1.00 79.23  ? 55   LYS A NZ    1 
ATOM   932  N  N     . PRO C 3 56  ? 49.036  -5.125  22.503  1.00 48.30  ? 56   PRO A N     1 
ATOM   933  C  CA    . PRO C 3 56  ? 49.040  -4.848  23.944  1.00 44.43  ? 56   PRO A CA    1 
ATOM   934  C  C     . PRO C 3 56  ? 48.088  -5.705  24.770  1.00 43.33  ? 56   PRO A C     1 
ATOM   935  O  O     . PRO C 3 56  ? 47.081  -6.204  24.263  1.00 46.68  ? 56   PRO A O     1 
ATOM   936  C  CB    . PRO C 3 56  ? 48.688  -3.360  24.010  1.00 45.52  ? 56   PRO A CB    1 
ATOM   937  C  CG    . PRO C 3 56  ? 47.837  -3.161  22.791  1.00 45.42  ? 56   PRO A CG    1 
ATOM   938  C  CD    . PRO C 3 56  ? 48.585  -3.945  21.748  1.00 46.92  ? 56   PRO A CD    1 
ATOM   939  N  N     . CYS C 3 57  ? 48.428  -5.873  26.047  1.00 41.76  ? 57   CYS A N     1 
ATOM   940  C  CA    . CYS C 3 57  ? 47.630  -6.660  26.984  1.00 45.10  ? 57   CYS A CA    1 
ATOM   941  C  C     . CYS C 3 57  ? 47.637  -6.003  28.356  1.00 48.64  ? 57   CYS A C     1 
ATOM   942  O  O     . CYS C 3 57  ? 48.545  -5.228  28.665  1.00 49.33  ? 57   CYS A O     1 
ATOM   943  C  CB    . CYS C 3 57  ? 48.232  -8.054  27.173  1.00 50.75  ? 57   CYS A CB    1 
ATOM   944  S  SG    . CYS C 3 57  ? 48.337  -9.097  25.719  1.00 63.71  ? 57   CYS A SG    1 
ATOM   945  N  N     . THR C 3 58  ? 46.633  -6.318  29.179  1.00 49.35  ? 58   THR A N     1 
ATOM   946  C  CA    . THR C 3 58  ? 46.609  -5.823  30.561  1.00 53.04  ? 58   THR A CA    1 
ATOM   947  C  C     . THR C 3 58  ? 46.675  -7.029  31.503  1.00 49.83  ? 58   THR A C     1 
ATOM   948  O  O     . THR C 3 58  ? 46.118  -8.092  31.229  1.00 51.53  ? 58   THR A O     1 
ATOM   949  C  CB    . THR C 3 58  ? 45.343  -5.004  30.920  1.00 56.10  ? 58   THR A CB    1 
ATOM   950  O  OG1   . THR C 3 58  ? 44.273  -5.887  31.280  1.00 54.79  ? 58   THR A OG1   1 
ATOM   951  C  CG2   . THR C 3 58  ? 44.929  -4.126  29.752  1.00 61.73  ? 58   THR A CG2   1 
ATOM   952  N  N     . ARG C 3 59  ? 47.366  -6.848  32.617  1.00 49.41  ? 59   ARG A N     1 
ATOM   953  C  CA    . ARG C 3 59  ? 47.548  -7.899  33.607  1.00 50.31  ? 59   ARG A CA    1 
ATOM   954  C  C     . ARG C 3 59  ? 46.296  -8.078  34.476  1.00 49.81  ? 59   ARG A C     1 
ATOM   955  O  O     . ARG C 3 59  ? 45.509  -7.156  34.639  1.00 46.13  ? 59   ARG A O     1 
ATOM   956  C  CB    . ARG C 3 59  ? 48.769  -7.544  34.463  1.00 48.53  ? 59   ARG A CB    1 
ATOM   957  C  CG    . ARG C 3 59  ? 49.201  -8.599  35.426  1.00 50.02  ? 59   ARG A CG    1 
ATOM   958  C  CD    . ARG C 3 59  ? 50.234  -8.003  36.343  1.00 51.64  ? 59   ARG A CD    1 
ATOM   959  N  NE    . ARG C 3 59  ? 50.619  -8.947  37.381  1.00 59.53  ? 59   ARG A NE    1 
ATOM   960  C  CZ    . ARG C 3 59  ? 51.350  -8.631  38.442  1.00 61.63  ? 59   ARG A CZ    1 
ATOM   961  N  NH1   . ARG C 3 59  ? 51.778  -7.381  38.611  1.00 65.52  ? 59   ARG A NH1   1 
ATOM   962  N  NH2   . ARG C 3 59  ? 51.657  -9.567  39.329  1.00 59.85  ? 59   ARG A NH2   1 
ATOM   963  N  N     . LYS C 3 60  ? 46.122  -9.284  35.010  1.00 52.41  ? 60   LYS A N     1 
ATOM   964  C  CA    . LYS C 3 60  ? 44.984  -9.626  35.862  1.00 49.79  ? 60   LYS A CA    1 
ATOM   965  C  C     . LYS C 3 60  ? 45.520  -10.509 36.981  1.00 48.88  ? 60   LYS A C     1 
ATOM   966  O  O     . LYS C 3 60  ? 45.888  -11.658 36.749  1.00 51.54  ? 60   LYS A O     1 
ATOM   967  C  CB    . LYS C 3 60  ? 43.927  -10.401 35.065  1.00 55.68  ? 60   LYS A CB    1 
ATOM   968  C  CG    . LYS C 3 60  ? 43.396  -9.690  33.819  1.00 63.84  ? 60   LYS A CG    1 
ATOM   969  C  CD    . LYS C 3 60  ? 42.061  -8.970  34.070  1.00 69.39  ? 60   LYS A CD    1 
ATOM   970  C  CE    . LYS C 3 60  ? 41.542  -8.304  32.779  1.00 71.76  ? 60   LYS A CE    1 
ATOM   971  N  NZ    . LYS C 3 60  ? 40.217  -7.603  32.915  1.00 69.12  ? 60   LYS A NZ    1 
ATOM   972  N  N     . LEU C 3 61  ? 45.574  -9.970  38.192  1.00 43.65  ? 61   LEU A N     1 
ATOM   973  C  CA    . LEU C 3 61  ? 46.078  -10.717 39.338  1.00 46.27  ? 61   LEU A CA    1 
ATOM   974  C  C     . LEU C 3 61  ? 44.912  -11.316 40.126  1.00 49.08  ? 61   LEU A C     1 
ATOM   975  O  O     . LEU C 3 61  ? 44.052  -10.593 40.627  1.00 56.58  ? 61   LEU A O     1 
ATOM   976  C  CB    . LEU C 3 61  ? 46.903  -9.780  40.223  1.00 49.73  ? 61   LEU A CB    1 
ATOM   977  C  CG    . LEU C 3 61  ? 47.390  -10.326 41.563  1.00 53.84  ? 61   LEU A CG    1 
ATOM   978  C  CD1   . LEU C 3 61  ? 48.550  -11.301 41.343  1.00 58.68  ? 61   LEU A CD1   1 
ATOM   979  C  CD2   . LEU C 3 61  ? 47.810  -9.172  42.447  1.00 48.64  ? 61   LEU A CD2   1 
ATOM   980  N  N     . PHE C 3 62  ? 44.893  -12.639 40.238  1.00 45.62  ? 62   PHE A N     1 
ATOM   981  C  CA    . PHE C 3 62  ? 43.829  -13.341 40.947  1.00 44.52  ? 62   PHE A CA    1 
ATOM   982  C  C     . PHE C 3 62  ? 44.176  -13.595 42.401  1.00 45.14  ? 62   PHE A C     1 
ATOM   983  O  O     . PHE C 3 62  ? 45.349  -13.634 42.767  1.00 45.52  ? 62   PHE A O     1 
ATOM   984  C  CB    . PHE C 3 62  ? 43.519  -14.676 40.251  1.00 39.73  ? 62   PHE A CB    1 
ATOM   985  C  CG    . PHE C 3 62  ? 43.220  -14.521 38.801  1.00 40.37  ? 62   PHE A CG    1 
ATOM   986  C  CD1   . PHE C 3 62  ? 44.243  -14.258 37.884  1.00 45.04  ? 62   PHE A CD1   1 
ATOM   987  C  CD2   . PHE C 3 62  ? 41.910  -14.540 38.350  1.00 44.40  ? 62   PHE A CD2   1 
ATOM   988  C  CE1   . PHE C 3 62  ? 43.962  -14.007 36.526  1.00 39.32  ? 62   PHE A CE1   1 
ATOM   989  C  CE2   . PHE C 3 62  ? 41.613  -14.292 37.007  1.00 44.73  ? 62   PHE A CE2   1 
ATOM   990  C  CZ    . PHE C 3 62  ? 42.649  -14.022 36.087  1.00 45.31  ? 62   PHE A CZ    1 
ATOM   991  N  N     . ALA C 3 63  ? 43.138  -13.774 43.216  1.00 45.36  ? 63   ALA A N     1 
ATOM   992  C  CA    . ALA C 3 63  ? 43.284  -14.024 44.643  1.00 45.31  ? 63   ALA A CA    1 
ATOM   993  C  C     . ALA C 3 63  ? 43.904  -15.382 44.913  1.00 45.66  ? 63   ALA A C     1 
ATOM   994  O  O     . ALA C 3 63  ? 44.713  -15.534 45.824  1.00 47.87  ? 63   ALA A O     1 
ATOM   995  C  CB    . ALA C 3 63  ? 41.921  -13.934 45.326  1.00 46.72  ? 63   ALA A CB    1 
ATOM   996  N  N     . ASN C 3 64  ? 43.512  -16.371 44.120  1.00 48.05  ? 64   ASN A N     1 
ATOM   997  C  CA    . ASN C 3 64  ? 44.017  -17.732 44.271  1.00 45.65  ? 64   ASN A CA    1 
ATOM   998  C  C     . ASN C 3 64  ? 44.027  -18.403 42.906  1.00 44.78  ? 64   ASN A C     1 
ATOM   999  O  O     . ASN C 3 64  ? 43.509  -17.847 41.931  1.00 39.28  ? 64   ASN A O     1 
ATOM   1000 C  CB    . ASN C 3 64  ? 43.127  -18.520 45.239  1.00 48.03  ? 64   ASN A CB    1 
ATOM   1001 C  CG    . ASN C 3 64  ? 41.676  -18.505 44.824  1.00 47.89  ? 64   ASN A CG    1 
ATOM   1002 O  OD1   . ASN C 3 64  ? 41.113  -19.524 44.434  1.00 54.01  ? 64   ASN A OD1   1 
ATOM   1003 N  ND2   . ASN C 3 64  ? 41.064  -17.337 44.887  1.00 58.39  ? 64   ASN A ND2   1 
ATOM   1004 N  N     . MET C 3 65  ? 44.605  -19.600 42.839  1.00 41.19  ? 65   MET A N     1 
ATOM   1005 C  CA    . MET C 3 65  ? 44.687  -20.321 41.580  1.00 43.61  ? 65   MET A CA    1 
ATOM   1006 C  C     . MET C 3 65  ? 43.356  -20.858 41.076  1.00 43.94  ? 65   MET A C     1 
ATOM   1007 O  O     . MET C 3 65  ? 43.136  -20.932 39.862  1.00 38.52  ? 65   MET A O     1 
ATOM   1008 C  CB    . MET C 3 65  ? 45.728  -21.435 41.689  1.00 39.81  ? 65   MET A CB    1 
ATOM   1009 C  CG    . MET C 3 65  ? 47.165  -20.923 41.608  1.00 36.85  ? 65   MET A CG    1 
ATOM   1010 S  SD    . MET C 3 65  ? 48.352  -22.234 41.974  1.00 43.33  ? 65   MET A SD    1 
ATOM   1011 C  CE    . MET C 3 65  ? 48.327  -22.306 43.755  1.00 42.21  ? 65   MET A CE    1 
ATOM   1012 N  N     . ARG C 3 66  ? 42.458  -21.210 41.991  1.00 47.93  ? 66   ARG A N     1 
ATOM   1013 C  CA    . ARG C 3 66  ? 41.155  -21.708 41.566  1.00 52.48  ? 66   ARG A CA    1 
ATOM   1014 C  C     . ARG C 3 66  ? 40.444  -20.621 40.778  1.00 49.76  ? 66   ARG A C     1 
ATOM   1015 O  O     . ARG C 3 66  ? 39.846  -20.893 39.740  1.00 51.00  ? 66   ARG A O     1 
ATOM   1016 C  CB    . ARG C 3 66  ? 40.289  -22.121 42.761  1.00 59.78  ? 66   ARG A CB    1 
ATOM   1017 C  CG    . ARG C 3 66  ? 38.929  -22.714 42.348  1.00 70.39  ? 66   ARG A CG    1 
ATOM   1018 C  CD    . ARG C 3 66  ? 38.041  -23.034 43.552  1.00 81.85  ? 66   ARG A CD    1 
ATOM   1019 N  NE    . ARG C 3 66  ? 37.793  -21.848 44.370  1.00 92.22  ? 66   ARG A NE    1 
ATOM   1020 C  CZ    . ARG C 3 66  ? 37.004  -20.836 44.012  1.00 94.63  ? 66   ARG A CZ    1 
ATOM   1021 N  NH1   . ARG C 3 66  ? 36.369  -20.863 42.841  1.00 90.41  ? 66   ARG A NH1   1 
ATOM   1022 N  NH2   . ARG C 3 66  ? 36.858  -19.788 44.822  1.00 94.77  ? 66   ARG A NH2   1 
ATOM   1023 N  N     . ASP C 3 67  ? 40.520  -19.384 41.259  1.00 47.01  ? 67   ASP A N     1 
ATOM   1024 C  CA    . ASP C 3 67  ? 39.861  -18.289 40.559  1.00 50.47  ? 67   ASP A CA    1 
ATOM   1025 C  C     . ASP C 3 67  ? 40.443  -18.161 39.165  1.00 48.45  ? 67   ASP A C     1 
ATOM   1026 O  O     . ASP C 3 67  ? 39.711  -18.129 38.187  1.00 48.41  ? 67   ASP A O     1 
ATOM   1027 C  CB    . ASP C 3 67  ? 40.032  -16.963 41.309  1.00 57.75  ? 67   ASP A CB    1 
ATOM   1028 C  CG    . ASP C 3 67  ? 39.195  -16.886 42.595  1.00 66.67  ? 67   ASP A CG    1 
ATOM   1029 O  OD1   . ASP C 3 67  ? 38.535  -17.884 42.967  1.00 73.82  ? 67   ASP A OD1   1 
ATOM   1030 O  OD2   . ASP C 3 67  ? 39.207  -15.813 43.239  1.00 70.75  ? 67   ASP A OD2   1 
ATOM   1031 N  N     . ALA C 3 68  ? 41.771  -18.109 39.094  1.00 50.66  ? 68   ALA A N     1 
ATOM   1032 C  CA    . ALA C 3 68  ? 42.501  -17.970 37.839  1.00 43.82  ? 68   ALA A CA    1 
ATOM   1033 C  C     . ALA C 3 68  ? 42.065  -19.007 36.812  1.00 43.62  ? 68   ALA A C     1 
ATOM   1034 O  O     . ALA C 3 68  ? 41.823  -18.678 35.645  1.00 40.44  ? 68   ALA A O     1 
ATOM   1035 C  CB    . ALA C 3 68  ? 43.989  -18.077 38.101  1.00 45.65  ? 68   ALA A CB    1 
ATOM   1036 N  N     . SER C 3 69  ? 41.963  -20.260 37.237  1.00 42.22  ? 69   SER A N     1 
ATOM   1037 C  CA    . SER C 3 69  ? 41.520  -21.304 36.320  1.00 47.09  ? 69   SER A CA    1 
ATOM   1038 C  C     . SER C 3 69  ? 40.091  -20.981 35.911  1.00 51.93  ? 69   SER A C     1 
ATOM   1039 O  O     . SER C 3 69  ? 39.782  -20.882 34.723  1.00 55.71  ? 69   SER A O     1 
ATOM   1040 C  CB    . SER C 3 69  ? 41.548  -22.676 36.989  1.00 40.50  ? 69   SER A CB    1 
ATOM   1041 O  OG    . SER C 3 69  ? 42.852  -23.024 37.386  1.00 52.59  ? 69   SER A OG    1 
ATOM   1042 N  N     . GLN C 3 70  ? 39.231  -20.807 36.911  1.00 51.64  ? 70   GLN A N     1 
ATOM   1043 C  CA    . GLN C 3 70  ? 37.824  -20.494 36.694  1.00 55.21  ? 70   GLN A CA    1 
ATOM   1044 C  C     . GLN C 3 70  ? 37.648  -19.364 35.672  1.00 53.80  ? 70   GLN A C     1 
ATOM   1045 O  O     . GLN C 3 70  ? 36.730  -19.397 34.854  1.00 54.08  ? 70   GLN A O     1 
ATOM   1046 C  CB    . GLN C 3 70  ? 37.178  -20.122 38.041  1.00 60.43  ? 70   GLN A CB    1 
ATOM   1047 C  CG    . GLN C 3 70  ? 35.889  -19.321 37.953  1.00 76.41  ? 70   GLN A CG    1 
ATOM   1048 C  CD    . GLN C 3 70  ? 34.669  -20.175 37.674  1.00 86.47  ? 70   GLN A CD    1 
ATOM   1049 O  OE1   . GLN C 3 70  ? 34.648  -20.961 36.726  1.00 91.74  ? 70   GLN A OE1   1 
ATOM   1050 N  NE2   . GLN C 3 70  ? 33.634  -20.017 38.501  1.00 87.32  ? 70   GLN A NE2   1 
ATOM   1051 N  N     . TRP C 3 71  ? 38.547  -18.384 35.711  1.00 48.43  ? 71   TRP A N     1 
ATOM   1052 C  CA    . TRP C 3 71  ? 38.498  -17.231 34.814  1.00 46.08  ? 71   TRP A CA    1 
ATOM   1053 C  C     . TRP C 3 71  ? 38.870  -17.575 33.362  1.00 48.79  ? 71   TRP A C     1 
ATOM   1054 O  O     . TRP C 3 71  ? 38.499  -16.865 32.409  1.00 44.14  ? 71   TRP A O     1 
ATOM   1055 C  CB    . TRP C 3 71  ? 39.446  -16.146 35.335  1.00 46.23  ? 71   TRP A CB    1 
ATOM   1056 C  CG    . TRP C 3 71  ? 39.542  -14.939 34.446  1.00 44.77  ? 71   TRP A CG    1 
ATOM   1057 C  CD1   . TRP C 3 71  ? 38.713  -13.863 34.439  1.00 47.29  ? 71   TRP A CD1   1 
ATOM   1058 C  CD2   . TRP C 3 71  ? 40.500  -14.712 33.405  1.00 46.40  ? 71   TRP A CD2   1 
ATOM   1059 N  NE1   . TRP C 3 71  ? 39.084  -12.975 33.458  1.00 45.46  ? 71   TRP A NE1   1 
ATOM   1060 C  CE2   . TRP C 3 71  ? 40.178  -13.469 32.805  1.00 47.02  ? 71   TRP A CE2   1 
ATOM   1061 C  CE3   . TRP C 3 71  ? 41.595  -15.437 32.917  1.00 42.68  ? 71   TRP A CE3   1 
ATOM   1062 C  CZ2   . TRP C 3 71  ? 40.915  -12.929 31.742  1.00 48.00  ? 71   TRP A CZ2   1 
ATOM   1063 C  CZ3   . TRP C 3 71  ? 42.333  -14.901 31.855  1.00 48.43  ? 71   TRP A CZ3   1 
ATOM   1064 C  CH2   . TRP C 3 71  ? 41.985  -13.658 31.279  1.00 49.69  ? 71   TRP A CH2   1 
ATOM   1065 N  N     . ILE C 3 72  ? 39.620  -18.659 33.204  1.00 48.44  ? 72   ILE A N     1 
ATOM   1066 C  CA    . ILE C 3 72  ? 40.044  -19.090 31.890  1.00 48.08  ? 72   ILE A CA    1 
ATOM   1067 C  C     . ILE C 3 72  ? 38.869  -19.775 31.214  1.00 49.37  ? 72   ILE A C     1 
ATOM   1068 O  O     . ILE C 3 72  ? 38.574  -19.527 30.047  1.00 45.85  ? 72   ILE A O     1 
ATOM   1069 C  CB    . ILE C 3 72  ? 41.239  -20.084 31.978  1.00 48.44  ? 72   ILE A CB    1 
ATOM   1070 C  CG1   . ILE C 3 72  ? 42.457  -19.396 32.598  1.00 46.48  ? 72   ILE A CG1   1 
ATOM   1071 C  CG2   . ILE C 3 72  ? 41.599  -20.582 30.589  1.00 48.41  ? 72   ILE A CG2   1 
ATOM   1072 C  CD1   . ILE C 3 72  ? 43.717  -20.249 32.635  1.00 40.12  ? 72   ILE A CD1   1 
ATOM   1073 N  N     . LYS C 3 73  ? 38.196  -20.637 31.964  1.00 53.28  ? 73   LYS A N     1 
ATOM   1074 C  CA    . LYS C 3 73  ? 37.053  -21.354 31.433  1.00 56.53  ? 73   LYS A CA    1 
ATOM   1075 C  C     . LYS C 3 73  ? 36.043  -20.303 31.024  1.00 55.50  ? 73   LYS A C     1 
ATOM   1076 O  O     . LYS C 3 73  ? 35.517  -20.326 29.917  1.00 57.51  ? 73   LYS A O     1 
ATOM   1077 C  CB    . LYS C 3 73  ? 36.466  -22.274 32.504  1.00 60.56  ? 73   LYS A CB    1 
ATOM   1078 C  CG    . LYS C 3 73  ? 35.881  -23.593 31.988  1.00 69.69  ? 73   LYS A CG    1 
ATOM   1079 C  CD    . LYS C 3 73  ? 34.522  -23.431 31.303  1.00 78.40  ? 73   LYS A CD    1 
ATOM   1080 C  CE    . LYS C 3 73  ? 34.655  -23.061 29.830  1.00 79.55  ? 73   LYS A CE    1 
ATOM   1081 N  NZ    . LYS C 3 73  ? 33.315  -22.885 29.182  1.00 77.57  ? 73   LYS A NZ    1 
ATOM   1082 N  N     . ARG C 3 74  ? 35.794  -19.361 31.918  1.00 56.57  ? 74   ARG A N     1 
ATOM   1083 C  CA    . ARG C 3 74  ? 34.839  -18.298 31.652  1.00 59.59  ? 74   ARG A CA    1 
ATOM   1084 C  C     . ARG C 3 74  ? 35.230  -17.500 30.410  1.00 58.74  ? 74   ARG A C     1 
ATOM   1085 O  O     . ARG C 3 74  ? 34.384  -17.209 29.563  1.00 59.80  ? 74   ARG A O     1 
ATOM   1086 C  CB    . ARG C 3 74  ? 34.745  -17.392 32.882  1.00 69.02  ? 74   ARG A CB    1 
ATOM   1087 C  CG    . ARG C 3 74  ? 33.661  -16.342 32.828  1.00 79.03  ? 74   ARG A CG    1 
ATOM   1088 C  CD    . ARG C 3 74  ? 34.175  -15.042 32.255  1.00 85.78  ? 74   ARG A CD    1 
ATOM   1089 N  NE    . ARG C 3 74  ? 33.271  -13.947 32.576  1.00 92.33  ? 74   ARG A NE    1 
ATOM   1090 C  CZ    . ARG C 3 74  ? 33.584  -12.660 32.480  1.00 92.17  ? 74   ARG A CZ    1 
ATOM   1091 N  NH1   . ARG C 3 74  ? 34.793  -12.294 32.067  1.00 88.70  ? 74   ARG A NH1   1 
ATOM   1092 N  NH2   . ARG C 3 74  ? 32.686  -11.736 32.805  1.00 89.32  ? 74   ARG A NH2   1 
ATOM   1093 N  N     . MET C 3 75  ? 36.515  -17.159 30.303  1.00 56.97  ? 75   MET A N     1 
ATOM   1094 C  CA    . MET C 3 75  ? 37.031  -16.393 29.167  1.00 53.04  ? 75   MET A CA    1 
ATOM   1095 C  C     . MET C 3 75  ? 36.837  -17.123 27.857  1.00 55.35  ? 75   MET A C     1 
ATOM   1096 O  O     . MET C 3 75  ? 36.786  -16.512 26.791  1.00 54.07  ? 75   MET A O     1 
ATOM   1097 C  CB    . MET C 3 75  ? 38.514  -16.101 29.346  1.00 52.61  ? 75   MET A CB    1 
ATOM   1098 C  CG    . MET C 3 75  ? 38.791  -14.758 29.979  1.00 51.46  ? 75   MET A CG    1 
ATOM   1099 S  SD    . MET C 3 75  ? 38.288  -13.400 28.932  1.00 48.13  ? 75   MET A SD    1 
ATOM   1100 C  CE    . MET C 3 75  ? 39.855  -12.930 28.179  1.00 48.52  ? 75   MET A CE    1 
ATOM   1101 N  N     . GLU C 3 76  ? 36.743  -18.440 27.954  1.00 59.29  ? 76   GLU A N     1 
ATOM   1102 C  CA    . GLU C 3 76  ? 36.545  -19.298 26.806  1.00 62.52  ? 76   GLU A CA    1 
ATOM   1103 C  C     . GLU C 3 76  ? 35.206  -19.065 26.142  1.00 64.92  ? 76   GLU A C     1 
ATOM   1104 O  O     . GLU C 3 76  ? 35.157  -18.856 24.933  1.00 68.62  ? 76   GLU A O     1 
ATOM   1105 C  CB    . GLU C 3 76  ? 36.658  -20.755 27.226  1.00 68.35  ? 76   GLU A CB    1 
ATOM   1106 C  CG    . GLU C 3 76  ? 36.099  -21.746 26.235  1.00 78.40  ? 76   GLU A CG    1 
ATOM   1107 C  CD    . GLU C 3 76  ? 36.643  -23.138 26.483  1.00 87.74  ? 76   GLU A CD    1 
ATOM   1108 O  OE1   . GLU C 3 76  ? 37.785  -23.239 26.986  1.00 91.33  ? 76   GLU A OE1   1 
ATOM   1109 O  OE2   . GLU C 3 76  ? 35.942  -24.124 26.170  1.00 92.45  ? 76   GLU A OE2   1 
ATOM   1110 N  N     . ASP C 3 77  ? 34.122  -19.119 26.918  1.00 64.92  ? 77   ASP A N     1 
ATOM   1111 C  CA    . ASP C 3 77  ? 32.783  -18.899 26.368  1.00 65.10  ? 77   ASP A CA    1 
ATOM   1112 C  C     . ASP C 3 77  ? 32.728  -17.572 25.643  1.00 61.43  ? 77   ASP A C     1 
ATOM   1113 O  O     . ASP C 3 77  ? 32.422  -17.522 24.461  1.00 61.25  ? 77   ASP A O     1 
ATOM   1114 C  CB    . ASP C 3 77  ? 31.747  -18.916 27.476  1.00 71.98  ? 77   ASP A CB    1 
ATOM   1115 C  CG    . ASP C 3 77  ? 31.783  -20.201 28.259  1.00 82.05  ? 77   ASP A CG    1 
ATOM   1116 O  OD1   . ASP C 3 77  ? 31.766  -21.275 27.615  1.00 86.97  ? 77   ASP A OD1   1 
ATOM   1117 O  OD2   . ASP C 3 77  ? 31.837  -20.134 29.505  1.00 85.40  ? 77   ASP A OD2   1 
ATOM   1118 N  N     . ILE C 3 78  ? 33.023  -16.492 26.350  1.00 59.04  ? 78   ILE A N     1 
ATOM   1119 C  CA    . ILE C 3 78  ? 33.030  -15.174 25.726  1.00 59.66  ? 78   ILE A CA    1 
ATOM   1120 C  C     . ILE C 3 78  ? 33.712  -15.229 24.338  1.00 59.35  ? 78   ILE A C     1 
ATOM   1121 O  O     . ILE C 3 78  ? 33.350  -14.481 23.434  1.00 59.08  ? 78   ILE A O     1 
ATOM   1122 C  CB    . ILE C 3 78  ? 33.803  -14.161 26.598  1.00 63.12  ? 78   ILE A CB    1 
ATOM   1123 C  CG1   . ILE C 3 78  ? 33.308  -14.234 28.041  1.00 62.84  ? 78   ILE A CG1   1 
ATOM   1124 C  CG2   . ILE C 3 78  ? 33.655  -12.753 26.023  1.00 62.52  ? 78   ILE A CG2   1 
ATOM   1125 C  CD1   . ILE C 3 78  ? 34.132  -13.399 28.993  1.00 63.86  ? 78   ILE A CD1   1 
ATOM   1126 N  N     . GLY C 3 79  ? 34.706  -16.103 24.186  1.00 59.50  ? 79   GLY A N     1 
ATOM   1127 C  CA    . GLY C 3 79  ? 35.409  -16.226 22.919  1.00 56.18  ? 79   GLY A CA    1 
ATOM   1128 C  C     . GLY C 3 79  ? 36.651  -15.359 22.818  1.00 58.25  ? 79   GLY A C     1 
ATOM   1129 O  O     . GLY C 3 79  ? 37.117  -15.060 21.716  1.00 55.47  ? 79   GLY A O     1 
ATOM   1130 N  N     . LEU C 3 80  ? 37.183  -14.952 23.972  1.00 58.41  ? 80   LEU A N     1 
ATOM   1131 C  CA    . LEU C 3 80  ? 38.385  -14.116 24.036  1.00 56.04  ? 80   LEU A CA    1 
ATOM   1132 C  C     . LEU C 3 80  ? 39.606  -14.908 24.540  1.00 54.72  ? 80   LEU A C     1 
ATOM   1133 O  O     . LEU C 3 80  ? 39.513  -15.709 25.478  1.00 49.59  ? 80   LEU A O     1 
ATOM   1134 C  CB    . LEU C 3 80  ? 38.135  -12.918 24.959  1.00 56.92  ? 80   LEU A CB    1 
ATOM   1135 C  CG    . LEU C 3 80  ? 36.981  -11.986 24.585  1.00 56.70  ? 80   LEU A CG    1 
ATOM   1136 C  CD1   . LEU C 3 80  ? 36.544  -11.228 25.821  1.00 57.45  ? 80   LEU A CD1   1 
ATOM   1137 C  CD2   . LEU C 3 80  ? 37.399  -11.046 23.468  1.00 50.37  ? 80   LEU A CD2   1 
ATOM   1138 N  N     . GLU C 3 81  ? 40.755  -14.656 23.922  1.00 50.28  ? 81   GLU A N     1 
ATOM   1139 C  CA    . GLU C 3 81  ? 41.998  -15.324 24.285  1.00 44.24  ? 81   GLU A CA    1 
ATOM   1140 C  C     . GLU C 3 81  ? 42.468  -15.076 25.726  1.00 42.68  ? 81   GLU A C     1 
ATOM   1141 O  O     . GLU C 3 81  ? 42.356  -13.969 26.258  1.00 39.72  ? 81   GLU A O     1 
ATOM   1142 C  CB    . GLU C 3 81  ? 43.101  -14.893 23.323  1.00 41.27  ? 81   GLU A CB    1 
ATOM   1143 C  CG    . GLU C 3 81  ? 44.325  -15.791 23.369  1.00 52.58  ? 81   GLU A CG    1 
ATOM   1144 C  CD    . GLU C 3 81  ? 45.429  -15.330 22.433  1.00 58.83  ? 81   GLU A CD    1 
ATOM   1145 O  OE1   . GLU C 3 81  ? 45.103  -14.790 21.347  1.00 59.06  ? 81   GLU A OE1   1 
ATOM   1146 O  OE2   . GLU C 3 81  ? 46.619  -15.522 22.778  1.00 59.74  ? 81   GLU A OE2   1 
ATOM   1147 N  N     . ALA C 3 82  ? 42.997  -16.120 26.355  1.00 41.36  ? 82   ALA A N     1 
ATOM   1148 C  CA    . ALA C 3 82  ? 43.513  -16.007 27.709  1.00 39.77  ? 82   ALA A CA    1 
ATOM   1149 C  C     . ALA C 3 82  ? 45.010  -16.234 27.660  1.00 42.36  ? 82   ALA A C     1 
ATOM   1150 O  O     . ALA C 3 82  ? 45.494  -17.352 27.836  1.00 46.35  ? 82   ALA A O     1 
ATOM   1151 C  CB    . ALA C 3 82  ? 42.868  -17.020 28.609  1.00 33.61  ? 82   ALA A CB    1 
ATOM   1152 N  N     . LEU C 3 83  ? 45.743  -15.161 27.402  1.00 41.34  ? 83   LEU A N     1 
ATOM   1153 C  CA    . LEU C 3 83  ? 47.186  -15.242 27.321  1.00 40.16  ? 83   LEU A CA    1 
ATOM   1154 C  C     . LEU C 3 83  ? 47.815  -15.478 28.683  1.00 40.05  ? 83   LEU A C     1 
ATOM   1155 O  O     . LEU C 3 83  ? 47.201  -15.215 29.718  1.00 40.19  ? 83   LEU A O     1 
ATOM   1156 C  CB    . LEU C 3 83  ? 47.744  -13.969 26.687  1.00 38.15  ? 83   LEU A CB    1 
ATOM   1157 C  CG    . LEU C 3 83  ? 47.244  -13.747 25.254  1.00 38.69  ? 83   LEU A CG    1 
ATOM   1158 C  CD1   . LEU C 3 83  ? 45.831  -13.206 25.315  1.00 41.33  ? 83   LEU A CD1   1 
ATOM   1159 C  CD2   . LEU C 3 83  ? 48.139  -12.784 24.499  1.00 44.90  ? 83   LEU A CD2   1 
ATOM   1160 N  N     . GLY C 3 84  ? 49.035  -16.008 28.672  1.00 35.31  ? 84   GLY A N     1 
ATOM   1161 C  CA    . GLY C 3 84  ? 49.736  -16.261 29.910  1.00 30.66  ? 84   GLY A CA    1 
ATOM   1162 C  C     . GLY C 3 84  ? 49.983  -17.712 30.240  1.00 33.58  ? 84   GLY A C     1 
ATOM   1163 O  O     . GLY C 3 84  ? 49.291  -18.609 29.751  1.00 36.87  ? 84   GLY A O     1 
ATOM   1164 N  N     . MET C 3 85  ? 50.978  -17.929 31.094  1.00 32.03  ? 85   MET A N     1 
ATOM   1165 C  CA    . MET C 3 85  ? 51.373  -19.253 31.543  1.00 32.05  ? 85   MET A CA    1 
ATOM   1166 C  C     . MET C 3 85  ? 50.286  -19.848 32.425  1.00 34.56  ? 85   MET A C     1 
ATOM   1167 O  O     . MET C 3 85  ? 50.075  -19.392 33.541  1.00 34.01  ? 85   MET A O     1 
ATOM   1168 C  CB    . MET C 3 85  ? 52.701  -19.152 32.309  1.00 32.78  ? 85   MET A CB    1 
ATOM   1169 C  CG    . MET C 3 85  ? 53.161  -20.454 32.975  1.00 37.28  ? 85   MET A CG    1 
ATOM   1170 S  SD    . MET C 3 85  ? 53.089  -21.887 31.871  1.00 36.92  ? 85   MET A SD    1 
ATOM   1171 C  CE    . MET C 3 85  ? 54.551  -21.535 30.744  1.00 36.58  ? 85   MET A CE    1 
ATOM   1172 N  N     . ASP C 3 86  ? 49.610  -20.877 31.913  1.00 41.48  ? 86   ASP A N     1 
ATOM   1173 C  CA    . ASP C 3 86  ? 48.520  -21.558 32.626  1.00 45.25  ? 86   ASP A CA    1 
ATOM   1174 C  C     . ASP C 3 86  ? 48.973  -22.636 33.599  1.00 45.91  ? 86   ASP A C     1 
ATOM   1175 O  O     . ASP C 3 86  ? 48.201  -23.073 34.444  1.00 46.55  ? 86   ASP A O     1 
ATOM   1176 C  CB    . ASP C 3 86  ? 47.553  -22.164 31.623  1.00 49.09  ? 86   ASP A CB    1 
ATOM   1177 C  CG    . ASP C 3 86  ? 48.262  -22.698 30.391  1.00 57.70  ? 86   ASP A CG    1 
ATOM   1178 O  OD1   . ASP C 3 86  ? 49.235  -23.462 30.545  1.00 58.87  ? 86   ASP A OD1   1 
ATOM   1179 O  OD2   . ASP C 3 86  ? 47.843  -22.351 29.266  1.00 66.57  ? 86   ASP A OD2   1 
ATOM   1180 N  N     . ASP C 3 87  ? 50.210  -23.095 33.462  1.00 48.33  ? 87   ASP A N     1 
ATOM   1181 C  CA    . ASP C 3 87  ? 50.746  -24.081 34.396  1.00 48.24  ? 87   ASP A CA    1 
ATOM   1182 C  C     . ASP C 3 87  ? 51.377  -23.203 35.486  1.00 50.17  ? 87   ASP A C     1 
ATOM   1183 O  O     . ASP C 3 87  ? 52.490  -22.704 35.333  1.00 53.95  ? 87   ASP A O     1 
ATOM   1184 C  CB    . ASP C 3 87  ? 51.808  -24.947 33.723  1.00 46.20  ? 87   ASP A CB    1 
ATOM   1185 C  CG    . ASP C 3 87  ? 52.198  -26.131 34.567  1.00 45.24  ? 87   ASP A CG    1 
ATOM   1186 O  OD1   . ASP C 3 87  ? 52.055  -26.041 35.801  1.00 54.32  ? 87   ASP A OD1   1 
ATOM   1187 O  OD2   . ASP C 3 87  ? 52.659  -27.146 34.011  1.00 52.25  ? 87   ASP A OD2   1 
ATOM   1188 N  N     . PHE C 3 88  ? 50.645  -23.012 36.578  1.00 48.89  ? 88   PHE A N     1 
ATOM   1189 C  CA    . PHE C 3 88  ? 51.081  -22.142 37.661  1.00 46.04  ? 88   PHE A CA    1 
ATOM   1190 C  C     . PHE C 3 88  ? 52.312  -22.561 38.443  1.00 44.94  ? 88   PHE A C     1 
ATOM   1191 O  O     . PHE C 3 88  ? 52.863  -21.760 39.178  1.00 52.71  ? 88   PHE A O     1 
ATOM   1192 C  CB    . PHE C 3 88  ? 49.901  -21.886 38.605  1.00 43.48  ? 88   PHE A CB    1 
ATOM   1193 C  CG    . PHE C 3 88  ? 48.640  -21.444 37.889  1.00 41.16  ? 88   PHE A CG    1 
ATOM   1194 C  CD1   . PHE C 3 88  ? 48.688  -20.482 36.873  1.00 38.50  ? 88   PHE A CD1   1 
ATOM   1195 C  CD2   . PHE C 3 88  ? 47.409  -21.981 38.231  1.00 42.28  ? 88   PHE A CD2   1 
ATOM   1196 C  CE1   . PHE C 3 88  ? 47.529  -20.065 36.211  1.00 31.07  ? 88   PHE A CE1   1 
ATOM   1197 C  CE2   . PHE C 3 88  ? 46.239  -21.570 37.574  1.00 40.46  ? 88   PHE A CE2   1 
ATOM   1198 C  CZ    . PHE C 3 88  ? 46.305  -20.608 36.561  1.00 36.13  ? 88   PHE A CZ    1 
ATOM   1199 N  N     . LYS C 3 89  ? 52.756  -23.800 38.294  1.00 46.69  ? 89   LYS A N     1 
ATOM   1200 C  CA    . LYS C 3 89  ? 53.965  -24.240 38.996  1.00 45.76  ? 89   LYS A CA    1 
ATOM   1201 C  C     . LYS C 3 89  ? 55.192  -23.579 38.373  1.00 45.67  ? 89   LYS A C     1 
ATOM   1202 O  O     . LYS C 3 89  ? 56.132  -23.214 39.081  1.00 40.86  ? 89   LYS A O     1 
ATOM   1203 C  CB    . LYS C 3 89  ? 54.171  -25.750 38.870  1.00 45.32  ? 89   LYS A CB    1 
ATOM   1204 C  CG    . LYS C 3 89  ? 53.323  -26.598 39.767  1.00 56.73  ? 89   LYS A CG    1 
ATOM   1205 C  CD    . LYS C 3 89  ? 53.594  -28.085 39.539  1.00 48.75  ? 89   LYS A CD    1 
ATOM   1206 C  CE    . LYS C 3 89  ? 52.969  -28.603 38.253  1.00 41.11  ? 89   LYS A CE    1 
ATOM   1207 N  NZ    . LYS C 3 89  ? 53.613  -28.024 37.056  1.00 48.21  ? 89   LYS A NZ    1 
ATOM   1208 N  N     . LEU C 3 90  ? 55.179  -23.465 37.043  1.00 38.61  ? 90   LEU A N     1 
ATOM   1209 C  CA    . LEU C 3 90  ? 56.288  -22.900 36.291  1.00 34.88  ? 90   LEU A CA    1 
ATOM   1210 C  C     . LEU C 3 90  ? 56.347  -21.394 36.452  1.00 42.93  ? 90   LEU A C     1 
ATOM   1211 O  O     . LEU C 3 90  ? 57.417  -20.795 36.346  1.00 47.81  ? 90   LEU A O     1 
ATOM   1212 C  CB    . LEU C 3 90  ? 56.155  -23.260 34.802  1.00 27.91  ? 90   LEU A CB    1 
ATOM   1213 C  CG    . LEU C 3 90  ? 55.957  -24.731 34.419  1.00 31.31  ? 90   LEU A CG    1 
ATOM   1214 C  CD1   . LEU C 3 90  ? 56.143  -24.902 32.912  1.00 22.83  ? 90   LEU A CD1   1 
ATOM   1215 C  CD2   . LEU C 3 90  ? 56.936  -25.611 35.191  1.00 24.89  ? 90   LEU A CD2   1 
ATOM   1216 N  N     . ALA C 3 91  ? 55.199  -20.775 36.706  1.00 40.33  ? 91   ALA A N     1 
ATOM   1217 C  CA    . ALA C 3 91  ? 55.164  -19.328 36.861  1.00 37.30  ? 91   ALA A CA    1 
ATOM   1218 C  C     . ALA C 3 91  ? 55.699  -19.003 38.243  1.00 37.78  ? 91   ALA A C     1 
ATOM   1219 O  O     . ALA C 3 91  ? 56.383  -18.009 38.457  1.00 35.18  ? 91   ALA A O     1 
ATOM   1220 C  CB    . ALA C 3 91  ? 53.740  -18.810 36.698  1.00 32.43  ? 91   ALA A CB    1 
ATOM   1221 N  N     . TYR C 3 92  ? 55.394  -19.867 39.190  1.00 37.30  ? 92   TYR A N     1 
ATOM   1222 C  CA    . TYR C 3 92  ? 55.868  -19.640 40.521  1.00 38.79  ? 92   TYR A CA    1 
ATOM   1223 C  C     . TYR C 3 92  ? 57.375  -19.864 40.590  1.00 41.74  ? 92   TYR A C     1 
ATOM   1224 O  O     . TYR C 3 92  ? 58.047  -19.211 41.377  1.00 47.62  ? 92   TYR A O     1 
ATOM   1225 C  CB    . TYR C 3 92  ? 55.120  -20.537 41.493  1.00 30.44  ? 92   TYR A CB    1 
ATOM   1226 C  CG    . TYR C 3 92  ? 55.802  -20.664 42.820  1.00 35.00  ? 92   TYR A CG    1 
ATOM   1227 C  CD1   . TYR C 3 92  ? 56.781  -21.626 43.023  1.00 33.85  ? 92   TYR A CD1   1 
ATOM   1228 C  CD2   . TYR C 3 92  ? 55.470  -19.831 43.880  1.00 32.82  ? 92   TYR A CD2   1 
ATOM   1229 C  CE1   . TYR C 3 92  ? 57.409  -21.762 44.248  1.00 35.28  ? 92   TYR A CE1   1 
ATOM   1230 C  CE2   . TYR C 3 92  ? 56.095  -19.963 45.110  1.00 32.67  ? 92   TYR A CE2   1 
ATOM   1231 C  CZ    . TYR C 3 92  ? 57.062  -20.930 45.285  1.00 30.58  ? 92   TYR A CZ    1 
ATOM   1232 O  OH    . TYR C 3 92  ? 57.675  -21.073 46.501  1.00 35.54  ? 92   TYR A OH    1 
ATOM   1233 N  N     . LEU C 3 93  ? 57.916  -20.771 39.776  1.00 39.98  ? 93   LEU A N     1 
ATOM   1234 C  CA    . LEU C 3 93  ? 59.368  -21.023 39.794  1.00 38.16  ? 93   LEU A CA    1 
ATOM   1235 C  C     . LEU C 3 93  ? 60.102  -19.867 39.125  1.00 38.02  ? 93   LEU A C     1 
ATOM   1236 O  O     . LEU C 3 93  ? 61.206  -19.471 39.525  1.00 34.40  ? 93   LEU A O     1 
ATOM   1237 C  CB    . LEU C 3 93  ? 59.720  -22.336 39.072  1.00 25.73  ? 93   LEU A CB    1 
ATOM   1238 C  CG    . LEU C 3 93  ? 59.510  -23.642 39.855  1.00 31.76  ? 93   LEU A CG    1 
ATOM   1239 C  CD1   . LEU C 3 93  ? 59.871  -24.830 38.981  1.00 21.46  ? 93   LEU A CD1   1 
ATOM   1240 C  CD2   . LEU C 3 93  ? 60.319  -23.629 41.155  1.00 24.08  ? 93   LEU A CD2   1 
ATOM   1241 N  N     . SER C 3 94  ? 59.471  -19.334 38.093  1.00 35.25  ? 94   SER A N     1 
ATOM   1242 C  CA    . SER C 3 94  ? 60.020  -18.226 37.345  1.00 35.33  ? 94   SER A CA    1 
ATOM   1243 C  C     . SER C 3 94  ? 60.060  -16.962 38.223  1.00 36.21  ? 94   SER A C     1 
ATOM   1244 O  O     . SER C 3 94  ? 60.914  -16.092 38.064  1.00 36.28  ? 94   SER A O     1 
ATOM   1245 C  CB    . SER C 3 94  ? 59.146  -18.030 36.111  1.00 26.00  ? 94   SER A CB    1 
ATOM   1246 O  OG    . SER C 3 94  ? 59.524  -16.904 35.361  1.00 36.53  ? 94   SER A OG    1 
ATOM   1247 N  N     . ASP C 3 95  ? 59.152  -16.882 39.181  1.00 40.00  ? 95   ASP A N     1 
ATOM   1248 C  CA    . ASP C 3 95  ? 59.085  -15.706 40.045  1.00 43.94  ? 95   ASP A CA    1 
ATOM   1249 C  C     . ASP C 3 95  ? 60.001  -15.810 41.258  1.00 37.03  ? 95   ASP A C     1 
ATOM   1250 O  O     . ASP C 3 95  ? 60.590  -14.823 41.682  1.00 40.91  ? 95   ASP A O     1 
ATOM   1251 C  CB    . ASP C 3 95  ? 57.636  -15.470 40.535  1.00 46.79  ? 95   ASP A CB    1 
ATOM   1252 C  CG    . ASP C 3 95  ? 56.674  -14.973 39.426  1.00 50.56  ? 95   ASP A CG    1 
ATOM   1253 O  OD1   . ASP C 3 95  ? 57.110  -14.590 38.312  1.00 47.43  ? 95   ASP A OD1   1 
ATOM   1254 O  OD2   . ASP C 3 95  ? 55.450  -14.952 39.698  1.00 51.60  ? 95   ASP A OD2   1 
ATOM   1255 N  N     . THR C 3 96  ? 60.106  -17.015 41.800  1.00 34.05  ? 96   THR A N     1 
ATOM   1256 C  CA    . THR C 3 96  ? 60.908  -17.280 42.982  1.00 35.11  ? 96   THR A CA    1 
ATOM   1257 C  C     . THR C 3 96  ? 62.402  -17.455 42.739  1.00 35.43  ? 96   THR A C     1 
ATOM   1258 O  O     . THR C 3 96  ? 63.201  -17.265 43.649  1.00 40.35  ? 96   THR A O     1 
ATOM   1259 C  CB    . THR C 3 96  ? 60.383  -18.520 43.694  1.00 32.19  ? 96   THR A CB    1 
ATOM   1260 O  OG1   . THR C 3 96  ? 58.976  -18.372 43.904  1.00 44.19  ? 96   THR A OG1   1 
ATOM   1261 C  CG2   . THR C 3 96  ? 61.073  -18.711 45.032  1.00 30.61  ? 96   THR A CG2   1 
ATOM   1262 N  N     . TYR C 3 97  ? 62.777  -17.846 41.531  1.00 35.63  ? 97   TYR A N     1 
ATOM   1263 C  CA    . TYR C 3 97  ? 64.180  -18.033 41.201  1.00 37.49  ? 97   TYR A CA    1 
ATOM   1264 C  C     . TYR C 3 97  ? 64.438  -17.269 39.926  1.00 43.66  ? 97   TYR A C     1 
ATOM   1265 O  O     . TYR C 3 97  ? 64.639  -17.862 38.877  1.00 42.82  ? 97   TYR A O     1 
ATOM   1266 C  CB    . TYR C 3 97  ? 64.504  -19.515 40.990  1.00 34.90  ? 97   TYR A CB    1 
ATOM   1267 C  CG    . TYR C 3 97  ? 64.242  -20.368 42.211  1.00 44.51  ? 97   TYR A CG    1 
ATOM   1268 C  CD1   . TYR C 3 97  ? 65.190  -20.462 43.232  1.00 45.96  ? 97   TYR A CD1   1 
ATOM   1269 C  CD2   . TYR C 3 97  ? 63.010  -21.003 42.403  1.00 42.84  ? 97   TYR A CD2   1 
ATOM   1270 C  CE1   . TYR C 3 97  ? 64.912  -21.159 44.424  1.00 43.01  ? 97   TYR A CE1   1 
ATOM   1271 C  CE2   . TYR C 3 97  ? 62.727  -21.702 43.595  1.00 41.32  ? 97   TYR A CE2   1 
ATOM   1272 C  CZ    . TYR C 3 97  ? 63.682  -21.767 44.598  1.00 38.78  ? 97   TYR A CZ    1 
ATOM   1273 O  OH    . TYR C 3 97  ? 63.409  -22.387 45.790  1.00 39.68  ? 97   TYR A OH    1 
ATOM   1274 N  N     . ASN C 3 98  ? 64.411  -15.945 40.016  1.00 50.76  ? 98   ASN A N     1 
ATOM   1275 C  CA    . ASN C 3 98  ? 64.655  -15.104 38.855  1.00 54.07  ? 98   ASN A CA    1 
ATOM   1276 C  C     . ASN C 3 98  ? 66.151  -14.843 38.717  1.00 53.74  ? 98   ASN A C     1 
ATOM   1277 O  O     . ASN C 3 98  ? 66.639  -13.751 38.989  1.00 51.00  ? 98   ASN A O     1 
ATOM   1278 C  CB    . ASN C 3 98  ? 63.872  -13.795 38.982  1.00 57.82  ? 98   ASN A CB    1 
ATOM   1279 C  CG    . ASN C 3 98  ? 64.067  -13.123 40.334  1.00 70.92  ? 98   ASN A CG    1 
ATOM   1280 O  OD1   . ASN C 3 98  ? 64.250  -13.790 41.366  1.00 66.93  ? 98   ASN A OD1   1 
ATOM   1281 N  ND2   . ASN C 3 98  ? 64.006  -11.793 40.341  1.00 74.37  ? 98   ASN A ND2   1 
ATOM   1282 N  N     . TYR C 3 99  ? 66.862  -15.884 38.297  1.00 53.17  ? 99   TYR A N     1 
ATOM   1283 C  CA    . TYR C 3 99  ? 68.303  -15.849 38.105  1.00 51.53  ? 99   TYR A CA    1 
ATOM   1284 C  C     . TYR C 3 99  ? 68.775  -17.231 37.714  1.00 50.81  ? 99   TYR A C     1 
ATOM   1285 O  O     . TYR C 3 99  ? 68.102  -18.205 38.029  1.00 52.79  ? 99   TYR A O     1 
ATOM   1286 C  CB    . TYR C 3 99  ? 69.008  -15.462 39.397  1.00 43.56  ? 99   TYR A CB    1 
ATOM   1287 C  CG    . TYR C 3 99  ? 68.610  -16.280 40.608  1.00 40.00  ? 99   TYR A CG    1 
ATOM   1288 C  CD1   . TYR C 3 99  ? 69.266  -17.469 40.918  1.00 39.91  ? 99   TYR A CD1   1 
ATOM   1289 C  CD2   . TYR C 3 99  ? 67.631  -15.820 41.491  1.00 40.94  ? 99   TYR A CD2   1 
ATOM   1290 C  CE1   . TYR C 3 99  ? 68.971  -18.177 42.084  1.00 35.68  ? 99   TYR A CE1   1 
ATOM   1291 C  CE2   . TYR C 3 99  ? 67.327  -16.513 42.669  1.00 35.81  ? 99   TYR A CE2   1 
ATOM   1292 C  CZ    . TYR C 3 99  ? 68.005  -17.692 42.961  1.00 41.44  ? 99   TYR A CZ    1 
ATOM   1293 O  OH    . TYR C 3 99  ? 67.745  -18.375 44.135  1.00 36.13  ? 99   TYR A OH    1 
ATOM   1294 N  N     . GLU C 3 100 ? 69.924  -17.322 37.043  1.00 48.67  ? 100  GLU A N     1 
ATOM   1295 C  CA    . GLU C 3 100 ? 70.457  -18.626 36.663  1.00 52.41  ? 100  GLU A CA    1 
ATOM   1296 C  C     . GLU C 3 100 ? 70.583  -19.453 37.925  1.00 51.97  ? 100  GLU A C     1 
ATOM   1297 O  O     . GLU C 3 100 ? 71.143  -19.001 38.926  1.00 52.36  ? 100  GLU A O     1 
ATOM   1298 C  CB    . GLU C 3 100 ? 71.834  -18.518 36.026  1.00 51.96  ? 100  GLU A CB    1 
ATOM   1299 C  CG    . GLU C 3 100 ? 71.843  -17.967 34.633  1.00 61.41  ? 100  GLU A CG    1 
ATOM   1300 C  CD    . GLU C 3 100 ? 73.209  -18.095 33.996  1.00 67.59  ? 100  GLU A CD    1 
ATOM   1301 O  OE1   . GLU C 3 100 ? 74.214  -17.780 34.674  1.00 62.54  ? 100  GLU A OE1   1 
ATOM   1302 O  OE2   . GLU C 3 100 ? 73.276  -18.505 32.818  1.00 73.46  ? 100  GLU A OE2   1 
ATOM   1303 N  N     . ILE C 3 101 ? 70.068  -20.671 37.881  1.00 50.58  ? 101  ILE A N     1 
ATOM   1304 C  CA    . ILE C 3 101 ? 70.143  -21.496 39.058  1.00 52.26  ? 101  ILE A CA    1 
ATOM   1305 C  C     . ILE C 3 101 ? 71.465  -22.214 39.094  1.00 53.18  ? 101  ILE A C     1 
ATOM   1306 O  O     . ILE C 3 101 ? 71.910  -22.784 38.098  1.00 56.51  ? 101  ILE A O     1 
ATOM   1307 C  CB    . ILE C 3 101 ? 68.973  -22.511 39.120  1.00 52.74  ? 101  ILE A CB    1 
ATOM   1308 C  CG1   . ILE C 3 101 ? 67.649  -21.740 39.136  1.00 50.32  ? 101  ILE A CG1   1 
ATOM   1309 C  CG2   . ILE C 3 101 ? 69.086  -23.388 40.379  1.00 43.09  ? 101  ILE A CG2   1 
ATOM   1310 C  CD1   . ILE C 3 101 ? 66.430  -22.598 39.307  1.00 59.34  ? 101  ILE A CD1   1 
ATOM   1311 N  N     . LYS C 3 102 ? 72.109  -22.137 40.248  1.00 50.39  ? 102  LYS A N     1 
ATOM   1312 C  CA    . LYS C 3 102 ? 73.372  -22.796 40.464  1.00 49.20  ? 102  LYS A CA    1 
ATOM   1313 C  C     . LYS C 3 102 ? 73.050  -23.796 41.550  1.00 49.22  ? 102  LYS A C     1 
ATOM   1314 O  O     . LYS C 3 102 ? 72.799  -23.409 42.686  1.00 51.20  ? 102  LYS A O     1 
ATOM   1315 C  CB    . LYS C 3 102 ? 74.420  -21.789 40.947  1.00 54.18  ? 102  LYS A CB    1 
ATOM   1316 C  CG    . LYS C 3 102 ? 75.615  -22.439 41.615  1.00 66.55  ? 102  LYS A CG    1 
ATOM   1317 C  CD    . LYS C 3 102 ? 76.906  -21.666 41.391  1.00 73.13  ? 102  LYS A CD    1 
ATOM   1318 C  CE    . LYS C 3 102 ? 78.102  -22.469 41.901  1.00 77.63  ? 102  LYS A CE    1 
ATOM   1319 N  NZ    . LYS C 3 102 ? 79.408  -21.925 41.425  1.00 79.36  ? 102  LYS A NZ    1 
ATOM   1320 N  N     . TYR C 3 103 ? 73.031  -25.080 41.214  1.00 46.72  ? 103  TYR A N     1 
ATOM   1321 C  CA    . TYR C 3 103 ? 72.710  -26.078 42.227  1.00 45.63  ? 103  TYR A CA    1 
ATOM   1322 C  C     . TYR C 3 103 ? 73.914  -26.862 42.700  1.00 45.04  ? 103  TYR A C     1 
ATOM   1323 O  O     . TYR C 3 103 ? 74.972  -26.820 42.089  1.00 50.25  ? 103  TYR A O     1 
ATOM   1324 C  CB    . TYR C 3 103 ? 71.655  -27.052 41.706  1.00 46.23  ? 103  TYR A CB    1 
ATOM   1325 C  CG    . TYR C 3 103 ? 72.133  -27.924 40.578  1.00 41.82  ? 103  TYR A CG    1 
ATOM   1326 C  CD1   . TYR C 3 103 ? 72.238  -27.435 39.278  1.00 46.92  ? 103  TYR A CD1   1 
ATOM   1327 C  CD2   . TYR C 3 103 ? 72.497  -29.242 40.812  1.00 44.85  ? 103  TYR A CD2   1 
ATOM   1328 C  CE1   . TYR C 3 103 ? 72.696  -28.249 38.232  1.00 39.14  ? 103  TYR A CE1   1 
ATOM   1329 C  CE2   . TYR C 3 103 ? 72.955  -30.057 39.783  1.00 42.72  ? 103  TYR A CE2   1 
ATOM   1330 C  CZ    . TYR C 3 103 ? 73.051  -29.559 38.501  1.00 41.70  ? 103  TYR A CZ    1 
ATOM   1331 O  OH    . TYR C 3 103 ? 73.505  -30.399 37.505  1.00 57.75  ? 103  TYR A OH    1 
ATOM   1332 N  N     . ASP C 3 104 ? 73.739  -27.585 43.797  1.00 48.59  ? 104  ASP A N     1 
ATOM   1333 C  CA    . ASP C 3 104 ? 74.804  -28.393 44.381  1.00 46.81  ? 104  ASP A CA    1 
ATOM   1334 C  C     . ASP C 3 104 ? 74.265  -29.801 44.637  1.00 48.50  ? 104  ASP A C     1 
ATOM   1335 O  O     . ASP C 3 104 ? 73.775  -30.112 45.728  1.00 39.94  ? 104  ASP A O     1 
ATOM   1336 C  CB    . ASP C 3 104 ? 75.276  -27.757 45.691  1.00 50.43  ? 104  ASP A CB    1 
ATOM   1337 C  CG    . ASP C 3 104 ? 76.371  -28.560 46.368  1.00 53.32  ? 104  ASP A CG    1 
ATOM   1338 O  OD1   . ASP C 3 104 ? 76.824  -29.561 45.764  1.00 49.69  ? 104  ASP A OD1   1 
ATOM   1339 O  OD2   . ASP C 3 104 ? 76.783  -28.198 47.499  1.00 54.89  ? 104  ASP A OD2   1 
ATOM   1340 N  N     . HIS C 3 105 ? 74.364  -30.646 43.615  1.00 51.86  ? 105  HIS A N     1 
ATOM   1341 C  CA    . HIS C 3 105 ? 73.881  -32.019 43.688  1.00 57.45  ? 105  HIS A CA    1 
ATOM   1342 C  C     . HIS C 3 105 ? 74.259  -32.745 44.991  1.00 56.78  ? 105  HIS A C     1 
ATOM   1343 O  O     . HIS C 3 105 ? 73.577  -33.679 45.399  1.00 59.96  ? 105  HIS A O     1 
ATOM   1344 C  CB    . HIS C 3 105 ? 74.408  -32.815 42.492  1.00 64.39  ? 105  HIS A CB    1 
ATOM   1345 C  CG    . HIS C 3 105 ? 75.807  -33.302 42.673  1.00 72.90  ? 105  HIS A CG    1 
ATOM   1346 N  ND1   . HIS C 3 105 ? 76.872  -32.448 42.865  1.00 75.13  ? 105  HIS A ND1   1 
ATOM   1347 C  CD2   . HIS C 3 105 ? 76.307  -34.555 42.772  1.00 74.71  ? 105  HIS A CD2   1 
ATOM   1348 C  CE1   . HIS C 3 105 ? 77.966  -33.156 43.080  1.00 77.01  ? 105  HIS A CE1   1 
ATOM   1349 N  NE2   . HIS C 3 105 ? 77.649  -34.438 43.030  1.00 76.28  ? 105  HIS A NE2   1 
ATOM   1350 N  N     . THR C 3 106 ? 75.333  -32.324 45.648  1.00 51.10  ? 106  THR A N     1 
ATOM   1351 C  CA    . THR C 3 106 ? 75.732  -32.977 46.884  1.00 50.54  ? 106  THR A CA    1 
ATOM   1352 C  C     . THR C 3 106 ? 74.741  -32.752 48.033  1.00 52.00  ? 106  THR A C     1 
ATOM   1353 O  O     . THR C 3 106 ? 74.880  -33.336 49.114  1.00 54.15  ? 106  THR A O     1 
ATOM   1354 C  CB    . THR C 3 106 ? 77.119  -32.504 47.363  1.00 52.61  ? 106  THR A CB    1 
ATOM   1355 O  OG1   . THR C 3 106 ? 77.621  -33.442 48.319  1.00 61.25  ? 106  THR A OG1   1 
ATOM   1356 C  CG2   . THR C 3 106 ? 77.032  -31.162 48.054  1.00 46.02  ? 106  THR A CG2   1 
ATOM   1357 N  N     . LYS C 3 107 ? 73.744  -31.907 47.812  1.00 47.59  ? 107  LYS A N     1 
ATOM   1358 C  CA    . LYS C 3 107 ? 72.778  -31.647 48.866  1.00 45.08  ? 107  LYS A CA    1 
ATOM   1359 C  C     . LYS C 3 107 ? 71.410  -32.214 48.492  1.00 41.70  ? 107  LYS A C     1 
ATOM   1360 O  O     . LYS C 3 107 ? 70.464  -32.146 49.274  1.00 40.01  ? 107  LYS A O     1 
ATOM   1361 C  CB    . LYS C 3 107 ? 72.692  -30.139 49.136  1.00 44.30  ? 107  LYS A CB    1 
ATOM   1362 C  CG    . LYS C 3 107 ? 74.038  -29.417 49.012  1.00 39.33  ? 107  LYS A CG    1 
ATOM   1363 C  CD    . LYS C 3 107 ? 74.362  -28.532 50.201  1.00 43.44  ? 107  LYS A CD    1 
ATOM   1364 C  CE    . LYS C 3 107 ? 74.724  -29.350 51.436  1.00 51.34  ? 107  LYS A CE    1 
ATOM   1365 N  NZ    . LYS C 3 107 ? 75.044  -28.497 52.634  1.00 50.23  ? 107  LYS A NZ    1 
ATOM   1366 N  N     . ILE C 3 108 ? 71.340  -32.796 47.293  1.00 41.56  ? 108  ILE A N     1 
ATOM   1367 C  CA    . ILE C 3 108 ? 70.126  -33.395 46.732  1.00 37.66  ? 108  ILE A CA    1 
ATOM   1368 C  C     . ILE C 3 108 ? 70.047  -34.896 47.051  1.00 38.33  ? 108  ILE A C     1 
ATOM   1369 O  O     . ILE C 3 108 ? 70.914  -35.663 46.660  1.00 38.04  ? 108  ILE A O     1 
ATOM   1370 C  CB    . ILE C 3 108 ? 70.090  -33.199 45.185  1.00 34.80  ? 108  ILE A CB    1 
ATOM   1371 C  CG1   . ILE C 3 108 ? 70.047  -31.700 44.843  1.00 29.24  ? 108  ILE A CG1   1 
ATOM   1372 C  CG2   . ILE C 3 108 ? 68.887  -33.923 44.592  1.00 33.80  ? 108  ILE A CG2   1 
ATOM   1373 C  CD1   . ILE C 3 108 ? 69.969  -31.380 43.345  1.00 25.11  ? 108  ILE A CD1   1 
ATOM   1374 N  N     . ARG C 3 109 ? 69.005  -35.322 47.752  1.00 37.23  ? 109  ARG A N     1 
ATOM   1375 C  CA    . ARG C 3 109 ? 68.907  -36.733 48.090  1.00 40.96  ? 109  ARG A CA    1 
ATOM   1376 C  C     . ARG C 3 109 ? 68.385  -37.638 46.960  1.00 41.81  ? 109  ARG A C     1 
ATOM   1377 O  O     . ARG C 3 109 ? 67.216  -37.583 46.569  1.00 43.56  ? 109  ARG A O     1 
ATOM   1378 C  CB    . ARG C 3 109 ? 68.060  -36.914 49.357  1.00 38.03  ? 109  ARG A CB    1 
ATOM   1379 C  CG    . ARG C 3 109 ? 68.198  -38.302 49.977  1.00 44.79  ? 109  ARG A CG    1 
ATOM   1380 C  CD    . ARG C 3 109 ? 67.302  -38.458 51.185  1.00 48.35  ? 109  ARG A CD    1 
ATOM   1381 N  NE    . ARG C 3 109 ? 67.561  -37.401 52.157  1.00 53.83  ? 109  ARG A NE    1 
ATOM   1382 C  CZ    . ARG C 3 109 ? 68.331  -37.534 53.232  1.00 54.02  ? 109  ARG A CZ    1 
ATOM   1383 N  NH1   . ARG C 3 109 ? 68.927  -38.691 53.501  1.00 50.86  ? 109  ARG A NH1   1 
ATOM   1384 N  NH2   . ARG C 3 109 ? 68.530  -36.491 54.024  1.00 58.47  ? 109  ARG A NH2   1 
ATOM   1385 N  N     . VAL C 3 110 ? 69.272  -38.464 46.424  1.00 40.48  ? 110  VAL A N     1 
ATOM   1386 C  CA    . VAL C 3 110 ? 68.895  -39.376 45.352  1.00 41.46  ? 110  VAL A CA    1 
ATOM   1387 C  C     . VAL C 3 110 ? 68.827  -40.788 45.911  1.00 41.35  ? 110  VAL A C     1 
ATOM   1388 O  O     . VAL C 3 110 ? 69.825  -41.304 46.423  1.00 39.83  ? 110  VAL A O     1 
ATOM   1389 C  CB    . VAL C 3 110 ? 69.926  -39.364 44.172  1.00 39.30  ? 110  VAL A CB    1 
ATOM   1390 C  CG1   . VAL C 3 110 ? 69.490  -40.366 43.085  1.00 27.40  ? 110  VAL A CG1   1 
ATOM   1391 C  CG2   . VAL C 3 110 ? 70.041  -37.959 43.585  1.00 36.05  ? 110  VAL A CG2   1 
ATOM   1392 N  N     . ALA C 3 111 ? 67.646  -41.395 45.823  1.00 40.78  ? 111  ALA A N     1 
ATOM   1393 C  CA    . ALA C 3 111 ? 67.440  -42.757 46.312  1.00 45.04  ? 111  ALA A CA    1 
ATOM   1394 C  C     . ALA C 3 111 ? 67.380  -43.783 45.181  1.00 46.51  ? 111  ALA A C     1 
ATOM   1395 O  O     . ALA C 3 111 ? 66.831  -43.535 44.101  1.00 47.47  ? 111  ALA A O     1 
ATOM   1396 C  CB    . ALA C 3 111 ? 66.158  -42.842 47.150  1.00 48.13  ? 111  ALA A CB    1 
ATOM   1397 N  N     . ASN C 3 112 ? 67.950  -44.945 45.455  1.00 44.99  ? 112  ASN A N     1 
ATOM   1398 C  CA    . ASN C 3 112 ? 68.000  -46.037 44.499  1.00 44.38  ? 112  ASN A CA    1 
ATOM   1399 C  C     . ASN C 3 112 ? 67.549  -47.313 45.217  1.00 42.57  ? 112  ASN A C     1 
ATOM   1400 O  O     . ASN C 3 112 ? 68.189  -47.738 46.172  1.00 46.25  ? 112  ASN A O     1 
ATOM   1401 C  CB    . ASN C 3 112 ? 69.446  -46.159 44.006  1.00 45.47  ? 112  ASN A CB    1 
ATOM   1402 C  CG    . ASN C 3 112 ? 69.613  -47.159 42.897  1.00 51.14  ? 112  ASN A CG    1 
ATOM   1403 O  OD1   . ASN C 3 112 ? 70.635  -47.172 42.221  1.00 60.02  ? 112  ASN A OD1   1 
ATOM   1404 N  ND2   . ASN C 3 112 ? 68.619  -48.013 42.706  1.00 60.81  ? 112  ASN A ND2   1 
ATOM   1405 N  N     . PHE C 3 113 ? 66.450  -47.923 44.787  1.00 39.93  ? 113  PHE A N     1 
ATOM   1406 C  CA    . PHE C 3 113 ? 66.007  -49.132 45.475  1.00 44.83  ? 113  PHE A CA    1 
ATOM   1407 C  C     . PHE C 3 113 ? 65.444  -50.269 44.609  1.00 45.02  ? 113  PHE A C     1 
ATOM   1408 O  O     . PHE C 3 113 ? 64.993  -50.051 43.482  1.00 42.23  ? 113  PHE A O     1 
ATOM   1409 C  CB    . PHE C 3 113 ? 64.984  -48.755 46.575  1.00 46.40  ? 113  PHE A CB    1 
ATOM   1410 C  CG    . PHE C 3 113 ? 63.546  -48.621 46.087  1.00 41.00  ? 113  PHE A CG    1 
ATOM   1411 C  CD1   . PHE C 3 113 ? 63.180  -47.653 45.157  1.00 41.11  ? 113  PHE A CD1   1 
ATOM   1412 C  CD2   . PHE C 3 113 ? 62.558  -49.467 46.581  1.00 36.64  ? 113  PHE A CD2   1 
ATOM   1413 C  CE1   . PHE C 3 113 ? 61.845  -47.539 44.731  1.00 39.88  ? 113  PHE A CE1   1 
ATOM   1414 C  CE2   . PHE C 3 113 ? 61.235  -49.356 46.161  1.00 33.94  ? 113  PHE A CE2   1 
ATOM   1415 C  CZ    . PHE C 3 113 ? 60.881  -48.393 45.238  1.00 33.04  ? 113  PHE A CZ    1 
ATOM   1416 N  N     . ASP C 3 114 ? 65.514  -51.489 45.144  1.00 49.85  ? 114  ASP A N     1 
ATOM   1417 C  CA    . ASP C 3 114 ? 64.965  -52.675 44.482  1.00 56.61  ? 114  ASP A CA    1 
ATOM   1418 C  C     . ASP C 3 114 ? 64.367  -53.599 45.532  1.00 55.88  ? 114  ASP A C     1 
ATOM   1419 O  O     . ASP C 3 114 ? 64.891  -53.694 46.637  1.00 57.76  ? 114  ASP A O     1 
ATOM   1420 C  CB    . ASP C 3 114 ? 66.020  -53.459 43.688  1.00 64.19  ? 114  ASP A CB    1 
ATOM   1421 C  CG    . ASP C 3 114 ? 65.421  -54.695 42.993  1.00 76.54  ? 114  ASP A CG    1 
ATOM   1422 O  OD1   . ASP C 3 114 ? 64.252  -54.616 42.554  1.00 86.84  ? 114  ASP A OD1   1 
ATOM   1423 O  OD2   . ASP C 3 114 ? 66.107  -55.737 42.884  1.00 77.83  ? 114  ASP A OD2   1 
ATOM   1424 N  N     . ILE C 3 115 ? 63.259  -54.260 45.202  1.00 56.21  ? 115  ILE A N     1 
ATOM   1425 C  CA    . ILE C 3 115 ? 62.635  -55.190 46.136  1.00 56.87  ? 115  ILE A CA    1 
ATOM   1426 C  C     . ILE C 3 115 ? 62.591  -56.602 45.548  1.00 60.75  ? 115  ILE A C     1 
ATOM   1427 O  O     . ILE C 3 115 ? 62.770  -56.802 44.339  1.00 62.86  ? 115  ILE A O     1 
ATOM   1428 C  CB    . ILE C 3 115 ? 61.211  -54.758 46.502  1.00 50.50  ? 115  ILE A CB    1 
ATOM   1429 C  CG1   . ILE C 3 115 ? 60.253  -55.072 45.358  1.00 46.53  ? 115  ILE A CG1   1 
ATOM   1430 C  CG2   . ILE C 3 115 ? 61.196  -53.270 46.796  1.00 51.07  ? 115  ILE A CG2   1 
ATOM   1431 C  CD1   . ILE C 3 115 ? 58.849  -54.633 45.627  1.00 41.80  ? 115  ILE A CD1   1 
ATOM   1432 N  N     . GLU C 3 116 ? 62.365  -57.571 46.430  1.00 61.83  ? 116  GLU A N     1 
ATOM   1433 C  CA    . GLU C 3 116 ? 62.294  -58.982 46.081  1.00 60.31  ? 116  GLU A CA    1 
ATOM   1434 C  C     . GLU C 3 116 ? 60.989  -59.540 46.644  1.00 62.07  ? 116  GLU A C     1 
ATOM   1435 O  O     . GLU C 3 116 ? 60.662  -59.316 47.808  1.00 64.43  ? 116  GLU A O     1 
ATOM   1436 C  CB    . GLU C 3 116 ? 63.492  -59.714 46.684  1.00 56.67  ? 116  GLU A CB    1 
ATOM   1437 C  CG    . GLU C 3 116 ? 64.835  -59.166 46.223  1.00 63.73  ? 116  GLU A CG    1 
ATOM   1438 C  CD    . GLU C 3 116 ? 65.042  -59.280 44.718  1.00 71.11  ? 116  GLU A CD    1 
ATOM   1439 O  OE1   . GLU C 3 116 ? 64.204  -59.920 44.035  1.00 76.43  ? 116  GLU A OE1   1 
ATOM   1440 O  OE2   . GLU C 3 116 ? 66.049  -58.732 44.220  1.00 70.69  ? 116  GLU A OE2   1 
ATOM   1441 N  N     . VAL C 3 117 ? 60.242  -60.267 45.821  1.00 63.95  ? 117  VAL A N     1 
ATOM   1442 C  CA    . VAL C 3 117 ? 58.963  -60.817 46.255  1.00 64.94  ? 117  VAL A CA    1 
ATOM   1443 C  C     . VAL C 3 117 ? 58.673  -62.220 45.717  1.00 66.48  ? 117  VAL A C     1 
ATOM   1444 O  O     . VAL C 3 117 ? 58.168  -62.383 44.606  1.00 70.46  ? 117  VAL A O     1 
ATOM   1445 C  CB    . VAL C 3 117 ? 57.805  -59.879 45.844  1.00 62.58  ? 117  VAL A CB    1 
ATOM   1446 C  CG1   . VAL C 3 117 ? 56.477  -60.440 46.318  1.00 65.34  ? 117  VAL A CG1   1 
ATOM   1447 C  CG2   . VAL C 3 117 ? 58.027  -58.499 46.421  1.00 60.89  ? 117  VAL A CG2   1 
ATOM   1448 N  N     . THR C 3 118 ? 58.982  -63.221 46.536  1.00 67.48  ? 118  THR A N     1 
ATOM   1449 C  CA    . THR C 3 118 ? 58.782  -64.634 46.225  1.00 67.38  ? 118  THR A CA    1 
ATOM   1450 C  C     . THR C 3 118 ? 57.381  -64.976 45.740  1.00 69.57  ? 118  THR A C     1 
ATOM   1451 O  O     . THR C 3 118 ? 56.405  -64.697 46.428  1.00 68.62  ? 118  THR A O     1 
ATOM   1452 C  CB    . THR C 3 118 ? 59.021  -65.471 47.467  1.00 65.83  ? 118  THR A CB    1 
ATOM   1453 O  OG1   . THR C 3 118 ? 60.193  -64.993 48.128  1.00 70.96  ? 118  THR A OG1   1 
ATOM   1454 C  CG2   . THR C 3 118 ? 59.218  -66.926 47.105  1.00 70.18  ? 118  THR A CG2   1 
ATOM   1455 N  N     . SER C 3 119 ? 57.279  -65.614 44.577  1.00 74.84  ? 119  SER A N     1 
ATOM   1456 C  CA    . SER C 3 119 ? 55.969  -65.987 44.053  1.00 80.75  ? 119  SER A CA    1 
ATOM   1457 C  C     . SER C 3 119 ? 55.875  -67.400 43.489  1.00 83.12  ? 119  SER A C     1 
ATOM   1458 O  O     . SER C 3 119 ? 56.555  -67.735 42.521  1.00 86.50  ? 119  SER A O     1 
ATOM   1459 C  CB    . SER C 3 119 ? 55.521  -65.005 42.972  1.00 82.89  ? 119  SER A CB    1 
ATOM   1460 O  OG    . SER C 3 119 ? 54.372  -65.501 42.309  1.00 87.10  ? 119  SER A OG    1 
ATOM   1461 N  N     . PRO C 3 120 ? 55.017  -68.244 44.093  1.00 83.34  ? 120  PRO A N     1 
ATOM   1462 C  CA    . PRO C 3 120 ? 54.767  -69.636 43.706  1.00 82.10  ? 120  PRO A CA    1 
ATOM   1463 C  C     . PRO C 3 120 ? 54.034  -69.660 42.370  1.00 80.88  ? 120  PRO A C     1 
ATOM   1464 O  O     . PRO C 3 120 ? 54.409  -70.387 41.447  1.00 80.77  ? 120  PRO A O     1 
ATOM   1465 C  CB    . PRO C 3 120 ? 53.885  -70.150 44.840  1.00 83.24  ? 120  PRO A CB    1 
ATOM   1466 C  CG    . PRO C 3 120 ? 54.313  -69.324 46.000  1.00 82.62  ? 120  PRO A CG    1 
ATOM   1467 C  CD    . PRO C 3 120 ? 54.390  -67.961 45.393  1.00 83.88  ? 120  PRO A CD    1 
ATOM   1468 N  N     . ASP C 3 121 ? 52.976  -68.861 42.284  1.00 80.18  ? 121  ASP A N     1 
ATOM   1469 C  CA    . ASP C 3 121 ? 52.197  -68.765 41.058  1.00 82.47  ? 121  ASP A CA    1 
ATOM   1470 C  C     . ASP C 3 121 ? 52.982  -67.923 40.071  1.00 81.77  ? 121  ASP A C     1 
ATOM   1471 O  O     . ASP C 3 121 ? 54.213  -67.983 40.044  1.00 82.49  ? 121  ASP A O     1 
ATOM   1472 C  CB    . ASP C 3 121 ? 50.839  -68.123 41.331  1.00 86.29  ? 121  ASP A CB    1 
ATOM   1473 C  CG    . ASP C 3 121 ? 50.778  -67.459 42.689  1.00 94.70  ? 121  ASP A CG    1 
ATOM   1474 O  OD1   . ASP C 3 121 ? 51.654  -66.611 42.962  1.00 101.37 ? 121  ASP A OD1   1 
ATOM   1475 O  OD2   . ASP C 3 121 ? 49.867  -67.790 43.480  1.00 96.35  ? 121  ASP A OD2   1 
ATOM   1476 N  N     . GLY C 3 122 ? 52.285  -67.123 39.275  1.00 82.58  ? 122  GLY A N     1 
ATOM   1477 C  CA    . GLY C 3 122 ? 52.981  -66.311 38.293  1.00 84.98  ? 122  GLY A CA    1 
ATOM   1478 C  C     . GLY C 3 122 ? 53.654  -65.045 38.802  1.00 83.46  ? 122  GLY A C     1 
ATOM   1479 O  O     . GLY C 3 122 ? 53.662  -64.747 39.999  1.00 84.56  ? 122  GLY A O     1 
ATOM   1480 N  N     . PHE C 3 123 ? 54.241  -64.307 37.868  1.00 80.10  ? 123  PHE A N     1 
ATOM   1481 C  CA    . PHE C 3 123 ? 54.899  -63.050 38.178  1.00 75.40  ? 123  PHE A CA    1 
ATOM   1482 C  C     . PHE C 3 123 ? 53.933  -62.205 39.004  1.00 71.30  ? 123  PHE A C     1 
ATOM   1483 O  O     . PHE C 3 123 ? 52.787  -61.998 38.612  1.00 70.44  ? 123  PHE A O     1 
ATOM   1484 C  CB    . PHE C 3 123 ? 55.255  -62.323 36.873  1.00 74.59  ? 123  PHE A CB    1 
ATOM   1485 C  CG    . PHE C 3 123 ? 55.535  -60.856 37.045  1.00 71.74  ? 123  PHE A CG    1 
ATOM   1486 C  CD1   . PHE C 3 123 ? 56.737  -60.415 37.586  1.00 75.12  ? 123  PHE A CD1   1 
ATOM   1487 C  CD2   . PHE C 3 123 ? 54.577  -59.914 36.688  1.00 73.89  ? 123  PHE A CD2   1 
ATOM   1488 C  CE1   . PHE C 3 123 ? 56.980  -59.052 37.772  1.00 75.34  ? 123  PHE A CE1   1 
ATOM   1489 C  CE2   . PHE C 3 123 ? 54.809  -58.554 36.869  1.00 72.42  ? 123  PHE A CE2   1 
ATOM   1490 C  CZ    . PHE C 3 123 ? 56.015  -58.121 37.414  1.00 73.64  ? 123  PHE A CZ    1 
ATOM   1491 N  N     . PRO C 3 124 ? 54.386  -61.701 40.160  1.00 68.39  ? 124  PRO A N     1 
ATOM   1492 C  CA    . PRO C 3 124 ? 53.537  -60.879 41.026  1.00 67.29  ? 124  PRO A CA    1 
ATOM   1493 C  C     . PRO C 3 124 ? 53.065  -59.569 40.399  1.00 65.72  ? 124  PRO A C     1 
ATOM   1494 O  O     . PRO C 3 124 ? 53.872  -58.714 40.045  1.00 68.14  ? 124  PRO A O     1 
ATOM   1495 C  CB    . PRO C 3 124 ? 54.426  -60.651 42.245  1.00 67.52  ? 124  PRO A CB    1 
ATOM   1496 C  CG    . PRO C 3 124 ? 55.799  -60.611 41.639  1.00 66.02  ? 124  PRO A CG    1 
ATOM   1497 C  CD    . PRO C 3 124 ? 55.753  -61.793 40.703  1.00 67.98  ? 124  PRO A CD    1 
ATOM   1498 N  N     . GLU C 3 125 ? 51.753  -59.421 40.261  1.00 66.59  ? 125  GLU A N     1 
ATOM   1499 C  CA    . GLU C 3 125 ? 51.175  -58.205 39.708  1.00 70.69  ? 125  GLU A CA    1 
ATOM   1500 C  C     . GLU C 3 125 ? 51.212  -57.118 40.778  1.00 72.99  ? 125  GLU A C     1 
ATOM   1501 O  O     . GLU C 3 125 ? 50.717  -57.308 41.895  1.00 74.50  ? 125  GLU A O     1 
ATOM   1502 C  CB    . GLU C 3 125 ? 49.731  -58.453 39.274  1.00 73.15  ? 125  GLU A CB    1 
ATOM   1503 C  CG    . GLU C 3 125 ? 49.591  -58.965 37.857  1.00 77.83  ? 125  GLU A CG    1 
ATOM   1504 C  CD    . GLU C 3 125 ? 49.742  -57.856 36.828  1.00 82.57  ? 125  GLU A CD    1 
ATOM   1505 O  OE1   . GLU C 3 125 ? 50.284  -56.783 37.180  1.00 85.38  ? 125  GLU A OE1   1 
ATOM   1506 O  OE2   . GLU C 3 125 ? 49.326  -58.064 35.667  1.00 80.62  ? 125  GLU A OE2   1 
ATOM   1507 N  N     . PRO C 3 126 ? 51.798  -55.959 40.451  1.00 72.57  ? 126  PRO A N     1 
ATOM   1508 C  CA    . PRO C 3 126 ? 51.884  -54.864 41.417  1.00 70.61  ? 126  PRO A CA    1 
ATOM   1509 C  C     . PRO C 3 126 ? 50.527  -54.325 41.855  1.00 70.28  ? 126  PRO A C     1 
ATOM   1510 O  O     . PRO C 3 126 ? 50.313  -54.073 43.041  1.00 74.43  ? 126  PRO A O     1 
ATOM   1511 C  CB    . PRO C 3 126 ? 52.698  -53.808 40.674  1.00 69.31  ? 126  PRO A CB    1 
ATOM   1512 C  CG    . PRO C 3 126 ? 53.492  -54.613 39.674  1.00 69.27  ? 126  PRO A CG    1 
ATOM   1513 C  CD    . PRO C 3 126 ? 52.467  -55.594 39.193  1.00 72.01  ? 126  PRO A CD    1 
ATOM   1514 N  N     . SER C 3 127 ? 49.606  -54.158 40.909  1.00 67.48  ? 127  SER A N     1 
ATOM   1515 C  CA    . SER C 3 127 ? 48.289  -53.606 41.234  1.00 65.61  ? 127  SER A CA    1 
ATOM   1516 C  C     . SER C 3 127 ? 47.487  -54.459 42.221  1.00 66.56  ? 127  SER A C     1 
ATOM   1517 O  O     . SER C 3 127 ? 46.388  -54.078 42.631  1.00 61.07  ? 127  SER A O     1 
ATOM   1518 C  CB    . SER C 3 127 ? 47.482  -53.374 39.949  1.00 63.60  ? 127  SER A CB    1 
ATOM   1519 O  OG    . SER C 3 127 ? 47.215  -54.586 39.263  1.00 65.97  ? 127  SER A OG    1 
ATOM   1520 N  N     . GLN C 3 128 ? 48.056  -55.595 42.619  1.00 67.09  ? 128  GLN A N     1 
ATOM   1521 C  CA    . GLN C 3 128 ? 47.392  -56.499 43.549  1.00 71.56  ? 128  GLN A CA    1 
ATOM   1522 C  C     . GLN C 3 128 ? 48.199  -56.726 44.820  1.00 70.86  ? 128  GLN A C     1 
ATOM   1523 O  O     . GLN C 3 128 ? 47.639  -56.777 45.913  1.00 72.59  ? 128  GLN A O     1 
ATOM   1524 C  CB    . GLN C 3 128 ? 47.125  -57.847 42.877  1.00 77.63  ? 128  GLN A CB    1 
ATOM   1525 C  CG    . GLN C 3 128 ? 46.272  -57.767 41.623  1.00 83.38  ? 128  GLN A CG    1 
ATOM   1526 C  CD    . GLN C 3 128 ? 45.064  -56.866 41.796  1.00 89.41  ? 128  GLN A CD    1 
ATOM   1527 O  OE1   . GLN C 3 128 ? 44.371  -56.918 42.821  1.00 89.60  ? 128  GLN A OE1   1 
ATOM   1528 N  NE2   . GLN C 3 128 ? 44.799  -56.035 40.787  1.00 89.90  ? 128  GLN A NE2   1 
ATOM   1529 N  N     . ALA C 3 129 ? 49.507  -56.893 44.666  1.00 69.82  ? 129  ALA A N     1 
ATOM   1530 C  CA    . ALA C 3 129 ? 50.398  -57.091 45.804  1.00 72.33  ? 129  ALA A CA    1 
ATOM   1531 C  C     . ALA C 3 129 ? 49.905  -58.182 46.747  1.00 72.21  ? 129  ALA A C     1 
ATOM   1532 O  O     . ALA C 3 129 ? 49.782  -57.955 47.955  1.00 70.93  ? 129  ALA A O     1 
ATOM   1533 C  CB    . ALA C 3 129 ? 50.558  -55.773 46.572  1.00 70.20  ? 129  ALA A CB    1 
ATOM   1534 N  N     . LYS C 3 130 ? 49.642  -59.360 46.190  1.00 71.62  ? 130  LYS A N     1 
ATOM   1535 C  CA    . LYS C 3 130 ? 49.165  -60.503 46.959  1.00 72.55  ? 130  LYS A CA    1 
ATOM   1536 C  C     . LYS C 3 130 ? 50.295  -61.231 47.697  1.00 70.69  ? 130  LYS A C     1 
ATOM   1537 O  O     . LYS C 3 130 ? 50.069  -61.892 48.706  1.00 70.70  ? 130  LYS A O     1 
ATOM   1538 C  CB    . LYS C 3 130 ? 48.465  -61.485 46.026  1.00 74.43  ? 130  LYS A CB    1 
ATOM   1539 C  CG    . LYS C 3 130 ? 47.321  -60.885 45.231  1.00 81.95  ? 130  LYS A CG    1 
ATOM   1540 C  CD    . LYS C 3 130 ? 46.964  -61.785 44.049  1.00 90.71  ? 130  LYS A CD    1 
ATOM   1541 C  CE    . LYS C 3 130 ? 46.629  -63.207 44.505  1.00 92.47  ? 130  LYS A CE    1 
ATOM   1542 N  NZ    . LYS C 3 130 ? 46.513  -64.157 43.360  1.00 88.69  ? 130  LYS A NZ    1 
ATOM   1543 N  N     . HIS C 3 131 ? 51.512  -61.102 47.189  1.00 68.81  ? 131  HIS A N     1 
ATOM   1544 C  CA    . HIS C 3 131 ? 52.664  -61.761 47.785  1.00 70.52  ? 131  HIS A CA    1 
ATOM   1545 C  C     . HIS C 3 131 ? 53.518  -60.816 48.624  1.00 70.48  ? 131  HIS A C     1 
ATOM   1546 O  O     . HIS C 3 131 ? 53.730  -59.666 48.263  1.00 75.19  ? 131  HIS A O     1 
ATOM   1547 C  CB    . HIS C 3 131 ? 53.519  -62.386 46.683  1.00 75.16  ? 131  HIS A CB    1 
ATOM   1548 C  CG    . HIS C 3 131 ? 52.892  -63.585 46.041  1.00 82.10  ? 131  HIS A CG    1 
ATOM   1549 N  ND1   . HIS C 3 131 ? 51.587  -63.594 45.595  1.00 82.98  ? 131  HIS A ND1   1 
ATOM   1550 C  CD2   . HIS C 3 131 ? 53.388  -64.816 45.779  1.00 81.58  ? 131  HIS A CD2   1 
ATOM   1551 C  CE1   . HIS C 3 131 ? 51.306  -64.781 45.087  1.00 81.01  ? 131  HIS A CE1   1 
ATOM   1552 N  NE2   . HIS C 3 131 ? 52.383  -65.540 45.187  1.00 82.52  ? 131  HIS A NE2   1 
ATOM   1553 N  N     . PRO C 3 132 ? 54.029  -61.301 49.760  1.00 70.12  ? 132  PRO A N     1 
ATOM   1554 C  CA    . PRO C 3 132 ? 54.867  -60.521 50.679  1.00 69.09  ? 132  PRO A CA    1 
ATOM   1555 C  C     . PRO C 3 132 ? 56.226  -60.078 50.129  1.00 69.60  ? 132  PRO A C     1 
ATOM   1556 O  O     . PRO C 3 132 ? 56.800  -60.726 49.250  1.00 70.68  ? 132  PRO A O     1 
ATOM   1557 C  CB    . PRO C 3 132 ? 55.036  -61.461 51.868  1.00 69.76  ? 132  PRO A CB    1 
ATOM   1558 C  CG    . PRO C 3 132 ? 53.795  -62.269 51.841  1.00 72.48  ? 132  PRO A CG    1 
ATOM   1559 C  CD    . PRO C 3 132 ? 53.642  -62.579 50.376  1.00 72.69  ? 132  PRO A CD    1 
ATOM   1560 N  N     . ILE C 3 133 ? 56.733  -58.973 50.673  1.00 65.64  ? 133  ILE A N     1 
ATOM   1561 C  CA    . ILE C 3 133 ? 58.030  -58.438 50.290  1.00 60.55  ? 133  ILE A CA    1 
ATOM   1562 C  C     . ILE C 3 133 ? 59.025  -58.996 51.302  1.00 60.72  ? 133  ILE A C     1 
ATOM   1563 O  O     . ILE C 3 133 ? 58.947  -58.666 52.483  1.00 61.62  ? 133  ILE A O     1 
ATOM   1564 C  CB    . ILE C 3 133 ? 58.033  -56.902 50.385  1.00 58.20  ? 133  ILE A CB    1 
ATOM   1565 C  CG1   . ILE C 3 133 ? 56.953  -56.330 49.469  1.00 56.96  ? 133  ILE A CG1   1 
ATOM   1566 C  CG2   . ILE C 3 133 ? 59.403  -56.354 50.024  1.00 57.41  ? 133  ILE A CG2   1 
ATOM   1567 C  CD1   . ILE C 3 133 ? 56.808  -54.829 49.550  1.00 55.95  ? 133  ILE A CD1   1 
ATOM   1568 N  N     . ASP C 3 134 ? 59.948  -59.844 50.861  1.00 61.96  ? 134  ASP A N     1 
ATOM   1569 C  CA    . ASP C 3 134 ? 60.914  -60.423 51.786  1.00 60.26  ? 134  ASP A CA    1 
ATOM   1570 C  C     . ASP C 3 134 ? 62.273  -59.778 51.733  1.00 59.54  ? 134  ASP A C     1 
ATOM   1571 O  O     . ASP C 3 134 ? 63.195  -60.199 52.423  1.00 67.74  ? 134  ASP A O     1 
ATOM   1572 C  CB    . ASP C 3 134 ? 61.068  -61.938 51.568  1.00 67.62  ? 134  ASP A CB    1 
ATOM   1573 C  CG    . ASP C 3 134 ? 61.073  -62.340 50.093  1.00 72.55  ? 134  ASP A CG    1 
ATOM   1574 O  OD1   . ASP C 3 134 ? 61.855  -61.778 49.296  1.00 72.98  ? 134  ASP A OD1   1 
ATOM   1575 O  OD2   . ASP C 3 134 ? 60.289  -63.243 49.738  1.00 76.39  ? 134  ASP A OD2   1 
ATOM   1576 N  N     . ALA C 3 135 ? 62.418  -58.762 50.904  1.00 55.34  ? 135  ALA A N     1 
ATOM   1577 C  CA    . ALA C 3 135 ? 63.694  -58.080 50.830  1.00 51.27  ? 135  ALA A CA    1 
ATOM   1578 C  C     . ALA C 3 135 ? 63.505  -56.724 50.200  1.00 52.59  ? 135  ALA A C     1 
ATOM   1579 O  O     . ALA C 3 135 ? 62.564  -56.488 49.444  1.00 50.03  ? 135  ALA A O     1 
ATOM   1580 C  CB    . ALA C 3 135 ? 64.682  -58.895 50.054  1.00 41.21  ? 135  ALA A CB    1 
ATOM   1581 N  N     . ILE C 3 136 ? 64.410  -55.822 50.527  1.00 56.57  ? 136  ILE A N     1 
ATOM   1582 C  CA    . ILE C 3 136 ? 64.324  -54.475 50.014  1.00 58.88  ? 136  ILE A CA    1 
ATOM   1583 C  C     . ILE C 3 136 ? 65.594  -53.721 50.409  1.00 54.49  ? 136  ILE A C     1 
ATOM   1584 O  O     . ILE C 3 136 ? 65.898  -53.532 51.585  1.00 58.61  ? 136  ILE A O     1 
ATOM   1585 C  CB    . ILE C 3 136 ? 63.024  -53.803 50.554  1.00 59.40  ? 136  ILE A CB    1 
ATOM   1586 C  CG1   . ILE C 3 136 ? 62.843  -52.404 49.988  1.00 59.05  ? 136  ILE A CG1   1 
ATOM   1587 C  CG2   . ILE C 3 136 ? 63.043  -53.774 52.053  1.00 62.09  ? 136  ILE A CG2   1 
ATOM   1588 C  CD1   . ILE C 3 136 ? 61.441  -51.880 50.197  1.00 62.76  ? 136  ILE A CD1   1 
ATOM   1589 N  N     . THR C 3 137 ? 66.363  -53.344 49.402  1.00 47.22  ? 137  THR A N     1 
ATOM   1590 C  CA    . THR C 3 137 ? 67.585  -52.628 49.636  1.00 46.00  ? 137  THR A CA    1 
ATOM   1591 C  C     . THR C 3 137 ? 67.390  -51.215 49.115  1.00 47.80  ? 137  THR A C     1 
ATOM   1592 O  O     . THR C 3 137 ? 66.922  -51.009 47.996  1.00 45.28  ? 137  THR A O     1 
ATOM   1593 C  CB    . THR C 3 137 ? 68.744  -53.326 48.952  1.00 46.94  ? 137  THR A CB    1 
ATOM   1594 O  OG1   . THR C 3 137 ? 68.839  -54.658 49.459  1.00 49.27  ? 137  THR A OG1   1 
ATOM   1595 C  CG2   . THR C 3 137 ? 70.038  -52.605 49.227  1.00 53.35  ? 137  THR A CG2   1 
ATOM   1596 N  N     . HIS C 3 138 ? 67.742  -50.251 49.963  1.00 47.29  ? 138  HIS A N     1 
ATOM   1597 C  CA    . HIS C 3 138 ? 67.583  -48.831 49.686  1.00 47.03  ? 138  HIS A CA    1 
ATOM   1598 C  C     . HIS C 3 138 ? 68.925  -48.120 49.832  1.00 51.18  ? 138  HIS A C     1 
ATOM   1599 O  O     . HIS C 3 138 ? 69.492  -48.078 50.928  1.00 55.80  ? 138  HIS A O     1 
ATOM   1600 C  CB    . HIS C 3 138 ? 66.584  -48.259 50.699  1.00 42.54  ? 138  HIS A CB    1 
ATOM   1601 C  CG    . HIS C 3 138 ? 66.095  -46.881 50.383  1.00 44.21  ? 138  HIS A CG    1 
ATOM   1602 N  ND1   . HIS C 3 138 ? 64.899  -46.650 49.740  1.00 46.76  ? 138  HIS A ND1   1 
ATOM   1603 C  CD2   . HIS C 3 138 ? 66.622  -45.661 50.650  1.00 41.05  ? 138  HIS A CD2   1 
ATOM   1604 C  CE1   . HIS C 3 138 ? 64.708  -45.346 49.628  1.00 44.95  ? 138  HIS A CE1   1 
ATOM   1605 N  NE2   . HIS C 3 138 ? 65.739  -44.724 50.172  1.00 38.79  ? 138  HIS A NE2   1 
ATOM   1606 N  N     . TYR C 3 139 ? 69.440  -47.568 48.736  1.00 50.06  ? 139  TYR A N     1 
ATOM   1607 C  CA    . TYR C 3 139 ? 70.706  -46.841 48.794  1.00 48.58  ? 139  TYR A CA    1 
ATOM   1608 C  C     . TYR C 3 139 ? 70.446  -45.335 48.792  1.00 50.87  ? 139  TYR A C     1 
ATOM   1609 O  O     . TYR C 3 139 ? 69.797  -44.807 47.885  1.00 49.28  ? 139  TYR A O     1 
ATOM   1610 C  CB    . TYR C 3 139 ? 71.614  -47.209 47.623  1.00 41.53  ? 139  TYR A CB    1 
ATOM   1611 C  CG    . TYR C 3 139 ? 72.812  -46.295 47.517  1.00 42.28  ? 139  TYR A CG    1 
ATOM   1612 C  CD1   . TYR C 3 139 ? 73.972  -46.533 48.263  1.00 43.65  ? 139  TYR A CD1   1 
ATOM   1613 C  CD2   . TYR C 3 139 ? 72.770  -45.151 46.721  1.00 42.05  ? 139  TYR A CD2   1 
ATOM   1614 C  CE1   . TYR C 3 139 ? 75.061  -45.647 48.222  1.00 32.92  ? 139  TYR A CE1   1 
ATOM   1615 C  CE2   . TYR C 3 139 ? 73.855  -44.262 46.670  1.00 39.59  ? 139  TYR A CE2   1 
ATOM   1616 C  CZ    . TYR C 3 139 ? 74.989  -44.519 47.425  1.00 36.79  ? 139  TYR A CZ    1 
ATOM   1617 O  OH    . TYR C 3 139 ? 76.043  -43.643 47.385  1.00 41.80  ? 139  TYR A OH    1 
ATOM   1618 N  N     . ASP C 3 140 ? 70.958  -44.663 49.825  1.00 47.76  ? 140  ASP A N     1 
ATOM   1619 C  CA    . ASP C 3 140 ? 70.805  -43.223 50.014  1.00 39.84  ? 140  ASP A CA    1 
ATOM   1620 C  C     . ASP C 3 140 ? 72.107  -42.520 49.678  1.00 41.92  ? 140  ASP A C     1 
ATOM   1621 O  O     . ASP C 3 140 ? 73.150  -42.787 50.281  1.00 38.95  ? 140  ASP A O     1 
ATOM   1622 C  CB    . ASP C 3 140 ? 70.419  -42.945 51.467  1.00 44.00  ? 140  ASP A CB    1 
ATOM   1623 C  CG    . ASP C 3 140 ? 70.053  -41.502 51.709  1.00 55.67  ? 140  ASP A CG    1 
ATOM   1624 O  OD1   . ASP C 3 140 ? 70.972  -40.650 51.778  1.00 61.67  ? 140  ASP A OD1   1 
ATOM   1625 O  OD2   . ASP C 3 140 ? 68.834  -41.219 51.824  1.00 62.59  ? 140  ASP A OD2   1 
ATOM   1626 N  N     . SER C 3 141 ? 72.048  -41.608 48.717  1.00 42.85  ? 141  SER A N     1 
ATOM   1627 C  CA    . SER C 3 141 ? 73.244  -40.887 48.303  1.00 43.77  ? 141  SER A CA    1 
ATOM   1628 C  C     . SER C 3 141 ? 73.786  -39.951 49.356  1.00 45.37  ? 141  SER A C     1 
ATOM   1629 O  O     . SER C 3 141 ? 74.997  -39.795 49.466  1.00 50.81  ? 141  SER A O     1 
ATOM   1630 C  CB    . SER C 3 141 ? 72.985  -40.084 47.025  1.00 44.13  ? 141  SER A CB    1 
ATOM   1631 O  OG    . SER C 3 141 ? 72.194  -38.935 47.281  1.00 47.52  ? 141  SER A OG    1 
ATOM   1632 N  N     . ILE C 3 142 ? 72.909  -39.313 50.123  1.00 46.95  ? 142  ILE A N     1 
ATOM   1633 C  CA    . ILE C 3 142 ? 73.388  -38.387 51.144  1.00 48.45  ? 142  ILE A CA    1 
ATOM   1634 C  C     . ILE C 3 142 ? 74.265  -39.149 52.130  1.00 48.78  ? 142  ILE A C     1 
ATOM   1635 O  O     . ILE C 3 142 ? 75.377  -38.712 52.420  1.00 48.41  ? 142  ILE A O     1 
ATOM   1636 C  CB    . ILE C 3 142 ? 72.232  -37.689 51.936  1.00 50.52  ? 142  ILE A CB    1 
ATOM   1637 C  CG1   . ILE C 3 142 ? 71.436  -36.724 51.041  1.00 47.26  ? 142  ILE A CG1   1 
ATOM   1638 C  CG2   . ILE C 3 142 ? 72.817  -36.906 53.092  1.00 44.11  ? 142  ILE A CG2   1 
ATOM   1639 C  CD1   . ILE C 3 142 ? 72.227  -35.593 50.495  1.00 44.39  ? 142  ILE A CD1   1 
ATOM   1640 N  N     . ASP C 3 143 ? 73.780  -40.285 52.632  1.00 45.79  ? 143  ASP A N     1 
ATOM   1641 C  CA    . ASP C 3 143 ? 74.556  -41.077 53.595  1.00 50.89  ? 143  ASP A CA    1 
ATOM   1642 C  C     . ASP C 3 143 ? 75.592  -42.033 52.997  1.00 51.27  ? 143  ASP A C     1 
ATOM   1643 O  O     . ASP C 3 143 ? 76.512  -42.463 53.694  1.00 46.50  ? 143  ASP A O     1 
ATOM   1644 C  CB    . ASP C 3 143 ? 73.635  -41.906 54.493  1.00 51.28  ? 143  ASP A CB    1 
ATOM   1645 C  CG    . ASP C 3 143 ? 72.634  -41.063 55.251  1.00 55.17  ? 143  ASP A CG    1 
ATOM   1646 O  OD1   . ASP C 3 143 ? 72.974  -39.916 55.618  1.00 58.59  ? 143  ASP A OD1   1 
ATOM   1647 O  OD2   . ASP C 3 143 ? 71.514  -41.565 55.492  1.00 53.87  ? 143  ASP A OD2   1 
ATOM   1648 N  N     . ASP C 3 144 ? 75.438  -42.356 51.714  1.00 53.97  ? 144  ASP A N     1 
ATOM   1649 C  CA    . ASP C 3 144 ? 76.328  -43.281 51.016  1.00 52.73  ? 144  ASP A CA    1 
ATOM   1650 C  C     . ASP C 3 144 ? 76.299  -44.615 51.757  1.00 50.47  ? 144  ASP A C     1 
ATOM   1651 O  O     . ASP C 3 144 ? 77.322  -45.114 52.212  1.00 44.82  ? 144  ASP A O     1 
ATOM   1652 C  CB    . ASP C 3 144 ? 77.762  -42.734 50.964  1.00 57.21  ? 144  ASP A CB    1 
ATOM   1653 C  CG    . ASP C 3 144 ? 78.671  -43.548 50.039  1.00 61.50  ? 144  ASP A CG    1 
ATOM   1654 O  OD1   . ASP C 3 144 ? 78.413  -43.582 48.820  1.00 61.68  ? 144  ASP A OD1   1 
ATOM   1655 O  OD2   . ASP C 3 144 ? 79.644  -44.161 50.523  1.00 64.70  ? 144  ASP A OD2   1 
ATOM   1656 N  N     . ARG C 3 145 ? 75.105  -45.181 51.883  1.00 51.43  ? 145  ARG A N     1 
ATOM   1657 C  CA    . ARG C 3 145 ? 74.920  -46.453 52.572  1.00 52.52  ? 145  ARG A CA    1 
ATOM   1658 C  C     . ARG C 3 145 ? 73.899  -47.309 51.840  1.00 52.53  ? 145  ARG A C     1 
ATOM   1659 O  O     . ARG C 3 145 ? 73.067  -46.800 51.088  1.00 57.36  ? 145  ARG A O     1 
ATOM   1660 C  CB    . ARG C 3 145 ? 74.418  -46.213 53.999  1.00 48.94  ? 145  ARG A CB    1 
ATOM   1661 C  CG    . ARG C 3 145 ? 75.397  -45.501 54.926  1.00 50.16  ? 145  ARG A CG    1 
ATOM   1662 C  CD    . ARG C 3 145 ? 76.612  -46.368 55.245  1.00 52.36  ? 145  ARG A CD    1 
ATOM   1663 N  NE    . ARG C 3 145 ? 77.833  -45.881 54.610  1.00 58.30  ? 145  ARG A NE    1 
ATOM   1664 C  CZ    . ARG C 3 145 ? 78.712  -45.069 55.193  1.00 60.55  ? 145  ARG A CZ    1 
ATOM   1665 N  NH1   . ARG C 3 145 ? 78.506  -44.655 56.437  1.00 58.69  ? 145  ARG A NH1   1 
ATOM   1666 N  NH2   . ARG C 3 145 ? 79.789  -44.658 54.525  1.00 55.92  ? 145  ARG A NH2   1 
ATOM   1667 N  N     . PHE C 3 146 ? 73.975  -48.614 52.056  1.00 49.98  ? 146  PHE A N     1 
ATOM   1668 C  CA    . PHE C 3 146 ? 73.031  -49.541 51.454  1.00 45.25  ? 146  PHE A CA    1 
ATOM   1669 C  C     . PHE C 3 146 ? 72.194  -50.088 52.606  1.00 47.00  ? 146  PHE A C     1 
ATOM   1670 O  O     . PHE C 3 146 ? 72.664  -50.919 53.380  1.00 51.81  ? 146  PHE A O     1 
ATOM   1671 C  CB    . PHE C 3 146 ? 73.760  -50.694 50.763  1.00 40.84  ? 146  PHE A CB    1 
ATOM   1672 C  CG    . PHE C 3 146 ? 74.422  -50.322 49.465  1.00 36.07  ? 146  PHE A CG    1 
ATOM   1673 C  CD1   . PHE C 3 146 ? 75.652  -49.680 49.448  1.00 37.40  ? 146  PHE A CD1   1 
ATOM   1674 C  CD2   . PHE C 3 146 ? 73.840  -50.677 48.246  1.00 38.11  ? 146  PHE A CD2   1 
ATOM   1675 C  CE1   . PHE C 3 146 ? 76.303  -49.401 48.227  1.00 38.94  ? 146  PHE A CE1   1 
ATOM   1676 C  CE2   . PHE C 3 146 ? 74.483  -50.402 47.023  1.00 35.43  ? 146  PHE A CE2   1 
ATOM   1677 C  CZ    . PHE C 3 146 ? 75.715  -49.765 47.012  1.00 32.09  ? 146  PHE A CZ    1 
ATOM   1678 N  N     . TYR C 3 147 ? 70.961  -49.618 52.732  1.00 47.35  ? 147  TYR A N     1 
ATOM   1679 C  CA    . TYR C 3 147 ? 70.100  -50.074 53.812  1.00 50.94  ? 147  TYR A CA    1 
ATOM   1680 C  C     . TYR C 3 147 ? 69.309  -51.294 53.383  1.00 54.16  ? 147  TYR A C     1 
ATOM   1681 O  O     . TYR C 3 147 ? 68.398  -51.189 52.563  1.00 54.10  ? 147  TYR A O     1 
ATOM   1682 C  CB    . TYR C 3 147 ? 69.150  -48.952 54.237  1.00 53.70  ? 147  TYR A CB    1 
ATOM   1683 C  CG    . TYR C 3 147 ? 69.864  -47.721 54.775  1.00 56.82  ? 147  TYR A CG    1 
ATOM   1684 C  CD1   . TYR C 3 147 ? 70.303  -46.709 53.918  1.00 57.85  ? 147  TYR A CD1   1 
ATOM   1685 C  CD2   . TYR C 3 147 ? 70.120  -47.581 56.140  1.00 54.15  ? 147  TYR A CD2   1 
ATOM   1686 C  CE1   . TYR C 3 147 ? 70.977  -45.586 54.410  1.00 54.51  ? 147  TYR A CE1   1 
ATOM   1687 C  CE2   . TYR C 3 147 ? 70.793  -46.466 56.642  1.00 50.06  ? 147  TYR A CE2   1 
ATOM   1688 C  CZ    . TYR C 3 147 ? 71.217  -45.471 55.777  1.00 54.89  ? 147  TYR A CZ    1 
ATOM   1689 O  OH    . TYR C 3 147 ? 71.847  -44.352 56.285  1.00 53.16  ? 147  TYR A OH    1 
ATOM   1690 N  N     . VAL C 3 148 ? 69.655  -52.452 53.944  1.00 56.27  ? 148  VAL A N     1 
ATOM   1691 C  CA    . VAL C 3 148 ? 68.985  -53.705 53.599  1.00 55.00  ? 148  VAL A CA    1 
ATOM   1692 C  C     . VAL C 3 148 ? 67.919  -54.147 54.603  1.00 56.75  ? 148  VAL A C     1 
ATOM   1693 O  O     . VAL C 3 148 ? 68.207  -54.395 55.770  1.00 56.34  ? 148  VAL A O     1 
ATOM   1694 C  CB    . VAL C 3 148 ? 70.004  -54.837 53.463  1.00 50.06  ? 148  VAL A CB    1 
ATOM   1695 C  CG1   . VAL C 3 148 ? 69.333  -56.065 52.898  1.00 55.44  ? 148  VAL A CG1   1 
ATOM   1696 C  CG2   . VAL C 3 148 ? 71.151  -54.396 52.575  1.00 54.04  ? 148  VAL A CG2   1 
ATOM   1697 N  N     . PHE C 3 149 ? 66.683  -54.257 54.140  1.00 59.20  ? 149  PHE A N     1 
ATOM   1698 C  CA    . PHE C 3 149 ? 65.595  -54.682 55.004  1.00 62.45  ? 149  PHE A CA    1 
ATOM   1699 C  C     . PHE C 3 149 ? 65.227  -56.113 54.633  1.00 67.63  ? 149  PHE A C     1 
ATOM   1700 O  O     . PHE C 3 149 ? 64.403  -56.350 53.746  1.00 68.60  ? 149  PHE A O     1 
ATOM   1701 C  CB    . PHE C 3 149 ? 64.395  -53.765 54.820  1.00 62.34  ? 149  PHE A CB    1 
ATOM   1702 C  CG    . PHE C 3 149 ? 64.706  -52.318 55.052  1.00 67.05  ? 149  PHE A CG    1 
ATOM   1703 C  CD1   . PHE C 3 149 ? 65.537  -51.616 54.184  1.00 66.38  ? 149  PHE A CD1   1 
ATOM   1704 C  CD2   . PHE C 3 149 ? 64.184  -51.657 56.154  1.00 67.79  ? 149  PHE A CD2   1 
ATOM   1705 C  CE1   . PHE C 3 149 ? 65.842  -50.270 54.417  1.00 69.30  ? 149  PHE A CE1   1 
ATOM   1706 C  CE2   . PHE C 3 149 ? 64.483  -50.315 56.394  1.00 69.35  ? 149  PHE A CE2   1 
ATOM   1707 C  CZ    . PHE C 3 149 ? 65.312  -49.621 55.525  1.00 67.37  ? 149  PHE A CZ    1 
ATOM   1708 N  N     . ASP C 3 150 ? 65.855  -57.056 55.332  1.00 69.16  ? 150  ASP A N     1 
ATOM   1709 C  CA    . ASP C 3 150 ? 65.673  -58.491 55.119  1.00 67.86  ? 150  ASP A CA    1 
ATOM   1710 C  C     . ASP C 3 150 ? 64.620  -59.144 56.031  1.00 67.22  ? 150  ASP A C     1 
ATOM   1711 O  O     . ASP C 3 150 ? 64.771  -59.175 57.253  1.00 68.77  ? 150  ASP A O     1 
ATOM   1712 C  CB    . ASP C 3 150 ? 67.041  -59.170 55.293  1.00 68.10  ? 150  ASP A CB    1 
ATOM   1713 C  CG    . ASP C 3 150 ? 66.978  -60.679 55.180  1.00 65.90  ? 150  ASP A CG    1 
ATOM   1714 O  OD1   . ASP C 3 150 ? 66.141  -61.192 54.403  1.00 66.75  ? 150  ASP A OD1   1 
ATOM   1715 O  OD2   . ASP C 3 150 ? 67.788  -61.347 55.862  1.00 62.08  ? 150  ASP A OD2   1 
ATOM   1716 N  N     . LEU C 3 151 ? 63.557  -59.665 55.422  1.00 66.76  ? 151  LEU A N     1 
ATOM   1717 C  CA    . LEU C 3 151 ? 62.476  -60.332 56.151  1.00 67.14  ? 151  LEU A CA    1 
ATOM   1718 C  C     . LEU C 3 151 ? 62.956  -61.710 56.612  1.00 70.15  ? 151  LEU A C     1 
ATOM   1719 O  O     . LEU C 3 151 ? 63.953  -62.211 56.098  1.00 71.08  ? 151  LEU A O     1 
ATOM   1720 C  CB    . LEU C 3 151 ? 61.267  -60.488 55.243  1.00 60.59  ? 151  LEU A CB    1 
ATOM   1721 C  CG    . LEU C 3 151 ? 60.064  -61.132 55.901  1.00 59.39  ? 151  LEU A CG    1 
ATOM   1722 C  CD1   . LEU C 3 151 ? 59.496  -60.205 56.971  1.00 55.26  ? 151  LEU A CD1   1 
ATOM   1723 C  CD2   . LEU C 3 151 ? 59.032  -61.427 54.830  1.00 59.74  ? 151  LEU A CD2   1 
ATOM   1724 N  N     . LEU C 3 152 ? 62.249  -62.339 57.553  1.00 72.08  ? 152  LEU A N     1 
ATOM   1725 C  CA    . LEU C 3 152 ? 62.695  -63.640 58.065  1.00 71.54  ? 152  LEU A CA    1 
ATOM   1726 C  C     . LEU C 3 152 ? 61.683  -64.702 58.440  1.00 71.99  ? 152  LEU A C     1 
ATOM   1727 O  O     . LEU C 3 152 ? 62.082  -65.801 58.807  1.00 73.68  ? 152  LEU A O     1 
ATOM   1728 C  CB    . LEU C 3 152 ? 63.598  -63.443 59.283  1.00 68.84  ? 152  LEU A CB    1 
ATOM   1729 C  CG    . LEU C 3 152 ? 65.065  -63.177 58.980  1.00 74.10  ? 152  LEU A CG    1 
ATOM   1730 C  CD1   . LEU C 3 152 ? 65.885  -63.219 60.263  1.00 72.11  ? 152  LEU A CD1   1 
ATOM   1731 C  CD2   . LEU C 3 152 ? 65.555  -64.234 57.999  1.00 76.14  ? 152  LEU A CD2   1 
ATOM   1732 N  N     . ASN C 3 153 ? 60.394  -64.400 58.384  1.00 70.75  ? 153  ASN A N     1 
ATOM   1733 C  CA    . ASN C 3 153 ? 59.412  -65.404 58.760  1.00 74.45  ? 153  ASN A CA    1 
ATOM   1734 C  C     . ASN C 3 153 ? 58.135  -65.267 57.965  1.00 76.70  ? 153  ASN A C     1 
ATOM   1735 O  O     . ASN C 3 153 ? 57.082  -64.915 58.492  1.00 81.65  ? 153  ASN A O     1 
ATOM   1736 C  CB    . ASN C 3 153 ? 59.127  -65.321 60.262  1.00 73.29  ? 153  ASN A CB    1 
ATOM   1737 C  CG    . ASN C 3 153 ? 60.320  -65.739 61.097  1.00 75.42  ? 153  ASN A CG    1 
ATOM   1738 O  OD1   . ASN C 3 153 ? 60.756  -66.892 61.046  1.00 75.55  ? 153  ASN A OD1   1 
ATOM   1739 N  ND2   . ASN C 3 153 ? 60.865  -64.801 61.861  1.00 75.79  ? 153  ASN A ND2   1 
ATOM   1740 N  N     . SER C 3 154 ? 58.251  -65.589 56.685  1.00 78.78  ? 154  SER A N     1 
ATOM   1741 C  CA    . SER C 3 154 ? 57.155  -65.507 55.729  1.00 78.71  ? 154  SER A CA    1 
ATOM   1742 C  C     . SER C 3 154 ? 56.266  -66.744 55.664  1.00 76.72  ? 154  SER A C     1 
ATOM   1743 O  O     . SER C 3 154 ? 56.585  -67.788 56.234  1.00 77.39  ? 154  SER A O     1 
ATOM   1744 C  CB    . SER C 3 154 ? 57.737  -65.251 54.336  1.00 83.21  ? 154  SER A CB    1 
ATOM   1745 O  OG    . SER C 3 154 ? 58.735  -66.216 54.022  1.00 83.71  ? 154  SER A OG    1 
ATOM   1746 N  N     . PRO C 3 155 ? 55.122  -66.627 54.970  1.00 74.21  ? 155  PRO A N     1 
ATOM   1747 C  CA    . PRO C 3 155 ? 54.181  -67.736 54.812  1.00 74.63  ? 155  PRO A CA    1 
ATOM   1748 C  C     . PRO C 3 155 ? 54.751  -68.690 53.770  1.00 71.83  ? 155  PRO A C     1 
ATOM   1749 O  O     . PRO C 3 155 ? 54.157  -69.717 53.449  1.00 75.89  ? 155  PRO A O     1 
ATOM   1750 C  CB    . PRO C 3 155 ? 52.902  -67.041 54.345  1.00 73.59  ? 155  PRO A CB    1 
ATOM   1751 C  CG    . PRO C 3 155 ? 53.418  -65.866 53.602  1.00 73.21  ? 155  PRO A CG    1 
ATOM   1752 C  CD    . PRO C 3 155 ? 54.518  -65.371 54.497  1.00 74.05  ? 155  PRO A CD    1 
ATOM   1753 N  N     . TYR C 3 156 ? 55.915  -68.321 53.244  1.00 65.99  ? 156  TYR A N     1 
ATOM   1754 C  CA    . TYR C 3 156 ? 56.610  -69.126 52.251  1.00 62.27  ? 156  TYR A CA    1 
ATOM   1755 C  C     . TYR C 3 156 ? 57.938  -69.623 52.809  1.00 58.92  ? 156  TYR A C     1 
ATOM   1756 O  O     . TYR C 3 156 ? 58.881  -69.843 52.055  1.00 62.07  ? 156  TYR A O     1 
ATOM   1757 C  CB    . TYR C 3 156 ? 56.908  -68.320 50.982  1.00 62.83  ? 156  TYR A CB    1 
ATOM   1758 C  CG    . TYR C 3 156 ? 55.708  -67.779 50.246  1.00 63.71  ? 156  TYR A CG    1 
ATOM   1759 C  CD1   . TYR C 3 156 ? 54.599  -68.575 49.987  1.00 64.31  ? 156  TYR A CD1   1 
ATOM   1760 C  CD2   . TYR C 3 156 ? 55.710  -66.478 49.759  1.00 65.71  ? 156  TYR A CD2   1 
ATOM   1761 C  CE1   . TYR C 3 156 ? 53.521  -68.086 49.257  1.00 68.67  ? 156  TYR A CE1   1 
ATOM   1762 C  CE2   . TYR C 3 156 ? 54.642  -65.980 49.028  1.00 69.08  ? 156  TYR A CE2   1 
ATOM   1763 C  CZ    . TYR C 3 156 ? 53.547  -66.791 48.778  1.00 69.56  ? 156  TYR A CZ    1 
ATOM   1764 O  OH    . TYR C 3 156 ? 52.482  -66.320 48.040  1.00 69.32  ? 156  TYR A OH    1 
ATOM   1765 N  N     . GLY C 3 157 ? 58.023  -69.782 54.124  1.00 57.23  ? 157  GLY A N     1 
ATOM   1766 C  CA    . GLY C 3 157 ? 59.259  -70.258 54.720  1.00 56.96  ? 157  GLY A CA    1 
ATOM   1767 C  C     . GLY C 3 157 ? 59.895  -69.277 55.682  1.00 61.78  ? 157  GLY A C     1 
ATOM   1768 O  O     . GLY C 3 157 ? 59.605  -68.076 55.647  1.00 61.56  ? 157  GLY A O     1 
ATOM   1769 N  N     . ASN C 3 158 ? 60.765  -69.802 56.543  1.00 62.01  ? 158  ASN A N     1 
ATOM   1770 C  CA    . ASN C 3 158 ? 61.481  -69.008 57.538  1.00 63.61  ? 158  ASN A CA    1 
ATOM   1771 C  C     . ASN C 3 158 ? 62.950  -69.346 57.370  1.00 65.05  ? 158  ASN A C     1 
ATOM   1772 O  O     . ASN C 3 158 ? 63.285  -70.498 57.120  1.00 67.73  ? 158  ASN A O     1 
ATOM   1773 C  CB    . ASN C 3 158 ? 61.025  -69.380 58.954  1.00 64.19  ? 158  ASN A CB    1 
ATOM   1774 C  CG    . ASN C 3 158 ? 59.577  -68.998 59.226  1.00 67.42  ? 158  ASN A CG    1 
ATOM   1775 O  OD1   . ASN C 3 158 ? 59.076  -69.163 60.339  1.00 73.36  ? 158  ASN A OD1   1 
ATOM   1776 N  ND2   . ASN C 3 158 ? 58.898  -68.487 58.208  1.00 72.14  ? 158  ASN A ND2   1 
ATOM   1777 N  N     . VAL C 3 159 ? 63.829  -68.361 57.533  1.00 69.68  ? 159  VAL A N     1 
ATOM   1778 C  CA    . VAL C 3 159 ? 65.252  -68.606 57.326  1.00 70.82  ? 159  VAL A CA    1 
ATOM   1779 C  C     . VAL C 3 159 ? 66.244  -67.903 58.238  1.00 70.59  ? 159  VAL A C     1 
ATOM   1780 O  O     . VAL C 3 159 ? 65.874  -67.152 59.132  1.00 70.78  ? 159  VAL A O     1 
ATOM   1781 C  CB    . VAL C 3 159 ? 65.632  -68.262 55.884  1.00 75.08  ? 159  VAL A CB    1 
ATOM   1782 C  CG1   . VAL C 3 159 ? 65.088  -69.320 54.936  1.00 78.71  ? 159  VAL A CG1   1 
ATOM   1783 C  CG2   . VAL C 3 159 ? 65.050  -66.903 55.522  1.00 75.55  ? 159  VAL A CG2   1 
ATOM   1784 N  N     . GLU C 3 160 ? 67.519  -68.165 57.976  1.00 72.75  ? 160  GLU A N     1 
ATOM   1785 C  CA    . GLU C 3 160 ? 68.624  -67.602 58.739  1.00 78.66  ? 160  GLU A CA    1 
ATOM   1786 C  C     . GLU C 3 160 ? 69.029  -66.240 58.203  1.00 79.92  ? 160  GLU A C     1 
ATOM   1787 O  O     . GLU C 3 160 ? 68.943  -65.990 56.997  1.00 82.31  ? 160  GLU A O     1 
ATOM   1788 C  CB    . GLU C 3 160 ? 69.835  -68.535 58.667  1.00 84.07  ? 160  GLU A CB    1 
ATOM   1789 C  CG    . GLU C 3 160 ? 69.670  -69.849 59.405  1.00 92.82  ? 160  GLU A CG    1 
ATOM   1790 C  CD    . GLU C 3 160 ? 69.752  -69.686 60.913  1.00 95.29  ? 160  GLU A CD    1 
ATOM   1791 O  OE1   . GLU C 3 160 ? 70.856  -69.379 61.418  1.00 95.66  ? 160  GLU A OE1   1 
ATOM   1792 O  OE2   . GLU C 3 160 ? 68.712  -69.860 61.587  1.00 97.07  ? 160  GLU A OE2   1 
ATOM   1793 N  N     . GLU C 3 161 ? 69.491  -65.371 59.097  1.00 79.38  ? 161  GLU A N     1 
ATOM   1794 C  CA    . GLU C 3 161 ? 69.919  -64.040 58.704  1.00 79.66  ? 161  GLU A CA    1 
ATOM   1795 C  C     . GLU C 3 161 ? 71.020  -64.100 57.662  1.00 78.34  ? 161  GLU A C     1 
ATOM   1796 O  O     . GLU C 3 161 ? 71.651  -65.136 57.457  1.00 81.31  ? 161  GLU A O     1 
ATOM   1797 C  CB    . GLU C 3 161 ? 70.422  -63.254 59.914  1.00 80.80  ? 161  GLU A CB    1 
ATOM   1798 C  CG    . GLU C 3 161 ? 69.372  -63.059 60.987  1.00 88.32  ? 161  GLU A CG    1 
ATOM   1799 C  CD    . GLU C 3 161 ? 69.805  -62.075 62.061  1.00 91.55  ? 161  GLU A CD    1 
ATOM   1800 O  OE1   . GLU C 3 161 ? 70.942  -62.201 62.566  1.00 90.10  ? 161  GLU A OE1   1 
ATOM   1801 O  OE2   . GLU C 3 161 ? 69.000  -61.181 62.403  1.00 93.41  ? 161  GLU A OE2   1 
ATOM   1802 N  N     . TRP C 3 162 ? 71.226  -62.968 57.003  1.00 73.78  ? 162  TRP A N     1 
ATOM   1803 C  CA    . TRP C 3 162 ? 72.246  -62.816 55.980  1.00 64.35  ? 162  TRP A CA    1 
ATOM   1804 C  C     . TRP C 3 162 ? 73.581  -62.648 56.698  1.00 63.71  ? 162  TRP A C     1 
ATOM   1805 O  O     . TRP C 3 162 ? 73.630  -62.116 57.809  1.00 66.06  ? 162  TRP A O     1 
ATOM   1806 C  CB    . TRP C 3 162 ? 71.927  -61.571 55.147  1.00 59.23  ? 162  TRP A CB    1 
ATOM   1807 C  CG    . TRP C 3 162 ? 72.921  -61.242 54.076  1.00 54.84  ? 162  TRP A CG    1 
ATOM   1808 C  CD1   . TRP C 3 162 ? 73.132  -61.929 52.918  1.00 55.48  ? 162  TRP A CD1   1 
ATOM   1809 C  CD2   . TRP C 3 162 ? 73.830  -60.131 54.054  1.00 55.47  ? 162  TRP A CD2   1 
ATOM   1810 N  NE1   . TRP C 3 162 ? 74.112  -61.319 52.173  1.00 57.06  ? 162  TRP A NE1   1 
ATOM   1811 C  CE2   . TRP C 3 162 ? 74.559  -60.213 52.846  1.00 54.72  ? 162  TRP A CE2   1 
ATOM   1812 C  CE3   . TRP C 3 162 ? 74.098  -59.073 54.937  1.00 53.48  ? 162  TRP A CE3   1 
ATOM   1813 C  CZ2   . TRP C 3 162 ? 75.541  -59.274 52.493  1.00 54.94  ? 162  TRP A CZ2   1 
ATOM   1814 C  CZ3   . TRP C 3 162 ? 75.077  -58.136 54.582  1.00 57.26  ? 162  TRP A CZ3   1 
ATOM   1815 C  CH2   . TRP C 3 162 ? 75.784  -58.247 53.371  1.00 54.54  ? 162  TRP A CH2   1 
ATOM   1816 N  N     . SER C 3 163 ? 74.659  -63.112 56.076  1.00 61.39  ? 163  SER A N     1 
ATOM   1817 C  CA    . SER C 3 163 ? 75.983  -62.994 56.672  1.00 61.69  ? 163  SER A CA    1 
ATOM   1818 C  C     . SER C 3 163 ? 76.919  -62.232 55.749  1.00 64.64  ? 163  SER A C     1 
ATOM   1819 O  O     . SER C 3 163 ? 77.246  -62.703 54.661  1.00 67.19  ? 163  SER A O     1 
ATOM   1820 C  CB    . SER C 3 163 ? 76.564  -64.381 56.961  1.00 60.51  ? 163  SER A CB    1 
ATOM   1821 O  OG    . SER C 3 163 ? 77.946  -64.299 57.263  1.00 56.71  ? 163  SER A OG    1 
ATOM   1822 N  N     . ILE C 3 164 ? 77.350  -61.056 56.190  1.00 66.21  ? 164  ILE A N     1 
ATOM   1823 C  CA    . ILE C 3 164 ? 78.245  -60.217 55.404  1.00 67.46  ? 164  ILE A CA    1 
ATOM   1824 C  C     . ILE C 3 164 ? 79.681  -60.761 55.294  1.00 68.61  ? 164  ILE A C     1 
ATOM   1825 O  O     . ILE C 3 164 ? 80.378  -60.526 54.298  1.00 64.24  ? 164  ILE A O     1 
ATOM   1826 C  CB    . ILE C 3 164 ? 78.295  -58.807 55.993  1.00 70.14  ? 164  ILE A CB    1 
ATOM   1827 C  CG1   . ILE C 3 164 ? 79.140  -57.907 55.092  1.00 71.04  ? 164  ILE A CG1   1 
ATOM   1828 C  CG2   . ILE C 3 164 ? 78.846  -58.862 57.425  1.00 67.89  ? 164  ILE A CG2   1 
ATOM   1829 C  CD1   . ILE C 3 164 ? 79.066  -56.445 55.455  1.00 71.92  ? 164  ILE A CD1   1 
ATOM   1830 N  N     . GLU C 3 165 ? 80.127  -61.479 56.320  1.00 73.79  ? 165  GLU A N     1 
ATOM   1831 C  CA    . GLU C 3 165 ? 81.468  -62.051 56.312  1.00 75.04  ? 165  GLU A CA    1 
ATOM   1832 C  C     . GLU C 3 165 ? 81.590  -62.965 55.092  1.00 75.82  ? 165  GLU A C     1 
ATOM   1833 O  O     . GLU C 3 165 ? 82.549  -62.852 54.325  1.00 76.29  ? 165  GLU A O     1 
ATOM   1834 C  CB    . GLU C 3 165 ? 81.728  -62.831 57.603  1.00 76.82  ? 165  GLU A CB    1 
ATOM   1835 C  CG    . GLU C 3 165 ? 81.490  -62.014 58.864  1.00 86.19  ? 165  GLU A CG    1 
ATOM   1836 C  CD    . GLU C 3 165 ? 80.018  -61.956 59.267  1.00 89.56  ? 165  GLU A CD    1 
ATOM   1837 O  OE1   . GLU C 3 165 ? 79.150  -62.282 58.428  1.00 93.82  ? 165  GLU A OE1   1 
ATOM   1838 O  OE2   . GLU C 3 165 ? 79.728  -61.580 60.424  1.00 92.18  ? 165  GLU A OE2   1 
ATOM   1839 N  N     . ILE C 3 166 ? 80.612  -63.854 54.902  1.00 73.32  ? 166  ILE A N     1 
ATOM   1840 C  CA    . ILE C 3 166 ? 80.614  -64.762 53.749  1.00 70.74  ? 166  ILE A CA    1 
ATOM   1841 C  C     . ILE C 3 166 ? 80.611  -63.946 52.462  1.00 70.52  ? 166  ILE A C     1 
ATOM   1842 O  O     . ILE C 3 166 ? 81.603  -63.891 51.736  1.00 70.48  ? 166  ILE A O     1 
ATOM   1843 C  CB    . ILE C 3 166 ? 79.359  -65.663 53.716  1.00 68.83  ? 166  ILE A CB    1 
ATOM   1844 C  CG1   . ILE C 3 166 ? 79.409  -66.690 54.847  1.00 67.16  ? 166  ILE A CG1   1 
ATOM   1845 C  CG2   . ILE C 3 166 ? 79.265  -66.367 52.368  1.00 65.32  ? 166  ILE A CG2   1 
ATOM   1846 C  CD1   . ILE C 3 166 ? 78.195  -67.599 54.896  1.00 60.50  ? 166  ILE A CD1   1 
ATOM   1847 N  N     . ALA C 3 167 ? 79.462  -63.331 52.206  1.00 69.13  ? 167  ALA A N     1 
ATOM   1848 C  CA    . ALA C 3 167 ? 79.204  -62.484 51.050  1.00 67.68  ? 167  ALA A CA    1 
ATOM   1849 C  C     . ALA C 3 167 ? 80.384  -61.970 50.221  1.00 67.73  ? 167  ALA A C     1 
ATOM   1850 O  O     . ALA C 3 167 ? 80.291  -61.926 48.994  1.00 70.14  ? 167  ALA A O     1 
ATOM   1851 C  CB    . ALA C 3 167 ? 78.356  -61.306 51.488  1.00 66.66  ? 167  ALA A CB    1 
ATOM   1852 N  N     . ALA C 3 168 ? 81.482  -61.583 50.864  1.00 66.60  ? 168  ALA A N     1 
ATOM   1853 C  CA    . ALA C 3 168 ? 82.626  -61.044 50.131  1.00 68.08  ? 168  ALA A CA    1 
ATOM   1854 C  C     . ALA C 3 168 ? 83.658  -62.046 49.611  1.00 71.39  ? 168  ALA A C     1 
ATOM   1855 O  O     . ALA C 3 168 ? 84.636  -61.655 48.959  1.00 69.15  ? 168  ALA A O     1 
ATOM   1856 C  CB    . ALA C 3 168 ? 83.320  -60.012 50.983  1.00 71.09  ? 168  ALA A CB    1 
ATOM   1857 N  N     . LYS C 3 169 ? 83.455  -63.331 49.888  1.00 74.36  ? 169  LYS A N     1 
ATOM   1858 C  CA    . LYS C 3 169 ? 84.406  -64.348 49.436  1.00 77.36  ? 169  LYS A CA    1 
ATOM   1859 C  C     . LYS C 3 169 ? 84.129  -64.846 48.020  1.00 77.55  ? 169  LYS A C     1 
ATOM   1860 O  O     . LYS C 3 169 ? 83.060  -64.598 47.461  1.00 77.93  ? 169  LYS A O     1 
ATOM   1861 C  CB    . LYS C 3 169 ? 84.413  -65.526 50.414  1.00 77.17  ? 169  LYS A CB    1 
ATOM   1862 C  CG    . LYS C 3 169 ? 84.559  -65.084 51.854  1.00 81.04  ? 169  LYS A CG    1 
ATOM   1863 C  CD    . LYS C 3 169 ? 85.673  -64.049 51.971  1.00 86.84  ? 169  LYS A CD    1 
ATOM   1864 C  CE    . LYS C 3 169 ? 85.286  -62.927 52.924  1.00 85.51  ? 169  LYS A CE    1 
ATOM   1865 N  NZ    . LYS C 3 169 ? 86.268  -61.810 52.913  1.00 82.48  ? 169  LYS A NZ    1 
ATOM   1866 N  N     . LEU C 3 170 ? 85.108  -65.532 47.438  1.00 76.09  ? 170  LEU A N     1 
ATOM   1867 C  CA    . LEU C 3 170 ? 84.964  -66.067 46.091  1.00 73.25  ? 170  LEU A CA    1 
ATOM   1868 C  C     . LEU C 3 170 ? 83.806  -67.059 46.097  1.00 73.54  ? 170  LEU A C     1 
ATOM   1869 O  O     . LEU C 3 170 ? 83.619  -67.786 47.077  1.00 72.34  ? 170  LEU A O     1 
ATOM   1870 C  CB    . LEU C 3 170 ? 86.242  -66.793 45.671  1.00 73.80  ? 170  LEU A CB    1 
ATOM   1871 C  CG    . LEU C 3 170 ? 87.563  -66.031 45.543  1.00 72.98  ? 170  LEU A CG    1 
ATOM   1872 C  CD1   . LEU C 3 170 ? 87.457  -65.036 44.400  1.00 73.73  ? 170  LEU A CD1   1 
ATOM   1873 C  CD2   . LEU C 3 170 ? 87.909  -65.339 46.856  1.00 73.11  ? 170  LEU A CD2   1 
ATOM   1874 N  N     . GLN C 3 171 ? 83.028  -67.083 45.014  1.00 73.96  ? 171  GLN A N     1 
ATOM   1875 C  CA    . GLN C 3 171 ? 81.902  -68.009 44.913  1.00 72.34  ? 171  GLN A CA    1 
ATOM   1876 C  C     . GLN C 3 171 ? 82.454  -69.419 45.023  1.00 69.50  ? 171  GLN A C     1 
ATOM   1877 O  O     . GLN C 3 171 ? 81.840  -70.288 45.643  1.00 68.80  ? 171  GLN A O     1 
ATOM   1878 C  CB    . GLN C 3 171 ? 81.164  -67.843 43.581  1.00 74.73  ? 171  GLN A CB    1 
ATOM   1879 C  CG    . GLN C 3 171 ? 80.536  -66.474 43.373  1.00 78.33  ? 171  GLN A CG    1 
ATOM   1880 C  CD    . GLN C 3 171 ? 79.110  -66.564 42.867  1.00 81.60  ? 171  GLN A CD    1 
ATOM   1881 O  OE1   . GLN C 3 171 ? 78.773  -67.452 42.082  1.00 88.81  ? 171  GLN A OE1   1 
ATOM   1882 N  NE2   . GLN C 3 171 ? 78.265  -65.638 43.305  1.00 80.81  ? 171  GLN A NE2   1 
ATOM   1883 N  N     . GLU C 3 172 ? 83.622  -69.636 44.426  1.00 65.41  ? 172  GLU A N     1 
ATOM   1884 C  CA    . GLU C 3 172 ? 84.282  -70.935 44.468  1.00 65.60  ? 172  GLU A CA    1 
ATOM   1885 C  C     . GLU C 3 172 ? 84.619  -71.345 45.901  1.00 64.30  ? 172  GLU A C     1 
ATOM   1886 O  O     . GLU C 3 172 ? 85.548  -72.111 46.138  1.00 59.85  ? 172  GLU A O     1 
ATOM   1887 C  CB    . GLU C 3 172 ? 85.552  -70.890 43.633  1.00 67.50  ? 172  GLU A CB    1 
ATOM   1888 C  CG    . GLU C 3 172 ? 86.199  -69.527 43.639  1.00 79.05  ? 172  GLU A CG    1 
ATOM   1889 C  CD    . GLU C 3 172 ? 87.464  -69.478 42.810  1.00 85.46  ? 172  GLU A CD    1 
ATOM   1890 O  OE1   . GLU C 3 172 ? 88.139  -70.524 42.691  1.00 87.47  ? 172  GLU A OE1   1 
ATOM   1891 O  OE2   . GLU C 3 172 ? 87.781  -68.386 42.289  1.00 89.48  ? 172  GLU A OE2   1 
ATOM   1892 N  N     . GLN C 3 173 ? 83.851  -70.826 46.853  1.00 65.72  ? 173  GLN A N     1 
ATOM   1893 C  CA    . GLN C 3 173 ? 84.044  -71.130 48.261  1.00 65.20  ? 173  GLN A CA    1 
ATOM   1894 C  C     . GLN C 3 173 ? 82.735  -71.021 49.021  1.00 63.41  ? 173  GLN A C     1 
ATOM   1895 O  O     . GLN C 3 173 ? 82.630  -71.459 50.163  1.00 60.90  ? 173  GLN A O     1 
ATOM   1896 C  CB    . GLN C 3 173 ? 85.086  -70.186 48.853  1.00 63.88  ? 173  GLN A CB    1 
ATOM   1897 C  CG    . GLN C 3 173 ? 86.476  -70.770 48.797  1.00 74.01  ? 173  GLN A CG    1 
ATOM   1898 C  CD    . GLN C 3 173 ? 87.536  -69.723 48.618  1.00 81.28  ? 173  GLN A CD    1 
ATOM   1899 O  OE1   . GLN C 3 173 ? 88.730  -70.025 48.640  1.00 89.03  ? 173  GLN A OE1   1 
ATOM   1900 N  NE2   . GLN C 3 173 ? 87.113  -68.477 48.429  1.00 86.51  ? 173  GLN A NE2   1 
ATOM   1901 N  N     . GLY C 3 174 ? 81.732  -70.446 48.368  1.00 66.96  ? 174  GLY A N     1 
ATOM   1902 C  CA    . GLY C 3 174 ? 80.435  -70.281 48.998  1.00 69.25  ? 174  GLY A CA    1 
ATOM   1903 C  C     . GLY C 3 174 ? 80.076  -68.813 49.087  1.00 70.49  ? 174  GLY A C     1 
ATOM   1904 O  O     . GLY C 3 174 ? 78.918  -68.456 49.328  1.00 68.37  ? 174  GLY A O     1 
ATOM   1905 N  N     . GLY C 3 175 ? 81.083  -67.964 48.883  1.00 71.65  ? 175  GLY A N     1 
ATOM   1906 C  CA    . GLY C 3 175 ? 80.883  -66.528 48.937  1.00 74.68  ? 175  GLY A CA    1 
ATOM   1907 C  C     . GLY C 3 175 ? 79.960  -66.086 47.822  1.00 75.89  ? 175  GLY A C     1 
ATOM   1908 O  O     . GLY C 3 175 ? 79.578  -66.903 46.982  1.00 76.44  ? 175  GLY A O     1 
ATOM   1909 N  N     . ASP C 3 176 ? 79.607  -64.802 47.804  1.00 74.42  ? 176  ASP A N     1 
ATOM   1910 C  CA    . ASP C 3 176 ? 78.713  -64.272 46.785  1.00 69.22  ? 176  ASP A CA    1 
ATOM   1911 C  C     . ASP C 3 176 ? 79.393  -63.222 45.926  1.00 65.88  ? 176  ASP A C     1 
ATOM   1912 O  O     . ASP C 3 176 ? 78.762  -62.592 45.090  1.00 64.88  ? 176  ASP A O     1 
ATOM   1913 C  CB    . ASP C 3 176 ? 77.467  -63.692 47.451  1.00 69.14  ? 176  ASP A CB    1 
ATOM   1914 C  CG    . ASP C 3 176 ? 76.711  -64.730 48.265  1.00 72.07  ? 176  ASP A CG    1 
ATOM   1915 O  OD1   . ASP C 3 176 ? 77.119  -65.909 48.244  1.00 77.79  ? 176  ASP A OD1   1 
ATOM   1916 O  OD2   . ASP C 3 176 ? 75.710  -64.375 48.919  1.00 75.30  ? 176  ASP A OD2   1 
ATOM   1917 N  N     . GLU C 3 177 ? 80.690  -63.049 46.135  1.00 67.76  ? 177  GLU A N     1 
ATOM   1918 C  CA    . GLU C 3 177 ? 81.471  -62.078 45.382  1.00 70.42  ? 177  GLU A CA    1 
ATOM   1919 C  C     . GLU C 3 177 ? 80.954  -60.643 45.453  1.00 69.18  ? 177  GLU A C     1 
ATOM   1920 O  O     . GLU C 3 177 ? 81.018  -59.907 44.465  1.00 69.53  ? 177  GLU A O     1 
ATOM   1921 C  CB    . GLU C 3 177 ? 81.580  -62.504 43.916  1.00 75.88  ? 177  GLU A CB    1 
ATOM   1922 C  CG    . GLU C 3 177 ? 82.802  -63.370 43.614  1.00 87.14  ? 177  GLU A CG    1 
ATOM   1923 C  CD    . GLU C 3 177 ? 83.317  -63.164 42.193  1.00 95.41  ? 177  GLU A CD    1 
ATOM   1924 O  OE1   . GLU C 3 177 ? 82.592  -63.517 41.233  1.00 99.76  ? 177  GLU A OE1   1 
ATOM   1925 O  OE2   . GLU C 3 177 ? 84.442  -62.631 42.039  1.00 97.53  ? 177  GLU A OE2   1 
ATOM   1926 N  N     . VAL C 3 178 ? 80.442  -60.243 46.616  1.00 66.64  ? 178  VAL A N     1 
ATOM   1927 C  CA    . VAL C 3 178 ? 79.947  -58.879 46.791  1.00 62.31  ? 178  VAL A CA    1 
ATOM   1928 C  C     . VAL C 3 178 ? 81.161  -57.955 46.825  1.00 62.57  ? 178  VAL A C     1 
ATOM   1929 O  O     . VAL C 3 178 ? 82.019  -58.094 47.693  1.00 64.08  ? 178  VAL A O     1 
ATOM   1930 C  CB    . VAL C 3 178 ? 79.164  -58.727 48.106  1.00 59.76  ? 178  VAL A CB    1 
ATOM   1931 C  CG1   . VAL C 3 178 ? 78.941  -57.258 48.412  1.00 55.07  ? 178  VAL A CG1   1 
ATOM   1932 C  CG2   . VAL C 3 178 ? 77.829  -59.446 48.003  1.00 56.95  ? 178  VAL A CG2   1 
ATOM   1933 N  N     . PRO C 3 179 ? 81.249  -57.002 45.877  1.00 62.28  ? 179  PRO A N     1 
ATOM   1934 C  CA    . PRO C 3 179 ? 82.375  -56.062 45.809  1.00 65.91  ? 179  PRO A CA    1 
ATOM   1935 C  C     . PRO C 3 179 ? 82.942  -55.650 47.166  1.00 66.35  ? 179  PRO A C     1 
ATOM   1936 O  O     . PRO C 3 179 ? 82.213  -55.547 48.147  1.00 66.23  ? 179  PRO A O     1 
ATOM   1937 C  CB    . PRO C 3 179 ? 81.786  -54.887 45.040  1.00 65.47  ? 179  PRO A CB    1 
ATOM   1938 C  CG    . PRO C 3 179 ? 80.928  -55.581 44.040  1.00 64.79  ? 179  PRO A CG    1 
ATOM   1939 C  CD    . PRO C 3 179 ? 80.206  -56.614 44.909  1.00 61.16  ? 179  PRO A CD    1 
ATOM   1940 N  N     . SER C 3 180 ? 84.249  -55.424 47.212  1.00 66.41  ? 180  SER A N     1 
ATOM   1941 C  CA    . SER C 3 180 ? 84.919  -55.037 48.447  1.00 67.52  ? 180  SER A CA    1 
ATOM   1942 C  C     . SER C 3 180 ? 84.528  -53.633 48.929  1.00 66.90  ? 180  SER A C     1 
ATOM   1943 O  O     . SER C 3 180 ? 84.032  -53.452 50.049  1.00 63.39  ? 180  SER A O     1 
ATOM   1944 C  CB    . SER C 3 180 ? 86.439  -55.122 48.256  1.00 68.59  ? 180  SER A CB    1 
ATOM   1945 O  OG    . SER C 3 180 ? 86.886  -54.271 47.211  1.00 72.27  ? 180  SER A OG    1 
ATOM   1946 N  N     . GLU C 3 181 ? 84.757  -52.648 48.069  1.00 65.84  ? 181  GLU A N     1 
ATOM   1947 C  CA    . GLU C 3 181 ? 84.461  -51.257 48.365  1.00 67.79  ? 181  GLU A CA    1 
ATOM   1948 C  C     . GLU C 3 181 ? 82.989  -50.986 48.633  1.00 69.35  ? 181  GLU A C     1 
ATOM   1949 O  O     . GLU C 3 181 ? 82.545  -49.843 48.538  1.00 76.69  ? 181  GLU A O     1 
ATOM   1950 C  CB    . GLU C 3 181 ? 84.905  -50.380 47.201  1.00 67.92  ? 181  GLU A CB    1 
ATOM   1951 C  CG    . GLU C 3 181 ? 84.048  -50.536 45.957  1.00 69.24  ? 181  GLU A CG    1 
ATOM   1952 C  CD    . GLU C 3 181 ? 84.283  -51.847 45.227  1.00 71.46  ? 181  GLU A CD    1 
ATOM   1953 O  OE1   . GLU C 3 181 ? 84.933  -52.736 45.807  1.00 73.02  ? 181  GLU A OE1   1 
ATOM   1954 O  OE2   . GLU C 3 181 ? 83.813  -51.989 44.076  1.00 71.79  ? 181  GLU A OE2   1 
ATOM   1955 N  N     . ILE C 3 182 ? 82.231  -52.017 48.974  1.00 67.66  ? 182  ILE A N     1 
ATOM   1956 C  CA    . ILE C 3 182 ? 80.802  -51.849 49.224  1.00 68.89  ? 182  ILE A CA    1 
ATOM   1957 C  C     . ILE C 3 182 ? 80.439  -52.504 50.557  1.00 67.33  ? 182  ILE A C     1 
ATOM   1958 O  O     . ILE C 3 182 ? 79.464  -52.132 51.210  1.00 65.06  ? 182  ILE A O     1 
ATOM   1959 C  CB    . ILE C 3 182 ? 79.982  -52.517 48.081  1.00 73.30  ? 182  ILE A CB    1 
ATOM   1960 C  CG1   . ILE C 3 182 ? 78.558  -51.981 48.038  1.00 71.74  ? 182  ILE A CG1   1 
ATOM   1961 C  CG2   . ILE C 3 182 ? 79.913  -54.022 48.298  1.00 74.79  ? 182  ILE A CG2   1 
ATOM   1962 C  CD1   . ILE C 3 182 ? 77.679  -52.736 47.055  1.00 71.09  ? 182  ILE A CD1   1 
ATOM   1963 N  N     . ILE C 3 183 ? 81.259  -53.470 50.950  1.00 68.20  ? 183  ILE A N     1 
ATOM   1964 C  CA    . ILE C 3 183 ? 81.059  -54.239 52.168  1.00 70.93  ? 183  ILE A CA    1 
ATOM   1965 C  C     . ILE C 3 183 ? 80.931  -53.421 53.448  1.00 71.56  ? 183  ILE A C     1 
ATOM   1966 O  O     . ILE C 3 183 ? 80.163  -53.788 54.339  1.00 72.89  ? 183  ILE A O     1 
ATOM   1967 C  CB    . ILE C 3 183 ? 82.197  -55.246 52.347  1.00 73.04  ? 183  ILE A CB    1 
ATOM   1968 C  CG1   . ILE C 3 183 ? 82.516  -55.900 51.006  1.00 76.05  ? 183  ILE A CG1   1 
ATOM   1969 C  CG2   . ILE C 3 183 ? 81.785  -56.325 53.326  1.00 71.66  ? 183  ILE A CG2   1 
ATOM   1970 C  CD1   . ILE C 3 183 ? 83.844  -56.637 50.980  1.00 87.71  ? 183  ILE A CD1   1 
ATOM   1971 N  N     . ASP C 3 184 ? 81.678  -52.323 53.544  1.00 71.79  ? 184  ASP A N     1 
ATOM   1972 C  CA    . ASP C 3 184 ? 81.633  -51.469 54.734  1.00 71.70  ? 184  ASP A CA    1 
ATOM   1973 C  C     . ASP C 3 184 ? 80.577  -50.362 54.675  1.00 68.87  ? 184  ASP A C     1 
ATOM   1974 O  O     . ASP C 3 184 ? 80.405  -49.602 55.631  1.00 67.88  ? 184  ASP A O     1 
ATOM   1975 C  CB    . ASP C 3 184 ? 83.012  -50.851 55.002  1.00 74.76  ? 184  ASP A CB    1 
ATOM   1976 C  CG    . ASP C 3 184 ? 84.047  -51.889 55.436  1.00 79.97  ? 184  ASP A CG    1 
ATOM   1977 O  OD1   . ASP C 3 184 ? 83.702  -52.767 56.261  1.00 76.45  ? 184  ASP A OD1   1 
ATOM   1978 O  OD2   . ASP C 3 184 ? 85.204  -51.818 54.961  1.00 82.00  ? 184  ASP A OD2   1 
ATOM   1979 N  N     . LYS C 3 185 ? 79.868  -50.278 53.552  1.00 64.45  ? 185  LYS A N     1 
ATOM   1980 C  CA    . LYS C 3 185 ? 78.819  -49.279 53.379  1.00 55.22  ? 185  LYS A CA    1 
ATOM   1981 C  C     . LYS C 3 185 ? 77.438  -49.907 53.523  1.00 53.82  ? 185  LYS A C     1 
ATOM   1982 O  O     . LYS C 3 185 ? 76.442  -49.350 53.073  1.00 53.88  ? 185  LYS A O     1 
ATOM   1983 C  CB    . LYS C 3 185 ? 78.939  -48.615 52.011  1.00 46.64  ? 185  LYS A CB    1 
ATOM   1984 C  CG    . LYS C 3 185 ? 80.189  -47.777 51.857  1.00 45.47  ? 185  LYS A CG    1 
ATOM   1985 C  CD    . LYS C 3 185 ? 80.282  -47.126 50.486  1.00 44.02  ? 185  LYS A CD    1 
ATOM   1986 C  CE    . LYS C 3 185 ? 81.582  -46.330 50.348  1.00 50.91  ? 185  LYS A CE    1 
ATOM   1987 N  NZ    . LYS C 3 185 ? 81.827  -45.794 48.976  1.00 52.31  ? 185  LYS A NZ    1 
ATOM   1988 N  N     . ILE C 3 186 ? 77.375  -51.061 54.167  1.00 49.64  ? 186  ILE A N     1 
ATOM   1989 C  CA    . ILE C 3 186 ? 76.105  -51.738 54.340  1.00 52.45  ? 186  ILE A CA    1 
ATOM   1990 C  C     . ILE C 3 186 ? 75.584  -51.697 55.772  1.00 55.93  ? 186  ILE A C     1 
ATOM   1991 O  O     . ILE C 3 186 ? 76.349  -51.812 56.731  1.00 54.55  ? 186  ILE A O     1 
ATOM   1992 C  CB    . ILE C 3 186 ? 76.206  -53.213 53.888  1.00 51.26  ? 186  ILE A CB    1 
ATOM   1993 C  CG1   . ILE C 3 186 ? 76.510  -53.281 52.396  1.00 51.64  ? 186  ILE A CG1   1 
ATOM   1994 C  CG2   . ILE C 3 186 ? 74.909  -53.947 54.181  1.00 48.12  ? 186  ILE A CG2   1 
ATOM   1995 C  CD1   . ILE C 3 186 ? 76.566  -54.693 51.867  1.00 49.71  ? 186  ILE A CD1   1 
ATOM   1996 N  N     . ILE C 3 187 ? 74.268  -51.520 55.889  1.00 58.16  ? 187  ILE A N     1 
ATOM   1997 C  CA    . ILE C 3 187 ? 73.564  -51.484 57.169  1.00 57.11  ? 187  ILE A CA    1 
ATOM   1998 C  C     . ILE C 3 187 ? 72.471  -52.537 57.032  1.00 60.14  ? 187  ILE A C     1 
ATOM   1999 O  O     . ILE C 3 187 ? 71.443  -52.294 56.395  1.00 60.82  ? 187  ILE A O     1 
ATOM   2000 C  CB    . ILE C 3 187 ? 72.893  -50.112 57.423  1.00 56.95  ? 187  ILE A CB    1 
ATOM   2001 C  CG1   . ILE C 3 187 ? 73.902  -48.974 57.208  1.00 57.24  ? 187  ILE A CG1   1 
ATOM   2002 C  CG2   . ILE C 3 187 ? 72.332  -50.061 58.829  1.00 51.30  ? 187  ILE A CG2   1 
ATOM   2003 C  CD1   . ILE C 3 187 ? 75.168  -49.090 58.022  1.00 56.71  ? 187  ILE A CD1   1 
ATOM   2004 N  N     . TYR C 3 188 ? 72.711  -53.709 57.617  1.00 63.08  ? 188  TYR A N     1 
ATOM   2005 C  CA    . TYR C 3 188 ? 71.770  -54.825 57.545  1.00 62.90  ? 188  TYR A CA    1 
ATOM   2006 C  C     . TYR C 3 188 ? 70.768  -54.849 58.694  1.00 61.11  ? 188  TYR A C     1 
ATOM   2007 O  O     . TYR C 3 188 ? 71.142  -54.913 59.865  1.00 58.16  ? 188  TYR A O     1 
ATOM   2008 C  CB    . TYR C 3 188 ? 72.546  -56.144 57.508  1.00 65.00  ? 188  TYR A CB    1 
ATOM   2009 C  CG    . TYR C 3 188 ? 71.695  -57.395 57.540  1.00 66.51  ? 188  TYR A CG    1 
ATOM   2010 C  CD1   . TYR C 3 188 ? 70.367  -57.382 57.127  1.00 64.32  ? 188  TYR A CD1   1 
ATOM   2011 C  CD2   . TYR C 3 188 ? 72.221  -58.593 58.007  1.00 68.01  ? 188  TYR A CD2   1 
ATOM   2012 C  CE1   . TYR C 3 188 ? 69.588  -58.528 57.188  1.00 65.49  ? 188  TYR A CE1   1 
ATOM   2013 C  CE2   . TYR C 3 188 ? 71.448  -59.740 58.072  1.00 66.55  ? 188  TYR A CE2   1 
ATOM   2014 C  CZ    . TYR C 3 188 ? 70.134  -59.703 57.665  1.00 63.37  ? 188  TYR A CZ    1 
ATOM   2015 O  OH    . TYR C 3 188 ? 69.358  -60.836 57.762  1.00 62.92  ? 188  TYR A OH    1 
ATOM   2016 N  N     . MET C 3 189 ? 69.491  -54.826 58.334  1.00 61.08  ? 189  MET A N     1 
ATOM   2017 C  CA    . MET C 3 189 ? 68.400  -54.837 59.297  1.00 63.15  ? 189  MET A CA    1 
ATOM   2018 C  C     . MET C 3 189 ? 67.465  -56.028 59.024  1.00 65.28  ? 189  MET A C     1 
ATOM   2019 O  O     . MET C 3 189 ? 66.714  -56.021 58.045  1.00 67.04  ? 189  MET A O     1 
ATOM   2020 C  CB    . MET C 3 189 ? 67.626  -53.526 59.172  1.00 67.80  ? 189  MET A CB    1 
ATOM   2021 C  CG    . MET C 3 189 ? 68.525  -52.294 59.141  1.00 71.69  ? 189  MET A CG    1 
ATOM   2022 S  SD    . MET C 3 189 ? 67.698  -50.806 58.517  1.00 78.74  ? 189  MET A SD    1 
ATOM   2023 C  CE    . MET C 3 189 ? 66.734  -50.307 59.934  1.00 77.79  ? 189  MET A CE    1 
ATOM   2024 N  N     . PRO C 3 190 ? 67.517  -57.072 59.876  1.00 63.41  ? 190  PRO A N     1 
ATOM   2025 C  CA    . PRO C 3 190 ? 66.705  -58.295 59.784  1.00 61.52  ? 190  PRO A CA    1 
ATOM   2026 C  C     . PRO C 3 190 ? 65.400  -58.182 60.563  1.00 62.67  ? 190  PRO A C     1 
ATOM   2027 O  O     . PRO C 3 190 ? 65.391  -57.680 61.683  1.00 66.33  ? 190  PRO A O     1 
ATOM   2028 C  CB    . PRO C 3 190 ? 67.622  -59.342 60.381  1.00 64.52  ? 190  PRO A CB    1 
ATOM   2029 C  CG    . PRO C 3 190 ? 68.260  -58.572 61.492  1.00 62.21  ? 190  PRO A CG    1 
ATOM   2030 C  CD    . PRO C 3 190 ? 68.624  -57.264 60.830  1.00 61.62  ? 190  PRO A CD    1 
ATOM   2031 N  N     . PHE C 3 191 ? 64.301  -58.662 59.992  1.00 65.17  ? 191  PHE A N     1 
ATOM   2032 C  CA    . PHE C 3 191 ? 63.009  -58.562 60.668  1.00 67.34  ? 191  PHE A CA    1 
ATOM   2033 C  C     . PHE C 3 191 ? 62.323  -59.905 60.862  1.00 71.66  ? 191  PHE A C     1 
ATOM   2034 O  O     . PHE C 3 191 ? 62.615  -60.859 60.146  1.00 75.85  ? 191  PHE A O     1 
ATOM   2035 C  CB    . PHE C 3 191 ? 62.086  -57.624 59.890  1.00 67.04  ? 191  PHE A CB    1 
ATOM   2036 C  CG    . PHE C 3 191 ? 62.654  -56.247 59.683  1.00 69.31  ? 191  PHE A CG    1 
ATOM   2037 C  CD1   . PHE C 3 191 ? 63.705  -56.043 58.793  1.00 72.12  ? 191  PHE A CD1   1 
ATOM   2038 C  CD2   . PHE C 3 191 ? 62.143  -55.156 60.377  1.00 65.52  ? 191  PHE A CD2   1 
ATOM   2039 C  CE1   . PHE C 3 191 ? 64.239  -54.774 58.596  1.00 70.33  ? 191  PHE A CE1   1 
ATOM   2040 C  CE2   . PHE C 3 191 ? 62.671  -53.885 60.187  1.00 67.43  ? 191  PHE A CE2   1 
ATOM   2041 C  CZ    . PHE C 3 191 ? 63.722  -53.694 59.293  1.00 70.10  ? 191  PHE A CZ    1 
ATOM   2042 N  N     . ASP C 3 192 ? 61.401  -59.965 61.825  1.00 75.60  ? 192  ASP A N     1 
ATOM   2043 C  CA    . ASP C 3 192 ? 60.665  -61.194 62.156  1.00 77.83  ? 192  ASP A CA    1 
ATOM   2044 C  C     . ASP C 3 192 ? 59.239  -61.238 61.610  1.00 79.24  ? 192  ASP A C     1 
ATOM   2045 O  O     . ASP C 3 192 ? 58.561  -62.260 61.718  1.00 82.03  ? 192  ASP A O     1 
ATOM   2046 C  CB    . ASP C 3 192 ? 60.597  -61.371 63.682  1.00 80.84  ? 192  ASP A CB    1 
ATOM   2047 C  CG    . ASP C 3 192 ? 61.973  -61.481 64.331  1.00 83.46  ? 192  ASP A CG    1 
ATOM   2048 O  OD1   . ASP C 3 192 ? 62.677  -62.491 64.100  1.00 83.20  ? 192  ASP A OD1   1 
ATOM   2049 O  OD2   . ASP C 3 192 ? 62.348  -60.552 65.078  1.00 83.76  ? 192  ASP A OD2   1 
ATOM   2050 N  N     . ASN C 3 193 ? 58.789  -60.136 61.024  1.00 80.22  ? 193  ASN A N     1 
ATOM   2051 C  CA    . ASN C 3 193 ? 57.435  -60.044 60.491  1.00 78.78  ? 193  ASN A CA    1 
ATOM   2052 C  C     . ASN C 3 193 ? 57.416  -58.980 59.391  1.00 80.60  ? 193  ASN A C     1 
ATOM   2053 O  O     . ASN C 3 193 ? 58.183  -58.016 59.463  1.00 80.45  ? 193  ASN A O     1 
ATOM   2054 C  CB    . ASN C 3 193 ? 56.493  -59.639 61.625  1.00 80.84  ? 193  ASN A CB    1 
ATOM   2055 C  CG    . ASN C 3 193 ? 55.107  -59.285 61.142  1.00 86.91  ? 193  ASN A CG    1 
ATOM   2056 O  OD1   . ASN C 3 193 ? 54.941  -58.616 60.124  1.00 91.02  ? 193  ASN A OD1   1 
ATOM   2057 N  ND2   . ASN C 3 193 ? 54.096  -59.712 61.889  1.00 92.60  ? 193  ASN A ND2   1 
ATOM   2058 N  N     . GLU C 3 194 ? 56.553  -59.150 58.384  1.00 78.30  ? 194  GLU A N     1 
ATOM   2059 C  CA    . GLU C 3 194 ? 56.449  -58.178 57.290  1.00 75.11  ? 194  GLU A CA    1 
ATOM   2060 C  C     . GLU C 3 194 ? 55.884  -56.839 57.762  1.00 73.05  ? 194  GLU A C     1 
ATOM   2061 O  O     . GLU C 3 194 ? 56.521  -55.804 57.569  1.00 73.67  ? 194  GLU A O     1 
ATOM   2062 C  CB    . GLU C 3 194 ? 55.579  -58.716 56.140  1.00 74.46  ? 194  GLU A CB    1 
ATOM   2063 C  CG    . GLU C 3 194 ? 55.360  -57.699 55.014  1.00 73.63  ? 194  GLU A CG    1 
ATOM   2064 C  CD    . GLU C 3 194 ? 54.429  -58.198 53.924  1.00 72.43  ? 194  GLU A CD    1 
ATOM   2065 O  OE1   . GLU C 3 194 ? 53.537  -59.014 54.230  1.00 67.38  ? 194  GLU A OE1   1 
ATOM   2066 O  OE2   . GLU C 3 194 ? 54.574  -57.760 52.760  1.00 72.78  ? 194  GLU A OE2   1 
ATOM   2067 N  N     . LYS C 3 195 ? 54.691  -56.863 58.366  1.00 73.57  ? 195  LYS A N     1 
ATOM   2068 C  CA    . LYS C 3 195 ? 54.040  -55.646 58.871  1.00 71.30  ? 195  LYS A CA    1 
ATOM   2069 C  C     . LYS C 3 195 ? 55.053  -54.834 59.674  1.00 66.26  ? 195  LYS A C     1 
ATOM   2070 O  O     . LYS C 3 195 ? 55.114  -53.620 59.555  1.00 65.54  ? 195  LYS A O     1 
ATOM   2071 C  CB    . LYS C 3 195 ? 52.817  -55.994 59.732  1.00 76.20  ? 195  LYS A CB    1 
ATOM   2072 C  CG    . LYS C 3 195 ? 51.853  -56.975 59.055  1.00 84.32  ? 195  LYS A CG    1 
ATOM   2073 C  CD    . LYS C 3 195 ? 50.462  -56.952 59.689  1.00 90.97  ? 195  LYS A CD    1 
ATOM   2074 C  CE    . LYS C 3 195 ? 49.637  -58.203 59.324  1.00 94.94  ? 195  LYS A CE    1 
ATOM   2075 N  NZ    . LYS C 3 195 ? 49.484  -58.465 57.852  1.00 94.37  ? 195  LYS A NZ    1 
ATOM   2076 N  N     . GLU C 3 196 ? 55.852  -55.521 60.478  1.00 63.61  ? 196  GLU A N     1 
ATOM   2077 C  CA    . GLU C 3 196 ? 56.908  -54.892 61.261  1.00 66.96  ? 196  GLU A CA    1 
ATOM   2078 C  C     . GLU C 3 196 ? 57.814  -54.231 60.218  1.00 65.60  ? 196  GLU A C     1 
ATOM   2079 O  O     . GLU C 3 196 ? 57.790  -53.016 60.038  1.00 68.05  ? 196  GLU A O     1 
ATOM   2080 C  CB    . GLU C 3 196 ? 57.653  -55.983 62.033  1.00 74.61  ? 196  GLU A CB    1 
ATOM   2081 C  CG    . GLU C 3 196 ? 58.953  -55.598 62.703  1.00 85.33  ? 196  GLU A CG    1 
ATOM   2082 C  CD    . GLU C 3 196 ? 59.539  -56.782 63.481  1.00 95.15  ? 196  GLU A CD    1 
ATOM   2083 O  OE1   . GLU C 3 196 ? 58.843  -57.284 64.394  1.00 96.07  ? 196  GLU A OE1   1 
ATOM   2084 O  OE2   . GLU C 3 196 ? 60.679  -57.216 63.180  1.00 98.30  ? 196  GLU A OE2   1 
ATOM   2085 N  N     . LEU C 3 197 ? 58.592  -55.055 59.523  1.00 65.45  ? 197  LEU A N     1 
ATOM   2086 C  CA    . LEU C 3 197 ? 59.492  -54.635 58.445  1.00 62.06  ? 197  LEU A CA    1 
ATOM   2087 C  C     . LEU C 3 197 ? 58.978  -53.435 57.636  1.00 61.85  ? 197  LEU A C     1 
ATOM   2088 O  O     . LEU C 3 197 ? 59.704  -52.463 57.424  1.00 56.72  ? 197  LEU A O     1 
ATOM   2089 C  CB    . LEU C 3 197 ? 59.707  -55.827 57.505  1.00 59.08  ? 197  LEU A CB    1 
ATOM   2090 C  CG    . LEU C 3 197 ? 60.387  -55.710 56.140  1.00 55.49  ? 197  LEU A CG    1 
ATOM   2091 C  CD1   . LEU C 3 197 ? 59.524  -54.947 55.157  1.00 53.91  ? 197  LEU A CD1   1 
ATOM   2092 C  CD2   . LEU C 3 197 ? 61.721  -55.045 56.325  1.00 64.60  ? 197  LEU A CD2   1 
ATOM   2093 N  N     . LEU C 3 198 ? 57.733  -53.518 57.174  1.00 59.78  ? 198  LEU A N     1 
ATOM   2094 C  CA    . LEU C 3 198 ? 57.123  -52.444 56.391  1.00 62.12  ? 198  LEU A CA    1 
ATOM   2095 C  C     . LEU C 3 198 ? 57.025  -51.123 57.144  1.00 63.40  ? 198  LEU A C     1 
ATOM   2096 O  O     . LEU C 3 198 ? 57.359  -50.074 56.600  1.00 64.46  ? 198  LEU A O     1 
ATOM   2097 C  CB    . LEU C 3 198 ? 55.721  -52.839 55.930  1.00 61.97  ? 198  LEU A CB    1 
ATOM   2098 C  CG    . LEU C 3 198 ? 55.610  -53.954 54.898  1.00 64.50  ? 198  LEU A CG    1 
ATOM   2099 C  CD1   . LEU C 3 198 ? 54.141  -54.212 54.570  1.00 64.56  ? 198  LEU A CD1   1 
ATOM   2100 C  CD2   . LEU C 3 198 ? 56.390  -53.558 53.659  1.00 61.05  ? 198  LEU A CD2   1 
ATOM   2101 N  N     . MET C 3 199 ? 56.538  -51.164 58.380  1.00 63.14  ? 199  MET A N     1 
ATOM   2102 C  CA    . MET C 3 199 ? 56.418  -49.946 59.164  1.00 63.45  ? 199  MET A CA    1 
ATOM   2103 C  C     . MET C 3 199 ? 57.775  -49.289 59.324  1.00 63.20  ? 199  MET A C     1 
ATOM   2104 O  O     . MET C 3 199 ? 57.903  -48.080 59.147  1.00 65.04  ? 199  MET A O     1 
ATOM   2105 C  CB    . MET C 3 199 ? 55.809  -50.238 60.528  1.00 67.30  ? 199  MET A CB    1 
ATOM   2106 C  CG    . MET C 3 199 ? 54.345  -50.608 60.448  1.00 75.46  ? 199  MET A CG    1 
ATOM   2107 S  SD    . MET C 3 199 ? 53.589  -50.710 62.075  1.00 93.33  ? 199  MET A SD    1 
ATOM   2108 C  CE    . MET C 3 199 ? 54.253  -52.294 62.677  1.00 86.20  ? 199  MET A CE    1 
ATOM   2109 N  N     . GLU C 3 200 ? 58.789  -50.075 59.661  1.00 60.04  ? 200  GLU A N     1 
ATOM   2110 C  CA    . GLU C 3 200 ? 60.129  -49.521 59.797  1.00 60.03  ? 200  GLU A CA    1 
ATOM   2111 C  C     . GLU C 3 200 ? 60.534  -48.836 58.494  1.00 58.23  ? 200  GLU A C     1 
ATOM   2112 O  O     . GLU C 3 200 ? 61.116  -47.753 58.504  1.00 58.46  ? 200  GLU A O     1 
ATOM   2113 C  CB    . GLU C 3 200 ? 61.132  -50.625 60.123  1.00 63.43  ? 200  GLU A CB    1 
ATOM   2114 C  CG    . GLU C 3 200 ? 61.360  -50.840 61.602  1.00 76.75  ? 200  GLU A CG    1 
ATOM   2115 C  CD    . GLU C 3 200 ? 62.241  -49.759 62.212  1.00 84.80  ? 200  GLU A CD    1 
ATOM   2116 O  OE1   . GLU C 3 200 ? 63.358  -49.546 61.689  1.00 84.90  ? 200  GLU A OE1   1 
ATOM   2117 O  OE2   . GLU C 3 200 ? 61.818  -49.129 63.209  1.00 87.91  ? 200  GLU A OE2   1 
ATOM   2118 N  N     . TYR C 3 201 ? 60.209  -49.464 57.367  1.00 58.95  ? 201  TYR A N     1 
ATOM   2119 C  CA    . TYR C 3 201 ? 60.568  -48.902 56.071  1.00 55.15  ? 201  TYR A CA    1 
ATOM   2120 C  C     . TYR C 3 201 ? 59.953  -47.543 55.810  1.00 56.01  ? 201  TYR A C     1 
ATOM   2121 O  O     . TYR C 3 201 ? 60.452  -46.783 54.984  1.00 60.40  ? 201  TYR A O     1 
ATOM   2122 C  CB    . TYR C 3 201 ? 60.179  -49.821 54.921  1.00 48.98  ? 201  TYR A CB    1 
ATOM   2123 C  CG    . TYR C 3 201 ? 60.744  -49.310 53.625  1.00 41.25  ? 201  TYR A CG    1 
ATOM   2124 C  CD1   . TYR C 3 201 ? 62.129  -49.200 53.451  1.00 44.76  ? 201  TYR A CD1   1 
ATOM   2125 C  CD2   . TYR C 3 201 ? 59.913  -48.877 52.595  1.00 37.09  ? 201  TYR A CD2   1 
ATOM   2126 C  CE1   . TYR C 3 201 ? 62.677  -48.666 52.278  1.00 42.90  ? 201  TYR A CE1   1 
ATOM   2127 C  CE2   . TYR C 3 201 ? 60.445  -48.341 51.413  1.00 41.62  ? 201  TYR A CE2   1 
ATOM   2128 C  CZ    . TYR C 3 201 ? 61.830  -48.240 51.261  1.00 47.16  ? 201  TYR A CZ    1 
ATOM   2129 O  OH    . TYR C 3 201 ? 62.375  -47.724 50.102  1.00 47.25  ? 201  TYR A OH    1 
ATOM   2130 N  N     . LEU C 3 202 ? 58.853  -47.244 56.482  1.00 56.85  ? 202  LEU A N     1 
ATOM   2131 C  CA    . LEU C 3 202 ? 58.224  -45.948 56.315  1.00 55.37  ? 202  LEU A CA    1 
ATOM   2132 C  C     . LEU C 3 202 ? 58.858  -44.889 57.231  1.00 57.39  ? 202  LEU A C     1 
ATOM   2133 O  O     . LEU C 3 202 ? 59.038  -43.734 56.820  1.00 51.14  ? 202  LEU A O     1 
ATOM   2134 C  CB    . LEU C 3 202 ? 56.723  -46.058 56.559  1.00 54.19  ? 202  LEU A CB    1 
ATOM   2135 C  CG    . LEU C 3 202 ? 55.965  -46.118 55.235  1.00 53.86  ? 202  LEU A CG    1 
ATOM   2136 C  CD1   . LEU C 3 202 ? 54.483  -46.190 55.498  1.00 47.04  ? 202  LEU A CD1   1 
ATOM   2137 C  CD2   . LEU C 3 202 ? 56.287  -44.868 54.413  1.00 58.87  ? 202  LEU A CD2   1 
ATOM   2138 N  N     . ASN C 3 203 ? 59.205  -45.279 58.460  1.00 59.36  ? 203  ASN A N     1 
ATOM   2139 C  CA    . ASN C 3 203 ? 59.841  -44.349 59.402  1.00 63.70  ? 203  ASN A CA    1 
ATOM   2140 C  C     . ASN C 3 203 ? 61.136  -43.909 58.752  1.00 62.16  ? 203  ASN A C     1 
ATOM   2141 O  O     . ASN C 3 203 ? 61.535  -42.750 58.844  1.00 64.75  ? 203  ASN A O     1 
ATOM   2142 C  CB    . ASN C 3 203 ? 60.151  -45.028 60.741  1.00 66.24  ? 203  ASN A CB    1 
ATOM   2143 C  CG    . ASN C 3 203 ? 58.909  -45.561 61.423  1.00 70.54  ? 203  ASN A CG    1 
ATOM   2144 O  OD1   . ASN C 3 203 ? 57.896  -44.863 61.525  1.00 64.78  ? 203  ASN A OD1   1 
ATOM   2145 N  ND2   . ASN C 3 203 ? 58.981  -46.802 61.906  1.00 73.66  ? 203  ASN A ND2   1 
ATOM   2146 N  N     . PHE C 3 204 ? 61.776  -44.858 58.081  1.00 58.77  ? 204  PHE A N     1 
ATOM   2147 C  CA    . PHE C 3 204 ? 63.023  -44.611 57.376  1.00 53.93  ? 204  PHE A CA    1 
ATOM   2148 C  C     . PHE C 3 204 ? 62.771  -43.592 56.268  1.00 51.83  ? 204  PHE A C     1 
ATOM   2149 O  O     . PHE C 3 204 ? 63.491  -42.607 56.148  1.00 51.28  ? 204  PHE A O     1 
ATOM   2150 C  CB    . PHE C 3 204 ? 63.527  -45.928 56.772  1.00 52.84  ? 204  PHE A CB    1 
ATOM   2151 C  CG    . PHE C 3 204 ? 64.733  -45.782 55.880  1.00 46.81  ? 204  PHE A CG    1 
ATOM   2152 C  CD1   . PHE C 3 204 ? 65.992  -45.570 56.419  1.00 43.57  ? 204  PHE A CD1   1 
ATOM   2153 C  CD2   . PHE C 3 204 ? 64.598  -45.861 54.490  1.00 43.67  ? 204  PHE A CD2   1 
ATOM   2154 C  CE1   . PHE C 3 204 ? 67.109  -45.440 55.590  1.00 50.59  ? 204  PHE A CE1   1 
ATOM   2155 C  CE2   . PHE C 3 204 ? 65.695  -45.733 53.654  1.00 43.82  ? 204  PHE A CE2   1 
ATOM   2156 C  CZ    . PHE C 3 204 ? 66.961  -45.522 54.199  1.00 48.76  ? 204  PHE A CZ    1 
ATOM   2157 N  N     . TRP C 3 205 ? 61.727  -43.838 55.481  1.00 47.21  ? 205  TRP A N     1 
ATOM   2158 C  CA    . TRP C 3 205 ? 61.363  -42.992 54.348  1.00 49.39  ? 205  TRP A CA    1 
ATOM   2159 C  C     . TRP C 3 205 ? 60.949  -41.561 54.704  1.00 53.22  ? 205  TRP A C     1 
ATOM   2160 O  O     . TRP C 3 205 ? 61.139  -40.637 53.905  1.00 53.33  ? 205  TRP A O     1 
ATOM   2161 C  CB    . TRP C 3 205 ? 60.261  -43.692 53.550  1.00 42.18  ? 205  TRP A CB    1 
ATOM   2162 C  CG    . TRP C 3 205 ? 59.923  -43.084 52.225  1.00 39.24  ? 205  TRP A CG    1 
ATOM   2163 C  CD1   . TRP C 3 205 ? 59.129  -42.007 52.003  1.00 41.89  ? 205  TRP A CD1   1 
ATOM   2164 C  CD2   . TRP C 3 205 ? 60.261  -43.609 50.930  1.00 48.29  ? 205  TRP A CD2   1 
ATOM   2165 N  NE1   . TRP C 3 205 ? 58.930  -41.826 50.650  1.00 43.60  ? 205  TRP A NE1   1 
ATOM   2166 C  CE2   . TRP C 3 205 ? 59.617  -42.794 49.968  1.00 46.19  ? 205  TRP A CE2   1 
ATOM   2167 C  CE3   . TRP C 3 205 ? 61.046  -44.689 50.487  1.00 50.34  ? 205  TRP A CE3   1 
ATOM   2168 C  CZ2   . TRP C 3 205 ? 59.722  -43.029 48.587  1.00 45.99  ? 205  TRP A CZ2   1 
ATOM   2169 C  CZ3   . TRP C 3 205 ? 61.152  -44.925 49.110  1.00 55.79  ? 205  TRP A CZ3   1 
ATOM   2170 C  CH2   . TRP C 3 205 ? 60.491  -44.091 48.177  1.00 50.49  ? 205  TRP A CH2   1 
ATOM   2171 N  N     . GLN C 3 206 ? 60.381  -41.370 55.893  1.00 55.79  ? 206  GLN A N     1 
ATOM   2172 C  CA    . GLN C 3 206 ? 59.981  -40.031 56.324  1.00 57.59  ? 206  GLN A CA    1 
ATOM   2173 C  C     . GLN C 3 206 ? 61.204  -39.300 56.865  1.00 55.50  ? 206  GLN A C     1 
ATOM   2174 O  O     . GLN C 3 206 ? 61.361  -38.094 56.678  1.00 52.64  ? 206  GLN A O     1 
ATOM   2175 C  CB    . GLN C 3 206 ? 58.892  -40.106 57.401  1.00 63.38  ? 206  GLN A CB    1 
ATOM   2176 C  CG    . GLN C 3 206 ? 57.553  -40.627 56.894  1.00 76.56  ? 206  GLN A CG    1 
ATOM   2177 C  CD    . GLN C 3 206 ? 57.019  -39.835 55.707  1.00 85.88  ? 206  GLN A CD    1 
ATOM   2178 O  OE1   . GLN C 3 206 ? 57.710  -38.986 55.130  1.00 90.19  ? 206  GLN A OE1   1 
ATOM   2179 N  NE2   . GLN C 3 206 ? 55.783  -40.119 55.330  1.00 89.71  ? 206  GLN A NE2   1 
ATOM   2180 N  N     . GLN C 3 207 ? 62.081  -40.062 57.511  1.00 55.59  ? 207  GLN A N     1 
ATOM   2181 C  CA    . GLN C 3 207 ? 63.302  -39.533 58.101  1.00 59.15  ? 207  GLN A CA    1 
ATOM   2182 C  C     . GLN C 3 207 ? 64.387  -39.262 57.053  1.00 54.07  ? 207  GLN A C     1 
ATOM   2183 O  O     . GLN C 3 207 ? 65.398  -38.626 57.341  1.00 56.16  ? 207  GLN A O     1 
ATOM   2184 C  CB    . GLN C 3 207 ? 63.818  -40.512 59.162  1.00 63.62  ? 207  GLN A CB    1 
ATOM   2185 C  CG    . GLN C 3 207 ? 64.833  -39.941 60.142  1.00 75.43  ? 207  GLN A CG    1 
ATOM   2186 C  CD    . GLN C 3 207 ? 66.212  -40.567 59.989  1.00 83.59  ? 207  GLN A CD    1 
ATOM   2187 O  OE1   . GLN C 3 207 ? 66.338  -41.782 59.816  1.00 87.28  ? 207  GLN A OE1   1 
ATOM   2188 N  NE2   . GLN C 3 207 ? 67.255  -39.738 60.065  1.00 83.89  ? 207  GLN A NE2   1 
ATOM   2189 N  N     . LYS C 3 208 ? 64.163  -39.744 55.836  1.00 49.43  ? 208  LYS A N     1 
ATOM   2190 C  CA    . LYS C 3 208 ? 65.095  -39.571 54.725  1.00 45.27  ? 208  LYS A CA    1 
ATOM   2191 C  C     . LYS C 3 208 ? 64.283  -39.617 53.433  1.00 45.45  ? 208  LYS A C     1 
ATOM   2192 O  O     . LYS C 3 208 ? 64.454  -40.503 52.610  1.00 49.31  ? 208  LYS A O     1 
ATOM   2193 C  CB    . LYS C 3 208 ? 66.125  -40.701 54.716  1.00 44.27  ? 208  LYS A CB    1 
ATOM   2194 C  CG    . LYS C 3 208 ? 66.933  -40.840 55.989  1.00 47.21  ? 208  LYS A CG    1 
ATOM   2195 C  CD    . LYS C 3 208 ? 67.802  -42.078 55.928  1.00 50.28  ? 208  LYS A CD    1 
ATOM   2196 C  CE    . LYS C 3 208 ? 68.583  -42.267 57.209  1.00 47.44  ? 208  LYS A CE    1 
ATOM   2197 N  NZ    . LYS C 3 208 ? 69.475  -41.115 57.486  1.00 57.15  ? 208  LYS A NZ    1 
ATOM   2198 N  N     . THR C 3 209 ? 63.393  -38.655 53.260  1.00 42.85  ? 209  THR A N     1 
ATOM   2199 C  CA    . THR C 3 209 ? 62.562  -38.631 52.078  1.00 44.11  ? 209  THR A CA    1 
ATOM   2200 C  C     . THR C 3 209 ? 63.349  -38.304 50.804  1.00 41.57  ? 209  THR A C     1 
ATOM   2201 O  O     . THR C 3 209 ? 63.948  -37.241 50.688  1.00 43.31  ? 209  THR A O     1 
ATOM   2202 C  CB    . THR C 3 209 ? 61.409  -37.630 52.274  1.00 46.25  ? 209  THR A CB    1 
ATOM   2203 O  OG1   . THR C 3 209 ? 60.801  -37.877 53.545  1.00 45.73  ? 209  THR A OG1   1 
ATOM   2204 C  CG2   . THR C 3 209 ? 60.351  -37.779 51.181  1.00 38.02  ? 209  THR A CG2   1 
ATOM   2205 N  N     . PRO C 3 210 ? 63.343  -39.233 49.827  1.00 39.08  ? 210  PRO A N     1 
ATOM   2206 C  CA    . PRO C 3 210 ? 64.055  -39.046 48.561  1.00 35.18  ? 210  PRO A CA    1 
ATOM   2207 C  C     . PRO C 3 210 ? 63.557  -37.794 47.870  1.00 34.96  ? 210  PRO A C     1 
ATOM   2208 O  O     . PRO C 3 210 ? 62.435  -37.364 48.114  1.00 36.08  ? 210  PRO A O     1 
ATOM   2209 C  CB    . PRO C 3 210 ? 63.676  -40.298 47.753  1.00 39.33  ? 210  PRO A CB    1 
ATOM   2210 C  CG    . PRO C 3 210 ? 63.327  -41.326 48.791  1.00 39.82  ? 210  PRO A CG    1 
ATOM   2211 C  CD    . PRO C 3 210 ? 62.581  -40.501 49.815  1.00 37.41  ? 210  PRO A CD    1 
ATOM   2212 N  N     . VAL C 3 211 ? 64.399  -37.208 47.024  1.00 32.81  ? 211  VAL A N     1 
ATOM   2213 C  CA    . VAL C 3 211 ? 64.014  -36.036 46.243  1.00 32.53  ? 211  VAL A CA    1 
ATOM   2214 C  C     . VAL C 3 211 ? 63.886  -36.585 44.835  1.00 34.75  ? 211  VAL A C     1 
ATOM   2215 O  O     . VAL C 3 211 ? 62.995  -36.216 44.073  1.00 38.13  ? 211  VAL A O     1 
ATOM   2216 C  CB    . VAL C 3 211 ? 65.070  -34.918 46.306  1.00 33.11  ? 211  VAL A CB    1 
ATOM   2217 C  CG1   . VAL C 3 211 ? 64.779  -33.850 45.253  1.00 22.26  ? 211  VAL A CG1   1 
ATOM   2218 C  CG2   . VAL C 3 211 ? 65.035  -34.282 47.688  1.00 27.12  ? 211  VAL A CG2   1 
ATOM   2219 N  N     . ILE C 3 212 ? 64.788  -37.493 44.511  1.00 36.34  ? 212  ILE A N     1 
ATOM   2220 C  CA    . ILE C 3 212 ? 64.774  -38.166 43.228  1.00 35.67  ? 212  ILE A CA    1 
ATOM   2221 C  C     . ILE C 3 212 ? 64.838  -39.643 43.555  1.00 35.23  ? 212  ILE A C     1 
ATOM   2222 O  O     . ILE C 3 212 ? 65.603  -40.059 44.423  1.00 34.50  ? 212  ILE A O     1 
ATOM   2223 C  CB    . ILE C 3 212 ? 65.966  -37.742 42.347  1.00 36.82  ? 212  ILE A CB    1 
ATOM   2224 C  CG1   . ILE C 3 212 ? 65.739  -36.304 41.900  1.00 24.37  ? 212  ILE A CG1   1 
ATOM   2225 C  CG2   . ILE C 3 212 ? 66.111  -38.690 41.153  1.00 28.33  ? 212  ILE A CG2   1 
ATOM   2226 C  CD1   . ILE C 3 212 ? 66.612  -35.886 40.810  1.00 42.51  ? 212  ILE A CD1   1 
ATOM   2227 N  N     . LEU C 3 213 ? 64.006  -40.424 42.877  1.00 36.03  ? 213  LEU A N     1 
ATOM   2228 C  CA    . LEU C 3 213 ? 63.925  -41.860 43.106  1.00 34.76  ? 213  LEU A CA    1 
ATOM   2229 C  C     . LEU C 3 213 ? 64.250  -42.635 41.841  1.00 39.30  ? 213  LEU A C     1 
ATOM   2230 O  O     . LEU C 3 213 ? 63.662  -42.392 40.788  1.00 36.03  ? 213  LEU A O     1 
ATOM   2231 C  CB    . LEU C 3 213 ? 62.521  -42.208 43.591  1.00 27.45  ? 213  LEU A CB    1 
ATOM   2232 C  CG    . LEU C 3 213 ? 62.273  -43.535 44.295  1.00 31.90  ? 213  LEU A CG    1 
ATOM   2233 C  CD1   . LEU C 3 213 ? 63.330  -43.791 45.383  1.00 24.76  ? 213  LEU A CD1   1 
ATOM   2234 C  CD2   . LEU C 3 213 ? 60.857  -43.500 44.873  1.00 24.55  ? 213  LEU A CD2   1 
ATOM   2235 N  N     . THR C 3 214 ? 65.201  -43.559 41.952  1.00 44.74  ? 214  THR A N     1 
ATOM   2236 C  CA    . THR C 3 214 ? 65.619  -44.370 40.817  1.00 46.10  ? 214  THR A CA    1 
ATOM   2237 C  C     . THR C 3 214 ? 65.668  -45.864 41.158  1.00 47.34  ? 214  THR A C     1 
ATOM   2238 O  O     . THR C 3 214 ? 65.440  -46.275 42.307  1.00 46.45  ? 214  THR A O     1 
ATOM   2239 C  CB    . THR C 3 214 ? 67.009  -43.891 40.288  1.00 48.74  ? 214  THR A CB    1 
ATOM   2240 O  OG1   . THR C 3 214 ? 66.977  -43.806 38.855  1.00 47.48  ? 214  THR A OG1   1 
ATOM   2241 C  CG2   . THR C 3 214 ? 68.115  -44.841 40.721  1.00 47.18  ? 214  THR A CG2   1 
ATOM   2242 N  N     . GLY C 3 215 ? 65.978  -46.662 40.138  1.00 49.21  ? 215  GLY A N     1 
ATOM   2243 C  CA    . GLY C 3 215 ? 66.047  -48.107 40.261  1.00 47.40  ? 215  GLY A CA    1 
ATOM   2244 C  C     . GLY C 3 215 ? 65.897  -48.616 38.845  1.00 48.36  ? 215  GLY A C     1 
ATOM   2245 O  O     . GLY C 3 215 ? 65.862  -47.818 37.908  1.00 49.36  ? 215  GLY A O     1 
ATOM   2246 N  N     . TRP C 3 216 ? 65.814  -49.927 38.659  1.00 51.54  ? 216  TRP A N     1 
ATOM   2247 C  CA    . TRP C 3 216 ? 65.666  -50.444 37.307  1.00 46.24  ? 216  TRP A CA    1 
ATOM   2248 C  C     . TRP C 3 216 ? 64.242  -50.945 37.111  1.00 45.73  ? 216  TRP A C     1 
ATOM   2249 O  O     . TRP C 3 216 ? 63.943  -52.097 37.418  1.00 44.66  ? 216  TRP A O     1 
ATOM   2250 C  CB    . TRP C 3 216 ? 66.684  -51.559 37.037  1.00 38.24  ? 216  TRP A CB    1 
ATOM   2251 C  CG    . TRP C 3 216 ? 66.913  -51.788 35.560  1.00 37.82  ? 216  TRP A CG    1 
ATOM   2252 C  CD1   . TRP C 3 216 ? 66.307  -52.727 34.766  1.00 38.01  ? 216  TRP A CD1   1 
ATOM   2253 C  CD2   . TRP C 3 216 ? 67.730  -50.998 34.682  1.00 34.97  ? 216  TRP A CD2   1 
ATOM   2254 N  NE1   . TRP C 3 216 ? 66.696  -52.566 33.454  1.00 36.14  ? 216  TRP A NE1   1 
ATOM   2255 C  CE2   . TRP C 3 216 ? 67.569  -51.515 33.375  1.00 37.64  ? 216  TRP A CE2   1 
ATOM   2256 C  CE3   . TRP C 3 216 ? 68.578  -49.909 34.872  1.00 31.08  ? 216  TRP A CE3   1 
ATOM   2257 C  CZ2   . TRP C 3 216 ? 68.225  -50.968 32.263  1.00 40.92  ? 216  TRP A CZ2   1 
ATOM   2258 C  CZ3   . TRP C 3 216 ? 69.233  -49.364 33.762  1.00 37.54  ? 216  TRP A CZ3   1 
ATOM   2259 C  CH2   . TRP C 3 216 ? 69.054  -49.897 32.477  1.00 37.78  ? 216  TRP A CH2   1 
ATOM   2260 N  N     . ASN C 3 217 ? 63.382  -50.046 36.621  1.00 41.48  ? 217  ASN A N     1 
ATOM   2261 C  CA    . ASN C 3 217 ? 61.957  -50.288 36.348  1.00 39.72  ? 217  ASN A CA    1 
ATOM   2262 C  C     . ASN C 3 217 ? 61.066  -50.161 37.587  1.00 42.28  ? 217  ASN A C     1 
ATOM   2263 O  O     . ASN C 3 217 ? 60.023  -50.814 37.682  1.00 39.78  ? 217  ASN A O     1 
ATOM   2264 C  CB    . ASN C 3 217 ? 61.756  -51.669 35.719  1.00 39.92  ? 217  ASN A CB    1 
ATOM   2265 C  CG    . ASN C 3 217 ? 60.440  -51.786 34.963  1.00 41.74  ? 217  ASN A CG    1 
ATOM   2266 O  OD1   . ASN C 3 217 ? 60.197  -51.061 33.993  1.00 42.48  ? 217  ASN A OD1   1 
ATOM   2267 N  ND2   . ASN C 3 217 ? 59.591  -52.704 35.394  1.00 43.03  ? 217  ASN A ND2   1 
ATOM   2268 N  N     . VAL C 3 218 ? 61.482  -49.305 38.525  1.00 42.21  ? 218  VAL A N     1 
ATOM   2269 C  CA    . VAL C 3 218 ? 60.764  -49.067 39.782  1.00 37.62  ? 218  VAL A CA    1 
ATOM   2270 C  C     . VAL C 3 218 ? 59.428  -48.369 39.555  1.00 41.00  ? 218  VAL A C     1 
ATOM   2271 O  O     . VAL C 3 218 ? 58.539  -48.406 40.411  1.00 42.93  ? 218  VAL A O     1 
ATOM   2272 C  CB    . VAL C 3 218 ? 61.578  -48.165 40.743  1.00 40.54  ? 218  VAL A CB    1 
ATOM   2273 C  CG1   . VAL C 3 218 ? 62.835  -48.860 41.226  1.00 38.49  ? 218  VAL A CG1   1 
ATOM   2274 C  CG2   . VAL C 3 218 ? 61.942  -46.895 40.031  1.00 37.92  ? 218  VAL A CG2   1 
ATOM   2275 N  N     . GLU C 3 219 ? 59.286  -47.717 38.407  1.00 38.64  ? 219  GLU A N     1 
ATOM   2276 C  CA    . GLU C 3 219 ? 58.051  -47.016 38.094  1.00 39.22  ? 219  GLU A CA    1 
ATOM   2277 C  C     . GLU C 3 219 ? 56.868  -47.955 37.775  1.00 42.91  ? 219  GLU A C     1 
ATOM   2278 O  O     . GLU C 3 219 ? 55.767  -47.764 38.294  1.00 48.98  ? 219  GLU A O     1 
ATOM   2279 C  CB    . GLU C 3 219 ? 58.309  -46.041 36.947  1.00 33.97  ? 219  GLU A CB    1 
ATOM   2280 C  CG    . GLU C 3 219 ? 57.082  -45.356 36.399  1.00 42.66  ? 219  GLU A CG    1 
ATOM   2281 C  CD    . GLU C 3 219 ? 57.396  -44.565 35.135  1.00 57.46  ? 219  GLU A CD    1 
ATOM   2282 O  OE1   . GLU C 3 219 ? 58.134  -45.097 34.272  1.00 66.80  ? 219  GLU A OE1   1 
ATOM   2283 O  OE2   . GLU C 3 219 ? 56.904  -43.422 34.989  1.00 61.90  ? 219  GLU A OE2   1 
ATOM   2284 N  N     . SER C 3 220 ? 57.084  -48.969 36.939  1.00 45.08  ? 220  SER A N     1 
ATOM   2285 C  CA    . SER C 3 220 ? 56.009  -49.904 36.584  1.00 42.21  ? 220  SER A CA    1 
ATOM   2286 C  C     . SER C 3 220 ? 55.940  -51.172 37.448  1.00 42.08  ? 220  SER A C     1 
ATOM   2287 O  O     . SER C 3 220 ? 55.107  -52.045 37.211  1.00 47.14  ? 220  SER A O     1 
ATOM   2288 C  CB    . SER C 3 220 ? 56.129  -50.286 35.109  1.00 42.81  ? 220  SER A CB    1 
ATOM   2289 O  OG    . SER C 3 220 ? 57.438  -50.743 34.820  1.00 47.54  ? 220  SER A OG    1 
ATOM   2290 N  N     . PHE C 3 221 ? 56.797  -51.272 38.458  1.00 43.10  ? 221  PHE A N     1 
ATOM   2291 C  CA    . PHE C 3 221 ? 56.773  -52.436 39.330  1.00 44.53  ? 221  PHE A CA    1 
ATOM   2292 C  C     . PHE C 3 221 ? 57.020  -52.196 40.836  1.00 48.40  ? 221  PHE A C     1 
ATOM   2293 O  O     . PHE C 3 221 ? 56.111  -52.365 41.644  1.00 55.00  ? 221  PHE A O     1 
ATOM   2294 C  CB    . PHE C 3 221 ? 57.744  -53.490 38.803  1.00 45.50  ? 221  PHE A CB    1 
ATOM   2295 C  CG    . PHE C 3 221 ? 57.947  -54.631 39.741  1.00 48.09  ? 221  PHE A CG    1 
ATOM   2296 C  CD1   . PHE C 3 221 ? 56.945  -55.574 39.938  1.00 45.89  ? 221  PHE A CD1   1 
ATOM   2297 C  CD2   . PHE C 3 221 ? 59.110  -54.728 40.481  1.00 43.77  ? 221  PHE A CD2   1 
ATOM   2298 C  CE1   . PHE C 3 221 ? 57.103  -56.593 40.865  1.00 45.56  ? 221  PHE A CE1   1 
ATOM   2299 C  CE2   . PHE C 3 221 ? 59.276  -55.743 41.408  1.00 43.64  ? 221  PHE A CE2   1 
ATOM   2300 C  CZ    . PHE C 3 221 ? 58.271  -56.677 41.602  1.00 43.33  ? 221  PHE A CZ    1 
ATOM   2301 N  N     . ASP C 3 222 ? 58.243  -51.826 41.211  1.00 49.30  ? 222  ASP A N     1 
ATOM   2302 C  CA    . ASP C 3 222 ? 58.612  -51.584 42.617  1.00 45.50  ? 222  ASP A CA    1 
ATOM   2303 C  C     . ASP C 3 222 ? 57.754  -50.583 43.393  1.00 46.93  ? 222  ASP A C     1 
ATOM   2304 O  O     . ASP C 3 222 ? 57.279  -50.879 44.485  1.00 47.20  ? 222  ASP A O     1 
ATOM   2305 C  CB    . ASP C 3 222 ? 60.050  -51.114 42.679  1.00 48.71  ? 222  ASP A CB    1 
ATOM   2306 C  CG    . ASP C 3 222 ? 61.012  -52.171 42.245  1.00 48.96  ? 222  ASP A CG    1 
ATOM   2307 O  OD1   . ASP C 3 222 ? 61.311  -52.234 41.032  1.00 49.72  ? 222  ASP A OD1   1 
ATOM   2308 O  OD2   . ASP C 3 222 ? 61.459  -52.943 43.116  1.00 53.05  ? 222  ASP A OD2   1 
ATOM   2309 N  N     . ILE C 3 223 ? 57.574  -49.388 42.846  1.00 46.77  ? 223  ILE A N     1 
ATOM   2310 C  CA    . ILE C 3 223 ? 56.788  -48.371 43.528  1.00 48.35  ? 223  ILE A CA    1 
ATOM   2311 C  C     . ILE C 3 223 ? 55.312  -48.764 43.661  1.00 51.82  ? 223  ILE A C     1 
ATOM   2312 O  O     . ILE C 3 223 ? 54.750  -48.731 44.756  1.00 54.89  ? 223  ILE A O     1 
ATOM   2313 C  CB    . ILE C 3 223 ? 56.942  -47.020 42.811  1.00 47.46  ? 223  ILE A CB    1 
ATOM   2314 C  CG1   . ILE C 3 223 ? 58.414  -46.594 42.865  1.00 41.35  ? 223  ILE A CG1   1 
ATOM   2315 C  CG2   . ILE C 3 223 ? 56.050  -45.977 43.444  1.00 39.31  ? 223  ILE A CG2   1 
ATOM   2316 C  CD1   . ILE C 3 223 ? 58.736  -45.400 42.007  1.00 36.96  ? 223  ILE A CD1   1 
ATOM   2317 N  N     . PRO C 3 224 ? 54.658  -49.139 42.550  1.00 54.59  ? 224  PRO A N     1 
ATOM   2318 C  CA    . PRO C 3 224 ? 53.246  -49.524 42.680  1.00 51.82  ? 224  PRO A CA    1 
ATOM   2319 C  C     . PRO C 3 224 ? 53.094  -50.732 43.600  1.00 49.78  ? 224  PRO A C     1 
ATOM   2320 O  O     . PRO C 3 224 ? 52.119  -50.858 44.337  1.00 50.97  ? 224  PRO A O     1 
ATOM   2321 C  CB    . PRO C 3 224 ? 52.841  -49.833 41.242  1.00 47.98  ? 224  PRO A CB    1 
ATOM   2322 C  CG    . PRO C 3 224 ? 53.681  -48.868 40.456  1.00 56.79  ? 224  PRO A CG    1 
ATOM   2323 C  CD    . PRO C 3 224 ? 55.036  -48.999 41.129  1.00 57.71  ? 224  PRO A CD    1 
ATOM   2324 N  N     . TYR C 3 225 ? 54.077  -51.616 43.575  1.00 46.58  ? 225  TYR A N     1 
ATOM   2325 C  CA    . TYR C 3 225 ? 53.999  -52.794 44.415  1.00 48.34  ? 225  TYR A CA    1 
ATOM   2326 C  C     . TYR C 3 225 ? 54.122  -52.452 45.897  1.00 47.54  ? 225  TYR A C     1 
ATOM   2327 O  O     . TYR C 3 225 ? 53.363  -52.959 46.716  1.00 48.31  ? 225  TYR A O     1 
ATOM   2328 C  CB    . TYR C 3 225 ? 55.062  -53.817 44.006  1.00 55.34  ? 225  TYR A CB    1 
ATOM   2329 C  CG    . TYR C 3 225 ? 54.712  -55.208 44.469  1.00 57.90  ? 225  TYR A CG    1 
ATOM   2330 C  CD1   . TYR C 3 225 ? 53.774  -55.964 43.773  1.00 58.39  ? 225  TYR A CD1   1 
ATOM   2331 C  CD2   . TYR C 3 225 ? 55.215  -55.714 45.665  1.00 58.28  ? 225  TYR A CD2   1 
ATOM   2332 C  CE1   . TYR C 3 225 ? 53.334  -57.170 44.258  1.00 63.55  ? 225  TYR A CE1   1 
ATOM   2333 C  CE2   . TYR C 3 225 ? 54.784  -56.929 46.159  1.00 61.67  ? 225  TYR A CE2   1 
ATOM   2334 C  CZ    . TYR C 3 225 ? 53.835  -57.648 45.456  1.00 62.24  ? 225  TYR A CZ    1 
ATOM   2335 O  OH    . TYR C 3 225 ? 53.333  -58.807 45.984  1.00 58.94  ? 225  TYR A OH    1 
ATOM   2336 N  N     . VAL C 3 226 ? 55.081  -51.602 46.249  1.00 50.27  ? 226  VAL A N     1 
ATOM   2337 C  CA    . VAL C 3 226 ? 55.245  -51.199 47.642  1.00 46.51  ? 226  VAL A CA    1 
ATOM   2338 C  C     . VAL C 3 226 ? 54.018  -50.402 48.107  1.00 48.77  ? 226  VAL A C     1 
ATOM   2339 O  O     . VAL C 3 226 ? 53.578  -50.517 49.257  1.00 40.13  ? 226  VAL A O     1 
ATOM   2340 C  CB    . VAL C 3 226 ? 56.470  -50.313 47.811  1.00 45.81  ? 226  VAL A CB    1 
ATOM   2341 C  CG1   . VAL C 3 226 ? 56.567  -49.846 49.244  1.00 43.71  ? 226  VAL A CG1   1 
ATOM   2342 C  CG2   . VAL C 3 226 ? 57.713  -51.071 47.413  1.00 53.43  ? 226  VAL A CG2   1 
ATOM   2343 N  N     . TYR C 3 227 ? 53.471  -49.591 47.201  1.00 48.01  ? 227  TYR A N     1 
ATOM   2344 C  CA    . TYR C 3 227 ? 52.310  -48.768 47.512  1.00 48.99  ? 227  TYR A CA    1 
ATOM   2345 C  C     . TYR C 3 227 ? 51.075  -49.613 47.790  1.00 54.18  ? 227  TYR A C     1 
ATOM   2346 O  O     . TYR C 3 227 ? 50.492  -49.532 48.875  1.00 58.30  ? 227  TYR A O     1 
ATOM   2347 C  CB    . TYR C 3 227 ? 52.014  -47.816 46.364  1.00 45.40  ? 227  TYR A CB    1 
ATOM   2348 C  CG    . TYR C 3 227 ? 50.921  -46.818 46.673  1.00 50.37  ? 227  TYR A CG    1 
ATOM   2349 C  CD1   . TYR C 3 227 ? 51.136  -45.781 47.580  1.00 53.66  ? 227  TYR A CD1   1 
ATOM   2350 C  CD2   . TYR C 3 227 ? 49.680  -46.886 46.028  1.00 51.15  ? 227  TYR A CD2   1 
ATOM   2351 C  CE1   . TYR C 3 227 ? 50.145  -44.824 47.836  1.00 52.74  ? 227  TYR A CE1   1 
ATOM   2352 C  CE2   . TYR C 3 227 ? 48.682  -45.939 46.270  1.00 53.32  ? 227  TYR A CE2   1 
ATOM   2353 C  CZ    . TYR C 3 227 ? 48.923  -44.905 47.175  1.00 57.21  ? 227  TYR A CZ    1 
ATOM   2354 O  OH    . TYR C 3 227 ? 47.962  -43.939 47.383  1.00 54.97  ? 227  TYR A OH    1 
ATOM   2355 N  N     . ASN C 3 228 ? 50.683  -50.425 46.807  1.00 56.03  ? 228  ASN A N     1 
ATOM   2356 C  CA    . ASN C 3 228 ? 49.509  -51.280 46.939  1.00 47.18  ? 228  ASN A CA    1 
ATOM   2357 C  C     . ASN C 3 228 ? 49.650  -52.256 48.081  1.00 48.82  ? 228  ASN A C     1 
ATOM   2358 O  O     . ASN C 3 228 ? 48.692  -52.510 48.799  1.00 47.62  ? 228  ASN A O     1 
ATOM   2359 C  CB    . ASN C 3 228 ? 49.253  -52.031 45.643  1.00 43.98  ? 228  ASN A CB    1 
ATOM   2360 C  CG    . ASN C 3 228 ? 48.679  -51.138 44.576  1.00 45.77  ? 228  ASN A CG    1 
ATOM   2361 O  OD1   . ASN C 3 228 ? 47.592  -50.605 44.732  1.00 48.86  ? 228  ASN A OD1   1 
ATOM   2362 N  ND2   . ASN C 3 228 ? 49.412  -50.959 43.489  1.00 46.02  ? 228  ASN A ND2   1 
ATOM   2363 N  N     . ARG C 3 229 ? 50.849  -52.792 48.265  1.00 49.09  ? 229  ARG A N     1 
ATOM   2364 C  CA    . ARG C 3 229 ? 51.075  -53.732 49.345  1.00 51.52  ? 229  ARG A CA    1 
ATOM   2365 C  C     . ARG C 3 229 ? 50.741  -53.062 50.670  1.00 54.74  ? 229  ARG A C     1 
ATOM   2366 O  O     . ARG C 3 229 ? 49.818  -53.486 51.363  1.00 58.27  ? 229  ARG A O     1 
ATOM   2367 C  CB    . ARG C 3 229 ? 52.530  -54.200 49.345  1.00 55.60  ? 229  ARG A CB    1 
ATOM   2368 C  CG    . ARG C 3 229 ? 52.815  -55.327 50.326  1.00 62.67  ? 229  ARG A CG    1 
ATOM   2369 C  CD    . ARG C 3 229 ? 51.791  -56.444 50.176  1.00 66.42  ? 229  ARG A CD    1 
ATOM   2370 N  NE    . ARG C 3 229 ? 52.181  -57.663 50.875  1.00 67.94  ? 229  ARG A NE    1 
ATOM   2371 C  CZ    . ARG C 3 229 ? 51.391  -58.722 50.998  1.00 70.01  ? 229  ARG A CZ    1 
ATOM   2372 N  NH1   . ARG C 3 229 ? 50.176  -58.691 50.470  1.00 68.36  ? 229  ARG A NH1   1 
ATOM   2373 N  NH2   . ARG C 3 229 ? 51.813  -59.807 51.637  1.00 69.63  ? 229  ARG A NH2   1 
ATOM   2374 N  N     . ILE C 3 230 ? 51.489  -52.012 51.014  1.00 55.72  ? 230  ILE A N     1 
ATOM   2375 C  CA    . ILE C 3 230 ? 51.277  -51.280 52.260  1.00 49.82  ? 230  ILE A CA    1 
ATOM   2376 C  C     . ILE C 3 230 ? 49.814  -50.880 52.348  1.00 50.96  ? 230  ILE A C     1 
ATOM   2377 O  O     . ILE C 3 230 ? 49.193  -50.984 53.405  1.00 46.93  ? 230  ILE A O     1 
ATOM   2378 C  CB    . ILE C 3 230 ? 52.158  -50.013 52.330  1.00 49.18  ? 230  ILE A CB    1 
ATOM   2379 C  CG1   . ILE C 3 230 ? 53.625  -50.416 52.479  1.00 48.26  ? 230  ILE A CG1   1 
ATOM   2380 C  CG2   . ILE C 3 230 ? 51.749  -49.140 53.510  1.00 42.50  ? 230  ILE A CG2   1 
ATOM   2381 C  CD1   . ILE C 3 230 ? 54.551  -49.240 52.608  1.00 45.23  ? 230  ILE A CD1   1 
ATOM   2382 N  N     . LYS C 3 231 ? 49.267  -50.421 51.229  1.00 48.94  ? 231  LYS A N     1 
ATOM   2383 C  CA    . LYS C 3 231 ? 47.870  -50.046 51.190  1.00 52.26  ? 231  LYS A CA    1 
ATOM   2384 C  C     . LYS C 3 231 ? 47.074  -51.228 51.738  1.00 59.08  ? 231  LYS A C     1 
ATOM   2385 O  O     . LYS C 3 231 ? 46.493  -51.147 52.815  1.00 64.37  ? 231  LYS A O     1 
ATOM   2386 C  CB    . LYS C 3 231 ? 47.433  -49.768 49.757  1.00 51.14  ? 231  LYS A CB    1 
ATOM   2387 C  CG    . LYS C 3 231 ? 45.987  -49.340 49.647  1.00 51.59  ? 231  LYS A CG    1 
ATOM   2388 C  CD    . LYS C 3 231 ? 45.535  -49.262 48.210  1.00 51.77  ? 231  LYS A CD    1 
ATOM   2389 C  CE    . LYS C 3 231 ? 44.086  -48.836 48.156  1.00 56.49  ? 231  LYS A CE    1 
ATOM   2390 N  NZ    . LYS C 3 231 ? 43.482  -49.044 46.815  1.00 61.92  ? 231  LYS A NZ    1 
ATOM   2391 N  N     . ASN C 3 232 ? 47.063  -52.326 50.987  1.00 63.24  ? 232  ASN A N     1 
ATOM   2392 C  CA    . ASN C 3 232 ? 46.359  -53.551 51.369  1.00 62.61  ? 232  ASN A CA    1 
ATOM   2393 C  C     . ASN C 3 232 ? 46.374  -53.881 52.857  1.00 64.48  ? 232  ASN A C     1 
ATOM   2394 O  O     . ASN C 3 232 ? 45.342  -54.216 53.443  1.00 65.90  ? 232  ASN A O     1 
ATOM   2395 C  CB    . ASN C 3 232 ? 46.953  -54.747 50.625  1.00 60.06  ? 232  ASN A CB    1 
ATOM   2396 C  CG    . ASN C 3 232 ? 46.330  -54.960 49.260  1.00 55.00  ? 232  ASN A CG    1 
ATOM   2397 O  OD1   . ASN C 3 232 ? 46.776  -55.810 48.496  1.00 57.37  ? 232  ASN A OD1   1 
ATOM   2398 N  ND2   . ASN C 3 232 ? 45.288  -54.197 48.954  1.00 48.30  ? 232  ASN A ND2   1 
ATOM   2399 N  N     . ILE C 3 233 ? 47.554  -53.792 53.459  1.00 68.15  ? 233  ILE A N     1 
ATOM   2400 C  CA    . ILE C 3 233 ? 47.726  -54.110 54.875  1.00 69.96  ? 233  ILE A CA    1 
ATOM   2401 C  C     . ILE C 3 233 ? 47.431  -52.995 55.884  1.00 71.28  ? 233  ILE A C     1 
ATOM   2402 O  O     . ILE C 3 233 ? 47.019  -53.281 57.005  1.00 72.64  ? 233  ILE A O     1 
ATOM   2403 C  CB    . ILE C 3 233 ? 49.160  -54.593 55.158  1.00 68.02  ? 233  ILE A CB    1 
ATOM   2404 C  CG1   . ILE C 3 233 ? 49.510  -55.772 54.251  1.00 68.10  ? 233  ILE A CG1   1 
ATOM   2405 C  CG2   . ILE C 3 233 ? 49.290  -54.979 56.612  1.00 65.23  ? 233  ILE A CG2   1 
ATOM   2406 C  CD1   . ILE C 3 233 ? 50.983  -56.116 54.257  1.00 68.58  ? 233  ILE A CD1   1 
ATOM   2407 N  N     . PHE C 3 234 ? 47.641  -51.736 55.505  1.00 72.27  ? 234  PHE A N     1 
ATOM   2408 C  CA    . PHE C 3 234 ? 47.414  -50.642 56.443  1.00 68.21  ? 234  PHE A CA    1 
ATOM   2409 C  C     . PHE C 3 234 ? 46.412  -49.586 56.003  1.00 68.47  ? 234  PHE A C     1 
ATOM   2410 O  O     . PHE C 3 234 ? 45.991  -48.774 56.817  1.00 72.89  ? 234  PHE A O     1 
ATOM   2411 C  CB    . PHE C 3 234 ? 48.727  -49.938 56.773  1.00 65.45  ? 234  PHE A CB    1 
ATOM   2412 C  CG    . PHE C 3 234 ? 49.808  -50.853 57.272  1.00 67.60  ? 234  PHE A CG    1 
ATOM   2413 C  CD1   . PHE C 3 234 ? 50.578  -51.604 56.386  1.00 74.48  ? 234  PHE A CD1   1 
ATOM   2414 C  CD2   . PHE C 3 234 ? 50.089  -50.933 58.630  1.00 68.31  ? 234  PHE A CD2   1 
ATOM   2415 C  CE1   . PHE C 3 234 ? 51.627  -52.423 56.856  1.00 78.40  ? 234  PHE A CE1   1 
ATOM   2416 C  CE2   . PHE C 3 234 ? 51.131  -51.747 59.112  1.00 71.26  ? 234  PHE A CE2   1 
ATOM   2417 C  CZ    . PHE C 3 234 ? 51.903  -52.492 58.225  1.00 73.31  ? 234  PHE A CZ    1 
ATOM   2418 N  N     . GLY C 3 235 ? 46.035  -49.573 54.730  1.00 67.62  ? 235  GLY A N     1 
ATOM   2419 C  CA    . GLY C 3 235 ? 45.077  -48.576 54.270  1.00 64.24  ? 235  GLY A CA    1 
ATOM   2420 C  C     . GLY C 3 235 ? 45.706  -47.490 53.418  1.00 62.34  ? 235  GLY A C     1 
ATOM   2421 O  O     . GLY C 3 235 ? 46.790  -47.002 53.726  1.00 62.48  ? 235  GLY A O     1 
ATOM   2422 N  N     . GLU C 3 236 ? 45.014  -47.093 52.356  1.00 63.16  ? 236  GLU A N     1 
ATOM   2423 C  CA    . GLU C 3 236 ? 45.521  -46.079 51.438  1.00 66.68  ? 236  GLU A CA    1 
ATOM   2424 C  C     . GLU C 3 236 ? 45.911  -44.749 52.080  1.00 69.36  ? 236  GLU A C     1 
ATOM   2425 O  O     . GLU C 3 236 ? 46.623  -43.943 51.474  1.00 72.63  ? 236  GLU A O     1 
ATOM   2426 C  CB    . GLU C 3 236 ? 44.507  -45.822 50.320  1.00 63.75  ? 236  GLU A CB    1 
ATOM   2427 C  CG    . GLU C 3 236 ? 44.978  -44.792 49.314  1.00 68.86  ? 236  GLU A CG    1 
ATOM   2428 C  CD    . GLU C 3 236 ? 44.026  -44.618 48.153  1.00 75.39  ? 236  GLU A CD    1 
ATOM   2429 O  OE1   . GLU C 3 236 ? 42.797  -44.616 48.395  1.00 79.62  ? 236  GLU A OE1   1 
ATOM   2430 O  OE2   . GLU C 3 236 ? 44.510  -44.469 47.003  1.00 75.06  ? 236  GLU A OE2   1 
ATOM   2431 N  N     . SER C 3 237 ? 45.469  -44.517 53.308  1.00 67.33  ? 237  SER A N     1 
ATOM   2432 C  CA    . SER C 3 237 ? 45.793  -43.258 53.958  1.00 68.84  ? 237  SER A CA    1 
ATOM   2433 C  C     . SER C 3 237 ? 47.013  -43.344 54.856  1.00 66.81  ? 237  SER A C     1 
ATOM   2434 O  O     . SER C 3 237 ? 47.362  -42.376 55.525  1.00 72.42  ? 237  SER A O     1 
ATOM   2435 C  CB    . SER C 3 237 ? 44.593  -42.739 54.755  1.00 72.61  ? 237  SER A CB    1 
ATOM   2436 O  OG    . SER C 3 237 ? 44.796  -41.386 55.145  1.00 71.55  ? 237  SER A OG    1 
ATOM   2437 N  N     . THR C 3 238 ? 47.652  -44.505 54.885  1.00 60.31  ? 238  THR A N     1 
ATOM   2438 C  CA    . THR C 3 238 ? 48.855  -44.679 55.681  1.00 61.44  ? 238  THR A CA    1 
ATOM   2439 C  C     . THR C 3 238 ? 49.858  -45.289 54.731  1.00 61.78  ? 238  THR A C     1 
ATOM   2440 O  O     . THR C 3 238 ? 50.905  -45.807 55.120  1.00 63.56  ? 238  THR A O     1 
ATOM   2441 C  CB    . THR C 3 238 ? 48.621  -45.599 56.902  1.00 64.22  ? 238  THR A CB    1 
ATOM   2442 O  OG1   . THR C 3 238 ? 49.609  -46.639 56.925  1.00 60.56  ? 238  THR A OG1   1 
ATOM   2443 C  CG2   . THR C 3 238 ? 47.215  -46.184 56.866  1.00 64.88  ? 238  THR A CG2   1 
ATOM   2444 N  N     . ALA C 3 239 ? 49.491  -45.213 53.458  1.00 63.83  ? 239  ALA A N     1 
ATOM   2445 C  CA    . ALA C 3 239 ? 50.297  -45.707 52.354  1.00 61.20  ? 239  ALA A CA    1 
ATOM   2446 C  C     . ALA C 3 239 ? 50.670  -44.445 51.608  1.00 59.11  ? 239  ALA A C     1 
ATOM   2447 O  O     . ALA C 3 239 ? 51.706  -44.375 50.965  1.00 61.88  ? 239  ALA A O     1 
ATOM   2448 C  CB    . ALA C 3 239 ? 49.475  -46.617 51.466  1.00 63.21  ? 239  ALA A CB    1 
ATOM   2449 N  N     . LYS C 3 240 ? 49.802  -43.446 51.698  1.00 56.44  ? 240  LYS A N     1 
ATOM   2450 C  CA    . LYS C 3 240 ? 50.045  -42.165 51.056  1.00 52.98  ? 240  LYS A CA    1 
ATOM   2451 C  C     . LYS C 3 240 ? 51.193  -41.445 51.768  1.00 52.48  ? 240  LYS A C     1 
ATOM   2452 O  O     . LYS C 3 240 ? 51.573  -40.339 51.387  1.00 54.21  ? 240  LYS A O     1 
ATOM   2453 C  CB    . LYS C 3 240 ? 48.778  -41.310 51.108  1.00 50.37  ? 240  LYS A CB    1 
ATOM   2454 C  CG    . LYS C 3 240 ? 47.756  -41.603 50.013  1.00 47.59  ? 240  LYS A CG    1 
ATOM   2455 C  CD    . LYS C 3 240 ? 46.380  -41.056 50.393  1.00 45.21  ? 240  LYS A CD    1 
ATOM   2456 C  CE    . LYS C 3 240 ? 45.510  -40.731 49.179  1.00 49.23  ? 240  LYS A CE    1 
ATOM   2457 N  NZ    . LYS C 3 240 ? 46.022  -39.540 48.413  1.00 52.52  ? 240  LYS A NZ    1 
ATOM   2458 N  N     . ARG C 3 241 ? 51.745  -42.079 52.798  1.00 50.32  ? 241  ARG A N     1 
ATOM   2459 C  CA    . ARG C 3 241 ? 52.842  -41.496 53.556  1.00 49.04  ? 241  ARG A CA    1 
ATOM   2460 C  C     . ARG C 3 241 ? 54.196  -41.657 52.857  1.00 51.40  ? 241  ARG A C     1 
ATOM   2461 O  O     . ARG C 3 241 ? 55.251  -41.428 53.446  1.00 53.01  ? 241  ARG A O     1 
ATOM   2462 C  CB    . ARG C 3 241 ? 52.889  -42.113 54.955  1.00 49.91  ? 241  ARG A CB    1 
ATOM   2463 C  CG    . ARG C 3 241 ? 51.598  -41.932 55.746  1.00 56.98  ? 241  ARG A CG    1 
ATOM   2464 C  CD    . ARG C 3 241 ? 51.848  -41.370 57.140  1.00 62.51  ? 241  ARG A CD    1 
ATOM   2465 N  NE    . ARG C 3 241 ? 51.924  -42.390 58.188  1.00 75.31  ? 241  ARG A NE    1 
ATOM   2466 C  CZ    . ARG C 3 241 ? 52.881  -43.312 58.300  1.00 79.94  ? 241  ARG A CZ    1 
ATOM   2467 N  NH1   . ARG C 3 241 ? 53.876  -43.368 57.422  1.00 79.65  ? 241  ARG A NH1   1 
ATOM   2468 N  NH2   . ARG C 3 241 ? 52.847  -44.185 59.301  1.00 85.67  ? 241  ARG A NH2   1 
ATOM   2469 N  N     . LEU C 3 242 ? 54.167  -42.071 51.597  1.00 53.31  ? 242  LEU A N     1 
ATOM   2470 C  CA    . LEU C 3 242 ? 55.391  -42.216 50.818  1.00 50.00  ? 242  LEU A CA    1 
ATOM   2471 C  C     . LEU C 3 242 ? 55.538  -40.882 50.111  1.00 53.35  ? 242  LEU A C     1 
ATOM   2472 O  O     . LEU C 3 242 ? 56.548  -40.609 49.464  1.00 57.88  ? 242  LEU A O     1 
ATOM   2473 C  CB    . LEU C 3 242 ? 55.248  -43.342 49.797  1.00 47.76  ? 242  LEU A CB    1 
ATOM   2474 C  CG    . LEU C 3 242 ? 55.249  -44.749 50.386  1.00 47.44  ? 242  LEU A CG    1 
ATOM   2475 C  CD1   . LEU C 3 242 ? 54.858  -45.755 49.324  1.00 44.30  ? 242  LEU A CD1   1 
ATOM   2476 C  CD2   . LEU C 3 242 ? 56.617  -45.060 50.943  1.00 48.21  ? 242  LEU A CD2   1 
ATOM   2477 N  N     . SER C 3 243 ? 54.494  -40.067 50.246  1.00 51.57  ? 243  SER A N     1 
ATOM   2478 C  CA    . SER C 3 243 ? 54.430  -38.730 49.678  1.00 52.42  ? 243  SER A CA    1 
ATOM   2479 C  C     . SER C 3 243 ? 54.685  -37.723 50.806  1.00 52.37  ? 243  SER A C     1 
ATOM   2480 O  O     . SER C 3 243 ? 53.907  -37.621 51.751  1.00 56.89  ? 243  SER A O     1 
ATOM   2481 C  CB    . SER C 3 243 ? 53.047  -38.494 49.063  1.00 54.50  ? 243  SER A CB    1 
ATOM   2482 O  OG    . SER C 3 243 ? 52.862  -37.137 48.699  1.00 53.23  ? 243  SER A OG    1 
ATOM   2483 N  N     . PRO C 3 244 ? 55.789  -36.971 50.724  1.00 51.13  ? 244  PRO A N     1 
ATOM   2484 C  CA    . PRO C 3 244 ? 56.099  -35.987 51.765  1.00 49.39  ? 244  PRO A CA    1 
ATOM   2485 C  C     . PRO C 3 244 ? 54.942  -35.023 52.049  1.00 50.43  ? 244  PRO A C     1 
ATOM   2486 O  O     . PRO C 3 244 ? 54.949  -34.340 53.071  1.00 53.56  ? 244  PRO A O     1 
ATOM   2487 C  CB    . PRO C 3 244 ? 57.330  -35.275 51.204  1.00 48.44  ? 244  PRO A CB    1 
ATOM   2488 C  CG    . PRO C 3 244 ? 57.142  -35.388 49.702  1.00 48.30  ? 244  PRO A CG    1 
ATOM   2489 C  CD    . PRO C 3 244 ? 56.674  -36.806 49.555  1.00 49.78  ? 244  PRO A CD    1 
ATOM   2490 N  N     . HIS C 3 245 ? 53.959  -34.975 51.145  1.00 46.84  ? 245  HIS A N     1 
ATOM   2491 C  CA    . HIS C 3 245 ? 52.783  -34.098 51.291  1.00 43.72  ? 245  HIS A CA    1 
ATOM   2492 C  C     . HIS C 3 245 ? 51.471  -34.872 51.462  1.00 44.44  ? 245  HIS A C     1 
ATOM   2493 O  O     . HIS C 3 245 ? 50.386  -34.301 51.346  1.00 39.64  ? 245  HIS A O     1 
ATOM   2494 C  CB    . HIS C 3 245 ? 52.634  -33.185 50.074  1.00 38.63  ? 245  HIS A CB    1 
ATOM   2495 C  CG    . HIS C 3 245 ? 53.867  -32.414 49.743  1.00 41.86  ? 245  HIS A CG    1 
ATOM   2496 N  ND1   . HIS C 3 245 ? 54.457  -31.538 50.629  1.00 45.38  ? 245  HIS A ND1   1 
ATOM   2497 C  CD2   . HIS C 3 245 ? 54.627  -32.390 48.624  1.00 47.18  ? 245  HIS A CD2   1 
ATOM   2498 C  CE1   . HIS C 3 245 ? 55.531  -31.008 50.069  1.00 42.02  ? 245  HIS A CE1   1 
ATOM   2499 N  NE2   . HIS C 3 245 ? 55.658  -31.510 48.853  1.00 47.45  ? 245  HIS A NE2   1 
ATOM   2500 N  N     . ARG C 3 246 ? 51.584  -36.171 51.716  1.00 48.02  ? 246  ARG A N     1 
ATOM   2501 C  CA    . ARG C 3 246 ? 50.430  -37.044 51.899  1.00 54.71  ? 246  ARG A CA    1 
ATOM   2502 C  C     . ARG C 3 246 ? 49.454  -36.981 50.723  1.00 52.31  ? 246  ARG A C     1 
ATOM   2503 O  O     . ARG C 3 246 ? 48.245  -37.080 50.906  1.00 49.68  ? 246  ARG A O     1 
ATOM   2504 C  CB    . ARG C 3 246 ? 49.670  -36.693 53.186  1.00 66.77  ? 246  ARG A CB    1 
ATOM   2505 C  CG    . ARG C 3 246 ? 50.515  -36.301 54.387  1.00 80.06  ? 246  ARG A CG    1 
ATOM   2506 C  CD    . ARG C 3 246 ? 51.520  -37.366 54.775  1.00 89.88  ? 246  ARG A CD    1 
ATOM   2507 N  NE    . ARG C 3 246 ? 52.135  -37.050 56.062  1.00 98.43  ? 246  ARG A NE    1 
ATOM   2508 C  CZ    . ARG C 3 246 ? 53.183  -37.686 56.575  1.00 102.77 ? 246  ARG A CZ    1 
ATOM   2509 N  NH1   . ARG C 3 246 ? 53.751  -38.682 55.910  1.00 105.14 ? 246  ARG A NH1   1 
ATOM   2510 N  NH2   . ARG C 3 246 ? 53.656  -37.331 57.765  1.00 105.68 ? 246  ARG A NH2   1 
ATOM   2511 N  N     . LYS C 3 247 ? 49.971  -36.796 49.516  1.00 48.89  ? 247  LYS A N     1 
ATOM   2512 C  CA    . LYS C 3 247 ? 49.110  -36.772 48.348  1.00 46.61  ? 247  LYS A CA    1 
ATOM   2513 C  C     . LYS C 3 247 ? 49.699  -37.638 47.248  1.00 46.98  ? 247  LYS A C     1 
ATOM   2514 O  O     . LYS C 3 247 ? 50.886  -37.543 46.937  1.00 47.01  ? 247  LYS A O     1 
ATOM   2515 C  CB    . LYS C 3 247 ? 48.900  -35.352 47.818  1.00 42.16  ? 247  LYS A CB    1 
ATOM   2516 C  CG    . LYS C 3 247 ? 48.055  -35.363 46.553  1.00 45.21  ? 247  LYS A CG    1 
ATOM   2517 C  CD    . LYS C 3 247 ? 47.622  -33.994 46.058  1.00 50.80  ? 247  LYS A CD    1 
ATOM   2518 C  CE    . LYS C 3 247 ? 46.603  -34.168 44.929  1.00 55.23  ? 247  LYS A CE    1 
ATOM   2519 N  NZ    . LYS C 3 247 ? 46.087  -32.897 44.353  1.00 59.28  ? 247  LYS A NZ    1 
ATOM   2520 N  N     . THR C 3 248 ? 48.858  -38.494 46.674  1.00 46.39  ? 248  THR A N     1 
ATOM   2521 C  CA    . THR C 3 248 ? 49.265  -39.377 45.589  1.00 45.38  ? 248  THR A CA    1 
ATOM   2522 C  C     . THR C 3 248 ? 48.170  -39.369 44.542  1.00 45.10  ? 248  THR A C     1 
ATOM   2523 O  O     . THR C 3 248 ? 47.096  -38.839 44.770  1.00 47.78  ? 248  THR A O     1 
ATOM   2524 C  CB    . THR C 3 248 ? 49.431  -40.811 46.055  1.00 43.36  ? 248  THR A CB    1 
ATOM   2525 O  OG1   . THR C 3 248 ? 48.135  -41.368 46.309  1.00 52.69  ? 248  THR A OG1   1 
ATOM   2526 C  CG2   . THR C 3 248 ? 50.274  -40.869 47.317  1.00 45.67  ? 248  THR A CG2   1 
ATOM   2527 N  N     . ARG C 3 249 ? 48.452  -39.952 43.389  1.00 45.46  ? 249  ARG A N     1 
ATOM   2528 C  CA    . ARG C 3 249 ? 47.482  -40.032 42.310  1.00 51.48  ? 249  ARG A CA    1 
ATOM   2529 C  C     . ARG C 3 249 ? 47.747  -41.313 41.538  1.00 53.66  ? 249  ARG A C     1 
ATOM   2530 O  O     . ARG C 3 249 ? 48.763  -41.437 40.862  1.00 55.84  ? 249  ARG A O     1 
ATOM   2531 C  CB    . ARG C 3 249 ? 47.607  -38.832 41.367  1.00 54.94  ? 249  ARG A CB    1 
ATOM   2532 C  CG    . ARG C 3 249 ? 46.977  -39.061 39.987  1.00 63.99  ? 249  ARG A CG    1 
ATOM   2533 C  CD    . ARG C 3 249 ? 47.385  -37.988 38.987  1.00 75.72  ? 249  ARG A CD    1 
ATOM   2534 N  NE    . ARG C 3 249 ? 46.447  -36.876 38.979  1.00 83.01  ? 249  ARG A NE    1 
ATOM   2535 C  CZ    . ARG C 3 249 ? 46.807  -35.599 38.947  1.00 87.59  ? 249  ARG A CZ    1 
ATOM   2536 N  NH1   . ARG C 3 249 ? 48.096  -35.273 38.920  1.00 85.79  ? 249  ARG A NH1   1 
ATOM   2537 N  NH2   . ARG C 3 249 ? 45.877  -34.651 38.945  1.00 91.93  ? 249  ARG A NH2   1 
ATOM   2538 N  N     . VAL C 3 250 ? 46.819  -42.258 41.637  1.00 57.73  ? 250  VAL A N     1 
ATOM   2539 C  CA    . VAL C 3 250 ? 46.935  -43.547 40.960  1.00 54.82  ? 250  VAL A CA    1 
ATOM   2540 C  C     . VAL C 3 250 ? 46.320  -43.617 39.574  1.00 52.62  ? 250  VAL A C     1 
ATOM   2541 O  O     . VAL C 3 250 ? 45.121  -43.434 39.413  1.00 52.87  ? 250  VAL A O     1 
ATOM   2542 C  CB    . VAL C 3 250 ? 46.275  -44.634 41.778  1.00 48.12  ? 250  VAL A CB    1 
ATOM   2543 C  CG1   . VAL C 3 250 ? 46.513  -45.977 41.123  1.00 51.62  ? 250  VAL A CG1   1 
ATOM   2544 C  CG2   . VAL C 3 250 ? 46.814  -44.593 43.195  1.00 53.29  ? 250  VAL A CG2   1 
ATOM   2545 N  N     . LYS C 3 251 ? 47.137  -43.899 38.572  1.00 56.73  ? 251  LYS A N     1 
ATOM   2546 C  CA    . LYS C 3 251 ? 46.619  -44.010 37.213  1.00 62.49  ? 251  LYS A CA    1 
ATOM   2547 C  C     . LYS C 3 251 ? 46.641  -45.481 36.815  1.00 64.18  ? 251  LYS A C     1 
ATOM   2548 O  O     . LYS C 3 251 ? 47.589  -46.197 37.133  1.00 67.32  ? 251  LYS A O     1 
ATOM   2549 C  CB    . LYS C 3 251 ? 47.469  -43.199 36.239  1.00 60.15  ? 251  LYS A CB    1 
ATOM   2550 C  CG    . LYS C 3 251 ? 46.878  -43.160 34.852  1.00 61.97  ? 251  LYS A CG    1 
ATOM   2551 C  CD    . LYS C 3 251 ? 47.816  -42.497 33.862  1.00 66.08  ? 251  LYS A CD    1 
ATOM   2552 C  CE    . LYS C 3 251 ? 47.159  -42.345 32.498  1.00 69.58  ? 251  LYS A CE    1 
ATOM   2553 N  NZ    . LYS C 3 251 ? 48.084  -41.732 31.504  1.00 73.80  ? 251  LYS A NZ    1 
ATOM   2554 N  N     . VAL C 3 252 ? 45.607  -45.932 36.115  1.00 65.62  ? 252  VAL A N     1 
ATOM   2555 C  CA    . VAL C 3 252 ? 45.529  -47.332 35.715  1.00 67.73  ? 252  VAL A CA    1 
ATOM   2556 C  C     . VAL C 3 252 ? 45.485  -47.567 34.220  1.00 69.72  ? 252  VAL A C     1 
ATOM   2557 O  O     . VAL C 3 252 ? 44.942  -46.761 33.465  1.00 67.73  ? 252  VAL A O     1 
ATOM   2558 C  CB    . VAL C 3 252 ? 44.296  -48.011 36.344  1.00 64.70  ? 252  VAL A CB    1 
ATOM   2559 C  CG1   . VAL C 3 252 ? 44.134  -49.423 35.789  1.00 61.59  ? 252  VAL A CG1   1 
ATOM   2560 C  CG2   . VAL C 3 252 ? 44.444  -48.034 37.869  1.00 63.33  ? 252  VAL A CG2   1 
ATOM   2561 N  N     . ILE C 3 253 ? 46.072  -48.683 33.796  1.00 76.73  ? 253  ILE A N     1 
ATOM   2562 C  CA    . ILE C 3 253 ? 46.088  -49.057 32.380  1.00 80.02  ? 253  ILE A CA    1 
ATOM   2563 C  C     . ILE C 3 253 ? 46.063  -50.573 32.165  1.00 84.23  ? 253  ILE A C     1 
ATOM   2564 O  O     . ILE C 3 253 ? 46.547  -51.349 33.004  1.00 83.24  ? 253  ILE A O     1 
ATOM   2565 C  CB    . ILE C 3 253 ? 47.317  -48.517 31.682  1.00 79.93  ? 253  ILE A CB    1 
ATOM   2566 C  CG1   . ILE C 3 253 ? 47.620  -47.093 32.142  1.00 73.13  ? 253  ILE A CG1   1 
ATOM   2567 C  CG2   . ILE C 3 253 ? 47.065  -48.548 30.193  1.00 81.43  ? 253  ILE A CG2   1 
ATOM   2568 C  CD1   . ILE C 3 253 ? 48.955  -46.574 31.651  1.00 68.58  ? 253  ILE A CD1   1 
ATOM   2569 N  N     . GLU C 3 254 ? 45.497  -50.990 31.038  1.00 91.87  ? 254  GLU A N     1 
ATOM   2570 C  CA    . GLU C 3 254 ? 45.416  -52.405 30.721  1.00 98.52  ? 254  GLU A CA    1 
ATOM   2571 C  C     . GLU C 3 254 ? 45.018  -52.587 29.221  1.00 100.47 ? 254  GLU A C     1 
ATOM   2572 O  O     . GLU C 3 254 ? 44.147  -51.889 28.719  1.00 100.51 ? 254  GLU A O     1 
ATOM   2573 C  CB    . GLU C 3 254 ? 44.424  -53.136 31.667  1.00 102.54 ? 254  GLU A CB    1 
ATOM   2574 C  CG    . GLU C 3 254 ? 43.672  -52.188 32.618  1.00 107.98 ? 254  GLU A CG    1 
ATOM   2575 C  CD    . GLU C 3 254 ? 43.161  -52.875 33.926  1.00 110.60 ? 254  GLU A CD    1 
ATOM   2576 O  OE1   . GLU C 3 254 ? 43.996  -53.420 34.680  1.00 111.31 ? 254  GLU A OE1   1 
ATOM   2577 O  OE2   . GLU C 3 254 ? 41.937  -52.844 34.153  1.00 111.75 ? 254  GLU A OE2   1 
ATOM   2578 N  N     . ASN C 3 255 ? 45.729  -53.490 28.546  1.00 103.73 ? 255  ASN A N     1 
ATOM   2579 C  CA    . ASN C 3 255 ? 45.481  -53.887 27.175  1.00 106.27 ? 255  ASN A CA    1 
ATOM   2580 C  C     . ASN C 3 255 ? 45.225  -55.389 27.146  1.00 108.61 ? 255  ASN A C     1 
ATOM   2581 O  O     . ASN C 3 255 ? 45.963  -56.147 27.672  1.00 108.96 ? 255  ASN A O     1 
ATOM   2582 C  CB    . ASN C 3 255 ? 46.714  -53.482 26.258  1.00 103.77 ? 255  ASN A CB    1 
ATOM   2583 C  CG    . ASN C 3 255 ? 48.002  -54.349 26.506  1.00 104.34 ? 255  ASN A CG    1 
ATOM   2584 O  OD1   . ASN C 3 255 ? 47.995  -55.259 27.394  1.00 103.67 ? 255  ASN A OD1   1 
ATOM   2585 N  ND2   . ASN C 3 255 ? 49.047  -54.092 25.789  1.00 101.97 ? 255  ASN A ND2   1 
ATOM   2586 N  N     . MET C 3 256 ? 44.089  -55.841 26.639  1.00 110.89 ? 256  MET A N     1 
ATOM   2587 C  CA    . MET C 3 256 ? 43.717  -57.185 26.477  1.00 114.18 ? 256  MET A CA    1 
ATOM   2588 C  C     . MET C 3 256 ? 44.008  -58.044 27.668  1.00 115.93 ? 256  MET A C     1 
ATOM   2589 O  O     . MET C 3 256 ? 43.179  -58.273 28.515  1.00 119.20 ? 256  MET A O     1 
ATOM   2590 C  CB    . MET C 3 256 ? 44.382  -57.756 25.219  1.00 115.04 ? 256  MET A CB    1 
ATOM   2591 C  CG    . MET C 3 256 ? 43.893  -57.200 23.911  1.00 118.01 ? 256  MET A CG    1 
ATOM   2592 S  SD    . MET C 3 256 ? 43.995  -58.210 22.443  1.00 122.09 ? 256  MET A SD    1 
ATOM   2593 C  CE    . MET C 3 256 ? 45.718  -58.604 22.425  1.00 121.90 ? 256  MET A CE    1 
ATOM   2594 N  N     . TYR C 3 257 ? 45.258  -58.490 27.817  1.00 114.29 ? 257  TYR A N     1 
ATOM   2595 C  CA    . TYR C 3 257 ? 45.590  -59.298 28.998  1.00 114.07 ? 257  TYR A CA    1 
ATOM   2596 C  C     . TYR C 3 257 ? 46.812  -58.800 29.814  1.00 110.48 ? 257  TYR A C     1 
ATOM   2597 O  O     . TYR C 3 257 ? 47.595  -59.568 30.427  1.00 110.92 ? 257  TYR A O     1 
ATOM   2598 C  CB    . TYR C 3 257 ? 45.785  -60.789 28.598  1.00 118.65 ? 257  TYR A CB    1 
ATOM   2599 C  CG    . TYR C 3 257 ? 45.855  -61.788 29.736  1.00 121.95 ? 257  TYR A CG    1 
ATOM   2600 C  CD1   . TYR C 3 257 ? 47.070  -62.070 30.349  1.00 122.09 ? 257  TYR A CD1   1 
ATOM   2601 C  CD2   . TYR C 3 257 ? 44.712  -62.445 30.196  1.00 122.09 ? 257  TYR A CD2   1 
ATOM   2602 C  CE1   . TYR C 3 257 ? 47.163  -62.977 31.396  1.00 122.09 ? 257  TYR A CE1   1 
ATOM   2603 C  CE2   . TYR C 3 257 ? 44.789  -63.368 31.255  1.00 122.09 ? 257  TYR A CE2   1 
ATOM   2604 C  CZ    . TYR C 3 257 ? 46.026  -63.632 31.847  1.00 122.09 ? 257  TYR A CZ    1 
ATOM   2605 O  OH    . TYR C 3 257 ? 46.156  -64.579 32.843  1.00 122.09 ? 257  TYR A OH    1 
ATOM   2606 N  N     . GLY C 3 258 ? 47.006  -57.502 29.769  1.00 105.59 ? 258  GLY A N     1 
ATOM   2607 C  CA    . GLY C 3 258 ? 48.114  -56.900 30.469  1.00 96.72  ? 258  GLY A CA    1 
ATOM   2608 C  C     . GLY C 3 258 ? 47.532  -55.691 31.139  1.00 92.63  ? 258  GLY A C     1 
ATOM   2609 O  O     . GLY C 3 258 ? 46.691  -55.038 30.550  1.00 90.55  ? 258  GLY A O     1 
ATOM   2610 N  N     . SER C 3 259 ? 47.954  -55.402 32.360  1.00 88.33  ? 259  SER A N     1 
ATOM   2611 C  CA    . SER C 3 259 ? 47.434  -54.260 33.087  1.00 84.41  ? 259  SER A CA    1 
ATOM   2612 C  C     . SER C 3 259 ? 48.463  -53.642 34.045  1.00 80.77  ? 259  SER A C     1 
ATOM   2613 O  O     . SER C 3 259 ? 49.253  -54.360 34.660  1.00 83.11  ? 259  SER A O     1 
ATOM   2614 C  CB    . SER C 3 259 ? 46.203  -54.656 33.898  1.00 87.76  ? 259  SER A CB    1 
ATOM   2615 O  OG    . SER C 3 259 ? 46.573  -55.261 35.130  1.00 93.25  ? 259  SER A OG    1 
ATOM   2616 N  N     . ARG C 3 260 ? 48.440  -52.319 34.206  1.00 72.46  ? 260  ARG A N     1 
ATOM   2617 C  CA    . ARG C 3 260 ? 49.409  -51.674 35.092  1.00 64.58  ? 260  ARG A CA    1 
ATOM   2618 C  C     . ARG C 3 260 ? 48.960  -50.435 35.856  1.00 59.83  ? 260  ARG A C     1 
ATOM   2619 O  O     . ARG C 3 260 ? 48.008  -49.752 35.478  1.00 55.83  ? 260  ARG A O     1 
ATOM   2620 C  CB    . ARG C 3 260 ? 50.683  -51.333 34.306  1.00 63.04  ? 260  ARG A CB    1 
ATOM   2621 C  CG    . ARG C 3 260 ? 51.636  -52.503 34.138  1.00 61.02  ? 260  ARG A CG    1 
ATOM   2622 C  CD    . ARG C 3 260 ? 51.984  -53.095 35.496  1.00 67.92  ? 260  ARG A CD    1 
ATOM   2623 N  NE    . ARG C 3 260 ? 52.726  -54.344 35.377  1.00 69.81  ? 260  ARG A NE    1 
ATOM   2624 C  CZ    . ARG C 3 260 ? 53.978  -54.436 34.942  1.00 65.13  ? 260  ARG A CZ    1 
ATOM   2625 N  NH1   . ARG C 3 260 ? 54.642  -53.350 34.585  1.00 63.59  ? 260  ARG A NH1   1 
ATOM   2626 N  NH2   . ARG C 3 260 ? 54.566  -55.618 34.861  1.00 63.53  ? 260  ARG A NH2   1 
ATOM   2627 N  N     . GLU C 3 261 ? 49.680  -50.152 36.936  1.00 55.78  ? 261  GLU A N     1 
ATOM   2628 C  CA    . GLU C 3 261 ? 49.410  -48.994 37.786  1.00 56.03  ? 261  GLU A CA    1 
ATOM   2629 C  C     . GLU C 3 261 ? 50.654  -48.135 37.956  1.00 52.22  ? 261  GLU A C     1 
ATOM   2630 O  O     . GLU C 3 261 ? 51.719  -48.656 38.254  1.00 56.14  ? 261  GLU A O     1 
ATOM   2631 C  CB    . GLU C 3 261 ? 48.981  -49.456 39.168  1.00 58.16  ? 261  GLU A CB    1 
ATOM   2632 C  CG    . GLU C 3 261 ? 47.551  -49.192 39.517  1.00 63.34  ? 261  GLU A CG    1 
ATOM   2633 C  CD    . GLU C 3 261 ? 47.247  -49.659 40.922  1.00 67.79  ? 261  GLU A CD    1 
ATOM   2634 O  OE1   . GLU C 3 261 ? 48.192  -50.178 41.557  1.00 65.14  ? 261  GLU A OE1   1 
ATOM   2635 O  OE2   . GLU C 3 261 ? 46.088  -49.515 41.383  1.00 71.02  ? 261  GLU A OE2   1 
ATOM   2636 N  N     . ILE C 3 262 ? 50.526  -46.828 37.773  1.00 47.85  ? 262  ILE A N     1 
ATOM   2637 C  CA    . ILE C 3 262 ? 51.667  -45.929 37.959  1.00 51.09  ? 262  ILE A CA    1 
ATOM   2638 C  C     . ILE C 3 262 ? 51.284  -44.878 39.001  1.00 47.93  ? 262  ILE A C     1 
ATOM   2639 O  O     . ILE C 3 262 ? 50.526  -43.942 38.748  1.00 46.80  ? 262  ILE A O     1 
ATOM   2640 C  CB    . ILE C 3 262 ? 52.092  -45.280 36.633  1.00 54.89  ? 262  ILE A CB    1 
ATOM   2641 C  CG1   . ILE C 3 262 ? 50.884  -44.588 35.997  1.00 64.76  ? 262  ILE A CG1   1 
ATOM   2642 C  CG2   . ILE C 3 262 ? 52.656  -46.363 35.689  1.00 55.55  ? 262  ILE A CG2   1 
ATOM   2643 C  CD1   . ILE C 3 262 ? 51.130  -44.022 34.601  1.00 71.30  ? 262  ILE A CD1   1 
ATOM   2644 N  N     . ILE C 3 263 ? 51.822  -45.071 40.194  1.00 44.33  ? 263  ILE A N     1 
ATOM   2645 C  CA    . ILE C 3 263 ? 51.525  -44.215 41.318  1.00 46.47  ? 263  ILE A CA    1 
ATOM   2646 C  C     . ILE C 3 263 ? 52.397  -42.980 41.439  1.00 44.54  ? 263  ILE A C     1 
ATOM   2647 O  O     . ILE C 3 263 ? 53.522  -43.061 41.910  1.00 45.78  ? 263  ILE A O     1 
ATOM   2648 C  CB    . ILE C 3 263 ? 51.603  -45.054 42.603  1.00 48.03  ? 263  ILE A CB    1 
ATOM   2649 C  CG1   . ILE C 3 263 ? 50.483  -46.092 42.563  1.00 54.56  ? 263  ILE A CG1   1 
ATOM   2650 C  CG2   . ILE C 3 263 ? 51.481  -44.177 43.840  1.00 52.33  ? 263  ILE A CG2   1 
ATOM   2651 C  CD1   . ILE C 3 263 ? 50.826  -47.380 43.240  1.00 58.99  ? 263  ILE A CD1   1 
ATOM   2652 N  N     . THR C 3 264 ? 51.873  -41.836 41.015  1.00 39.57  ? 264  THR A N     1 
ATOM   2653 C  CA    . THR C 3 264 ? 52.625  -40.596 41.116  1.00 44.68  ? 264  THR A CA    1 
ATOM   2654 C  C     . THR C 3 264 ? 52.629  -40.064 42.558  1.00 42.67  ? 264  THR A C     1 
ATOM   2655 O  O     . THR C 3 264 ? 51.590  -39.759 43.131  1.00 43.95  ? 264  THR A O     1 
ATOM   2656 C  CB    . THR C 3 264 ? 52.067  -39.509 40.158  1.00 46.38  ? 264  THR A CB    1 
ATOM   2657 O  OG1   . THR C 3 264 ? 51.541  -38.428 40.924  1.00 46.62  ? 264  THR A OG1   1 
ATOM   2658 C  CG2   . THR C 3 264 ? 50.979  -40.081 39.248  1.00 50.14  ? 264  THR A CG2   1 
ATOM   2659 N  N     . LEU C 3 265 ? 53.816  -39.977 43.143  1.00 43.51  ? 265  LEU A N     1 
ATOM   2660 C  CA    . LEU C 3 265 ? 53.971  -39.500 44.508  1.00 44.10  ? 265  LEU A CA    1 
ATOM   2661 C  C     . LEU C 3 265 ? 54.228  -38.004 44.522  1.00 46.25  ? 265  LEU A C     1 
ATOM   2662 O  O     . LEU C 3 265 ? 55.250  -37.541 44.032  1.00 51.66  ? 265  LEU A O     1 
ATOM   2663 C  CB    . LEU C 3 265 ? 55.151  -40.196 45.174  1.00 38.72  ? 265  LEU A CB    1 
ATOM   2664 C  CG    . LEU C 3 265 ? 55.145  -41.715 45.164  1.00 38.93  ? 265  LEU A CG    1 
ATOM   2665 C  CD1   . LEU C 3 265 ? 56.540  -42.210 45.508  1.00 39.15  ? 265  LEU A CD1   1 
ATOM   2666 C  CD2   . LEU C 3 265 ? 54.100  -42.236 46.144  1.00 32.02  ? 265  LEU A CD2   1 
ATOM   2667 N  N     . PHE C 3 266 ? 53.305  -37.246 45.092  1.00 47.73  ? 266  PHE A N     1 
ATOM   2668 C  CA    . PHE C 3 266 ? 53.467  -35.803 45.158  1.00 46.03  ? 266  PHE A CA    1 
ATOM   2669 C  C     . PHE C 3 266 ? 54.646  -35.403 46.037  1.00 43.72  ? 266  PHE A C     1 
ATOM   2670 O  O     . PHE C 3 266 ? 54.852  -35.960 47.112  1.00 45.48  ? 266  PHE A O     1 
ATOM   2671 C  CB    . PHE C 3 266 ? 52.181  -35.157 45.676  1.00 47.91  ? 266  PHE A CB    1 
ATOM   2672 C  CG    . PHE C 3 266 ? 51.193  -34.837 44.598  1.00 42.23  ? 266  PHE A CG    1 
ATOM   2673 C  CD1   . PHE C 3 266 ? 50.633  -35.836 43.827  1.00 44.06  ? 266  PHE A CD1   1 
ATOM   2674 C  CD2   . PHE C 3 266 ? 50.859  -33.524 44.325  1.00 40.34  ? 266  PHE A CD2   1 
ATOM   2675 C  CE1   . PHE C 3 266 ? 49.753  -35.521 42.791  1.00 47.60  ? 266  PHE A CE1   1 
ATOM   2676 C  CE2   . PHE C 3 266 ? 49.984  -33.203 43.294  1.00 43.93  ? 266  PHE A CE2   1 
ATOM   2677 C  CZ    . PHE C 3 266 ? 49.433  -34.199 42.528  1.00 41.84  ? 266  PHE A CZ    1 
ATOM   2678 N  N     . GLY C 3 267 ? 55.434  -34.444 45.576  1.00 41.24  ? 267  GLY A N     1 
ATOM   2679 C  CA    . GLY C 3 267 ? 56.558  -34.012 46.382  1.00 43.90  ? 267  GLY A CA    1 
ATOM   2680 C  C     . GLY C 3 267 ? 57.859  -34.774 46.198  1.00 47.25  ? 267  GLY A C     1 
ATOM   2681 O  O     . GLY C 3 267 ? 58.819  -34.580 46.954  1.00 46.37  ? 267  GLY A O     1 
ATOM   2682 N  N     . ILE C 3 268 ? 57.904  -35.662 45.215  1.00 46.71  ? 268  ILE A N     1 
ATOM   2683 C  CA    . ILE C 3 268 ? 59.132  -36.389 44.950  1.00 46.59  ? 268  ILE A CA    1 
ATOM   2684 C  C     . ILE C 3 268 ? 59.224  -36.727 43.475  1.00 43.94  ? 268  ILE A C     1 
ATOM   2685 O  O     . ILE C 3 268 ? 58.243  -37.128 42.874  1.00 46.53  ? 268  ILE A O     1 
ATOM   2686 C  CB    . ILE C 3 268 ? 59.245  -37.655 45.825  1.00 45.62  ? 268  ILE A CB    1 
ATOM   2687 C  CG1   . ILE C 3 268 ? 59.799  -38.807 45.001  1.00 52.31  ? 268  ILE A CG1   1 
ATOM   2688 C  CG2   . ILE C 3 268 ? 57.926  -37.988 46.441  1.00 49.81  ? 268  ILE A CG2   1 
ATOM   2689 C  CD1   . ILE C 3 268 ? 60.038  -40.038 45.822  1.00 65.92  ? 268  ILE A CD1   1 
ATOM   2690 N  N     . SER C 3 269 ? 60.407  -36.529 42.897  1.00 47.09  ? 269  SER A N     1 
ATOM   2691 C  CA    . SER C 3 269 ? 60.649  -36.798 41.474  1.00 45.96  ? 269  SER A CA    1 
ATOM   2692 C  C     . SER C 3 269 ? 61.173  -38.196 41.153  1.00 46.26  ? 269  SER A C     1 
ATOM   2693 O  O     . SER C 3 269 ? 62.258  -38.582 41.588  1.00 49.10  ? 269  SER A O     1 
ATOM   2694 C  CB    . SER C 3 269 ? 61.618  -35.767 40.906  1.00 42.53  ? 269  SER A CB    1 
ATOM   2695 O  OG    . SER C 3 269 ? 60.944  -34.555 40.618  1.00 47.72  ? 269  SER A OG    1 
ATOM   2696 N  N     . VAL C 3 270 ? 60.397  -38.940 40.369  1.00 42.66  ? 270  VAL A N     1 
ATOM   2697 C  CA    . VAL C 3 270 ? 60.757  -40.290 39.968  1.00 33.79  ? 270  VAL A CA    1 
ATOM   2698 C  C     . VAL C 3 270 ? 61.364  -40.345 38.577  1.00 37.08  ? 270  VAL A C     1 
ATOM   2699 O  O     . VAL C 3 270 ? 60.693  -40.077 37.587  1.00 39.64  ? 270  VAL A O     1 
ATOM   2700 C  CB    . VAL C 3 270 ? 59.536  -41.206 39.991  1.00 34.76  ? 270  VAL A CB    1 
ATOM   2701 C  CG1   . VAL C 3 270 ? 59.798  -42.484 39.167  1.00 31.47  ? 270  VAL A CG1   1 
ATOM   2702 C  CG2   . VAL C 3 270 ? 59.193  -41.536 41.428  1.00 32.32  ? 270  VAL A CG2   1 
ATOM   2703 N  N     . LEU C 3 271 ? 62.646  -40.699 38.528  1.00 40.28  ? 271  LEU A N     1 
ATOM   2704 C  CA    . LEU C 3 271 ? 63.417  -40.852 37.290  1.00 37.71  ? 271  LEU A CA    1 
ATOM   2705 C  C     . LEU C 3 271 ? 63.897  -42.313 37.246  1.00 40.62  ? 271  LEU A C     1 
ATOM   2706 O  O     . LEU C 3 271 ? 64.997  -42.624 37.710  1.00 34.90  ? 271  LEU A O     1 
ATOM   2707 C  CB    . LEU C 3 271 ? 64.635  -39.929 37.296  1.00 33.72  ? 271  LEU A CB    1 
ATOM   2708 C  CG    . LEU C 3 271 ? 64.384  -38.423 37.289  1.00 41.60  ? 271  LEU A CG    1 
ATOM   2709 C  CD1   . LEU C 3 271 ? 65.686  -37.705 37.500  1.00 45.95  ? 271  LEU A CD1   1 
ATOM   2710 C  CD2   . LEU C 3 271 ? 63.762  -37.994 35.979  1.00 39.87  ? 271  LEU A CD2   1 
ATOM   2711 N  N     . ASP C 3 272 ? 63.046  -43.192 36.710  1.00 40.72  ? 272  ASP A N     1 
ATOM   2712 C  CA    . ASP C 3 272 ? 63.325  -44.626 36.582  1.00 40.64  ? 272  ASP A CA    1 
ATOM   2713 C  C     . ASP C 3 272 ? 64.509  -44.703 35.639  1.00 41.14  ? 272  ASP A C     1 
ATOM   2714 O  O     . ASP C 3 272 ? 64.451  -44.162 34.530  1.00 41.09  ? 272  ASP A O     1 
ATOM   2715 C  CB    . ASP C 3 272 ? 62.098  -45.342 35.984  1.00 44.95  ? 272  ASP A CB    1 
ATOM   2716 C  CG    . ASP C 3 272 ? 62.141  -46.850 36.168  1.00 44.47  ? 272  ASP A CG    1 
ATOM   2717 O  OD1   . ASP C 3 272 ? 63.147  -47.458 35.777  1.00 49.90  ? 272  ASP A OD1   1 
ATOM   2718 O  OD2   . ASP C 3 272 ? 61.170  -47.434 36.693  1.00 46.10  ? 272  ASP A OD2   1 
ATOM   2719 N  N     . TYR C 3 273 ? 65.581  -45.369 36.058  1.00 39.62  ? 273  TYR A N     1 
ATOM   2720 C  CA    . TYR C 3 273 ? 66.760  -45.409 35.203  1.00 42.21  ? 273  TYR A CA    1 
ATOM   2721 C  C     . TYR C 3 273 ? 66.570  -46.141 33.883  1.00 43.94  ? 273  TYR A C     1 
ATOM   2722 O  O     . TYR C 3 273 ? 67.232  -45.822 32.901  1.00 49.11  ? 273  TYR A O     1 
ATOM   2723 C  CB    . TYR C 3 273 ? 67.976  -45.968 35.954  1.00 42.07  ? 273  TYR A CB    1 
ATOM   2724 C  CG    . TYR C 3 273 ? 69.247  -45.176 35.661  1.00 43.29  ? 273  TYR A CG    1 
ATOM   2725 C  CD1   . TYR C 3 273 ? 69.924  -45.301 34.439  1.00 40.08  ? 273  TYR A CD1   1 
ATOM   2726 C  CD2   . TYR C 3 273 ? 69.735  -44.246 36.579  1.00 41.76  ? 273  TYR A CD2   1 
ATOM   2727 C  CE1   . TYR C 3 273 ? 71.050  -44.511 34.145  1.00 34.72  ? 273  TYR A CE1   1 
ATOM   2728 C  CE2   . TYR C 3 273 ? 70.854  -43.458 36.292  1.00 35.78  ? 273  TYR A CE2   1 
ATOM   2729 C  CZ    . TYR C 3 273 ? 71.504  -43.592 35.079  1.00 35.34  ? 273  TYR A CZ    1 
ATOM   2730 O  OH    . TYR C 3 273 ? 72.590  -42.790 34.800  1.00 31.34  ? 273  TYR A OH    1 
ATOM   2731 N  N     . ILE C 3 274 ? 65.665  -47.104 33.830  1.00 38.76  ? 274  ILE A N     1 
ATOM   2732 C  CA    . ILE C 3 274 ? 65.483  -47.790 32.572  1.00 41.19  ? 274  ILE A CA    1 
ATOM   2733 C  C     . ILE C 3 274 ? 64.823  -46.808 31.628  1.00 43.20  ? 274  ILE A C     1 
ATOM   2734 O  O     . ILE C 3 274 ? 65.190  -46.710 30.458  1.00 39.44  ? 274  ILE A O     1 
ATOM   2735 C  CB    . ILE C 3 274 ? 64.600  -49.050 32.709  1.00 39.84  ? 274  ILE A CB    1 
ATOM   2736 C  CG1   . ILE C 3 274 ? 64.643  -49.847 31.398  1.00 32.63  ? 274  ILE A CG1   1 
ATOM   2737 C  CG2   . ILE C 3 274 ? 63.164  -48.658 33.031  1.00 35.46  ? 274  ILE A CG2   1 
ATOM   2738 C  CD1   . ILE C 3 274 ? 63.850  -51.137 31.416  1.00 31.19  ? 274  ILE A CD1   1 
ATOM   2739 N  N     . ASP C 3 275 ? 63.852  -46.068 32.151  1.00 45.78  ? 275  ASP A N     1 
ATOM   2740 C  CA    . ASP C 3 275 ? 63.129  -45.093 31.343  1.00 47.36  ? 275  ASP A CA    1 
ATOM   2741 C  C     . ASP C 3 275 ? 64.149  -44.064 30.894  1.00 44.49  ? 275  ASP A C     1 
ATOM   2742 O  O     . ASP C 3 275 ? 64.107  -43.550 29.771  1.00 45.42  ? 275  ASP A O     1 
ATOM   2743 C  CB    . ASP C 3 275 ? 62.012  -44.415 32.165  1.00 48.52  ? 275  ASP A CB    1 
ATOM   2744 C  CG    . ASP C 3 275 ? 60.770  -45.308 32.356  1.00 53.85  ? 275  ASP A CG    1 
ATOM   2745 O  OD1   . ASP C 3 275 ? 60.878  -46.399 32.944  1.00 65.44  ? 275  ASP A OD1   1 
ATOM   2746 O  OD2   . ASP C 3 275 ? 59.669  -44.914 31.927  1.00 64.99  ? 275  ASP A OD2   1 
ATOM   2747 N  N     . LEU C 3 276 ? 65.090  -43.797 31.784  1.00 41.40  ? 276  LEU A N     1 
ATOM   2748 C  CA    . LEU C 3 276 ? 66.134  -42.814 31.547  1.00 42.74  ? 276  LEU A CA    1 
ATOM   2749 C  C     . LEU C 3 276 ? 67.168  -43.341 30.565  1.00 44.96  ? 276  LEU A C     1 
ATOM   2750 O  O     . LEU C 3 276 ? 67.551  -42.659 29.615  1.00 42.58  ? 276  LEU A O     1 
ATOM   2751 C  CB    . LEU C 3 276 ? 66.799  -42.478 32.884  1.00 43.69  ? 276  LEU A CB    1 
ATOM   2752 C  CG    . LEU C 3 276 ? 67.269  -41.057 33.175  1.00 42.69  ? 276  LEU A CG    1 
ATOM   2753 C  CD1   . LEU C 3 276 ? 66.188  -40.055 32.874  1.00 33.08  ? 276  LEU A CD1   1 
ATOM   2754 C  CD2   . LEU C 3 276 ? 67.662  -40.979 34.634  1.00 41.28  ? 276  LEU A CD2   1 
ATOM   2755 N  N     . TYR C 3 277 ? 67.605  -44.575 30.789  1.00 45.76  ? 277  TYR A N     1 
ATOM   2756 C  CA    . TYR C 3 277 ? 68.605  -45.177 29.928  1.00 45.46  ? 277  TYR A CA    1 
ATOM   2757 C  C     . TYR C 3 277 ? 68.128  -45.307 28.482  1.00 46.50  ? 277  TYR A C     1 
ATOM   2758 O  O     . TYR C 3 277 ? 68.927  -45.245 27.555  1.00 51.01  ? 277  TYR A O     1 
ATOM   2759 C  CB    . TYR C 3 277 ? 69.014  -46.541 30.465  1.00 45.48  ? 277  TYR A CB    1 
ATOM   2760 C  CG    . TYR C 3 277 ? 70.155  -47.136 29.685  1.00 48.59  ? 277  TYR A CG    1 
ATOM   2761 C  CD1   . TYR C 3 277 ? 69.922  -47.815 28.489  1.00 49.90  ? 277  TYR A CD1   1 
ATOM   2762 C  CD2   . TYR C 3 277 ? 71.476  -46.985 30.114  1.00 51.34  ? 277  TYR A CD2   1 
ATOM   2763 C  CE1   . TYR C 3 277 ? 70.979  -48.332 27.733  1.00 55.39  ? 277  TYR A CE1   1 
ATOM   2764 C  CE2   . TYR C 3 277 ? 72.541  -47.497 29.372  1.00 52.22  ? 277  TYR A CE2   1 
ATOM   2765 C  CZ    . TYR C 3 277 ? 72.285  -48.173 28.177  1.00 54.90  ? 277  TYR A CZ    1 
ATOM   2766 O  OH    . TYR C 3 277 ? 73.328  -48.705 27.438  1.00 52.20  ? 277  TYR A OH    1 
ATOM   2767 N  N     . LYS C 3 278 ? 66.829  -45.475 28.286  1.00 44.94  ? 278  LYS A N     1 
ATOM   2768 C  CA    . LYS C 3 278 ? 66.300  -45.604 26.939  1.00 43.54  ? 278  LYS A CA    1 
ATOM   2769 C  C     . LYS C 3 278 ? 66.228  -44.267 26.208  1.00 43.04  ? 278  LYS A C     1 
ATOM   2770 O  O     . LYS C 3 278 ? 66.199  -44.227 24.985  1.00 42.27  ? 278  LYS A O     1 
ATOM   2771 C  CB    . LYS C 3 278 ? 64.916  -46.254 26.974  1.00 41.77  ? 278  LYS A CB    1 
ATOM   2772 C  CG    . LYS C 3 278 ? 64.953  -47.761 27.167  1.00 47.06  ? 278  LYS A CG    1 
ATOM   2773 C  CD    . LYS C 3 278 ? 63.559  -48.356 27.384  1.00 50.66  ? 278  LYS A CD    1 
ATOM   2774 C  CE    . LYS C 3 278 ? 62.648  -48.184 26.168  1.00 46.29  ? 278  LYS A CE    1 
ATOM   2775 N  NZ    . LYS C 3 278 ? 61.294  -48.758 26.438  1.00 52.03  ? 278  LYS A NZ    1 
ATOM   2776 N  N     . LYS C 3 279 ? 66.228  -43.165 26.945  1.00 47.11  ? 279  LYS A N     1 
ATOM   2777 C  CA    . LYS C 3 279 ? 66.142  -41.873 26.282  1.00 49.59  ? 279  LYS A CA    1 
ATOM   2778 C  C     . LYS C 3 279 ? 67.467  -41.238 25.861  1.00 51.09  ? 279  LYS A C     1 
ATOM   2779 O  O     . LYS C 3 279 ? 67.610  -40.788 24.718  1.00 51.43  ? 279  LYS A O     1 
ATOM   2780 C  CB    . LYS C 3 279 ? 65.370  -40.867 27.140  1.00 47.82  ? 279  LYS A CB    1 
ATOM   2781 C  CG    . LYS C 3 279 ? 65.137  -39.562 26.401  1.00 51.06  ? 279  LYS A CG    1 
ATOM   2782 C  CD    . LYS C 3 279 ? 64.253  -38.577 27.149  1.00 53.15  ? 279  LYS A CD    1 
ATOM   2783 C  CE    . LYS C 3 279 ? 63.794  -37.459 26.203  1.00 53.40  ? 279  LYS A CE    1 
ATOM   2784 N  NZ    . LYS C 3 279 ? 62.833  -36.487 26.800  1.00 62.81  ? 279  LYS A NZ    1 
ATOM   2785 N  N     . PHE C 3 280 ? 68.435  -41.192 26.770  1.00 47.36  ? 280  PHE A N     1 
ATOM   2786 C  CA    . PHE C 3 280 ? 69.712  -40.566 26.449  1.00 50.44  ? 280  PHE A CA    1 
ATOM   2787 C  C     . PHE C 3 280 ? 70.800  -41.516 25.956  1.00 55.07  ? 280  PHE A C     1 
ATOM   2788 O  O     . PHE C 3 280 ? 71.903  -41.074 25.643  1.00 53.26  ? 280  PHE A O     1 
ATOM   2789 C  CB    . PHE C 3 280 ? 70.228  -39.788 27.665  1.00 43.10  ? 280  PHE A CB    1 
ATOM   2790 C  CG    . PHE C 3 280 ? 69.242  -38.810 28.213  1.00 41.63  ? 280  PHE A CG    1 
ATOM   2791 C  CD1   . PHE C 3 280 ? 68.766  -37.773 27.419  1.00 43.17  ? 280  PHE A CD1   1 
ATOM   2792 C  CD2   . PHE C 3 280 ? 68.740  -38.956 29.504  1.00 47.05  ? 280  PHE A CD2   1 
ATOM   2793 C  CE1   . PHE C 3 280 ? 67.795  -36.891 27.889  1.00 46.57  ? 280  PHE A CE1   1 
ATOM   2794 C  CE2   . PHE C 3 280 ? 67.762  -38.080 29.997  1.00 53.67  ? 280  PHE A CE2   1 
ATOM   2795 C  CZ    . PHE C 3 280 ? 67.286  -37.043 29.184  1.00 55.06  ? 280  PHE A CZ    1 
ATOM   2796 N  N     . SER C 3 281 ? 70.484  -42.805 25.868  1.00 58.97  ? 281  SER A N     1 
ATOM   2797 C  CA    . SER C 3 281 ? 71.450  -43.807 25.434  1.00 61.24  ? 281  SER A CA    1 
ATOM   2798 C  C     . SER C 3 281 ? 71.821  -43.685 23.962  1.00 65.45  ? 281  SER A C     1 
ATOM   2799 O  O     . SER C 3 281 ? 72.986  -43.833 23.585  1.00 65.93  ? 281  SER A O     1 
ATOM   2800 C  CB    . SER C 3 281 ? 70.900  -45.202 25.705  1.00 63.67  ? 281  SER A CB    1 
ATOM   2801 O  OG    . SER C 3 281 ? 71.923  -46.059 26.170  1.00 70.03  ? 281  SER A OG    1 
ATOM   2802 N  N     . PHE C 3 282 ? 70.820  -43.422 23.130  1.00 71.22  ? 282  PHE A N     1 
ATOM   2803 C  CA    . PHE C 3 282 ? 71.030  -43.272 21.696  1.00 75.94  ? 282  PHE A CA    1 
ATOM   2804 C  C     . PHE C 3 282 ? 71.682  -44.502 21.083  1.00 79.30  ? 282  PHE A C     1 
ATOM   2805 O  O     . PHE C 3 282 ? 72.410  -44.418 20.101  1.00 80.86  ? 282  PHE A O     1 
ATOM   2806 C  CB    . PHE C 3 282 ? 71.874  -42.030 21.442  1.00 74.28  ? 282  PHE A CB    1 
ATOM   2807 C  CG    . PHE C 3 282 ? 71.198  -40.767 21.865  1.00 72.78  ? 282  PHE A CG    1 
ATOM   2808 C  CD1   . PHE C 3 282 ? 69.846  -40.581 21.609  1.00 69.35  ? 282  PHE A CD1   1 
ATOM   2809 C  CD2   . PHE C 3 282 ? 71.898  -39.777 22.542  1.00 73.90  ? 282  PHE A CD2   1 
ATOM   2810 C  CE1   . PHE C 3 282 ? 69.197  -39.430 22.023  1.00 72.93  ? 282  PHE A CE1   1 
ATOM   2811 C  CE2   . PHE C 3 282 ? 71.257  -38.620 22.961  1.00 73.02  ? 282  PHE A CE2   1 
ATOM   2812 C  CZ    . PHE C 3 282 ? 69.902  -38.444 22.703  1.00 69.29  ? 282  PHE A CZ    1 
ATOM   2813 N  N     . THR C 3 283 ? 71.407  -45.647 21.685  1.00 83.98  ? 283  THR A N     1 
ATOM   2814 C  CA    . THR C 3 283 ? 71.935  -46.912 21.217  1.00 90.86  ? 283  THR A CA    1 
ATOM   2815 C  C     . THR C 3 283 ? 70.810  -47.906 21.389  1.00 90.57  ? 283  THR A C     1 
ATOM   2816 O  O     . THR C 3 283 ? 70.326  -48.100 22.509  1.00 90.49  ? 283  THR A O     1 
ATOM   2817 C  CB    . THR C 3 283 ? 73.131  -47.391 22.066  1.00 95.13  ? 283  THR A CB    1 
ATOM   2818 O  OG1   . THR C 3 283 ? 74.200  -46.443 21.976  1.00 101.36 ? 283  THR A OG1   1 
ATOM   2819 C  CG2   . THR C 3 283 ? 73.624  -48.746 21.569  1.00 99.18  ? 283  THR A CG2   1 
ATOM   2820 N  N     . ASN C 3 284 ? 70.373  -48.531 20.300  1.00 89.28  ? 284  ASN A N     1 
ATOM   2821 C  CA    . ASN C 3 284 ? 69.298  -49.490 20.451  1.00 87.08  ? 284  ASN A CA    1 
ATOM   2822 C  C     . ASN C 3 284 ? 69.800  -50.833 20.925  1.00 80.57  ? 284  ASN A C     1 
ATOM   2823 O  O     . ASN C 3 284 ? 70.476  -51.566 20.199  1.00 78.95  ? 284  ASN A O     1 
ATOM   2824 C  CB    . ASN C 3 284 ? 68.504  -49.692 19.163  1.00 93.79  ? 284  ASN A CB    1 
ATOM   2825 C  CG    . ASN C 3 284 ? 67.187  -50.419 19.416  1.00 99.82  ? 284  ASN A CG    1 
ATOM   2826 O  OD1   . ASN C 3 284 ? 66.501  -50.850 18.484  1.00 103.09 ? 284  ASN A OD1   1 
ATOM   2827 N  ND2   . ASN C 3 284 ? 66.825  -50.550 20.696  1.00 100.94 ? 284  ASN A ND2   1 
ATOM   2828 N  N     . GLN C 3 285 ? 69.474  -51.140 22.167  1.00 73.38  ? 285  GLN A N     1 
ATOM   2829 C  CA    . GLN C 3 285 ? 69.854  -52.404 22.736  1.00 70.77  ? 285  GLN A CA    1 
ATOM   2830 C  C     . GLN C 3 285 ? 68.741  -53.379 22.365  1.00 70.53  ? 285  GLN A C     1 
ATOM   2831 O  O     . GLN C 3 285 ? 67.551  -53.048 22.419  1.00 72.14  ? 285  GLN A O     1 
ATOM   2832 C  CB    . GLN C 3 285 ? 69.991  -52.268 24.251  1.00 73.15  ? 285  GLN A CB    1 
ATOM   2833 C  CG    . GLN C 3 285 ? 71.088  -51.312 24.675  1.00 73.34  ? 285  GLN A CG    1 
ATOM   2834 C  CD    . GLN C 3 285 ? 72.432  -51.720 24.129  1.00 74.28  ? 285  GLN A CD    1 
ATOM   2835 O  OE1   . GLN C 3 285 ? 72.579  -52.801 23.565  1.00 73.23  ? 285  GLN A OE1   1 
ATOM   2836 N  NE2   . GLN C 3 285 ? 73.428  -50.861 24.299  1.00 80.11  ? 285  GLN A NE2   1 
ATOM   2837 N  N     . PRO C 3 286 ? 69.114  -54.591 21.950  1.00 65.31  ? 286  PRO A N     1 
ATOM   2838 C  CA    . PRO C 3 286 ? 68.122  -55.598 21.571  1.00 61.38  ? 286  PRO A CA    1 
ATOM   2839 C  C     . PRO C 3 286 ? 67.347  -56.102 22.788  1.00 56.49  ? 286  PRO A C     1 
ATOM   2840 O  O     . PRO C 3 286 ? 66.360  -56.822 22.666  1.00 58.26  ? 286  PRO A O     1 
ATOM   2841 C  CB    . PRO C 3 286 ? 68.978  -56.677 20.921  1.00 62.02  ? 286  PRO A CB    1 
ATOM   2842 C  CG    . PRO C 3 286 ? 70.268  -56.566 21.691  1.00 58.84  ? 286  PRO A CG    1 
ATOM   2843 C  CD    . PRO C 3 286 ? 70.483  -55.090 21.749  1.00 60.43  ? 286  PRO A CD    1 
ATOM   2844 N  N     . SER C 3 287 ? 67.806  -55.692 23.962  1.00 53.38  ? 287  SER A N     1 
ATOM   2845 C  CA    . SER C 3 287 ? 67.210  -56.076 25.242  1.00 53.06  ? 287  SER A CA    1 
ATOM   2846 C  C     . SER C 3 287 ? 67.530  -54.961 26.238  1.00 55.52  ? 287  SER A C     1 
ATOM   2847 O  O     . SER C 3 287 ? 68.504  -54.228 26.055  1.00 53.87  ? 287  SER A O     1 
ATOM   2848 C  CB    . SER C 3 287 ? 67.835  -57.397 25.726  1.00 51.79  ? 287  SER A CB    1 
ATOM   2849 O  OG    . SER C 3 287 ? 67.503  -57.685 27.078  1.00 49.88  ? 287  SER A OG    1 
ATOM   2850 N  N     . TYR C 3 288 ? 66.720  -54.827 27.285  1.00 51.40  ? 288  TYR A N     1 
ATOM   2851 C  CA    . TYR C 3 288 ? 66.976  -53.797 28.288  1.00 46.77  ? 288  TYR A CA    1 
ATOM   2852 C  C     . TYR C 3 288 ? 66.982  -54.324 29.712  1.00 44.46  ? 288  TYR A C     1 
ATOM   2853 O  O     . TYR C 3 288 ? 66.658  -53.614 30.657  1.00 41.53  ? 288  TYR A O     1 
ATOM   2854 C  CB    . TYR C 3 288 ? 65.972  -52.659 28.139  1.00 44.16  ? 288  TYR A CB    1 
ATOM   2855 C  CG    . TYR C 3 288 ? 66.349  -51.713 27.027  1.00 48.08  ? 288  TYR A CG    1 
ATOM   2856 C  CD1   . TYR C 3 288 ? 67.376  -50.790 27.205  1.00 50.48  ? 288  TYR A CD1   1 
ATOM   2857 C  CD2   . TYR C 3 288 ? 65.701  -51.744 25.790  1.00 45.90  ? 288  TYR A CD2   1 
ATOM   2858 C  CE1   . TYR C 3 288 ? 67.754  -49.915 26.177  1.00 55.09  ? 288  TYR A CE1   1 
ATOM   2859 C  CE2   . TYR C 3 288 ? 66.068  -50.870 24.752  1.00 45.53  ? 288  TYR A CE2   1 
ATOM   2860 C  CZ    . TYR C 3 288 ? 67.095  -49.957 24.949  1.00 52.50  ? 288  TYR A CZ    1 
ATOM   2861 O  OH    . TYR C 3 288 ? 67.468  -49.089 23.931  1.00 47.49  ? 288  TYR A OH    1 
ATOM   2862 N  N     . SER C 3 289 ? 67.363  -55.582 29.864  1.00 44.95  ? 289  SER A N     1 
ATOM   2863 C  CA    . SER C 3 289 ? 67.412  -56.167 31.186  1.00 44.33  ? 289  SER A CA    1 
ATOM   2864 C  C     . SER C 3 289 ? 68.631  -55.625 31.914  1.00 44.36  ? 289  SER A C     1 
ATOM   2865 O  O     . SER C 3 289 ? 69.667  -55.342 31.302  1.00 45.54  ? 289  SER A O     1 
ATOM   2866 C  CB    . SER C 3 289 ? 67.487  -57.692 31.098  1.00 44.36  ? 289  SER A CB    1 
ATOM   2867 O  OG    . SER C 3 289 ? 68.701  -58.111 30.505  1.00 42.34  ? 289  SER A OG    1 
ATOM   2868 N  N     . LEU C 3 290 ? 68.504  -55.475 33.224  1.00 44.18  ? 290  LEU A N     1 
ATOM   2869 C  CA    . LEU C 3 290 ? 69.603  -54.970 34.032  1.00 49.62  ? 290  LEU A CA    1 
ATOM   2870 C  C     . LEU C 3 290 ? 70.830  -55.793 33.691  1.00 50.87  ? 290  LEU A C     1 
ATOM   2871 O  O     . LEU C 3 290 ? 71.934  -55.266 33.577  1.00 53.39  ? 290  LEU A O     1 
ATOM   2872 C  CB    . LEU C 3 290 ? 69.276  -55.115 35.524  1.00 46.05  ? 290  LEU A CB    1 
ATOM   2873 C  CG    . LEU C 3 290 ? 70.277  -54.462 36.483  1.00 44.11  ? 290  LEU A CG    1 
ATOM   2874 C  CD1   . LEU C 3 290 ? 70.421  -52.970 36.186  1.00 47.39  ? 290  LEU A CD1   1 
ATOM   2875 C  CD2   . LEU C 3 290 ? 69.794  -54.667 37.900  1.00 48.77  ? 290  LEU A CD2   1 
ATOM   2876 N  N     . ASP C 3 291 ? 70.604  -57.088 33.502  1.00 52.14  ? 291  ASP A N     1 
ATOM   2877 C  CA    . ASP C 3 291 ? 71.661  -58.039 33.183  1.00 55.03  ? 291  ASP A CA    1 
ATOM   2878 C  C     . ASP C 3 291 ? 72.368  -57.764 31.860  1.00 53.70  ? 291  ASP A C     1 
ATOM   2879 O  O     . ASP C 3 291 ? 73.599  -57.776 31.789  1.00 48.68  ? 291  ASP A O     1 
ATOM   2880 C  CB    . ASP C 3 291 ? 71.075  -59.448 33.170  1.00 65.61  ? 291  ASP A CB    1 
ATOM   2881 C  CG    . ASP C 3 291 ? 70.263  -59.752 34.424  1.00 79.01  ? 291  ASP A CG    1 
ATOM   2882 O  OD1   . ASP C 3 291 ? 69.247  -59.052 34.663  1.00 83.49  ? 291  ASP A OD1   1 
ATOM   2883 O  OD2   . ASP C 3 291 ? 70.646  -60.685 35.167  1.00 77.84  ? 291  ASP A OD2   1 
ATOM   2884 N  N     . TYR C 3 292 ? 71.593  -57.515 30.810  1.00 54.44  ? 292  TYR A N     1 
ATOM   2885 C  CA    . TYR C 3 292 ? 72.172  -57.257 29.497  1.00 56.14  ? 292  TYR A CA    1 
ATOM   2886 C  C     . TYR C 3 292 ? 72.873  -55.911 29.430  1.00 57.35  ? 292  TYR A C     1 
ATOM   2887 O  O     . TYR C 3 292 ? 74.011  -55.818 28.972  1.00 57.82  ? 292  TYR A O     1 
ATOM   2888 C  CB    . TYR C 3 292 ? 71.094  -57.324 28.416  1.00 58.72  ? 292  TYR A CB    1 
ATOM   2889 C  CG    . TYR C 3 292 ? 71.629  -57.079 27.030  1.00 62.19  ? 292  TYR A CG    1 
ATOM   2890 C  CD1   . TYR C 3 292 ? 72.736  -57.775 26.564  1.00 66.62  ? 292  TYR A CD1   1 
ATOM   2891 C  CD2   . TYR C 3 292 ? 71.023  -56.162 26.175  1.00 68.36  ? 292  TYR A CD2   1 
ATOM   2892 C  CE1   . TYR C 3 292 ? 73.229  -57.569 25.282  1.00 69.40  ? 292  TYR A CE1   1 
ATOM   2893 C  CE2   . TYR C 3 292 ? 71.509  -55.946 24.883  1.00 68.30  ? 292  TYR A CE2   1 
ATOM   2894 C  CZ    . TYR C 3 292 ? 72.612  -56.658 24.446  1.00 68.01  ? 292  TYR A CZ    1 
ATOM   2895 O  OH    . TYR C 3 292 ? 73.091  -56.484 23.170  1.00 68.07  ? 292  TYR A OH    1 
ATOM   2896 N  N     . ILE C 3 293 ? 72.189  -54.871 29.892  1.00 56.60  ? 293  ILE A N     1 
ATOM   2897 C  CA    . ILE C 3 293 ? 72.765  -53.541 29.866  1.00 53.05  ? 293  ILE A CA    1 
ATOM   2898 C  C     . ILE C 3 293 ? 73.980  -53.455 30.777  1.00 52.18  ? 293  ILE A C     1 
ATOM   2899 O  O     . ILE C 3 293 ? 74.949  -52.782 30.446  1.00 50.52  ? 293  ILE A O     1 
ATOM   2900 C  CB    . ILE C 3 293 ? 71.719  -52.463 30.267  1.00 51.60  ? 293  ILE A CB    1 
ATOM   2901 C  CG1   . ILE C 3 293 ? 70.972  -51.973 29.021  1.00 49.35  ? 293  ILE A CG1   1 
ATOM   2902 C  CG2   . ILE C 3 293 ? 72.404  -51.269 30.927  1.00 44.50  ? 293  ILE A CG2   1 
ATOM   2903 C  CD1   . ILE C 3 293 ? 70.234  -53.028 28.290  1.00 51.35  ? 293  ILE A CD1   1 
ATOM   2904 N  N     . SER C 3 294 ? 73.943  -54.142 31.914  1.00 50.89  ? 294  SER A N     1 
ATOM   2905 C  CA    . SER C 3 294 ? 75.071  -54.095 32.838  1.00 56.80  ? 294  SER A CA    1 
ATOM   2906 C  C     . SER C 3 294 ? 76.303  -54.748 32.207  1.00 56.85  ? 294  SER A C     1 
ATOM   2907 O  O     . SER C 3 294 ? 77.442  -54.376 32.493  1.00 57.62  ? 294  SER A O     1 
ATOM   2908 C  CB    . SER C 3 294 ? 74.703  -54.788 34.147  1.00 55.45  ? 294  SER A CB    1 
ATOM   2909 O  OG    . SER C 3 294 ? 74.467  -56.158 33.920  1.00 66.20  ? 294  SER A OG    1 
ATOM   2910 N  N     . GLU C 3 295 ? 76.064  -55.725 31.342  1.00 60.56  ? 295  GLU A N     1 
ATOM   2911 C  CA    . GLU C 3 295 ? 77.144  -56.412 30.643  1.00 58.65  ? 295  GLU A CA    1 
ATOM   2912 C  C     . GLU C 3 295 ? 77.744  -55.443 29.626  1.00 53.88  ? 295  GLU A C     1 
ATOM   2913 O  O     . GLU C 3 295 ? 78.946  -55.215 29.596  1.00 52.76  ? 295  GLU A O     1 
ATOM   2914 C  CB    . GLU C 3 295 ? 76.599  -57.641 29.919  1.00 67.68  ? 295  GLU A CB    1 
ATOM   2915 C  CG    . GLU C 3 295 ? 77.483  -58.126 28.780  1.00 82.33  ? 295  GLU A CG    1 
ATOM   2916 C  CD    . GLU C 3 295 ? 76.690  -58.456 27.522  1.00 90.98  ? 295  GLU A CD    1 
ATOM   2917 O  OE1   . GLU C 3 295 ? 75.861  -57.612 27.104  1.00 92.09  ? 295  GLU A OE1   1 
ATOM   2918 O  OE2   . GLU C 3 295 ? 76.903  -59.552 26.953  1.00 94.60  ? 295  GLU A OE2   1 
ATOM   2919 N  N     . PHE C 3 296 ? 76.881  -54.875 28.797  1.00 50.42  ? 296  PHE A N     1 
ATOM   2920 C  CA    . PHE C 3 296 ? 77.283  -53.930 27.772  1.00 51.68  ? 296  PHE A CA    1 
ATOM   2921 C  C     . PHE C 3 296 ? 78.124  -52.776 28.296  1.00 55.28  ? 296  PHE A C     1 
ATOM   2922 O  O     . PHE C 3 296 ? 79.191  -52.486 27.758  1.00 56.54  ? 296  PHE A O     1 
ATOM   2923 C  CB    . PHE C 3 296 ? 76.038  -53.359 27.113  1.00 50.99  ? 296  PHE A CB    1 
ATOM   2924 C  CG    . PHE C 3 296 ? 76.319  -52.370 26.023  1.00 55.23  ? 296  PHE A CG    1 
ATOM   2925 C  CD1   . PHE C 3 296 ? 76.419  -51.008 26.305  1.00 54.00  ? 296  PHE A CD1   1 
ATOM   2926 C  CD2   . PHE C 3 296 ? 76.417  -52.789 24.699  1.00 55.69  ? 296  PHE A CD2   1 
ATOM   2927 C  CE1   . PHE C 3 296 ? 76.603  -50.071 25.278  1.00 51.65  ? 296  PHE A CE1   1 
ATOM   2928 C  CE2   . PHE C 3 296 ? 76.599  -51.863 23.665  1.00 56.09  ? 296  PHE A CE2   1 
ATOM   2929 C  CZ    . PHE C 3 296 ? 76.690  -50.501 23.956  1.00 52.05  ? 296  PHE A CZ    1 
ATOM   2930 N  N     . GLU C 3 297 ? 77.624  -52.121 29.344  1.00 57.40  ? 297  GLU A N     1 
ATOM   2931 C  CA    . GLU C 3 297 ? 78.269  -50.953 29.953  1.00 55.61  ? 297  GLU A CA    1 
ATOM   2932 C  C     . GLU C 3 297 ? 79.365  -51.261 30.949  1.00 53.66  ? 297  GLU A C     1 
ATOM   2933 O  O     . GLU C 3 297 ? 80.209  -50.410 31.216  1.00 54.12  ? 297  GLU A O     1 
ATOM   2934 C  CB    . GLU C 3 297 ? 77.223  -50.087 30.673  1.00 57.46  ? 297  GLU A CB    1 
ATOM   2935 C  CG    . GLU C 3 297 ? 76.079  -49.590 29.802  1.00 56.35  ? 297  GLU A CG    1 
ATOM   2936 C  CD    . GLU C 3 297 ? 76.447  -48.365 28.987  1.00 60.39  ? 297  GLU A CD    1 
ATOM   2937 O  OE1   . GLU C 3 297 ? 77.617  -48.254 28.575  1.00 70.21  ? 297  GLU A OE1   1 
ATOM   2938 O  OE2   . GLU C 3 297 ? 75.561  -47.519 28.746  1.00 59.97  ? 297  GLU A OE2   1 
ATOM   2939 N  N     . LEU C 3 298 ? 79.361  -52.465 31.501  1.00 52.31  ? 298  LEU A N     1 
ATOM   2940 C  CA    . LEU C 3 298 ? 80.350  -52.802 32.518  1.00 60.08  ? 298  LEU A CA    1 
ATOM   2941 C  C     . LEU C 3 298 ? 81.175  -54.075 32.310  1.00 66.58  ? 298  LEU A C     1 
ATOM   2942 O  O     . LEU C 3 298 ? 82.029  -54.401 33.150  1.00 65.70  ? 298  LEU A O     1 
ATOM   2943 C  CB    . LEU C 3 298 ? 79.639  -52.912 33.865  1.00 54.58  ? 298  LEU A CB    1 
ATOM   2944 C  CG    . LEU C 3 298 ? 78.630  -51.818 34.208  1.00 50.80  ? 298  LEU A CG    1 
ATOM   2945 C  CD1   . LEU C 3 298 ? 77.818  -52.228 35.439  1.00 47.39  ? 298  LEU A CD1   1 
ATOM   2946 C  CD2   . LEU C 3 298 ? 79.369  -50.514 34.436  1.00 52.13  ? 298  LEU A CD2   1 
ATOM   2947 N  N     . ASN C 3 299 ? 80.930  -54.782 31.205  1.00 69.98  ? 299  ASN A N     1 
ATOM   2948 C  CA    . ASN C 3 299 ? 81.623  -56.041 30.917  1.00 69.15  ? 299  ASN A CA    1 
ATOM   2949 C  C     . ASN C 3 299 ? 81.687  -56.845 32.201  1.00 67.79  ? 299  ASN A C     1 
ATOM   2950 O  O     . ASN C 3 299 ? 82.750  -57.262 32.657  1.00 65.15  ? 299  ASN A O     1 
ATOM   2951 C  CB    . ASN C 3 299 ? 83.024  -55.788 30.353  1.00 68.58  ? 299  ASN A CB    1 
ATOM   2952 C  CG    . ASN C 3 299 ? 83.011  -55.551 28.845  1.00 74.27  ? 299  ASN A CG    1 
ATOM   2953 O  OD1   . ASN C 3 299 ? 84.056  -55.324 28.232  1.00 77.36  ? 299  ASN A OD1   1 
ATOM   2954 N  ND2   . ASN C 3 299 ? 81.824  -55.608 28.241  1.00 75.27  ? 299  ASN A ND2   1 
ATOM   2955 N  N     . VAL C 3 300 ? 80.503  -57.032 32.769  1.00 67.60  ? 300  VAL A N     1 
ATOM   2956 C  CA    . VAL C 3 300 ? 80.291  -57.761 34.007  1.00 70.18  ? 300  VAL A CA    1 
ATOM   2957 C  C     . VAL C 3 300 ? 79.304  -58.884 33.674  1.00 73.31  ? 300  VAL A C     1 
ATOM   2958 O  O     . VAL C 3 300 ? 78.342  -58.674 32.925  1.00 76.44  ? 300  VAL A O     1 
ATOM   2959 C  CB    . VAL C 3 300 ? 79.702  -56.812 35.074  1.00 69.59  ? 300  VAL A CB    1 
ATOM   2960 C  CG1   . VAL C 3 300 ? 79.333  -57.580 36.310  1.00 68.71  ? 300  VAL A CG1   1 
ATOM   2961 C  CG2   . VAL C 3 300 ? 80.722  -55.730 35.415  1.00 66.70  ? 300  VAL A CG2   1 
ATOM   2962 N  N     . GLY C 3 301 ? 79.537  -60.068 34.230  1.00 72.93  ? 301  GLY A N     1 
ATOM   2963 C  CA    . GLY C 3 301 ? 78.677  -61.197 33.926  1.00 73.69  ? 301  GLY A CA    1 
ATOM   2964 C  C     . GLY C 3 301 ? 77.411  -61.416 34.731  1.00 73.99  ? 301  GLY A C     1 
ATOM   2965 O  O     . GLY C 3 301 ? 77.310  -61.018 35.890  1.00 71.34  ? 301  GLY A O     1 
ATOM   2966 N  N     . LYS C 3 302 ? 76.446  -62.076 34.096  1.00 77.98  ? 302  LYS A N     1 
ATOM   2967 C  CA    . LYS C 3 302 ? 75.159  -62.396 34.710  1.00 83.08  ? 302  LYS A CA    1 
ATOM   2968 C  C     . LYS C 3 302 ? 75.325  -63.291 35.935  1.00 84.68  ? 302  LYS A C     1 
ATOM   2969 O  O     . LYS C 3 302 ? 75.374  -64.511 35.812  1.00 87.68  ? 302  LYS A O     1 
ATOM   2970 C  CB    . LYS C 3 302 ? 74.251  -63.090 33.689  1.00 83.47  ? 302  LYS A CB    1 
ATOM   2971 C  CG    . LYS C 3 302 ? 74.999  -63.972 32.689  1.00 93.01  ? 302  LYS A CG    1 
ATOM   2972 C  CD    . LYS C 3 302 ? 74.035  -64.656 31.726  1.00 98.51  ? 302  LYS A CD    1 
ATOM   2973 C  CE    . LYS C 3 302 ? 74.755  -65.200 30.499  1.00 100.63 ? 302  LYS A CE    1 
ATOM   2974 N  NZ    . LYS C 3 302 ? 73.791  -65.801 29.527  1.00 100.25 ? 302  LYS A NZ    1 
ATOM   2975 N  N     . LEU C 3 303 ? 75.408  -62.680 37.112  1.00 84.90  ? 303  LEU A N     1 
ATOM   2976 C  CA    . LEU C 3 303 ? 75.570  -63.409 38.367  1.00 86.78  ? 303  LEU A CA    1 
ATOM   2977 C  C     . LEU C 3 303 ? 74.842  -64.752 38.350  1.00 87.01  ? 303  LEU A C     1 
ATOM   2978 O  O     . LEU C 3 303 ? 73.625  -64.805 38.150  1.00 85.81  ? 303  LEU A O     1 
ATOM   2979 C  CB    . LEU C 3 303 ? 75.060  -62.545 39.516  1.00 87.93  ? 303  LEU A CB    1 
ATOM   2980 C  CG    . LEU C 3 303 ? 75.651  -61.139 39.503  1.00 89.44  ? 303  LEU A CG    1 
ATOM   2981 C  CD1   . LEU C 3 303 ? 75.163  -60.395 40.726  1.00 87.11  ? 303  LEU A CD1   1 
ATOM   2982 C  CD2   . LEU C 3 303 ? 77.187  -61.207 39.478  1.00 93.09  ? 303  LEU A CD2   1 
ATOM   2983 N  N     . LYS C 3 304 ? 75.596  -65.827 38.581  1.00 86.67  ? 304  LYS A N     1 
ATOM   2984 C  CA    . LYS C 3 304 ? 75.047  -67.186 38.554  1.00 85.98  ? 304  LYS A CA    1 
ATOM   2985 C  C     . LYS C 3 304 ? 74.376  -67.642 39.843  1.00 81.76  ? 304  LYS A C     1 
ATOM   2986 O  O     . LYS C 3 304 ? 74.724  -67.204 40.936  1.00 81.58  ? 304  LYS A O     1 
ATOM   2987 C  CB    . LYS C 3 304 ? 76.145  -68.211 38.211  1.00 89.23  ? 304  LYS A CB    1 
ATOM   2988 C  CG    . LYS C 3 304 ? 77.087  -67.822 37.074  1.00 95.81  ? 304  LYS A CG    1 
ATOM   2989 C  CD    . LYS C 3 304 ? 76.344  -67.571 35.768  1.00 100.18 ? 304  LYS A CD    1 
ATOM   2990 C  CE    . LYS C 3 304 ? 77.281  -67.023 34.691  1.00 98.21  ? 304  LYS A CE    1 
ATOM   2991 N  NZ    . LYS C 3 304 ? 76.566  -66.771 33.408  1.00 93.91  ? 304  LYS A NZ    1 
ATOM   2992 N  N     . TYR C 3 305 ? 73.416  -68.546 39.684  1.00 79.22  ? 305  TYR A N     1 
ATOM   2993 C  CA    . TYR C 3 305 ? 72.676  -69.150 40.785  1.00 78.19  ? 305  TYR A CA    1 
ATOM   2994 C  C     . TYR C 3 305 ? 71.799  -70.209 40.130  1.00 80.09  ? 305  TYR A C     1 
ATOM   2995 O  O     . TYR C 3 305 ? 71.170  -69.949 39.096  1.00 81.49  ? 305  TYR A O     1 
ATOM   2996 C  CB    . TYR C 3 305 ? 71.813  -68.115 41.513  1.00 75.32  ? 305  TYR A CB    1 
ATOM   2997 C  CG    . TYR C 3 305 ? 70.469  -67.833 40.872  1.00 78.83  ? 305  TYR A CG    1 
ATOM   2998 C  CD1   . TYR C 3 305 ? 69.384  -68.694 41.058  1.00 76.85  ? 305  TYR A CD1   1 
ATOM   2999 C  CD2   . TYR C 3 305 ? 70.282  -66.704 40.074  1.00 80.59  ? 305  TYR A CD2   1 
ATOM   3000 C  CE1   . TYR C 3 305 ? 68.152  -68.435 40.465  1.00 74.15  ? 305  TYR A CE1   1 
ATOM   3001 C  CE2   . TYR C 3 305 ? 69.054  -66.438 39.479  1.00 77.62  ? 305  TYR A CE2   1 
ATOM   3002 C  CZ    . TYR C 3 305 ? 67.996  -67.305 39.678  1.00 76.38  ? 305  TYR A CZ    1 
ATOM   3003 O  OH    . TYR C 3 305 ? 66.787  -67.039 39.081  1.00 77.59  ? 305  TYR A OH    1 
ATOM   3004 N  N     . ASP C 3 306 ? 71.758  -71.400 40.718  1.00 79.86  ? 306  ASP A N     1 
ATOM   3005 C  CA    . ASP C 3 306 ? 70.968  -72.480 40.145  1.00 80.64  ? 306  ASP A CA    1 
ATOM   3006 C  C     . ASP C 3 306 ? 69.611  -72.709 40.809  1.00 76.72  ? 306  ASP A C     1 
ATOM   3007 O  O     . ASP C 3 306 ? 69.405  -72.372 41.976  1.00 72.76  ? 306  ASP A O     1 
ATOM   3008 C  CB    . ASP C 3 306 ? 71.773  -73.781 40.168  1.00 84.49  ? 306  ASP A CB    1 
ATOM   3009 C  CG    . ASP C 3 306 ? 72.051  -74.262 41.574  1.00 87.25  ? 306  ASP A CG    1 
ATOM   3010 O  OD1   . ASP C 3 306 ? 72.842  -73.613 42.294  1.00 86.44  ? 306  ASP A OD1   1 
ATOM   3011 O  OD2   . ASP C 3 306 ? 71.463  -75.292 41.960  1.00 93.58  ? 306  ASP A OD2   1 
ATOM   3012 N  N     . GLY C 3 307 ? 68.696  -73.297 40.044  1.00 75.91  ? 307  GLY A N     1 
ATOM   3013 C  CA    . GLY C 3 307 ? 67.366  -73.578 40.542  1.00 74.96  ? 307  GLY A CA    1 
ATOM   3014 C  C     . GLY C 3 307 ? 66.329  -72.614 40.005  1.00 75.85  ? 307  GLY A C     1 
ATOM   3015 O  O     . GLY C 3 307 ? 66.673  -71.615 39.382  1.00 78.03  ? 307  GLY A O     1 
ATOM   3016 N  N     . PRO C 3 308 ? 65.039  -72.900 40.214  1.00 78.41  ? 308  PRO A N     1 
ATOM   3017 C  CA    . PRO C 3 308 ? 63.961  -72.028 39.744  1.00 80.21  ? 308  PRO A CA    1 
ATOM   3018 C  C     . PRO C 3 308 ? 63.938  -70.752 40.602  1.00 83.61  ? 308  PRO A C     1 
ATOM   3019 O  O     . PRO C 3 308 ? 64.027  -70.814 41.838  1.00 84.02  ? 308  PRO A O     1 
ATOM   3020 C  CB    . PRO C 3 308 ? 62.721  -72.894 39.932  1.00 76.72  ? 308  PRO A CB    1 
ATOM   3021 C  CG    . PRO C 3 308 ? 63.051  -73.648 41.172  1.00 79.37  ? 308  PRO A CG    1 
ATOM   3022 C  CD    . PRO C 3 308 ? 64.492  -74.067 40.925  1.00 80.04  ? 308  PRO A CD    1 
ATOM   3023 N  N     . ILE C 3 309 ? 63.820  -69.605 39.937  1.00 84.25  ? 309  ILE A N     1 
ATOM   3024 C  CA    . ILE C 3 309 ? 63.815  -68.296 40.596  1.00 82.59  ? 309  ILE A CA    1 
ATOM   3025 C  C     . ILE C 3 309 ? 62.804  -68.127 41.734  1.00 77.38  ? 309  ILE A C     1 
ATOM   3026 O  O     . ILE C 3 309 ? 63.093  -67.473 42.737  1.00 74.51  ? 309  ILE A O     1 
ATOM   3027 C  CB    . ILE C 3 309 ? 63.579  -67.171 39.557  1.00 88.62  ? 309  ILE A CB    1 
ATOM   3028 C  CG1   . ILE C 3 309 ? 63.877  -65.810 40.185  1.00 90.05  ? 309  ILE A CG1   1 
ATOM   3029 C  CG2   . ILE C 3 309 ? 62.137  -67.222 39.043  1.00 90.58  ? 309  ILE A CG2   1 
ATOM   3030 C  CD1   . ILE C 3 309 ? 63.786  -64.660 39.202  1.00 99.16  ? 309  ILE A CD1   1 
ATOM   3031 N  N     . SER C 3 310 ? 61.622  -68.713 41.575  1.00 74.49  ? 310  SER A N     1 
ATOM   3032 C  CA    . SER C 3 310 ? 60.564  -68.613 42.578  1.00 73.09  ? 310  SER A CA    1 
ATOM   3033 C  C     . SER C 3 310 ? 60.845  -69.307 43.900  1.00 70.36  ? 310  SER A C     1 
ATOM   3034 O  O     . SER C 3 310 ? 60.052  -69.211 44.833  1.00 67.01  ? 310  SER A O     1 
ATOM   3035 C  CB    . SER C 3 310 ? 59.257  -69.175 42.025  1.00 78.63  ? 310  SER A CB    1 
ATOM   3036 O  OG    . SER C 3 310 ? 58.341  -69.422 43.083  1.00 87.54  ? 310  SER A OG    1 
ATOM   3037 N  N     . LYS C 3 311 ? 61.961  -70.013 43.991  1.00 70.64  ? 311  LYS A N     1 
ATOM   3038 C  CA    . LYS C 3 311 ? 62.266  -70.709 45.220  1.00 67.98  ? 311  LYS A CA    1 
ATOM   3039 C  C     . LYS C 3 311 ? 63.688  -70.446 45.687  1.00 68.12  ? 311  LYS A C     1 
ATOM   3040 O  O     . LYS C 3 311 ? 64.149  -71.060 46.646  1.00 73.17  ? 311  LYS A O     1 
ATOM   3041 C  CB    . LYS C 3 311 ? 62.018  -72.213 45.034  1.00 72.80  ? 311  LYS A CB    1 
ATOM   3042 C  CG    . LYS C 3 311 ? 60.532  -72.590 44.998  1.00 78.90  ? 311  LYS A CG    1 
ATOM   3043 C  CD    . LYS C 3 311 ? 60.289  -74.066 44.687  1.00 79.80  ? 311  LYS A CD    1 
ATOM   3044 C  CE    . LYS C 3 311 ? 60.502  -74.354 43.207  1.00 84.50  ? 311  LYS A CE    1 
ATOM   3045 N  NZ    . LYS C 3 311 ? 60.151  -75.760 42.827  1.00 84.92  ? 311  LYS A NZ    1 
ATOM   3046 N  N     . LEU C 3 312 ? 64.380  -69.524 45.025  1.00 65.09  ? 312  LEU A N     1 
ATOM   3047 C  CA    . LEU C 3 312 ? 65.757  -69.199 45.398  1.00 62.13  ? 312  LEU A CA    1 
ATOM   3048 C  C     . LEU C 3 312 ? 65.897  -68.711 46.844  1.00 62.49  ? 312  LEU A C     1 
ATOM   3049 O  O     . LEU C 3 312 ? 66.992  -68.734 47.414  1.00 60.80  ? 312  LEU A O     1 
ATOM   3050 C  CB    . LEU C 3 312 ? 66.334  -68.151 44.440  1.00 57.47  ? 312  LEU A CB    1 
ATOM   3051 C  CG    . LEU C 3 312 ? 67.703  -67.522 44.751  1.00 54.87  ? 312  LEU A CG    1 
ATOM   3052 C  CD1   . LEU C 3 312 ? 68.720  -68.569 45.150  1.00 53.79  ? 312  LEU A CD1   1 
ATOM   3053 C  CD2   . LEU C 3 312 ? 68.187  -66.774 43.530  1.00 49.47  ? 312  LEU A CD2   1 
ATOM   3054 N  N     . ARG C 3 313 ? 64.790  -68.283 47.442  1.00 63.82  ? 313  ARG A N     1 
ATOM   3055 C  CA    . ARG C 3 313 ? 64.826  -67.800 48.818  1.00 66.50  ? 313  ARG A CA    1 
ATOM   3056 C  C     . ARG C 3 313 ? 64.844  -68.911 49.866  1.00 66.98  ? 313  ARG A C     1 
ATOM   3057 O  O     . ARG C 3 313 ? 65.656  -68.883 50.796  1.00 61.52  ? 313  ARG A O     1 
ATOM   3058 C  CB    . ARG C 3 313 ? 63.649  -66.866 49.096  1.00 66.81  ? 313  ARG A CB    1 
ATOM   3059 C  CG    . ARG C 3 313 ? 63.559  -66.507 50.564  1.00 67.46  ? 313  ARG A CG    1 
ATOM   3060 C  CD    . ARG C 3 313 ? 62.802  -65.224 50.808  1.00 69.69  ? 313  ARG A CD    1 
ATOM   3061 N  NE    . ARG C 3 313 ? 62.777  -64.894 52.229  1.00 70.32  ? 313  ARG A NE    1 
ATOM   3062 C  CZ    . ARG C 3 313 ? 62.052  -65.536 53.140  1.00 72.49  ? 313  ARG A CZ    1 
ATOM   3063 N  NH1   . ARG C 3 313 ? 61.275  -66.553 52.788  1.00 73.71  ? 313  ARG A NH1   1 
ATOM   3064 N  NH2   . ARG C 3 313 ? 62.109  -65.161 54.411  1.00 76.26  ? 313  ARG A NH2   1 
ATOM   3065 N  N     . GLU C 3 314 ? 63.938  -69.875 49.727  1.00 70.87  ? 314  GLU A N     1 
ATOM   3066 C  CA    . GLU C 3 314 ? 63.884  -70.984 50.670  1.00 76.08  ? 314  GLU A CA    1 
ATOM   3067 C  C     . GLU C 3 314 ? 65.019  -71.970 50.381  1.00 76.13  ? 314  GLU A C     1 
ATOM   3068 O  O     . GLU C 3 314 ? 65.427  -72.746 51.250  1.00 77.07  ? 314  GLU A O     1 
ATOM   3069 C  CB    . GLU C 3 314 ? 62.510  -71.670 50.605  1.00 79.65  ? 314  GLU A CB    1 
ATOM   3070 C  CG    . GLU C 3 314 ? 62.530  -73.170 50.409  1.00 85.05  ? 314  GLU A CG    1 
ATOM   3071 C  CD    . GLU C 3 314 ? 62.530  -73.553 48.939  1.00 92.72  ? 314  GLU A CD    1 
ATOM   3072 O  OE1   . GLU C 3 314 ? 63.457  -73.130 48.213  1.00 95.89  ? 314  GLU A OE1   1 
ATOM   3073 O  OE2   . GLU C 3 314 ? 61.600  -74.273 48.512  1.00 96.64  ? 314  GLU A OE2   1 
ATOM   3074 N  N     . SER C 3 315 ? 65.536  -71.914 49.158  1.00 73.67  ? 315  SER A N     1 
ATOM   3075 C  CA    . SER C 3 315 ? 66.632  -72.777 48.738  1.00 70.99  ? 315  SER A CA    1 
ATOM   3076 C  C     . SER C 3 315 ? 67.930  -72.230 49.312  1.00 70.16  ? 315  SER A C     1 
ATOM   3077 O  O     . SER C 3 315 ? 68.608  -72.888 50.098  1.00 67.78  ? 315  SER A O     1 
ATOM   3078 C  CB    . SER C 3 315 ? 66.718  -72.804 47.209  1.00 74.44  ? 315  SER A CB    1 
ATOM   3079 O  OG    . SER C 3 315 ? 67.917  -73.410 46.760  1.00 77.22  ? 315  SER A OG    1 
ATOM   3080 N  N     . ASN C 3 316 ? 68.265  -71.012 48.905  1.00 72.07  ? 316  ASN A N     1 
ATOM   3081 C  CA    . ASN C 3 316 ? 69.471  -70.342 49.367  1.00 73.44  ? 316  ASN A CA    1 
ATOM   3082 C  C     . ASN C 3 316 ? 69.162  -68.865 49.622  1.00 75.39  ? 316  ASN A C     1 
ATOM   3083 O  O     . ASN C 3 316 ? 68.973  -68.085 48.684  1.00 76.89  ? 316  ASN A O     1 
ATOM   3084 C  CB    . ASN C 3 316 ? 70.582  -70.489 48.325  1.00 67.78  ? 316  ASN A CB    1 
ATOM   3085 C  CG    . ASN C 3 316 ? 71.741  -69.538 48.562  1.00 67.40  ? 316  ASN A CG    1 
ATOM   3086 O  OD1   . ASN C 3 316 ? 72.890  -69.964 48.685  1.00 63.60  ? 316  ASN A OD1   1 
ATOM   3087 N  ND2   . ASN C 3 316 ? 71.449  -68.242 48.608  1.00 65.41  ? 316  ASN A ND2   1 
ATOM   3088 N  N     . HIS C 3 317 ? 69.104  -68.498 50.900  1.00 74.85  ? 317  HIS A N     1 
ATOM   3089 C  CA    . HIS C 3 317 ? 68.817  -67.131 51.321  1.00 72.74  ? 317  HIS A CA    1 
ATOM   3090 C  C     . HIS C 3 317 ? 70.064  -66.248 51.246  1.00 70.47  ? 317  HIS A C     1 
ATOM   3091 O  O     . HIS C 3 317 ? 70.021  -65.152 50.687  1.00 69.60  ? 317  HIS A O     1 
ATOM   3092 C  CB    . HIS C 3 317 ? 68.252  -67.156 52.745  1.00 75.77  ? 317  HIS A CB    1 
ATOM   3093 C  CG    . HIS C 3 317 ? 68.126  -65.805 53.374  1.00 77.04  ? 317  HIS A CG    1 
ATOM   3094 N  ND1   . HIS C 3 317 ? 69.061  -65.307 54.254  1.00 78.88  ? 317  HIS A ND1   1 
ATOM   3095 C  CD2   . HIS C 3 317 ? 67.179  -64.847 53.246  1.00 76.75  ? 317  HIS A CD2   1 
ATOM   3096 C  CE1   . HIS C 3 317 ? 68.694  -64.098 54.644  1.00 82.89  ? 317  HIS A CE1   1 
ATOM   3097 N  NE2   . HIS C 3 317 ? 67.553  -63.797 54.044  1.00 79.43  ? 317  HIS A NE2   1 
ATOM   3098 N  N     . GLN C 3 318 ? 71.168  -66.729 51.808  1.00 66.90  ? 318  GLN A N     1 
ATOM   3099 C  CA    . GLN C 3 318 ? 72.433  -65.997 51.789  1.00 66.82  ? 318  GLN A CA    1 
ATOM   3100 C  C     . GLN C 3 318 ? 72.629  -65.251 50.468  1.00 67.95  ? 318  GLN A C     1 
ATOM   3101 O  O     . GLN C 3 318 ? 72.679  -64.021 50.429  1.00 69.14  ? 318  GLN A O     1 
ATOM   3102 C  CB    . GLN C 3 318 ? 73.589  -66.971 51.983  1.00 64.31  ? 318  GLN A CB    1 
ATOM   3103 C  CG    . GLN C 3 318 ? 74.972  -66.348 51.921  1.00 68.66  ? 318  GLN A CG    1 
ATOM   3104 C  CD    . GLN C 3 318 ? 75.215  -65.326 53.021  1.00 72.67  ? 318  GLN A CD    1 
ATOM   3105 O  OE1   . GLN C 3 318 ? 74.648  -65.421 54.114  1.00 72.48  ? 318  GLN A OE1   1 
ATOM   3106 N  NE2   . GLN C 3 318 ? 76.078  -64.351 52.742  1.00 74.33  ? 318  GLN A NE2   1 
ATOM   3107 N  N     . ARG C 3 319 ? 72.738  -66.018 49.388  1.00 69.03  ? 319  ARG A N     1 
ATOM   3108 C  CA    . ARG C 3 319 ? 72.928  -65.483 48.040  1.00 68.37  ? 319  ARG A CA    1 
ATOM   3109 C  C     . ARG C 3 319 ? 71.726  -64.674 47.537  1.00 65.89  ? 319  ARG A C     1 
ATOM   3110 O  O     . ARG C 3 319 ? 71.878  -63.723 46.762  1.00 65.63  ? 319  ARG A O     1 
ATOM   3111 C  CB    . ARG C 3 319 ? 73.232  -66.632 47.071  1.00 67.66  ? 319  ARG A CB    1 
ATOM   3112 C  CG    . ARG C 3 319 ? 73.251  -66.226 45.613  1.00 72.62  ? 319  ARG A CG    1 
ATOM   3113 C  CD    . ARG C 3 319 ? 74.209  -67.084 44.849  1.00 75.09  ? 319  ARG A CD    1 
ATOM   3114 N  NE    . ARG C 3 319 ? 75.479  -67.132 45.555  1.00 81.80  ? 319  ARG A NE    1 
ATOM   3115 C  CZ    . ARG C 3 319 ? 76.542  -67.811 45.144  1.00 84.72  ? 319  ARG A CZ    1 
ATOM   3116 N  NH1   . ARG C 3 319 ? 76.493  -68.504 44.011  1.00 81.59  ? 319  ARG A NH1   1 
ATOM   3117 N  NH2   . ARG C 3 319 ? 77.646  -67.821 45.886  1.00 83.06  ? 319  ARG A NH2   1 
ATOM   3118 N  N     . TYR C 3 320 ? 70.535  -65.063 47.972  1.00 60.39  ? 320  TYR A N     1 
ATOM   3119 C  CA    . TYR C 3 320 ? 69.323  -64.362 47.587  1.00 57.77  ? 320  TYR A CA    1 
ATOM   3120 C  C     . TYR C 3 320 ? 69.467  -62.870 47.896  1.00 59.88  ? 320  TYR A C     1 
ATOM   3121 O  O     . TYR C 3 320 ? 69.245  -62.024 47.030  1.00 59.78  ? 320  TYR A O     1 
ATOM   3122 C  CB    . TYR C 3 320 ? 68.139  -64.918 48.362  1.00 58.74  ? 320  TYR A CB    1 
ATOM   3123 C  CG    . TYR C 3 320 ? 66.819  -64.319 47.950  1.00 58.82  ? 320  TYR A CG    1 
ATOM   3124 C  CD1   . TYR C 3 320 ? 66.386  -64.407 46.633  1.00 60.04  ? 320  TYR A CD1   1 
ATOM   3125 C  CD2   . TYR C 3 320 ? 65.970  -63.718 48.882  1.00 56.59  ? 320  TYR A CD2   1 
ATOM   3126 C  CE1   . TYR C 3 320 ? 65.131  -63.924 46.245  1.00 56.76  ? 320  TYR A CE1   1 
ATOM   3127 C  CE2   . TYR C 3 320 ? 64.703  -63.228 48.499  1.00 53.98  ? 320  TYR A CE2   1 
ATOM   3128 C  CZ    . TYR C 3 320 ? 64.300  -63.345 47.173  1.00 55.72  ? 320  TYR A CZ    1 
ATOM   3129 O  OH    . TYR C 3 320 ? 63.056  -62.920 46.759  1.00 66.48  ? 320  TYR A OH    1 
ATOM   3130 N  N     . ILE C 3 321 ? 69.834  -62.560 49.138  1.00 53.53  ? 321  ILE A N     1 
ATOM   3131 C  CA    . ILE C 3 321 ? 70.018  -61.188 49.590  1.00 48.47  ? 321  ILE A CA    1 
ATOM   3132 C  C     . ILE C 3 321 ? 71.238  -60.517 48.952  1.00 52.86  ? 321  ILE A C     1 
ATOM   3133 O  O     . ILE C 3 321 ? 71.168  -59.363 48.532  1.00 56.49  ? 321  ILE A O     1 
ATOM   3134 C  CB    . ILE C 3 321 ? 70.141  -61.149 51.140  1.00 45.56  ? 321  ILE A CB    1 
ATOM   3135 C  CG1   . ILE C 3 321 ? 68.755  -61.319 51.763  1.00 43.49  ? 321  ILE A CG1   1 
ATOM   3136 C  CG2   . ILE C 3 321 ? 70.809  -59.865 51.612  1.00 41.37  ? 321  ILE A CG2   1 
ATOM   3137 C  CD1   . ILE C 3 321 ? 67.720  -60.329 51.250  1.00 38.62  ? 321  ILE A CD1   1 
ATOM   3138 N  N     . SER C 3 322 ? 72.354  -61.235 48.872  1.00 52.24  ? 322  SER A N     1 
ATOM   3139 C  CA    . SER C 3 322 ? 73.566  -60.668 48.288  1.00 51.86  ? 322  SER A CA    1 
ATOM   3140 C  C     . SER C 3 322 ? 73.398  -60.233 46.844  1.00 51.96  ? 322  SER A C     1 
ATOM   3141 O  O     . SER C 3 322 ? 74.118  -59.362 46.373  1.00 52.78  ? 322  SER A O     1 
ATOM   3142 C  CB    . SER C 3 322 ? 74.724  -61.663 48.363  1.00 52.28  ? 322  SER A CB    1 
ATOM   3143 O  OG    . SER C 3 322 ? 75.160  -61.853 49.696  1.00 52.03  ? 322  SER A OG    1 
ATOM   3144 N  N     . TYR C 3 323 ? 72.462  -60.849 46.136  1.00 53.06  ? 323  TYR A N     1 
ATOM   3145 C  CA    . TYR C 3 323 ? 72.233  -60.494 44.747  1.00 57.90  ? 323  TYR A CA    1 
ATOM   3146 C  C     . TYR C 3 323 ? 71.248  -59.324 44.633  1.00 58.02  ? 323  TYR A C     1 
ATOM   3147 O  O     . TYR C 3 323 ? 71.034  -58.769 43.552  1.00 62.42  ? 323  TYR A O     1 
ATOM   3148 C  CB    . TYR C 3 323 ? 71.742  -61.726 43.972  1.00 62.06  ? 323  TYR A CB    1 
ATOM   3149 C  CG    . TYR C 3 323 ? 72.859  -62.654 43.517  1.00 67.18  ? 323  TYR A CG    1 
ATOM   3150 C  CD1   . TYR C 3 323 ? 74.202  -62.330 43.730  1.00 66.79  ? 323  TYR A CD1   1 
ATOM   3151 C  CD2   . TYR C 3 323 ? 72.570  -63.842 42.848  1.00 68.89  ? 323  TYR A CD2   1 
ATOM   3152 C  CE1   . TYR C 3 323 ? 75.224  -63.166 43.287  1.00 69.10  ? 323  TYR A CE1   1 
ATOM   3153 C  CE2   . TYR C 3 323 ? 73.584  -64.680 42.404  1.00 70.92  ? 323  TYR A CE2   1 
ATOM   3154 C  CZ    . TYR C 3 323 ? 74.908  -64.338 42.625  1.00 70.55  ? 323  TYR A CZ    1 
ATOM   3155 O  OH    . TYR C 3 323 ? 75.909  -65.164 42.170  1.00 72.76  ? 323  TYR A OH    1 
ATOM   3156 N  N     . ASN C 3 324 ? 70.655  -58.952 45.762  1.00 56.63  ? 324  ASN A N     1 
ATOM   3157 C  CA    . ASN C 3 324 ? 69.718  -57.831 45.823  1.00 51.70  ? 324  ASN A CA    1 
ATOM   3158 C  C     . ASN C 3 324 ? 70.597  -56.585 45.888  1.00 52.07  ? 324  ASN A C     1 
ATOM   3159 O  O     . ASN C 3 324 ? 70.425  -55.623 45.135  1.00 52.75  ? 324  ASN A O     1 
ATOM   3160 C  CB    . ASN C 3 324 ? 68.879  -57.915 47.098  1.00 54.56  ? 324  ASN A CB    1 
ATOM   3161 C  CG    . ASN C 3 324 ? 67.739  -56.913 47.123  1.00 57.08  ? 324  ASN A CG    1 
ATOM   3162 O  OD1   . ASN C 3 324 ? 67.169  -56.632 48.176  1.00 60.75  ? 324  ASN A OD1   1 
ATOM   3163 N  ND2   . ASN C 3 324 ? 67.387  -56.384 45.960  1.00 59.51  ? 324  ASN A ND2   1 
ATOM   3164 N  N     . ILE C 3 325 ? 71.558  -56.620 46.797  1.00 47.11  ? 325  ILE A N     1 
ATOM   3165 C  CA    . ILE C 3 325 ? 72.479  -55.521 46.959  1.00 47.11  ? 325  ILE A CA    1 
ATOM   3166 C  C     . ILE C 3 325 ? 73.299  -55.289 45.683  1.00 48.29  ? 325  ILE A C     1 
ATOM   3167 O  O     . ILE C 3 325 ? 73.362  -54.169 45.175  1.00 53.98  ? 325  ILE A O     1 
ATOM   3168 C  CB    . ILE C 3 325 ? 73.455  -55.813 48.107  1.00 49.29  ? 325  ILE A CB    1 
ATOM   3169 C  CG1   . ILE C 3 325 ? 72.685  -55.963 49.420  1.00 48.79  ? 325  ILE A CG1   1 
ATOM   3170 C  CG2   . ILE C 3 325 ? 74.513  -54.719 48.185  1.00 51.57  ? 325  ILE A CG2   1 
ATOM   3171 C  CD1   . ILE C 3 325 ? 73.606  -56.278 50.605  1.00 45.75  ? 325  ILE A CD1   1 
ATOM   3172 N  N     . ILE C 3 326 ? 73.927  -56.348 45.177  1.00 46.76  ? 326  ILE A N     1 
ATOM   3173 C  CA    . ILE C 3 326 ? 74.763  -56.256 43.978  1.00 49.77  ? 326  ILE A CA    1 
ATOM   3174 C  C     . ILE C 3 326 ? 74.021  -55.527 42.867  1.00 53.82  ? 326  ILE A C     1 
ATOM   3175 O  O     . ILE C 3 326 ? 74.585  -54.684 42.158  1.00 53.84  ? 326  ILE A O     1 
ATOM   3176 C  CB    . ILE C 3 326 ? 75.126  -57.652 43.396  1.00 53.87  ? 326  ILE A CB    1 
ATOM   3177 C  CG1   . ILE C 3 326 ? 75.806  -58.549 44.444  1.00 50.40  ? 326  ILE A CG1   1 
ATOM   3178 C  CG2   . ILE C 3 326 ? 75.990  -57.461 42.151  1.00 48.60  ? 326  ILE A CG2   1 
ATOM   3179 C  CD1   . ILE C 3 326 ? 77.251  -58.284 44.654  1.00 50.29  ? 326  ILE A CD1   1 
ATOM   3180 N  N     . ASP C 3 327 ? 72.752  -55.873 42.708  1.00 51.79  ? 327  ASP A N     1 
ATOM   3181 C  CA    . ASP C 3 327 ? 71.949  -55.273 41.664  1.00 53.54  ? 327  ASP A CA    1 
ATOM   3182 C  C     . ASP C 3 327 ? 71.726  -53.782 41.857  1.00 51.64  ? 327  ASP A C     1 
ATOM   3183 O  O     . ASP C 3 327 ? 71.772  -53.022 40.889  1.00 51.32  ? 327  ASP A O     1 
ATOM   3184 C  CB    . ASP C 3 327 ? 70.610  -56.006 41.540  1.00 60.58  ? 327  ASP A CB    1 
ATOM   3185 C  CG    . ASP C 3 327 ? 70.490  -56.800 40.234  1.00 65.38  ? 327  ASP A CG    1 
ATOM   3186 O  OD1   . ASP C 3 327 ? 71.458  -56.799 39.445  1.00 66.21  ? 327  ASP A OD1   1 
ATOM   3187 O  OD2   . ASP C 3 327 ? 69.428  -57.422 39.996  1.00 67.09  ? 327  ASP A OD2   1 
ATOM   3188 N  N     . VAL C 3 328 ? 71.475  -53.355 43.092  1.00 48.87  ? 328  VAL A N     1 
ATOM   3189 C  CA    . VAL C 3 328 ? 71.283  -51.932 43.347  1.00 46.31  ? 328  VAL A CA    1 
ATOM   3190 C  C     . VAL C 3 328 ? 72.601  -51.267 43.000  1.00 45.93  ? 328  VAL A C     1 
ATOM   3191 O  O     . VAL C 3 328 ? 72.632  -50.177 42.424  1.00 48.79  ? 328  VAL A O     1 
ATOM   3192 C  CB    . VAL C 3 328 ? 70.926  -51.653 44.821  1.00 47.23  ? 328  VAL A CB    1 
ATOM   3193 C  CG1   . VAL C 3 328 ? 71.178  -50.199 45.158  1.00 39.56  ? 328  VAL A CG1   1 
ATOM   3194 C  CG2   . VAL C 3 328 ? 69.461  -51.965 45.057  1.00 48.92  ? 328  VAL A CG2   1 
ATOM   3195 N  N     . TYR C 3 329 ? 73.691  -51.946 43.334  1.00 42.22  ? 329  TYR A N     1 
ATOM   3196 C  CA    . TYR C 3 329 ? 75.020  -51.427 43.045  1.00 43.38  ? 329  TYR A CA    1 
ATOM   3197 C  C     . TYR C 3 329 ? 75.303  -51.291 41.535  1.00 45.68  ? 329  TYR A C     1 
ATOM   3198 O  O     . TYR C 3 329 ? 75.920  -50.316 41.107  1.00 45.13  ? 329  TYR A O     1 
ATOM   3199 C  CB    . TYR C 3 329 ? 76.076  -52.322 43.705  1.00 42.78  ? 329  TYR A CB    1 
ATOM   3200 C  CG    . TYR C 3 329 ? 77.503  -51.864 43.495  1.00 49.98  ? 329  TYR A CG    1 
ATOM   3201 C  CD1   . TYR C 3 329 ? 77.870  -50.540 43.712  1.00 50.57  ? 329  TYR A CD1   1 
ATOM   3202 C  CD2   . TYR C 3 329 ? 78.492  -52.760 43.092  1.00 51.64  ? 329  TYR A CD2   1 
ATOM   3203 C  CE1   . TYR C 3 329 ? 79.182  -50.119 43.533  1.00 50.45  ? 329  TYR A CE1   1 
ATOM   3204 C  CE2   . TYR C 3 329 ? 79.807  -52.347 42.912  1.00 50.13  ? 329  TYR A CE2   1 
ATOM   3205 C  CZ    . TYR C 3 329 ? 80.143  -51.024 43.133  1.00 51.17  ? 329  TYR A CZ    1 
ATOM   3206 O  OH    . TYR C 3 329 ? 81.440  -50.597 42.945  1.00 55.34  ? 329  TYR A OH    1 
ATOM   3207 N  N     . ARG C 3 330 ? 74.861  -52.265 40.736  1.00 46.29  ? 330  ARG A N     1 
ATOM   3208 C  CA    . ARG C 3 330 ? 75.078  -52.245 39.291  1.00 43.93  ? 330  ARG A CA    1 
ATOM   3209 C  C     . ARG C 3 330 ? 74.444  -51.017 38.649  1.00 46.15  ? 330  ARG A C     1 
ATOM   3210 O  O     . ARG C 3 330 ? 74.946  -50.490 37.652  1.00 47.06  ? 330  ARG A O     1 
ATOM   3211 C  CB    . ARG C 3 330 ? 74.519  -53.519 38.656  1.00 53.23  ? 330  ARG A CB    1 
ATOM   3212 C  CG    . ARG C 3 330 ? 75.490  -54.692 38.605  1.00 57.58  ? 330  ARG A CG    1 
ATOM   3213 C  CD    . ARG C 3 330 ? 74.732  -55.979 38.374  1.00 65.10  ? 330  ARG A CD    1 
ATOM   3214 N  NE    . ARG C 3 330 ? 75.564  -57.077 37.887  1.00 73.32  ? 330  ARG A NE    1 
ATOM   3215 C  CZ    . ARG C 3 330 ? 76.725  -57.456 38.419  1.00 80.30  ? 330  ARG A CZ    1 
ATOM   3216 N  NH1   . ARG C 3 330 ? 77.239  -56.825 39.472  1.00 79.83  ? 330  ARG A NH1   1 
ATOM   3217 N  NH2   . ARG C 3 330 ? 77.360  -58.500 37.909  1.00 79.57  ? 330  ARG A NH2   1 
ATOM   3218 N  N     . VAL C 3 331 ? 73.341  -50.560 39.227  1.00 45.85  ? 331  VAL A N     1 
ATOM   3219 C  CA    . VAL C 3 331 ? 72.649  -49.378 38.734  1.00 45.72  ? 331  VAL A CA    1 
ATOM   3220 C  C     . VAL C 3 331 ? 73.446  -48.096 39.040  1.00 44.96  ? 331  VAL A C     1 
ATOM   3221 O  O     . VAL C 3 331 ? 73.418  -47.142 38.257  1.00 45.99  ? 331  VAL A O     1 
ATOM   3222 C  CB    . VAL C 3 331 ? 71.254  -49.261 39.367  1.00 48.93  ? 331  VAL A CB    1 
ATOM   3223 C  CG1   . VAL C 3 331 ? 70.493  -48.080 38.761  1.00 44.24  ? 331  VAL A CG1   1 
ATOM   3224 C  CG2   . VAL C 3 331 ? 70.502  -50.557 39.166  1.00 46.42  ? 331  VAL A CG2   1 
ATOM   3225 N  N     . LEU C 3 332 ? 74.139  -48.055 40.174  1.00 38.13  ? 332  LEU A N     1 
ATOM   3226 C  CA    . LEU C 3 332 ? 74.941  -46.883 40.507  1.00 42.09  ? 332  LEU A CA    1 
ATOM   3227 C  C     . LEU C 3 332 ? 76.154  -46.819 39.568  1.00 47.15  ? 332  LEU A C     1 
ATOM   3228 O  O     . LEU C 3 332 ? 76.585  -45.745 39.131  1.00 47.22  ? 332  LEU A O     1 
ATOM   3229 C  CB    . LEU C 3 332 ? 75.417  -46.965 41.960  1.00 42.18  ? 332  LEU A CB    1 
ATOM   3230 C  CG    . LEU C 3 332 ? 74.314  -46.844 43.022  1.00 49.11  ? 332  LEU A CG    1 
ATOM   3231 C  CD1   . LEU C 3 332 ? 74.844  -47.121 44.443  1.00 41.94  ? 332  LEU A CD1   1 
ATOM   3232 C  CD2   . LEU C 3 332 ? 73.737  -45.432 42.918  1.00 46.53  ? 332  LEU A CD2   1 
ATOM   3233 N  N     . GLN C 3 333 ? 76.688  -47.987 39.243  1.00 46.97  ? 333  GLN A N     1 
ATOM   3234 C  CA    . GLN C 3 333 ? 77.844  -48.057 38.378  1.00 43.47  ? 333  GLN A CA    1 
ATOM   3235 C  C     . GLN C 3 333 ? 77.482  -47.573 36.978  1.00 42.29  ? 333  GLN A C     1 
ATOM   3236 O  O     . GLN C 3 333 ? 78.318  -46.994 36.261  1.00 38.41  ? 333  GLN A O     1 
ATOM   3237 C  CB    . GLN C 3 333 ? 78.371  -49.488 38.344  1.00 40.70  ? 333  GLN A CB    1 
ATOM   3238 C  CG    . GLN C 3 333 ? 78.679  -50.049 39.721  1.00 41.21  ? 333  GLN A CG    1 
ATOM   3239 C  CD    . GLN C 3 333 ? 79.294  -51.429 39.652  1.00 45.09  ? 333  GLN A CD    1 
ATOM   3240 O  OE1   . GLN C 3 333 ? 80.361  -51.610 39.081  1.00 50.78  ? 333  GLN A OE1   1 
ATOM   3241 N  NE2   . GLN C 3 333 ? 78.620  -52.412 40.230  1.00 46.72  ? 333  GLN A NE2   1 
ATOM   3242 N  N     . ILE C 3 334 ? 76.232  -47.789 36.588  1.00 37.48  ? 334  ILE A N     1 
ATOM   3243 C  CA    . ILE C 3 334 ? 75.822  -47.349 35.267  1.00 40.45  ? 334  ILE A CA    1 
ATOM   3244 C  C     . ILE C 3 334 ? 75.613  -45.849 35.263  1.00 44.49  ? 334  ILE A C     1 
ATOM   3245 O  O     . ILE C 3 334 ? 75.884  -45.184 34.257  1.00 46.31  ? 334  ILE A O     1 
ATOM   3246 C  CB    . ILE C 3 334 ? 74.538  -48.048 34.796  1.00 34.51  ? 334  ILE A CB    1 
ATOM   3247 C  CG1   . ILE C 3 334 ? 74.807  -49.547 34.685  1.00 32.42  ? 334  ILE A CG1   1 
ATOM   3248 C  CG2   . ILE C 3 334 ? 74.086  -47.468 33.443  1.00 33.22  ? 334  ILE A CG2   1 
ATOM   3249 C  CD1   . ILE C 3 334 ? 73.663  -50.343 34.173  1.00 31.10  ? 334  ILE A CD1   1 
ATOM   3250 N  N     . ASP C 3 335 ? 75.153  -45.310 36.389  1.00 41.30  ? 335  ASP A N     1 
ATOM   3251 C  CA    . ASP C 3 335 ? 74.931  -43.876 36.481  1.00 42.22  ? 335  ASP A CA    1 
ATOM   3252 C  C     . ASP C 3 335 ? 76.278  -43.184 36.647  1.00 40.41  ? 335  ASP A C     1 
ATOM   3253 O  O     . ASP C 3 335 ? 76.517  -42.111 36.092  1.00 38.17  ? 335  ASP A O     1 
ATOM   3254 C  CB    . ASP C 3 335 ? 74.004  -43.538 37.659  1.00 40.74  ? 335  ASP A CB    1 
ATOM   3255 C  CG    . ASP C 3 335 ? 73.886  -42.032 37.905  1.00 45.25  ? 335  ASP A CG    1 
ATOM   3256 O  OD1   . ASP C 3 335 ? 73.462  -41.277 36.990  1.00 33.97  ? 335  ASP A OD1   1 
ATOM   3257 O  OD2   . ASP C 3 335 ? 74.222  -41.601 39.030  1.00 49.97  ? 335  ASP A OD2   1 
ATOM   3258 N  N     . ALA C 3 336 ? 77.157  -43.813 37.409  1.00 38.43  ? 336  ALA A N     1 
ATOM   3259 C  CA    . ALA C 3 336 ? 78.475  -43.261 37.630  1.00 43.92  ? 336  ALA A CA    1 
ATOM   3260 C  C     . ALA C 3 336 ? 79.221  -43.216 36.292  1.00 45.63  ? 336  ALA A C     1 
ATOM   3261 O  O     . ALA C 3 336 ? 80.226  -42.524 36.132  1.00 45.53  ? 336  ALA A O     1 
ATOM   3262 C  CB    . ALA C 3 336 ? 79.221  -44.119 38.632  1.00 41.04  ? 336  ALA A CB    1 
ATOM   3263 N  N     . LYS C 3 337 ? 78.697  -43.937 35.315  1.00 47.21  ? 337  LYS A N     1 
ATOM   3264 C  CA    . LYS C 3 337 ? 79.325  -43.983 34.014  1.00 50.30  ? 337  LYS A CA    1 
ATOM   3265 C  C     . LYS C 3 337 ? 78.559  -43.171 32.971  1.00 48.89  ? 337  LYS A C     1 
ATOM   3266 O  O     . LYS C 3 337 ? 79.159  -42.431 32.192  1.00 44.76  ? 337  LYS A O     1 
ATOM   3267 C  CB    . LYS C 3 337 ? 79.459  -45.445 33.583  1.00 58.97  ? 337  LYS A CB    1 
ATOM   3268 C  CG    . LYS C 3 337 ? 78.749  -45.798 32.297  1.00 72.63  ? 337  LYS A CG    1 
ATOM   3269 C  CD    . LYS C 3 337 ? 79.633  -45.575 31.081  1.00 80.58  ? 337  LYS A CD    1 
ATOM   3270 C  CE    . LYS C 3 337 ? 80.815  -46.530 31.075  1.00 83.48  ? 337  LYS A CE    1 
ATOM   3271 N  NZ    . LYS C 3 337 ? 81.518  -46.527 29.757  1.00 87.02  ? 337  LYS A NZ    1 
ATOM   3272 N  N     . ARG C 3 338 ? 77.236  -43.300 32.956  1.00 50.39  ? 338  ARG A N     1 
ATOM   3273 C  CA    . ARG C 3 338 ? 76.435  -42.571 31.977  1.00 48.85  ? 338  ARG A CA    1 
ATOM   3274 C  C     . ARG C 3 338 ? 76.067  -41.168 32.448  1.00 44.90  ? 338  ARG A C     1 
ATOM   3275 O  O     . ARG C 3 338 ? 75.839  -40.277 31.627  1.00 35.78  ? 338  ARG A O     1 
ATOM   3276 C  CB    . ARG C 3 338 ? 75.162  -43.356 31.617  1.00 48.96  ? 338  ARG A CB    1 
ATOM   3277 C  CG    . ARG C 3 338 ? 75.409  -44.762 31.066  1.00 49.70  ? 338  ARG A CG    1 
ATOM   3278 C  CD    . ARG C 3 338 ? 76.460  -44.796 29.944  1.00 45.68  ? 338  ARG A CD    1 
ATOM   3279 N  NE    . ARG C 3 338 ? 76.063  -44.012 28.778  1.00 49.89  ? 338  ARG A NE    1 
ATOM   3280 C  CZ    . ARG C 3 338 ? 75.902  -44.504 27.548  1.00 51.40  ? 338  ARG A CZ    1 
ATOM   3281 N  NH1   . ARG C 3 338 ? 76.109  -45.793 27.301  1.00 49.36  ? 338  ARG A NH1   1 
ATOM   3282 N  NH2   . ARG C 3 338 ? 75.512  -43.702 26.560  1.00 43.71  ? 338  ARG A NH2   1 
ATOM   3283 N  N     . GLN C 3 339 ? 76.022  -40.981 33.768  1.00 42.68  ? 339  GLN A N     1 
ATOM   3284 C  CA    . GLN C 3 339 ? 75.692  -39.689 34.376  1.00 40.06  ? 339  GLN A CA    1 
ATOM   3285 C  C     . GLN C 3 339 ? 74.346  -39.117 33.946  1.00 40.83  ? 339  GLN A C     1 
ATOM   3286 O  O     . GLN C 3 339 ? 74.206  -37.900 33.828  1.00 34.95  ? 339  GLN A O     1 
ATOM   3287 C  CB    . GLN C 3 339 ? 76.797  -38.685 34.054  1.00 43.69  ? 339  GLN A CB    1 
ATOM   3288 C  CG    . GLN C 3 339 ? 78.126  -39.007 34.728  1.00 58.04  ? 339  GLN A CG    1 
ATOM   3289 C  CD    . GLN C 3 339 ? 78.141  -38.627 36.200  1.00 66.66  ? 339  GLN A CD    1 
ATOM   3290 O  OE1   . GLN C 3 339 ? 78.297  -37.456 36.540  1.00 73.98  ? 339  GLN A OE1   1 
ATOM   3291 N  NE2   . GLN C 3 339 ? 77.970  -39.614 37.081  1.00 69.08  ? 339  GLN A NE2   1 
ATOM   3292 N  N     . PHE C 3 340 ? 73.350  -39.977 33.734  1.00 38.80  ? 340  PHE A N     1 
ATOM   3293 C  CA    . PHE C 3 340 ? 72.046  -39.497 33.284  1.00 38.36  ? 340  PHE A CA    1 
ATOM   3294 C  C     . PHE C 3 340 ? 71.185  -38.722 34.282  1.00 39.55  ? 340  PHE A C     1 
ATOM   3295 O  O     . PHE C 3 340 ? 70.424  -37.843 33.875  1.00 36.25  ? 340  PHE A O     1 
ATOM   3296 C  CB    . PHE C 3 340 ? 71.235  -40.647 32.708  1.00 38.14  ? 340  PHE A CB    1 
ATOM   3297 C  CG    . PHE C 3 340 ? 71.791  -41.189 31.433  1.00 39.99  ? 340  PHE A CG    1 
ATOM   3298 C  CD1   . PHE C 3 340 ? 72.342  -40.337 30.493  1.00 34.59  ? 340  PHE A CD1   1 
ATOM   3299 C  CD2   . PHE C 3 340 ? 71.701  -42.546 31.133  1.00 40.92  ? 340  PHE A CD2   1 
ATOM   3300 C  CE1   . PHE C 3 340 ? 72.789  -40.823 29.268  1.00 36.49  ? 340  PHE A CE1   1 
ATOM   3301 C  CE2   . PHE C 3 340 ? 72.150  -43.040 29.903  1.00 35.81  ? 340  PHE A CE2   1 
ATOM   3302 C  CZ    . PHE C 3 340 ? 72.692  -42.174 28.972  1.00 31.97  ? 340  PHE A CZ    1 
ATOM   3303 N  N     . ILE C 3 341 ? 71.286  -39.041 35.571  1.00 37.16  ? 341  ILE A N     1 
ATOM   3304 C  CA    . ILE C 3 341 ? 70.518  -38.323 36.583  1.00 40.57  ? 341  ILE A CA    1 
ATOM   3305 C  C     . ILE C 3 341 ? 71.073  -36.902 36.625  1.00 41.67  ? 341  ILE A C     1 
ATOM   3306 O  O     . ILE C 3 341 ? 70.339  -35.916 36.684  1.00 43.18  ? 341  ILE A O     1 
ATOM   3307 C  CB    . ILE C 3 341 ? 70.692  -38.966 37.979  1.00 46.48  ? 341  ILE A CB    1 
ATOM   3308 C  CG1   . ILE C 3 341 ? 70.022  -40.344 38.004  1.00 42.83  ? 341  ILE A CG1   1 
ATOM   3309 C  CG2   . ILE C 3 341 ? 70.111  -38.053 39.057  1.00 45.00  ? 341  ILE A CG2   1 
ATOM   3310 C  CD1   . ILE C 3 341 ? 70.111  -41.047 39.345  1.00 39.82  ? 341  ILE A CD1   1 
ATOM   3311 N  N     . ASN C 3 342 ? 72.391  -36.814 36.569  1.00 43.72  ? 342  ASN A N     1 
ATOM   3312 C  CA    . ASN C 3 342 ? 73.074  -35.537 36.599  1.00 45.33  ? 342  ASN A CA    1 
ATOM   3313 C  C     . ASN C 3 342 ? 72.719  -34.645 35.401  1.00 45.20  ? 342  ASN A C     1 
ATOM   3314 O  O     . ASN C 3 342 ? 72.750  -33.411 35.496  1.00 44.59  ? 342  ASN A O     1 
ATOM   3315 C  CB    . ASN C 3 342 ? 74.564  -35.794 36.650  1.00 53.76  ? 342  ASN A CB    1 
ATOM   3316 C  CG    . ASN C 3 342 ? 75.284  -34.780 37.476  1.00 63.32  ? 342  ASN A CG    1 
ATOM   3317 O  OD1   . ASN C 3 342 ? 74.879  -34.484 38.601  1.00 66.75  ? 342  ASN A OD1   1 
ATOM   3318 N  ND2   . ASN C 3 342 ? 76.367  -34.237 36.931  1.00 70.01  ? 342  ASN A ND2   1 
ATOM   3319 N  N     . LEU C 3 343 ? 72.382  -35.277 34.278  1.00 40.25  ? 343  LEU A N     1 
ATOM   3320 C  CA    . LEU C 3 343 ? 72.001  -34.560 33.065  1.00 39.73  ? 343  LEU A CA    1 
ATOM   3321 C  C     . LEU C 3 343 ? 70.560  -34.082 33.273  1.00 40.36  ? 343  LEU A C     1 
ATOM   3322 O  O     . LEU C 3 343 ? 70.179  -33.007 32.829  1.00 39.03  ? 343  LEU A O     1 
ATOM   3323 C  CB    . LEU C 3 343 ? 72.081  -35.497 31.839  1.00 40.28  ? 343  LEU A CB    1 
ATOM   3324 C  CG    . LEU C 3 343 ? 72.211  -34.916 30.414  1.00 36.05  ? 343  LEU A CG    1 
ATOM   3325 C  CD1   . LEU C 3 343 ? 71.783  -35.965 29.408  1.00 36.77  ? 343  LEU A CD1   1 
ATOM   3326 C  CD2   . LEU C 3 343 ? 71.345  -33.691 30.238  1.00 45.77  ? 343  LEU A CD2   1 
ATOM   3327 N  N     . SER C 3 344 ? 69.767  -34.885 33.974  1.00 43.08  ? 344  SER A N     1 
ATOM   3328 C  CA    . SER C 3 344 ? 68.374  -34.545 34.251  1.00 40.07  ? 344  SER A CA    1 
ATOM   3329 C  C     . SER C 3 344 ? 68.253  -33.270 35.067  1.00 37.67  ? 344  SER A C     1 
ATOM   3330 O  O     . SER C 3 344 ? 67.508  -32.342 34.708  1.00 35.00  ? 344  SER A O     1 
ATOM   3331 C  CB    . SER C 3 344 ? 67.700  -35.695 34.987  1.00 39.85  ? 344  SER A CB    1 
ATOM   3332 O  OG    . SER C 3 344 ? 67.349  -36.710 34.064  1.00 47.74  ? 344  SER A OG    1 
ATOM   3333 N  N     . LEU C 3 345 ? 68.976  -33.232 36.175  1.00 33.10  ? 345  LEU A N     1 
ATOM   3334 C  CA    . LEU C 3 345 ? 68.974  -32.059 37.030  1.00 39.55  ? 345  LEU A CA    1 
ATOM   3335 C  C     . LEU C 3 345 ? 69.362  -30.812 36.221  1.00 41.80  ? 345  LEU A C     1 
ATOM   3336 O  O     . LEU C 3 345 ? 68.619  -29.830 36.174  1.00 45.79  ? 345  LEU A O     1 
ATOM   3337 C  CB    . LEU C 3 345 ? 69.965  -32.270 38.178  1.00 35.04  ? 345  LEU A CB    1 
ATOM   3338 C  CG    . LEU C 3 345 ? 69.648  -33.434 39.121  1.00 32.58  ? 345  LEU A CG    1 
ATOM   3339 C  CD1   . LEU C 3 345 ? 70.818  -33.705 40.021  1.00 26.44  ? 345  LEU A CD1   1 
ATOM   3340 C  CD2   . LEU C 3 345 ? 68.410  -33.099 39.934  1.00 33.79  ? 345  LEU A CD2   1 
ATOM   3341 N  N     . ASP C 3 346 ? 70.519  -30.872 35.566  1.00 37.03  ? 346  ASP A N     1 
ATOM   3342 C  CA    . ASP C 3 346 ? 71.026  -29.751 34.780  1.00 37.34  ? 346  ASP A CA    1 
ATOM   3343 C  C     . ASP C 3 346 ? 70.012  -29.157 33.801  1.00 36.00  ? 346  ASP A C     1 
ATOM   3344 O  O     . ASP C 3 346 ? 69.822  -27.945 33.754  1.00 38.93  ? 346  ASP A O     1 
ATOM   3345 C  CB    . ASP C 3 346 ? 72.281  -30.182 34.027  1.00 40.54  ? 346  ASP A CB    1 
ATOM   3346 C  CG    . ASP C 3 346 ? 73.044  -29.017 33.479  1.00 42.07  ? 346  ASP A CG    1 
ATOM   3347 O  OD1   . ASP C 3 346 ? 73.679  -28.297 34.285  1.00 45.93  ? 346  ASP A OD1   1 
ATOM   3348 O  OD2   . ASP C 3 346 ? 72.993  -28.805 32.246  1.00 45.56  ? 346  ASP A OD2   1 
ATOM   3349 N  N     . MET C 3 347 ? 69.382  -30.013 33.007  1.00 39.68  ? 347  MET A N     1 
ATOM   3350 C  CA    . MET C 3 347 ? 68.382  -29.588 32.033  1.00 38.78  ? 347  MET A CA    1 
ATOM   3351 C  C     . MET C 3 347 ? 67.157  -29.084 32.796  1.00 39.33  ? 347  MET A C     1 
ATOM   3352 O  O     . MET C 3 347 ? 66.548  -28.081 32.437  1.00 33.98  ? 347  MET A O     1 
ATOM   3353 C  CB    . MET C 3 347 ? 68.005  -30.779 31.168  1.00 45.08  ? 347  MET A CB    1 
ATOM   3354 C  CG    . MET C 3 347 ? 67.544  -30.469 29.766  1.00 53.79  ? 347  MET A CG    1 
ATOM   3355 S  SD    . MET C 3 347 ? 67.767  -32.003 28.771  1.00 74.75  ? 347  MET A SD    1 
ATOM   3356 C  CE    . MET C 3 347 ? 66.159  -32.733 28.867  1.00 69.05  ? 347  MET A CE    1 
ATOM   3357 N  N     . GLY C 3 348 ? 66.810  -29.786 33.867  1.00 38.17  ? 348  GLY A N     1 
ATOM   3358 C  CA    . GLY C 3 348 ? 65.666  -29.387 34.665  1.00 42.77  ? 348  GLY A CA    1 
ATOM   3359 C  C     . GLY C 3 348 ? 65.803  -27.981 35.213  1.00 44.64  ? 348  GLY A C     1 
ATOM   3360 O  O     . GLY C 3 348 ? 64.930  -27.137 34.999  1.00 45.77  ? 348  GLY A O     1 
ATOM   3361 N  N     . TYR C 3 349 ? 66.896  -27.727 35.925  1.00 41.87  ? 349  TYR A N     1 
ATOM   3362 C  CA    . TYR C 3 349 ? 67.138  -26.409 36.505  1.00 40.97  ? 349  TYR A CA    1 
ATOM   3363 C  C     . TYR C 3 349 ? 67.424  -25.330 35.470  1.00 40.35  ? 349  TYR A C     1 
ATOM   3364 O  O     . TYR C 3 349 ? 67.472  -24.140 35.800  1.00 43.66  ? 349  TYR A O     1 
ATOM   3365 C  CB    . TYR C 3 349 ? 68.305  -26.464 37.484  1.00 38.47  ? 349  TYR A CB    1 
ATOM   3366 C  CG    . TYR C 3 349 ? 68.034  -27.217 38.769  1.00 34.67  ? 349  TYR A CG    1 
ATOM   3367 C  CD1   . TYR C 3 349 ? 66.977  -26.865 39.598  1.00 32.45  ? 349  TYR A CD1   1 
ATOM   3368 C  CD2   . TYR C 3 349 ? 68.893  -28.227 39.200  1.00 35.45  ? 349  TYR A CD2   1 
ATOM   3369 C  CE1   . TYR C 3 349 ? 66.784  -27.493 40.829  1.00 27.06  ? 349  TYR A CE1   1 
ATOM   3370 C  CE2   . TYR C 3 349 ? 68.710  -28.854 40.427  1.00 35.83  ? 349  TYR A CE2   1 
ATOM   3371 C  CZ    . TYR C 3 349 ? 67.656  -28.480 41.236  1.00 31.20  ? 349  TYR A CZ    1 
ATOM   3372 O  OH    . TYR C 3 349 ? 67.506  -29.087 42.463  1.00 36.81  ? 349  TYR A OH    1 
ATOM   3373 N  N     . TYR C 3 350 ? 67.616  -25.735 34.221  1.00 36.91  ? 350  TYR A N     1 
ATOM   3374 C  CA    . TYR C 3 350 ? 67.903  -24.774 33.164  1.00 40.42  ? 350  TYR A CA    1 
ATOM   3375 C  C     . TYR C 3 350 ? 66.627  -24.179 32.645  1.00 37.02  ? 350  TYR A C     1 
ATOM   3376 O  O     . TYR C 3 350 ? 66.564  -22.999 32.338  1.00 38.86  ? 350  TYR A O     1 
ATOM   3377 C  CB    . TYR C 3 350 ? 68.645  -25.447 32.008  1.00 44.48  ? 350  TYR A CB    1 
ATOM   3378 C  CG    . TYR C 3 350 ? 68.822  -24.553 30.789  1.00 42.02  ? 350  TYR A CG    1 
ATOM   3379 C  CD1   . TYR C 3 350 ? 69.635  -23.424 30.836  1.00 45.80  ? 350  TYR A CD1   1 
ATOM   3380 C  CD2   . TYR C 3 350 ? 68.172  -24.838 29.593  1.00 43.70  ? 350  TYR A CD2   1 
ATOM   3381 C  CE1   . TYR C 3 350 ? 69.796  -22.595 29.708  1.00 46.72  ? 350  TYR A CE1   1 
ATOM   3382 C  CE2   . TYR C 3 350 ? 68.325  -24.022 28.467  1.00 43.41  ? 350  TYR A CE2   1 
ATOM   3383 C  CZ    . TYR C 3 350 ? 69.135  -22.903 28.530  1.00 45.08  ? 350  TYR A CZ    1 
ATOM   3384 O  OH    . TYR C 3 350 ? 69.275  -22.091 27.422  1.00 50.55  ? 350  TYR A OH    1 
ATOM   3385 N  N     . ALA C 3 351 ? 65.612  -25.023 32.542  1.00 42.92  ? 351  ALA A N     1 
ATOM   3386 C  CA    . ALA C 3 351 ? 64.301  -24.624 32.054  1.00 44.89  ? 351  ALA A CA    1 
ATOM   3387 C  C     . ALA C 3 351 ? 63.383  -24.228 33.216  1.00 43.37  ? 351  ALA A C     1 
ATOM   3388 O  O     . ALA C 3 351 ? 62.332  -23.626 33.005  1.00 40.93  ? 351  ALA A O     1 
ATOM   3389 C  CB    . ALA C 3 351 ? 63.685  -25.781 31.255  1.00 46.86  ? 351  ALA A CB    1 
ATOM   3390 N  N     . LYS C 3 352 ? 63.793  -24.573 34.436  1.00 40.14  ? 352  LYS A N     1 
ATOM   3391 C  CA    . LYS C 3 352 ? 63.025  -24.268 35.645  1.00 38.51  ? 352  LYS A CA    1 
ATOM   3392 C  C     . LYS C 3 352 ? 61.707  -25.001 35.623  1.00 35.91  ? 352  LYS A C     1 
ATOM   3393 O  O     . LYS C 3 352 ? 60.653  -24.397 35.513  1.00 38.66  ? 352  LYS A O     1 
ATOM   3394 C  CB    . LYS C 3 352 ? 62.792  -22.766 35.762  1.00 37.97  ? 352  LYS A CB    1 
ATOM   3395 C  CG    . LYS C 3 352 ? 64.038  -21.980 36.111  1.00 35.57  ? 352  LYS A CG    1 
ATOM   3396 C  CD    . LYS C 3 352 ? 63.782  -20.500 36.025  1.00 37.98  ? 352  LYS A CD    1 
ATOM   3397 C  CE    . LYS C 3 352 ? 64.948  -19.723 36.584  1.00 44.00  ? 352  LYS A CE    1 
ATOM   3398 N  NZ    . LYS C 3 352 ? 64.723  -18.254 36.452  1.00 53.02  ? 352  LYS A NZ    1 
ATOM   3399 N  N     . ILE C 3 353 ? 61.802  -26.321 35.719  1.00 34.23  ? 353  ILE A N     1 
ATOM   3400 C  CA    . ILE C 3 353 ? 60.660  -27.217 35.695  1.00 31.49  ? 353  ILE A CA    1 
ATOM   3401 C  C     . ILE C 3 353 ? 60.850  -28.333 36.729  1.00 35.56  ? 353  ILE A C     1 
ATOM   3402 O  O     . ILE C 3 353 ? 61.864  -28.414 37.432  1.00 28.85  ? 353  ILE A O     1 
ATOM   3403 C  CB    . ILE C 3 353 ? 60.501  -27.907 34.316  1.00 31.18  ? 353  ILE A CB    1 
ATOM   3404 C  CG1   . ILE C 3 353 ? 61.784  -28.655 33.991  1.00 32.13  ? 353  ILE A CG1   1 
ATOM   3405 C  CG2   . ILE C 3 353 ? 60.176  -26.890 33.210  1.00 32.08  ? 353  ILE A CG2   1 
ATOM   3406 C  CD1   . ILE C 3 353 ? 61.775  -29.300 32.638  1.00 44.91  ? 353  ILE A CD1   1 
ATOM   3407 N  N     . GLN C 3 354 ? 59.840  -29.185 36.835  1.00 35.11  ? 354  GLN A N     1 
ATOM   3408 C  CA    . GLN C 3 354 ? 59.936  -30.294 37.753  1.00 34.21  ? 354  GLN A CA    1 
ATOM   3409 C  C     . GLN C 3 354 ? 60.967  -31.123 37.037  1.00 35.30  ? 354  GLN A C     1 
ATOM   3410 O  O     . GLN C 3 354 ? 60.954  -31.168 35.803  1.00 37.92  ? 354  GLN A O     1 
ATOM   3411 C  CB    . GLN C 3 354 ? 58.614  -31.038 37.834  1.00 33.44  ? 354  GLN A CB    1 
ATOM   3412 C  CG    . GLN C 3 354 ? 57.457  -30.156 38.219  1.00 35.35  ? 354  GLN A CG    1 
ATOM   3413 C  CD    . GLN C 3 354 ? 56.211  -30.941 38.540  1.00 38.81  ? 354  GLN A CD    1 
ATOM   3414 O  OE1   . GLN C 3 354 ? 55.646  -31.621 37.690  1.00 40.04  ? 354  GLN A OE1   1 
ATOM   3415 N  NE2   . GLN C 3 354 ? 55.776  -30.854 39.780  1.00 47.37  ? 354  GLN A NE2   1 
ATOM   3416 N  N     . ILE C 3 355 ? 61.869  -31.757 37.779  1.00 33.76  ? 355  ILE A N     1 
ATOM   3417 C  CA    . ILE C 3 355 ? 62.917  -32.553 37.152  1.00 35.41  ? 355  ILE A CA    1 
ATOM   3418 C  C     . ILE C 3 355 ? 62.385  -33.682 36.247  1.00 40.48  ? 355  ILE A C     1 
ATOM   3419 O  O     . ILE C 3 355 ? 62.962  -33.971 35.193  1.00 41.34  ? 355  ILE A O     1 
ATOM   3420 C  CB    . ILE C 3 355 ? 63.875  -33.135 38.215  1.00 32.21  ? 355  ILE A CB    1 
ATOM   3421 C  CG1   . ILE C 3 355 ? 64.422  -32.004 39.081  1.00 34.03  ? 355  ILE A CG1   1 
ATOM   3422 C  CG2   . ILE C 3 355 ? 65.063  -33.797 37.543  1.00 38.57  ? 355  ILE A CG2   1 
ATOM   3423 C  CD1   . ILE C 3 355 ? 65.135  -30.902 38.275  1.00 29.36  ? 355  ILE A CD1   1 
ATOM   3424 N  N     . GLN C 3 356 ? 61.276  -34.302 36.629  1.00 35.01  ? 356  GLN A N     1 
ATOM   3425 C  CA    . GLN C 3 356 ? 60.734  -35.379 35.825  1.00 30.80  ? 356  GLN A CA    1 
ATOM   3426 C  C     . GLN C 3 356 ? 60.149  -34.926 34.509  1.00 32.56  ? 356  GLN A C     1 
ATOM   3427 O  O     . GLN C 3 356 ? 59.929  -35.734 33.612  1.00 35.76  ? 356  GLN A O     1 
ATOM   3428 C  CB    . GLN C 3 356 ? 59.649  -36.123 36.589  1.00 32.62  ? 356  GLN A CB    1 
ATOM   3429 C  CG    . GLN C 3 356 ? 58.387  -35.309 36.780  1.00 35.78  ? 356  GLN A CG    1 
ATOM   3430 C  CD    . GLN C 3 356 ? 58.245  -34.796 38.191  1.00 45.49  ? 356  GLN A CD    1 
ATOM   3431 O  OE1   . GLN C 3 356 ? 59.242  -34.506 38.870  1.00 46.77  ? 356  GLN A OE1   1 
ATOM   3432 N  NE2   . GLN C 3 356 ? 57.010  -34.660 38.643  1.00 48.15  ? 356  GLN A NE2   1 
ATOM   3433 N  N     . SER C 3 357 ? 59.873  -33.643 34.376  1.00 34.38  ? 357  SER A N     1 
ATOM   3434 C  CA    . SER C 3 357 ? 59.276  -33.162 33.135  1.00 41.10  ? 357  SER A CA    1 
ATOM   3435 C  C     . SER C 3 357 ? 60.309  -33.155 32.025  1.00 41.43  ? 357  SER A C     1 
ATOM   3436 O  O     . SER C 3 357 ? 60.069  -32.653 30.931  1.00 38.94  ? 357  SER A O     1 
ATOM   3437 C  CB    . SER C 3 357 ? 58.720  -31.756 33.330  1.00 46.57  ? 357  SER A CB    1 
ATOM   3438 O  OG    . SER C 3 357 ? 57.754  -31.723 34.370  1.00 56.93  ? 357  SER A OG    1 
ATOM   3439 N  N     . VAL C 3 358 ? 61.462  -33.731 32.322  1.00 42.81  ? 358  VAL A N     1 
ATOM   3440 C  CA    . VAL C 3 358 ? 62.557  -33.787 31.376  1.00 46.36  ? 358  VAL A CA    1 
ATOM   3441 C  C     . VAL C 3 358 ? 62.230  -34.805 30.292  1.00 45.41  ? 358  VAL A C     1 
ATOM   3442 O  O     . VAL C 3 358 ? 62.752  -34.734 29.179  1.00 44.42  ? 358  VAL A O     1 
ATOM   3443 C  CB    . VAL C 3 358 ? 63.867  -34.158 32.116  1.00 49.88  ? 358  VAL A CB    1 
ATOM   3444 C  CG1   . VAL C 3 358 ? 64.278  -35.567 31.804  1.00 44.74  ? 358  VAL A CG1   1 
ATOM   3445 C  CG2   . VAL C 3 358 ? 64.952  -33.163 31.786  1.00 49.44  ? 358  VAL A CG2   1 
ATOM   3446 N  N     . PHE C 3 359 ? 61.348  -35.746 30.619  1.00 40.74  ? 359  PHE A N     1 
ATOM   3447 C  CA    . PHE C 3 359 ? 60.949  -36.771 29.660  1.00 39.02  ? 359  PHE A CA    1 
ATOM   3448 C  C     . PHE C 3 359 ? 60.049  -36.166 28.605  1.00 39.52  ? 359  PHE A C     1 
ATOM   3449 O  O     . PHE C 3 359 ? 59.719  -36.818 27.625  1.00 42.91  ? 359  PHE A O     1 
ATOM   3450 C  CB    . PHE C 3 359 ? 60.209  -37.932 30.351  1.00 32.74  ? 359  PHE A CB    1 
ATOM   3451 C  CG    . PHE C 3 359 ? 61.104  -38.840 31.167  1.00 36.55  ? 359  PHE A CG    1 
ATOM   3452 C  CD1   . PHE C 3 359 ? 62.123  -39.560 30.570  1.00 31.08  ? 359  PHE A CD1   1 
ATOM   3453 C  CD2   . PHE C 3 359 ? 60.947  -38.942 32.550  1.00 36.32  ? 359  PHE A CD2   1 
ATOM   3454 C  CE1   . PHE C 3 359 ? 62.975  -40.360 31.335  1.00 35.31  ? 359  PHE A CE1   1 
ATOM   3455 C  CE2   . PHE C 3 359 ? 61.803  -39.748 33.321  1.00 36.40  ? 359  PHE A CE2   1 
ATOM   3456 C  CZ    . PHE C 3 359 ? 62.814  -40.451 32.711  1.00 30.96  ? 359  PHE A CZ    1 
ATOM   3457 N  N     . SER C 3 360 ? 59.658  -34.915 28.808  1.00 43.31  ? 360  SER A N     1 
ATOM   3458 C  CA    . SER C 3 360 ? 58.777  -34.229 27.873  1.00 43.47  ? 360  SER A CA    1 
ATOM   3459 C  C     . SER C 3 360 ? 59.438  -33.025 27.229  1.00 49.83  ? 360  SER A C     1 
ATOM   3460 O  O     . SER C 3 360 ? 59.730  -32.031 27.899  1.00 52.72  ? 360  SER A O     1 
ATOM   3461 C  CB    . SER C 3 360 ? 57.508  -33.764 28.585  1.00 34.91  ? 360  SER A CB    1 
ATOM   3462 O  OG    . SER C 3 360 ? 56.699  -32.977 27.726  1.00 39.63  ? 360  SER A OG    1 
ATOM   3463 N  N     . PRO C 3 361 ? 59.700  -33.103 25.917  1.00 56.23  ? 361  PRO A N     1 
ATOM   3464 C  CA    . PRO C 3 361 ? 60.328  -32.004 25.176  1.00 58.73  ? 361  PRO A CA    1 
ATOM   3465 C  C     . PRO C 3 361 ? 59.375  -30.811 25.157  1.00 59.00  ? 361  PRO A C     1 
ATOM   3466 O  O     . PRO C 3 361 ? 59.796  -29.654 25.110  1.00 60.84  ? 361  PRO A O     1 
ATOM   3467 C  CB    . PRO C 3 361 ? 60.545  -32.610 23.790  1.00 61.17  ? 361  PRO A CB    1 
ATOM   3468 C  CG    . PRO C 3 361 ? 60.786  -34.056 24.099  1.00 59.35  ? 361  PRO A CG    1 
ATOM   3469 C  CD    . PRO C 3 361 ? 59.682  -34.329 25.103  1.00 61.67  ? 361  PRO A CD    1 
ATOM   3470 N  N     . ILE C 3 362 ? 58.083  -31.115 25.205  1.00 56.53  ? 362  ILE A N     1 
ATOM   3471 C  CA    . ILE C 3 362 ? 57.047  -30.096 25.218  1.00 55.07  ? 362  ILE A CA    1 
ATOM   3472 C  C     . ILE C 3 362 ? 57.130  -29.173 26.435  1.00 48.09  ? 362  ILE A C     1 
ATOM   3473 O  O     . ILE C 3 362 ? 57.063  -27.964 26.279  1.00 48.36  ? 362  ILE A O     1 
ATOM   3474 C  CB    . ILE C 3 362 ? 55.641  -30.736 25.175  1.00 62.91  ? 362  ILE A CB    1 
ATOM   3475 C  CG1   . ILE C 3 362 ? 55.239  -31.002 23.723  1.00 60.48  ? 362  ILE A CG1   1 
ATOM   3476 C  CG2   . ILE C 3 362 ? 54.623  -29.836 25.870  1.00 69.25  ? 362  ILE A CG2   1 
ATOM   3477 C  CD1   . ILE C 3 362 ? 55.248  -29.766 22.862  1.00 61.41  ? 362  ILE A CD1   1 
ATOM   3478 N  N     . LYS C 3 363 ? 57.255  -29.739 27.637  1.00 42.57  ? 363  LYS A N     1 
ATOM   3479 C  CA    . LYS C 3 363 ? 57.344  -28.944 28.868  1.00 41.85  ? 363  LYS A CA    1 
ATOM   3480 C  C     . LYS C 3 363 ? 58.613  -28.111 28.923  1.00 45.40  ? 363  LYS A C     1 
ATOM   3481 O  O     . LYS C 3 363 ? 58.579  -26.897 29.158  1.00 38.63  ? 363  LYS A O     1 
ATOM   3482 C  CB    . LYS C 3 363 ? 57.310  -29.852 30.094  1.00 44.78  ? 363  LYS A CB    1 
ATOM   3483 C  CG    . LYS C 3 363 ? 56.023  -29.751 30.892  1.00 52.28  ? 363  LYS A CG    1 
ATOM   3484 C  CD    . LYS C 3 363 ? 55.947  -28.440 31.617  1.00 50.97  ? 363  LYS A CD    1 
ATOM   3485 C  CE    . LYS C 3 363 ? 54.609  -28.289 32.301  1.00 59.40  ? 363  LYS A CE    1 
ATOM   3486 N  NZ    . LYS C 3 363 ? 53.517  -28.127 31.299  1.00 62.74  ? 363  LYS A NZ    1 
ATOM   3487 N  N     . THR C 3 364 ? 59.738  -28.787 28.707  1.00 46.82  ? 364  THR A N     1 
ATOM   3488 C  CA    . THR C 3 364 ? 61.036  -28.151 28.734  1.00 39.62  ? 364  THR A CA    1 
ATOM   3489 C  C     . THR C 3 364 ? 61.079  -26.925 27.850  1.00 37.48  ? 364  THR A C     1 
ATOM   3490 O  O     . THR C 3 364 ? 61.312  -25.831 28.344  1.00 39.88  ? 364  THR A O     1 
ATOM   3491 C  CB    . THR C 3 364 ? 62.129  -29.158 28.346  1.00 41.26  ? 364  THR A CB    1 
ATOM   3492 O  OG1   . THR C 3 364 ? 62.177  -30.178 29.348  1.00 46.07  ? 364  THR A OG1   1 
ATOM   3493 C  CG2   . THR C 3 364 ? 63.504  -28.496 28.261  1.00 37.33  ? 364  THR A CG2   1 
ATOM   3494 N  N     . TRP C 3 365 ? 60.831  -27.077 26.556  1.00 36.16  ? 365  TRP A N     1 
ATOM   3495 C  CA    . TRP C 3 365 ? 60.878  -25.909 25.681  1.00 37.98  ? 365  TRP A CA    1 
ATOM   3496 C  C     . TRP C 3 365 ? 59.842  -24.846 26.028  1.00 38.81  ? 365  TRP A C     1 
ATOM   3497 O  O     . TRP C 3 365 ? 60.107  -23.640 25.943  1.00 40.66  ? 365  TRP A O     1 
ATOM   3498 C  CB    . TRP C 3 365 ? 60.743  -26.330 24.215  1.00 36.61  ? 365  TRP A CB    1 
ATOM   3499 C  CG    . TRP C 3 365 ? 62.082  -26.479 23.551  1.00 42.62  ? 365  TRP A CG    1 
ATOM   3500 C  CD1   . TRP C 3 365 ? 62.700  -27.641 23.207  1.00 50.47  ? 365  TRP A CD1   1 
ATOM   3501 C  CD2   . TRP C 3 365 ? 62.989  -25.426 23.203  1.00 40.65  ? 365  TRP A CD2   1 
ATOM   3502 N  NE1   . TRP C 3 365 ? 63.939  -27.385 22.668  1.00 46.89  ? 365  TRP A NE1   1 
ATOM   3503 C  CE2   . TRP C 3 365 ? 64.142  -26.032 22.655  1.00 42.73  ? 365  TRP A CE2   1 
ATOM   3504 C  CE3   . TRP C 3 365 ? 62.942  -24.032 23.303  1.00 41.59  ? 365  TRP A CE3   1 
ATOM   3505 C  CZ2   . TRP C 3 365 ? 65.236  -25.293 22.204  1.00 44.67  ? 365  TRP A CZ2   1 
ATOM   3506 C  CZ3   . TRP C 3 365 ? 64.033  -23.295 22.853  1.00 46.36  ? 365  TRP A CZ3   1 
ATOM   3507 C  CH2   . TRP C 3 365 ? 65.165  -23.930 22.312  1.00 46.39  ? 365  TRP A CH2   1 
ATOM   3508 N  N     . ASP C 3 366 ? 58.661  -25.295 26.430  1.00 36.25  ? 366  ASP A N     1 
ATOM   3509 C  CA    . ASP C 3 366 ? 57.601  -24.377 26.786  1.00 31.74  ? 366  ASP A CA    1 
ATOM   3510 C  C     . ASP C 3 366 ? 58.091  -23.448 27.894  1.00 35.04  ? 366  ASP A C     1 
ATOM   3511 O  O     . ASP C 3 366 ? 57.836  -22.248 27.847  1.00 32.32  ? 366  ASP A O     1 
ATOM   3512 C  CB    . ASP C 3 366 ? 56.365  -25.156 27.233  1.00 32.15  ? 366  ASP A CB    1 
ATOM   3513 C  CG    . ASP C 3 366 ? 55.138  -24.272 27.396  1.00 43.06  ? 366  ASP A CG    1 
ATOM   3514 O  OD1   . ASP C 3 366 ? 54.867  -23.428 26.501  1.00 43.34  ? 366  ASP A OD1   1 
ATOM   3515 O  OD2   . ASP C 3 366 ? 54.426  -24.422 28.416  1.00 41.89  ? 366  ASP A OD2   1 
ATOM   3516 N  N     . ALA C 3 367 ? 58.804  -24.005 28.873  1.00 33.15  ? 367  ALA A N     1 
ATOM   3517 C  CA    . ALA C 3 367 ? 59.340  -23.240 29.998  1.00 36.61  ? 367  ALA A CA    1 
ATOM   3518 C  C     . ALA C 3 367 ? 60.474  -22.280 29.590  1.00 41.54  ? 367  ALA A C     1 
ATOM   3519 O  O     . ALA C 3 367 ? 60.501  -21.124 30.007  1.00 38.34  ? 367  ALA A O     1 
ATOM   3520 C  CB    . ALA C 3 367 ? 59.826  -24.201 31.070  1.00 44.72  ? 367  ALA A CB    1 
ATOM   3521 N  N     . ILE C 3 368 ? 61.405  -22.766 28.774  1.00 37.61  ? 368  ILE A N     1 
ATOM   3522 C  CA    . ILE C 3 368 ? 62.518  -21.959 28.285  1.00 36.15  ? 368  ILE A CA    1 
ATOM   3523 C  C     . ILE C 3 368 ? 62.004  -20.706 27.577  1.00 38.47  ? 368  ILE A C     1 
ATOM   3524 O  O     . ILE C 3 368 ? 62.384  -19.592 27.934  1.00 45.89  ? 368  ILE A O     1 
ATOM   3525 C  CB    . ILE C 3 368 ? 63.424  -22.793 27.292  1.00 38.60  ? 368  ILE A CB    1 
ATOM   3526 C  CG1   . ILE C 3 368 ? 64.103  -23.937 28.050  1.00 34.59  ? 368  ILE A CG1   1 
ATOM   3527 C  CG2   . ILE C 3 368 ? 64.499  -21.929 26.655  1.00 26.42  ? 368  ILE A CG2   1 
ATOM   3528 C  CD1   . ILE C 3 368 ? 64.729  -24.953 27.167  1.00 33.16  ? 368  ILE A CD1   1 
ATOM   3529 N  N     . ILE C 3 369 ? 61.139  -20.877 26.581  1.00 34.17  ? 369  ILE A N     1 
ATOM   3530 C  CA    . ILE C 3 369 ? 60.615  -19.732 25.826  1.00 34.44  ? 369  ILE A CA    1 
ATOM   3531 C  C     . ILE C 3 369 ? 59.782  -18.776 26.672  1.00 34.37  ? 369  ILE A C     1 
ATOM   3532 O  O     . ILE C 3 369 ? 59.749  -17.577 26.414  1.00 31.84  ? 369  ILE A O     1 
ATOM   3533 C  CB    . ILE C 3 369 ? 59.795  -20.214 24.614  1.00 32.61  ? 369  ILE A CB    1 
ATOM   3534 C  CG1   . ILE C 3 369 ? 60.719  -21.000 23.675  1.00 33.45  ? 369  ILE A CG1   1 
ATOM   3535 C  CG2   . ILE C 3 369 ? 59.178  -19.032 23.891  1.00 24.07  ? 369  ILE A CG2   1 
ATOM   3536 C  CD1   . ILE C 3 369 ? 60.014  -21.816 22.635  1.00 33.20  ? 369  ILE A CD1   1 
ATOM   3537 N  N     . PHE C 3 370 ? 59.123  -19.319 27.692  1.00 38.37  ? 370  PHE A N     1 
ATOM   3538 C  CA    . PHE C 3 370 ? 58.297  -18.534 28.601  1.00 36.64  ? 370  PHE A CA    1 
ATOM   3539 C  C     . PHE C 3 370 ? 59.181  -17.626 29.441  1.00 38.95  ? 370  PHE A C     1 
ATOM   3540 O  O     . PHE C 3 370 ? 58.974  -16.412 29.507  1.00 41.73  ? 370  PHE A O     1 
ATOM   3541 C  CB    . PHE C 3 370 ? 57.511  -19.455 29.526  1.00 35.26  ? 370  PHE A CB    1 
ATOM   3542 C  CG    . PHE C 3 370 ? 56.960  -18.768 30.740  1.00 34.33  ? 370  PHE A CG    1 
ATOM   3543 C  CD1   . PHE C 3 370 ? 56.322  -17.538 30.628  1.00 31.43  ? 370  PHE A CD1   1 
ATOM   3544 C  CD2   . PHE C 3 370 ? 57.126  -19.324 32.002  1.00 29.52  ? 370  PHE A CD2   1 
ATOM   3545 C  CE1   . PHE C 3 370 ? 55.869  -16.878 31.758  1.00 35.39  ? 370  PHE A CE1   1 
ATOM   3546 C  CE2   . PHE C 3 370 ? 56.678  -18.673 33.137  1.00 31.19  ? 370  PHE A CE2   1 
ATOM   3547 C  CZ    . PHE C 3 370 ? 56.050  -17.449 33.022  1.00 28.77  ? 370  PHE A CZ    1 
ATOM   3548 N  N     . ASN C 3 371 ? 60.154  -18.235 30.102  1.00 35.33  ? 371  ASN A N     1 
ATOM   3549 C  CA    . ASN C 3 371 ? 61.086  -17.505 30.937  1.00 35.98  ? 371  ASN A CA    1 
ATOM   3550 C  C     . ASN C 3 371 ? 61.855  -16.460 30.132  1.00 35.32  ? 371  ASN A C     1 
ATOM   3551 O  O     . ASN C 3 371 ? 62.106  -15.356 30.600  1.00 38.75  ? 371  ASN A O     1 
ATOM   3552 C  CB    . ASN C 3 371 ? 62.048  -18.490 31.594  1.00 31.58  ? 371  ASN A CB    1 
ATOM   3553 C  CG    . ASN C 3 371 ? 61.431  -19.208 32.776  1.00 33.25  ? 371  ASN A CG    1 
ATOM   3554 O  OD1   . ASN C 3 371 ? 61.305  -18.638 33.853  1.00 41.78  ? 371  ASN A OD1   1 
ATOM   3555 N  ND2   . ASN C 3 371 ? 61.039  -20.458 32.582  1.00 28.91  ? 371  ASN A ND2   1 
ATOM   3556 N  N     . SER C 3 372 ? 62.228  -16.802 28.912  1.00 40.19  ? 372  SER A N     1 
ATOM   3557 C  CA    . SER C 3 372 ? 62.955  -15.858 28.075  1.00 44.14  ? 372  SER A CA    1 
ATOM   3558 C  C     . SER C 3 372 ? 62.040  -14.688 27.764  1.00 47.04  ? 372  SER A C     1 
ATOM   3559 O  O     . SER C 3 372 ? 62.451  -13.536 27.841  1.00 54.50  ? 372  SER A O     1 
ATOM   3560 C  CB    . SER C 3 372 ? 63.386  -16.535 26.773  1.00 46.40  ? 372  SER A CB    1 
ATOM   3561 O  OG    . SER C 3 372 ? 63.885  -15.589 25.845  1.00 46.52  ? 372  SER A OG    1 
ATOM   3562 N  N     . LEU C 3 373 ? 60.791  -14.991 27.425  1.00 49.00  ? 373  LEU A N     1 
ATOM   3563 C  CA    . LEU C 3 373 ? 59.817  -13.959 27.089  1.00 43.88  ? 373  LEU A CA    1 
ATOM   3564 C  C     . LEU C 3 373 ? 59.379  -13.094 28.258  1.00 41.15  ? 373  LEU A C     1 
ATOM   3565 O  O     . LEU C 3 373 ? 59.156  -11.901 28.090  1.00 41.04  ? 373  LEU A O     1 
ATOM   3566 C  CB    . LEU C 3 373 ? 58.591  -14.596 26.430  1.00 32.97  ? 373  LEU A CB    1 
ATOM   3567 C  CG    . LEU C 3 373 ? 58.399  -14.369 24.922  1.00 30.85  ? 373  LEU A CG    1 
ATOM   3568 C  CD1   . LEU C 3 373 ? 59.719  -14.086 24.233  1.00 34.65  ? 373  LEU A CD1   1 
ATOM   3569 C  CD2   . LEU C 3 373 ? 57.736  -15.589 24.320  1.00 28.96  ? 373  LEU A CD2   1 
ATOM   3570 N  N     . LYS C 3 374 ? 59.257  -13.695 29.435  1.00 39.89  ? 374  LYS A N     1 
ATOM   3571 C  CA    . LYS C 3 374 ? 58.833  -12.976 30.628  1.00 39.86  ? 374  LYS A CA    1 
ATOM   3572 C  C     . LYS C 3 374 ? 59.825  -11.886 31.027  1.00 45.51  ? 374  LYS A C     1 
ATOM   3573 O  O     . LYS C 3 374 ? 59.424  -10.830 31.520  1.00 41.47  ? 374  LYS A O     1 
ATOM   3574 C  CB    . LYS C 3 374 ? 58.647  -13.961 31.780  1.00 42.41  ? 374  LYS A CB    1 
ATOM   3575 C  CG    . LYS C 3 374 ? 58.421  -13.320 33.135  1.00 40.59  ? 374  LYS A CG    1 
ATOM   3576 C  CD    . LYS C 3 374 ? 58.121  -14.379 34.167  1.00 46.77  ? 374  LYS A CD    1 
ATOM   3577 C  CE    . LYS C 3 374 ? 58.165  -13.846 35.600  1.00 53.01  ? 374  LYS A CE    1 
ATOM   3578 N  NZ    . LYS C 3 374 ? 59.552  -13.663 36.145  1.00 44.23  ? 374  LYS A NZ    1 
ATOM   3579 N  N     . GLU C 3 375 ? 61.115  -12.129 30.810  1.00 47.40  ? 375  GLU A N     1 
ATOM   3580 C  CA    . GLU C 3 375 ? 62.106  -11.128 31.174  1.00 52.39  ? 375  GLU A CA    1 
ATOM   3581 C  C     . GLU C 3 375 ? 62.099  -9.938  30.204  1.00 49.48  ? 375  GLU A C     1 
ATOM   3582 O  O     . GLU C 3 375 ? 63.018  -9.125  30.185  1.00 51.69  ? 375  GLU A O     1 
ATOM   3583 C  CB    . GLU C 3 375 ? 63.501  -11.757 31.256  1.00 56.02  ? 375  GLU A CB    1 
ATOM   3584 C  CG    . GLU C 3 375 ? 64.240  -11.858 29.932  1.00 78.02  ? 375  GLU A CG    1 
ATOM   3585 C  CD    . GLU C 3 375 ? 65.564  -11.094 29.945  1.00 88.45  ? 375  GLU A CD    1 
ATOM   3586 O  OE1   . GLU C 3 375 ? 66.414  -11.392 30.815  1.00 93.09  ? 375  GLU A OE1   1 
ATOM   3587 O  OE2   . GLU C 3 375 ? 65.750  -10.196 29.088  1.00 94.65  ? 375  GLU A OE2   1 
ATOM   3588 N  N     . GLN C 3 376 ? 61.043  -9.827  29.410  1.00 45.76  ? 376  GLN A N     1 
ATOM   3589 C  CA    . GLN C 3 376 ? 60.927  -8.728  28.458  1.00 45.01  ? 376  GLN A CA    1 
ATOM   3590 C  C     . GLN C 3 376 ? 59.532  -8.141  28.451  1.00 45.82  ? 376  GLN A C     1 
ATOM   3591 O  O     . GLN C 3 376 ? 59.187  -7.396  27.534  1.00 41.25  ? 376  GLN A O     1 
ATOM   3592 C  CB    . GLN C 3 376 ? 61.206  -9.204  27.050  1.00 46.57  ? 376  GLN A CB    1 
ATOM   3593 C  CG    . GLN C 3 376 ? 62.564  -9.754  26.814  1.00 48.61  ? 376  GLN A CG    1 
ATOM   3594 C  CD    . GLN C 3 376 ? 62.650  -10.306 25.424  1.00 53.70  ? 376  GLN A CD    1 
ATOM   3595 O  OE1   . GLN C 3 376 ? 62.376  -9.600  24.453  1.00 56.02  ? 376  GLN A OE1   1 
ATOM   3596 N  NE2   . GLN C 3 376 ? 63.013  -11.574 25.308  1.00 59.26  ? 376  GLN A NE2   1 
ATOM   3597 N  N     . ASN C 3 377 ? 58.733  -8.506  29.452  1.00 44.32  ? 377  ASN A N     1 
ATOM   3598 C  CA    . ASN C 3 377 ? 57.370  -8.034  29.554  1.00 47.38  ? 377  ASN A CA    1 
ATOM   3599 C  C     . ASN C 3 377 ? 56.591  -8.534  28.342  1.00 51.02  ? 377  ASN A C     1 
ATOM   3600 O  O     . ASN C 3 377 ? 55.790  -7.801  27.756  1.00 57.84  ? 377  ASN A O     1 
ATOM   3601 C  CB    . ASN C 3 377 ? 57.325  -6.505  29.597  1.00 46.09  ? 377  ASN A CB    1 
ATOM   3602 C  CG    . ASN C 3 377 ? 58.115  -5.921  30.759  1.00 52.14  ? 377  ASN A CG    1 
ATOM   3603 O  OD1   . ASN C 3 377 ? 58.089  -6.446  31.884  1.00 48.84  ? 377  ASN A OD1   1 
ATOM   3604 N  ND2   . ASN C 3 377 ? 58.805  -4.807  30.499  1.00 53.68  ? 377  ASN A ND2   1 
ATOM   3605 N  N     . LYS C 3 378 ? 56.843  -9.777  27.944  1.00 45.45  ? 378  LYS A N     1 
ATOM   3606 C  CA    . LYS C 3 378 ? 56.132  -10.361 26.810  1.00 40.89  ? 378  LYS A CA    1 
ATOM   3607 C  C     . LYS C 3 378 ? 55.155  -11.404 27.351  1.00 41.68  ? 378  LYS A C     1 
ATOM   3608 O  O     . LYS C 3 378 ? 55.398  -12.024 28.385  1.00 37.22  ? 378  LYS A O     1 
ATOM   3609 C  CB    . LYS C 3 378 ? 57.120  -10.992 25.853  1.00 35.84  ? 378  LYS A CB    1 
ATOM   3610 C  CG    . LYS C 3 378 ? 58.014  -10.003 25.176  1.00 34.80  ? 378  LYS A CG    1 
ATOM   3611 C  CD    . LYS C 3 378 ? 57.451  -9.614  23.830  1.00 44.74  ? 378  LYS A CD    1 
ATOM   3612 C  CE    . LYS C 3 378 ? 58.386  -10.008 22.680  1.00 55.06  ? 378  LYS A CE    1 
ATOM   3613 N  NZ    . LYS C 3 378 ? 59.712  -9.301  22.668  1.00 51.37  ? 378  LYS A NZ    1 
ATOM   3614 N  N     . VAL C 3 379 ? 54.047  -11.593 26.652  1.00 40.04  ? 379  VAL A N     1 
ATOM   3615 C  CA    . VAL C 3 379 ? 53.023  -12.525 27.104  1.00 42.80  ? 379  VAL A CA    1 
ATOM   3616 C  C     . VAL C 3 379 ? 52.819  -13.706 26.157  1.00 37.89  ? 379  VAL A C     1 
ATOM   3617 O  O     . VAL C 3 379 ? 52.448  -13.520 24.999  1.00 41.86  ? 379  VAL A O     1 
ATOM   3618 C  CB    . VAL C 3 379 ? 51.695  -11.763 27.299  1.00 44.09  ? 379  VAL A CB    1 
ATOM   3619 C  CG1   . VAL C 3 379 ? 50.632  -12.700 27.781  1.00 46.90  ? 379  VAL A CG1   1 
ATOM   3620 C  CG2   . VAL C 3 379 ? 51.902  -10.615 28.297  1.00 41.92  ? 379  VAL A CG2   1 
ATOM   3621 N  N     . ILE C 3 380 ? 53.049  -14.920 26.651  1.00 34.91  ? 380  ILE A N     1 
ATOM   3622 C  CA    . ILE C 3 380 ? 52.914  -16.108 25.811  1.00 34.17  ? 380  ILE A CA    1 
ATOM   3623 C  C     . ILE C 3 380 ? 51.498  -16.364 25.353  1.00 35.74  ? 380  ILE A C     1 
ATOM   3624 O  O     . ILE C 3 380 ? 50.550  -16.153 26.099  1.00 33.60  ? 380  ILE A O     1 
ATOM   3625 C  CB    . ILE C 3 380 ? 53.430  -17.385 26.516  1.00 34.31  ? 380  ILE A CB    1 
ATOM   3626 C  CG1   . ILE C 3 380 ? 52.559  -17.724 27.728  1.00 29.96  ? 380  ILE A CG1   1 
ATOM   3627 C  CG2   . ILE C 3 380 ? 54.888  -17.185 26.910  1.00 46.90  ? 380  ILE A CG2   1 
ATOM   3628 C  CD1   . ILE C 3 380 ? 53.002  -18.963 28.482  1.00 21.55  ? 380  ILE A CD1   1 
ATOM   3629 N  N     . PRO C 3 381 ? 51.338  -16.841 24.108  1.00 42.29  ? 381  PRO A N     1 
ATOM   3630 C  CA    . PRO C 3 381 ? 50.050  -17.153 23.477  1.00 40.36  ? 381  PRO A CA    1 
ATOM   3631 C  C     . PRO C 3 381 ? 49.328  -18.216 24.254  1.00 38.80  ? 381  PRO A C     1 
ATOM   3632 O  O     . PRO C 3 381 ? 49.952  -19.001 24.956  1.00 45.66  ? 381  PRO A O     1 
ATOM   3633 C  CB    . PRO C 3 381 ? 50.447  -17.685 22.112  1.00 39.67  ? 381  PRO A CB    1 
ATOM   3634 C  CG    . PRO C 3 381 ? 51.805  -17.108 21.879  1.00 45.76  ? 381  PRO A CG    1 
ATOM   3635 C  CD    . PRO C 3 381 ? 52.445  -17.227 23.221  1.00 42.53  ? 381  PRO A CD    1 
ATOM   3636 N  N     . GLN C 3 382 ? 48.015  -18.262 24.138  1.00 40.48  ? 382  GLN A N     1 
ATOM   3637 C  CA    . GLN C 3 382 ? 47.294  -19.311 24.834  1.00 46.23  ? 382  GLN A CA    1 
ATOM   3638 C  C     . GLN C 3 382 ? 47.361  -20.556 23.964  1.00 45.66  ? 382  GLN A C     1 
ATOM   3639 O  O     . GLN C 3 382 ? 47.304  -20.470 22.734  1.00 42.26  ? 382  GLN A O     1 
ATOM   3640 C  CB    . GLN C 3 382 ? 45.832  -18.931 25.045  1.00 50.18  ? 382  GLN A CB    1 
ATOM   3641 C  CG    . GLN C 3 382 ? 44.968  -20.090 25.492  1.00 51.35  ? 382  GLN A CG    1 
ATOM   3642 C  CD    . GLN C 3 382 ? 43.552  -19.667 25.786  1.00 56.90  ? 382  GLN A CD    1 
ATOM   3643 O  OE1   . GLN C 3 382 ? 42.922  -18.964 24.990  1.00 51.35  ? 382  GLN A OE1   1 
ATOM   3644 N  NE2   . GLN C 3 382 ? 43.035  -20.099 26.935  1.00 51.03  ? 382  GLN A NE2   1 
ATOM   3645 N  N     . GLY C 3 383 ? 47.486  -21.710 24.604  1.00 46.80  ? 383  GLY A N     1 
ATOM   3646 C  CA    . GLY C 3 383 ? 47.539  -22.954 23.858  1.00 55.72  ? 383  GLY A CA    1 
ATOM   3647 C  C     . GLY C 3 383 ? 46.177  -23.392 23.346  1.00 58.52  ? 383  GLY A C     1 
ATOM   3648 O  O     . GLY C 3 383 ? 45.264  -23.642 24.119  1.00 60.19  ? 383  GLY A O     1 
ATOM   3649 N  N     . ARG C 3 384 ? 46.035  -23.473 22.031  1.00 64.36  ? 384  ARG A N     1 
ATOM   3650 C  CA    . ARG C 3 384 ? 44.782  -23.897 21.428  1.00 70.80  ? 384  ARG A CA    1 
ATOM   3651 C  C     . ARG C 3 384 ? 45.090  -25.242 20.778  1.00 72.93  ? 384  ARG A C     1 
ATOM   3652 O  O     . ARG C 3 384 ? 46.218  -25.467 20.351  1.00 78.63  ? 384  ARG A O     1 
ATOM   3653 C  CB    . ARG C 3 384 ? 44.331  -22.865 20.386  1.00 70.76  ? 384  ARG A CB    1 
ATOM   3654 C  CG    . ARG C 3 384 ? 42.810  -22.740 20.295  1.00 85.83  ? 384  ARG A CG    1 
ATOM   3655 C  CD    . ARG C 3 384 ? 42.355  -21.569 19.424  1.00 89.52  ? 384  ARG A CD    1 
ATOM   3656 N  NE    . ARG C 3 384 ? 42.612  -20.254 20.022  1.00 93.48  ? 384  ARG A NE    1 
ATOM   3657 C  CZ    . ARG C 3 384 ? 42.157  -19.853 21.210  1.00 92.16  ? 384  ARG A CZ    1 
ATOM   3658 N  NH1   . ARG C 3 384 ? 41.417  -20.663 21.959  1.00 88.71  ? 384  ARG A NH1   1 
ATOM   3659 N  NH2   . ARG C 3 384 ? 42.428  -18.626 21.641  1.00 88.01  ? 384  ARG A NH2   1 
ATOM   3660 N  N     . SER C 3 385 ? 44.117  -26.146 20.718  1.00 75.54  ? 385  SER A N     1 
ATOM   3661 C  CA    . SER C 3 385 ? 44.366  -27.454 20.106  1.00 76.83  ? 385  SER A CA    1 
ATOM   3662 C  C     . SER C 3 385 ? 44.076  -27.450 18.604  1.00 73.06  ? 385  SER A C     1 
ATOM   3663 O  O     . SER C 3 385 ? 43.340  -26.595 18.093  1.00 70.08  ? 385  SER A O     1 
ATOM   3664 C  CB    . SER C 3 385 ? 43.533  -28.551 20.787  1.00 81.99  ? 385  SER A CB    1 
ATOM   3665 O  OG    . SER C 3 385 ? 42.158  -28.451 20.453  1.00 85.19  ? 385  SER A OG    1 
ATOM   3666 N  N     . HIS C 3 386 ? 44.676  -28.410 17.906  1.00 69.36  ? 386  HIS A N     1 
ATOM   3667 C  CA    . HIS C 3 386 ? 44.503  -28.549 16.467  1.00 69.17  ? 386  HIS A CA    1 
ATOM   3668 C  C     . HIS C 3 386 ? 44.459  -30.044 16.143  1.00 72.39  ? 386  HIS A C     1 
ATOM   3669 O  O     . HIS C 3 386 ? 45.071  -30.858 16.843  1.00 73.96  ? 386  HIS A O     1 
ATOM   3670 C  CB    . HIS C 3 386 ? 45.664  -27.879 15.714  1.00 63.20  ? 386  HIS A CB    1 
ATOM   3671 C  CG    . HIS C 3 386 ? 46.222  -26.671 16.405  1.00 62.98  ? 386  HIS A CG    1 
ATOM   3672 N  ND1   . HIS C 3 386 ? 47.081  -26.760 17.482  1.00 62.60  ? 386  HIS A ND1   1 
ATOM   3673 C  CD2   . HIS C 3 386 ? 46.034  -25.347 16.186  1.00 61.07  ? 386  HIS A CD2   1 
ATOM   3674 C  CE1   . HIS C 3 386 ? 47.398  -25.545 17.894  1.00 57.31  ? 386  HIS A CE1   1 
ATOM   3675 N  NE2   . HIS C 3 386 ? 46.776  -24.670 17.126  1.00 59.64  ? 386  HIS A NE2   1 
ATOM   3676 N  N     . PRO C 3 387 ? 43.734  -30.422 15.077  1.00 70.93  ? 387  PRO A N     1 
ATOM   3677 C  CA    . PRO C 3 387 ? 43.584  -31.813 14.634  1.00 70.42  ? 387  PRO A CA    1 
ATOM   3678 C  C     . PRO C 3 387 ? 44.909  -32.426 14.210  1.00 68.74  ? 387  PRO A C     1 
ATOM   3679 O  O     . PRO C 3 387 ? 45.625  -31.836 13.400  1.00 70.48  ? 387  PRO A O     1 
ATOM   3680 C  CB    . PRO C 3 387 ? 42.626  -31.701 13.449  1.00 73.19  ? 387  PRO A CB    1 
ATOM   3681 C  CG    . PRO C 3 387 ? 41.915  -30.399 13.681  1.00 75.85  ? 387  PRO A CG    1 
ATOM   3682 C  CD    . PRO C 3 387 ? 43.009  -29.514 14.176  1.00 71.18  ? 387  PRO A CD    1 
ATOM   3683 N  N     . VAL C 3 388 ? 45.240  -33.601 14.745  1.00 67.64  ? 388  VAL A N     1 
ATOM   3684 C  CA    . VAL C 3 388 ? 46.492  -34.259 14.367  1.00 69.62  ? 388  VAL A CA    1 
ATOM   3685 C  C     . VAL C 3 388 ? 46.396  -34.730 12.917  1.00 71.99  ? 388  VAL A C     1 
ATOM   3686 O  O     . VAL C 3 388 ? 45.441  -35.412 12.540  1.00 73.67  ? 388  VAL A O     1 
ATOM   3687 C  CB    . VAL C 3 388 ? 46.804  -35.500 15.243  1.00 67.14  ? 388  VAL A CB    1 
ATOM   3688 C  CG1   . VAL C 3 388 ? 48.129  -36.132 14.794  1.00 68.42  ? 388  VAL A CG1   1 
ATOM   3689 C  CG2   . VAL C 3 388 ? 46.885  -35.107 16.702  1.00 63.52  ? 388  VAL A CG2   1 
ATOM   3690 N  N     . GLN C 3 389 ? 47.382  -34.365 12.108  1.00 74.37  ? 389  GLN A N     1 
ATOM   3691 C  CA    . GLN C 3 389 ? 47.403  -34.762 10.706  1.00 79.37  ? 389  GLN A CA    1 
ATOM   3692 C  C     . GLN C 3 389 ? 48.816  -34.635 10.167  1.00 81.10  ? 389  GLN A C     1 
ATOM   3693 O  O     . GLN C 3 389 ? 49.464  -33.595 10.325  1.00 78.59  ? 389  GLN A O     1 
ATOM   3694 C  CB    . GLN C 3 389 ? 46.450  -33.892 9.887   1.00 83.16  ? 389  GLN A CB    1 
ATOM   3695 C  CG    . GLN C 3 389 ? 46.729  -32.404 9.975   1.00 87.20  ? 389  GLN A CG    1 
ATOM   3696 C  CD    . GLN C 3 389 ? 45.628  -31.579 9.336   1.00 90.50  ? 389  GLN A CD    1 
ATOM   3697 O  OE1   . GLN C 3 389 ? 45.391  -31.658 8.128   1.00 91.70  ? 389  GLN A OE1   1 
ATOM   3698 N  NE2   . GLN C 3 389 ? 44.942  -30.785 10.150  1.00 93.33  ? 389  GLN A NE2   1 
ATOM   3699 N  N     . PRO C 3 390 ? 49.317  -35.706 9.532   1.00 85.03  ? 390  PRO A N     1 
ATOM   3700 C  CA    . PRO C 3 390 ? 50.668  -35.749 8.959   1.00 86.81  ? 390  PRO A CA    1 
ATOM   3701 C  C     . PRO C 3 390 ? 50.938  -34.825 7.763   1.00 86.06  ? 390  PRO A C     1 
ATOM   3702 O  O     . PRO C 3 390 ? 50.018  -34.397 7.058   1.00 83.71  ? 390  PRO A O     1 
ATOM   3703 C  CB    . PRO C 3 390 ? 50.847  -37.232 8.605   1.00 87.18  ? 390  PRO A CB    1 
ATOM   3704 C  CG    . PRO C 3 390 ? 49.954  -37.933 9.600   1.00 85.57  ? 390  PRO A CG    1 
ATOM   3705 C  CD    . PRO C 3 390 ? 48.724  -37.056 9.564   1.00 83.41  ? 390  PRO A CD    1 
ATOM   3706 N  N     . TYR C 3 391 ? 52.220  -34.527 7.566   1.00 87.31  ? 391  TYR A N     1 
ATOM   3707 C  CA    . TYR C 3 391 ? 52.712  -33.679 6.476   1.00 88.22  ? 391  TYR A CA    1 
ATOM   3708 C  C     . TYR C 3 391 ? 53.965  -34.360 5.916   1.00 89.85  ? 391  TYR A C     1 
ATOM   3709 O  O     . TYR C 3 391 ? 54.510  -35.271 6.550   1.00 90.91  ? 391  TYR A O     1 
ATOM   3710 C  CB    . TYR C 3 391 ? 53.061  -32.277 6.999   1.00 86.76  ? 391  TYR A CB    1 
ATOM   3711 C  CG    . TYR C 3 391 ? 53.516  -32.257 8.441   1.00 83.92  ? 391  TYR A CG    1 
ATOM   3712 C  CD1   . TYR C 3 391 ? 52.599  -32.451 9.476   1.00 80.24  ? 391  TYR A CD1   1 
ATOM   3713 C  CD2   . TYR C 3 391 ? 54.869  -32.099 8.771   1.00 81.40  ? 391  TYR A CD2   1 
ATOM   3714 C  CE1   . TYR C 3 391 ? 53.006  -32.496 10.801  1.00 80.87  ? 391  TYR A CE1   1 
ATOM   3715 C  CE2   . TYR C 3 391 ? 55.294  -32.143 10.102  1.00 80.04  ? 391  TYR A CE2   1 
ATOM   3716 C  CZ    . TYR C 3 391 ? 54.352  -32.345 11.113  1.00 81.97  ? 391  TYR A CZ    1 
ATOM   3717 O  OH    . TYR C 3 391 ? 54.742  -32.409 12.434  1.00 80.87  ? 391  TYR A OH    1 
ATOM   3718 N  N     . PRO C 3 392 ? 54.450  -33.924 4.736   1.00 90.30  ? 392  PRO A N     1 
ATOM   3719 C  CA    . PRO C 3 392 ? 55.648  -34.569 4.180   1.00 89.60  ? 392  PRO A CA    1 
ATOM   3720 C  C     . PRO C 3 392 ? 56.721  -34.847 5.229   1.00 86.75  ? 392  PRO A C     1 
ATOM   3721 O  O     . PRO C 3 392 ? 56.841  -34.121 6.212   1.00 86.66  ? 392  PRO A O     1 
ATOM   3722 C  CB    . PRO C 3 392 ? 56.114  -33.581 3.099   1.00 91.21  ? 392  PRO A CB    1 
ATOM   3723 C  CG    . PRO C 3 392 ? 55.553  -32.259 3.554   1.00 92.21  ? 392  PRO A CG    1 
ATOM   3724 C  CD    . PRO C 3 392 ? 54.171  -32.659 4.034   1.00 89.61  ? 392  PRO A CD    1 
ATOM   3725 N  N     . GLY C 3 393 ? 57.484  -35.914 5.022   1.00 85.90  ? 393  GLY A N     1 
ATOM   3726 C  CA    . GLY C 3 393 ? 58.528  -36.260 5.968   1.00 82.25  ? 393  GLY A CA    1 
ATOM   3727 C  C     . GLY C 3 393 ? 59.921  -35.967 5.445   1.00 78.60  ? 393  GLY A C     1 
ATOM   3728 O  O     . GLY C 3 393 ? 60.126  -35.047 4.651   1.00 75.58  ? 393  GLY A O     1 
ATOM   3729 N  N     . ALA C 3 394 ? 60.885  -36.760 5.896   1.00 77.20  ? 394  ALA A N     1 
ATOM   3730 C  CA    . ALA C 3 394 ? 62.268  -36.597 5.480   1.00 76.72  ? 394  ALA A CA    1 
ATOM   3731 C  C     . ALA C 3 394 ? 62.504  -37.280 4.139   1.00 75.33  ? 394  ALA A C     1 
ATOM   3732 O  O     . ALA C 3 394 ? 62.114  -38.435 3.945   1.00 74.96  ? 394  ALA A O     1 
ATOM   3733 C  CB    . ALA C 3 394 ? 63.195  -37.188 6.537   1.00 76.77  ? 394  ALA A CB    1 
ATOM   3734 N  N     . PHE C 3 395 ? 63.132  -36.571 3.204   1.00 73.83  ? 395  PHE A N     1 
ATOM   3735 C  CA    . PHE C 3 395 ? 63.399  -37.188 1.912   1.00 70.11  ? 395  PHE A CA    1 
ATOM   3736 C  C     . PHE C 3 395 ? 64.469  -38.243 2.077   1.00 62.42  ? 395  PHE A C     1 
ATOM   3737 O  O     . PHE C 3 395 ? 65.515  -37.997 2.671   1.00 56.40  ? 395  PHE A O     1 
ATOM   3738 C  CB    . PHE C 3 395 ? 63.877  -36.185 0.850   1.00 70.02  ? 395  PHE A CB    1 
ATOM   3739 C  CG    . PHE C 3 395 ? 64.251  -36.842 -0.463  1.00 71.94  ? 395  PHE A CG    1 
ATOM   3740 C  CD1   . PHE C 3 395 ? 63.304  -37.568 -1.194  1.00 70.46  ? 395  PHE A CD1   1 
ATOM   3741 C  CD2   . PHE C 3 395 ? 65.561  -36.785 -0.941  1.00 72.18  ? 395  PHE A CD2   1 
ATOM   3742 C  CE1   . PHE C 3 395 ? 63.659  -38.231 -2.379  1.00 67.70  ? 395  PHE A CE1   1 
ATOM   3743 C  CE2   . PHE C 3 395 ? 65.927  -37.446 -2.127  1.00 69.48  ? 395  PHE A CE2   1 
ATOM   3744 C  CZ    . PHE C 3 395 ? 64.973  -38.170 -2.845  1.00 68.72  ? 395  PHE A CZ    1 
ATOM   3745 N  N     . VAL C 3 396 ? 64.182  -39.429 1.558   1.00 59.92  ? 396  VAL A N     1 
ATOM   3746 C  CA    . VAL C 3 396 ? 65.122  -40.528 1.603   1.00 55.60  ? 396  VAL A CA    1 
ATOM   3747 C  C     . VAL C 3 396 ? 65.170  -41.118 0.209   1.00 53.35  ? 396  VAL A C     1 
ATOM   3748 O  O     . VAL C 3 396 ? 64.181  -41.639 -0.290  1.00 46.95  ? 396  VAL A O     1 
ATOM   3749 C  CB    . VAL C 3 396 ? 64.692  -41.595 2.606   1.00 52.49  ? 396  VAL A CB    1 
ATOM   3750 C  CG1   . VAL C 3 396 ? 65.788  -42.654 2.746   1.00 49.61  ? 396  VAL A CG1   1 
ATOM   3751 C  CG2   . VAL C 3 396 ? 64.410  -40.932 3.937   1.00 55.23  ? 396  VAL A CG2   1 
ATOM   3752 N  N     . LYS C 3 397 ? 66.335  -40.999 -0.416  1.00 54.90  ? 397  LYS A N     1 
ATOM   3753 C  CA    . LYS C 3 397 ? 66.558  -41.499 -1.764  1.00 55.01  ? 397  LYS A CA    1 
ATOM   3754 C  C     . LYS C 3 397 ? 66.435  -43.027 -1.807  1.00 54.33  ? 397  LYS A C     1 
ATOM   3755 O  O     . LYS C 3 397 ? 66.920  -43.715 -0.906  1.00 56.82  ? 397  LYS A O     1 
ATOM   3756 C  CB    . LYS C 3 397 ? 67.956  -41.054 -2.223  1.00 51.03  ? 397  LYS A CB    1 
ATOM   3757 C  CG    . LYS C 3 397 ? 68.302  -41.356 -3.670  1.00 50.49  ? 397  LYS A CG    1 
ATOM   3758 C  CD    . LYS C 3 397 ? 69.663  -40.773 -4.028  1.00 48.72  ? 397  LYS A CD    1 
ATOM   3759 C  CE    . LYS C 3 397 ? 70.128  -41.187 -5.419  1.00 48.57  ? 397  LYS A CE    1 
ATOM   3760 N  NZ    . LYS C 3 397 ? 69.251  -40.673 -6.498  1.00 52.48  ? 397  LYS A NZ    1 
ATOM   3761 N  N     . GLU C 3 398 ? 65.760  -43.561 -2.823  1.00 50.71  ? 398  GLU A N     1 
ATOM   3762 C  CA    . GLU C 3 398 ? 65.660  -45.016 -2.954  1.00 50.75  ? 398  GLU A CA    1 
ATOM   3763 C  C     . GLU C 3 398 ? 66.912  -45.403 -3.728  1.00 48.56  ? 398  GLU A C     1 
ATOM   3764 O  O     . GLU C 3 398 ? 67.024  -45.153 -4.928  1.00 47.09  ? 398  GLU A O     1 
ATOM   3765 C  CB    . GLU C 3 398 ? 64.422  -45.440 -3.738  1.00 53.83  ? 398  GLU A CB    1 
ATOM   3766 C  CG    . GLU C 3 398 ? 64.254  -46.960 -3.843  1.00 61.82  ? 398  GLU A CG    1 
ATOM   3767 C  CD    . GLU C 3 398 ? 63.828  -47.619 -2.531  1.00 73.40  ? 398  GLU A CD    1 
ATOM   3768 O  OE1   . GLU C 3 398 ? 62.627  -47.540 -2.184  1.00 70.26  ? 398  GLU A OE1   1 
ATOM   3769 O  OE2   . GLU C 3 398 ? 64.695  -48.212 -1.845  1.00 77.73  ? 398  GLU A OE2   1 
ATOM   3770 N  N     . PRO C 3 399 ? 67.878  -46.020 -3.040  1.00 46.38  ? 399  PRO A N     1 
ATOM   3771 C  CA    . PRO C 3 399 ? 69.131  -46.427 -3.664  1.00 44.41  ? 399  PRO A CA    1 
ATOM   3772 C  C     . PRO C 3 399 ? 68.974  -47.632 -4.552  1.00 46.22  ? 399  PRO A C     1 
ATOM   3773 O  O     . PRO C 3 399 ? 68.068  -48.439 -4.365  1.00 50.49  ? 399  PRO A O     1 
ATOM   3774 C  CB    . PRO C 3 399 ? 70.008  -46.729 -2.463  1.00 41.80  ? 399  PRO A CB    1 
ATOM   3775 C  CG    . PRO C 3 399 ? 69.023  -47.405 -1.548  1.00 43.21  ? 399  PRO A CG    1 
ATOM   3776 C  CD    . PRO C 3 399 ? 67.813  -46.493 -1.643  1.00 43.45  ? 399  PRO A CD    1 
ATOM   3777 N  N     . ILE C 3 400 ? 69.846  -47.745 -5.540  1.00 46.53  ? 400  ILE A N     1 
ATOM   3778 C  CA    . ILE C 3 400 ? 69.819  -48.921 -6.392  1.00 46.45  ? 400  ILE A CA    1 
ATOM   3779 C  C     . ILE C 3 400 ? 70.670  -49.929 -5.601  1.00 44.42  ? 400  ILE A C     1 
ATOM   3780 O  O     . ILE C 3 400 ? 71.833  -49.652 -5.314  1.00 42.96  ? 400  ILE A O     1 
ATOM   3781 C  CB    . ILE C 3 400 ? 70.494  -48.661 -7.770  1.00 44.51  ? 400  ILE A CB    1 
ATOM   3782 C  CG1   . ILE C 3 400 ? 69.690  -47.644 -8.577  1.00 36.30  ? 400  ILE A CG1   1 
ATOM   3783 C  CG2   . ILE C 3 400 ? 70.608  -49.965 -8.534  1.00 34.73  ? 400  ILE A CG2   1 
ATOM   3784 C  CD1   . ILE C 3 400 ? 70.358  -47.288 -9.866  1.00 29.98  ? 400  ILE A CD1   1 
ATOM   3785 N  N     . PRO C 3 401 ? 70.093  -51.086 -5.208  1.00 43.34  ? 401  PRO A N     1 
ATOM   3786 C  CA    . PRO C 3 401 ? 70.856  -52.086 -4.449  1.00 41.24  ? 401  PRO A CA    1 
ATOM   3787 C  C     . PRO C 3 401 ? 72.080  -52.504 -5.231  1.00 40.30  ? 401  PRO A C     1 
ATOM   3788 O  O     . PRO C 3 401 ? 71.986  -52.855 -6.407  1.00 46.18  ? 401  PRO A O     1 
ATOM   3789 C  CB    . PRO C 3 401 ? 69.858  -53.226 -4.278  1.00 34.04  ? 401  PRO A CB    1 
ATOM   3790 C  CG    . PRO C 3 401 ? 68.556  -52.527 -4.235  1.00 36.74  ? 401  PRO A CG    1 
ATOM   3791 C  CD    . PRO C 3 401 ? 68.700  -51.531 -5.373  1.00 42.01  ? 401  PRO A CD    1 
ATOM   3792 N  N     . ASN C 3 402 ? 73.233  -52.469 -4.583  1.00 41.26  ? 402  ASN A N     1 
ATOM   3793 C  CA    . ASN C 3 402 ? 74.453  -52.829 -5.279  1.00 44.15  ? 402  ASN A CA    1 
ATOM   3794 C  C     . ASN C 3 402 ? 75.652  -52.694 -4.342  1.00 45.16  ? 402  ASN A C     1 
ATOM   3795 O  O     . ASN C 3 402 ? 75.500  -52.374 -3.164  1.00 47.31  ? 402  ASN A O     1 
ATOM   3796 C  CB    . ASN C 3 402 ? 74.601  -51.899 -6.497  1.00 41.62  ? 402  ASN A CB    1 
ATOM   3797 C  CG    . ASN C 3 402 ? 75.595  -52.403 -7.525  1.00 45.36  ? 402  ASN A CG    1 
ATOM   3798 O  OD1   . ASN C 3 402 ? 75.611  -51.916 -8.650  1.00 51.04  ? 402  ASN A OD1   1 
ATOM   3799 N  ND2   . ASN C 3 402 ? 76.433  -53.363 -7.149  1.00 45.35  ? 402  ASN A ND2   1 
ATOM   3800 N  N     . ARG C 3 403 ? 76.839  -52.964 -4.877  1.00 47.22  ? 403  ARG A N     1 
ATOM   3801 C  CA    . ARG C 3 403 ? 78.083  -52.852 -4.132  1.00 45.05  ? 403  ARG A CA    1 
ATOM   3802 C  C     . ARG C 3 403 ? 78.624  -51.480 -4.500  1.00 41.96  ? 403  ARG A C     1 
ATOM   3803 O  O     . ARG C 3 403 ? 78.376  -50.994 -5.611  1.00 42.57  ? 403  ARG A O     1 
ATOM   3804 C  CB    . ARG C 3 403 ? 79.066  -53.920 -4.590  1.00 38.49  ? 403  ARG A CB    1 
ATOM   3805 C  CG    . ARG C 3 403 ? 79.372  -53.805 -6.065  1.00 46.29  ? 403  ARG A CG    1 
ATOM   3806 C  CD    . ARG C 3 403 ? 79.661  -55.141 -6.685  1.00 50.83  ? 403  ARG A CD    1 
ATOM   3807 N  NE    . ARG C 3 403 ? 80.906  -55.715 -6.202  1.00 57.48  ? 403  ARG A NE    1 
ATOM   3808 C  CZ    . ARG C 3 403 ? 81.263  -56.977 -6.410  1.00 60.75  ? 403  ARG A CZ    1 
ATOM   3809 N  NH1   . ARG C 3 403 ? 80.457  -57.787 -7.082  1.00 58.59  ? 403  ARG A NH1   1 
ATOM   3810 N  NH2   . ARG C 3 403 ? 82.437  -57.419 -5.973  1.00 63.05  ? 403  ARG A NH2   1 
ATOM   3811 N  N     . TYR C 3 404 ? 79.345  -50.860 -3.573  1.00 38.82  ? 404  TYR A N     1 
ATOM   3812 C  CA    . TYR C 3 404 ? 79.939  -49.554 -3.809  1.00 42.09  ? 404  TYR A CA    1 
ATOM   3813 C  C     . TYR C 3 404 ? 81.332  -49.541 -3.202  1.00 43.87  ? 404  TYR A C     1 
ATOM   3814 O  O     . TYR C 3 404 ? 81.483  -49.582 -1.977  1.00 41.79  ? 404  TYR A O     1 
ATOM   3815 C  CB    . TYR C 3 404 ? 79.063  -48.460 -3.215  1.00 41.58  ? 404  TYR A CB    1 
ATOM   3816 C  CG    . TYR C 3 404 ? 77.726  -48.357 -3.916  1.00 41.41  ? 404  TYR A CG    1 
ATOM   3817 C  CD1   . TYR C 3 404 ? 77.607  -47.663 -5.122  1.00 42.01  ? 404  TYR A CD1   1 
ATOM   3818 C  CD2   . TYR C 3 404 ? 76.579  -48.973 -3.390  1.00 44.50  ? 404  TYR A CD2   1 
ATOM   3819 C  CE1   . TYR C 3 404 ? 76.377  -47.573 -5.797  1.00 40.89  ? 404  TYR A CE1   1 
ATOM   3820 C  CE2   . TYR C 3 404 ? 75.335  -48.895 -4.063  1.00 39.33  ? 404  TYR A CE2   1 
ATOM   3821 C  CZ    . TYR C 3 404 ? 75.246  -48.191 -5.267  1.00 40.45  ? 404  TYR A CZ    1 
ATOM   3822 O  OH    . TYR C 3 404 ? 74.048  -48.116 -5.949  1.00 36.41  ? 404  TYR A OH    1 
ATOM   3823 N  N     . LYS C 3 405 ? 82.336  -49.490 -4.086  1.00 46.05  ? 405  LYS A N     1 
ATOM   3824 C  CA    . LYS C 3 405 ? 83.762  -49.521 -3.739  1.00 45.92  ? 405  LYS A CA    1 
ATOM   3825 C  C     . LYS C 3 405 ? 84.282  -48.360 -2.900  1.00 46.72  ? 405  LYS A C     1 
ATOM   3826 O  O     . LYS C 3 405 ? 84.756  -48.542 -1.773  1.00 48.08  ? 405  LYS A O     1 
ATOM   3827 C  CB    . LYS C 3 405 ? 84.583  -49.614 -5.025  1.00 51.89  ? 405  LYS A CB    1 
ATOM   3828 C  CG    . LYS C 3 405 ? 85.935  -50.315 -4.882  1.00 57.52  ? 405  LYS A CG    1 
ATOM   3829 C  CD    . LYS C 3 405 ? 86.558  -50.529 -6.258  1.00 64.68  ? 405  LYS A CD    1 
ATOM   3830 C  CE    . LYS C 3 405 ? 87.592  -51.647 -6.259  1.00 67.11  ? 405  LYS A CE    1 
ATOM   3831 N  NZ    . LYS C 3 405 ? 88.098  -51.906 -7.640  1.00 69.20  ? 405  LYS A NZ    1 
ATOM   3832 N  N     . TYR C 3 406 ? 84.226  -47.166 -3.468  1.00 48.29  ? 406  TYR A N     1 
ATOM   3833 C  CA    . TYR C 3 406 ? 84.691  -45.989 -2.764  1.00 44.13  ? 406  TYR A CA    1 
ATOM   3834 C  C     . TYR C 3 406 ? 83.504  -45.103 -2.464  1.00 44.73  ? 406  TYR A C     1 
ATOM   3835 O  O     . TYR C 3 406 ? 82.713  -44.782 -3.351  1.00 41.19  ? 406  TYR A O     1 
ATOM   3836 C  CB    . TYR C 3 406 ? 85.728  -45.256 -3.607  1.00 45.30  ? 406  TYR A CB    1 
ATOM   3837 C  CG    . TYR C 3 406 ? 86.969  -46.094 -3.823  1.00 47.41  ? 406  TYR A CG    1 
ATOM   3838 C  CD1   . TYR C 3 406 ? 87.874  -46.312 -2.780  1.00 45.96  ? 406  TYR A CD1   1 
ATOM   3839 C  CD2   . TYR C 3 406 ? 87.206  -46.730 -5.043  1.00 46.18  ? 406  TYR A CD2   1 
ATOM   3840 C  CE1   . TYR C 3 406 ? 88.978  -47.150 -2.947  1.00 48.55  ? 406  TYR A CE1   1 
ATOM   3841 C  CE2   . TYR C 3 406 ? 88.308  -47.567 -5.221  1.00 44.48  ? 406  TYR A CE2   1 
ATOM   3842 C  CZ    . TYR C 3 406 ? 89.185  -47.777 -4.172  1.00 47.40  ? 406  TYR A CZ    1 
ATOM   3843 O  OH    . TYR C 3 406 ? 90.249  -48.631 -4.331  1.00 46.62  ? 406  TYR A OH    1 
ATOM   3844 N  N     . VAL C 3 407 ? 83.368  -44.735 -1.195  1.00 41.80  ? 407  VAL A N     1 
ATOM   3845 C  CA    . VAL C 3 407 ? 82.263  -43.900 -0.770  1.00 39.82  ? 407  VAL A CA    1 
ATOM   3846 C  C     . VAL C 3 407 ? 82.688  -42.938 0.319   1.00 42.14  ? 407  VAL A C     1 
ATOM   3847 O  O     . VAL C 3 407 ? 83.369  -43.327 1.268   1.00 40.67  ? 407  VAL A O     1 
ATOM   3848 C  CB    . VAL C 3 407 ? 81.102  -44.748 -0.197  1.00 38.74  ? 407  VAL A CB    1 
ATOM   3849 C  CG1   . VAL C 3 407 ? 79.977  -43.834 0.238   1.00 33.71  ? 407  VAL A CG1   1 
ATOM   3850 C  CG2   . VAL C 3 407 ? 80.600  -45.744 -1.228  1.00 36.96  ? 407  VAL A CG2   1 
ATOM   3851 N  N     . MET C 3 408 ? 82.306  -41.675 0.156   1.00 41.73  ? 408  MET A N     1 
ATOM   3852 C  CA    . MET C 3 408 ? 82.563  -40.653 1.163   1.00 42.53  ? 408  MET A CA    1 
ATOM   3853 C  C     . MET C 3 408 ? 81.262  -39.874 1.340   1.00 40.00  ? 408  MET A C     1 
ATOM   3854 O  O     . MET C 3 408 ? 80.568  -39.569 0.373   1.00 38.81  ? 408  MET A O     1 
ATOM   3855 C  CB    . MET C 3 408 ? 83.750  -39.748 0.786   1.00 47.87  ? 408  MET A CB    1 
ATOM   3856 C  CG    . MET C 3 408 ? 83.612  -38.852 -0.416  1.00 53.44  ? 408  MET A CG    1 
ATOM   3857 S  SD    . MET C 3 408 ? 85.213  -37.965 -0.714  1.00 59.54  ? 408  MET A SD    1 
ATOM   3858 C  CE    . MET C 3 408 ? 85.795  -37.627 1.009   1.00 41.77  ? 408  MET A CE    1 
ATOM   3859 N  N     . SER C 3 409 ? 80.906  -39.598 2.586   1.00 35.99  ? 409  SER A N     1 
ATOM   3860 C  CA    . SER C 3 409 ? 79.662  -38.914 2.861   1.00 33.90  ? 409  SER A CA    1 
ATOM   3861 C  C     . SER C 3 409 ? 79.813  -37.516 3.430   1.00 38.55  ? 409  SER A C     1 
ATOM   3862 O  O     . SER C 3 409 ? 80.824  -37.183 4.038   1.00 37.33  ? 409  SER A O     1 
ATOM   3863 C  CB    . SER C 3 409 ? 78.836  -39.766 3.811   1.00 37.07  ? 409  SER A CB    1 
ATOM   3864 O  OG    . SER C 3 409 ? 79.505  -39.956 5.050   1.00 40.90  ? 409  SER A OG    1 
ATOM   3865 N  N     . PHE C 3 410 ? 78.777  -36.706 3.230   1.00 43.99  ? 410  PHE A N     1 
ATOM   3866 C  CA    . PHE C 3 410 ? 78.738  -35.329 3.714   1.00 39.22  ? 410  PHE A CA    1 
ATOM   3867 C  C     . PHE C 3 410 ? 77.474  -35.119 4.538   1.00 39.33  ? 410  PHE A C     1 
ATOM   3868 O  O     . PHE C 3 410 ? 76.418  -35.609 4.171   1.00 38.57  ? 410  PHE A O     1 
ATOM   3869 C  CB    . PHE C 3 410 ? 78.736  -34.362 2.538   1.00 36.59  ? 410  PHE A CB    1 
ATOM   3870 C  CG    . PHE C 3 410 ? 79.905  -34.525 1.626   1.00 36.42  ? 410  PHE A CG    1 
ATOM   3871 C  CD1   . PHE C 3 410 ? 79.938  -35.564 0.703   1.00 29.89  ? 410  PHE A CD1   1 
ATOM   3872 C  CD2   . PHE C 3 410 ? 80.991  -33.651 1.704   1.00 28.44  ? 410  PHE A CD2   1 
ATOM   3873 C  CE1   . PHE C 3 410 ? 81.037  -35.732 -0.129  1.00 31.46  ? 410  PHE A CE1   1 
ATOM   3874 C  CE2   . PHE C 3 410 ? 82.089  -33.816 0.876   1.00 29.95  ? 410  PHE A CE2   1 
ATOM   3875 C  CZ    . PHE C 3 410 ? 82.111  -34.862 -0.045  1.00 26.01  ? 410  PHE A CZ    1 
ATOM   3876 N  N     . ASP C 3 411 ? 77.584  -34.385 5.645   1.00 41.89  ? 411  ASP A N     1 
ATOM   3877 C  CA    . ASP C 3 411 ? 76.444  -34.105 6.527   1.00 44.64  ? 411  ASP A CA    1 
ATOM   3878 C  C     . ASP C 3 411 ? 76.229  -32.616 6.709   1.00 42.47  ? 411  ASP A C     1 
ATOM   3879 O  O     . ASP C 3 411 ? 77.194  -31.872 6.784   1.00 42.20  ? 411  ASP A O     1 
ATOM   3880 C  CB    . ASP C 3 411 ? 76.693  -34.707 7.909   1.00 51.62  ? 411  ASP A CB    1 
ATOM   3881 C  CG    . ASP C 3 411 ? 76.474  -36.197 7.936   1.00 71.03  ? 411  ASP A CG    1 
ATOM   3882 O  OD1   . ASP C 3 411 ? 75.943  -36.725 6.936   1.00 79.53  ? 411  ASP A OD1   1 
ATOM   3883 O  OD2   . ASP C 3 411 ? 76.824  -36.840 8.953   1.00 77.97  ? 411  ASP A OD2   1 
ATOM   3884 N  N     . LEU C 3 412 ? 74.982  -32.154 6.762   1.00 38.86  ? 412  LEU A N     1 
ATOM   3885 C  CA    . LEU C 3 412 ? 74.826  -30.739 7.031   1.00 41.48  ? 412  LEU A CA    1 
ATOM   3886 C  C     . LEU C 3 412 ? 74.413  -30.540 8.476   1.00 37.85  ? 412  LEU A C     1 
ATOM   3887 O  O     . LEU C 3 412 ? 73.561  -31.245 8.989   1.00 38.13  ? 412  LEU A O     1 
ATOM   3888 C  CB    . LEU C 3 412 ? 73.900  -30.007 6.036   1.00 40.14  ? 412  LEU A CB    1 
ATOM   3889 C  CG    . LEU C 3 412 ? 72.479  -30.208 5.549   1.00 42.48  ? 412  LEU A CG    1 
ATOM   3890 C  CD1   . LEU C 3 412 ? 72.083  -28.872 4.955   1.00 46.22  ? 412  LEU A CD1   1 
ATOM   3891 C  CD2   . LEU C 3 412 ? 72.331  -31.311 4.502   1.00 42.54  ? 412  LEU A CD2   1 
ATOM   3892 N  N     . THR C 3 413 ? 75.082  -29.589 9.124   1.00 34.86  ? 413  THR A N     1 
ATOM   3893 C  CA    . THR C 3 413 ? 74.910  -29.262 10.534  1.00 34.72  ? 413  THR A CA    1 
ATOM   3894 C  C     . THR C 3 413 ? 73.529  -28.903 11.043  1.00 38.77  ? 413  THR A C     1 
ATOM   3895 O  O     . THR C 3 413 ? 72.877  -28.023 10.483  1.00 43.46  ? 413  THR A O     1 
ATOM   3896 C  CB    . THR C 3 413 ? 75.822  -28.116 10.901  1.00 36.51  ? 413  THR A CB    1 
ATOM   3897 O  OG1   . THR C 3 413 ? 77.055  -28.245 10.189  1.00 45.56  ? 413  THR A OG1   1 
ATOM   3898 C  CG2   . THR C 3 413 ? 76.101  -28.121 12.391  1.00 39.97  ? 413  THR A CG2   1 
ATOM   3899 N  N     . SER C 3 414 ? 73.108  -29.561 12.129  1.00 40.13  ? 414  SER A N     1 
ATOM   3900 C  CA    . SER C 3 414 ? 71.792  -29.330 12.769  1.00 40.89  ? 414  SER A CA    1 
ATOM   3901 C  C     . SER C 3 414 ? 70.744  -28.854 11.774  1.00 42.31  ? 414  SER A C     1 
ATOM   3902 O  O     . SER C 3 414 ? 70.076  -27.848 11.993  1.00 47.51  ? 414  SER A O     1 
ATOM   3903 C  CB    . SER C 3 414 ? 71.915  -28.271 13.868  1.00 41.25  ? 414  SER A CB    1 
ATOM   3904 O  OG    . SER C 3 414 ? 72.825  -28.658 14.882  1.00 47.50  ? 414  SER A OG    1 
ATOM   3905 N  N     . LEU C 3 415 ? 70.601  -29.593 10.687  1.00 42.78  ? 415  LEU A N     1 
ATOM   3906 C  CA    . LEU C 3 415 ? 69.689  -29.238 9.620   1.00 40.92  ? 415  LEU A CA    1 
ATOM   3907 C  C     . LEU C 3 415 ? 68.423  -28.464 9.996   1.00 42.12  ? 415  LEU A C     1 
ATOM   3908 O  O     . LEU C 3 415 ? 68.279  -27.305 9.608   1.00 40.85  ? 415  LEU A O     1 
ATOM   3909 C  CB    . LEU C 3 415 ? 69.325  -30.492 8.823   1.00 37.66  ? 415  LEU A CB    1 
ATOM   3910 C  CG    . LEU C 3 415 ? 68.465  -30.194 7.597   1.00 38.29  ? 415  LEU A CG    1 
ATOM   3911 C  CD1   . LEU C 3 415 ? 69.201  -29.203 6.710   1.00 34.15  ? 415  LEU A CD1   1 
ATOM   3912 C  CD2   . LEU C 3 415 ? 68.138  -31.477 6.868   1.00 39.95  ? 415  LEU A CD2   1 
ATOM   3913 N  N     . TYR C 3 416 ? 67.517  -29.082 10.757  1.00 39.32  ? 416  TYR A N     1 
ATOM   3914 C  CA    . TYR C 3 416 ? 66.251  -28.436 11.120  1.00 31.59  ? 416  TYR A CA    1 
ATOM   3915 C  C     . TYR C 3 416 ? 66.328  -27.177 11.968  1.00 31.65  ? 416  TYR A C     1 
ATOM   3916 O  O     . TYR C 3 416 ? 65.735  -26.167 11.620  1.00 31.76  ? 416  TYR A O     1 
ATOM   3917 C  CB    . TYR C 3 416 ? 65.303  -29.467 11.731  1.00 29.43  ? 416  TYR A CB    1 
ATOM   3918 C  CG    . TYR C 3 416 ? 64.689  -30.370 10.677  1.00 36.25  ? 416  TYR A CG    1 
ATOM   3919 C  CD1   . TYR C 3 416 ? 65.301  -30.527 9.435   1.00 38.50  ? 416  TYR A CD1   1 
ATOM   3920 C  CD2   . TYR C 3 416 ? 63.509  -31.067 10.916  1.00 38.68  ? 416  TYR A CD2   1 
ATOM   3921 C  CE1   . TYR C 3 416 ? 64.765  -31.343 8.464   1.00 36.94  ? 416  TYR A CE1   1 
ATOM   3922 C  CE2   . TYR C 3 416 ? 62.961  -31.893 9.943   1.00 44.70  ? 416  TYR A CE2   1 
ATOM   3923 C  CZ    . TYR C 3 416 ? 63.600  -32.025 8.715   1.00 44.72  ? 416  TYR A CZ    1 
ATOM   3924 O  OH    . TYR C 3 416 ? 63.079  -32.842 7.732   1.00 52.58  ? 416  TYR A OH    1 
ATOM   3925 N  N     . PRO C 3 417 ? 67.031  -27.212 13.102  1.00 34.70  ? 417  PRO A N     1 
ATOM   3926 C  CA    . PRO C 3 417 ? 67.074  -25.952 13.855  1.00 34.06  ? 417  PRO A CA    1 
ATOM   3927 C  C     . PRO C 3 417 ? 67.696  -24.881 12.956  1.00 35.19  ? 417  PRO A C     1 
ATOM   3928 O  O     . PRO C 3 417 ? 67.385  -23.701 13.059  1.00 37.90  ? 417  PRO A O     1 
ATOM   3929 C  CB    . PRO C 3 417 ? 67.961  -26.300 15.040  1.00 33.02  ? 417  PRO A CB    1 
ATOM   3930 C  CG    . PRO C 3 417 ? 67.611  -27.767 15.286  1.00 36.54  ? 417  PRO A CG    1 
ATOM   3931 C  CD    . PRO C 3 417 ? 67.600  -28.329 13.882  1.00 34.16  ? 417  PRO A CD    1 
ATOM   3932 N  N     . SER C 3 418 ? 68.580  -25.320 12.065  1.00 34.02  ? 418  SER A N     1 
ATOM   3933 C  CA    . SER C 3 418 ? 69.242  -24.424 11.131  1.00 36.44  ? 418  SER A CA    1 
ATOM   3934 C  C     . SER C 3 418 ? 68.306  -23.848 10.066  1.00 36.24  ? 418  SER A C     1 
ATOM   3935 O  O     . SER C 3 418 ? 68.481  -22.716 9.637   1.00 32.70  ? 418  SER A O     1 
ATOM   3936 C  CB    . SER C 3 418 ? 70.410  -25.136 10.478  1.00 39.16  ? 418  SER A CB    1 
ATOM   3937 O  OG    . SER C 3 418 ? 71.420  -25.344 11.444  1.00 48.14  ? 418  SER A OG    1 
ATOM   3938 N  N     . ILE C 3 419 ? 67.332  -24.623 9.615   1.00 34.34  ? 419  ILE A N     1 
ATOM   3939 C  CA    . ILE C 3 419 ? 66.380  -24.092 8.655   1.00 37.45  ? 419  ILE A CA    1 
ATOM   3940 C  C     . ILE C 3 419 ? 65.559  -23.003 9.363   1.00 39.13  ? 419  ILE A C     1 
ATOM   3941 O  O     . ILE C 3 419 ? 65.441  -21.889 8.871   1.00 45.32  ? 419  ILE A O     1 
ATOM   3942 C  CB    . ILE C 3 419 ? 65.448  -25.188 8.158   1.00 36.66  ? 419  ILE A CB    1 
ATOM   3943 C  CG1   . ILE C 3 419 ? 66.277  -26.245 7.440   1.00 33.17  ? 419  ILE A CG1   1 
ATOM   3944 C  CG2   . ILE C 3 419 ? 64.350  -24.593 7.278   1.00 32.38  ? 419  ILE A CG2   1 
ATOM   3945 C  CD1   . ILE C 3 419 ? 65.473  -27.382 6.947   1.00 32.41  ? 419  ILE A CD1   1 
ATOM   3946 N  N     . ILE C 3 420 ? 65.012  -23.333 10.531  1.00 37.79  ? 420  ILE A N     1 
ATOM   3947 C  CA    . ILE C 3 420 ? 64.221  -22.405 11.341  1.00 37.93  ? 420  ILE A CA    1 
ATOM   3948 C  C     . ILE C 3 420 ? 64.935  -21.058 11.478  1.00 38.93  ? 420  ILE A C     1 
ATOM   3949 O  O     . ILE C 3 420 ? 64.295  -20.012 11.548  1.00 41.92  ? 420  ILE A O     1 
ATOM   3950 C  CB    . ILE C 3 420 ? 63.975  -22.992 12.761  1.00 38.24  ? 420  ILE A CB    1 
ATOM   3951 C  CG1   . ILE C 3 420 ? 63.117  -24.263 12.663  1.00 39.17  ? 420  ILE A CG1   1 
ATOM   3952 C  CG2   . ILE C 3 420 ? 63.310  -21.969 13.652  1.00 35.87  ? 420  ILE A CG2   1 
ATOM   3953 C  CD1   . ILE C 3 420 ? 62.884  -24.964 14.007  1.00 32.71  ? 420  ILE A CD1   1 
ATOM   3954 N  N     . ARG C 3 421 ? 66.260  -21.080 11.511  1.00 38.72  ? 421  ARG A N     1 
ATOM   3955 C  CA    . ARG C 3 421 ? 67.035  -19.840 11.634  1.00 40.00  ? 421  ARG A CA    1 
ATOM   3956 C  C     . ARG C 3 421 ? 67.308  -19.160 10.291  1.00 42.51  ? 421  ARG A C     1 
ATOM   3957 O  O     . ARG C 3 421 ? 67.472  -17.935 10.233  1.00 46.24  ? 421  ARG A O     1 
ATOM   3958 C  CB    . ARG C 3 421 ? 68.383  -20.107 12.306  1.00 33.87  ? 421  ARG A CB    1 
ATOM   3959 C  CG    . ARG C 3 421 ? 68.310  -20.568 13.745  1.00 43.05  ? 421  ARG A CG    1 
ATOM   3960 C  CD    . ARG C 3 421 ? 69.691  -20.959 14.252  1.00 45.88  ? 421  ARG A CD    1 
ATOM   3961 N  NE    . ARG C 3 421 ? 70.563  -19.802 14.445  1.00 45.61  ? 421  ARG A NE    1 
ATOM   3962 C  CZ    . ARG C 3 421 ? 71.892  -19.834 14.349  1.00 44.82  ? 421  ARG A CZ    1 
ATOM   3963 N  NH1   . ARG C 3 421 ? 72.519  -20.963 14.048  1.00 34.69  ? 421  ARG A NH1   1 
ATOM   3964 N  NH2   . ARG C 3 421 ? 72.598  -18.739 14.596  1.00 42.53  ? 421  ARG A NH2   1 
ATOM   3965 N  N     . GLN C 3 422 ? 67.363  -19.945 9.216   1.00 37.03  ? 422  GLN A N     1 
ATOM   3966 C  CA    . GLN C 3 422 ? 67.668  -19.382 7.910   1.00 37.89  ? 422  GLN A CA    1 
ATOM   3967 C  C     . GLN C 3 422 ? 66.461  -18.719 7.290   1.00 41.16  ? 422  GLN A C     1 
ATOM   3968 O  O     . GLN C 3 422 ? 66.536  -17.592 6.800   1.00 39.79  ? 422  GLN A O     1 
ATOM   3969 C  CB    . GLN C 3 422 ? 68.196  -20.460 6.953   1.00 40.00  ? 422  GLN A CB    1 
ATOM   3970 C  CG    . GLN C 3 422 ? 68.969  -19.840 5.802   1.00 41.84  ? 422  GLN A CG    1 
ATOM   3971 C  CD    . GLN C 3 422 ? 69.347  -20.788 4.699   1.00 41.45  ? 422  GLN A CD    1 
ATOM   3972 O  OE1   . GLN C 3 422 ? 68.565  -21.036 3.786   1.00 45.75  ? 422  GLN A OE1   1 
ATOM   3973 N  NE2   . GLN C 3 422 ? 70.561  -21.312 4.766   1.00 42.15  ? 422  GLN A NE2   1 
ATOM   3974 N  N     . VAL C 3 423 ? 65.345  -19.431 7.313   1.00 39.60  ? 423  VAL A N     1 
ATOM   3975 C  CA    . VAL C 3 423 ? 64.130  -18.913 6.742   1.00 39.40  ? 423  VAL A CA    1 
ATOM   3976 C  C     . VAL C 3 423 ? 63.472  -17.931 7.694   1.00 40.16  ? 423  VAL A C     1 
ATOM   3977 O  O     . VAL C 3 423 ? 62.758  -17.030 7.259   1.00 38.63  ? 423  VAL A O     1 
ATOM   3978 C  CB    . VAL C 3 423 ? 63.151  -20.044 6.423   1.00 40.93  ? 423  VAL A CB    1 
ATOM   3979 C  CG1   . VAL C 3 423 ? 61.960  -19.478 5.720   1.00 34.53  ? 423  VAL A CG1   1 
ATOM   3980 C  CG2   . VAL C 3 423 ? 63.816  -21.092 5.547   1.00 37.95  ? 423  VAL A CG2   1 
ATOM   3981 N  N     . ASN C 3 424 ? 63.731  -18.098 8.990   1.00 38.51  ? 424  ASN A N     1 
ATOM   3982 C  CA    . ASN C 3 424 ? 63.159  -17.236 10.032  1.00 39.47  ? 424  ASN A CA    1 
ATOM   3983 C  C     . ASN C 3 424 ? 61.704  -17.647 10.296  1.00 34.75  ? 424  ASN A C     1 
ATOM   3984 O  O     . ASN C 3 424 ? 60.816  -16.817 10.379  1.00 40.58  ? 424  ASN A O     1 
ATOM   3985 C  CB    . ASN C 3 424 ? 63.230  -15.758 9.608   1.00 37.33  ? 424  ASN A CB    1 
ATOM   3986 C  CG    . ASN C 3 424 ? 62.994  -14.799 10.769  1.00 39.59  ? 424  ASN A CG    1 
ATOM   3987 O  OD1   . ASN C 3 424 ? 62.646  -13.639 10.566  1.00 32.14  ? 424  ASN A OD1   1 
ATOM   3988 N  ND2   . ASN C 3 424 ? 63.198  -15.282 11.991  1.00 38.39  ? 424  ASN A ND2   1 
ATOM   3989 N  N     . ILE C 3 425 ? 61.482  -18.944 10.444  1.00 35.69  ? 425  ILE A N     1 
ATOM   3990 C  CA    . ILE C 3 425 ? 60.154  -19.490 10.674  1.00 37.07  ? 425  ILE A CA    1 
ATOM   3991 C  C     . ILE C 3 425 ? 59.727  -19.438 12.139  1.00 42.29  ? 425  ILE A C     1 
ATOM   3992 O  O     . ILE C 3 425 ? 60.373  -20.007 13.012  1.00 47.30  ? 425  ILE A O     1 
ATOM   3993 C  CB    . ILE C 3 425 ? 60.096  -20.946 10.167  1.00 34.68  ? 425  ILE A CB    1 
ATOM   3994 C  CG1   . ILE C 3 425 ? 60.396  -20.960 8.666   1.00 34.20  ? 425  ILE A CG1   1 
ATOM   3995 C  CG2   . ILE C 3 425 ? 58.742  -21.561 10.470  1.00 30.95  ? 425  ILE A CG2   1 
ATOM   3996 C  CD1   . ILE C 3 425 ? 60.801  -22.306 8.131   1.00 38.56  ? 425  ILE A CD1   1 
ATOM   3997 N  N     . SER C 3 426 ? 58.634  -18.739 12.405  1.00 44.05  ? 426  SER A N     1 
ATOM   3998 C  CA    . SER C 3 426 ? 58.107  -18.619 13.759  1.00 44.01  ? 426  SER A CA    1 
ATOM   3999 C  C     . SER C 3 426 ? 56.619  -18.322 13.595  1.00 44.80  ? 426  SER A C     1 
ATOM   4000 O  O     . SER C 3 426 ? 56.160  -17.981 12.499  1.00 46.65  ? 426  SER A O     1 
ATOM   4001 C  CB    . SER C 3 426 ? 58.833  -17.473 14.491  1.00 49.25  ? 426  SER A CB    1 
ATOM   4002 O  OG    . SER C 3 426 ? 58.433  -17.336 15.851  1.00 49.63  ? 426  SER A OG    1 
ATOM   4003 N  N     . PRO C 3 427 ? 55.833  -18.470 14.659  1.00 41.11  ? 427  PRO A N     1 
ATOM   4004 C  CA    . PRO C 3 427 ? 54.424  -18.165 14.417  1.00 41.34  ? 427  PRO A CA    1 
ATOM   4005 C  C     . PRO C 3 427 ? 54.109  -16.695 14.106  1.00 46.33  ? 427  PRO A C     1 
ATOM   4006 O  O     . PRO C 3 427 ? 53.208  -16.409 13.315  1.00 49.86  ? 427  PRO A O     1 
ATOM   4007 C  CB    . PRO C 3 427 ? 53.732  -18.689 15.674  1.00 33.79  ? 427  PRO A CB    1 
ATOM   4008 C  CG    . PRO C 3 427 ? 54.809  -18.683 16.707  1.00 43.05  ? 427  PRO A CG    1 
ATOM   4009 C  CD    . PRO C 3 427 ? 56.030  -19.120 15.961  1.00 40.51  ? 427  PRO A CD    1 
ATOM   4010 N  N     . GLU C 3 428 ? 54.861  -15.760 14.683  1.00 49.18  ? 428  GLU A N     1 
ATOM   4011 C  CA    . GLU C 3 428 ? 54.584  -14.348 14.437  1.00 46.94  ? 428  GLU A CA    1 
ATOM   4012 C  C     . GLU C 3 428 ? 55.450  -13.694 13.370  1.00 45.32  ? 428  GLU A C     1 
ATOM   4013 O  O     . GLU C 3 428 ? 55.657  -12.480 13.381  1.00 45.99  ? 428  GLU A O     1 
ATOM   4014 C  CB    . GLU C 3 428 ? 54.668  -13.552 15.747  1.00 51.83  ? 428  GLU A CB    1 
ATOM   4015 C  CG    . GLU C 3 428 ? 56.058  -13.127 16.166  1.00 57.73  ? 428  GLU A CG    1 
ATOM   4016 C  CD    . GLU C 3 428 ? 57.020  -14.284 16.255  1.00 60.52  ? 428  GLU A CD    1 
ATOM   4017 O  OE1   . GLU C 3 428 ? 56.608  -15.357 16.746  1.00 62.54  ? 428  GLU A OE1   1 
ATOM   4018 O  OE2   . GLU C 3 428 ? 58.189  -14.113 15.846  1.00 64.40  ? 428  GLU A OE2   1 
ATOM   4019 N  N     . THR C 3 429 ? 55.961  -14.498 12.445  1.00 43.89  ? 429  THR A N     1 
ATOM   4020 C  CA    . THR C 3 429 ? 56.779  -13.972 11.353  1.00 40.83  ? 429  THR A CA    1 
ATOM   4021 C  C     . THR C 3 429 ? 56.126  -14.314 10.016  1.00 42.26  ? 429  THR A C     1 
ATOM   4022 O  O     . THR C 3 429 ? 56.672  -13.986 8.964   1.00 43.77  ? 429  THR A O     1 
ATOM   4023 C  CB    . THR C 3 429 ? 58.211  -14.546 11.368  1.00 38.71  ? 429  THR A CB    1 
ATOM   4024 O  OG1   . THR C 3 429 ? 58.161  -15.951 11.655  1.00 44.43  ? 429  THR A OG1   1 
ATOM   4025 C  CG2   . THR C 3 429 ? 59.058  -13.846 12.404  1.00 31.17  ? 429  THR A CG2   1 
ATOM   4026 N  N     . ILE C 3 430 ? 54.972  -14.988 10.062  1.00 41.44  ? 430  ILE A N     1 
ATOM   4027 C  CA    . ILE C 3 430 ? 54.235  -15.325 8.847   1.00 42.69  ? 430  ILE A CA    1 
ATOM   4028 C  C     . ILE C 3 430 ? 53.906  -13.994 8.171   1.00 50.13  ? 430  ILE A C     1 
ATOM   4029 O  O     . ILE C 3 430 ? 53.505  -13.039 8.837   1.00 50.78  ? 430  ILE A O     1 
ATOM   4030 C  CB    . ILE C 3 430 ? 52.887  -15.996 9.138   1.00 40.75  ? 430  ILE A CB    1 
ATOM   4031 C  CG1   . ILE C 3 430 ? 53.077  -17.301 9.915   1.00 42.90  ? 430  ILE A CG1   1 
ATOM   4032 C  CG2   . ILE C 3 430 ? 52.157  -16.220 7.836   1.00 32.19  ? 430  ILE A CG2   1 
ATOM   4033 C  CD1   . ILE C 3 430 ? 53.710  -18.406 9.111   1.00 56.45  ? 430  ILE A CD1   1 
ATOM   4034 N  N     . ALA C 3 431 ? 54.054  -13.923 6.852   1.00 51.03  ? 431  ALA A N     1 
ATOM   4035 C  CA    . ALA C 3 431 ? 53.789  -12.674 6.163   1.00 49.64  ? 431  ALA A CA    1 
ATOM   4036 C  C     . ALA C 3 431 ? 52.956  -12.843 4.911   1.00 51.48  ? 431  ALA A C     1 
ATOM   4037 O  O     . ALA C 3 431 ? 52.504  -11.863 4.324   1.00 56.13  ? 431  ALA A O     1 
ATOM   4038 C  CB    . ALA C 3 431 ? 55.100  -12.001 5.822   1.00 51.81  ? 431  ALA A CB    1 
ATOM   4039 N  N     . GLY C 3 432 ? 52.761  -14.081 4.485   1.00 52.43  ? 432  GLY A N     1 
ATOM   4040 C  CA    . GLY C 3 432 ? 51.979  -14.283 3.288   1.00 51.87  ? 432  GLY A CA    1 
ATOM   4041 C  C     . GLY C 3 432 ? 52.048  -15.660 2.679   1.00 52.47  ? 432  GLY A C     1 
ATOM   4042 O  O     . GLY C 3 432 ? 52.432  -16.641 3.317   1.00 52.98  ? 432  GLY A O     1 
ATOM   4043 N  N     . THR C 3 433 ? 51.679  -15.712 1.407   1.00 53.64  ? 433  THR A N     1 
ATOM   4044 C  CA    . THR C 3 433 ? 51.639  -16.953 0.647   1.00 51.22  ? 433  THR A CA    1 
ATOM   4045 C  C     . THR C 3 433 ? 52.014  -16.631 -0.783  1.00 49.39  ? 433  THR A C     1 
ATOM   4046 O  O     . THR C 3 433 ? 51.920  -15.481 -1.200  1.00 53.74  ? 433  THR A O     1 
ATOM   4047 C  CB    . THR C 3 433 ? 50.194  -17.537 0.664   1.00 53.38  ? 433  THR A CB    1 
ATOM   4048 O  OG1   . THR C 3 433 ? 49.902  -18.050 1.973   1.00 53.33  ? 433  THR A OG1   1 
ATOM   4049 C  CG2   . THR C 3 433 ? 50.026  -18.651 -0.378  1.00 63.58  ? 433  THR A CG2   1 
ATOM   4050 N  N     . PHE C 3 434 ? 52.462  -17.636 -1.525  1.00 48.17  ? 434  PHE A N     1 
ATOM   4051 C  CA    . PHE C 3 434 ? 52.777  -17.439 -2.933  1.00 51.95  ? 434  PHE A CA    1 
ATOM   4052 C  C     . PHE C 3 434 ? 52.314  -18.660 -3.715  1.00 53.56  ? 434  PHE A C     1 
ATOM   4053 O  O     . PHE C 3 434 ? 52.219  -19.749 -3.153  1.00 53.35  ? 434  PHE A O     1 
ATOM   4054 C  CB    . PHE C 3 434 ? 54.275  -17.148 -3.139  1.00 55.39  ? 434  PHE A CB    1 
ATOM   4055 C  CG    . PHE C 3 434 ? 55.188  -18.281 -2.777  1.00 60.34  ? 434  PHE A CG    1 
ATOM   4056 C  CD1   . PHE C 3 434 ? 55.554  -19.223 -3.728  1.00 61.69  ? 434  PHE A CD1   1 
ATOM   4057 C  CD2   . PHE C 3 434 ? 55.724  -18.382 -1.494  1.00 60.19  ? 434  PHE A CD2   1 
ATOM   4058 C  CE1   . PHE C 3 434 ? 56.449  -20.252 -3.410  1.00 60.04  ? 434  PHE A CE1   1 
ATOM   4059 C  CE2   . PHE C 3 434 ? 56.615  -19.405 -1.170  1.00 57.49  ? 434  PHE A CE2   1 
ATOM   4060 C  CZ    . PHE C 3 434 ? 56.976  -20.339 -2.130  1.00 54.91  ? 434  PHE A CZ    1 
ATOM   4061 N  N     . LYS C 3 435 ? 51.964  -18.464 -4.989  1.00 57.69  ? 435  LYS A N     1 
ATOM   4062 C  CA    . LYS C 3 435 ? 51.504  -19.565 -5.842  1.00 59.86  ? 435  LYS A CA    1 
ATOM   4063 C  C     . LYS C 3 435 ? 52.671  -20.521 -6.026  1.00 58.01  ? 435  LYS A C     1 
ATOM   4064 O  O     . LYS C 3 435 ? 53.698  -20.183 -6.626  1.00 49.59  ? 435  LYS A O     1 
ATOM   4065 C  CB    . LYS C 3 435 ? 50.995  -19.024 -7.185  1.00 69.93  ? 435  LYS A CB    1 
ATOM   4066 C  CG    . LYS C 3 435 ? 49.760  -18.136 -7.024  1.00 78.97  ? 435  LYS A CG    1 
ATOM   4067 C  CD    . LYS C 3 435 ? 49.197  -17.658 -8.354  1.00 82.82  ? 435  LYS A CD    1 
ATOM   4068 C  CE    . LYS C 3 435 ? 47.983  -16.765 -8.135  1.00 84.04  ? 435  LYS A CE    1 
ATOM   4069 N  NZ    . LYS C 3 435 ? 48.280  -15.624 -7.219  1.00 79.11  ? 435  LYS A NZ    1 
ATOM   4070 N  N     . VAL C 3 436 ? 52.503  -21.725 -5.498  1.00 56.71  ? 436  VAL A N     1 
ATOM   4071 C  CA    . VAL C 3 436 ? 53.566  -22.710 -5.525  1.00 56.81  ? 436  VAL A CA    1 
ATOM   4072 C  C     . VAL C 3 436 ? 53.601  -23.727 -6.661  1.00 60.87  ? 436  VAL A C     1 
ATOM   4073 O  O     . VAL C 3 436 ? 52.602  -24.366 -6.999  1.00 59.06  ? 436  VAL A O     1 
ATOM   4074 C  CB    . VAL C 3 436 ? 53.607  -23.454 -4.175  1.00 53.32  ? 436  VAL A CB    1 
ATOM   4075 C  CG1   . VAL C 3 436 ? 52.213  -23.915 -3.807  1.00 52.76  ? 436  VAL A CG1   1 
ATOM   4076 C  CG2   . VAL C 3 436 ? 54.575  -24.629 -4.243  1.00 59.69  ? 436  VAL A CG2   1 
ATOM   4077 N  N     . ALA C 3 437 ? 54.793  -23.860 -7.237  1.00 62.13  ? 437  ALA A N     1 
ATOM   4078 C  CA    . ALA C 3 437 ? 55.061  -24.795 -8.322  1.00 59.79  ? 437  ALA A CA    1 
ATOM   4079 C  C     . ALA C 3 437 ? 55.411  -26.178 -7.749  1.00 57.64  ? 437  ALA A C     1 
ATOM   4080 O  O     . ALA C 3 437 ? 55.552  -26.348 -6.535  1.00 55.91  ? 437  ALA A O     1 
ATOM   4081 C  CB    . ALA C 3 437 ? 56.224  -24.277 -9.168  1.00 52.08  ? 437  ALA A CB    1 
ATOM   4082 N  N     . PRO C 3 438 ? 55.532  -27.190 -8.620  1.00 54.67  ? 438  PRO A N     1 
ATOM   4083 C  CA    . PRO C 3 438 ? 55.875  -28.534 -8.146  1.00 56.60  ? 438  PRO A CA    1 
ATOM   4084 C  C     . PRO C 3 438 ? 57.224  -28.440 -7.421  1.00 55.39  ? 438  PRO A C     1 
ATOM   4085 O  O     . PRO C 3 438 ? 57.984  -27.503 -7.666  1.00 55.19  ? 438  PRO A O     1 
ATOM   4086 C  CB    . PRO C 3 438 ? 55.947  -29.333 -9.444  1.00 59.44  ? 438  PRO A CB    1 
ATOM   4087 C  CG    . PRO C 3 438 ? 54.897  -28.664 -10.292 1.00 52.89  ? 438  PRO A CG    1 
ATOM   4088 C  CD    . PRO C 3 438 ? 55.207  -27.210 -10.055 1.00 50.32  ? 438  PRO A CD    1 
ATOM   4089 N  N     . LEU C 3 439 ? 57.529  -29.389 -6.536  1.00 50.41  ? 439  LEU A N     1 
ATOM   4090 C  CA    . LEU C 3 439 ? 58.784  -29.304 -5.796  1.00 45.42  ? 439  LEU A CA    1 
ATOM   4091 C  C     . LEU C 3 439 ? 59.975  -29.534 -6.697  1.00 41.28  ? 439  LEU A C     1 
ATOM   4092 O  O     . LEU C 3 439 ? 61.035  -28.953 -6.494  1.00 37.56  ? 439  LEU A O     1 
ATOM   4093 C  CB    . LEU C 3 439 ? 58.810  -30.291 -4.621  1.00 42.25  ? 439  LEU A CB    1 
ATOM   4094 C  CG    . LEU C 3 439 ? 60.056  -30.100 -3.742  1.00 37.55  ? 439  LEU A CG    1 
ATOM   4095 C  CD1   . LEU C 3 439 ? 60.017  -28.742 -3.067  1.00 31.40  ? 439  LEU A CD1   1 
ATOM   4096 C  CD2   . LEU C 3 439 ? 60.138  -31.199 -2.716  1.00 33.91  ? 439  LEU A CD2   1 
ATOM   4097 N  N     . HIS C 3 440 ? 59.786  -30.376 -7.703  1.00 44.71  ? 440  HIS A N     1 
ATOM   4098 C  CA    . HIS C 3 440 ? 60.838  -30.679 -8.661  1.00 50.13  ? 440  HIS A CA    1 
ATOM   4099 C  C     . HIS C 3 440 ? 61.292  -29.396 -9.361  1.00 51.91  ? 440  HIS A C     1 
ATOM   4100 O  O     . HIS C 3 440 ? 62.478  -29.201 -9.640  1.00 50.19  ? 440  HIS A O     1 
ATOM   4101 C  CB    . HIS C 3 440 ? 60.326  -31.690 -9.697  1.00 59.93  ? 440  HIS A CB    1 
ATOM   4102 C  CG    . HIS C 3 440 ? 60.549  -31.263 -11.116 1.00 75.71  ? 440  HIS A CG    1 
ATOM   4103 N  ND1   . HIS C 3 440 ? 59.590  -30.601 -11.852 1.00 81.24  ? 440  HIS A ND1   1 
ATOM   4104 C  CD2   . HIS C 3 440 ? 61.650  -31.323 -11.902 1.00 79.64  ? 440  HIS A CD2   1 
ATOM   4105 C  CE1   . HIS C 3 440 ? 60.093  -30.267 -13.028 1.00 84.30  ? 440  HIS A CE1   1 
ATOM   4106 N  NE2   . HIS C 3 440 ? 61.343  -30.692 -13.083 1.00 82.95  ? 440  HIS A NE2   1 
ATOM   4107 N  N     . ASP C 3 441 ? 60.330  -28.528 -9.646  1.00 54.55  ? 441  ASP A N     1 
ATOM   4108 C  CA    . ASP C 3 441 ? 60.610  -27.273 -10.317 1.00 55.53  ? 441  ASP A CA    1 
ATOM   4109 C  C     . ASP C 3 441 ? 61.525  -26.392 -9.492  1.00 55.33  ? 441  ASP A C     1 
ATOM   4110 O  O     . ASP C 3 441 ? 62.243  -25.558 -10.041 1.00 55.10  ? 441  ASP A O     1 
ATOM   4111 C  CB    . ASP C 3 441 ? 59.310  -26.536 -10.601 1.00 63.36  ? 441  ASP A CB    1 
ATOM   4112 C  CG    . ASP C 3 441 ? 58.850  -26.693 -12.036 1.00 69.53  ? 441  ASP A CG    1 
ATOM   4113 O  OD1   . ASP C 3 441 ? 58.735  -27.841 -12.508 1.00 70.32  ? 441  ASP A OD1   1 
ATOM   4114 O  OD2   . ASP C 3 441 ? 58.600  -25.660 -12.689 1.00 75.99  ? 441  ASP A OD2   1 
ATOM   4115 N  N     . TYR C 3 442 ? 61.501  -26.565 -8.173  1.00 53.68  ? 442  TYR A N     1 
ATOM   4116 C  CA    . TYR C 3 442 ? 62.365  -25.767 -7.309  1.00 54.46  ? 442  TYR A CA    1 
ATOM   4117 C  C     . TYR C 3 442 ? 63.777  -26.342 -7.182  1.00 56.12  ? 442  TYR A C     1 
ATOM   4118 O  O     . TYR C 3 442 ? 64.749  -25.583 -7.259  1.00 55.74  ? 442  TYR A O     1 
ATOM   4119 C  CB    . TYR C 3 442 ? 61.730  -25.581 -5.923  1.00 48.36  ? 442  TYR A CB    1 
ATOM   4120 C  CG    . TYR C 3 442 ? 60.523  -24.663 -5.934  1.00 42.05  ? 442  TYR A CG    1 
ATOM   4121 C  CD1   . TYR C 3 442 ? 60.654  -23.305 -6.219  1.00 41.63  ? 442  TYR A CD1   1 
ATOM   4122 C  CD2   . TYR C 3 442 ? 59.244  -25.168 -5.722  1.00 40.69  ? 442  TYR A CD2   1 
ATOM   4123 C  CE1   . TYR C 3 442 ? 59.541  -22.480 -6.302  1.00 36.07  ? 442  TYR A CE1   1 
ATOM   4124 C  CE2   . TYR C 3 442 ? 58.128  -24.356 -5.802  1.00 36.86  ? 442  TYR A CE2   1 
ATOM   4125 C  CZ    . TYR C 3 442 ? 58.280  -23.013 -6.097  1.00 39.92  ? 442  TYR A CZ    1 
ATOM   4126 O  OH    . TYR C 3 442 ? 57.161  -22.219 -6.219  1.00 46.96  ? 442  TYR A OH    1 
ATOM   4127 N  N     . ILE C 3 443 ? 63.913  -27.657 -7.009  1.00 47.19  ? 443  ILE A N     1 
ATOM   4128 C  CA    . ILE C 3 443 ? 65.254  -28.222 -6.881  1.00 50.28  ? 443  ILE A CA    1 
ATOM   4129 C  C     . ILE C 3 443 ? 66.092  -27.961 -8.139  1.00 52.48  ? 443  ILE A C     1 
ATOM   4130 O  O     . ILE C 3 443 ? 67.323  -27.886 -8.073  1.00 49.25  ? 443  ILE A O     1 
ATOM   4131 C  CB    . ILE C 3 443 ? 65.226  -29.765 -6.605  1.00 54.08  ? 443  ILE A CB    1 
ATOM   4132 C  CG1   . ILE C 3 443 ? 64.689  -30.508 -7.817  1.00 58.38  ? 443  ILE A CG1   1 
ATOM   4133 C  CG2   . ILE C 3 443 ? 64.363  -30.087 -5.394  1.00 51.50  ? 443  ILE A CG2   1 
ATOM   4134 C  CD1   . ILE C 3 443 ? 64.631  -32.018 -7.634  1.00 71.29  ? 443  ILE A CD1   1 
ATOM   4135 N  N     . ASN C 3 444 ? 65.415  -27.818 -9.280  1.00 56.60  ? 444  ASN A N     1 
ATOM   4136 C  CA    . ASN C 3 444 ? 66.082  -27.576 -10.566 1.00 61.79  ? 444  ASN A CA    1 
ATOM   4137 C  C     . ASN C 3 444 ? 66.185  -26.106 -10.968 1.00 61.52  ? 444  ASN A C     1 
ATOM   4138 O  O     . ASN C 3 444 ? 66.663  -25.810 -12.057 1.00 60.30  ? 444  ASN A O     1 
ATOM   4139 C  CB    . ASN C 3 444 ? 65.370  -28.319 -11.704 1.00 62.58  ? 444  ASN A CB    1 
ATOM   4140 C  CG    . ASN C 3 444 ? 65.458  -29.827 -11.568 1.00 68.72  ? 444  ASN A CG    1 
ATOM   4141 O  OD1   . ASN C 3 444 ? 66.517  -30.380 -11.252 1.00 67.28  ? 444  ASN A OD1   1 
ATOM   4142 N  ND2   . ASN C 3 444 ? 64.346  -30.504 -11.827 1.00 71.34  ? 444  ASN A ND2   1 
ATOM   4143 N  N     . ALA C 3 445 ? 65.732  -25.199 -10.107 1.00 63.33  ? 445  ALA A N     1 
ATOM   4144 C  CA    . ALA C 3 445 ? 65.779  -23.764 -10.397 1.00 67.15  ? 445  ALA A CA    1 
ATOM   4145 C  C     . ALA C 3 445 ? 65.075  -23.415 -11.717 1.00 69.09  ? 445  ALA A C     1 
ATOM   4146 O  O     . ALA C 3 445 ? 65.597  -22.661 -12.542 1.00 71.58  ? 445  ALA A O     1 
ATOM   4147 C  CB    . ALA C 3 445 ? 67.228  -23.278 -10.426 1.00 61.38  ? 445  ALA A CB    1 
ATOM   4148 N  N     . VAL C 3 446 ? 63.883  -23.972 -11.903 1.00 68.53  ? 446  VAL A N     1 
ATOM   4149 C  CA    . VAL C 3 446 ? 63.081  -23.746 -13.096 1.00 65.32  ? 446  VAL A CA    1 
ATOM   4150 C  C     . VAL C 3 446 ? 61.897  -22.833 -12.779 1.00 66.17  ? 446  VAL A C     1 
ATOM   4151 O  O     . VAL C 3 446 ? 61.459  -22.047 -13.620 1.00 68.75  ? 446  VAL A O     1 
ATOM   4152 C  CB    . VAL C 3 446 ? 62.593  -25.095 -13.659 1.00 65.84  ? 446  VAL A CB    1 
ATOM   4153 C  CG1   . VAL C 3 446 ? 61.253  -24.947 -14.349 1.00 69.28  ? 446  VAL A CG1   1 
ATOM   4154 C  CG2   . VAL C 3 446 ? 63.633  -25.634 -14.621 1.00 68.04  ? 446  VAL A CG2   1 
ATOM   4155 N  N     . ALA C 3 447 ? 61.389  -22.935 -11.555 1.00 65.71  ? 447  ALA A N     1 
ATOM   4156 C  CA    . ALA C 3 447 ? 60.269  -22.112 -11.103 1.00 64.50  ? 447  ALA A CA    1 
ATOM   4157 C  C     . ALA C 3 447 ? 60.673  -20.629 -10.987 1.00 65.02  ? 447  ALA A C     1 
ATOM   4158 O  O     . ALA C 3 447 ? 61.851  -20.282 -11.102 1.00 63.15  ? 447  ALA A O     1 
ATOM   4159 C  CB    . ALA C 3 447 ? 59.766  -22.637 -9.750  1.00 60.10  ? 447  ALA A CB    1 
ATOM   4160 N  N     . GLU C 3 448 ? 59.696  -19.757 -10.763 1.00 64.59  ? 448  GLU A N     1 
ATOM   4161 C  CA    . GLU C 3 448 ? 59.973  -18.328 -10.631 1.00 64.31  ? 448  GLU A CA    1 
ATOM   4162 C  C     . GLU C 3 448 ? 60.282  -17.972 -9.177  1.00 60.61  ? 448  GLU A C     1 
ATOM   4163 O  O     . GLU C 3 448 ? 59.679  -18.525 -8.258  1.00 60.37  ? 448  GLU A O     1 
ATOM   4164 C  CB    . GLU C 3 448 ? 58.770  -17.512 -11.104 1.00 69.60  ? 448  GLU A CB    1 
ATOM   4165 C  CG    . GLU C 3 448 ? 59.062  -16.027 -11.240 1.00 86.31  ? 448  GLU A CG    1 
ATOM   4166 C  CD    . GLU C 3 448 ? 57.801  -15.173 -11.270 1.00 91.79  ? 448  GLU A CD    1 
ATOM   4167 O  OE1   . GLU C 3 448 ? 56.837  -15.545 -11.979 1.00 96.43  ? 448  GLU A OE1   1 
ATOM   4168 O  OE2   . GLU C 3 448 ? 57.781  -14.124 -10.586 1.00 92.26  ? 448  GLU A OE2   1 
ATOM   4169 N  N     . ARG C 3 449 ? 61.221  -17.053 -8.973  1.00 54.98  ? 449  ARG A N     1 
ATOM   4170 C  CA    . ARG C 3 449 ? 61.596  -16.624 -7.627  1.00 52.43  ? 449  ARG A CA    1 
ATOM   4171 C  C     . ARG C 3 449 ? 60.336  -16.128 -6.914  1.00 57.49  ? 449  ARG A C     1 
ATOM   4172 O  O     . ARG C 3 449 ? 59.726  -15.143 -7.330  1.00 65.92  ? 449  ARG A O     1 
ATOM   4173 C  CB    . ARG C 3 449 ? 62.631  -15.511 -7.724  1.00 44.07  ? 449  ARG A CB    1 
ATOM   4174 C  CG    . ARG C 3 449 ? 63.442  -15.258 -6.465  1.00 45.39  ? 449  ARG A CG    1 
ATOM   4175 C  CD    . ARG C 3 449 ? 64.547  -14.239 -6.752  1.00 42.86  ? 449  ARG A CD    1 
ATOM   4176 N  NE    . ARG C 3 449 ? 65.500  -14.042 -5.658  1.00 46.50  ? 449  ARG A NE    1 
ATOM   4177 C  CZ    . ARG C 3 449 ? 65.529  -12.968 -4.873  1.00 46.69  ? 449  ARG A CZ    1 
ATOM   4178 N  NH1   . ARG C 3 449 ? 64.651  -12.001 -5.056  1.00 51.77  ? 449  ARG A NH1   1 
ATOM   4179 N  NH2   . ARG C 3 449 ? 66.452  -12.833 -3.933  1.00 43.86  ? 449  ARG A NH2   1 
ATOM   4180 N  N     . PRO C 3 450 ? 59.932  -16.804 -5.822  1.00 59.67  ? 450  PRO A N     1 
ATOM   4181 C  CA    . PRO C 3 450 ? 58.740  -16.466 -5.035  1.00 59.25  ? 450  PRO A CA    1 
ATOM   4182 C  C     . PRO C 3 450 ? 58.600  -15.026 -4.559  1.00 60.27  ? 450  PRO A C     1 
ATOM   4183 O  O     . PRO C 3 450 ? 57.521  -14.453 -4.654  1.00 62.49  ? 450  PRO A O     1 
ATOM   4184 C  CB    . PRO C 3 450 ? 58.810  -17.448 -3.863  1.00 58.85  ? 450  PRO A CB    1 
ATOM   4185 C  CG    . PRO C 3 450 ? 59.463  -18.618 -4.454  1.00 59.07  ? 450  PRO A CG    1 
ATOM   4186 C  CD    . PRO C 3 450 ? 60.594  -17.985 -5.240  1.00 60.46  ? 450  PRO A CD    1 
ATOM   4187 N  N     . SER C 3 451 ? 59.675  -14.445 -4.035  1.00 59.66  ? 451  SER A N     1 
ATOM   4188 C  CA    . SER C 3 451 ? 59.607  -13.076 -3.539  1.00 55.19  ? 451  SER A CA    1 
ATOM   4189 C  C     . SER C 3 451 ? 60.942  -12.348 -3.485  1.00 59.70  ? 451  SER A C     1 
ATOM   4190 O  O     . SER C 3 451 ? 62.013  -12.963 -3.479  1.00 63.33  ? 451  SER A O     1 
ATOM   4191 C  CB    . SER C 3 451 ? 58.979  -13.063 -2.148  1.00 51.31  ? 451  SER A CB    1 
ATOM   4192 O  OG    . SER C 3 451 ? 59.174  -11.813 -1.517  1.00 53.90  ? 451  SER A OG    1 
ATOM   4193 N  N     . ASP C 3 452 ? 60.862  -11.023 -3.447  1.00 62.81  ? 452  ASP A N     1 
ATOM   4194 C  CA    . ASP C 3 452 ? 62.046  -10.193 -3.370  1.00 61.43  ? 452  ASP A CA    1 
ATOM   4195 C  C     . ASP C 3 452 ? 61.987  -9.354  -2.096  1.00 57.85  ? 452  ASP A C     1 
ATOM   4196 O  O     . ASP C 3 452 ? 62.832  -8.489  -1.866  1.00 55.09  ? 452  ASP A O     1 
ATOM   4197 C  CB    . ASP C 3 452 ? 62.145  -9.287  -4.597  1.00 71.17  ? 452  ASP A CB    1 
ATOM   4198 C  CG    . ASP C 3 452 ? 63.534  -8.713  -4.777  1.00 79.09  ? 452  ASP A CG    1 
ATOM   4199 O  OD1   . ASP C 3 452 ? 64.465  -9.494  -5.062  1.00 87.14  ? 452  ASP A OD1   1 
ATOM   4200 O  OD2   . ASP C 3 452 ? 63.700  -7.485  -4.624  1.00 86.33  ? 452  ASP A OD2   1 
ATOM   4201 N  N     . VAL C 3 453 ? 60.982  -9.615  -1.263  1.00 54.93  ? 453  VAL A N     1 
ATOM   4202 C  CA    . VAL C 3 453 ? 60.852  -8.898  0.004   1.00 55.28  ? 453  VAL A CA    1 
ATOM   4203 C  C     . VAL C 3 453 ? 60.711  -9.849  1.193   1.00 52.59  ? 453  VAL A C     1 
ATOM   4204 O  O     . VAL C 3 453 ? 61.007  -9.469  2.319   1.00 54.43  ? 453  VAL A O     1 
ATOM   4205 C  CB    . VAL C 3 453 ? 59.634  -7.912  0.011   1.00 56.02  ? 453  VAL A CB    1 
ATOM   4206 C  CG1   . VAL C 3 453 ? 59.745  -6.930  -1.146  1.00 54.29  ? 453  VAL A CG1   1 
ATOM   4207 C  CG2   . VAL C 3 453 ? 58.335  -8.675  -0.066  1.00 56.41  ? 453  VAL A CG2   1 
ATOM   4208 N  N     . TYR C 3 454 ? 60.278  -11.084 0.949   1.00 55.11  ? 454  TYR A N     1 
ATOM   4209 C  CA    . TYR C 3 454 ? 60.111  -12.039 2.042   1.00 57.45  ? 454  TYR A CA    1 
ATOM   4210 C  C     . TYR C 3 454 ? 60.962  -13.302 1.931   1.00 55.93  ? 454  TYR A C     1 
ATOM   4211 O  O     . TYR C 3 454 ? 61.403  -13.661 0.843   1.00 57.09  ? 454  TYR A O     1 
ATOM   4212 C  CB    . TYR C 3 454 ? 58.633  -12.415 2.180   1.00 60.12  ? 454  TYR A CB    1 
ATOM   4213 C  CG    . TYR C 3 454 ? 57.738  -11.219 2.439   1.00 62.40  ? 454  TYR A CG    1 
ATOM   4214 C  CD1   . TYR C 3 454 ? 57.907  -10.426 3.580   1.00 59.87  ? 454  TYR A CD1   1 
ATOM   4215 C  CD2   . TYR C 3 454 ? 56.757  -10.847 1.518   1.00 61.87  ? 454  TYR A CD2   1 
ATOM   4216 C  CE1   . TYR C 3 454 ? 57.128  -9.290  3.786   1.00 60.71  ? 454  TYR A CE1   1 
ATOM   4217 C  CE2   . TYR C 3 454 ? 55.974  -9.714  1.716   1.00 59.97  ? 454  TYR A CE2   1 
ATOM   4218 C  CZ    . TYR C 3 454 ? 56.163  -8.935  2.850   1.00 63.25  ? 454  TYR A CZ    1 
ATOM   4219 O  OH    . TYR C 3 454 ? 55.401  -7.799  3.039   1.00 61.36  ? 454  TYR A OH    1 
ATOM   4220 N  N     . SER C 3 455 ? 61.189  -13.949 3.080   1.00 52.17  ? 455  SER A N     1 
ATOM   4221 C  CA    . SER C 3 455 ? 61.980  -15.179 3.197   1.00 43.29  ? 455  SER A CA    1 
ATOM   4222 C  C     . SER C 3 455 ? 61.049  -16.365 2.984   1.00 45.74  ? 455  SER A C     1 
ATOM   4223 O  O     . SER C 3 455 ? 60.128  -16.572 3.770   1.00 47.18  ? 455  SER A O     1 
ATOM   4224 C  CB    . SER C 3 455 ? 62.596  -15.241 4.587   1.00 39.88  ? 455  SER A CB    1 
ATOM   4225 O  OG    . SER C 3 455 ? 63.418  -16.383 4.740   1.00 52.34  ? 455  SER A OG    1 
ATOM   4226 N  N     . CYS C 3 456 ? 61.304  -17.166 1.951   1.00 45.66  ? 456  CYS A N     1 
ATOM   4227 C  CA    . CYS C 3 456 ? 60.397  -18.272 1.630   1.00 47.38  ? 456  CYS A CA    1 
ATOM   4228 C  C     . CYS C 3 456 ? 60.811  -19.740 1.758   1.00 47.69  ? 456  CYS A C     1 
ATOM   4229 O  O     . CYS C 3 456 ? 61.966  -20.079 1.995   1.00 49.33  ? 456  CYS A O     1 
ATOM   4230 C  CB    . CYS C 3 456 ? 59.858  -18.044 0.223   1.00 45.02  ? 456  CYS A CB    1 
ATOM   4231 S  SG    . CYS C 3 456 ? 59.275  -16.365 -0.004  1.00 55.48  ? 456  CYS A SG    1 
ATOM   4232 N  N     . SER C 3 457 ? 59.809  -20.596 1.593   1.00 45.13  ? 457  SER A N     1 
ATOM   4233 C  CA    . SER C 3 457 ? 59.948  -22.040 1.649   1.00 47.12  ? 457  SER A CA    1 
ATOM   4234 C  C     . SER C 3 457 ? 59.190  -22.616 0.448   1.00 47.18  ? 457  SER A C     1 
ATOM   4235 O  O     . SER C 3 457 ? 58.204  -22.051 -0.001  1.00 47.87  ? 457  SER A O     1 
ATOM   4236 C  CB    . SER C 3 457 ? 59.350  -22.577 2.954   1.00 47.33  ? 457  SER A CB    1 
ATOM   4237 O  OG    . SER C 3 457 ? 59.345  -23.993 2.980   1.00 43.96  ? 457  SER A OG    1 
ATOM   4238 N  N     . PRO C 3 458 ? 59.642  -23.759 -0.077  1.00 48.39  ? 458  PRO A N     1 
ATOM   4239 C  CA    . PRO C 3 458 ? 59.012  -24.412 -1.228  1.00 46.93  ? 458  PRO A CA    1 
ATOM   4240 C  C     . PRO C 3 458 ? 57.522  -24.745 -1.091  1.00 47.58  ? 458  PRO A C     1 
ATOM   4241 O  O     . PRO C 3 458 ? 56.872  -25.014 -2.097  1.00 48.91  ? 458  PRO A O     1 
ATOM   4242 C  CB    . PRO C 3 458 ? 59.844  -25.682 -1.408  1.00 49.32  ? 458  PRO A CB    1 
ATOM   4243 C  CG    . PRO C 3 458 ? 61.154  -25.350 -0.786  1.00 49.65  ? 458  PRO A CG    1 
ATOM   4244 C  CD    . PRO C 3 458 ? 60.762  -24.570 0.432   1.00 48.44  ? 458  PRO A CD    1 
ATOM   4245 N  N     . ASN C 3 459 ? 56.978  -24.759 0.126   1.00 46.68  ? 459  ASN A N     1 
ATOM   4246 C  CA    . ASN C 3 459 ? 55.550  -25.079 0.300   1.00 48.09  ? 459  ASN A CA    1 
ATOM   4247 C  C     . ASN C 3 459 ? 54.606  -23.912 -0.031  1.00 50.58  ? 459  ASN A C     1 
ATOM   4248 O  O     . ASN C 3 459 ? 53.454  -24.124 -0.408  1.00 54.92  ? 459  ASN A O     1 
ATOM   4249 C  CB    . ASN C 3 459 ? 55.270  -25.573 1.725   1.00 40.92  ? 459  ASN A CB    1 
ATOM   4250 C  CG    . ASN C 3 459 ? 55.559  -24.527 2.771   1.00 41.93  ? 459  ASN A CG    1 
ATOM   4251 O  OD1   . ASN C 3 459 ? 55.077  -24.616 3.898   1.00 40.31  ? 459  ASN A OD1   1 
ATOM   4252 N  ND2   . ASN C 3 459 ? 56.364  -23.535 2.413   1.00 40.80  ? 459  ASN A ND2   1 
ATOM   4253 N  N     . GLY C 3 460 ? 55.091  -22.684 0.117   1.00 52.71  ? 460  GLY A N     1 
ATOM   4254 C  CA    . GLY C 3 460 ? 54.267  -21.534 -0.199  1.00 52.13  ? 460  GLY A CA    1 
ATOM   4255 C  C     . GLY C 3 460 ? 54.170  -20.473 0.875   1.00 49.64  ? 460  GLY A C     1 
ATOM   4256 O  O     . GLY C 3 460 ? 53.390  -19.538 0.741   1.00 54.81  ? 460  GLY A O     1 
ATOM   4257 N  N     . MET C 3 461 ? 54.950  -20.608 1.940   1.00 46.83  ? 461  MET A N     1 
ATOM   4258 C  CA    . MET C 3 461 ? 54.931  -19.635 3.033   1.00 44.84  ? 461  MET A CA    1 
ATOM   4259 C  C     . MET C 3 461 ? 55.982  -18.558 2.849   1.00 46.31  ? 461  MET A C     1 
ATOM   4260 O  O     . MET C 3 461 ? 56.990  -18.761 2.178   1.00 49.71  ? 461  MET A O     1 
ATOM   4261 C  CB    . MET C 3 461 ? 55.201  -20.323 4.365   1.00 42.08  ? 461  MET A CB    1 
ATOM   4262 C  CG    . MET C 3 461 ? 54.117  -21.250 4.836   1.00 48.87  ? 461  MET A CG    1 
ATOM   4263 S  SD    . MET C 3 461 ? 52.694  -20.306 5.379   1.00 52.81  ? 461  MET A SD    1 
ATOM   4264 C  CE    . MET C 3 461 ? 51.416  -21.166 4.554   1.00 57.90  ? 461  MET A CE    1 
ATOM   4265 N  N     . MET C 3 462 ? 55.746  -17.409 3.464   1.00 45.36  ? 462  MET A N     1 
ATOM   4266 C  CA    . MET C 3 462 ? 56.690  -16.310 3.386   1.00 43.01  ? 462  MET A CA    1 
ATOM   4267 C  C     . MET C 3 462 ? 56.827  -15.749 4.781   1.00 41.23  ? 462  MET A C     1 
ATOM   4268 O  O     . MET C 3 462 ? 55.862  -15.705 5.535   1.00 44.38  ? 462  MET A O     1 
ATOM   4269 C  CB    . MET C 3 462 ? 56.194  -15.237 2.425   1.00 44.12  ? 462  MET A CB    1 
ATOM   4270 C  CG    . MET C 3 462 ? 55.884  -15.759 1.032   1.00 54.23  ? 462  MET A CG    1 
ATOM   4271 S  SD    . MET C 3 462 ? 55.695  -14.417 -0.163  1.00 69.38  ? 462  MET A SD    1 
ATOM   4272 C  CE    . MET C 3 462 ? 54.013  -13.926 0.128   1.00 63.57  ? 462  MET A CE    1 
ATOM   4273 N  N     . TYR C 3 463 ? 58.032  -15.333 5.138   1.00 42.52  ? 463  TYR A N     1 
ATOM   4274 C  CA    . TYR C 3 463 ? 58.258  -14.812 6.468   1.00 42.49  ? 463  TYR A CA    1 
ATOM   4275 C  C     . TYR C 3 463 ? 58.923  -13.469 6.407   1.00 46.53  ? 463  TYR A C     1 
ATOM   4276 O  O     . TYR C 3 463 ? 59.517  -13.112 5.388   1.00 49.57  ? 463  TYR A O     1 
ATOM   4277 C  CB    . TYR C 3 463 ? 59.114  -15.787 7.272   1.00 37.92  ? 463  TYR A CB    1 
ATOM   4278 C  CG    . TYR C 3 463 ? 58.476  -17.143 7.365   1.00 37.86  ? 463  TYR A CG    1 
ATOM   4279 C  CD1   . TYR C 3 463 ? 58.520  -18.020 6.291   1.00 30.14  ? 463  TYR A CD1   1 
ATOM   4280 C  CD2   . TYR C 3 463 ? 57.737  -17.514 8.491   1.00 37.58  ? 463  TYR A CD2   1 
ATOM   4281 C  CE1   . TYR C 3 463 ? 57.847  -19.220 6.327   1.00 37.89  ? 463  TYR A CE1   1 
ATOM   4282 C  CE2   . TYR C 3 463 ? 57.052  -18.721 8.534   1.00 35.27  ? 463  TYR A CE2   1 
ATOM   4283 C  CZ    . TYR C 3 463 ? 57.112  -19.568 7.445   1.00 37.50  ? 463  TYR A CZ    1 
ATOM   4284 O  OH    . TYR C 3 463 ? 56.445  -20.768 7.463   1.00 42.94  ? 463  TYR A OH    1 
ATOM   4285 N  N     . TYR C 3 464 ? 58.810  -12.734 7.509   1.00 47.80  ? 464  TYR A N     1 
ATOM   4286 C  CA    . TYR C 3 464 ? 59.382  -11.401 7.633   1.00 51.85  ? 464  TYR A CA    1 
ATOM   4287 C  C     . TYR C 3 464 ? 60.903  -11.436 7.790   1.00 49.50  ? 464  TYR A C     1 
ATOM   4288 O  O     . TYR C 3 464 ? 61.426  -12.061 8.710   1.00 48.85  ? 464  TYR A O     1 
ATOM   4289 C  CB    . TYR C 3 464 ? 58.714  -10.686 8.816   1.00 55.10  ? 464  TYR A CB    1 
ATOM   4290 C  CG    . TYR C 3 464 ? 57.296  -10.236 8.508   1.00 63.29  ? 464  TYR A CG    1 
ATOM   4291 C  CD1   . TYR C 3 464 ? 57.012  -9.541  7.332   1.00 66.61  ? 464  TYR A CD1   1 
ATOM   4292 C  CD2   . TYR C 3 464 ? 56.240  -10.491 9.391   1.00 64.70  ? 464  TYR A CD2   1 
ATOM   4293 C  CE1   . TYR C 3 464 ? 55.720  -9.106  7.037   1.00 65.89  ? 464  TYR A CE1   1 
ATOM   4294 C  CE2   . TYR C 3 464 ? 54.937  -10.060 9.103   1.00 61.00  ? 464  TYR A CE2   1 
ATOM   4295 C  CZ    . TYR C 3 464 ? 54.690  -9.367  7.922   1.00 66.26  ? 464  TYR A CZ    1 
ATOM   4296 O  OH    . TYR C 3 464 ? 53.425  -8.926  7.616   1.00 66.18  ? 464  TYR A OH    1 
ATOM   4297 N  N     . LYS C 3 465 ? 61.607  -10.771 6.881   1.00 45.23  ? 465  LYS A N     1 
ATOM   4298 C  CA    . LYS C 3 465 ? 63.064  -10.734 6.930   1.00 51.14  ? 465  LYS A CA    1 
ATOM   4299 C  C     . LYS C 3 465 ? 63.607  -9.595  7.781   1.00 58.07  ? 465  LYS A C     1 
ATOM   4300 O  O     . LYS C 3 465 ? 64.800  -9.558  8.084   1.00 56.66  ? 465  LYS A O     1 
ATOM   4301 C  CB    . LYS C 3 465 ? 63.645  -10.579 5.530   1.00 49.56  ? 465  LYS A CB    1 
ATOM   4302 C  CG    . LYS C 3 465 ? 63.494  -11.771 4.628   1.00 48.06  ? 465  LYS A CG    1 
ATOM   4303 C  CD    . LYS C 3 465 ? 64.252  -11.533 3.333   1.00 51.19  ? 465  LYS A CD    1 
ATOM   4304 C  CE    . LYS C 3 465 ? 65.730  -11.238 3.568   1.00 47.59  ? 465  LYS A CE    1 
ATOM   4305 N  NZ    . LYS C 3 465 ? 66.411  -10.977 2.264   1.00 57.42  ? 465  LYS A NZ    1 
ATOM   4306 N  N     . ASP C 3 466 ? 62.736  -8.664  8.160   1.00 65.47  ? 466  ASP A N     1 
ATOM   4307 C  CA    . ASP C 3 466 ? 63.163  -7.508  8.942   1.00 70.22  ? 466  ASP A CA    1 
ATOM   4308 C  C     . ASP C 3 466 ? 63.080  -7.672  10.464  1.00 70.77  ? 466  ASP A C     1 
ATOM   4309 O  O     . ASP C 3 466 ? 63.609  -6.844  11.210  1.00 72.59  ? 466  ASP A O     1 
ATOM   4310 C  CB    . ASP C 3 466 ? 62.382  -6.256  8.497   1.00 75.31  ? 466  ASP A CB    1 
ATOM   4311 C  CG    . ASP C 3 466 ? 60.987  -6.165  9.113   1.00 80.35  ? 466  ASP A CG    1 
ATOM   4312 O  OD1   . ASP C 3 466 ? 60.136  -7.039  8.833   1.00 79.37  ? 466  ASP A OD1   1 
ATOM   4313 O  OD2   . ASP C 3 466 ? 60.749  -5.202  9.878   1.00 82.84  ? 466  ASP A OD2   1 
ATOM   4314 N  N     . ARG C 3 467 ? 62.442  -8.740  10.927  1.00 67.31  ? 467  ARG A N     1 
ATOM   4315 C  CA    . ARG C 3 467 ? 62.334  -8.959  12.358  1.00 65.41  ? 467  ARG A CA    1 
ATOM   4316 C  C     . ARG C 3 467 ? 62.801  -10.356 12.731  1.00 65.12  ? 467  ARG A C     1 
ATOM   4317 O  O     . ARG C 3 467 ? 62.673  -11.295 11.950  1.00 67.78  ? 467  ARG A O     1 
ATOM   4318 C  CB    . ARG C 3 467 ? 60.893  -8.750  12.818  1.00 62.53  ? 467  ARG A CB    1 
ATOM   4319 C  CG    . ARG C 3 467 ? 59.969  -9.919  12.551  1.00 66.83  ? 467  ARG A CG    1 
ATOM   4320 C  CD    . ARG C 3 467 ? 58.511  -9.490  12.681  1.00 65.10  ? 467  ARG A CD    1 
ATOM   4321 N  NE    . ARG C 3 467 ? 58.165  -8.493  11.671  1.00 66.30  ? 467  ARG A NE    1 
ATOM   4322 C  CZ    . ARG C 3 467 ? 56.983  -7.891  11.578  1.00 67.10  ? 467  ARG A CZ    1 
ATOM   4323 N  NH1   . ARG C 3 467 ? 56.013  -8.173  12.440  1.00 65.27  ? 467  ARG A NH1   1 
ATOM   4324 N  NH2   . ARG C 3 467 ? 56.767  -7.017  10.604  1.00 65.29  ? 467  ARG A NH2   1 
ATOM   4325 N  N     . ASP C 3 468 ? 63.368  -10.486 13.922  1.00 64.97  ? 468  ASP A N     1 
ATOM   4326 C  CA    . ASP C 3 468 ? 63.834  -11.773 14.388  1.00 65.40  ? 468  ASP A CA    1 
ATOM   4327 C  C     . ASP C 3 468 ? 62.627  -12.521 14.932  1.00 63.41  ? 468  ASP A C     1 
ATOM   4328 O  O     . ASP C 3 468 ? 61.673  -11.916 15.413  1.00 66.47  ? 468  ASP A O     1 
ATOM   4329 C  CB    . ASP C 3 468 ? 64.880  -11.592 15.487  1.00 74.02  ? 468  ASP A CB    1 
ATOM   4330 C  CG    . ASP C 3 468 ? 65.971  -10.595 15.101  1.00 83.03  ? 468  ASP A CG    1 
ATOM   4331 O  OD1   . ASP C 3 468 ? 66.302  -10.516 13.895  1.00 84.31  ? 468  ASP A OD1   1 
ATOM   4332 O  OD2   . ASP C 3 468 ? 66.499  -9.904  16.006  1.00 84.39  ? 468  ASP A OD2   1 
ATOM   4333 N  N     . GLY C 3 469 ? 62.661  -13.839 14.839  1.00 57.53  ? 469  GLY A N     1 
ATOM   4334 C  CA    . GLY C 3 469 ? 61.547  -14.612 15.334  1.00 49.58  ? 469  GLY A CA    1 
ATOM   4335 C  C     . GLY C 3 469 ? 61.798  -15.073 16.749  1.00 46.37  ? 469  GLY A C     1 
ATOM   4336 O  O     . GLY C 3 469 ? 62.944  -15.212 17.157  1.00 47.16  ? 469  GLY A O     1 
ATOM   4337 N  N     . VAL C 3 470 ? 60.725  -15.309 17.494  1.00 41.84  ? 470  VAL A N     1 
ATOM   4338 C  CA    . VAL C 3 470 ? 60.815  -15.768 18.870  1.00 43.07  ? 470  VAL A CA    1 
ATOM   4339 C  C     . VAL C 3 470 ? 61.578  -17.094 18.944  1.00 47.83  ? 470  VAL A C     1 
ATOM   4340 O  O     . VAL C 3 470 ? 62.539  -17.229 19.701  1.00 52.59  ? 470  VAL A O     1 
ATOM   4341 C  CB    . VAL C 3 470 ? 59.402  -15.995 19.467  1.00 47.02  ? 470  VAL A CB    1 
ATOM   4342 C  CG1   . VAL C 3 470 ? 59.506  -16.406 20.919  1.00 46.92  ? 470  VAL A CG1   1 
ATOM   4343 C  CG2   . VAL C 3 470 ? 58.573  -14.743 19.331  1.00 47.72  ? 470  VAL A CG2   1 
ATOM   4344 N  N     . VAL C 3 471 ? 61.139  -18.072 18.156  1.00 44.27  ? 471  VAL A N     1 
ATOM   4345 C  CA    . VAL C 3 471 ? 61.770  -19.377 18.146  1.00 44.46  ? 471  VAL A CA    1 
ATOM   4346 C  C     . VAL C 3 471 ? 63.227  -19.305 17.676  1.00 44.45  ? 471  VAL A C     1 
ATOM   4347 O  O     . VAL C 3 471 ? 64.131  -19.755 18.377  1.00 46.74  ? 471  VAL A O     1 
ATOM   4348 C  CB    . VAL C 3 471 ? 60.957  -20.363 17.274  1.00 46.78  ? 471  VAL A CB    1 
ATOM   4349 C  CG1   . VAL C 3 471 ? 61.666  -21.695 17.175  1.00 48.79  ? 471  VAL A CG1   1 
ATOM   4350 C  CG2   . VAL C 3 471 ? 59.586  -20.558 17.878  1.00 45.18  ? 471  VAL A CG2   1 
ATOM   4351 N  N     . PRO C 3 472 ? 63.480  -18.737 16.485  1.00 42.98  ? 472  PRO A N     1 
ATOM   4352 C  CA    . PRO C 3 472 ? 64.871  -18.660 16.025  1.00 43.01  ? 472  PRO A CA    1 
ATOM   4353 C  C     . PRO C 3 472 ? 65.804  -17.881 16.954  1.00 45.86  ? 472  PRO A C     1 
ATOM   4354 O  O     . PRO C 3 472 ? 66.987  -18.198 17.061  1.00 54.39  ? 472  PRO A O     1 
ATOM   4355 C  CB    . PRO C 3 472 ? 64.751  -18.041 14.622  1.00 39.20  ? 472  PRO A CB    1 
ATOM   4356 C  CG    . PRO C 3 472 ? 63.365  -17.455 14.575  1.00 41.96  ? 472  PRO A CG    1 
ATOM   4357 C  CD    . PRO C 3 472 ? 62.541  -18.368 15.410  1.00 40.04  ? 472  PRO A CD    1 
ATOM   4358 N  N     . THR C 3 473 ? 65.280  -16.875 17.642  1.00 43.81  ? 473  THR A N     1 
ATOM   4359 C  CA    . THR C 3 473 ? 66.109  -16.102 18.564  1.00 39.35  ? 473  THR A CA    1 
ATOM   4360 C  C     . THR C 3 473 ? 66.517  -16.967 19.736  1.00 40.07  ? 473  THR A C     1 
ATOM   4361 O  O     . THR C 3 473 ? 67.603  -16.823 20.287  1.00 39.02  ? 473  THR A O     1 
ATOM   4362 C  CB    . THR C 3 473 ? 65.350  -14.890 19.078  1.00 38.63  ? 473  THR A CB    1 
ATOM   4363 O  OG1   . THR C 3 473 ? 65.302  -13.911 18.037  1.00 46.25  ? 473  THR A OG1   1 
ATOM   4364 C  CG2   . THR C 3 473 ? 66.016  -14.297 20.305  1.00 39.22  ? 473  THR A CG2   1 
ATOM   4365 N  N     . GLU C 3 474 ? 65.627  -17.876 20.103  1.00 44.67  ? 474  GLU A N     1 
ATOM   4366 C  CA    . GLU C 3 474 ? 65.861  -18.776 21.212  1.00 46.09  ? 474  GLU A CA    1 
ATOM   4367 C  C     . GLU C 3 474 ? 66.850  -19.879 20.865  1.00 47.25  ? 474  GLU A C     1 
ATOM   4368 O  O     . GLU C 3 474 ? 67.607  -20.325 21.723  1.00 46.78  ? 474  GLU A O     1 
ATOM   4369 C  CB    . GLU C 3 474 ? 64.541  -19.404 21.651  1.00 50.72  ? 474  GLU A CB    1 
ATOM   4370 C  CG    . GLU C 3 474 ? 64.531  -19.803 23.104  1.00 61.83  ? 474  GLU A CG    1 
ATOM   4371 C  CD    . GLU C 3 474 ? 64.973  -18.662 24.001  1.00 67.21  ? 474  GLU A CD    1 
ATOM   4372 O  OE1   . GLU C 3 474 ? 64.561  -17.510 23.740  1.00 67.19  ? 474  GLU A OE1   1 
ATOM   4373 O  OE2   . GLU C 3 474 ? 65.724  -18.915 24.967  1.00 73.83  ? 474  GLU A OE2   1 
ATOM   4374 N  N     . ILE C 3 475 ? 66.823  -20.336 19.615  1.00 48.11  ? 475  ILE A N     1 
ATOM   4375 C  CA    . ILE C 3 475 ? 67.735  -21.389 19.172  1.00 50.43  ? 475  ILE A CA    1 
ATOM   4376 C  C     . ILE C 3 475 ? 69.149  -20.829 19.201  1.00 48.17  ? 475  ILE A C     1 
ATOM   4377 O  O     . ILE C 3 475 ? 70.067  -21.460 19.722  1.00 51.50  ? 475  ILE A O     1 
ATOM   4378 C  CB    . ILE C 3 475 ? 67.426  -21.865 17.723  1.00 50.66  ? 475  ILE A CB    1 
ATOM   4379 C  CG1   . ILE C 3 475 ? 66.023  -22.465 17.648  1.00 53.65  ? 475  ILE A CG1   1 
ATOM   4380 C  CG2   . ILE C 3 475 ? 68.419  -22.924 17.304  1.00 49.70  ? 475  ILE A CG2   1 
ATOM   4381 C  CD1   . ILE C 3 475 ? 65.655  -23.010 16.281  1.00 51.20  ? 475  ILE A CD1   1 
ATOM   4382 N  N     . THR C 3 476 ? 69.311  -19.637 18.640  1.00 44.56  ? 476  THR A N     1 
ATOM   4383 C  CA    . THR C 3 476 ? 70.603  -18.966 18.602  1.00 41.25  ? 476  THR A CA    1 
ATOM   4384 C  C     . THR C 3 476 ? 71.177  -18.760 20.013  1.00 41.83  ? 476  THR A C     1 
ATOM   4385 O  O     . THR C 3 476 ? 72.391  -18.897 20.230  1.00 42.69  ? 476  THR A O     1 
ATOM   4386 C  CB    . THR C 3 476 ? 70.485  -17.606 17.896  1.00 32.33  ? 476  THR A CB    1 
ATOM   4387 O  OG1   . THR C 3 476 ? 69.929  -17.796 16.589  1.00 37.27  ? 476  THR A OG1   1 
ATOM   4388 C  CG2   . THR C 3 476 ? 71.823  -16.977 17.756  1.00 30.17  ? 476  THR A CG2   1 
ATOM   4389 N  N     . LYS C 3 477 ? 70.322  -18.444 20.979  1.00 35.35  ? 477  LYS A N     1 
ATOM   4390 C  CA    . LYS C 3 477 ? 70.819  -18.249 22.341  1.00 40.10  ? 477  LYS A CA    1 
ATOM   4391 C  C     . LYS C 3 477 ? 71.445  -19.530 22.867  1.00 36.74  ? 477  LYS A C     1 
ATOM   4392 O  O     . LYS C 3 477 ? 72.551  -19.511 23.399  1.00 35.70  ? 477  LYS A O     1 
ATOM   4393 C  CB    . LYS C 3 477 ? 69.695  -17.811 23.280  1.00 40.94  ? 477  LYS A CB    1 
ATOM   4394 C  CG    . LYS C 3 477 ? 69.180  -16.404 23.029  1.00 51.82  ? 477  LYS A CG    1 
ATOM   4395 C  CD    . LYS C 3 477 ? 67.935  -16.118 23.864  1.00 58.30  ? 477  LYS A CD    1 
ATOM   4396 C  CE    . LYS C 3 477 ? 68.184  -16.397 25.344  1.00 59.72  ? 477  LYS A CE    1 
ATOM   4397 N  NZ    . LYS C 3 477 ? 66.928  -16.354 26.134  1.00 53.62  ? 477  LYS A NZ    1 
ATOM   4398 N  N     . VAL C 3 478 ? 70.728  -20.638 22.702  1.00 39.04  ? 478  VAL A N     1 
ATOM   4399 C  CA    . VAL C 3 478 ? 71.189  -21.940 23.160  1.00 40.15  ? 478  VAL A CA    1 
ATOM   4400 C  C     . VAL C 3 478 ? 72.432  -22.399 22.423  1.00 40.68  ? 478  VAL A C     1 
ATOM   4401 O  O     . VAL C 3 478 ? 73.288  -23.052 23.003  1.00 41.25  ? 478  VAL A O     1 
ATOM   4402 C  CB    . VAL C 3 478 ? 70.085  -23.000 23.008  1.00 42.01  ? 478  VAL A CB    1 
ATOM   4403 C  CG1   . VAL C 3 478 ? 70.623  -24.376 23.349  1.00 45.57  ? 478  VAL A CG1   1 
ATOM   4404 C  CG2   . VAL C 3 478 ? 68.932  -22.659 23.930  1.00 41.76  ? 478  VAL A CG2   1 
ATOM   4405 N  N     . PHE C 3 479 ? 72.541  -22.046 21.148  1.00 43.11  ? 479  PHE A N     1 
ATOM   4406 C  CA    . PHE C 3 479 ? 73.703  -22.433 20.362  1.00 47.56  ? 479  PHE A CA    1 
ATOM   4407 C  C     . PHE C 3 479 ? 74.969  -21.720 20.862  1.00 48.41  ? 479  PHE A C     1 
ATOM   4408 O  O     . PHE C 3 479 ? 76.034  -22.324 20.982  1.00 48.99  ? 479  PHE A O     1 
ATOM   4409 C  CB    . PHE C 3 479 ? 73.446  -22.140 18.873  1.00 47.26  ? 479  PHE A CB    1 
ATOM   4410 C  CG    . PHE C 3 479 ? 74.649  -22.333 18.002  1.00 52.26  ? 479  PHE A CG    1 
ATOM   4411 C  CD1   . PHE C 3 479 ? 75.133  -23.609 17.732  1.00 60.51  ? 479  PHE A CD1   1 
ATOM   4412 C  CD2   . PHE C 3 479 ? 75.344  -21.231 17.505  1.00 58.51  ? 479  PHE A CD2   1 
ATOM   4413 C  CE1   . PHE C 3 479 ? 76.296  -23.783 16.986  1.00 68.01  ? 479  PHE A CE1   1 
ATOM   4414 C  CE2   . PHE C 3 479 ? 76.509  -21.390 16.755  1.00 62.64  ? 479  PHE A CE2   1 
ATOM   4415 C  CZ    . PHE C 3 479 ? 76.989  -22.670 16.496  1.00 65.62  ? 479  PHE A CZ    1 
ATOM   4416 N  N     . ASN C 3 480 ? 74.836  -20.440 21.181  1.00 50.40  ? 480  ASN A N     1 
ATOM   4417 C  CA    . ASN C 3 480 ? 75.967  -19.656 21.654  1.00 48.94  ? 480  ASN A CA    1 
ATOM   4418 C  C     . ASN C 3 480 ? 76.373  -20.008 23.077  1.00 47.94  ? 480  ASN A C     1 
ATOM   4419 O  O     . ASN C 3 480 ? 77.491  -19.710 23.489  1.00 47.78  ? 480  ASN A O     1 
ATOM   4420 C  CB    . ASN C 3 480 ? 75.640  -18.162 21.551  1.00 47.31  ? 480  ASN A CB    1 
ATOM   4421 C  CG    . ASN C 3 480 ? 75.498  -17.698 20.105  1.00 51.53  ? 480  ASN A CG    1 
ATOM   4422 O  OD1   . ASN C 3 480 ? 75.166  -16.547 19.840  1.00 54.93  ? 480  ASN A OD1   1 
ATOM   4423 N  ND2   . ASN C 3 480 ? 75.755  -18.602 19.164  1.00 56.69  ? 480  ASN A ND2   1 
ATOM   4424 N  N     . GLN C 3 481 ? 75.466  -20.640 23.819  1.00 46.27  ? 481  GLN A N     1 
ATOM   4425 C  CA    . GLN C 3 481 ? 75.745  -21.034 25.190  1.00 45.79  ? 481  GLN A CA    1 
ATOM   4426 C  C     . GLN C 3 481 ? 76.613  -22.292 25.227  1.00 47.98  ? 481  GLN A C     1 
ATOM   4427 O  O     . GLN C 3 481 ? 77.309  -22.550 26.209  1.00 42.86  ? 481  GLN A O     1 
ATOM   4428 C  CB    . GLN C 3 481 ? 74.443  -21.295 25.936  1.00 48.12  ? 481  GLN A CB    1 
ATOM   4429 C  CG    . GLN C 3 481 ? 73.640  -20.062 26.259  1.00 50.54  ? 481  GLN A CG    1 
ATOM   4430 C  CD    . GLN C 3 481 ? 72.332  -20.395 26.951  1.00 54.58  ? 481  GLN A CD    1 
ATOM   4431 O  OE1   . GLN C 3 481 ? 71.626  -19.502 27.414  1.00 58.63  ? 481  GLN A OE1   1 
ATOM   4432 N  NE2   . GLN C 3 481 ? 71.997  -21.683 27.019  1.00 52.03  ? 481  GLN A NE2   1 
ATOM   4433 N  N     . ARG C 3 482 ? 76.557  -23.089 24.164  1.00 47.22  ? 482  ARG A N     1 
ATOM   4434 C  CA    . ARG C 3 482 ? 77.373  -24.292 24.109  1.00 50.97  ? 482  ARG A CA    1 
ATOM   4435 C  C     . ARG C 3 482 ? 78.817  -23.875 23.948  1.00 50.41  ? 482  ARG A C     1 
ATOM   4436 O  O     . ARG C 3 482 ? 79.699  -24.382 24.644  1.00 52.03  ? 482  ARG A O     1 
ATOM   4437 C  CB    . ARG C 3 482 ? 77.003  -25.163 22.924  1.00 51.43  ? 482  ARG A CB    1 
ATOM   4438 C  CG    . ARG C 3 482 ? 75.790  -25.994 23.106  1.00 49.72  ? 482  ARG A CG    1 
ATOM   4439 C  CD    . ARG C 3 482 ? 75.779  -26.996 21.993  1.00 53.21  ? 482  ARG A CD    1 
ATOM   4440 N  NE    . ARG C 3 482 ? 76.820  -27.999 22.172  1.00 54.01  ? 482  ARG A NE    1 
ATOM   4441 C  CZ    . ARG C 3 482 ? 77.180  -28.863 21.230  1.00 56.48  ? 482  ARG A CZ    1 
ATOM   4442 N  NH1   . ARG C 3 482 ? 76.589  -28.824 20.045  1.00 50.91  ? 482  ARG A NH1   1 
ATOM   4443 N  NH2   . ARG C 3 482 ? 78.099  -29.789 21.486  1.00 53.46  ? 482  ARG A NH2   1 
ATOM   4444 N  N     . LYS C 3 483 ? 79.059  -22.966 23.010  1.00 44.59  ? 483  LYS A N     1 
ATOM   4445 C  CA    . LYS C 3 483 ? 80.404  -22.477 22.791  1.00 46.14  ? 483  LYS A CA    1 
ATOM   4446 C  C     . LYS C 3 483 ? 80.980  -22.030 24.125  1.00 46.81  ? 483  LYS A C     1 
ATOM   4447 O  O     . LYS C 3 483 ? 82.147  -22.271 24.417  1.00 51.67  ? 483  LYS A O     1 
ATOM   4448 C  CB    . LYS C 3 483 ? 80.401  -21.287 21.839  1.00 49.14  ? 483  LYS A CB    1 
ATOM   4449 C  CG    . LYS C 3 483 ? 79.892  -21.594 20.440  1.00 57.38  ? 483  LYS A CG    1 
ATOM   4450 C  CD    . LYS C 3 483 ? 80.030  -20.363 19.539  1.00 62.80  ? 483  LYS A CD    1 
ATOM   4451 C  CE    . LYS C 3 483 ? 79.573  -20.627 18.109  1.00 65.31  ? 483  LYS A CE    1 
ATOM   4452 N  NZ    . LYS C 3 483 ? 79.959  -19.505 17.193  1.00 66.53  ? 483  LYS A NZ    1 
ATOM   4453 N  N     . GLU C 3 484 ? 80.142  -21.399 24.940  1.00 42.72  ? 484  GLU A N     1 
ATOM   4454 C  CA    . GLU C 3 484 ? 80.560  -20.892 26.235  1.00 46.63  ? 484  GLU A CA    1 
ATOM   4455 C  C     . GLU C 3 484 ? 81.004  -21.992 27.203  1.00 46.58  ? 484  GLU A C     1 
ATOM   4456 O  O     . GLU C 3 484 ? 82.029  -21.863 27.867  1.00 47.40  ? 484  GLU A O     1 
ATOM   4457 C  CB    . GLU C 3 484 ? 79.427  -20.066 26.850  1.00 54.39  ? 484  GLU A CB    1 
ATOM   4458 C  CG    . GLU C 3 484 ? 79.880  -19.064 27.898  1.00 67.57  ? 484  GLU A CG    1 
ATOM   4459 C  CD    . GLU C 3 484 ? 78.735  -18.220 28.430  1.00 78.16  ? 484  GLU A CD    1 
ATOM   4460 O  OE1   . GLU C 3 484 ? 77.567  -18.532 28.107  1.00 77.24  ? 484  GLU A OE1   1 
ATOM   4461 O  OE2   . GLU C 3 484 ? 79.006  -17.250 29.172  1.00 87.80  ? 484  GLU A OE2   1 
ATOM   4462 N  N     . HIS C 3 485 ? 80.239  -23.074 27.280  1.00 44.38  ? 485  HIS A N     1 
ATOM   4463 C  CA    . HIS C 3 485 ? 80.567  -24.166 28.178  1.00 42.26  ? 485  HIS A CA    1 
ATOM   4464 C  C     . HIS C 3 485 ? 81.677  -25.044 27.638  1.00 42.67  ? 485  HIS A C     1 
ATOM   4465 O  O     . HIS C 3 485 ? 82.359  -25.731 28.389  1.00 40.97  ? 485  HIS A O     1 
ATOM   4466 C  CB    . HIS C 3 485 ? 79.303  -24.961 28.480  1.00 42.70  ? 485  HIS A CB    1 
ATOM   4467 C  CG    . HIS C 3 485 ? 78.309  -24.184 29.286  1.00 47.82  ? 485  HIS A CG    1 
ATOM   4468 N  ND1   . HIS C 3 485 ? 78.504  -23.889 30.619  1.00 48.83  ? 485  HIS A ND1   1 
ATOM   4469 C  CD2   . HIS C 3 485 ? 77.168  -23.551 28.928  1.00 49.07  ? 485  HIS A CD2   1 
ATOM   4470 C  CE1   . HIS C 3 485 ? 77.530  -23.106 31.045  1.00 46.12  ? 485  HIS A CE1   1 
ATOM   4471 N  NE2   . HIS C 3 485 ? 76.706  -22.886 30.037  1.00 47.17  ? 485  HIS A NE2   1 
ATOM   4472 N  N     . LYS C 3 486 ? 81.867  -25.014 26.327  1.00 49.25  ? 486  LYS A N     1 
ATOM   4473 C  CA    . LYS C 3 486 ? 82.947  -25.774 25.708  1.00 52.00  ? 486  LYS A CA    1 
ATOM   4474 C  C     . LYS C 3 486 ? 84.206  -25.171 26.326  1.00 48.14  ? 486  LYS A C     1 
ATOM   4475 O  O     . LYS C 3 486 ? 84.997  -25.860 26.963  1.00 47.52  ? 486  LYS A O     1 
ATOM   4476 C  CB    . LYS C 3 486 ? 82.961  -25.530 24.203  1.00 56.68  ? 486  LYS A CB    1 
ATOM   4477 C  CG    . LYS C 3 486 ? 83.853  -26.477 23.435  1.00 59.40  ? 486  LYS A CG    1 
ATOM   4478 C  CD    . LYS C 3 486 ? 83.192  -27.827 23.282  1.00 61.48  ? 486  LYS A CD    1 
ATOM   4479 C  CE    . LYS C 3 486 ? 81.912  -27.699 22.474  1.00 67.73  ? 486  LYS A CE    1 
ATOM   4480 N  NZ    . LYS C 3 486 ? 81.256  -29.007 22.201  1.00 70.47  ? 486  LYS A NZ    1 
ATOM   4481 N  N     . GLY C 3 487 ? 84.355  -23.862 26.140  1.00 47.02  ? 487  GLY A N     1 
ATOM   4482 C  CA    . GLY C 3 487 ? 85.492  -23.138 26.673  1.00 43.09  ? 487  GLY A CA    1 
ATOM   4483 C  C     . GLY C 3 487 ? 85.765  -23.407 28.140  1.00 41.33  ? 487  GLY A C     1 
ATOM   4484 O  O     . GLY C 3 487 ? 86.900  -23.658 28.513  1.00 47.60  ? 487  GLY A O     1 
ATOM   4485 N  N     . TYR C 3 488 ? 84.732  -23.342 28.974  1.00 38.18  ? 488  TYR A N     1 
ATOM   4486 C  CA    . TYR C 3 488 ? 84.888  -23.586 30.399  1.00 37.63  ? 488  TYR A CA    1 
ATOM   4487 C  C     . TYR C 3 488 ? 85.453  -24.990 30.603  1.00 40.95  ? 488  TYR A C     1 
ATOM   4488 O  O     . TYR C 3 488 ? 86.358  -25.192 31.404  1.00 38.45  ? 488  TYR A O     1 
ATOM   4489 C  CB    . TYR C 3 488 ? 83.538  -23.477 31.121  1.00 38.11  ? 488  TYR A CB    1 
ATOM   4490 C  CG    . TYR C 3 488 ? 82.867  -22.123 31.069  1.00 44.77  ? 488  TYR A CG    1 
ATOM   4491 C  CD1   . TYR C 3 488 ? 83.599  -20.959 30.836  1.00 41.61  ? 488  TYR A CD1   1 
ATOM   4492 C  CD2   . TYR C 3 488 ? 81.489  -22.007 31.268  1.00 45.06  ? 488  TYR A CD2   1 
ATOM   4493 C  CE1   . TYR C 3 488 ? 82.978  -19.716 30.796  1.00 46.15  ? 488  TYR A CE1   1 
ATOM   4494 C  CE2   . TYR C 3 488 ? 80.856  -20.770 31.232  1.00 37.74  ? 488  TYR A CE2   1 
ATOM   4495 C  CZ    . TYR C 3 488 ? 81.607  -19.627 30.991  1.00 44.91  ? 488  TYR A CZ    1 
ATOM   4496 O  OH    . TYR C 3 488 ? 80.996  -18.394 30.912  1.00 38.23  ? 488  TYR A OH    1 
ATOM   4497 N  N     . MET C 3 489 ? 84.903  -25.955 29.868  1.00 41.54  ? 489  MET A N     1 
ATOM   4498 C  CA    . MET C 3 489 ? 85.327  -27.339 29.961  1.00 38.66  ? 489  MET A CA    1 
ATOM   4499 C  C     . MET C 3 489 ? 86.787  -27.487 29.564  1.00 42.40  ? 489  MET A C     1 
ATOM   4500 O  O     . MET C 3 489 ? 87.589  -28.009 30.336  1.00 49.04  ? 489  MET A O     1 
ATOM   4501 C  CB    . MET C 3 489 ? 84.466  -28.214 29.063  1.00 42.17  ? 489  MET A CB    1 
ATOM   4502 C  CG    . MET C 3 489 ? 84.816  -29.688 29.132  1.00 49.04  ? 489  MET A CG    1 
ATOM   4503 S  SD    . MET C 3 489 ? 84.138  -30.587 27.732  1.00 64.31  ? 489  MET A SD    1 
ATOM   4504 C  CE    . MET C 3 489 ? 85.366  -30.114 26.453  1.00 59.63  ? 489  MET A CE    1 
ATOM   4505 N  N     . LEU C 3 490 ? 87.133  -27.037 28.361  1.00 36.94  ? 490  LEU A N     1 
ATOM   4506 C  CA    . LEU C 3 490 ? 88.506  -27.121 27.885  1.00 34.22  ? 490  LEU A CA    1 
ATOM   4507 C  C     . LEU C 3 490 ? 89.467  -26.433 28.825  1.00 37.28  ? 490  LEU A C     1 
ATOM   4508 O  O     . LEU C 3 490 ? 90.549  -26.945 29.081  1.00 44.64  ? 490  LEU A O     1 
ATOM   4509 C  CB    . LEU C 3 490 ? 88.647  -26.493 26.496  1.00 32.88  ? 490  LEU A CB    1 
ATOM   4510 C  CG    . LEU C 3 490 ? 88.075  -27.324 25.344  1.00 34.91  ? 490  LEU A CG    1 
ATOM   4511 C  CD1   . LEU C 3 490 ? 88.238  -26.592 24.021  1.00 30.57  ? 490  LEU A CD1   1 
ATOM   4512 C  CD2   . LEU C 3 490 ? 88.766  -28.671 25.320  1.00 27.65  ? 490  LEU A CD2   1 
ATOM   4513 N  N     . ALA C 3 491 ? 89.087  -25.273 29.344  1.00 33.51  ? 491  ALA A N     1 
ATOM   4514 C  CA    . ALA C 3 491 ? 89.974  -24.553 30.246  1.00 35.84  ? 491  ALA A CA    1 
ATOM   4515 C  C     . ALA C 3 491 ? 90.128  -25.256 31.598  1.00 40.90  ? 491  ALA A C     1 
ATOM   4516 O  O     . ALA C 3 491 ? 91.175  -25.152 32.232  1.00 41.23  ? 491  ALA A O     1 
ATOM   4517 C  CB    . ALA C 3 491 ? 89.483  -23.131 30.440  1.00 26.47  ? 491  ALA A CB    1 
ATOM   4518 N  N     . ALA C 3 492 ? 89.096  -25.979 32.031  1.00 41.56  ? 492  ALA A N     1 
ATOM   4519 C  CA    . ALA C 3 492 ? 89.149  -26.680 33.307  1.00 43.77  ? 492  ALA A CA    1 
ATOM   4520 C  C     . ALA C 3 492 ? 89.919  -27.983 33.146  1.00 43.87  ? 492  ALA A C     1 
ATOM   4521 O  O     . ALA C 3 492 ? 90.638  -28.413 34.043  1.00 44.84  ? 492  ALA A O     1 
ATOM   4522 C  CB    . ALA C 3 492 ? 87.733  -26.964 33.816  1.00 40.81  ? 492  ALA A CB    1 
ATOM   4523 N  N     . GLN C 3 493 ? 89.751  -28.613 31.994  1.00 44.58  ? 493  GLN A N     1 
ATOM   4524 C  CA    . GLN C 3 493 ? 90.429  -29.865 31.708  1.00 51.10  ? 493  GLN A CA    1 
ATOM   4525 C  C     . GLN C 3 493 ? 91.889  -29.562 31.416  1.00 50.61  ? 493  GLN A C     1 
ATOM   4526 O  O     . GLN C 3 493 ? 92.735  -30.447 31.416  1.00 58.19  ? 493  GLN A O     1 
ATOM   4527 C  CB    . GLN C 3 493 ? 89.732  -30.573 30.533  1.00 55.45  ? 493  GLN A CB    1 
ATOM   4528 C  CG    . GLN C 3 493 ? 90.594  -31.473 29.689  1.00 62.14  ? 493  GLN A CG    1 
ATOM   4529 C  CD    . GLN C 3 493 ? 91.130  -30.743 28.481  1.00 78.29  ? 493  GLN A CD    1 
ATOM   4530 O  OE1   . GLN C 3 493 ? 90.368  -30.374 27.579  1.00 81.79  ? 493  GLN A OE1   1 
ATOM   4531 N  NE2   . GLN C 3 493 ? 92.447  -30.513 28.457  1.00 80.92  ? 493  GLN A NE2   1 
ATOM   4532 N  N     . ARG C 3 494 ? 92.178  -28.287 31.215  1.00 47.94  ? 494  ARG A N     1 
ATOM   4533 C  CA    . ARG C 3 494 ? 93.528  -27.838 30.932  1.00 43.76  ? 494  ARG A CA    1 
ATOM   4534 C  C     . ARG C 3 494 ? 94.207  -27.443 32.248  1.00 45.05  ? 494  ARG A C     1 
ATOM   4535 O  O     . ARG C 3 494 ? 95.367  -27.774 32.477  1.00 42.31  ? 494  ARG A O     1 
ATOM   4536 C  CB    . ARG C 3 494 ? 93.463  -26.639 29.991  1.00 45.60  ? 494  ARG A CB    1 
ATOM   4537 C  CG    . ARG C 3 494 ? 94.441  -26.647 28.841  1.00 35.83  ? 494  ARG A CG    1 
ATOM   4538 C  CD    . ARG C 3 494 ? 94.399  -25.299 28.135  1.00 43.55  ? 494  ARG A CD    1 
ATOM   4539 N  NE    . ARG C 3 494 ? 93.314  -25.207 27.168  1.00 42.43  ? 494  ARG A NE    1 
ATOM   4540 C  CZ    . ARG C 3 494 ? 92.394  -24.250 27.152  1.00 43.48  ? 494  ARG A CZ    1 
ATOM   4541 N  NH1   . ARG C 3 494 ? 92.413  -23.290 28.062  1.00 40.62  ? 494  ARG A NH1   1 
ATOM   4542 N  NH2   . ARG C 3 494 ? 91.460  -24.249 26.211  1.00 45.57  ? 494  ARG A NH2   1 
ATOM   4543 N  N     . ASN C 3 495 ? 93.480  -26.726 33.107  1.00 45.12  ? 495  ASN A N     1 
ATOM   4544 C  CA    . ASN C 3 495 ? 94.020  -26.317 34.405  1.00 44.64  ? 495  ASN A CA    1 
ATOM   4545 C  C     . ASN C 3 495 ? 94.258  -27.593 35.208  1.00 46.47  ? 495  ASN A C     1 
ATOM   4546 O  O     . ASN C 3 495 ? 95.019  -27.601 36.177  1.00 45.98  ? 495  ASN A O     1 
ATOM   4547 C  CB    . ASN C 3 495 ? 93.037  -25.427 35.183  1.00 40.21  ? 495  ASN A CB    1 
ATOM   4548 C  CG    . ASN C 3 495 ? 92.987  -23.993 34.670  1.00 43.01  ? 495  ASN A CG    1 
ATOM   4549 O  OD1   . ASN C 3 495 ? 94.016  -23.391 34.380  1.00 39.20  ? 495  ASN A OD1   1 
ATOM   4550 N  ND2   . ASN C 3 495 ? 91.776  -23.433 34.581  1.00 36.89  ? 495  ASN A ND2   1 
ATOM   4551 N  N     . GLY C 3 496 ? 93.588  -28.664 34.791  1.00 44.05  ? 496  GLY A N     1 
ATOM   4552 C  CA    . GLY C 3 496 ? 93.718  -29.937 35.470  1.00 47.20  ? 496  GLY A CA    1 
ATOM   4553 C  C     . GLY C 3 496 ? 95.087  -30.553 35.287  1.00 53.42  ? 496  GLY A C     1 
ATOM   4554 O  O     . GLY C 3 496 ? 95.659  -31.110 36.229  1.00 54.38  ? 496  GLY A O     1 
ATOM   4555 N  N     . GLU C 3 497 ? 95.617  -30.448 34.072  1.00 55.25  ? 497  GLU A N     1 
ATOM   4556 C  CA    . GLU C 3 497 ? 96.926  -30.999 33.766  1.00 53.18  ? 497  GLU A CA    1 
ATOM   4557 C  C     . GLU C 3 497 ? 97.962  -30.231 34.570  1.00 48.88  ? 497  GLU A C     1 
ATOM   4558 O  O     . GLU C 3 497 ? 98.774  -30.828 35.273  1.00 47.77  ? 497  GLU A O     1 
ATOM   4559 C  CB    . GLU C 3 497 ? 97.206  -30.884 32.270  1.00 54.44  ? 497  GLU A CB    1 
ATOM   4560 C  CG    . GLU C 3 497 ? 96.086  -31.429 31.402  1.00 66.39  ? 497  GLU A CG    1 
ATOM   4561 C  CD    . GLU C 3 497 ? 95.784  -32.903 31.653  1.00 72.63  ? 497  GLU A CD    1 
ATOM   4562 O  OE1   . GLU C 3 497 ? 96.615  -33.757 31.281  1.00 76.99  ? 497  GLU A OE1   1 
ATOM   4563 O  OE2   . GLU C 3 497 ? 94.712  -33.204 32.223  1.00 80.23  ? 497  GLU A OE2   1 
ATOM   4564 N  N     . ILE C 3 498 ? 97.916  -28.906 34.482  1.00 40.52  ? 498  ILE A N     1 
ATOM   4565 C  CA    . ILE C 3 498 ? 98.853  -28.077 35.224  1.00 38.06  ? 498  ILE A CA    1 
ATOM   4566 C  C     . ILE C 3 498 ? 98.978  -28.598 36.648  1.00 43.49  ? 498  ILE A C     1 
ATOM   4567 O  O     . ILE C 3 498 ? 100.076 -28.899 37.117  1.00 46.49  ? 498  ILE A O     1 
ATOM   4568 C  CB    . ILE C 3 498 ? 98.401  -26.591 35.271  1.00 35.39  ? 498  ILE A CB    1 
ATOM   4569 C  CG1   . ILE C 3 498 ? 98.703  -25.900 33.938  1.00 36.67  ? 498  ILE A CG1   1 
ATOM   4570 C  CG2   . ILE C 3 498 ? 99.160  -25.831 36.347  1.00 29.85  ? 498  ILE A CG2   1 
ATOM   4571 C  CD1   . ILE C 3 498 ? 98.047  -26.544 32.731  1.00 52.81  ? 498  ILE A CD1   1 
ATOM   4572 N  N     . ILE C 3 499 ? 97.839  -28.723 37.320  1.00 48.64  ? 499  ILE A N     1 
ATOM   4573 C  CA    . ILE C 3 499 ? 97.802  -29.190 38.700  1.00 46.59  ? 499  ILE A CA    1 
ATOM   4574 C  C     . ILE C 3 499 ? 98.442  -30.566 38.908  1.00 47.48  ? 499  ILE A C     1 
ATOM   4575 O  O     . ILE C 3 499 ? 99.156  -30.779 39.886  1.00 47.74  ? 499  ILE A O     1 
ATOM   4576 C  CB    . ILE C 3 499 ? 96.341  -29.206 39.240  1.00 43.95  ? 499  ILE A CB    1 
ATOM   4577 C  CG1   . ILE C 3 499 ? 95.782  -27.782 39.238  1.00 41.35  ? 499  ILE A CG1   1 
ATOM   4578 C  CG2   . ILE C 3 499 ? 96.297  -29.788 40.658  1.00 37.79  ? 499  ILE A CG2   1 
ATOM   4579 C  CD1   . ILE C 3 499 ? 94.413  -27.653 39.862  1.00 45.55  ? 499  ILE A CD1   1 
ATOM   4580 N  N     . LYS C 3 500 ? 98.195  -31.501 38.001  1.00 46.43  ? 500  LYS A N     1 
ATOM   4581 C  CA    . LYS C 3 500 ? 98.778  -32.825 38.146  1.00 53.39  ? 500  LYS A CA    1 
ATOM   4582 C  C     . LYS C 3 500 ? 100.301 -32.771 38.083  1.00 58.96  ? 500  LYS A C     1 
ATOM   4583 O  O     . LYS C 3 500 ? 100.990 -33.333 38.946  1.00 62.41  ? 500  LYS A O     1 
ATOM   4584 C  CB    . LYS C 3 500 ? 98.226  -33.770 37.076  1.00 50.48  ? 500  LYS A CB    1 
ATOM   4585 C  CG    . LYS C 3 500 ? 96.772  -34.136 37.308  1.00 50.18  ? 500  LYS A CG    1 
ATOM   4586 C  CD    . LYS C 3 500 ? 96.442  -35.503 36.737  1.00 55.06  ? 500  LYS A CD    1 
ATOM   4587 C  CE    . LYS C 3 500 ? 96.317  -35.498 35.220  1.00 57.24  ? 500  LYS A CE    1 
ATOM   4588 N  NZ    . LYS C 3 500 ? 95.044  -34.878 34.780  1.00 58.68  ? 500  LYS A NZ    1 
ATOM   4589 N  N     . GLU C 3 501 ? 100.826 -32.100 37.064  1.00 60.32  ? 501  GLU A N     1 
ATOM   4590 C  CA    . GLU C 3 501 ? 102.262 -31.965 36.916  1.00 58.74  ? 501  GLU A CA    1 
ATOM   4591 C  C     . GLU C 3 501 ? 102.838 -31.446 38.215  1.00 55.92  ? 501  GLU A C     1 
ATOM   4592 O  O     . GLU C 3 501 ? 103.894 -31.893 38.652  1.00 64.73  ? 501  GLU A O     1 
ATOM   4593 C  CB    . GLU C 3 501 ? 102.584 -31.000 35.786  1.00 64.50  ? 501  GLU A CB    1 
ATOM   4594 C  CG    . GLU C 3 501 ? 102.319 -31.587 34.428  1.00 78.84  ? 501  GLU A CG    1 
ATOM   4595 C  CD    . GLU C 3 501 ? 103.373 -32.614 34.039  1.00 86.98  ? 501  GLU A CD    1 
ATOM   4596 O  OE1   . GLU C 3 501 ? 104.532 -32.202 33.803  1.00 87.92  ? 501  GLU A OE1   1 
ATOM   4597 O  OE2   . GLU C 3 501 ? 103.043 -33.823 33.984  1.00 89.48  ? 501  GLU A OE2   1 
ATOM   4598 N  N     . ALA C 3 502 ? 102.143 -30.506 38.841  1.00 47.66  ? 502  ALA A N     1 
ATOM   4599 C  CA    . ALA C 3 502 ? 102.613 -29.956 40.106  1.00 48.58  ? 502  ALA A CA    1 
ATOM   4600 C  C     . ALA C 3 502 ? 102.739 -31.077 41.143  1.00 53.76  ? 502  ALA A C     1 
ATOM   4601 O  O     . ALA C 3 502 ? 103.718 -31.136 41.885  1.00 53.58  ? 502  ALA A O     1 
ATOM   4602 C  CB    . ALA C 3 502 ? 101.651 -28.893 40.597  1.00 40.01  ? 502  ALA A CB    1 
ATOM   4603 N  N     . LEU C 3 503 ? 101.744 -31.966 41.167  1.00 57.81  ? 503  LEU A N     1 
ATOM   4604 C  CA    . LEU C 3 503 ? 101.694 -33.094 42.090  1.00 58.03  ? 503  LEU A CA    1 
ATOM   4605 C  C     . LEU C 3 503 ? 102.902 -34.033 42.015  1.00 62.69  ? 503  LEU A C     1 
ATOM   4606 O  O     . LEU C 3 503 ? 103.149 -34.813 42.944  1.00 61.59  ? 503  LEU A O     1 
ATOM   4607 C  CB    . LEU C 3 503 ? 100.417 -33.899 41.853  1.00 57.46  ? 503  LEU A CB    1 
ATOM   4608 C  CG    . LEU C 3 503 ? 99.103  -33.346 42.406  1.00 58.19  ? 503  LEU A CG    1 
ATOM   4609 C  CD1   . LEU C 3 503 ? 97.951  -34.193 41.897  1.00 55.26  ? 503  LEU A CD1   1 
ATOM   4610 C  CD2   . LEU C 3 503 ? 99.137  -33.347 43.925  1.00 54.65  ? 503  LEU A CD2   1 
ATOM   4611 N  N     . HIS C 3 504 ? 103.642 -33.983 40.911  1.00 62.17  ? 504  HIS A N     1 
ATOM   4612 C  CA    . HIS C 3 504 ? 104.819 -34.831 40.781  1.00 58.94  ? 504  HIS A CA    1 
ATOM   4613 C  C     . HIS C 3 504 ? 105.914 -34.343 41.735  1.00 59.72  ? 504  HIS A C     1 
ATOM   4614 O  O     . HIS C 3 504 ? 106.870 -35.063 42.016  1.00 64.91  ? 504  HIS A O     1 
ATOM   4615 C  CB    . HIS C 3 504 ? 105.336 -34.828 39.343  1.00 54.39  ? 504  HIS A CB    1 
ATOM   4616 C  CG    . HIS C 3 504 ? 104.581 -35.741 38.421  1.00 62.98  ? 504  HIS A CG    1 
ATOM   4617 N  ND1   . HIS C 3 504 ? 104.071 -36.958 38.826  1.00 67.15  ? 504  HIS A ND1   1 
ATOM   4618 C  CD2   . HIS C 3 504 ? 104.306 -35.640 37.097  1.00 59.83  ? 504  HIS A CD2   1 
ATOM   4619 C  CE1   . HIS C 3 504 ? 103.515 -37.568 37.792  1.00 60.21  ? 504  HIS A CE1   1 
ATOM   4620 N  NE2   . HIS C 3 504 ? 103.645 -36.791 36.732  1.00 56.75  ? 504  HIS A NE2   1 
ATOM   4621 N  N     . ASN C 3 505 ? 105.765 -33.119 42.234  1.00 56.13  ? 505  ASN A N     1 
ATOM   4622 C  CA    . ASN C 3 505 ? 106.728 -32.536 43.163  1.00 53.36  ? 505  ASN A CA    1 
ATOM   4623 C  C     . ASN C 3 505 ? 106.022 -31.772 44.270  1.00 51.41  ? 505  ASN A C     1 
ATOM   4624 O  O     . ASN C 3 505 ? 106.116 -30.550 44.357  1.00 45.94  ? 505  ASN A O     1 
ATOM   4625 C  CB    . ASN C 3 505 ? 107.702 -31.612 42.421  1.00 61.62  ? 505  ASN A CB    1 
ATOM   4626 C  CG    . ASN C 3 505 ? 108.957 -32.343 41.953  1.00 71.77  ? 505  ASN A CG    1 
ATOM   4627 O  OD1   . ASN C 3 505 ? 109.827 -32.695 42.760  1.00 73.78  ? 505  ASN A OD1   1 
ATOM   4628 N  ND2   . ASN C 3 505 ? 109.051 -32.587 40.647  1.00 73.84  ? 505  ASN A ND2   1 
ATOM   4629 N  N     . PRO C 3 506 ? 105.292 -32.493 45.130  1.00 53.02  ? 506  PRO A N     1 
ATOM   4630 C  CA    . PRO C 3 506 ? 104.551 -31.917 46.252  1.00 55.40  ? 506  PRO A CA    1 
ATOM   4631 C  C     . PRO C 3 506 ? 105.530 -31.262 47.214  1.00 57.27  ? 506  PRO A C     1 
ATOM   4632 O  O     . PRO C 3 506 ? 106.622 -31.790 47.438  1.00 61.29  ? 506  PRO A O     1 
ATOM   4633 C  CB    . PRO C 3 506 ? 103.874 -33.137 46.878  1.00 55.74  ? 506  PRO A CB    1 
ATOM   4634 C  CG    . PRO C 3 506 ? 103.721 -34.070 45.731  1.00 58.23  ? 506  PRO A CG    1 
ATOM   4635 C  CD    . PRO C 3 506 ? 105.049 -33.940 45.045  1.00 54.88  ? 506  PRO A CD    1 
ATOM   4636 N  N     . ASN C 3 507 ? 105.148 -30.120 47.777  1.00 58.49  ? 507  ASN A N     1 
ATOM   4637 C  CA    . ASN C 3 507 ? 106.006 -29.415 48.724  1.00 64.24  ? 507  ASN A CA    1 
ATOM   4638 C  C     . ASN C 3 507 ? 105.661 -29.768 50.166  1.00 67.74  ? 507  ASN A C     1 
ATOM   4639 O  O     . ASN C 3 507 ? 104.549 -29.521 50.627  1.00 70.14  ? 507  ASN A O     1 
ATOM   4640 C  CB    . ASN C 3 507 ? 105.901 -27.905 48.516  1.00 64.38  ? 507  ASN A CB    1 
ATOM   4641 C  CG    . ASN C 3 507 ? 106.506 -27.463 47.194  1.00 66.80  ? 507  ASN A CG    1 
ATOM   4642 O  OD1   . ASN C 3 507 ? 106.128 -27.956 46.126  1.00 69.92  ? 507  ASN A OD1   1 
ATOM   4643 N  ND2   . ASN C 3 507 ? 107.450 -26.531 47.259  1.00 64.90  ? 507  ASN A ND2   1 
ATOM   4644 N  N     . LEU C 3 508 ? 106.629 -30.360 50.863  1.00 70.83  ? 508  LEU A N     1 
ATOM   4645 C  CA    . LEU C 3 508 ? 106.476 -30.767 52.259  1.00 71.67  ? 508  LEU A CA    1 
ATOM   4646 C  C     . LEU C 3 508 ? 106.191 -29.546 53.120  1.00 73.58  ? 508  LEU A C     1 
ATOM   4647 O  O     . LEU C 3 508 ? 107.103 -28.813 53.501  1.00 75.30  ? 508  LEU A O     1 
ATOM   4648 C  CB    . LEU C 3 508 ? 107.752 -31.457 52.752  1.00 65.87  ? 508  LEU A CB    1 
ATOM   4649 C  CG    . LEU C 3 508 ? 108.218 -32.635 51.894  1.00 68.27  ? 508  LEU A CG    1 
ATOM   4650 C  CD1   . LEU C 3 508 ? 109.594 -33.088 52.358  1.00 64.73  ? 508  LEU A CD1   1 
ATOM   4651 C  CD2   . LEU C 3 508 ? 107.197 -33.768 51.971  1.00 59.91  ? 508  LEU A CD2   1 
ATOM   4652 N  N     . SER C 3 509 ? 104.917 -29.337 53.425  1.00 75.69  ? 509  SER A N     1 
ATOM   4653 C  CA    . SER C 3 509 ? 104.504 -28.201 54.231  1.00 79.57  ? 509  SER A CA    1 
ATOM   4654 C  C     . SER C 3 509 ? 102.992 -28.191 54.417  1.00 80.34  ? 509  SER A C     1 
ATOM   4655 O  O     . SER C 3 509 ? 102.306 -29.159 54.070  1.00 81.20  ? 509  SER A O     1 
ATOM   4656 C  CB    . SER C 3 509 ? 104.969 -26.893 53.572  1.00 80.29  ? 509  SER A CB    1 
ATOM   4657 O  OG    . SER C 3 509 ? 104.948 -26.986 52.156  1.00 82.68  ? 509  SER A OG    1 
ATOM   4658 N  N     . VAL C 3 510 ? 102.479 -27.098 54.977  1.00 78.84  ? 510  VAL A N     1 
ATOM   4659 C  CA    . VAL C 3 510 ? 101.046 -26.961 55.214  1.00 75.90  ? 510  VAL A CA    1 
ATOM   4660 C  C     . VAL C 3 510 ? 100.538 -25.652 54.642  1.00 76.52  ? 510  VAL A C     1 
ATOM   4661 O  O     . VAL C 3 510 ? 100.963 -24.566 55.043  1.00 74.81  ? 510  VAL A O     1 
ATOM   4662 C  CB    . VAL C 3 510 ? 100.720 -27.017 56.714  1.00 71.61  ? 510  VAL A CB    1 
ATOM   4663 C  CG1   . VAL C 3 510 ? 101.282 -28.301 57.298  1.00 67.07  ? 510  VAL A CG1   1 
ATOM   4664 C  CG2   . VAL C 3 510 ? 101.280 -25.792 57.423  1.00 66.80  ? 510  VAL A CG2   1 
ATOM   4665 N  N     . ASP C 3 511 ? 99.617  -25.770 53.697  1.00 77.70  ? 511  ASP A N     1 
ATOM   4666 C  CA    . ASP C 3 511 ? 99.057  -24.608 53.035  1.00 80.17  ? 511  ASP A CA    1 
ATOM   4667 C  C     . ASP C 3 511 ? 97.570  -24.774 52.790  1.00 81.14  ? 511  ASP A C     1 
ATOM   4668 O  O     . ASP C 3 511 ? 96.905  -25.563 53.464  1.00 82.38  ? 511  ASP A O     1 
ATOM   4669 C  CB    . ASP C 3 511 ? 99.798  -24.371 51.713  1.00 81.16  ? 511  ASP A CB    1 
ATOM   4670 C  CG    . ASP C 3 511 ? 100.149 -25.677 50.986  1.00 81.47  ? 511  ASP A CG    1 
ATOM   4671 O  OD1   . ASP C 3 511 ? 99.495  -26.711 51.232  1.00 82.17  ? 511  ASP A OD1   1 
ATOM   4672 O  OD2   . ASP C 3 511 ? 101.083 -25.663 50.159  1.00 79.60  ? 511  ASP A OD2   1 
ATOM   4673 N  N     . GLU C 3 512 ? 97.059  -24.033 51.813  1.00 81.04  ? 512  GLU A N     1 
ATOM   4674 C  CA    . GLU C 3 512 ? 95.643  -24.069 51.471  1.00 79.60  ? 512  GLU A CA    1 
ATOM   4675 C  C     . GLU C 3 512 ? 95.389  -24.172 49.970  1.00 76.76  ? 512  GLU A C     1 
ATOM   4676 O  O     . GLU C 3 512 ? 96.251  -23.827 49.155  1.00 77.89  ? 512  GLU A O     1 
ATOM   4677 C  CB    . GLU C 3 512 ? 94.966  -22.806 52.000  1.00 80.99  ? 512  GLU A CB    1 
ATOM   4678 C  CG    . GLU C 3 512 ? 94.695  -22.833 53.480  1.00 85.52  ? 512  GLU A CG    1 
ATOM   4679 C  CD    . GLU C 3 512 ? 93.535  -23.744 53.822  1.00 90.59  ? 512  GLU A CD    1 
ATOM   4680 O  OE1   . GLU C 3 512 ? 92.406  -23.440 53.388  1.00 91.95  ? 512  GLU A OE1   1 
ATOM   4681 O  OE2   . GLU C 3 512 ? 93.750  -24.762 54.514  1.00 97.53  ? 512  GLU A OE2   1 
ATOM   4682 N  N     . PRO C 3 513 ? 94.203  -24.670 49.587  1.00 70.42  ? 513  PRO A N     1 
ATOM   4683 C  CA    . PRO C 3 513 ? 93.867  -24.791 48.169  1.00 67.81  ? 513  PRO A CA    1 
ATOM   4684 C  C     . PRO C 3 513 ? 93.478  -23.391 47.702  1.00 65.46  ? 513  PRO A C     1 
ATOM   4685 O  O     . PRO C 3 513 ? 92.625  -22.736 48.303  1.00 65.07  ? 513  PRO A O     1 
ATOM   4686 C  CB    . PRO C 3 513 ? 92.699  -25.771 48.175  1.00 71.44  ? 513  PRO A CB    1 
ATOM   4687 C  CG    . PRO C 3 513 ? 92.026  -25.467 49.477  1.00 72.04  ? 513  PRO A CG    1 
ATOM   4688 C  CD    . PRO C 3 513 ? 93.189  -25.325 50.429  1.00 69.71  ? 513  PRO A CD    1 
ATOM   4689 N  N     . LEU C 3 514 ? 94.133  -22.931 46.643  1.00 62.95  ? 514  LEU A N     1 
ATOM   4690 C  CA    . LEU C 3 514 ? 93.905  -21.598 46.106  1.00 58.09  ? 514  LEU A CA    1 
ATOM   4691 C  C     . LEU C 3 514 ? 92.463  -21.296 45.713  1.00 60.13  ? 514  LEU A C     1 
ATOM   4692 O  O     . LEU C 3 514 ? 91.724  -22.170 45.246  1.00 63.62  ? 514  LEU A O     1 
ATOM   4693 C  CB    . LEU C 3 514 ? 94.838  -21.354 44.913  1.00 53.00  ? 514  LEU A CB    1 
ATOM   4694 C  CG    . LEU C 3 514 ? 96.330  -21.180 45.227  1.00 55.68  ? 514  LEU A CG    1 
ATOM   4695 C  CD1   . LEU C 3 514 ? 96.858  -22.453 45.859  1.00 62.13  ? 514  LEU A CD1   1 
ATOM   4696 C  CD2   . LEU C 3 514 ? 97.129  -20.872 43.968  1.00 53.87  ? 514  LEU A CD2   1 
ATOM   4697 N  N     . ASP C 3 515 ? 92.087  -20.036 45.917  1.00 61.89  ? 515  ASP A N     1 
ATOM   4698 C  CA    . ASP C 3 515 ? 90.760  -19.517 45.605  1.00 63.93  ? 515  ASP A CA    1 
ATOM   4699 C  C     . ASP C 3 515 ? 90.763  -19.012 44.162  1.00 61.89  ? 515  ASP A C     1 
ATOM   4700 O  O     . ASP C 3 515 ? 91.007  -17.830 43.896  1.00 57.92  ? 515  ASP A O     1 
ATOM   4701 C  CB    . ASP C 3 515 ? 90.431  -18.369 46.562  1.00 73.44  ? 515  ASP A CB    1 
ATOM   4702 C  CG    . ASP C 3 515 ? 88.970  -17.956 46.516  1.00 81.54  ? 515  ASP A CG    1 
ATOM   4703 O  OD1   . ASP C 3 515 ? 88.520  -17.441 45.469  1.00 84.90  ? 515  ASP A OD1   1 
ATOM   4704 O  OD2   . ASP C 3 515 ? 88.272  -18.148 47.537  1.00 85.67  ? 515  ASP A OD2   1 
ATOM   4705 N  N     . VAL C 3 516 ? 90.486  -19.919 43.232  1.00 61.08  ? 516  VAL A N     1 
ATOM   4706 C  CA    . VAL C 3 516 ? 90.481  -19.585 41.812  1.00 61.63  ? 516  VAL A CA    1 
ATOM   4707 C  C     . VAL C 3 516 ? 89.275  -20.154 41.066  1.00 58.30  ? 516  VAL A C     1 
ATOM   4708 O  O     . VAL C 3 516 ? 88.653  -21.125 41.502  1.00 60.39  ? 516  VAL A O     1 
ATOM   4709 C  CB    . VAL C 3 516 ? 91.787  -20.101 41.115  1.00 64.96  ? 516  VAL A CB    1 
ATOM   4710 C  CG1   . VAL C 3 516 ? 93.013  -19.372 41.678  1.00 65.32  ? 516  VAL A CG1   1 
ATOM   4711 C  CG2   . VAL C 3 516 ? 91.926  -21.616 41.307  1.00 55.95  ? 516  VAL A CG2   1 
ATOM   4712 N  N     . ASP C 3 517 ? 88.947  -19.540 39.937  1.00 52.74  ? 517  ASP A N     1 
ATOM   4713 C  CA    . ASP C 3 517 ? 87.839  -20.014 39.121  1.00 51.18  ? 517  ASP A CA    1 
ATOM   4714 C  C     . ASP C 3 517 ? 88.415  -20.888 37.997  1.00 46.51  ? 517  ASP A C     1 
ATOM   4715 O  O     . ASP C 3 517 ? 89.113  -20.405 37.110  1.00 43.86  ? 517  ASP A O     1 
ATOM   4716 C  CB    . ASP C 3 517 ? 87.066  -18.818 38.557  1.00 55.21  ? 517  ASP A CB    1 
ATOM   4717 C  CG    . ASP C 3 517 ? 85.880  -19.235 37.715  1.00 61.62  ? 517  ASP A CG    1 
ATOM   4718 O  OD1   . ASP C 3 517 ? 85.349  -20.347 37.952  1.00 63.93  ? 517  ASP A OD1   1 
ATOM   4719 O  OD2   . ASP C 3 517 ? 85.472  -18.448 36.828  1.00 60.13  ? 517  ASP A OD2   1 
ATOM   4720 N  N     . TYR C 3 518 ? 88.109  -22.177 38.036  1.00 44.67  ? 518  TYR A N     1 
ATOM   4721 C  CA    . TYR C 3 518 ? 88.634  -23.112 37.046  1.00 41.02  ? 518  TYR A CA    1 
ATOM   4722 C  C     . TYR C 3 518 ? 88.140  -23.008 35.592  1.00 41.62  ? 518  TYR A C     1 
ATOM   4723 O  O     . TYR C 3 518 ? 88.741  -23.616 34.707  1.00 41.71  ? 518  TYR A O     1 
ATOM   4724 C  CB    . TYR C 3 518 ? 88.445  -24.536 37.551  1.00 36.87  ? 518  TYR A CB    1 
ATOM   4725 C  CG    . TYR C 3 518 ? 89.059  -24.757 38.913  1.00 40.13  ? 518  TYR A CG    1 
ATOM   4726 C  CD1   . TYR C 3 518 ? 88.427  -24.322 40.073  1.00 41.63  ? 518  TYR A CD1   1 
ATOM   4727 C  CD2   . TYR C 3 518 ? 90.290  -25.379 39.041  1.00 45.81  ? 518  TYR A CD2   1 
ATOM   4728 C  CE1   . TYR C 3 518 ? 89.021  -24.508 41.336  1.00 47.57  ? 518  TYR A CE1   1 
ATOM   4729 C  CE2   . TYR C 3 518 ? 90.891  -25.566 40.284  1.00 43.87  ? 518  TYR A CE2   1 
ATOM   4730 C  CZ    . TYR C 3 518 ? 90.263  -25.135 41.428  1.00 47.58  ? 518  TYR A CZ    1 
ATOM   4731 O  OH    . TYR C 3 518 ? 90.886  -25.332 42.653  1.00 39.84  ? 518  TYR A OH    1 
ATOM   4732 N  N     . ARG C 3 519 ? 87.078  -22.242 35.334  1.00 40.38  ? 519  ARG A N     1 
ATOM   4733 C  CA    . ARG C 3 519 ? 86.565  -22.107 33.967  1.00 42.51  ? 519  ARG A CA    1 
ATOM   4734 C  C     . ARG C 3 519 ? 87.502  -21.266 33.136  1.00 41.66  ? 519  ARG A C     1 
ATOM   4735 O  O     . ARG C 3 519 ? 87.325  -21.127 31.921  1.00 40.87  ? 519  ARG A O     1 
ATOM   4736 C  CB    . ARG C 3 519 ? 85.178  -21.444 33.928  1.00 43.60  ? 519  ARG A CB    1 
ATOM   4737 C  CG    . ARG C 3 519 ? 84.013  -22.314 34.354  1.00 44.50  ? 519  ARG A CG    1 
ATOM   4738 C  CD    . ARG C 3 519 ? 83.666  -22.064 35.794  1.00 48.31  ? 519  ARG A CD    1 
ATOM   4739 N  NE    . ARG C 3 519 ? 83.467  -20.642 36.061  1.00 50.81  ? 519  ARG A NE    1 
ATOM   4740 C  CZ    . ARG C 3 519 ? 82.500  -19.900 35.529  1.00 50.81  ? 519  ARG A CZ    1 
ATOM   4741 N  NH1   . ARG C 3 519 ? 81.634  -20.443 34.689  1.00 51.93  ? 519  ARG A NH1   1 
ATOM   4742 N  NH2   . ARG C 3 519 ? 82.385  -18.618 35.853  1.00 40.44  ? 519  ARG A NH2   1 
ATOM   4743 N  N     . PHE C 3 520 ? 88.491  -20.680 33.795  1.00 42.36  ? 520  PHE A N     1 
ATOM   4744 C  CA    . PHE C 3 520 ? 89.442  -19.843 33.084  1.00 46.83  ? 520  PHE A CA    1 
ATOM   4745 C  C     . PHE C 3 520 ? 90.879  -20.275 33.311  1.00 48.88  ? 520  PHE A C     1 
ATOM   4746 O  O     . PHE C 3 520 ? 91.280  -20.561 34.448  1.00 48.55  ? 520  PHE A O     1 
ATOM   4747 C  CB    . PHE C 3 520 ? 89.221  -18.392 33.498  1.00 43.16  ? 520  PHE A CB    1 
ATOM   4748 C  CG    . PHE C 3 520 ? 87.816  -17.923 33.254  1.00 47.16  ? 520  PHE A CG    1 
ATOM   4749 C  CD1   . PHE C 3 520 ? 87.415  -17.524 31.981  1.00 45.58  ? 520  PHE A CD1   1 
ATOM   4750 C  CD2   . PHE C 3 520 ? 86.865  -17.965 34.275  1.00 45.40  ? 520  PHE A CD2   1 
ATOM   4751 C  CE1   . PHE C 3 520 ? 86.088  -17.178 31.724  1.00 46.82  ? 520  PHE A CE1   1 
ATOM   4752 C  CE2   . PHE C 3 520 ? 85.530  -17.622 34.031  1.00 41.77  ? 520  PHE A CE2   1 
ATOM   4753 C  CZ    . PHE C 3 520 ? 85.140  -17.229 32.753  1.00 43.11  ? 520  PHE A CZ    1 
ATOM   4754 N  N     . ASP C 3 521 ? 91.637  -20.344 32.214  1.00 48.63  ? 521  ASP A N     1 
ATOM   4755 C  CA    . ASP C 3 521 ? 93.049  -20.730 32.253  1.00 48.11  ? 521  ASP A CA    1 
ATOM   4756 C  C     . ASP C 3 521 ? 93.777  -19.969 33.358  1.00 50.65  ? 521  ASP A C     1 
ATOM   4757 O  O     . ASP C 3 521 ? 93.697  -18.742 33.417  1.00 45.80  ? 521  ASP A O     1 
ATOM   4758 C  CB    . ASP C 3 521 ? 93.715  -20.424 30.912  1.00 49.01  ? 521  ASP A CB    1 
ATOM   4759 C  CG    . ASP C 3 521 ? 93.270  -21.369 29.800  1.00 57.40  ? 521  ASP A CG    1 
ATOM   4760 O  OD1   . ASP C 3 521 ? 93.644  -22.569 29.836  1.00 52.52  ? 521  ASP A OD1   1 
ATOM   4761 O  OD2   . ASP C 3 521 ? 92.547  -20.901 28.888  1.00 61.17  ? 521  ASP A OD2   1 
ATOM   4762 N  N     . PHE C 3 522 ? 94.480  -20.700 34.226  1.00 50.25  ? 522  PHE A N     1 
ATOM   4763 C  CA    . PHE C 3 522 ? 95.222  -20.106 35.341  1.00 51.28  ? 522  PHE A CA    1 
ATOM   4764 C  C     . PHE C 3 522 ? 96.253  -19.059 34.938  1.00 51.31  ? 522  PHE A C     1 
ATOM   4765 O  O     . PHE C 3 522 ? 96.963  -19.220 33.947  1.00 50.51  ? 522  PHE A O     1 
ATOM   4766 C  CB    . PHE C 3 522 ? 95.980  -21.175 36.127  1.00 53.71  ? 522  PHE A CB    1 
ATOM   4767 C  CG    . PHE C 3 522 ? 95.112  -22.115 36.885  1.00 49.49  ? 522  PHE A CG    1 
ATOM   4768 C  CD1   . PHE C 3 522 ? 93.946  -21.679 37.489  1.00 47.80  ? 522  PHE A CD1   1 
ATOM   4769 C  CD2   . PHE C 3 522 ? 95.497  -23.436 37.040  1.00 49.69  ? 522  PHE A CD2   1 
ATOM   4770 C  CE1   . PHE C 3 522 ? 93.177  -22.549 38.237  1.00 48.54  ? 522  PHE A CE1   1 
ATOM   4771 C  CE2   . PHE C 3 522 ? 94.741  -24.313 37.783  1.00 51.36  ? 522  PHE A CE2   1 
ATOM   4772 C  CZ    . PHE C 3 522 ? 93.577  -23.872 38.384  1.00 52.85  ? 522  PHE A CZ    1 
ATOM   4773 N  N     . SER C 3 523 ? 96.356  -18.005 35.737  1.00 46.68  ? 523  SER A N     1 
ATOM   4774 C  CA    . SER C 3 523 ? 97.321  -16.948 35.482  1.00 51.22  ? 523  SER A CA    1 
ATOM   4775 C  C     . SER C 3 523 ? 98.730  -17.421 35.871  1.00 55.83  ? 523  SER A C     1 
ATOM   4776 O  O     . SER C 3 523 ? 98.885  -18.398 36.609  1.00 57.15  ? 523  SER A O     1 
ATOM   4777 C  CB    . SER C 3 523 ? 96.974  -15.708 36.309  1.00 48.22  ? 523  SER A CB    1 
ATOM   4778 O  OG    . SER C 3 523 ? 97.202  -15.937 37.692  1.00 40.80  ? 523  SER A OG    1 
ATOM   4779 N  N     . ASP C 3 524 ? 99.749  -16.729 35.368  1.00 54.19  ? 524  ASP A N     1 
ATOM   4780 C  CA    . ASP C 3 524 ? 101.132 -17.048 35.690  1.00 57.22  ? 524  ASP A CA    1 
ATOM   4781 C  C     . ASP C 3 524 ? 101.354 -16.929 37.212  1.00 58.32  ? 524  ASP A C     1 
ATOM   4782 O  O     . ASP C 3 524 ? 102.155 -17.664 37.798  1.00 54.92  ? 524  ASP A O     1 
ATOM   4783 C  CB    . ASP C 3 524 ? 102.067 -16.096 34.934  1.00 62.47  ? 524  ASP A CB    1 
ATOM   4784 C  CG    . ASP C 3 524 ? 101.632 -14.637 35.040  1.00 67.98  ? 524  ASP A CG    1 
ATOM   4785 O  OD1   . ASP C 3 524 ? 100.888 -14.293 35.992  1.00 68.84  ? 524  ASP A OD1   1 
ATOM   4786 O  OD2   . ASP C 3 524 ? 102.041 -13.832 34.171  1.00 66.47  ? 524  ASP A OD2   1 
ATOM   4787 N  N     . GLU C 3 525 ? 100.638 -16.008 37.851  1.00 57.96  ? 525  GLU A N     1 
ATOM   4788 C  CA    . GLU C 3 525 ? 100.757 -15.841 39.292  1.00 59.91  ? 525  GLU A CA    1 
ATOM   4789 C  C     . GLU C 3 525 ? 100.306 -17.132 39.964  1.00 59.96  ? 525  GLU A C     1 
ATOM   4790 O  O     . GLU C 3 525 ? 101.026 -17.696 40.783  1.00 63.94  ? 525  GLU A O     1 
ATOM   4791 C  CB    . GLU C 3 525 ? 99.885  -14.680 39.771  1.00 66.04  ? 525  GLU A CB    1 
ATOM   4792 C  CG    . GLU C 3 525 ? 100.237 -13.341 39.153  1.00 75.95  ? 525  GLU A CG    1 
ATOM   4793 C  CD    . GLU C 3 525 ? 101.592 -12.826 39.606  1.00 82.47  ? 525  GLU A CD    1 
ATOM   4794 O  OE1   . GLU C 3 525 ? 102.317 -13.564 40.317  1.00 84.53  ? 525  GLU A OE1   1 
ATOM   4795 O  OE2   . GLU C 3 525 ? 101.927 -11.679 39.241  1.00 85.62  ? 525  GLU A OE2   1 
ATOM   4796 N  N     . ILE C 3 526 ? 99.110  -17.595 39.606  1.00 56.68  ? 526  ILE A N     1 
ATOM   4797 C  CA    . ILE C 3 526 ? 98.560  -18.826 40.155  1.00 53.59  ? 526  ILE A CA    1 
ATOM   4798 C  C     . ILE C 3 526 ? 99.503  -20.000 39.882  1.00 56.02  ? 526  ILE A C     1 
ATOM   4799 O  O     . ILE C 3 526 ? 99.898  -20.713 40.813  1.00 54.43  ? 526  ILE A O     1 
ATOM   4800 C  CB    . ILE C 3 526 ? 97.171  -19.139 39.538  1.00 54.28  ? 526  ILE A CB    1 
ATOM   4801 C  CG1   . ILE C 3 526 ? 96.174  -18.067 39.960  1.00 55.65  ? 526  ILE A CG1   1 
ATOM   4802 C  CG2   . ILE C 3 526 ? 96.678  -20.518 39.974  1.00 50.05  ? 526  ILE A CG2   1 
ATOM   4803 C  CD1   . ILE C 3 526 ? 96.022  -17.959 41.464  1.00 60.49  ? 526  ILE A CD1   1 
ATOM   4804 N  N     . LYS C 3 527 ? 99.857  -20.192 38.608  1.00 53.43  ? 527  LYS A N     1 
ATOM   4805 C  CA    . LYS C 3 527 ? 100.750 -21.274 38.196  1.00 55.71  ? 527  LYS A CA    1 
ATOM   4806 C  C     . LYS C 3 527 ? 101.988 -21.315 39.090  1.00 59.73  ? 527  LYS A C     1 
ATOM   4807 O  O     . LYS C 3 527 ? 102.455 -22.389 39.483  1.00 60.26  ? 527  LYS A O     1 
ATOM   4808 C  CB    . LYS C 3 527 ? 101.178 -21.076 36.737  1.00 52.31  ? 527  LYS A CB    1 
ATOM   4809 C  CG    . LYS C 3 527 ? 100.043 -21.162 35.752  1.00 55.92  ? 527  LYS A CG    1 
ATOM   4810 C  CD    . LYS C 3 527 ? 100.213 -20.181 34.595  1.00 61.96  ? 527  LYS A CD    1 
ATOM   4811 C  CE    . LYS C 3 527 ? 100.956 -20.794 33.420  1.00 64.81  ? 527  LYS A CE    1 
ATOM   4812 N  NZ    . LYS C 3 527 ? 101.275 -19.768 32.365  1.00 66.26  ? 527  LYS A NZ    1 
ATOM   4813 N  N     . GLU C 3 528 ? 102.504 -20.134 39.416  1.00 64.02  ? 528  GLU A N     1 
ATOM   4814 C  CA    . GLU C 3 528 ? 103.692 -20.019 40.248  1.00 67.71  ? 528  GLU A CA    1 
ATOM   4815 C  C     . GLU C 3 528 ? 103.465 -20.438 41.705  1.00 66.20  ? 528  GLU A C     1 
ATOM   4816 O  O     . GLU C 3 528 ? 104.403 -20.866 42.375  1.00 69.56  ? 528  GLU A O     1 
ATOM   4817 C  CB    . GLU C 3 528 ? 104.237 -18.587 40.187  1.00 73.66  ? 528  GLU A CB    1 
ATOM   4818 C  CG    . GLU C 3 528 ? 105.758 -18.505 40.149  1.00 84.13  ? 528  GLU A CG    1 
ATOM   4819 C  CD    . GLU C 3 528 ? 106.355 -19.309 38.991  1.00 91.95  ? 528  GLU A CD    1 
ATOM   4820 O  OE1   . GLU C 3 528 ? 105.908 -19.099 37.842  1.00 94.99  ? 528  GLU A OE1   1 
ATOM   4821 O  OE2   . GLU C 3 528 ? 107.264 -20.141 39.230  1.00 94.05  ? 528  GLU A OE2   1 
ATOM   4822 N  N     . LYS C 3 529 ? 102.236 -20.319 42.203  1.00 62.78  ? 529  LYS A N     1 
ATOM   4823 C  CA    . LYS C 3 529 ? 101.951 -20.726 43.575  1.00 57.60  ? 529  LYS A CA    1 
ATOM   4824 C  C     . LYS C 3 529 ? 101.728 -22.231 43.586  1.00 58.43  ? 529  LYS A C     1 
ATOM   4825 O  O     . LYS C 3 529 ? 102.146 -22.931 44.507  1.00 56.33  ? 529  LYS A O     1 
ATOM   4826 C  CB    . LYS C 3 529 ? 100.709 -20.023 44.106  1.00 54.61  ? 529  LYS A CB    1 
ATOM   4827 C  CG    . LYS C 3 529 ? 100.845 -18.525 44.221  1.00 58.98  ? 529  LYS A CG    1 
ATOM   4828 C  CD    . LYS C 3 529 ? 99.601  -17.945 44.862  1.00 66.48  ? 529  LYS A CD    1 
ATOM   4829 C  CE    . LYS C 3 529 ? 99.592  -16.428 44.828  1.00 71.70  ? 529  LYS A CE    1 
ATOM   4830 N  NZ    . LYS C 3 529 ? 98.343  -15.890 45.446  1.00 78.85  ? 529  LYS A NZ    1 
ATOM   4831 N  N     . ILE C 3 530 ? 101.070 -22.726 42.546  1.00 56.71  ? 530  ILE A N     1 
ATOM   4832 C  CA    . ILE C 3 530 ? 100.802 -24.152 42.418  1.00 59.27  ? 530  ILE A CA    1 
ATOM   4833 C  C     . ILE C 3 530 ? 102.057 -24.961 42.764  1.00 63.19  ? 530  ILE A C     1 
ATOM   4834 O  O     . ILE C 3 530 ? 102.021 -25.868 43.594  1.00 59.70  ? 530  ILE A O     1 
ATOM   4835 C  CB    . ILE C 3 530 ? 100.381 -24.503 40.968  1.00 60.19  ? 530  ILE A CB    1 
ATOM   4836 C  CG1   . ILE C 3 530 ? 99.107  -23.742 40.587  1.00 60.84  ? 530  ILE A CG1   1 
ATOM   4837 C  CG2   . ILE C 3 530 ? 100.182 -25.999 40.818  1.00 58.71  ? 530  ILE A CG2   1 
ATOM   4838 C  CD1   . ILE C 3 530 ? 97.898  -24.087 41.406  1.00 55.01  ? 530  ILE A CD1   1 
ATOM   4839 N  N     . LYS C 3 531 ? 103.169 -24.610 42.120  1.00 65.92  ? 531  LYS A N     1 
ATOM   4840 C  CA    . LYS C 3 531 ? 104.445 -25.290 42.315  1.00 62.73  ? 531  LYS A CA    1 
ATOM   4841 C  C     . LYS C 3 531 ? 104.935 -25.395 43.763  1.00 65.17  ? 531  LYS A C     1 
ATOM   4842 O  O     . LYS C 3 531 ? 105.747 -26.265 44.087  1.00 63.19  ? 531  LYS A O     1 
ATOM   4843 C  CB    . LYS C 3 531 ? 105.509 -24.605 41.472  1.00 55.33  ? 531  LYS A CB    1 
ATOM   4844 C  CG    . LYS C 3 531 ? 105.193 -24.572 39.998  1.00 58.08  ? 531  LYS A CG    1 
ATOM   4845 C  CD    . LYS C 3 531 ? 106.275 -23.802 39.265  1.00 67.38  ? 531  LYS A CD    1 
ATOM   4846 C  CE    . LYS C 3 531 ? 105.957 -23.595 37.795  1.00 66.40  ? 531  LYS A CE    1 
ATOM   4847 N  NZ    . LYS C 3 531 ? 107.032 -22.777 37.158  1.00 69.93  ? 531  LYS A NZ    1 
ATOM   4848 N  N     . LYS C 3 532 ? 104.454 -24.520 44.639  1.00 65.83  ? 532  LYS A N     1 
ATOM   4849 C  CA    . LYS C 3 532 ? 104.895 -24.583 46.021  1.00 66.00  ? 532  LYS A CA    1 
ATOM   4850 C  C     . LYS C 3 532 ? 103.867 -25.216 46.956  1.00 65.87  ? 532  LYS A C     1 
ATOM   4851 O  O     . LYS C 3 532 ? 104.202 -25.587 48.079  1.00 71.30  ? 532  LYS A O     1 
ATOM   4852 C  CB    . LYS C 3 532 ? 105.277 -23.190 46.532  1.00 68.10  ? 532  LYS A CB    1 
ATOM   4853 C  CG    . LYS C 3 532 ? 106.207 -23.227 47.749  1.00 76.58  ? 532  LYS A CG    1 
ATOM   4854 C  CD    . LYS C 3 532 ? 105.610 -22.622 49.039  1.00 78.93  ? 532  LYS A CD    1 
ATOM   4855 C  CE    . LYS C 3 532 ? 104.687 -23.576 49.828  1.00 79.07  ? 532  LYS A CE    1 
ATOM   4856 N  NZ    . LYS C 3 532 ? 103.262 -23.612 49.363  1.00 67.29  ? 532  LYS A NZ    1 
ATOM   4857 N  N     . LEU C 3 533 ? 102.625 -25.365 46.501  1.00 63.97  ? 533  LEU A N     1 
ATOM   4858 C  CA    . LEU C 3 533 ? 101.590 -25.955 47.355  1.00 60.68  ? 533  LEU A CA    1 
ATOM   4859 C  C     . LEU C 3 533 ? 101.945 -27.361 47.828  1.00 60.68  ? 533  LEU A C     1 
ATOM   4860 O  O     . LEU C 3 533 ? 102.827 -28.013 47.257  1.00 56.66  ? 533  LEU A O     1 
ATOM   4861 C  CB    . LEU C 3 533 ? 100.223 -25.984 46.642  1.00 56.75  ? 533  LEU A CB    1 
ATOM   4862 C  CG    . LEU C 3 533 ? 99.347  -24.720 46.670  1.00 54.73  ? 533  LEU A CG    1 
ATOM   4863 C  CD1   . LEU C 3 533 ? 99.050  -24.314 48.102  1.00 48.25  ? 533  LEU A CD1   1 
ATOM   4864 C  CD2   . LEU C 3 533 ? 100.046 -23.587 45.972  1.00 58.98  ? 533  LEU A CD2   1 
ATOM   4865 N  N     . SER C 3 534 ? 101.256 -27.811 48.880  1.00 60.33  ? 534  SER A N     1 
ATOM   4866 C  CA    . SER C 3 534 ? 101.467 -29.138 49.449  1.00 63.04  ? 534  SER A CA    1 
ATOM   4867 C  C     . SER C 3 534 ? 100.668 -30.148 48.637  1.00 63.36  ? 534  SER A C     1 
ATOM   4868 O  O     . SER C 3 534 ? 100.057 -29.790 47.630  1.00 66.71  ? 534  SER A O     1 
ATOM   4869 C  CB    . SER C 3 534 ? 101.000 -29.179 50.903  1.00 63.15  ? 534  SER A CB    1 
ATOM   4870 O  OG    . SER C 3 534 ? 99.589  -29.104 50.994  1.00 69.67  ? 534  SER A OG    1 
ATOM   4871 N  N     . ALA C 3 535 ? 100.671 -31.404 49.070  1.00 61.54  ? 535  ALA A N     1 
ATOM   4872 C  CA    . ALA C 3 535 ? 99.932  -32.447 48.366  1.00 61.32  ? 535  ALA A CA    1 
ATOM   4873 C  C     . ALA C 3 535 ? 98.449  -32.426 48.731  1.00 63.55  ? 535  ALA A C     1 
ATOM   4874 O  O     . ALA C 3 535 ? 97.598  -32.785 47.914  1.00 63.17  ? 535  ALA A O     1 
ATOM   4875 C  CB    . ALA C 3 535 ? 100.512 -33.810 48.687  1.00 57.44  ? 535  ALA A CB    1 
ATOM   4876 N  N     . LYS C 3 536 ? 98.142  -32.028 49.963  1.00 63.69  ? 536  LYS A N     1 
ATOM   4877 C  CA    . LYS C 3 536 ? 96.753  -31.958 50.403  1.00 63.17  ? 536  LYS A CA    1 
ATOM   4878 C  C     . LYS C 3 536 ? 96.059  -30.949 49.493  1.00 60.20  ? 536  LYS A C     1 
ATOM   4879 O  O     . LYS C 3 536 ? 95.283  -31.318 48.615  1.00 59.93  ? 536  LYS A O     1 
ATOM   4880 C  CB    . LYS C 3 536 ? 96.674  -31.470 51.852  1.00 65.90  ? 536  LYS A CB    1 
ATOM   4881 C  CG    . LYS C 3 536 ? 95.806  -32.320 52.766  1.00 68.48  ? 536  LYS A CG    1 
ATOM   4882 C  CD    . LYS C 3 536 ? 94.997  -31.452 53.725  1.00 70.94  ? 536  LYS A CD    1 
ATOM   4883 C  CE    . LYS C 3 536 ? 93.712  -30.933 53.062  1.00 80.90  ? 536  LYS A CE    1 
ATOM   4884 N  NZ    . LYS C 3 536 ? 93.920  -30.252 51.738  1.00 81.90  ? 536  LYS A NZ    1 
ATOM   4885 N  N     . SER C 3 537 ? 96.367  -29.674 49.709  1.00 53.78  ? 537  SER A N     1 
ATOM   4886 C  CA    . SER C 3 537 ? 95.801  -28.591 48.919  1.00 57.41  ? 537  SER A CA    1 
ATOM   4887 C  C     . SER C 3 537 ? 95.727  -28.915 47.435  1.00 57.38  ? 537  SER A C     1 
ATOM   4888 O  O     . SER C 3 537 ? 94.666  -28.814 46.826  1.00 60.03  ? 537  SER A O     1 
ATOM   4889 C  CB    . SER C 3 537 ? 96.622  -27.320 49.111  1.00 52.80  ? 537  SER A CB    1 
ATOM   4890 O  OG    . SER C 3 537 ? 96.586  -26.920 50.463  1.00 52.94  ? 537  SER A OG    1 
ATOM   4891 N  N     . LEU C 3 538 ? 96.860  -29.291 46.857  1.00 56.84  ? 538  LEU A N     1 
ATOM   4892 C  CA    . LEU C 3 538 ? 96.918  -29.620 45.439  1.00 56.88  ? 538  LEU A CA    1 
ATOM   4893 C  C     . LEU C 3 538 ? 95.858  -30.654 45.034  1.00 55.83  ? 538  LEU A C     1 
ATOM   4894 O  O     . LEU C 3 538 ? 95.090  -30.417 44.106  1.00 57.81  ? 538  LEU A O     1 
ATOM   4895 C  CB    . LEU C 3 538 ? 98.321  -30.127 45.080  1.00 59.02  ? 538  LEU A CB    1 
ATOM   4896 C  CG    . LEU C 3 538 ? 99.063  -29.435 43.931  1.00 51.50  ? 538  LEU A CG    1 
ATOM   4897 C  CD1   . LEU C 3 538 ? 99.228  -27.952 44.212  1.00 45.68  ? 538  LEU A CD1   1 
ATOM   4898 C  CD2   . LEU C 3 538 ? 100.409 -30.095 43.757  1.00 55.48  ? 538  LEU A CD2   1 
ATOM   4899 N  N     . ASN C 3 539 ? 95.822  -31.792 45.726  1.00 54.49  ? 539  ASN A N     1 
ATOM   4900 C  CA    . ASN C 3 539 ? 94.847  -32.851 45.447  1.00 54.31  ? 539  ASN A CA    1 
ATOM   4901 C  C     . ASN C 3 539 ? 93.417  -32.347 45.534  1.00 55.56  ? 539  ASN A C     1 
ATOM   4902 O  O     . ASN C 3 539 ? 92.511  -32.884 44.889  1.00 55.61  ? 539  ASN A O     1 
ATOM   4903 C  CB    . ASN C 3 539 ? 95.020  -33.992 46.436  1.00 52.76  ? 539  ASN A CB    1 
ATOM   4904 C  CG    . ASN C 3 539 ? 95.997  -35.016 45.959  1.00 53.64  ? 539  ASN A CG    1 
ATOM   4905 O  OD1   . ASN C 3 539 ? 95.630  -35.963 45.267  1.00 56.33  ? 539  ASN A OD1   1 
ATOM   4906 N  ND2   . ASN C 3 539 ? 97.259  -34.830 46.306  1.00 61.31  ? 539  ASN A ND2   1 
ATOM   4907 N  N     . GLU C 3 540 ? 93.225  -31.328 46.363  1.00 53.82  ? 540  GLU A N     1 
ATOM   4908 C  CA    . GLU C 3 540 ? 91.927  -30.710 46.545  1.00 53.35  ? 540  GLU A CA    1 
ATOM   4909 C  C     . GLU C 3 540 ? 91.618  -29.946 45.262  1.00 50.17  ? 540  GLU A C     1 
ATOM   4910 O  O     . GLU C 3 540 ? 90.592  -30.163 44.628  1.00 50.17  ? 540  GLU A O     1 
ATOM   4911 C  CB    . GLU C 3 540 ? 91.974  -29.758 47.746  1.00 57.42  ? 540  GLU A CB    1 
ATOM   4912 C  CG    . GLU C 3 540 ? 90.690  -28.984 48.011  1.00 68.49  ? 540  GLU A CG    1 
ATOM   4913 C  CD    . GLU C 3 540 ? 89.469  -29.881 48.057  1.00 72.53  ? 540  GLU A CD    1 
ATOM   4914 O  OE1   . GLU C 3 540 ? 89.567  -30.989 48.625  1.00 72.78  ? 540  GLU A OE1   1 
ATOM   4915 O  OE2   . GLU C 3 540 ? 88.411  -29.476 47.529  1.00 76.51  ? 540  GLU A OE2   1 
ATOM   4916 N  N     . MET C 3 541 ? 92.534  -29.070 44.873  1.00 47.09  ? 541  MET A N     1 
ATOM   4917 C  CA    . MET C 3 541 ? 92.364  -28.284 43.666  1.00 44.15  ? 541  MET A CA    1 
ATOM   4918 C  C     . MET C 3 541 ? 92.098  -29.167 42.458  1.00 40.52  ? 541  MET A C     1 
ATOM   4919 O  O     . MET C 3 541 ? 91.378  -28.767 41.552  1.00 41.71  ? 541  MET A O     1 
ATOM   4920 C  CB    . MET C 3 541 ? 93.596  -27.408 43.427  1.00 41.51  ? 541  MET A CB    1 
ATOM   4921 C  CG    . MET C 3 541 ? 93.679  -26.230 44.401  1.00 50.22  ? 541  MET A CG    1 
ATOM   4922 S  SD    . MET C 3 541 ? 94.971  -25.043 44.001  1.00 51.91  ? 541  MET A SD    1 
ATOM   4923 C  CE    . MET C 3 541 ? 94.342  -24.380 42.374  1.00 48.49  ? 541  MET A CE    1 
ATOM   4924 N  N     . LEU C 3 542 ? 92.655  -30.371 42.447  1.00 35.64  ? 542  LEU A N     1 
ATOM   4925 C  CA    . LEU C 3 542 ? 92.439  -31.256 41.317  1.00 44.37  ? 542  LEU A CA    1 
ATOM   4926 C  C     . LEU C 3 542 ? 91.006  -31.738 41.325  1.00 44.18  ? 542  LEU A C     1 
ATOM   4927 O  O     . LEU C 3 542 ? 90.392  -31.919 40.273  1.00 40.65  ? 542  LEU A O     1 
ATOM   4928 C  CB    . LEU C 3 542 ? 93.403  -32.451 41.345  1.00 48.76  ? 542  LEU A CB    1 
ATOM   4929 C  CG    . LEU C 3 542 ? 93.273  -33.476 40.201  1.00 51.43  ? 542  LEU A CG    1 
ATOM   4930 C  CD1   . LEU C 3 542 ? 94.500  -34.360 40.147  1.00 50.84  ? 542  LEU A CD1   1 
ATOM   4931 C  CD2   . LEU C 3 542 ? 92.034  -34.326 40.410  1.00 59.48  ? 542  LEU A CD2   1 
ATOM   4932 N  N     . PHE C 3 543 ? 90.475  -31.969 42.517  1.00 47.45  ? 543  PHE A N     1 
ATOM   4933 C  CA    . PHE C 3 543 ? 89.096  -32.408 42.638  1.00 48.91  ? 543  PHE A CA    1 
ATOM   4934 C  C     . PHE C 3 543 ? 88.218  -31.317 42.016  1.00 47.89  ? 543  PHE A C     1 
ATOM   4935 O  O     . PHE C 3 543 ? 87.495  -31.549 41.049  1.00 51.43  ? 543  PHE A O     1 
ATOM   4936 C  CB    . PHE C 3 543 ? 88.729  -32.582 44.110  1.00 50.78  ? 543  PHE A CB    1 
ATOM   4937 C  CG    . PHE C 3 543 ? 87.319  -33.036 44.326  1.00 61.72  ? 543  PHE A CG    1 
ATOM   4938 C  CD1   . PHE C 3 543 ? 86.896  -34.265 43.829  1.00 62.16  ? 543  PHE A CD1   1 
ATOM   4939 C  CD2   . PHE C 3 543 ? 86.406  -32.232 45.013  1.00 64.12  ? 543  PHE A CD2   1 
ATOM   4940 C  CE1   . PHE C 3 543 ? 85.593  -34.689 44.009  1.00 64.30  ? 543  PHE A CE1   1 
ATOM   4941 C  CE2   . PHE C 3 543 ? 85.095  -32.647 45.199  1.00 60.36  ? 543  PHE A CE2   1 
ATOM   4942 C  CZ    . PHE C 3 543 ? 84.688  -33.879 44.696  1.00 66.21  ? 543  PHE A CZ    1 
ATOM   4943 N  N     . ARG C 3 544 ? 88.315  -30.122 42.583  1.00 41.15  ? 544  ARG A N     1 
ATOM   4944 C  CA    . ARG C 3 544 ? 87.559  -28.975 42.140  1.00 41.80  ? 544  ARG A CA    1 
ATOM   4945 C  C     . ARG C 3 544 ? 87.754  -28.613 40.667  1.00 45.74  ? 544  ARG A C     1 
ATOM   4946 O  O     . ARG C 3 544 ? 86.867  -28.044 40.033  1.00 45.53  ? 544  ARG A O     1 
ATOM   4947 C  CB    . ARG C 3 544 ? 87.922  -27.781 43.019  1.00 41.08  ? 544  ARG A CB    1 
ATOM   4948 C  CG    . ARG C 3 544 ? 87.624  -27.991 44.496  1.00 37.45  ? 544  ARG A CG    1 
ATOM   4949 C  CD    . ARG C 3 544 ? 88.155  -26.816 45.300  1.00 42.27  ? 544  ARG A CD    1 
ATOM   4950 N  NE    . ARG C 3 544 ? 87.933  -26.949 46.740  1.00 40.57  ? 544  ARG A NE    1 
ATOM   4951 C  CZ    . ARG C 3 544 ? 88.367  -26.064 47.637  1.00 47.61  ? 544  ARG A CZ    1 
ATOM   4952 N  NH1   . ARG C 3 544 ? 89.045  -24.996 47.239  1.00 40.70  ? 544  ARG A NH1   1 
ATOM   4953 N  NH2   . ARG C 3 544 ? 88.108  -26.230 48.927  1.00 51.85  ? 544  ARG A NH2   1 
ATOM   4954 N  N     . ALA C 3 545 ? 88.919  -28.922 40.118  1.00 47.53  ? 545  ALA A N     1 
ATOM   4955 C  CA    . ALA C 3 545 ? 89.167  -28.596 38.722  1.00 48.82  ? 545  ALA A CA    1 
ATOM   4956 C  C     . ALA C 3 545 ? 88.486  -29.669 37.895  1.00 48.13  ? 545  ALA A C     1 
ATOM   4957 O  O     . ALA C 3 545 ? 87.981  -29.416 36.799  1.00 50.74  ? 545  ALA A O     1 
ATOM   4958 C  CB    . ALA C 3 545 ? 90.676  -28.558 38.439  1.00 47.18  ? 545  ALA A CB    1 
ATOM   4959 N  N     . GLN C 3 546 ? 88.460  -30.868 38.451  1.00 47.15  ? 546  GLN A N     1 
ATOM   4960 C  CA    . GLN C 3 546 ? 87.846  -31.993 37.788  1.00 49.97  ? 546  GLN A CA    1 
ATOM   4961 C  C     . GLN C 3 546 ? 86.326  -31.826 37.864  1.00 51.80  ? 546  GLN A C     1 
ATOM   4962 O  O     . GLN C 3 546 ? 85.610  -32.152 36.913  1.00 53.54  ? 546  GLN A O     1 
ATOM   4963 C  CB    . GLN C 3 546 ? 88.303  -33.279 38.471  1.00 54.10  ? 546  GLN A CB    1 
ATOM   4964 C  CG    . GLN C 3 546 ? 88.404  -34.475 37.551  1.00 67.33  ? 546  GLN A CG    1 
ATOM   4965 C  CD    . GLN C 3 546 ? 89.311  -35.567 38.111  1.00 75.70  ? 546  GLN A CD    1 
ATOM   4966 O  OE1   . GLN C 3 546 ? 90.510  -35.345 38.332  1.00 64.46  ? 546  GLN A OE1   1 
ATOM   4967 N  NE2   . GLN C 3 546 ? 88.742  -36.753 38.342  1.00 81.61  ? 546  GLN A NE2   1 
ATOM   4968 N  N     . ARG C 3 547 ? 85.834  -31.298 38.985  1.00 50.82  ? 547  ARG A N     1 
ATOM   4969 C  CA    . ARG C 3 547 ? 84.398  -31.082 39.160  1.00 46.75  ? 547  ARG A CA    1 
ATOM   4970 C  C     . ARG C 3 547 ? 83.907  -30.077 38.121  1.00 44.60  ? 547  ARG A C     1 
ATOM   4971 O  O     . ARG C 3 547 ? 82.892  -30.282 37.457  1.00 47.35  ? 547  ARG A O     1 
ATOM   4972 C  CB    . ARG C 3 547 ? 84.102  -30.542 40.564  1.00 48.52  ? 547  ARG A CB    1 
ATOM   4973 C  CG    . ARG C 3 547 ? 82.659  -30.068 40.767  1.00 54.65  ? 547  ARG A CG    1 
ATOM   4974 C  CD    . ARG C 3 547 ? 82.556  -29.069 41.923  1.00 64.83  ? 547  ARG A CD    1 
ATOM   4975 N  NE    . ARG C 3 547 ? 82.710  -29.717 43.226  1.00 72.74  ? 547  ARG A NE    1 
ATOM   4976 C  CZ    . ARG C 3 547 ? 83.230  -29.134 44.305  1.00 75.39  ? 547  ARG A CZ    1 
ATOM   4977 N  NH1   . ARG C 3 547 ? 83.657  -27.874 44.265  1.00 76.74  ? 547  ARG A NH1   1 
ATOM   4978 N  NH2   . ARG C 3 547 ? 83.343  -29.825 45.426  1.00 81.27  ? 547  ARG A NH2   1 
ATOM   4979 N  N     . THR C 3 548 ? 84.655  -28.997 37.979  1.00 35.87  ? 548  THR A N     1 
ATOM   4980 C  CA    . THR C 3 548 ? 84.315  -27.952 37.042  1.00 35.41  ? 548  THR A CA    1 
ATOM   4981 C  C     . THR C 3 548 ? 84.297  -28.428 35.591  1.00 38.48  ? 548  THR A C     1 
ATOM   4982 O  O     . THR C 3 548 ? 83.544  -27.924 34.760  1.00 40.95  ? 548  THR A O     1 
ATOM   4983 C  CB    . THR C 3 548 ? 85.305  -26.803 37.177  1.00 31.80  ? 548  THR A CB    1 
ATOM   4984 O  OG1   . THR C 3 548 ? 85.215  -26.256 38.499  1.00 30.96  ? 548  THR A OG1   1 
ATOM   4985 C  CG2   . THR C 3 548 ? 85.016  -25.726 36.152  1.00 36.11  ? 548  THR A CG2   1 
ATOM   4986 N  N     . GLU C 3 549 ? 85.124  -29.411 35.287  1.00 44.90  ? 549  GLU A N     1 
ATOM   4987 C  CA    . GLU C 3 549 ? 85.219  -29.906 33.924  1.00 46.83  ? 549  GLU A CA    1 
ATOM   4988 C  C     . GLU C 3 549 ? 83.998  -30.696 33.530  1.00 42.28  ? 549  GLU A C     1 
ATOM   4989 O  O     . GLU C 3 549 ? 83.474  -30.541 32.427  1.00 39.10  ? 549  GLU A O     1 
ATOM   4990 C  CB    . GLU C 3 549 ? 86.456  -30.793 33.769  1.00 51.67  ? 549  GLU A CB    1 
ATOM   4991 C  CG    . GLU C 3 549 ? 86.796  -31.125 32.330  1.00 57.40  ? 549  GLU A CG    1 
ATOM   4992 C  CD    . GLU C 3 549 ? 87.602  -32.404 32.204  1.00 63.27  ? 549  GLU A CD    1 
ATOM   4993 O  OE1   . GLU C 3 549 ? 88.609  -32.545 32.939  1.00 69.45  ? 549  GLU A OE1   1 
ATOM   4994 O  OE2   . GLU C 3 549 ? 87.230  -33.264 31.367  1.00 65.46  ? 549  GLU A OE2   1 
ATOM   4995 N  N     . VAL C 3 550 ? 83.560  -31.559 34.438  1.00 43.68  ? 550  VAL A N     1 
ATOM   4996 C  CA    . VAL C 3 550 ? 82.395  -32.398 34.189  1.00 40.76  ? 550  VAL A CA    1 
ATOM   4997 C  C     . VAL C 3 550 ? 81.178  -31.506 34.059  1.00 44.90  ? 550  VAL A C     1 
ATOM   4998 O  O     . VAL C 3 550 ? 80.337  -31.722 33.180  1.00 50.61  ? 550  VAL A O     1 
ATOM   4999 C  CB    . VAL C 3 550 ? 82.153  -33.392 35.336  1.00 34.84  ? 550  VAL A CB    1 
ATOM   5000 C  CG1   . VAL C 3 550 ? 80.990  -34.285 34.988  1.00 38.80  ? 550  VAL A CG1   1 
ATOM   5001 C  CG2   . VAL C 3 550 ? 83.412  -34.223 35.597  1.00 34.81  ? 550  VAL A CG2   1 
ATOM   5002 N  N     . ALA C 3 551 ? 81.111  -30.498 34.932  1.00 38.35  ? 551  ALA A N     1 
ATOM   5003 C  CA    . ALA C 3 551 ? 80.013  -29.532 34.963  1.00 35.72  ? 551  ALA A CA    1 
ATOM   5004 C  C     . ALA C 3 551 ? 79.798  -28.834 33.621  1.00 36.62  ? 551  ALA A C     1 
ATOM   5005 O  O     . ALA C 3 551 ? 78.674  -28.708 33.147  1.00 41.96  ? 551  ALA A O     1 
ATOM   5006 C  CB    . ALA C 3 551 ? 80.266  -28.498 36.048  1.00 28.48  ? 551  ALA A CB    1 
ATOM   5007 N  N     . GLY C 3 552 ? 80.884  -28.370 33.018  1.00 39.14  ? 552  GLY A N     1 
ATOM   5008 C  CA    . GLY C 3 552 ? 80.793  -27.702 31.735  1.00 41.44  ? 552  GLY A CA    1 
ATOM   5009 C  C     . GLY C 3 552 ? 80.467  -28.660 30.605  1.00 42.07  ? 552  GLY A C     1 
ATOM   5010 O  O     . GLY C 3 552 ? 79.932  -28.247 29.572  1.00 45.90  ? 552  GLY A O     1 
ATOM   5011 N  N     . MET C 3 553 ? 80.798  -29.935 30.793  1.00 43.04  ? 553  MET A N     1 
ATOM   5012 C  CA    . MET C 3 553 ? 80.531  -30.964 29.788  1.00 46.23  ? 553  MET A CA    1 
ATOM   5013 C  C     . MET C 3 553 ? 79.043  -31.298 29.745  1.00 46.60  ? 553  MET A C     1 
ATOM   5014 O  O     . MET C 3 553 ? 78.413  -31.316 28.679  1.00 42.34  ? 553  MET A O     1 
ATOM   5015 C  CB    . MET C 3 553 ? 81.316  -32.240 30.112  1.00 47.80  ? 553  MET A CB    1 
ATOM   5016 C  CG    . MET C 3 553 ? 80.875  -33.455 29.301  1.00 50.14  ? 553  MET A CG    1 
ATOM   5017 S  SD    . MET C 3 553 ? 81.122  -33.306 27.499  1.00 65.02  ? 553  MET A SD    1 
ATOM   5018 C  CE    . MET C 3 553 ? 81.118  -35.068 26.989  1.00 57.81  ? 553  MET A CE    1 
ATOM   5019 N  N     . THR C 3 554 ? 78.489  -31.568 30.922  1.00 45.06  ? 554  THR A N     1 
ATOM   5020 C  CA    . THR C 3 554 ? 77.080  -31.901 31.042  1.00 45.44  ? 554  THR A CA    1 
ATOM   5021 C  C     . THR C 3 554 ? 76.244  -30.725 30.533  1.00 44.33  ? 554  THR A C     1 
ATOM   5022 O  O     . THR C 3 554 ? 75.238  -30.912 29.863  1.00 47.58  ? 554  THR A O     1 
ATOM   5023 C  CB    . THR C 3 554 ? 76.728  -32.229 32.516  1.00 46.94  ? 554  THR A CB    1 
ATOM   5024 O  OG1   . THR C 3 554 ? 75.373  -32.676 32.599  1.00 54.95  ? 554  THR A OG1   1 
ATOM   5025 C  CG2   . THR C 3 554 ? 76.902  -31.015 33.399  1.00 49.55  ? 554  THR A CG2   1 
ATOM   5026 N  N     . ALA C 3 555 ? 76.691  -29.513 30.839  1.00 41.59  ? 555  ALA A N     1 
ATOM   5027 C  CA    . ALA C 3 555 ? 76.006  -28.304 30.423  1.00 37.96  ? 555  ALA A CA    1 
ATOM   5028 C  C     . ALA C 3 555 ? 75.827  -28.248 28.904  1.00 43.25  ? 555  ALA A C     1 
ATOM   5029 O  O     . ALA C 3 555 ? 74.789  -27.807 28.399  1.00 42.45  ? 555  ALA A O     1 
ATOM   5030 C  CB    . ALA C 3 555 ? 76.784  -27.079 30.902  1.00 32.06  ? 555  ALA A CB    1 
ATOM   5031 N  N     . GLN C 3 556 ? 76.828  -28.717 28.171  1.00 45.85  ? 556  GLN A N     1 
ATOM   5032 C  CA    . GLN C 3 556 ? 76.754  -28.671 26.723  1.00 48.17  ? 556  GLN A CA    1 
ATOM   5033 C  C     . GLN C 3 556 ? 76.107  -29.890 26.077  1.00 45.55  ? 556  GLN A C     1 
ATOM   5034 O  O     . GLN C 3 556 ? 75.615  -29.803 24.950  1.00 45.70  ? 556  GLN A O     1 
ATOM   5035 C  CB    . GLN C 3 556 ? 78.140  -28.397 26.153  1.00 52.34  ? 556  GLN A CB    1 
ATOM   5036 C  CG    . GLN C 3 556 ? 78.527  -29.269 25.008  1.00 60.39  ? 556  GLN A CG    1 
ATOM   5037 C  CD    . GLN C 3 556 ? 79.842  -29.913 25.275  1.00 62.56  ? 556  GLN A CD    1 
ATOM   5038 O  OE1   . GLN C 3 556 ? 80.855  -29.227 25.409  1.00 68.96  ? 556  GLN A OE1   1 
ATOM   5039 N  NE2   . GLN C 3 556 ? 79.846  -31.238 25.375  1.00 61.00  ? 556  GLN A NE2   1 
ATOM   5040 N  N     . ILE C 3 557 ? 76.108  -31.028 26.763  1.00 41.60  ? 557  ILE A N     1 
ATOM   5041 C  CA    . ILE C 3 557 ? 75.429  -32.201 26.216  1.00 39.57  ? 557  ILE A CA    1 
ATOM   5042 C  C     . ILE C 3 557 ? 73.969  -31.793 26.319  1.00 43.60  ? 557  ILE A C     1 
ATOM   5043 O  O     . ILE C 3 557 ? 73.107  -32.185 25.524  1.00 47.54  ? 557  ILE A O     1 
ATOM   5044 C  CB    . ILE C 3 557 ? 75.630  -33.445 27.087  1.00 35.19  ? 557  ILE A CB    1 
ATOM   5045 C  CG1   . ILE C 3 557 ? 77.077  -33.919 26.996  1.00 39.06  ? 557  ILE A CG1   1 
ATOM   5046 C  CG2   . ILE C 3 557 ? 74.706  -34.553 26.629  1.00 34.00  ? 557  ILE A CG2   1 
ATOM   5047 C  CD1   . ILE C 3 557 ? 77.549  -34.156 25.565  1.00 43.00  ? 557  ILE A CD1   1 
ATOM   5048 N  N     . ASN C 3 558 ? 73.712  -30.972 27.323  1.00 41.20  ? 558  ASN A N     1 
ATOM   5049 C  CA    . ASN C 3 558 ? 72.383  -30.497 27.579  1.00 42.51  ? 558  ASN A CA    1 
ATOM   5050 C  C     . ASN C 3 558 ? 71.905  -29.584 26.458  1.00 40.31  ? 558  ASN A C     1 
ATOM   5051 O  O     . ASN C 3 558 ? 70.928  -29.897 25.783  1.00 42.81  ? 558  ASN A O     1 
ATOM   5052 C  CB    . ASN C 3 558 ? 72.359  -29.808 28.945  1.00 50.25  ? 558  ASN A CB    1 
ATOM   5053 C  CG    . ASN C 3 558 ? 71.153  -28.921 29.137  1.00 61.42  ? 558  ASN A CG    1 
ATOM   5054 O  OD1   . ASN C 3 558 ? 70.035  -29.273 28.754  1.00 67.63  ? 558  ASN A OD1   1 
ATOM   5055 N  ND2   . ASN C 3 558 ? 71.370  -27.761 29.754  1.00 60.72  ? 558  ASN A ND2   1 
ATOM   5056 N  N     . ARG C 3 559 ? 72.599  -28.476 26.230  1.00 36.88  ? 559  ARG A N     1 
ATOM   5057 C  CA    . ARG C 3 559 ? 72.187  -27.557 25.174  1.00 34.75  ? 559  ARG A CA    1 
ATOM   5058 C  C     . ARG C 3 559 ? 72.136  -28.315 23.844  1.00 36.84  ? 559  ARG A C     1 
ATOM   5059 O  O     . ARG C 3 559 ? 71.385  -27.961 22.931  1.00 33.51  ? 559  ARG A O     1 
ATOM   5060 C  CB    . ARG C 3 559 ? 73.159  -26.384 25.039  1.00 30.88  ? 559  ARG A CB    1 
ATOM   5061 C  CG    . ARG C 3 559 ? 73.771  -25.890 26.330  1.00 36.69  ? 559  ARG A CG    1 
ATOM   5062 C  CD    . ARG C 3 559 ? 72.941  -24.850 27.061  1.00 38.68  ? 559  ARG A CD    1 
ATOM   5063 N  NE    . ARG C 3 559 ? 73.123  -25.030 28.506  1.00 44.29  ? 559  ARG A NE    1 
ATOM   5064 C  CZ    . ARG C 3 559 ? 73.258  -24.059 29.408  1.00 42.55  ? 559  ARG A CZ    1 
ATOM   5065 N  NH1   . ARG C 3 559 ? 73.239  -22.774 29.061  1.00 38.42  ? 559  ARG A NH1   1 
ATOM   5066 N  NH2   . ARG C 3 559 ? 73.408  -24.395 30.679  1.00 40.45  ? 559  ARG A NH2   1 
ATOM   5067 N  N     . LYS C 3 560 ? 72.934  -29.366 23.725  1.00 38.43  ? 560  LYS A N     1 
ATOM   5068 C  CA    . LYS C 3 560 ? 72.912  -30.117 22.484  1.00 43.52  ? 560  LYS A CA    1 
ATOM   5069 C  C     . LYS C 3 560 ? 71.663  -30.975 22.389  1.00 38.61  ? 560  LYS A C     1 
ATOM   5070 O  O     . LYS C 3 560 ? 71.039  -31.055 21.341  1.00 40.47  ? 560  LYS A O     1 
ATOM   5071 C  CB    . LYS C 3 560 ? 74.153  -31.006 22.339  1.00 46.51  ? 560  LYS A CB    1 
ATOM   5072 C  CG    . LYS C 3 560 ? 74.314  -31.541 20.913  1.00 51.90  ? 560  LYS A CG    1 
ATOM   5073 C  CD    . LYS C 3 560 ? 75.368  -32.614 20.799  1.00 61.00  ? 560  LYS A CD    1 
ATOM   5074 C  CE    . LYS C 3 560 ? 74.768  -33.995 20.952  1.00 60.33  ? 560  LYS A CE    1 
ATOM   5075 N  NZ    . LYS C 3 560 ? 75.827  -35.047 21.004  1.00 60.83  ? 560  LYS A NZ    1 
ATOM   5076 N  N     . LEU C 3 561 ? 71.297  -31.633 23.476  1.00 38.18  ? 561  LEU A N     1 
ATOM   5077 C  CA    . LEU C 3 561 ? 70.103  -32.466 23.439  1.00 40.04  ? 561  LEU A CA    1 
ATOM   5078 C  C     . LEU C 3 561 ? 68.858  -31.608 23.220  1.00 38.02  ? 561  LEU A C     1 
ATOM   5079 O  O     . LEU C 3 561 ? 67.909  -32.013 22.528  1.00 33.57  ? 561  LEU A O     1 
ATOM   5080 C  CB    . LEU C 3 561 ? 69.985  -33.260 24.736  1.00 31.77  ? 561  LEU A CB    1 
ATOM   5081 C  CG    . LEU C 3 561 ? 70.914  -34.462 24.789  1.00 33.23  ? 561  LEU A CG    1 
ATOM   5082 C  CD1   . LEU C 3 561 ? 70.686  -35.272 26.053  1.00 36.10  ? 561  LEU A CD1   1 
ATOM   5083 C  CD2   . LEU C 3 561 ? 70.642  -35.290 23.575  1.00 32.25  ? 561  LEU A CD2   1 
ATOM   5084 N  N     . LEU C 3 562 ? 68.895  -30.420 23.810  1.00 34.06  ? 562  LEU A N     1 
ATOM   5085 C  CA    . LEU C 3 562 ? 67.810  -29.453 23.736  1.00 39.73  ? 562  LEU A CA    1 
ATOM   5086 C  C     . LEU C 3 562 ? 67.496  -29.066 22.297  1.00 38.69  ? 562  LEU A C     1 
ATOM   5087 O  O     . LEU C 3 562 ? 66.375  -29.240 21.824  1.00 41.26  ? 562  LEU A O     1 
ATOM   5088 C  CB    . LEU C 3 562 ? 68.205  -28.211 24.532  1.00 38.36  ? 562  LEU A CB    1 
ATOM   5089 C  CG    . LEU C 3 562 ? 67.259  -27.709 25.621  1.00 37.37  ? 562  LEU A CG    1 
ATOM   5090 C  CD1   . LEU C 3 562 ? 66.706  -28.855 26.453  1.00 32.77  ? 562  LEU A CD1   1 
ATOM   5091 C  CD2   . LEU C 3 562 ? 68.033  -26.735 26.481  1.00 35.31  ? 562  LEU A CD2   1 
ATOM   5092 N  N     . ILE C 3 563 ? 68.502  -28.524 21.624  1.00 37.87  ? 563  ILE A N     1 
ATOM   5093 C  CA    . ILE C 3 563 ? 68.403  -28.102 20.241  1.00 43.36  ? 563  ILE A CA    1 
ATOM   5094 C  C     . ILE C 3 563 ? 67.858  -29.214 19.349  1.00 46.80  ? 563  ILE A C     1 
ATOM   5095 O  O     . ILE C 3 563 ? 67.057  -28.954 18.446  1.00 51.03  ? 563  ILE A O     1 
ATOM   5096 C  CB    . ILE C 3 563 ? 69.797  -27.680 19.704  1.00 48.63  ? 563  ILE A CB    1 
ATOM   5097 C  CG1   . ILE C 3 563 ? 70.295  -26.440 20.455  1.00 55.55  ? 563  ILE A CG1   1 
ATOM   5098 C  CG2   . ILE C 3 563 ? 69.721  -27.373 18.230  1.00 50.14  ? 563  ILE A CG2   1 
ATOM   5099 C  CD1   . ILE C 3 563 ? 71.714  -26.039 20.106  1.00 53.05  ? 563  ILE A CD1   1 
ATOM   5100 N  N     . ASN C 3 564 ? 68.283  -30.450 19.590  1.00 45.33  ? 564  ASN A N     1 
ATOM   5101 C  CA    . ASN C 3 564 ? 67.810  -31.551 18.762  1.00 45.69  ? 564  ASN A CA    1 
ATOM   5102 C  C     . ASN C 3 564 ? 66.378  -31.959 18.998  1.00 46.74  ? 564  ASN A C     1 
ATOM   5103 O  O     . ASN C 3 564 ? 65.774  -32.575 18.129  1.00 49.37  ? 564  ASN A O     1 
ATOM   5104 C  CB    . ASN C 3 564 ? 68.685  -32.790 18.922  1.00 52.82  ? 564  ASN A CB    1 
ATOM   5105 C  CG    . ASN C 3 564 ? 69.940  -32.724 18.088  1.00 55.00  ? 564  ASN A CG    1 
ATOM   5106 O  OD1   . ASN C 3 564 ? 69.947  -32.157 16.989  1.00 60.49  ? 564  ASN A OD1   1 
ATOM   5107 N  ND2   . ASN C 3 564 ? 71.009  -33.319 18.594  1.00 44.76  ? 564  ASN A ND2   1 
ATOM   5108 N  N     . SER C 3 565 ? 65.830  -31.628 20.165  1.00 43.02  ? 565  SER A N     1 
ATOM   5109 C  CA    . SER C 3 565 ? 64.461  -32.012 20.480  1.00 37.47  ? 565  SER A CA    1 
ATOM   5110 C  C     . SER C 3 565 ? 63.446  -30.948 20.151  1.00 37.49  ? 565  SER A C     1 
ATOM   5111 O  O     . SER C 3 565 ? 62.254  -31.158 20.342  1.00 42.33  ? 565  SER A O     1 
ATOM   5112 C  CB    . SER C 3 565 ? 64.339  -32.373 21.957  1.00 30.57  ? 565  SER A CB    1 
ATOM   5113 O  OG    . SER C 3 565 ? 64.469  -31.218 22.758  1.00 44.83  ? 565  SER A OG    1 
ATOM   5114 N  N     . LEU C 3 566 ? 63.914  -29.811 19.654  1.00 41.77  ? 566  LEU A N     1 
ATOM   5115 C  CA    . LEU C 3 566 ? 63.022  -28.708 19.317  1.00 40.68  ? 566  LEU A CA    1 
ATOM   5116 C  C     . LEU C 3 566 ? 62.048  -29.072 18.212  1.00 40.04  ? 566  LEU A C     1 
ATOM   5117 O  O     . LEU C 3 566 ? 60.839  -28.943 18.397  1.00 47.91  ? 566  LEU A O     1 
ATOM   5118 C  CB    . LEU C 3 566 ? 63.825  -27.465 18.916  1.00 39.97  ? 566  LEU A CB    1 
ATOM   5119 C  CG    . LEU C 3 566 ? 62.987  -26.239 18.576  1.00 40.96  ? 566  LEU A CG    1 
ATOM   5120 C  CD1   . LEU C 3 566 ? 62.068  -25.957 19.729  1.00 44.23  ? 566  LEU A CD1   1 
ATOM   5121 C  CD2   . LEU C 3 566 ? 63.860  -25.041 18.311  1.00 38.51  ? 566  LEU A CD2   1 
ATOM   5122 N  N     . TYR C 3 567 ? 62.553  -29.532 17.069  1.00 40.95  ? 567  TYR A N     1 
ATOM   5123 C  CA    . TYR C 3 567 ? 61.661  -29.889 15.969  1.00 43.53  ? 567  TYR A CA    1 
ATOM   5124 C  C     . TYR C 3 567 ? 60.557  -30.828 16.457  1.00 44.20  ? 567  TYR A C     1 
ATOM   5125 O  O     . TYR C 3 567 ? 59.458  -30.850 15.913  1.00 42.69  ? 567  TYR A O     1 
ATOM   5126 C  CB    . TYR C 3 567 ? 62.413  -30.546 14.802  1.00 42.21  ? 567  TYR A CB    1 
ATOM   5127 C  CG    . TYR C 3 567 ? 61.444  -30.971 13.735  1.00 48.80  ? 567  TYR A CG    1 
ATOM   5128 C  CD1   . TYR C 3 567 ? 60.540  -30.051 13.208  1.00 57.28  ? 567  TYR A CD1   1 
ATOM   5129 C  CD2   . TYR C 3 567 ? 61.314  -32.306 13.366  1.00 50.53  ? 567  TYR A CD2   1 
ATOM   5130 C  CE1   . TYR C 3 567 ? 59.523  -30.442 12.362  1.00 64.05  ? 567  TYR A CE1   1 
ATOM   5131 C  CE2   . TYR C 3 567 ? 60.300  -32.713 12.514  1.00 59.75  ? 567  TYR A CE2   1 
ATOM   5132 C  CZ    . TYR C 3 567 ? 59.400  -31.776 12.022  1.00 67.55  ? 567  TYR A CZ    1 
ATOM   5133 O  OH    . TYR C 3 567 ? 58.336  -32.171 11.241  1.00 72.02  ? 567  TYR A OH    1 
ATOM   5134 N  N     . GLY C 3 568 ? 60.858  -31.593 17.499  1.00 48.68  ? 568  GLY A N     1 
ATOM   5135 C  CA    . GLY C 3 568 ? 59.881  -32.514 18.057  1.00 47.12  ? 568  GLY A CA    1 
ATOM   5136 C  C     . GLY C 3 568 ? 58.721  -31.787 18.723  1.00 45.46  ? 568  GLY A C     1 
ATOM   5137 O  O     . GLY C 3 568 ? 57.616  -32.308 18.816  1.00 42.11  ? 568  GLY A O     1 
ATOM   5138 N  N     . ALA C 3 569 ? 58.980  -30.574 19.188  1.00 42.64  ? 569  ALA A N     1 
ATOM   5139 C  CA    . ALA C 3 569 ? 57.962  -29.775 19.840  1.00 44.52  ? 569  ALA A CA    1 
ATOM   5140 C  C     . ALA C 3 569 ? 57.161  -28.999 18.780  1.00 44.58  ? 569  ALA A C     1 
ATOM   5141 O  O     . ALA C 3 569 ? 55.930  -28.995 18.771  1.00 41.99  ? 569  ALA A O     1 
ATOM   5142 C  CB    . ALA C 3 569 ? 58.631  -28.824 20.825  1.00 46.64  ? 569  ALA A CB    1 
ATOM   5143 N  N     . LEU C 3 570 ? 57.878  -28.366 17.863  1.00 43.14  ? 570  LEU A N     1 
ATOM   5144 C  CA    . LEU C 3 570 ? 57.252  -27.600 16.797  1.00 42.78  ? 570  LEU A CA    1 
ATOM   5145 C  C     . LEU C 3 570 ? 56.357  -28.427 15.872  1.00 42.66  ? 570  LEU A C     1 
ATOM   5146 O  O     . LEU C 3 570 ? 55.575  -27.857 15.106  1.00 43.77  ? 570  LEU A O     1 
ATOM   5147 C  CB    . LEU C 3 570 ? 58.328  -26.914 15.956  1.00 41.51  ? 570  LEU A CB    1 
ATOM   5148 C  CG    . LEU C 3 570 ? 58.973  -25.687 16.562  1.00 38.28  ? 570  LEU A CG    1 
ATOM   5149 C  CD1   . LEU C 3 570 ? 59.855  -25.016 15.512  1.00 41.95  ? 570  LEU A CD1   1 
ATOM   5150 C  CD2   . LEU C 3 570 ? 57.884  -24.759 17.048  1.00 39.46  ? 570  LEU A CD2   1 
ATOM   5151 N  N     . GLY C 3 571 ? 56.482  -29.752 15.925  1.00 37.37  ? 571  GLY A N     1 
ATOM   5152 C  CA    . GLY C 3 571 ? 55.662  -30.605 15.080  1.00 33.68  ? 571  GLY A CA    1 
ATOM   5153 C  C     . GLY C 3 571 ? 54.544  -31.291 15.846  1.00 40.76  ? 571  GLY A C     1 
ATOM   5154 O  O     . GLY C 3 571 ? 53.698  -31.986 15.275  1.00 41.93  ? 571  GLY A O     1 
ATOM   5155 N  N     . ASN C 3 572 ? 54.531  -31.080 17.157  1.00 41.91  ? 572  ASN A N     1 
ATOM   5156 C  CA    . ASN C 3 572 ? 53.529  -31.684 18.030  1.00 46.33  ? 572  ASN A CA    1 
ATOM   5157 C  C     . ASN C 3 572 ? 52.353  -30.719 18.250  1.00 49.15  ? 572  ASN A C     1 
ATOM   5158 O  O     . ASN C 3 572 ? 52.530  -29.595 18.728  1.00 50.30  ? 572  ASN A O     1 
ATOM   5159 C  CB    . ASN C 3 572 ? 54.198  -32.058 19.360  1.00 43.72  ? 572  ASN A CB    1 
ATOM   5160 C  CG    . ASN C 3 572 ? 53.245  -32.695 20.347  1.00 48.23  ? 572  ASN A CG    1 
ATOM   5161 O  OD1   . ASN C 3 572 ? 52.098  -32.274 20.492  1.00 50.78  ? 572  ASN A OD1   1 
ATOM   5162 N  ND2   . ASN C 3 572 ? 53.727  -33.700 21.054  1.00 51.22  ? 572  ASN A ND2   1 
ATOM   5163 N  N     . VAL C 3 573 ? 51.155  -31.169 17.899  1.00 44.44  ? 573  VAL A N     1 
ATOM   5164 C  CA    . VAL C 3 573 ? 49.954  -30.353 18.027  1.00 45.67  ? 573  VAL A CA    1 
ATOM   5165 C  C     . VAL C 3 573 ? 49.723  -29.781 19.418  1.00 46.64  ? 573  VAL A C     1 
ATOM   5166 O  O     . VAL C 3 573 ? 48.989  -28.812 19.573  1.00 49.51  ? 573  VAL A O     1 
ATOM   5167 C  CB    . VAL C 3 573 ? 48.675  -31.148 17.622  1.00 47.90  ? 573  VAL A CB    1 
ATOM   5168 C  CG1   . VAL C 3 573 ? 48.715  -31.494 16.142  1.00 46.22  ? 573  VAL A CG1   1 
ATOM   5169 C  CG2   . VAL C 3 573 ? 48.546  -32.413 18.466  1.00 44.54  ? 573  VAL A CG2   1 
ATOM   5170 N  N     . TRP C 3 574 ? 50.340  -30.369 20.432  1.00 42.69  ? 574  TRP A N     1 
ATOM   5171 C  CA    . TRP C 3 574 ? 50.153  -29.866 21.781  1.00 45.91  ? 574  TRP A CA    1 
ATOM   5172 C  C     . TRP C 3 574 ? 51.157  -28.805 22.227  1.00 47.72  ? 574  TRP A C     1 
ATOM   5173 O  O     . TRP C 3 574 ? 51.144  -28.382 23.383  1.00 49.02  ? 574  TRP A O     1 
ATOM   5174 C  CB    . TRP C 3 574 ? 50.163  -31.018 22.772  1.00 52.63  ? 574  TRP A CB    1 
ATOM   5175 C  CG    . TRP C 3 574 ? 48.987  -31.900 22.625  1.00 62.55  ? 574  TRP A CG    1 
ATOM   5176 C  CD1   . TRP C 3 574 ? 48.857  -32.960 21.782  1.00 66.81  ? 574  TRP A CD1   1 
ATOM   5177 C  CD2   . TRP C 3 574 ? 47.747  -31.781 23.322  1.00 68.14  ? 574  TRP A CD2   1 
ATOM   5178 N  NE1   . TRP C 3 574 ? 47.609  -33.519 21.912  1.00 71.04  ? 574  TRP A NE1   1 
ATOM   5179 C  CE2   . TRP C 3 574 ? 46.907  -32.817 22.857  1.00 71.79  ? 574  TRP A CE2   1 
ATOM   5180 C  CE3   . TRP C 3 574 ? 47.264  -30.906 24.308  1.00 71.89  ? 574  TRP A CE3   1 
ATOM   5181 C  CZ2   . TRP C 3 574 ? 45.601  -32.994 23.333  1.00 73.67  ? 574  TRP A CZ2   1 
ATOM   5182 C  CZ3   . TRP C 3 574 ? 45.968  -31.083 24.782  1.00 73.18  ? 574  TRP A CZ3   1 
ATOM   5183 C  CH2   . TRP C 3 574 ? 45.154  -32.125 24.297  1.00 72.75  ? 574  TRP A CH2   1 
ATOM   5184 N  N     . PHE C 3 575 ? 52.037  -28.380 21.327  1.00 45.13  ? 575  PHE A N     1 
ATOM   5185 C  CA    . PHE C 3 575 ? 53.002  -27.360 21.687  1.00 41.19  ? 575  PHE A CA    1 
ATOM   5186 C  C     . PHE C 3 575 ? 52.330  -26.013 21.488  1.00 46.71  ? 575  PHE A C     1 
ATOM   5187 O  O     . PHE C 3 575 ? 51.685  -25.767 20.462  1.00 49.83  ? 575  PHE A O     1 
ATOM   5188 C  CB    . PHE C 3 575 ? 54.249  -27.460 20.809  1.00 38.00  ? 575  PHE A CB    1 
ATOM   5189 C  CG    . PHE C 3 575 ? 55.403  -26.597 21.275  1.00 35.26  ? 575  PHE A CG    1 
ATOM   5190 C  CD1   . PHE C 3 575 ? 55.730  -26.511 22.633  1.00 35.88  ? 575  PHE A CD1   1 
ATOM   5191 C  CD2   . PHE C 3 575 ? 56.205  -25.931 20.353  1.00 31.81  ? 575  PHE A CD2   1 
ATOM   5192 C  CE1   . PHE C 3 575 ? 56.840  -25.782 23.063  1.00 29.53  ? 575  PHE A CE1   1 
ATOM   5193 C  CE2   . PHE C 3 575 ? 57.315  -25.203 20.767  1.00 26.88  ? 575  PHE A CE2   1 
ATOM   5194 C  CZ    . PHE C 3 575 ? 57.637  -25.128 22.127  1.00 35.72  ? 575  PHE A CZ    1 
ATOM   5195 N  N     . ARG C 3 576 ? 52.485  -25.141 22.475  1.00 43.93  ? 576  ARG A N     1 
ATOM   5196 C  CA    . ARG C 3 576 ? 51.898  -23.808 22.439  1.00 41.07  ? 576  ARG A CA    1 
ATOM   5197 C  C     . ARG C 3 576 ? 52.220  -22.963 21.204  1.00 41.76  ? 576  ARG A C     1 
ATOM   5198 O  O     . ARG C 3 576 ? 51.459  -22.066 20.858  1.00 44.33  ? 576  ARG A O     1 
ATOM   5199 C  CB    . ARG C 3 576 ? 52.313  -23.071 23.715  1.00 42.29  ? 576  ARG A CB    1 
ATOM   5200 C  CG    . ARG C 3 576 ? 52.058  -21.586 23.723  1.00 43.49  ? 576  ARG A CG    1 
ATOM   5201 C  CD    . ARG C 3 576 ? 52.410  -20.979 25.078  1.00 42.12  ? 576  ARG A CD    1 
ATOM   5202 N  NE    . ARG C 3 576 ? 51.423  -21.298 26.121  1.00 41.11  ? 576  ARG A NE    1 
ATOM   5203 C  CZ    . ARG C 3 576 ? 51.685  -22.010 27.212  1.00 38.97  ? 576  ARG A CZ    1 
ATOM   5204 N  NH1   . ARG C 3 576 ? 52.897  -22.496 27.421  1.00 42.46  ? 576  ARG A NH1   1 
ATOM   5205 N  NH2   . ARG C 3 576 ? 50.741  -22.216 28.102  1.00 35.75  ? 576  ARG A NH2   1 
ATOM   5206 N  N     . TYR C 3 577 ? 53.332  -23.251 20.530  1.00 44.41  ? 577  TYR A N     1 
ATOM   5207 C  CA    . TYR C 3 577 ? 53.721  -22.472 19.358  1.00 40.45  ? 577  TYR A CA    1 
ATOM   5208 C  C     . TYR C 3 577 ? 53.630  -23.249 18.058  1.00 45.13  ? 577  TYR A C     1 
ATOM   5209 O  O     . TYR C 3 577 ? 54.257  -22.879 17.066  1.00 46.72  ? 577  TYR A O     1 
ATOM   5210 C  CB    . TYR C 3 577 ? 55.136  -21.933 19.521  1.00 40.05  ? 577  TYR A CB    1 
ATOM   5211 C  CG    . TYR C 3 577 ? 55.342  -21.211 20.827  1.00 41.63  ? 577  TYR A CG    1 
ATOM   5212 C  CD1   . TYR C 3 577 ? 55.456  -21.918 22.018  1.00 42.20  ? 577  TYR A CD1   1 
ATOM   5213 C  CD2   . TYR C 3 577 ? 55.394  -19.818 20.881  1.00 37.17  ? 577  TYR A CD2   1 
ATOM   5214 C  CE1   . TYR C 3 577 ? 55.616  -21.268 23.224  1.00 41.96  ? 577  TYR A CE1   1 
ATOM   5215 C  CE2   . TYR C 3 577 ? 55.554  -19.155 22.088  1.00 32.93  ? 577  TYR A CE2   1 
ATOM   5216 C  CZ    . TYR C 3 577 ? 55.662  -19.890 23.252  1.00 37.20  ? 577  TYR A CZ    1 
ATOM   5217 O  OH    . TYR C 3 577 ? 55.814  -19.256 24.457  1.00 38.18  ? 577  TYR A OH    1 
ATOM   5218 N  N     . TYR C 3 578 ? 52.846  -24.323 18.059  1.00 45.29  ? 578  TYR A N     1 
ATOM   5219 C  CA    . TYR C 3 578 ? 52.672  -25.128 16.856  1.00 45.73  ? 578  TYR A CA    1 
ATOM   5220 C  C     . TYR C 3 578 ? 51.807  -24.447 15.792  1.00 44.41  ? 578  TYR A C     1 
ATOM   5221 O  O     . TYR C 3 578 ? 50.868  -23.727 16.099  1.00 52.79  ? 578  TYR A O     1 
ATOM   5222 C  CB    . TYR C 3 578 ? 52.068  -26.484 17.232  1.00 48.25  ? 578  TYR A CB    1 
ATOM   5223 C  CG    . TYR C 3 578 ? 51.477  -27.288 16.080  1.00 52.63  ? 578  TYR A CG    1 
ATOM   5224 C  CD1   . TYR C 3 578 ? 50.270  -26.911 15.486  1.00 52.73  ? 578  TYR A CD1   1 
ATOM   5225 C  CD2   . TYR C 3 578 ? 52.109  -28.445 15.605  1.00 51.69  ? 578  TYR A CD2   1 
ATOM   5226 C  CE1   . TYR C 3 578 ? 49.705  -27.663 14.452  1.00 52.86  ? 578  TYR A CE1   1 
ATOM   5227 C  CE2   . TYR C 3 578 ? 51.549  -29.208 14.569  1.00 49.58  ? 578  TYR A CE2   1 
ATOM   5228 C  CZ    . TYR C 3 578 ? 50.346  -28.807 13.999  1.00 53.21  ? 578  TYR A CZ    1 
ATOM   5229 O  OH    . TYR C 3 578 ? 49.778  -29.539 12.980  1.00 50.51  ? 578  TYR A OH    1 
ATOM   5230 N  N     . ASP C 3 579 ? 52.144  -24.683 14.534  1.00 41.18  ? 579  ASP A N     1 
ATOM   5231 C  CA    . ASP C 3 579 ? 51.398  -24.168 13.403  1.00 38.47  ? 579  ASP A CA    1 
ATOM   5232 C  C     . ASP C 3 579 ? 51.697  -25.079 12.231  1.00 41.91  ? 579  ASP A C     1 
ATOM   5233 O  O     . ASP C 3 579 ? 52.788  -25.023 11.674  1.00 44.34  ? 579  ASP A O     1 
ATOM   5234 C  CB    . ASP C 3 579 ? 51.808  -22.752 13.046  1.00 41.46  ? 579  ASP A CB    1 
ATOM   5235 C  CG    . ASP C 3 579 ? 50.998  -22.203 11.876  1.00 54.83  ? 579  ASP A CG    1 
ATOM   5236 O  OD1   . ASP C 3 579 ? 51.099  -22.761 10.761  1.00 54.36  ? 579  ASP A OD1   1 
ATOM   5237 O  OD2   . ASP C 3 579 ? 50.246  -21.225 12.069  1.00 59.25  ? 579  ASP A OD2   1 
ATOM   5238 N  N     . LEU C 3 580 ? 50.725  -25.913 11.869  1.00 43.16  ? 580  LEU A N     1 
ATOM   5239 C  CA    . LEU C 3 580 ? 50.855  -26.864 10.765  1.00 43.94  ? 580  LEU A CA    1 
ATOM   5240 C  C     . LEU C 3 580 ? 51.626  -26.333 9.556   1.00 45.33  ? 580  LEU A C     1 
ATOM   5241 O  O     . LEU C 3 580 ? 52.538  -26.990 9.065   1.00 49.80  ? 580  LEU A O     1 
ATOM   5242 C  CB    . LEU C 3 580 ? 49.474  -27.311 10.301  1.00 41.94  ? 580  LEU A CB    1 
ATOM   5243 C  CG    . LEU C 3 580 ? 49.496  -28.336 9.170   1.00 48.22  ? 580  LEU A CG    1 
ATOM   5244 C  CD1   . LEU C 3 580 ? 49.828  -29.720 9.741   1.00 51.51  ? 580  LEU A CD1   1 
ATOM   5245 C  CD2   . LEU C 3 580 ? 48.147  -28.355 8.481   1.00 48.50  ? 580  LEU A CD2   1 
ATOM   5246 N  N     . ARG C 3 581 ? 51.254  -25.153 9.072   1.00 45.53  ? 581  ARG A N     1 
ATOM   5247 C  CA    . ARG C 3 581 ? 51.917  -24.559 7.914   1.00 45.26  ? 581  ARG A CA    1 
ATOM   5248 C  C     . ARG C 3 581 ? 53.431  -24.338 8.110   1.00 45.60  ? 581  ARG A C     1 
ATOM   5249 O  O     . ARG C 3 581 ? 54.196  -24.380 7.153   1.00 45.31  ? 581  ARG A O     1 
ATOM   5250 C  CB    . ARG C 3 581 ? 51.245  -23.224 7.543   1.00 47.94  ? 581  ARG A CB    1 
ATOM   5251 C  CG    . ARG C 3 581 ? 49.745  -23.313 7.321   1.00 48.41  ? 581  ARG A CG    1 
ATOM   5252 C  CD    . ARG C 3 581 ? 49.185  -22.114 6.545   1.00 54.76  ? 581  ARG A CD    1 
ATOM   5253 N  NE    . ARG C 3 581 ? 49.370  -20.809 7.188   1.00 59.46  ? 581  ARG A NE    1 
ATOM   5254 C  CZ    . ARG C 3 581 ? 49.094  -20.541 8.465   1.00 65.49  ? 581  ARG A CZ    1 
ATOM   5255 N  NH1   . ARG C 3 581 ? 48.625  -21.489 9.270   1.00 66.53  ? 581  ARG A NH1   1 
ATOM   5256 N  NH2   . ARG C 3 581 ? 49.258  -19.312 8.935   1.00 62.43  ? 581  ARG A NH2   1 
ATOM   5257 N  N     . ASN C 3 582 ? 53.860  -24.079 9.342   1.00 45.02  ? 582  ASN A N     1 
ATOM   5258 C  CA    . ASN C 3 582 ? 55.276  -23.864 9.610   1.00 44.36  ? 582  ASN A CA    1 
ATOM   5259 C  C     . ASN C 3 582 ? 55.985  -25.212 9.658   1.00 44.93  ? 582  ASN A C     1 
ATOM   5260 O  O     . ASN C 3 582 ? 57.060  -25.388 9.084   1.00 44.58  ? 582  ASN A O     1 
ATOM   5261 C  CB    . ASN C 3 582 ? 55.492  -23.130 10.943  1.00 40.43  ? 582  ASN A CB    1 
ATOM   5262 C  CG    . ASN C 3 582 ? 55.178  -21.638 10.864  1.00 44.44  ? 582  ASN A CG    1 
ATOM   5263 O  OD1   . ASN C 3 582 ? 55.087  -21.065 9.780   1.00 41.08  ? 582  ASN A OD1   1 
ATOM   5264 N  ND2   . ASN C 3 582 ? 55.029  -21.001 12.026  1.00 38.66  ? 582  ASN A ND2   1 
ATOM   5265 N  N     . ALA C 3 583 ? 55.372  -26.168 10.343  1.00 45.31  ? 583  ALA A N     1 
ATOM   5266 C  CA    . ALA C 3 583 ? 55.951  -27.499 10.474  1.00 46.69  ? 583  ALA A CA    1 
ATOM   5267 C  C     . ALA C 3 583 ? 56.217  -28.078 9.097   1.00 46.71  ? 583  ALA A C     1 
ATOM   5268 O  O     . ALA C 3 583 ? 57.203  -28.798 8.882   1.00 51.20  ? 583  ALA A O     1 
ATOM   5269 C  CB    . ALA C 3 583 ? 55.004  -28.407 11.257  1.00 43.99  ? 583  ALA A CB    1 
ATOM   5270 N  N     . THR C 3 584 ? 55.332  -27.736 8.167   1.00 41.66  ? 584  THR A N     1 
ATOM   5271 C  CA    . THR C 3 584 ? 55.425  -28.208 6.795   1.00 41.07  ? 584  THR A CA    1 
ATOM   5272 C  C     . THR C 3 584 ? 56.408  -27.381 5.962   1.00 39.33  ? 584  THR A C     1 
ATOM   5273 O  O     . THR C 3 584 ? 56.954  -27.868 4.973   1.00 40.19  ? 584  THR A O     1 
ATOM   5274 C  CB    . THR C 3 584 ? 54.038  -28.195 6.126   1.00 42.79  ? 584  THR A CB    1 
ATOM   5275 O  OG1   . THR C 3 584 ? 53.207  -29.206 6.714   1.00 45.02  ? 584  THR A OG1   1 
ATOM   5276 C  CG2   . THR C 3 584 ? 54.172  -28.455 4.644   1.00 44.52  ? 584  THR A CG2   1 
ATOM   5277 N  N     . ALA C 3 585 ? 56.625  -26.133 6.367   1.00 38.54  ? 585  ALA A N     1 
ATOM   5278 C  CA    . ALA C 3 585 ? 57.553  -25.250 5.678   1.00 37.92  ? 585  ALA A CA    1 
ATOM   5279 C  C     . ALA C 3 585 ? 59.000  -25.695 5.953   1.00 39.68  ? 585  ALA A C     1 
ATOM   5280 O  O     . ALA C 3 585 ? 59.889  -25.516 5.120   1.00 39.57  ? 585  ALA A O     1 
ATOM   5281 C  CB    . ALA C 3 585 ? 57.334  -23.812 6.140   1.00 36.06  ? 585  ALA A CB    1 
ATOM   5282 N  N     . ILE C 3 586 ? 59.222  -26.294 7.122   1.00 41.16  ? 586  ILE A N     1 
ATOM   5283 C  CA    . ILE C 3 586 ? 60.545  -26.779 7.535   1.00 37.61  ? 586  ILE A CA    1 
ATOM   5284 C  C     . ILE C 3 586 ? 60.860  -28.092 6.847   1.00 37.03  ? 586  ILE A C     1 
ATOM   5285 O  O     . ILE C 3 586 ? 61.947  -28.299 6.321   1.00 36.87  ? 586  ILE A O     1 
ATOM   5286 C  CB    . ILE C 3 586 ? 60.579  -27.007 9.057   1.00 36.15  ? 586  ILE A CB    1 
ATOM   5287 C  CG1   . ILE C 3 586 ? 60.459  -25.668 9.786   1.00 34.70  ? 586  ILE A CG1   1 
ATOM   5288 C  CG2   . ILE C 3 586 ? 61.847  -27.719 9.461   1.00 32.33  ? 586  ILE A CG2   1 
ATOM   5289 C  CD1   . ILE C 3 586 ? 60.151  -25.834 11.268  1.00 38.37  ? 586  ILE A CD1   1 
ATOM   5290 N  N     . THR C 3 587 ? 59.885  -28.984 6.845   1.00 42.30  ? 587  THR A N     1 
ATOM   5291 C  CA    . THR C 3 587 ? 60.067  -30.280 6.227   1.00 41.73  ? 587  THR A CA    1 
ATOM   5292 C  C     . THR C 3 587 ? 60.204  -30.222 4.723   1.00 42.55  ? 587  THR A C     1 
ATOM   5293 O  O     . THR C 3 587 ? 60.987  -30.972 4.153   1.00 45.38  ? 587  THR A O     1 
ATOM   5294 C  CB    . THR C 3 587 ? 58.920  -31.204 6.574   1.00 42.56  ? 587  THR A CB    1 
ATOM   5295 O  OG1   . THR C 3 587 ? 58.917  -31.428 7.986   1.00 54.22  ? 587  THR A OG1   1 
ATOM   5296 C  CG2   . THR C 3 587 ? 59.098  -32.524 5.885   1.00 59.16  ? 587  THR A CG2   1 
ATOM   5297 N  N     . THR C 3 588 ? 59.439  -29.346 4.077   1.00 45.09  ? 588  THR A N     1 
ATOM   5298 C  CA    . THR C 3 588 ? 59.508  -29.210 2.623   1.00 42.72  ? 588  THR A CA    1 
ATOM   5299 C  C     . THR C 3 588 ? 60.810  -28.527 2.210   1.00 42.75  ? 588  THR A C     1 
ATOM   5300 O  O     . THR C 3 588 ? 61.329  -28.777 1.124   1.00 46.22  ? 588  THR A O     1 
ATOM   5301 C  CB    . THR C 3 588 ? 58.314  -28.395 2.058   1.00 41.93  ? 588  THR A CB    1 
ATOM   5302 O  OG1   . THR C 3 588 ? 57.072  -29.021 2.425   1.00 45.30  ? 588  THR A OG1   1 
ATOM   5303 C  CG2   . THR C 3 588 ? 58.395  -28.334 0.543   1.00 40.44  ? 588  THR A CG2   1 
ATOM   5304 N  N     . PHE C 3 589 ? 61.332  -27.668 3.082   1.00 37.92  ? 589  PHE A N     1 
ATOM   5305 C  CA    . PHE C 3 589 ? 62.572  -26.953 2.816   1.00 31.59  ? 589  PHE A CA    1 
ATOM   5306 C  C     . PHE C 3 589 ? 63.714  -27.957 2.888   1.00 34.73  ? 589  PHE A C     1 
ATOM   5307 O  O     . PHE C 3 589 ? 64.499  -28.073 1.962   1.00 38.27  ? 589  PHE A O     1 
ATOM   5308 C  CB    . PHE C 3 589 ? 62.762  -25.836 3.855   1.00 37.14  ? 589  PHE A CB    1 
ATOM   5309 C  CG    . PHE C 3 589 ? 63.922  -24.917 3.565   1.00 39.48  ? 589  PHE A CG    1 
ATOM   5310 C  CD1   . PHE C 3 589 ? 65.209  -25.244 3.972   1.00 34.71  ? 589  PHE A CD1   1 
ATOM   5311 C  CD2   . PHE C 3 589 ? 63.727  -23.742 2.837   1.00 37.19  ? 589  PHE A CD2   1 
ATOM   5312 C  CE1   . PHE C 3 589 ? 66.285  -24.419 3.654   1.00 37.22  ? 589  PHE A CE1   1 
ATOM   5313 C  CE2   . PHE C 3 589 ? 64.794  -22.914 2.515   1.00 32.83  ? 589  PHE A CE2   1 
ATOM   5314 C  CZ    . PHE C 3 589 ? 66.076  -23.250 2.921   1.00 37.44  ? 589  PHE A CZ    1 
ATOM   5315 N  N     . GLY C 3 590 ? 63.791  -28.687 3.994   1.00 33.62  ? 590  GLY A N     1 
ATOM   5316 C  CA    . GLY C 3 590 ? 64.822  -29.694 4.159   1.00 38.95  ? 590  GLY A CA    1 
ATOM   5317 C  C     . GLY C 3 590 ? 64.890  -30.670 2.993   1.00 43.20  ? 590  GLY A C     1 
ATOM   5318 O  O     . GLY C 3 590 ? 65.977  -31.112 2.626   1.00 50.30  ? 590  GLY A O     1 
ATOM   5319 N  N     . GLN C 3 591 ? 63.745  -31.019 2.411   1.00 37.45  ? 591  GLN A N     1 
ATOM   5320 C  CA    . GLN C 3 591 ? 63.723  -31.926 1.266   1.00 37.62  ? 591  GLN A CA    1 
ATOM   5321 C  C     . GLN C 3 591 ? 64.392  -31.263 0.083   1.00 41.70  ? 591  GLN A C     1 
ATOM   5322 O  O     . GLN C 3 591 ? 65.345  -31.789 -0.486  1.00 46.83  ? 591  GLN A O     1 
ATOM   5323 C  CB    . GLN C 3 591 ? 62.295  -32.267 0.856   1.00 38.85  ? 591  GLN A CB    1 
ATOM   5324 C  CG    . GLN C 3 591 ? 61.664  -33.360 1.659   1.00 48.38  ? 591  GLN A CG    1 
ATOM   5325 C  CD    . GLN C 3 591 ? 60.409  -33.871 1.010   1.00 59.38  ? 591  GLN A CD    1 
ATOM   5326 O  OE1   . GLN C 3 591 ? 60.442  -34.340 -0.133  1.00 66.97  ? 591  GLN A OE1   1 
ATOM   5327 N  NE2   . GLN C 3 591 ? 59.286  -33.787 1.726   1.00 58.87  ? 591  GLN A NE2   1 
ATOM   5328 N  N     . MET C 3 592 ? 63.867  -30.102 -0.290  1.00 37.22  ? 592  MET A N     1 
ATOM   5329 C  CA    . MET C 3 592 ? 64.395  -29.349 -1.405  1.00 39.52  ? 592  MET A CA    1 
ATOM   5330 C  C     . MET C 3 592 ? 65.904  -29.155 -1.294  1.00 42.61  ? 592  MET A C     1 
ATOM   5331 O  O     . MET C 3 592 ? 66.637  -29.327 -2.264  1.00 47.31  ? 592  MET A O     1 
ATOM   5332 C  CB    . MET C 3 592 ? 63.727  -27.983 -1.478  1.00 46.55  ? 592  MET A CB    1 
ATOM   5333 C  CG    . MET C 3 592 ? 64.138  -27.167 -2.692  1.00 47.07  ? 592  MET A CG    1 
ATOM   5334 S  SD    . MET C 3 592 ? 63.847  -25.412 -2.446  1.00 55.86  ? 592  MET A SD    1 
ATOM   5335 C  CE    . MET C 3 592 ? 65.487  -24.797 -2.455  1.00 55.07  ? 592  MET A CE    1 
ATOM   5336 N  N     . ALA C 3 593 ? 66.369  -28.786 -0.110  1.00 41.13  ? 593  ALA A N     1 
ATOM   5337 C  CA    . ALA C 3 593 ? 67.792  -28.563 0.109   1.00 41.94  ? 593  ALA A CA    1 
ATOM   5338 C  C     . ALA C 3 593 ? 68.614  -29.781 -0.288  1.00 42.80  ? 593  ALA A C     1 
ATOM   5339 O  O     . ALA C 3 593 ? 69.566  -29.679 -1.069  1.00 45.12  ? 593  ALA A O     1 
ATOM   5340 C  CB    . ALA C 3 593 ? 68.046  -28.218 1.584   1.00 38.14  ? 593  ALA A CB    1 
ATOM   5341 N  N     . LEU C 3 594 ? 68.242  -30.935 0.254   1.00 40.82  ? 594  LEU A N     1 
ATOM   5342 C  CA    . LEU C 3 594 ? 68.962  -32.161 -0.036  1.00 38.42  ? 594  LEU A CA    1 
ATOM   5343 C  C     . LEU C 3 594 ? 69.017  -32.485 -1.505  1.00 36.20  ? 594  LEU A C     1 
ATOM   5344 O  O     . LEU C 3 594 ? 70.073  -32.818 -2.018  1.00 40.53  ? 594  LEU A O     1 
ATOM   5345 C  CB    . LEU C 3 594 ? 68.345  -33.340 0.712   1.00 42.08  ? 594  LEU A CB    1 
ATOM   5346 C  CG    . LEU C 3 594 ? 69.098  -33.767 1.967   1.00 42.78  ? 594  LEU A CG    1 
ATOM   5347 C  CD1   . LEU C 3 594 ? 70.340  -34.507 1.570   1.00 41.57  ? 594  LEU A CD1   1 
ATOM   5348 C  CD2   . LEU C 3 594 ? 69.449  -32.551 2.799   1.00 48.01  ? 594  LEU A CD2   1 
ATOM   5349 N  N     . GLN C 3 595 ? 67.892  -32.394 -2.193  1.00 32.69  ? 595  GLN A N     1 
ATOM   5350 C  CA    . GLN C 3 595 ? 67.895  -32.730 -3.607  1.00 39.02  ? 595  GLN A CA    1 
ATOM   5351 C  C     . GLN C 3 595 ? 68.556  -31.671 -4.490  1.00 41.42  ? 595  GLN A C     1 
ATOM   5352 O  O     . GLN C 3 595 ? 68.923  -31.943 -5.632  1.00 42.27  ? 595  GLN A O     1 
ATOM   5353 C  CB    . GLN C 3 595 ? 66.475  -33.004 -4.068  1.00 41.68  ? 595  GLN A CB    1 
ATOM   5354 C  CG    . GLN C 3 595 ? 65.845  -34.169 -3.336  1.00 45.30  ? 595  GLN A CG    1 
ATOM   5355 C  CD    . GLN C 3 595 ? 64.470  -34.491 -3.863  1.00 48.36  ? 595  GLN A CD    1 
ATOM   5356 O  OE1   . GLN C 3 595 ? 64.291  -34.640 -5.069  1.00 47.05  ? 595  GLN A OE1   1 
ATOM   5357 N  NE2   . GLN C 3 595 ? 63.490  -34.608 -2.967  1.00 44.03  ? 595  GLN A NE2   1 
ATOM   5358 N  N     . TRP C 3 596 ? 68.713  -30.471 -3.941  1.00 39.90  ? 596  TRP A N     1 
ATOM   5359 C  CA    . TRP C 3 596 ? 69.344  -29.364 -4.644  1.00 38.34  ? 596  TRP A CA    1 
ATOM   5360 C  C     . TRP C 3 596 ? 70.861  -29.567 -4.595  1.00 42.04  ? 596  TRP A C     1 
ATOM   5361 O  O     . TRP C 3 596 ? 71.546  -29.465 -5.620  1.00 43.25  ? 596  TRP A O     1 
ATOM   5362 C  CB    . TRP C 3 596 ? 68.934  -28.033 -3.982  1.00 32.42  ? 596  TRP A CB    1 
ATOM   5363 C  CG    . TRP C 3 596 ? 69.677  -26.802 -4.446  1.00 33.55  ? 596  TRP A CG    1 
ATOM   5364 C  CD1   . TRP C 3 596 ? 70.936  -26.409 -4.081  1.00 32.34  ? 596  TRP A CD1   1 
ATOM   5365 C  CD2   . TRP C 3 596 ? 69.179  -25.780 -5.319  1.00 40.71  ? 596  TRP A CD2   1 
ATOM   5366 N  NE1   . TRP C 3 596 ? 71.255  -25.206 -4.669  1.00 34.55  ? 596  TRP A NE1   1 
ATOM   5367 C  CE2   . TRP C 3 596 ? 70.198  -24.801 -5.443  1.00 40.92  ? 596  TRP A CE2   1 
ATOM   5368 C  CE3   . TRP C 3 596 ? 67.982  -25.602 -6.024  1.00 37.72  ? 596  TRP A CE3   1 
ATOM   5369 C  CZ2   . TRP C 3 596 ? 70.037  -23.652 -6.223  1.00 33.72  ? 596  TRP A CZ2   1 
ATOM   5370 C  CZ3   . TRP C 3 596 ? 67.826  -24.464 -6.795  1.00 34.91  ? 596  TRP A CZ3   1 
ATOM   5371 C  CH2   . TRP C 3 596 ? 68.852  -23.508 -6.895  1.00 33.79  ? 596  TRP A CH2   1 
ATOM   5372 N  N     . ILE C 3 597 ? 71.385  -29.863 -3.405  1.00 42.05  ? 597  ILE A N     1 
ATOM   5373 C  CA    . ILE C 3 597 ? 72.815  -30.087 -3.252  1.00 43.56  ? 597  ILE A CA    1 
ATOM   5374 C  C     . ILE C 3 597 ? 73.176  -31.372 -3.991  1.00 44.12  ? 597  ILE A C     1 
ATOM   5375 O  O     . ILE C 3 597 ? 74.318  -31.567 -4.377  1.00 47.81  ? 597  ILE A O     1 
ATOM   5376 C  CB    . ILE C 3 597 ? 73.213  -30.227 -1.768  1.00 44.83  ? 597  ILE A CB    1 
ATOM   5377 C  CG1   . ILE C 3 597 ? 74.699  -29.898 -1.593  1.00 45.16  ? 597  ILE A CG1   1 
ATOM   5378 C  CG2   . ILE C 3 597 ? 72.974  -31.655 -1.302  1.00 44.01  ? 597  ILE A CG2   1 
ATOM   5379 C  CD1   . ILE C 3 597 ? 75.090  -28.492 -2.021  1.00 38.80  ? 597  ILE A CD1   1 
ATOM   5380 N  N     . GLU C 3 598 ? 72.195  -32.251 -4.177  1.00 42.88  ? 598  GLU A N     1 
ATOM   5381 C  CA    . GLU C 3 598 ? 72.415  -33.500 -4.895  1.00 40.84  ? 598  GLU A CA    1 
ATOM   5382 C  C     . GLU C 3 598 ? 72.696  -33.150 -6.362  1.00 40.76  ? 598  GLU A C     1 
ATOM   5383 O  O     . GLU C 3 598 ? 73.731  -33.524 -6.917  1.00 39.56  ? 598  GLU A O     1 
ATOM   5384 C  CB    . GLU C 3 598 ? 71.178  -34.389 -4.801  1.00 45.25  ? 598  GLU A CB    1 
ATOM   5385 C  CG    . GLU C 3 598 ? 71.456  -35.846 -5.117  1.00 56.39  ? 598  GLU A CG    1 
ATOM   5386 C  CD    . GLU C 3 598 ? 70.230  -36.600 -5.609  1.00 64.33  ? 598  GLU A CD    1 
ATOM   5387 O  OE1   . GLU C 3 598 ? 69.297  -35.956 -6.124  1.00 71.18  ? 598  GLU A OE1   1 
ATOM   5388 O  OE2   . GLU C 3 598 ? 70.206  -37.842 -5.499  1.00 72.27  ? 598  GLU A OE2   1 
ATOM   5389 N  N     . ARG C 3 599 ? 71.769  -32.423 -6.981  1.00 37.20  ? 599  ARG A N     1 
ATOM   5390 C  CA    . ARG C 3 599 ? 71.926  -32.000 -8.367  1.00 37.46  ? 599  ARG A CA    1 
ATOM   5391 C  C     . ARG C 3 599 ? 73.268  -31.285 -8.549  1.00 40.65  ? 599  ARG A C     1 
ATOM   5392 O  O     . ARG C 3 599 ? 73.999  -31.577 -9.488  1.00 40.28  ? 599  ARG A O     1 
ATOM   5393 C  CB    . ARG C 3 599 ? 70.775  -31.064 -8.776  1.00 34.35  ? 599  ARG A CB    1 
ATOM   5394 C  CG    . ARG C 3 599 ? 70.981  -30.331 -10.115 1.00 37.80  ? 599  ARG A CG    1 
ATOM   5395 C  CD    . ARG C 3 599 ? 69.744  -29.515 -10.561 1.00 43.00  ? 599  ARG A CD    1 
ATOM   5396 N  NE    . ARG C 3 599 ? 69.495  -28.316 -9.757  1.00 42.34  ? 599  ARG A NE    1 
ATOM   5397 C  CZ    . ARG C 3 599 ? 70.279  -27.239 -9.745  1.00 48.99  ? 599  ARG A CZ    1 
ATOM   5398 N  NH1   . ARG C 3 599 ? 71.368  -27.195 -10.504 1.00 51.56  ? 599  ARG A NH1   1 
ATOM   5399 N  NH2   . ARG C 3 599 ? 69.992  -26.209 -8.953  1.00 45.42  ? 599  ARG A NH2   1 
ATOM   5400 N  N     . LYS C 3 600 ? 73.578  -30.360 -7.639  1.00 40.53  ? 600  LYS A N     1 
ATOM   5401 C  CA    . LYS C 3 600 ? 74.809  -29.581 -7.677  1.00 41.60  ? 600  LYS A CA    1 
ATOM   5402 C  C     . LYS C 3 600 ? 76.077  -30.418 -7.605  1.00 46.86  ? 600  LYS A C     1 
ATOM   5403 O  O     . LYS C 3 600 ? 77.031  -30.182 -8.361  1.00 49.86  ? 600  LYS A O     1 
ATOM   5404 C  CB    . LYS C 3 600 ? 74.815  -28.565 -6.542  1.00 44.62  ? 600  LYS A CB    1 
ATOM   5405 C  CG    . LYS C 3 600 ? 73.828  -27.433 -6.732  1.00 48.45  ? 600  LYS A CG    1 
ATOM   5406 C  CD    . LYS C 3 600 ? 74.260  -26.508 -7.846  1.00 45.77  ? 600  LYS A CD    1 
ATOM   5407 C  CE    . LYS C 3 600 ? 73.381  -25.285 -7.904  1.00 55.37  ? 600  LYS A CE    1 
ATOM   5408 N  NZ    . LYS C 3 600 ? 74.034  -24.203 -8.690  1.00 62.02  ? 600  LYS A NZ    1 
ATOM   5409 N  N     . VAL C 3 601 ? 76.115  -31.379 -6.688  1.00 42.12  ? 601  VAL A N     1 
ATOM   5410 C  CA    . VAL C 3 601 ? 77.286  -32.225 -6.591  1.00 33.86  ? 601  VAL A CA    1 
ATOM   5411 C  C     . VAL C 3 601 ? 77.355  -33.058 -7.868  1.00 38.00  ? 601  VAL A C     1 
ATOM   5412 O  O     . VAL C 3 601 ? 78.395  -33.094 -8.508  1.00 43.87  ? 601  VAL A O     1 
ATOM   5413 C  CB    . VAL C 3 601 ? 77.230  -33.133 -5.352  1.00 37.19  ? 601  VAL A CB    1 
ATOM   5414 C  CG1   . VAL C 3 601 ? 78.367  -34.153 -5.388  1.00 34.30  ? 601  VAL A CG1   1 
ATOM   5415 C  CG2   . VAL C 3 601 ? 77.350  -32.286 -4.105  1.00 35.29  ? 601  VAL A CG2   1 
ATOM   5416 N  N     . ASN C 3 602 ? 76.261  -33.709 -8.265  1.00 35.21  ? 602  ASN A N     1 
ATOM   5417 C  CA    . ASN C 3 602 ? 76.277  -34.501 -9.506  1.00 39.85  ? 602  ASN A CA    1 
ATOM   5418 C  C     . ASN C 3 602 ? 76.785  -33.651 -10.671 1.00 47.04  ? 602  ASN A C     1 
ATOM   5419 O  O     . ASN C 3 602 ? 77.372  -34.161 -11.622 1.00 46.68  ? 602  ASN A O     1 
ATOM   5420 C  CB    . ASN C 3 602 ? 74.878  -35.001 -9.867  1.00 38.47  ? 602  ASN A CB    1 
ATOM   5421 C  CG    . ASN C 3 602 ? 74.549  -36.317 -9.222  1.00 40.67  ? 602  ASN A CG    1 
ATOM   5422 O  OD1   . ASN C 3 602 ? 75.434  -37.022 -8.741  1.00 51.04  ? 602  ASN A OD1   1 
ATOM   5423 N  ND2   . ASN C 3 602 ? 73.278  -36.667 -9.216  1.00 43.43  ? 602  ASN A ND2   1 
ATOM   5424 N  N     . GLU C 3 603 ? 76.524  -32.351 -10.589 1.00 51.14  ? 603  GLU A N     1 
ATOM   5425 C  CA    . GLU C 3 603 ? 76.937  -31.407 -11.610 1.00 50.83  ? 603  GLU A CA    1 
ATOM   5426 C  C     . GLU C 3 603 ? 78.437  -31.156 -11.527 1.00 50.22  ? 603  GLU A C     1 
ATOM   5427 O  O     . GLU C 3 603 ? 79.151  -31.231 -12.525 1.00 51.67  ? 603  GLU A O     1 
ATOM   5428 C  CB    . GLU C 3 603 ? 76.191  -30.081 -11.429 1.00 51.88  ? 603  GLU A CB    1 
ATOM   5429 C  CG    . GLU C 3 603 ? 74.956  -29.918 -12.292 1.00 59.22  ? 603  GLU A CG    1 
ATOM   5430 C  CD    . GLU C 3 603 ? 74.138  -28.668 -11.948 1.00 65.56  ? 603  GLU A CD    1 
ATOM   5431 O  OE1   . GLU C 3 603 ? 74.732  -27.669 -11.465 1.00 65.06  ? 603  GLU A OE1   1 
ATOM   5432 O  OE2   . GLU C 3 603 ? 72.905  -28.688 -12.180 1.00 61.84  ? 603  GLU A OE2   1 
ATOM   5433 N  N     . TYR C 3 604 ? 78.912  -30.857 -10.327 1.00 49.50  ? 604  TYR A N     1 
ATOM   5434 C  CA    . TYR C 3 604 ? 80.320  -30.575 -10.126 1.00 49.33  ? 604  TYR A CA    1 
ATOM   5435 C  C     . TYR C 3 604 ? 81.266  -31.752 -10.328 1.00 52.87  ? 604  TYR A C     1 
ATOM   5436 O  O     . TYR C 3 604 ? 82.387  -31.559 -10.787 1.00 53.77  ? 604  TYR A O     1 
ATOM   5437 C  CB    . TYR C 3 604 ? 80.537  -29.991 -8.740  1.00 46.83  ? 604  TYR A CB    1 
ATOM   5438 C  CG    . TYR C 3 604 ? 81.986  -29.740 -8.437  1.00 46.39  ? 604  TYR A CG    1 
ATOM   5439 C  CD1   . TYR C 3 604 ? 82.622  -28.609 -8.923  1.00 51.00  ? 604  TYR A CD1   1 
ATOM   5440 C  CD2   . TYR C 3 604 ? 82.716  -30.622 -7.651  1.00 48.51  ? 604  TYR A CD2   1 
ATOM   5441 C  CE1   . TYR C 3 604 ? 83.938  -28.352 -8.631  1.00 54.01  ? 604  TYR A CE1   1 
ATOM   5442 C  CE2   . TYR C 3 604 ? 84.039  -30.375 -7.350  1.00 51.67  ? 604  TYR A CE2   1 
ATOM   5443 C  CZ    . TYR C 3 604 ? 84.640  -29.234 -7.838  1.00 52.88  ? 604  TYR A CZ    1 
ATOM   5444 O  OH    . TYR C 3 604 ? 85.927  -28.935 -7.481  1.00 55.77  ? 604  TYR A OH    1 
ATOM   5445 N  N     . LEU C 3 605 ? 80.842  -32.963 -9.983  1.00 53.14  ? 605  LEU A N     1 
ATOM   5446 C  CA    . LEU C 3 605 ? 81.725  -34.115 -10.164 1.00 54.84  ? 605  LEU A CA    1 
ATOM   5447 C  C     . LEU C 3 605 ? 81.786  -34.587 -11.612 1.00 57.30  ? 605  LEU A C     1 
ATOM   5448 O  O     . LEU C 3 605 ? 82.822  -35.077 -12.068 1.00 61.48  ? 605  LEU A O     1 
ATOM   5449 C  CB    . LEU C 3 605 ? 81.307  -35.280 -9.257  1.00 50.05  ? 605  LEU A CB    1 
ATOM   5450 C  CG    . LEU C 3 605 ? 81.629  -35.045 -7.774  1.00 51.62  ? 605  LEU A CG    1 
ATOM   5451 C  CD1   . LEU C 3 605 ? 81.142  -36.215 -6.923  1.00 46.43  ? 605  LEU A CD1   1 
ATOM   5452 C  CD2   . LEU C 3 605 ? 83.134  -34.846 -7.617  1.00 44.86  ? 605  LEU A CD2   1 
ATOM   5453 N  N     . ASN C 3 606 ? 80.689  -34.422 -12.344 1.00 55.44  ? 606  ASN A N     1 
ATOM   5454 C  CA    . ASN C 3 606 ? 80.662  -34.850 -13.731 1.00 55.49  ? 606  ASN A CA    1 
ATOM   5455 C  C     . ASN C 3 606 ? 81.493  -33.931 -14.595 1.00 59.92  ? 606  ASN A C     1 
ATOM   5456 O  O     . ASN C 3 606 ? 81.988  -34.329 -15.645 1.00 61.30  ? 606  ASN A O     1 
ATOM   5457 C  CB    . ASN C 3 606 ? 79.228  -34.891 -14.254 1.00 50.60  ? 606  ASN A CB    1 
ATOM   5458 C  CG    . ASN C 3 606 ? 78.645  -36.280 -14.225 1.00 55.68  ? 606  ASN A CG    1 
ATOM   5459 O  OD1   . ASN C 3 606 ? 79.182  -37.201 -14.836 1.00 67.03  ? 606  ASN A OD1   1 
ATOM   5460 N  ND2   . ASN C 3 606 ? 77.541  -36.443 -13.510 1.00 58.84  ? 606  ASN A ND2   1 
ATOM   5461 N  N     . GLU C 3 607 ? 81.653  -32.697 -14.141 1.00 62.32  ? 607  GLU A N     1 
ATOM   5462 C  CA    . GLU C 3 607 ? 82.411  -31.730 -14.903 1.00 64.01  ? 607  GLU A CA    1 
ATOM   5463 C  C     . GLU C 3 607 ? 83.886  -31.906 -14.632 1.00 63.55  ? 607  GLU A C     1 
ATOM   5464 O  O     . GLU C 3 607 ? 84.715  -31.845 -15.536 1.00 68.79  ? 607  GLU A O     1 
ATOM   5465 C  CB    . GLU C 3 607 ? 81.986  -30.310 -14.532 1.00 66.03  ? 607  GLU A CB    1 
ATOM   5466 C  CG    . GLU C 3 607 ? 82.374  -29.276 -15.580 1.00 72.85  ? 607  GLU A CG    1 
ATOM   5467 C  CD    . GLU C 3 607 ? 81.818  -27.890 -15.299 1.00 74.19  ? 607  GLU A CD    1 
ATOM   5468 O  OE1   . GLU C 3 607 ? 80.689  -27.791 -14.776 1.00 78.37  ? 607  GLU A OE1   1 
ATOM   5469 O  OE2   . GLU C 3 607 ? 82.506  -26.898 -15.623 1.00 70.82  ? 607  GLU A OE2   1 
ATOM   5470 N  N     . VAL C 3 608 ? 84.205  -32.142 -13.372 1.00 62.01  ? 608  VAL A N     1 
ATOM   5471 C  CA    . VAL C 3 608 ? 85.579  -32.312 -12.940 1.00 63.70  ? 608  VAL A CA    1 
ATOM   5472 C  C     . VAL C 3 608 ? 86.233  -33.578 -13.468 1.00 66.44  ? 608  VAL A C     1 
ATOM   5473 O  O     . VAL C 3 608 ? 87.430  -33.583 -13.765 1.00 66.61  ? 608  VAL A O     1 
ATOM   5474 C  CB    . VAL C 3 608 ? 85.644  -32.301 -11.411 1.00 64.42  ? 608  VAL A CB    1 
ATOM   5475 C  CG1   . VAL C 3 608 ? 87.016  -32.698 -10.941 1.00 61.97  ? 608  VAL A CG1   1 
ATOM   5476 C  CG2   . VAL C 3 608 ? 85.283  -30.915 -10.908 1.00 68.57  ? 608  VAL A CG2   1 
ATOM   5477 N  N     . CYS C 3 609 ? 85.457  -34.650 -13.580 1.00 68.95  ? 609  CYS A N     1 
ATOM   5478 C  CA    . CYS C 3 609 ? 85.993  -35.906 -14.091 1.00 70.36  ? 609  CYS A CA    1 
ATOM   5479 C  C     . CYS C 3 609 ? 85.811  -35.933 -15.602 1.00 70.31  ? 609  CYS A C     1 
ATOM   5480 O  O     . CYS C 3 609 ? 86.241  -36.875 -16.273 1.00 71.24  ? 609  CYS A O     1 
ATOM   5481 C  CB    . CYS C 3 609 ? 85.258  -37.101 -13.475 1.00 72.16  ? 609  CYS A CB    1 
ATOM   5482 S  SG    . CYS C 3 609 ? 85.419  -37.303 -11.677 1.00 75.93  ? 609  CYS A SG    1 
ATOM   5483 N  N     . GLY C 3 610 ? 85.165  -34.890 -16.123 1.00 68.70  ? 610  GLY A N     1 
ATOM   5484 C  CA    . GLY C 3 610 ? 84.909  -34.798 -17.544 1.00 65.24  ? 610  GLY A CA    1 
ATOM   5485 C  C     . GLY C 3 610 ? 84.023  -35.934 -18.022 1.00 67.89  ? 610  GLY A C     1 
ATOM   5486 O  O     . GLY C 3 610 ? 84.508  -36.892 -18.619 1.00 70.69  ? 610  GLY A O     1 
ATOM   5487 N  N     . THR C 3 611 ? 82.726  -35.844 -17.738 1.00 69.33  ? 611  THR A N     1 
ATOM   5488 C  CA    . THR C 3 611 ? 81.753  -36.857 -18.161 1.00 68.92  ? 611  THR A CA    1 
ATOM   5489 C  C     . THR C 3 611 ? 80.381  -36.203 -18.218 1.00 67.41  ? 611  THR A C     1 
ATOM   5490 O  O     . THR C 3 611 ? 80.268  -34.989 -18.050 1.00 63.18  ? 611  THR A O     1 
ATOM   5491 C  CB    . THR C 3 611 ? 81.675  -38.074 -17.191 1.00 70.28  ? 611  THR A CB    1 
ATOM   5492 O  OG1   . THR C 3 611 ? 81.209  -37.647 -15.909 1.00 68.28  ? 611  THR A OG1   1 
ATOM   5493 C  CG2   . THR C 3 611 ? 83.035  -38.728 -17.025 1.00 69.49  ? 611  THR A CG2   1 
ATOM   5494 N  N     . GLU C 3 612 ? 79.343  -37.003 -18.446 1.00 69.02  ? 612  GLU A N     1 
ATOM   5495 C  CA    . GLU C 3 612 ? 77.990  -36.466 -18.529 1.00 72.77  ? 612  GLU A CA    1 
ATOM   5496 C  C     . GLU C 3 612 ? 76.884  -37.435 -18.125 1.00 68.60  ? 612  GLU A C     1 
ATOM   5497 O  O     . GLU C 3 612 ? 76.907  -38.609 -18.490 1.00 69.15  ? 612  GLU A O     1 
ATOM   5498 C  CB    . GLU C 3 612 ? 77.723  -35.950 -19.951 1.00 81.39  ? 612  GLU A CB    1 
ATOM   5499 C  CG    . GLU C 3 612 ? 77.382  -34.466 -20.013 1.00 93.39  ? 612  GLU A CG    1 
ATOM   5500 C  CD    . GLU C 3 612 ? 77.753  -33.735 -18.720 1.00 101.79 ? 612  GLU A CD    1 
ATOM   5501 O  OE1   . GLU C 3 612 ? 77.083  -33.973 -17.686 1.00 104.35 ? 612  GLU A OE1   1 
ATOM   5502 O  OE2   . GLU C 3 612 ? 78.719  -32.939 -18.734 1.00 105.71 ? 612  GLU A OE2   1 
ATOM   5503 N  N     . GLY C 3 613 ? 75.919  -36.926 -17.366 1.00 63.80  ? 613  GLY A N     1 
ATOM   5504 C  CA    . GLY C 3 613 ? 74.798  -37.739 -16.935 1.00 62.53  ? 613  GLY A CA    1 
ATOM   5505 C  C     . GLY C 3 613 ? 75.142  -38.754 -15.868 1.00 63.46  ? 613  GLY A C     1 
ATOM   5506 O  O     . GLY C 3 613 ? 74.261  -39.430 -15.338 1.00 64.41  ? 613  GLY A O     1 
ATOM   5507 N  N     . GLU C 3 614 ? 76.426  -38.885 -15.563 1.00 62.49  ? 614  GLU A N     1 
ATOM   5508 C  CA    . GLU C 3 614 ? 76.856  -39.819 -14.531 1.00 65.32  ? 614  GLU A CA    1 
ATOM   5509 C  C     . GLU C 3 614 ? 76.222  -39.424 -13.188 1.00 62.19  ? 614  GLU A C     1 
ATOM   5510 O  O     . GLU C 3 614 ? 75.935  -38.247 -12.936 1.00 62.68  ? 614  GLU A O     1 
ATOM   5511 C  CB    . GLU C 3 614 ? 78.392  -39.810 -14.437 1.00 70.68  ? 614  GLU A CB    1 
ATOM   5512 C  CG    . GLU C 3 614 ? 79.011  -40.570 -13.262 1.00 83.14  ? 614  GLU A CG    1 
ATOM   5513 C  CD    . GLU C 3 614 ? 78.788  -42.076 -13.322 1.00 91.41  ? 614  GLU A CD    1 
ATOM   5514 O  OE1   . GLU C 3 614 ? 78.530  -42.613 -14.429 1.00 92.03  ? 614  GLU A OE1   1 
ATOM   5515 O  OE2   . GLU C 3 614 ? 78.891  -42.726 -12.253 1.00 95.11  ? 614  GLU A OE2   1 
ATOM   5516 N  N     . ALA C 3 615 ? 75.971  -40.418 -12.342 1.00 56.72  ? 615  ALA A N     1 
ATOM   5517 C  CA    . ALA C 3 615 ? 75.392  -40.173 -11.021 1.00 53.47  ? 615  ALA A CA    1 
ATOM   5518 C  C     . ALA C 3 615 ? 76.421  -40.535 -9.957  1.00 50.00  ? 615  ALA A C     1 
ATOM   5519 O  O     . ALA C 3 615 ? 76.859  -41.673 -9.854  1.00 49.24  ? 615  ALA A O     1 
ATOM   5520 C  CB    . ALA C 3 615 ? 74.122  -40.991 -10.832 1.00 49.36  ? 615  ALA A CB    1 
ATOM   5521 N  N     . PHE C 3 616 ? 76.815  -39.545 -9.173  1.00 48.71  ? 616  PHE A N     1 
ATOM   5522 C  CA    . PHE C 3 616 ? 77.804  -39.754 -8.135  1.00 45.94  ? 616  PHE A CA    1 
ATOM   5523 C  C     . PHE C 3 616 ? 77.154  -39.916 -6.773  1.00 44.59  ? 616  PHE A C     1 
ATOM   5524 O  O     . PHE C 3 616 ? 77.721  -40.531 -5.865  1.00 42.66  ? 616  PHE A O     1 
ATOM   5525 C  CB    . PHE C 3 616 ? 78.770  -38.587 -8.124  1.00 51.50  ? 616  PHE A CB    1 
ATOM   5526 C  CG    . PHE C 3 616 ? 79.708  -38.575 -9.288  1.00 52.57  ? 616  PHE A CG    1 
ATOM   5527 C  CD1   . PHE C 3 616 ? 79.376  -37.904 -10.460 1.00 52.71  ? 616  PHE A CD1   1 
ATOM   5528 C  CD2   . PHE C 3 616 ? 80.942  -39.201 -9.203  1.00 53.34  ? 616  PHE A CD2   1 
ATOM   5529 C  CE1   . PHE C 3 616 ? 80.261  -37.851 -11.523 1.00 49.40  ? 616  PHE A CE1   1 
ATOM   5530 C  CE2   . PHE C 3 616 ? 81.832  -39.152 -10.261 1.00 53.10  ? 616  PHE A CE2   1 
ATOM   5531 C  CZ    . PHE C 3 616 ? 81.492  -38.473 -11.425 1.00 52.10  ? 616  PHE A CZ    1 
ATOM   5532 N  N     . VAL C 3 617 ? 75.960  -39.359 -6.633  1.00 45.69  ? 617  VAL A N     1 
ATOM   5533 C  CA    . VAL C 3 617 ? 75.231  -39.471 -5.381  1.00 45.20  ? 617  VAL A CA    1 
ATOM   5534 C  C     . VAL C 3 617 ? 74.387  -40.729 -5.467  1.00 41.36  ? 617  VAL A C     1 
ATOM   5535 O  O     . VAL C 3 617 ? 73.438  -40.815 -6.251  1.00 36.83  ? 617  VAL A O     1 
ATOM   5536 C  CB    . VAL C 3 617 ? 74.315  -38.270 -5.140  1.00 46.36  ? 617  VAL A CB    1 
ATOM   5537 C  CG1   . VAL C 3 617 ? 74.068  -38.123 -3.662  1.00 53.55  ? 617  VAL A CG1   1 
ATOM   5538 C  CG2   . VAL C 3 617 ? 74.944  -37.008 -5.691  1.00 46.37  ? 617  VAL A CG2   1 
ATOM   5539 N  N     . LEU C 3 618 ? 74.752  -41.712 -4.658  1.00 37.51  ? 618  LEU A N     1 
ATOM   5540 C  CA    . LEU C 3 618 ? 74.061  -42.983 -4.654  1.00 34.59  ? 618  LEU A CA    1 
ATOM   5541 C  C     . LEU C 3 618 ? 72.959  -43.109 -3.611  1.00 32.55  ? 618  LEU A C     1 
ATOM   5542 O  O     . LEU C 3 618 ? 72.093  -43.964 -3.734  1.00 36.50  ? 618  LEU A O     1 
ATOM   5543 C  CB    . LEU C 3 618 ? 75.085  -44.089 -4.456  1.00 37.43  ? 618  LEU A CB    1 
ATOM   5544 C  CG    . LEU C 3 618 ? 75.845  -44.028 -3.135  1.00 37.55  ? 618  LEU A CG    1 
ATOM   5545 C  CD1   . LEU C 3 618 ? 75.209  -44.980 -2.141  1.00 35.06  ? 618  LEU A CD1   1 
ATOM   5546 C  CD2   . LEU C 3 618 ? 77.285  -44.398 -3.370  1.00 42.99  ? 618  LEU A CD2   1 
ATOM   5547 N  N     . TYR C 3 619 ? 72.981  -42.259 -2.592  1.00 32.98  ? 619  TYR A N     1 
ATOM   5548 C  CA    . TYR C 3 619 ? 71.977  -42.328 -1.536  1.00 37.96  ? 619  TYR A CA    1 
ATOM   5549 C  C     . TYR C 3 619 ? 71.888  -41.048 -0.708  1.00 42.11  ? 619  TYR A C     1 
ATOM   5550 O  O     . TYR C 3 619 ? 72.889  -40.376 -0.471  1.00 45.92  ? 619  TYR A O     1 
ATOM   5551 C  CB    . TYR C 3 619 ? 72.289  -43.524 -0.630  1.00 34.78  ? 619  TYR A CB    1 
ATOM   5552 C  CG    . TYR C 3 619 ? 71.376  -43.705 0.562   1.00 32.01  ? 619  TYR A CG    1 
ATOM   5553 C  CD1   . TYR C 3 619 ? 70.058  -44.137 0.399   1.00 31.88  ? 619  TYR A CD1   1 
ATOM   5554 C  CD2   . TYR C 3 619 ? 71.844  -43.495 1.858   1.00 28.03  ? 619  TYR A CD2   1 
ATOM   5555 C  CE1   . TYR C 3 619 ? 69.228  -44.362 1.511   1.00 31.68  ? 619  TYR A CE1   1 
ATOM   5556 C  CE2   . TYR C 3 619 ? 71.027  -43.719 2.970   1.00 29.25  ? 619  TYR A CE2   1 
ATOM   5557 C  CZ    . TYR C 3 619 ? 69.723  -44.154 2.795   1.00 31.47  ? 619  TYR A CZ    1 
ATOM   5558 O  OH    . TYR C 3 619 ? 68.942  -44.408 3.899   1.00 28.00  ? 619  TYR A OH    1 
ATOM   5559 N  N     . GLY C 3 620 ? 70.673  -40.726 -0.271  1.00 43.51  ? 620  GLY A N     1 
ATOM   5560 C  CA    . GLY C 3 620 ? 70.452  -39.534 0.524   1.00 40.00  ? 620  GLY A CA    1 
ATOM   5561 C  C     . GLY C 3 620 ? 69.734  -39.807 1.832   1.00 44.88  ? 620  GLY A C     1 
ATOM   5562 O  O     . GLY C 3 620 ? 68.654  -40.401 1.873   1.00 42.04  ? 620  GLY A O     1 
ATOM   5563 N  N     . ASP C 3 621 ? 70.369  -39.350 2.905   1.00 52.80  ? 621  ASP A N     1 
ATOM   5564 C  CA    . ASP C 3 621 ? 69.887  -39.455 4.287   1.00 57.73  ? 621  ASP A CA    1 
ATOM   5565 C  C     . ASP C 3 621 ? 68.809  -38.386 4.363   1.00 58.44  ? 621  ASP A C     1 
ATOM   5566 O  O     . ASP C 3 621 ? 68.230  -37.993 3.352   1.00 63.48  ? 621  ASP A O     1 
ATOM   5567 C  CB    . ASP C 3 621 ? 71.036  -39.061 5.233   1.00 66.54  ? 621  ASP A CB    1 
ATOM   5568 C  CG    . ASP C 3 621 ? 71.024  -39.805 6.565   1.00 69.52  ? 621  ASP A CG    1 
ATOM   5569 O  OD1   . ASP C 3 621 ? 71.105  -41.057 6.557   1.00 75.86  ? 621  ASP A OD1   1 
ATOM   5570 O  OD2   . ASP C 3 621 ? 70.959  -39.124 7.616   1.00 66.46  ? 621  ASP A OD2   1 
ATOM   5571 N  N     . THR C 3 622 ? 68.550  -37.891 5.558   1.00 56.90  ? 622  THR A N     1 
ATOM   5572 C  CA    . THR C 3 622 ? 67.559  -36.844 5.702   1.00 54.43  ? 622  THR A CA    1 
ATOM   5573 C  C     . THR C 3 622 ? 68.365  -35.554 5.710   1.00 51.32  ? 622  THR A C     1 
ATOM   5574 O  O     . THR C 3 622 ? 67.846  -34.476 5.427   1.00 52.88  ? 622  THR A O     1 
ATOM   5575 C  CB    . THR C 3 622 ? 66.766  -36.983 7.031   1.00 57.86  ? 622  THR A CB    1 
ATOM   5576 O  OG1   . THR C 3 622 ? 65.660  -36.078 7.019   1.00 59.45  ? 622  THR A OG1   1 
ATOM   5577 C  CG2   . THR C 3 622 ? 67.650  -36.650 8.232   1.00 63.68  ? 622  THR A CG2   1 
ATOM   5578 N  N     . ASP C 3 623 ? 69.649  -35.690 6.020   1.00 45.88  ? 623  ASP A N     1 
ATOM   5579 C  CA    . ASP C 3 623 ? 70.552  -34.558 6.084   1.00 42.16  ? 623  ASP A CA    1 
ATOM   5580 C  C     . ASP C 3 623 ? 71.950  -34.923 5.574   1.00 41.19  ? 623  ASP A C     1 
ATOM   5581 O  O     . ASP C 3 623 ? 72.902  -34.153 5.750   1.00 39.99  ? 623  ASP A O     1 
ATOM   5582 C  CB    . ASP C 3 623 ? 70.639  -34.063 7.526   1.00 42.13  ? 623  ASP A CB    1 
ATOM   5583 C  CG    . ASP C 3 623 ? 71.016  -35.167 8.499   1.00 50.03  ? 623  ASP A CG    1 
ATOM   5584 O  OD1   . ASP C 3 623 ? 71.942  -35.944 8.197   1.00 57.37  ? 623  ASP A OD1   1 
ATOM   5585 O  OD2   . ASP C 3 623 ? 70.401  -35.259 9.576   1.00 60.02  ? 623  ASP A OD2   1 
ATOM   5586 N  N     . SER C 3 624 ? 72.066  -36.095 4.948   1.00 35.73  ? 624  SER A N     1 
ATOM   5587 C  CA    . SER C 3 624 ? 73.340  -36.574 4.420   1.00 29.66  ? 624  SER A CA    1 
ATOM   5588 C  C     . SER C 3 624 ? 73.223  -37.057 2.998   1.00 29.59  ? 624  SER A C     1 
ATOM   5589 O  O     . SER C 3 624 ? 72.157  -37.474 2.564   1.00 33.27  ? 624  SER A O     1 
ATOM   5590 C  CB    . SER C 3 624 ? 73.870  -37.759 5.232   1.00 29.35  ? 624  SER A CB    1 
ATOM   5591 O  OG    . SER C 3 624 ? 73.510  -37.699 6.602   1.00 39.12  ? 624  SER A OG    1 
ATOM   5592 N  N     . ILE C 3 625 ? 74.329  -36.987 2.271   1.00 25.47  ? 625  ILE A N     1 
ATOM   5593 C  CA    . ILE C 3 625 ? 74.384  -37.507 0.911   1.00 31.67  ? 625  ILE A CA    1 
ATOM   5594 C  C     . ILE C 3 625 ? 75.628  -38.412 0.844   1.00 34.00  ? 625  ILE A C     1 
ATOM   5595 O  O     . ILE C 3 625 ? 76.661  -38.088 1.429   1.00 34.25  ? 625  ILE A O     1 
ATOM   5596 C  CB    . ILE C 3 625 ? 74.499  -36.401 -0.165  1.00 29.80  ? 625  ILE A CB    1 
ATOM   5597 C  CG1   . ILE C 3 625 ? 75.753  -35.562 0.074   1.00 38.40  ? 625  ILE A CG1   1 
ATOM   5598 C  CG2   . ILE C 3 625 ? 73.256  -35.549 -0.163  1.00 26.19  ? 625  ILE A CG2   1 
ATOM   5599 C  CD1   . ILE C 3 625 ? 76.054  -34.582 -1.037  1.00 33.58  ? 625  ILE A CD1   1 
ATOM   5600 N  N     . TYR C 3 626 ? 75.514  -39.564 0.180   1.00 33.61  ? 626  TYR A N     1 
ATOM   5601 C  CA    . TYR C 3 626 ? 76.642  -40.478 0.052   1.00 33.81  ? 626  TYR A CA    1 
ATOM   5602 C  C     . TYR C 3 626 ? 77.119  -40.504 -1.379  1.00 37.45  ? 626  TYR A C     1 
ATOM   5603 O  O     . TYR C 3 626 ? 76.364  -40.847 -2.287  1.00 42.53  ? 626  TYR A O     1 
ATOM   5604 C  CB    . TYR C 3 626 ? 76.269  -41.887 0.491   1.00 34.24  ? 626  TYR A CB    1 
ATOM   5605 C  CG    . TYR C 3 626 ? 75.988  -41.986 1.968   1.00 35.87  ? 626  TYR A CG    1 
ATOM   5606 C  CD1   . TYR C 3 626 ? 74.784  -41.532 2.492   1.00 39.34  ? 626  TYR A CD1   1 
ATOM   5607 C  CD2   . TYR C 3 626 ? 76.931  -42.509 2.847   1.00 29.92  ? 626  TYR A CD2   1 
ATOM   5608 C  CE1   . TYR C 3 626 ? 74.519  -41.595 3.860   1.00 39.76  ? 626  TYR A CE1   1 
ATOM   5609 C  CE2   . TYR C 3 626 ? 76.680  -42.576 4.215   1.00 33.82  ? 626  TYR A CE2   1 
ATOM   5610 C  CZ    . TYR C 3 626 ? 75.468  -42.114 4.720   1.00 38.82  ? 626  TYR A CZ    1 
ATOM   5611 O  OH    . TYR C 3 626 ? 75.196  -42.135 6.077   1.00 37.75  ? 626  TYR A OH    1 
ATOM   5612 N  N     . VAL C 3 627 ? 78.380  -40.139 -1.579  1.00 37.91  ? 627  VAL A N     1 
ATOM   5613 C  CA    . VAL C 3 627 ? 78.949  -40.082 -2.917  1.00 42.41  ? 627  VAL A CA    1 
ATOM   5614 C  C     . VAL C 3 627 ? 79.973  -41.178 -3.195  1.00 47.45  ? 627  VAL A C     1 
ATOM   5615 O  O     . VAL C 3 627 ? 80.776  -41.530 -2.321  1.00 51.56  ? 627  VAL A O     1 
ATOM   5616 C  CB    . VAL C 3 627 ? 79.590  -38.680 -3.154  1.00 42.56  ? 627  VAL A CB    1 
ATOM   5617 C  CG1   . VAL C 3 627 ? 80.364  -38.646 -4.453  1.00 45.10  ? 627  VAL A CG1   1 
ATOM   5618 C  CG2   . VAL C 3 627 ? 78.502  -37.631 -3.204  1.00 46.86  ? 627  VAL A CG2   1 
ATOM   5619 N  N     . SER C 3 628 ? 79.936  -41.741 -4.405  1.00 46.45  ? 628  SER A N     1 
ATOM   5620 C  CA    . SER C 3 628 ? 80.913  -42.772 -4.761  1.00 49.72  ? 628  SER A CA    1 
ATOM   5621 C  C     . SER C 3 628 ? 82.098  -42.139 -5.508  1.00 45.89  ? 628  SER A C     1 
ATOM   5622 O  O     . SER C 3 628 ? 81.959  -41.651 -6.635  1.00 45.18  ? 628  SER A O     1 
ATOM   5623 C  CB    . SER C 3 628 ? 80.265  -43.878 -5.608  1.00 51.46  ? 628  SER A CB    1 
ATOM   5624 O  OG    . SER C 3 628 ? 79.888  -43.397 -6.874  1.00 56.41  ? 628  SER A OG    1 
ATOM   5625 N  N     . ALA C 3 629 ? 83.260  -42.148 -4.855  1.00 45.11  ? 629  ALA A N     1 
ATOM   5626 C  CA    . ALA C 3 629 ? 84.486  -41.572 -5.408  1.00 47.01  ? 629  ALA A CA    1 
ATOM   5627 C  C     . ALA C 3 629 ? 85.124  -42.490 -6.439  1.00 51.02  ? 629  ALA A C     1 
ATOM   5628 O  O     . ALA C 3 629 ? 86.261  -42.276 -6.846  1.00 51.76  ? 629  ALA A O     1 
ATOM   5629 C  CB    . ALA C 3 629 ? 85.484  -41.273 -4.282  1.00 40.92  ? 629  ALA A CB    1 
ATOM   5630 N  N     . ASP C 3 630 ? 84.379  -43.501 -6.868  1.00 55.33  ? 630  ASP A N     1 
ATOM   5631 C  CA    . ASP C 3 630 ? 84.874  -44.458 -7.846  1.00 58.43  ? 630  ASP A CA    1 
ATOM   5632 C  C     . ASP C 3 630 ? 85.661  -43.868 -9.016  1.00 59.09  ? 630  ASP A C     1 
ATOM   5633 O  O     . ASP C 3 630 ? 86.803  -44.253 -9.242  1.00 59.47  ? 630  ASP A O     1 
ATOM   5634 C  CB    . ASP C 3 630 ? 83.711  -45.308 -8.360  1.00 63.38  ? 630  ASP A CB    1 
ATOM   5635 C  CG    . ASP C 3 630 ? 83.473  -46.550 -7.499  1.00 71.88  ? 630  ASP A CG    1 
ATOM   5636 O  OD1   . ASP C 3 630 ? 83.628  -46.450 -6.260  1.00 77.61  ? 630  ASP A OD1   1 
ATOM   5637 O  OD2   . ASP C 3 630 ? 83.132  -47.619 -8.060  1.00 71.22  ? 630  ASP A OD2   1 
ATOM   5638 N  N     . LYS C 3 631 ? 85.065  -42.936 -9.752  1.00 57.72  ? 631  LYS A N     1 
ATOM   5639 C  CA    . LYS C 3 631 ? 85.751  -42.334 -10.886 1.00 54.11  ? 631  LYS A CA    1 
ATOM   5640 C  C     . LYS C 3 631 ? 86.816  -41.349 -10.427 1.00 56.33  ? 631  LYS A C     1 
ATOM   5641 O  O     . LYS C 3 631 ? 87.805  -41.128 -11.119 1.00 56.16  ? 631  LYS A O     1 
ATOM   5642 C  CB    . LYS C 3 631 ? 84.753  -41.628 -11.794 1.00 52.60  ? 631  LYS A CB    1 
ATOM   5643 C  CG    . LYS C 3 631 ? 83.529  -42.468 -12.086 1.00 56.32  ? 631  LYS A CG    1 
ATOM   5644 C  CD    . LYS C 3 631 ? 83.198  -42.483 -13.564 1.00 61.03  ? 631  LYS A CD    1 
ATOM   5645 C  CE    . LYS C 3 631 ? 82.005  -43.380 -13.842 1.00 62.03  ? 631  LYS A CE    1 
ATOM   5646 N  NZ    . LYS C 3 631 ? 82.199  -44.738 -13.269 1.00 63.24  ? 631  LYS A NZ    1 
ATOM   5647 N  N     . ILE C 3 632 ? 86.615  -40.750 -9.262  1.00 57.65  ? 632  ILE A N     1 
ATOM   5648 C  CA    . ILE C 3 632 ? 87.590  -39.804 -8.734  1.00 59.59  ? 632  ILE A CA    1 
ATOM   5649 C  C     . ILE C 3 632 ? 88.904  -40.545 -8.465  1.00 61.32  ? 632  ILE A C     1 
ATOM   5650 O  O     . ILE C 3 632 ? 89.967  -39.935 -8.386  1.00 67.36  ? 632  ILE A O     1 
ATOM   5651 C  CB    . ILE C 3 632 ? 87.059  -39.132 -7.439  1.00 60.35  ? 632  ILE A CB    1 
ATOM   5652 C  CG1   . ILE C 3 632 ? 85.845  -38.266 -7.781  1.00 59.07  ? 632  ILE A CG1   1 
ATOM   5653 C  CG2   . ILE C 3 632 ? 88.127  -38.269 -6.798  1.00 56.69  ? 632  ILE A CG2   1 
ATOM   5654 C  CD1   . ILE C 3 632 ? 85.174  -37.638 -6.582  1.00 61.25  ? 632  ILE A CD1   1 
ATOM   5655 N  N     . ILE C 3 633 ? 88.827  -41.865 -8.324  1.00 58.62  ? 633  ILE A N     1 
ATOM   5656 C  CA    . ILE C 3 633 ? 90.018  -42.673 -8.099  1.00 56.13  ? 633  ILE A CA    1 
ATOM   5657 C  C     . ILE C 3 633 ? 90.529  -43.186 -9.441  1.00 57.44  ? 633  ILE A C     1 
ATOM   5658 O  O     . ILE C 3 633 ? 91.723  -43.115 -9.710  1.00 55.93  ? 633  ILE A O     1 
ATOM   5659 C  CB    . ILE C 3 633 ? 89.729  -43.875 -7.198  1.00 53.24  ? 633  ILE A CB    1 
ATOM   5660 C  CG1   . ILE C 3 633 ? 89.457  -43.400 -5.775  1.00 47.37  ? 633  ILE A CG1   1 
ATOM   5661 C  CG2   . ILE C 3 633 ? 90.925  -44.827 -7.190  1.00 54.15  ? 633  ILE A CG2   1 
ATOM   5662 C  CD1   . ILE C 3 633 ? 90.691  -43.086 -4.987  1.00 40.35  ? 633  ILE A CD1   1 
ATOM   5663 N  N     . ASP C 3 634 ? 89.630  -43.704 -10.279 1.00 58.26  ? 634  ASP A N     1 
ATOM   5664 C  CA    . ASP C 3 634 ? 90.013  -44.194 -11.605 1.00 63.17  ? 634  ASP A CA    1 
ATOM   5665 C  C     . ASP C 3 634 ? 90.741  -43.085 -12.349 1.00 66.26  ? 634  ASP A C     1 
ATOM   5666 O  O     . ASP C 3 634 ? 91.536  -43.342 -13.248 1.00 66.28  ? 634  ASP A O     1 
ATOM   5667 C  CB    . ASP C 3 634 ? 88.789  -44.598 -12.428 1.00 67.01  ? 634  ASP A CB    1 
ATOM   5668 C  CG    . ASP C 3 634 ? 88.039  -45.767 -11.827 1.00 78.24  ? 634  ASP A CG    1 
ATOM   5669 O  OD1   . ASP C 3 634 ? 88.709  -46.682 -11.291 1.00 77.80  ? 634  ASP A OD1   1 
ATOM   5670 O  OD2   . ASP C 3 634 ? 86.785  -45.773 -11.906 1.00 81.93  ? 634  ASP A OD2   1 
ATOM   5671 N  N     . LYS C 3 635 ? 90.454  -41.845 -11.965 1.00 69.40  ? 635  LYS A N     1 
ATOM   5672 C  CA    . LYS C 3 635 ? 91.080  -40.682 -12.581 1.00 69.03  ? 635  LYS A CA    1 
ATOM   5673 C  C     . LYS C 3 635 ? 92.562  -40.635 -12.208 1.00 69.65  ? 635  LYS A C     1 
ATOM   5674 O  O     . LYS C 3 635 ? 93.319  -39.833 -12.746 1.00 72.55  ? 635  LYS A O     1 
ATOM   5675 C  CB    . LYS C 3 635 ? 90.387  -39.397 -12.109 1.00 68.96  ? 635  LYS A CB    1 
ATOM   5676 C  CG    . LYS C 3 635 ? 90.426  -38.245 -13.108 1.00 64.74  ? 635  LYS A CG    1 
ATOM   5677 C  CD    . LYS C 3 635 ? 89.674  -38.603 -14.386 1.00 64.80  ? 635  LYS A CD    1 
ATOM   5678 C  CE    . LYS C 3 635 ? 89.760  -37.490 -15.429 1.00 66.44  ? 635  LYS A CE    1 
ATOM   5679 N  NZ    . LYS C 3 635 ? 89.265  -37.915 -16.785 1.00 68.06  ? 635  LYS A NZ    1 
ATOM   5680 N  N     . VAL C 3 636 ? 92.966  -41.502 -11.284 1.00 71.68  ? 636  VAL A N     1 
ATOM   5681 C  CA    . VAL C 3 636 ? 94.351  -41.573 -10.821 1.00 71.39  ? 636  VAL A CA    1 
ATOM   5682 C  C     . VAL C 3 636 ? 94.846  -43.025 -10.722 1.00 76.79  ? 636  VAL A C     1 
ATOM   5683 O  O     . VAL C 3 636 ? 95.571  -43.391 -9.792  1.00 79.40  ? 636  VAL A O     1 
ATOM   5684 C  CB    . VAL C 3 636 ? 94.498  -40.883 -9.444  1.00 68.15  ? 636  VAL A CB    1 
ATOM   5685 C  CG1   . VAL C 3 636 ? 95.950  -40.873 -9.008  1.00 68.22  ? 636  VAL A CG1   1 
ATOM   5686 C  CG2   . VAL C 3 636 ? 93.982  -39.462 -9.523  1.00 66.57  ? 636  VAL A CG2   1 
ATOM   5687 N  N     . GLY C 3 637 ? 94.407  -43.855 -11.668 1.00 79.35  ? 637  GLY A N     1 
ATOM   5688 C  CA    . GLY C 3 637 ? 94.829  -45.251 -11.740 1.00 81.80  ? 637  GLY A CA    1 
ATOM   5689 C  C     . GLY C 3 637 ? 94.741  -46.226 -10.575 1.00 81.98  ? 637  GLY A C     1 
ATOM   5690 O  O     . GLY C 3 637 ? 94.596  -47.425 -10.810 1.00 85.32  ? 637  GLY A O     1 
ATOM   5691 N  N     . GLU C 3 638 ? 94.865  -45.747 -9.340  1.00 81.05  ? 638  GLU A N     1 
ATOM   5692 C  CA    . GLU C 3 638 ? 94.786  -46.615 -8.160  1.00 81.84  ? 638  GLU A CA    1 
ATOM   5693 C  C     . GLU C 3 638 ? 95.987  -47.543 -8.057  1.00 80.65  ? 638  GLU A C     1 
ATOM   5694 O  O     . GLU C 3 638 ? 96.001  -48.465 -7.251  1.00 79.56  ? 638  GLU A O     1 
ATOM   5695 C  CB    . GLU C 3 638 ? 93.498  -47.457 -8.200  1.00 83.39  ? 638  GLU A CB    1 
ATOM   5696 C  CG    . GLU C 3 638 ? 93.143  -48.184 -6.888  1.00 80.63  ? 638  GLU A CG    1 
ATOM   5697 C  CD    . GLU C 3 638 ? 91.899  -49.078 -7.002  1.00 80.16  ? 638  GLU A CD    1 
ATOM   5698 O  OE1   . GLU C 3 638 ? 91.237  -49.089 -8.062  1.00 83.07  ? 638  GLU A OE1   1 
ATOM   5699 O  OE2   . GLU C 3 638 ? 91.576  -49.779 -6.023  1.00 78.96  ? 638  GLU A OE2   1 
ATOM   5700 N  N     . SER C 3 639 ? 96.990  -47.298 -8.890  1.00 84.80  ? 639  SER A N     1 
ATOM   5701 C  CA    . SER C 3 639 ? 98.211  -48.097 -8.899  1.00 85.52  ? 639  SER A CA    1 
ATOM   5702 C  C     . SER C 3 639 ? 99.339  -47.120 -8.620  1.00 84.68  ? 639  SER A C     1 
ATOM   5703 O  O     . SER C 3 639 ? 100.519 -47.451 -8.710  1.00 87.68  ? 639  SER A O     1 
ATOM   5704 C  CB    . SER C 3 639 ? 98.425  -48.750 -10.267 1.00 86.65  ? 639  SER A CB    1 
ATOM   5705 O  OG    . SER C 3 639 ? 98.748  -47.774 -11.247 1.00 84.59  ? 639  SER A OG    1 
ATOM   5706 N  N     . LYS C 3 640 ? 98.944  -45.896 -8.296  1.00 81.03  ? 640  LYS A N     1 
ATOM   5707 C  CA    . LYS C 3 640 ? 99.883  -44.840 -7.984  1.00 74.03  ? 640  LYS A CA    1 
ATOM   5708 C  C     . LYS C 3 640 ? 99.750  -44.578 -6.494  1.00 69.67  ? 640  LYS A C     1 
ATOM   5709 O  O     . LYS C 3 640 ? 100.239 -43.578 -5.978  1.00 70.47  ? 640  LYS A O     1 
ATOM   5710 C  CB    . LYS C 3 640 ? 99.544  -43.573 -8.773  1.00 74.79  ? 640  LYS A CB    1 
ATOM   5711 C  CG    . LYS C 3 640 ? 99.569  -43.739 -10.285 1.00 79.13  ? 640  LYS A CG    1 
ATOM   5712 C  CD    . LYS C 3 640 ? 99.241  -42.418 -10.969 1.00 86.57  ? 640  LYS A CD    1 
ATOM   5713 C  CE    . LYS C 3 640 ? 99.326  -42.538 -12.483 1.00 88.39  ? 640  LYS A CE    1 
ATOM   5714 N  NZ    . LYS C 3 640 ? 98.928  -41.262 -13.148 1.00 92.10  ? 640  LYS A NZ    1 
ATOM   5715 N  N     . PHE C 3 641 ? 99.072  -45.483 -5.800  1.00 63.85  ? 641  PHE A N     1 
ATOM   5716 C  CA    . PHE C 3 641 ? 98.901  -45.324 -4.365  1.00 61.28  ? 641  PHE A CA    1 
ATOM   5717 C  C     . PHE C 3 641 ? 99.804  -46.247 -3.581  1.00 57.07  ? 641  PHE A C     1 
ATOM   5718 O  O     . PHE C 3 641 ? 99.822  -47.452 -3.811  1.00 55.40  ? 641  PHE A O     1 
ATOM   5719 C  CB    . PHE C 3 641 ? 97.443  -45.574 -3.960  1.00 57.72  ? 641  PHE A CB    1 
ATOM   5720 C  CG    . PHE C 3 641 ? 96.514  -44.476 -4.367  1.00 55.42  ? 641  PHE A CG    1 
ATOM   5721 C  CD1   . PHE C 3 641 ? 96.439  -43.306 -3.611  1.00 49.66  ? 641  PHE A CD1   1 
ATOM   5722 C  CD2   . PHE C 3 641 ? 95.763  -44.575 -5.537  1.00 55.26  ? 641  PHE A CD2   1 
ATOM   5723 C  CE1   . PHE C 3 641 ? 95.633  -42.243 -4.013  1.00 50.67  ? 641  PHE A CE1   1 
ATOM   5724 C  CE2   . PHE C 3 641 ? 94.949  -43.519 -5.952  1.00 56.85  ? 641  PHE A CE2   1 
ATOM   5725 C  CZ    . PHE C 3 641 ? 94.884  -42.345 -5.187  1.00 54.75  ? 641  PHE A CZ    1 
ATOM   5726 N  N     . ARG C 3 642 ? 100.554 -45.673 -2.651  1.00 56.94  ? 642  ARG A N     1 
ATOM   5727 C  CA    . ARG C 3 642 ? 101.453 -46.458 -1.809  1.00 62.68  ? 642  ARG A CA    1 
ATOM   5728 C  C     . ARG C 3 642 ? 100.660 -47.505 -1.070  1.00 60.88  ? 642  ARG A C     1 
ATOM   5729 O  O     . ARG C 3 642 ? 100.498 -48.627 -1.534  1.00 62.52  ? 642  ARG A O     1 
ATOM   5730 C  CB    . ARG C 3 642 ? 102.147 -45.570 -0.785  1.00 65.16  ? 642  ARG A CB    1 
ATOM   5731 C  CG    . ARG C 3 642 ? 103.343 -44.850 -1.316  1.00 73.35  ? 642  ARG A CG    1 
ATOM   5732 C  CD    . ARG C 3 642 ? 103.885 -43.945 -0.267  1.00 79.61  ? 642  ARG A CD    1 
ATOM   5733 N  NE    . ARG C 3 642 ? 103.241 -42.641 -0.289  1.00 81.77  ? 642  ARG A NE    1 
ATOM   5734 C  CZ    . ARG C 3 642 ? 103.505 -41.700 0.601   1.00 87.49  ? 642  ARG A CZ    1 
ATOM   5735 N  NH1   . ARG C 3 642 ? 104.379 -41.961 1.554   1.00 91.97  ? 642  ARG A NH1   1 
ATOM   5736 N  NH2   . ARG C 3 642 ? 102.939 -40.504 0.524   1.00 89.13  ? 642  ARG A NH2   1 
ATOM   5737 N  N     . ASP C 3 643 ? 100.183 -47.106 0.099   1.00 60.95  ? 643  ASP A N     1 
ATOM   5738 C  CA    . ASP C 3 643 ? 99.375  -47.939 0.970   1.00 63.29  ? 643  ASP A CA    1 
ATOM   5739 C  C     . ASP C 3 643 ? 97.916  -47.469 0.867   1.00 64.35  ? 643  ASP A C     1 
ATOM   5740 O  O     . ASP C 3 643 ? 97.604  -46.539 0.128   1.00 63.74  ? 643  ASP A O     1 
ATOM   5741 C  CB    . ASP C 3 643 ? 99.876  -47.807 2.418   1.00 63.30  ? 643  ASP A CB    1 
ATOM   5742 C  CG    . ASP C 3 643 ? 99.998  -46.346 2.869   1.00 66.26  ? 643  ASP A CG    1 
ATOM   5743 O  OD1   . ASP C 3 643 ? 99.311  -45.482 2.281   1.00 69.61  ? 643  ASP A OD1   1 
ATOM   5744 O  OD2   . ASP C 3 643 ? 100.764 -46.061 3.820   1.00 62.21  ? 643  ASP A OD2   1 
ATOM   5745 N  N     . THR C 3 644 ? 97.025  -48.114 1.607   1.00 63.18  ? 644  THR A N     1 
ATOM   5746 C  CA    . THR C 3 644 ? 95.618  -47.741 1.591   1.00 58.27  ? 644  THR A CA    1 
ATOM   5747 C  C     . THR C 3 644 ? 95.487  -46.386 2.289   1.00 57.00  ? 644  THR A C     1 
ATOM   5748 O  O     . THR C 3 644 ? 94.734  -45.510 1.866   1.00 57.39  ? 644  THR A O     1 
ATOM   5749 C  CB    . THR C 3 644 ? 94.754  -48.814 2.318   1.00 57.42  ? 644  THR A CB    1 
ATOM   5750 O  OG1   . THR C 3 644 ? 94.118  -48.239 3.465   1.00 55.16  ? 644  THR A OG1   1 
ATOM   5751 C  CG2   . THR C 3 644 ? 95.628  -49.990 2.773   1.00 65.16  ? 644  THR A CG2   1 
ATOM   5752 N  N     . ASN C 3 645 ? 96.250  -46.218 3.358   1.00 53.82  ? 645  ASN A N     1 
ATOM   5753 C  CA    . ASN C 3 645 ? 96.246  -44.985 4.136   1.00 53.91  ? 645  ASN A CA    1 
ATOM   5754 C  C     . ASN C 3 645 ? 96.642  -43.761 3.277   1.00 54.07  ? 645  ASN A C     1 
ATOM   5755 O  O     . ASN C 3 645 ? 96.619  -42.618 3.734   1.00 48.32  ? 645  ASN A O     1 
ATOM   5756 C  CB    . ASN C 3 645 ? 97.212  -45.174 5.313   1.00 54.67  ? 645  ASN A CB    1 
ATOM   5757 C  CG    . ASN C 3 645 ? 97.085  -44.100 6.354   1.00 52.39  ? 645  ASN A CG    1 
ATOM   5758 O  OD1   . ASN C 3 645 ? 97.336  -42.937 6.081   1.00 58.63  ? 645  ASN A OD1   1 
ATOM   5759 N  ND2   . ASN C 3 645 ? 96.693  -44.484 7.565   1.00 55.37  ? 645  ASN A ND2   1 
ATOM   5760 N  N     . HIS C 3 646 ? 96.974  -44.006 2.014   1.00 55.84  ? 646  HIS A N     1 
ATOM   5761 C  CA    . HIS C 3 646 ? 97.392  -42.941 1.108   1.00 56.52  ? 646  HIS A CA    1 
ATOM   5762 C  C     . HIS C 3 646 ? 96.222  -42.331 0.335   1.00 59.26  ? 646  HIS A C     1 
ATOM   5763 O  O     . HIS C 3 646 ? 96.084  -41.108 0.277   1.00 60.71  ? 646  HIS A O     1 
ATOM   5764 C  CB    . HIS C 3 646 ? 98.451  -43.498 0.153   1.00 60.07  ? 646  HIS A CB    1 
ATOM   5765 C  CG    . HIS C 3 646 ? 99.062  -42.471 -0.747  1.00 61.07  ? 646  HIS A CG    1 
ATOM   5766 N  ND1   . HIS C 3 646 ? 98.716  -42.347 -2.076  1.00 62.68  ? 646  HIS A ND1   1 
ATOM   5767 C  CD2   . HIS C 3 646 ? 99.993  -41.518 -0.508  1.00 60.72  ? 646  HIS A CD2   1 
ATOM   5768 C  CE1   . HIS C 3 646 ? 99.406  -41.360 -2.617  1.00 58.43  ? 646  HIS A CE1   1 
ATOM   5769 N  NE2   . HIS C 3 646 ? 100.189 -40.840 -1.687  1.00 63.62  ? 646  HIS A NE2   1 
ATOM   5770 N  N     . TRP C 3 647 ? 95.384  -43.179 -0.261  1.00 57.19  ? 647  TRP A N     1 
ATOM   5771 C  CA    . TRP C 3 647 ? 94.220  -42.697 -0.997  1.00 52.30  ? 647  TRP A CA    1 
ATOM   5772 C  C     . TRP C 3 647 ? 93.190  -42.105 -0.015  1.00 49.59  ? 647  TRP A C     1 
ATOM   5773 O  O     . TRP C 3 647 ? 92.409  -41.215 -0.363  1.00 39.73  ? 647  TRP A O     1 
ATOM   5774 C  CB    . TRP C 3 647 ? 93.589  -43.830 -1.826  1.00 57.85  ? 647  TRP A CB    1 
ATOM   5775 C  CG    . TRP C 3 647 ? 93.012  -44.951 -1.019  1.00 65.38  ? 647  TRP A CG    1 
ATOM   5776 C  CD1   . TRP C 3 647 ? 93.648  -46.090 -0.627  1.00 66.69  ? 647  TRP A CD1   1 
ATOM   5777 C  CD2   . TRP C 3 647 ? 91.689  -45.018 -0.466  1.00 68.08  ? 647  TRP A CD2   1 
ATOM   5778 N  NE1   . TRP C 3 647 ? 92.806  -46.862 0.140   1.00 69.95  ? 647  TRP A NE1   1 
ATOM   5779 C  CE2   . TRP C 3 647 ? 91.599  -46.224 0.258   1.00 68.43  ? 647  TRP A CE2   1 
ATOM   5780 C  CE3   . TRP C 3 647 ? 90.576  -44.168 -0.503  1.00 66.49  ? 647  TRP A CE3   1 
ATOM   5781 C  CZ2   . TRP C 3 647 ? 90.438  -46.608 0.929   1.00 65.13  ? 647  TRP A CZ2   1 
ATOM   5782 C  CZ3   . TRP C 3 647 ? 89.425  -44.550 0.164   1.00 65.44  ? 647  TRP A CZ3   1 
ATOM   5783 C  CH2   . TRP C 3 647 ? 89.367  -45.759 0.875   1.00 63.97  ? 647  TRP A CH2   1 
ATOM   5784 N  N     . VAL C 3 648 ? 93.174  -42.601 1.217   1.00 49.06  ? 648  VAL A N     1 
ATOM   5785 C  CA    . VAL C 3 648 ? 92.253  -42.038 2.194   1.00 51.42  ? 648  VAL A CA    1 
ATOM   5786 C  C     . VAL C 3 648 ? 92.677  -40.573 2.355   1.00 55.31  ? 648  VAL A C     1 
ATOM   5787 O  O     . VAL C 3 648 ? 91.841  -39.670 2.420   1.00 56.85  ? 648  VAL A O     1 
ATOM   5788 C  CB    . VAL C 3 648 ? 92.345  -42.776 3.544   1.00 45.60  ? 648  VAL A CB    1 
ATOM   5789 C  CG1   . VAL C 3 648 ? 91.763  -41.916 4.644   1.00 39.42  ? 648  VAL A CG1   1 
ATOM   5790 C  CG2   . VAL C 3 648 ? 91.590  -44.093 3.458   1.00 41.07  ? 648  VAL A CG2   1 
ATOM   5791 N  N     . ASP C 3 649 ? 93.989  -40.353 2.403   1.00 55.07  ? 649  ASP A N     1 
ATOM   5792 C  CA    . ASP C 3 649 ? 94.555  -39.010 2.513   1.00 51.62  ? 649  ASP A CA    1 
ATOM   5793 C  C     . ASP C 3 649 ? 94.106  -38.150 1.327   1.00 48.64  ? 649  ASP A C     1 
ATOM   5794 O  O     . ASP C 3 649 ? 93.606  -37.049 1.485   1.00 45.52  ? 649  ASP A O     1 
ATOM   5795 C  CB    . ASP C 3 649 ? 96.075  -39.101 2.497   1.00 53.43  ? 649  ASP A CB    1 
ATOM   5796 C  CG    . ASP C 3 649 ? 96.697  -38.696 3.800   1.00 56.26  ? 649  ASP A CG    1 
ATOM   5797 O  OD1   . ASP C 3 649 ? 95.952  -38.451 4.764   1.00 62.17  ? 649  ASP A OD1   1 
ATOM   5798 O  OD2   . ASP C 3 649 ? 97.940  -38.623 3.861   1.00 65.80  ? 649  ASP A OD2   1 
ATOM   5799 N  N     . PHE C 3 650 ? 94.309  -38.674 0.128   1.00 50.32  ? 650  PHE A N     1 
ATOM   5800 C  CA    . PHE C 3 650 ? 93.948  -37.984 -1.096  1.00 50.96  ? 650  PHE A CA    1 
ATOM   5801 C  C     . PHE C 3 650 ? 92.481  -37.555 -1.133  1.00 53.44  ? 650  PHE A C     1 
ATOM   5802 O  O     . PHE C 3 650 ? 92.197  -36.381 -1.349  1.00 55.42  ? 650  PHE A O     1 
ATOM   5803 C  CB    . PHE C 3 650 ? 94.297  -38.885 -2.282  1.00 54.02  ? 650  PHE A CB    1 
ATOM   5804 C  CG    . PHE C 3 650 ? 93.677  -38.470 -3.574  1.00 53.12  ? 650  PHE A CG    1 
ATOM   5805 C  CD1   . PHE C 3 650 ? 93.822  -37.176 -4.047  1.00 54.83  ? 650  PHE A CD1   1 
ATOM   5806 C  CD2   . PHE C 3 650 ? 92.964  -39.393 -4.338  1.00 61.22  ? 650  PHE A CD2   1 
ATOM   5807 C  CE1   . PHE C 3 650 ? 93.268  -36.794 -5.268  1.00 55.83  ? 650  PHE A CE1   1 
ATOM   5808 C  CE2   . PHE C 3 650 ? 92.402  -39.025 -5.565  1.00 63.90  ? 650  PHE A CE2   1 
ATOM   5809 C  CZ    . PHE C 3 650 ? 92.555  -37.720 -6.031  1.00 57.82  ? 650  PHE A CZ    1 
ATOM   5810 N  N     . LEU C 3 651 ? 91.548  -38.486 -0.917  1.00 54.21  ? 651  LEU A N     1 
ATOM   5811 C  CA    . LEU C 3 651 ? 90.124  -38.124 -0.932  1.00 46.07  ? 651  LEU A CA    1 
ATOM   5812 C  C     . LEU C 3 651 ? 89.832  -37.105 0.158   1.00 42.43  ? 651  LEU A C     1 
ATOM   5813 O  O     . LEU C 3 651 ? 89.019  -36.208 -0.033  1.00 45.95  ? 651  LEU A O     1 
ATOM   5814 C  CB    . LEU C 3 651 ? 89.217  -39.343 -0.732  1.00 37.21  ? 651  LEU A CB    1 
ATOM   5815 C  CG    . LEU C 3 651 ? 89.046  -40.390 -1.841  1.00 34.41  ? 651  LEU A CG    1 
ATOM   5816 C  CD1   . LEU C 3 651 ? 87.931  -41.318 -1.414  1.00 35.06  ? 651  LEU A CD1   1 
ATOM   5817 C  CD2   . LEU C 3 651 ? 88.706  -39.771 -3.178  1.00 33.21  ? 651  LEU A CD2   1 
ATOM   5818 N  N     . ASP C 3 652 ? 90.497  -37.244 1.298   1.00 40.10  ? 652  ASP A N     1 
ATOM   5819 C  CA    . ASP C 3 652 ? 90.314  -36.313 2.407   1.00 45.52  ? 652  ASP A CA    1 
ATOM   5820 C  C     . ASP C 3 652 ? 90.579  -34.865 1.991   1.00 47.83  ? 652  ASP A C     1 
ATOM   5821 O  O     . ASP C 3 652 ? 89.902  -33.940 2.434   1.00 48.57  ? 652  ASP A O     1 
ATOM   5822 C  CB    . ASP C 3 652 ? 91.240  -36.686 3.568   1.00 44.44  ? 652  ASP A CB    1 
ATOM   5823 C  CG    . ASP C 3 652 ? 91.138  -35.719 4.731   1.00 44.93  ? 652  ASP A CG    1 
ATOM   5824 O  OD1   . ASP C 3 652 ? 90.008  -35.377 5.127   1.00 49.03  ? 652  ASP A OD1   1 
ATOM   5825 O  OD2   . ASP C 3 652 ? 92.187  -35.305 5.257   1.00 55.74  ? 652  ASP A OD2   1 
ATOM   5826 N  N     . LYS C 3 653 ? 91.566  -34.674 1.128   1.00 52.83  ? 653  LYS A N     1 
ATOM   5827 C  CA    . LYS C 3 653 ? 91.927  -33.342 0.659   1.00 52.12  ? 653  LYS A CA    1 
ATOM   5828 C  C     . LYS C 3 653 ? 91.032  -32.882 -0.492  1.00 49.10  ? 653  LYS A C     1 
ATOM   5829 O  O     . LYS C 3 653 ? 90.664  -31.708 -0.582  1.00 50.51  ? 653  LYS A O     1 
ATOM   5830 C  CB    . LYS C 3 653 ? 93.406  -33.342 0.247   1.00 54.78  ? 653  LYS A CB    1 
ATOM   5831 C  CG    . LYS C 3 653 ? 93.814  -32.256 -0.737  1.00 60.82  ? 653  LYS A CG    1 
ATOM   5832 C  CD    . LYS C 3 653 ? 95.292  -31.837 -0.623  1.00 63.40  ? 653  LYS A CD    1 
ATOM   5833 C  CE    . LYS C 3 653 ? 96.262  -33.014 -0.521  1.00 67.61  ? 653  LYS A CE    1 
ATOM   5834 N  NZ    . LYS C 3 653 ? 96.303  -33.607 0.852   1.00 66.75  ? 653  LYS A NZ    1 
ATOM   5835 N  N     . PHE C 3 654 ? 90.674  -33.817 -1.363  1.00 43.81  ? 654  PHE A N     1 
ATOM   5836 C  CA    . PHE C 3 654 ? 89.835  -33.503 -2.505  1.00 40.99  ? 654  PHE A CA    1 
ATOM   5837 C  C     . PHE C 3 654 ? 88.445  -33.057 -2.094  1.00 46.98  ? 654  PHE A C     1 
ATOM   5838 O  O     . PHE C 3 654 ? 87.771  -32.372 -2.853  1.00 48.64  ? 654  PHE A O     1 
ATOM   5839 C  CB    . PHE C 3 654 ? 89.738  -34.710 -3.428  1.00 39.70  ? 654  PHE A CB    1 
ATOM   5840 C  CG    . PHE C 3 654 ? 88.764  -34.536 -4.554  1.00 38.71  ? 654  PHE A CG    1 
ATOM   5841 C  CD1   . PHE C 3 654 ? 87.418  -34.776 -4.359  1.00 40.42  ? 654  PHE A CD1   1 
ATOM   5842 C  CD2   . PHE C 3 654 ? 89.199  -34.161 -5.820  1.00 41.61  ? 654  PHE A CD2   1 
ATOM   5843 C  CE1   . PHE C 3 654 ? 86.505  -34.655 -5.407  1.00 48.77  ? 654  PHE A CE1   1 
ATOM   5844 C  CE2   . PHE C 3 654 ? 88.294  -34.035 -6.881  1.00 47.00  ? 654  PHE A CE2   1 
ATOM   5845 C  CZ    . PHE C 3 654 ? 86.939  -34.285 -6.671  1.00 46.71  ? 654  PHE A CZ    1 
ATOM   5846 N  N     . ALA C 3 655 ? 88.009  -33.446 -0.901  1.00 47.13  ? 655  ALA A N     1 
ATOM   5847 C  CA    . ALA C 3 655 ? 86.690  -33.052 -0.424  1.00 46.86  ? 655  ALA A CA    1 
ATOM   5848 C  C     . ALA C 3 655 ? 86.763  -31.685 0.245   1.00 48.83  ? 655  ALA A C     1 
ATOM   5849 O  O     . ALA C 3 655 ? 85.851  -30.877 0.115   1.00 51.69  ? 655  ALA A O     1 
ATOM   5850 C  CB    . ALA C 3 655 ? 86.152  -34.089 0.566   1.00 46.06  ? 655  ALA A CB    1 
ATOM   5851 N  N     . ARG C 3 656 ? 87.855  -31.430 0.958   1.00 49.32  ? 656  ARG A N     1 
ATOM   5852 C  CA    . ARG C 3 656 ? 88.015  -30.169 1.670   1.00 51.97  ? 656  ARG A CA    1 
ATOM   5853 C  C     . ARG C 3 656 ? 88.363  -28.981 0.786   1.00 55.92  ? 656  ARG A C     1 
ATOM   5854 O  O     . ARG C 3 656 ? 87.855  -27.877 0.993   1.00 56.31  ? 656  ARG A O     1 
ATOM   5855 C  CB    . ARG C 3 656 ? 89.087  -30.302 2.742   1.00 44.04  ? 656  ARG A CB    1 
ATOM   5856 C  CG    . ARG C 3 656 ? 89.189  -29.084 3.618   1.00 54.87  ? 656  ARG A CG    1 
ATOM   5857 C  CD    . ARG C 3 656 ? 90.228  -29.276 4.711   1.00 67.14  ? 656  ARG A CD    1 
ATOM   5858 N  NE    . ARG C 3 656 ? 90.064  -30.549 5.418   1.00 76.39  ? 656  ARG A NE    1 
ATOM   5859 C  CZ    . ARG C 3 656 ? 90.797  -31.642 5.193   1.00 79.88  ? 656  ARG A CZ    1 
ATOM   5860 N  NH1   . ARG C 3 656 ? 91.762  -31.630 4.278   1.00 79.33  ? 656  ARG A NH1   1 
ATOM   5861 N  NH2   . ARG C 3 656 ? 90.561  -32.754 5.883   1.00 82.99  ? 656  ARG A NH2   1 
ATOM   5862 N  N     . GLU C 3 657 ? 89.230  -29.216 -0.195  1.00 55.23  ? 657  GLU A N     1 
ATOM   5863 C  CA    . GLU C 3 657 ? 89.683  -28.162 -1.089  1.00 56.64  ? 657  GLU A CA    1 
ATOM   5864 C  C     . GLU C 3 657 ? 88.839  -27.965 -2.343  1.00 57.05  ? 657  GLU A C     1 
ATOM   5865 O  O     . GLU C 3 657 ? 88.904  -26.913 -2.968  1.00 57.64  ? 657  GLU A O     1 
ATOM   5866 C  CB    . GLU C 3 657 ? 91.123  -28.429 -1.522  1.00 59.77  ? 657  GLU A CB    1 
ATOM   5867 C  CG    . GLU C 3 657 ? 92.147  -28.525 -0.405  1.00 71.44  ? 657  GLU A CG    1 
ATOM   5868 C  CD    . GLU C 3 657 ? 93.550  -28.734 -0.961  1.00 79.44  ? 657  GLU A CD    1 
ATOM   5869 O  OE1   . GLU C 3 657 ? 93.678  -29.480 -1.960  1.00 86.20  ? 657  GLU A OE1   1 
ATOM   5870 O  OE2   . GLU C 3 657 ? 94.517  -28.166 -0.405  1.00 79.01  ? 657  GLU A OE2   1 
ATOM   5871 N  N     . ARG C 3 658 ? 88.055  -28.965 -2.723  1.00 57.19  ? 658  ARG A N     1 
ATOM   5872 C  CA    . ARG C 3 658 ? 87.259  -28.843 -3.934  1.00 59.73  ? 658  ARG A CA    1 
ATOM   5873 C  C     . ARG C 3 658 ? 85.781  -29.186 -3.762  1.00 59.64  ? 658  ARG A C     1 
ATOM   5874 O  O     . ARG C 3 658 ? 84.901  -28.441 -4.197  1.00 60.91  ? 658  ARG A O     1 
ATOM   5875 C  CB    . ARG C 3 658 ? 87.882  -29.712 -5.033  1.00 66.76  ? 658  ARG A CB    1 
ATOM   5876 C  CG    . ARG C 3 658 ? 89.285  -29.275 -5.435  1.00 81.96  ? 658  ARG A CG    1 
ATOM   5877 C  CD    . ARG C 3 658 ? 89.273  -27.905 -6.102  1.00 98.90  ? 658  ARG A CD    1 
ATOM   5878 N  NE    . ARG C 3 658 ? 90.612  -27.329 -6.226  1.00 110.86 ? 658  ARG A NE    1 
ATOM   5879 C  CZ    . ARG C 3 658 ? 90.883  -26.188 -6.860  1.00 117.64 ? 658  ARG A CZ    1 
ATOM   5880 N  NH1   . ARG C 3 658 ? 89.908  -25.493 -7.438  1.00 119.54 ? 658  ARG A NH1   1 
ATOM   5881 N  NH2   . ARG C 3 658 ? 92.132  -25.732 -6.907  1.00 121.64 ? 658  ARG A NH2   1 
ATOM   5882 N  N     . MET C 3 659 ? 85.505  -30.314 -3.128  1.00 56.27  ? 659  MET A N     1 
ATOM   5883 C  CA    . MET C 3 659 ? 84.132  -30.735 -2.927  1.00 49.82  ? 659  MET A CA    1 
ATOM   5884 C  C     . MET C 3 659 ? 83.396  -29.704 -2.094  1.00 48.17  ? 659  MET A C     1 
ATOM   5885 O  O     . MET C 3 659 ? 82.417  -29.113 -2.550  1.00 46.26  ? 659  MET A O     1 
ATOM   5886 C  CB    . MET C 3 659 ? 84.104  -32.076 -2.206  1.00 52.78  ? 659  MET A CB    1 
ATOM   5887 C  CG    . MET C 3 659 ? 82.923  -32.960 -2.552  1.00 54.93  ? 659  MET A CG    1 
ATOM   5888 S  SD    . MET C 3 659 ? 83.358  -34.231 -3.760  1.00 52.00  ? 659  MET A SD    1 
ATOM   5889 C  CE    . MET C 3 659 ? 84.516  -35.224 -2.814  1.00 46.82  ? 659  MET A CE    1 
ATOM   5890 N  N     . GLU C 3 660 ? 83.886  -29.487 -0.874  1.00 46.92  ? 660  GLU A N     1 
ATOM   5891 C  CA    . GLU C 3 660 ? 83.266  -28.558 0.070   1.00 45.18  ? 660  GLU A CA    1 
ATOM   5892 C  C     . GLU C 3 660 ? 82.966  -27.192 -0.529  1.00 50.09  ? 660  GLU A C     1 
ATOM   5893 O  O     . GLU C 3 660 ? 81.835  -26.711 -0.450  1.00 54.58  ? 660  GLU A O     1 
ATOM   5894 C  CB    . GLU C 3 660 ? 84.145  -28.403 1.312   1.00 44.35  ? 660  GLU A CB    1 
ATOM   5895 C  CG    . GLU C 3 660 ? 83.461  -28.798 2.609   1.00 56.96  ? 660  GLU A CG    1 
ATOM   5896 C  CD    . GLU C 3 660 ? 84.221  -29.874 3.378   1.00 63.25  ? 660  GLU A CD    1 
ATOM   5897 O  OE1   . GLU C 3 660 ? 85.249  -29.561 4.014   1.00 66.71  ? 660  GLU A OE1   1 
ATOM   5898 O  OE2   . GLU C 3 660 ? 83.789  -31.044 3.341   1.00 69.87  ? 660  GLU A OE2   1 
ATOM   5899 N  N     . PRO C 3 661 ? 83.979  -26.546 -1.132  1.00 51.17  ? 661  PRO A N     1 
ATOM   5900 C  CA    . PRO C 3 661 ? 83.793  -25.225 -1.744  1.00 46.91  ? 661  PRO A CA    1 
ATOM   5901 C  C     . PRO C 3 661 ? 82.678  -25.190 -2.795  1.00 44.61  ? 661  PRO A C     1 
ATOM   5902 O  O     . PRO C 3 661 ? 81.914  -24.242 -2.853  1.00 46.18  ? 661  PRO A O     1 
ATOM   5903 C  CB    . PRO C 3 661 ? 85.165  -24.931 -2.346  1.00 47.98  ? 661  PRO A CB    1 
ATOM   5904 C  CG    . PRO C 3 661 ? 86.099  -25.632 -1.403  1.00 50.37  ? 661  PRO A CG    1 
ATOM   5905 C  CD    . PRO C 3 661 ? 85.400  -26.947 -1.175  1.00 53.86  ? 661  PRO A CD    1 
ATOM   5906 N  N     . ALA C 3 662 ? 82.579  -26.217 -3.628  1.00 45.00  ? 662  ALA A N     1 
ATOM   5907 C  CA    . ALA C 3 662 ? 81.536  -26.248 -4.650  1.00 46.43  ? 662  ALA A CA    1 
ATOM   5908 C  C     . ALA C 3 662 ? 80.173  -26.456 -3.994  1.00 51.33  ? 662  ALA A C     1 
ATOM   5909 O  O     . ALA C 3 662 ? 79.127  -26.110 -4.556  1.00 50.81  ? 662  ALA A O     1 
ATOM   5910 C  CB    . ALA C 3 662 ? 81.818  -27.367 -5.656  1.00 40.88  ? 662  ALA A CB    1 
ATOM   5911 N  N     . ILE C 3 663 ? 80.196  -27.027 -2.792  1.00 51.70  ? 663  ILE A N     1 
ATOM   5912 C  CA    . ILE C 3 663 ? 78.975  -27.288 -2.051  1.00 46.61  ? 663  ILE A CA    1 
ATOM   5913 C  C     . ILE C 3 663 ? 78.503  -26.000 -1.390  1.00 48.74  ? 663  ILE A C     1 
ATOM   5914 O  O     . ILE C 3 663 ? 77.320  -25.664 -1.473  1.00 48.80  ? 663  ILE A O     1 
ATOM   5915 C  CB    . ILE C 3 663 ? 79.194  -28.407 -0.985  1.00 43.08  ? 663  ILE A CB    1 
ATOM   5916 C  CG1   . ILE C 3 663 ? 79.276  -29.768 -1.671  1.00 39.49  ? 663  ILE A CG1   1 
ATOM   5917 C  CG2   . ILE C 3 663 ? 78.033  -28.457 -0.002  1.00 37.87  ? 663  ILE A CG2   1 
ATOM   5918 C  CD1   . ILE C 3 663 ? 79.750  -30.869 -0.750  1.00 38.86  ? 663  ILE A CD1   1 
ATOM   5919 N  N     . ASP C 3 664 ? 79.414  -25.274 -0.744  1.00 45.31  ? 664  ASP A N     1 
ATOM   5920 C  CA    . ASP C 3 664 ? 79.027  -24.033 -0.083  1.00 48.27  ? 664  ASP A CA    1 
ATOM   5921 C  C     . ASP C 3 664 ? 78.466  -23.047 -1.118  1.00 44.89  ? 664  ASP A C     1 
ATOM   5922 O  O     . ASP C 3 664 ? 77.448  -22.389 -0.881  1.00 41.04  ? 664  ASP A O     1 
ATOM   5923 C  CB    . ASP C 3 664 ? 80.217  -23.411 0.664   1.00 53.38  ? 664  ASP A CB    1 
ATOM   5924 C  CG    . ASP C 3 664 ? 79.790  -22.277 1.609   1.00 71.39  ? 664  ASP A CG    1 
ATOM   5925 O  OD1   . ASP C 3 664 ? 79.248  -22.575 2.701   1.00 76.56  ? 664  ASP A OD1   1 
ATOM   5926 O  OD2   . ASP C 3 664 ? 79.981  -21.090 1.251   1.00 71.55  ? 664  ASP A OD2   1 
ATOM   5927 N  N     . ARG C 3 665 ? 79.117  -22.963 -2.275  1.00 41.17  ? 665  ARG A N     1 
ATOM   5928 C  CA    . ARG C 3 665 ? 78.660  -22.078 -3.337  1.00 41.17  ? 665  ARG A CA    1 
ATOM   5929 C  C     . ARG C 3 665 ? 77.230  -22.408 -3.733  1.00 42.83  ? 665  ARG A C     1 
ATOM   5930 O  O     . ARG C 3 665 ? 76.414  -21.516 -3.908  1.00 48.76  ? 665  ARG A O     1 
ATOM   5931 C  CB    . ARG C 3 665 ? 79.553  -22.190 -4.575  1.00 43.69  ? 665  ARG A CB    1 
ATOM   5932 C  CG    . ARG C 3 665 ? 80.613  -21.105 -4.680  1.00 52.33  ? 665  ARG A CG    1 
ATOM   5933 C  CD    . ARG C 3 665 ? 81.157  -20.988 -6.104  1.00 62.45  ? 665  ARG A CD    1 
ATOM   5934 N  NE    . ARG C 3 665 ? 81.913  -22.167 -6.513  1.00 62.94  ? 665  ARG A NE    1 
ATOM   5935 C  CZ    . ARG C 3 665 ? 83.080  -22.505 -5.984  1.00 66.83  ? 665  ARG A CZ    1 
ATOM   5936 N  NH1   . ARG C 3 665 ? 83.613  -21.744 -5.034  1.00 68.34  ? 665  ARG A NH1   1 
ATOM   5937 N  NH2   . ARG C 3 665 ? 83.703  -23.606 -6.385  1.00 65.41  ? 665  ARG A NH2   1 
ATOM   5938 N  N     . GLY C 3 666 ? 76.925  -23.690 -3.878  1.00 43.55  ? 666  GLY A N     1 
ATOM   5939 C  CA    . GLY C 3 666 ? 75.581  -24.079 -4.259  1.00 43.76  ? 666  GLY A CA    1 
ATOM   5940 C  C     . GLY C 3 666 ? 74.501  -23.751 -3.241  1.00 43.10  ? 666  GLY A C     1 
ATOM   5941 O  O     . GLY C 3 666 ? 73.389  -23.354 -3.610  1.00 43.35  ? 666  GLY A O     1 
ATOM   5942 N  N     . PHE C 3 667 ? 74.809  -23.926 -1.959  1.00 42.17  ? 667  PHE A N     1 
ATOM   5943 C  CA    . PHE C 3 667 ? 73.837  -23.630 -0.910  1.00 46.67  ? 667  PHE A CA    1 
ATOM   5944 C  C     . PHE C 3 667 ? 73.576  -22.132 -0.742  1.00 50.12  ? 667  PHE A C     1 
ATOM   5945 O  O     . PHE C 3 667 ? 72.585  -21.735 -0.117  1.00 56.26  ? 667  PHE A O     1 
ATOM   5946 C  CB    . PHE C 3 667 ? 74.277  -24.250 0.423   1.00 43.26  ? 667  PHE A CB    1 
ATOM   5947 C  CG    . PHE C 3 667 ? 73.764  -25.645 0.634   1.00 47.56  ? 667  PHE A CG    1 
ATOM   5948 C  CD1   . PHE C 3 667 ? 72.407  -25.937 0.463   1.00 45.40  ? 667  PHE A CD1   1 
ATOM   5949 C  CD2   . PHE C 3 667 ? 74.622  -26.670 1.007   1.00 45.78  ? 667  PHE A CD2   1 
ATOM   5950 C  CE1   . PHE C 3 667 ? 71.921  -27.223 0.661   1.00 38.27  ? 667  PHE A CE1   1 
ATOM   5951 C  CE2   . PHE C 3 667 ? 74.135  -27.966 1.207   1.00 42.06  ? 667  PHE A CE2   1 
ATOM   5952 C  CZ    . PHE C 3 667 ? 72.784  -28.237 1.033   1.00 34.45  ? 667  PHE A CZ    1 
ATOM   5953 N  N     . ARG C 3 668 ? 74.459  -21.302 -1.291  1.00 48.66  ? 668  ARG A N     1 
ATOM   5954 C  CA    . ARG C 3 668 ? 74.270  -19.858 -1.214  1.00 45.95  ? 668  ARG A CA    1 
ATOM   5955 C  C     . ARG C 3 668 ? 73.367  -19.418 -2.355  1.00 42.17  ? 668  ARG A C     1 
ATOM   5956 O  O     . ARG C 3 668 ? 72.527  -18.540 -2.191  1.00 37.37  ? 668  ARG A O     1 
ATOM   5957 C  CB    . ARG C 3 668 ? 75.604  -19.128 -1.309  1.00 45.35  ? 668  ARG A CB    1 
ATOM   5958 C  CG    . ARG C 3 668 ? 76.391  -19.144 -0.020  1.00 51.46  ? 668  ARG A CG    1 
ATOM   5959 C  CD    . ARG C 3 668 ? 77.742  -18.440 -0.159  1.00 53.99  ? 668  ARG A CD    1 
ATOM   5960 N  NE    . ARG C 3 668 ? 78.502  -18.518 1.090   1.00 69.50  ? 668  ARG A NE    1 
ATOM   5961 C  CZ    . ARG C 3 668 ? 78.303  -17.736 2.154   1.00 73.70  ? 668  ARG A CZ    1 
ATOM   5962 N  NH1   . ARG C 3 668 ? 77.361  -16.789 2.121   1.00 73.94  ? 668  ARG A NH1   1 
ATOM   5963 N  NH2   . ARG C 3 668 ? 79.023  -17.920 3.271   1.00 68.19  ? 668  ARG A NH2   1 
ATOM   5964 N  N     . GLU C 3 669 ? 73.542  -20.038 -3.515  1.00 43.78  ? 669  GLU A N     1 
ATOM   5965 C  CA    . GLU C 3 669 ? 72.722  -19.703 -4.667  1.00 48.80  ? 669  GLU A CA    1 
ATOM   5966 C  C     . GLU C 3 669 ? 71.280  -20.061 -4.365  1.00 50.82  ? 669  GLU A C     1 
ATOM   5967 O  O     . GLU C 3 669 ? 70.366  -19.475 -4.938  1.00 57.24  ? 669  GLU A O     1 
ATOM   5968 C  CB    . GLU C 3 669 ? 73.193  -20.449 -5.919  1.00 45.64  ? 669  GLU A CB    1 
ATOM   5969 C  CG    . GLU C 3 669 ? 72.224  -20.329 -7.085  1.00 54.05  ? 669  GLU A CG    1 
ATOM   5970 C  CD    . GLU C 3 669 ? 72.747  -20.956 -8.366  1.00 59.29  ? 669  GLU A CD    1 
ATOM   5971 O  OE1   . GLU C 3 669 ? 73.967  -20.869 -8.626  1.00 65.32  ? 669  GLU A OE1   1 
ATOM   5972 O  OE2   . GLU C 3 669 ? 71.932  -21.526 -9.120  1.00 58.38  ? 669  GLU A OE2   1 
ATOM   5973 N  N     . MET C 3 670 ? 71.081  -21.016 -3.458  1.00 48.15  ? 670  MET A N     1 
ATOM   5974 C  CA    . MET C 3 670 ? 69.733  -21.445 -3.074  1.00 41.18  ? 670  MET A CA    1 
ATOM   5975 C  C     . MET C 3 670 ? 69.168  -20.503 -2.030  1.00 36.71  ? 670  MET A C     1 
ATOM   5976 O  O     . MET C 3 670 ? 67.972  -20.270 -1.978  1.00 37.77  ? 670  MET A O     1 
ATOM   5977 C  CB    . MET C 3 670 ? 69.756  -22.860 -2.500  1.00 44.07  ? 670  MET A CB    1 
ATOM   5978 C  CG    . MET C 3 670 ? 68.374  -23.399 -2.199  1.00 42.59  ? 670  MET A CG    1 
ATOM   5979 S  SD    . MET C 3 670 ? 68.392  -24.929 -1.243  1.00 46.30  ? 670  MET A SD    1 
ATOM   5980 C  CE    . MET C 3 670 ? 68.581  -24.252 0.438   1.00 38.70  ? 670  MET A CE    1 
ATOM   5981 N  N     . CYS C 3 671 ? 70.039  -19.968 -1.188  1.00 35.98  ? 671  CYS A N     1 
ATOM   5982 C  CA    . CYS C 3 671 ? 69.617  -19.040 -0.160  1.00 40.03  ? 671  CYS A CA    1 
ATOM   5983 C  C     . CYS C 3 671 ? 69.041  -17.780 -0.810  1.00 47.06  ? 671  CYS A C     1 
ATOM   5984 O  O     . CYS C 3 671 ? 68.053  -17.213 -0.340  1.00 50.99  ? 671  CYS A O     1 
ATOM   5985 C  CB    . CYS C 3 671 ? 70.810  -18.681 0.723   1.00 39.66  ? 671  CYS A CB    1 
ATOM   5986 S  SG    . CYS C 3 671 ? 70.491  -17.409 1.970   1.00 54.57  ? 671  CYS A SG    1 
ATOM   5987 N  N     . GLU C 3 672 ? 69.658  -17.335 -1.898  1.00 51.62  ? 672  GLU A N     1 
ATOM   5988 C  CA    . GLU C 3 672 ? 69.175  -16.146 -2.577  1.00 49.83  ? 672  GLU A CA    1 
ATOM   5989 C  C     . GLU C 3 672 ? 67.908  -16.448 -3.344  1.00 45.00  ? 672  GLU A C     1 
ATOM   5990 O  O     . GLU C 3 672 ? 66.967  -15.675 -3.312  1.00 47.80  ? 672  GLU A O     1 
ATOM   5991 C  CB    . GLU C 3 672 ? 70.224  -15.593 -3.532  1.00 56.55  ? 672  GLU A CB    1 
ATOM   5992 C  CG    . GLU C 3 672 ? 69.651  -14.471 -4.373  1.00 73.60  ? 672  GLU A CG    1 
ATOM   5993 C  CD    . GLU C 3 672 ? 70.693  -13.481 -4.843  1.00 82.58  ? 672  GLU A CD    1 
ATOM   5994 O  OE1   . GLU C 3 672 ? 71.524  -13.849 -5.703  1.00 85.66  ? 672  GLU A OE1   1 
ATOM   5995 O  OE2   . GLU C 3 672 ? 70.672  -12.334 -4.342  1.00 88.54  ? 672  GLU A OE2   1 
ATOM   5996 N  N     . TYR C 3 673 ? 67.909  -17.572 -4.048  1.00 44.56  ? 673  TYR A N     1 
ATOM   5997 C  CA    . TYR C 3 673 ? 66.764  -18.028 -4.828  1.00 43.09  ? 673  TYR A CA    1 
ATOM   5998 C  C     . TYR C 3 673 ? 65.480  -17.985 -3.995  1.00 45.67  ? 673  TYR A C     1 
ATOM   5999 O  O     . TYR C 3 673 ? 64.434  -17.519 -4.457  1.00 40.67  ? 673  TYR A O     1 
ATOM   6000 C  CB    . TYR C 3 673 ? 67.026  -19.453 -5.295  1.00 38.16  ? 673  TYR A CB    1 
ATOM   6001 C  CG    . TYR C 3 673 ? 65.930  -20.051 -6.122  1.00 40.50  ? 673  TYR A CG    1 
ATOM   6002 C  CD1   . TYR C 3 673 ? 65.244  -19.288 -7.057  1.00 40.85  ? 673  TYR A CD1   1 
ATOM   6003 C  CD2   . TYR C 3 673 ? 65.639  -21.409 -6.042  1.00 38.30  ? 673  TYR A CD2   1 
ATOM   6004 C  CE1   . TYR C 3 673 ? 64.298  -19.863 -7.902  1.00 41.43  ? 673  TYR A CE1   1 
ATOM   6005 C  CE2   . TYR C 3 673 ? 64.696  -21.994 -6.883  1.00 38.18  ? 673  TYR A CE2   1 
ATOM   6006 C  CZ    . TYR C 3 673 ? 64.029  -21.214 -7.815  1.00 39.06  ? 673  TYR A CZ    1 
ATOM   6007 O  OH    . TYR C 3 673 ? 63.105  -21.785 -8.669  1.00 43.28  ? 673  TYR A OH    1 
ATOM   6008 N  N     . MET C 3 674 ? 65.574  -18.494 -2.769  1.00 45.59  ? 674  MET A N     1 
ATOM   6009 C  CA    . MET C 3 674 ? 64.453  -18.507 -1.829  1.00 47.11  ? 674  MET A CA    1 
ATOM   6010 C  C     . MET C 3 674 ? 64.457  -17.245 -0.963  1.00 46.31  ? 674  MET A C     1 
ATOM   6011 O  O     . MET C 3 674 ? 63.594  -17.078 -0.098  1.00 46.34  ? 674  MET A O     1 
ATOM   6012 C  CB    . MET C 3 674 ? 64.532  -19.741 -0.932  1.00 45.59  ? 674  MET A CB    1 
ATOM   6013 C  CG    . MET C 3 674 ? 64.156  -21.034 -1.628  1.00 46.05  ? 674  MET A CG    1 
ATOM   6014 S  SD    . MET C 3 674 ? 62.387  -21.209 -1.932  1.00 49.53  ? 674  MET A SD    1 
ATOM   6015 C  CE    . MET C 3 674 ? 62.375  -21.476 -3.749  1.00 43.80  ? 674  MET A CE    1 
ATOM   6016 N  N     . ASN C 3 675 ? 65.445  -16.377 -1.188  1.00 40.42  ? 675  ASN A N     1 
ATOM   6017 C  CA    . ASN C 3 675 ? 65.542  -15.118 -0.470  1.00 38.08  ? 675  ASN A CA    1 
ATOM   6018 C  C     . ASN C 3 675 ? 65.443  -15.337 1.035   1.00 38.69  ? 675  ASN A C     1 
ATOM   6019 O  O     . ASN C 3 675 ? 64.419  -15.055 1.631   1.00 41.56  ? 675  ASN A O     1 
ATOM   6020 C  CB    . ASN C 3 675 ? 64.398  -14.217 -0.934  1.00 41.75  ? 675  ASN A CB    1 
ATOM   6021 C  CG    . ASN C 3 675 ? 64.595  -12.776 -0.558  1.00 47.06  ? 675  ASN A CG    1 
ATOM   6022 O  OD1   . ASN C 3 675 ? 64.988  -12.452 0.565   1.00 50.55  ? 675  ASN A OD1   1 
ATOM   6023 N  ND2   . ASN C 3 675 ? 64.309  -11.891 -1.497  1.00 48.31  ? 675  ASN A ND2   1 
ATOM   6024 N  N     . ASN C 3 676 ? 66.493  -15.843 1.660   1.00 37.86  ? 676  ASN A N     1 
ATOM   6025 C  CA    . ASN C 3 676 ? 66.423  -16.080 3.094   1.00 37.55  ? 676  ASN A CA    1 
ATOM   6026 C  C     . ASN C 3 676 ? 67.166  -15.036 3.928   1.00 41.02  ? 676  ASN A C     1 
ATOM   6027 O  O     . ASN C 3 676 ? 67.997  -14.278 3.429   1.00 35.85  ? 676  ASN A O     1 
ATOM   6028 C  CB    . ASN C 3 676 ? 66.939  -17.484 3.415   1.00 33.15  ? 676  ASN A CB    1 
ATOM   6029 C  CG    . ASN C 3 676 ? 66.000  -18.578 2.918   1.00 43.80  ? 676  ASN A CG    1 
ATOM   6030 O  OD1   . ASN C 3 676 ? 64.873  -18.709 3.395   1.00 50.25  ? 676  ASN A OD1   1 
ATOM   6031 N  ND2   . ASN C 3 676 ? 66.461  -19.366 1.959   1.00 42.76  ? 676  ASN A ND2   1 
ATOM   6032 N  N     . LYS C 3 677 ? 66.863  -15.008 5.218   1.00 41.87  ? 677  LYS A N     1 
ATOM   6033 C  CA    . LYS C 3 677 ? 67.484  -14.065 6.134   1.00 39.74  ? 677  LYS A CA    1 
ATOM   6034 C  C     . LYS C 3 677 ? 68.992  -14.235 6.312   1.00 40.50  ? 677  LYS A C     1 
ATOM   6035 O  O     . LYS C 3 677 ? 69.743  -13.279 6.151   1.00 41.87  ? 677  LYS A O     1 
ATOM   6036 C  CB    . LYS C 3 677 ? 66.781  -14.156 7.492   1.00 41.66  ? 677  LYS A CB    1 
ATOM   6037 C  CG    . LYS C 3 677 ? 67.194  -13.095 8.496   1.00 38.89  ? 677  LYS A CG    1 
ATOM   6038 C  CD    . LYS C 3 677 ? 66.125  -12.921 9.557   1.00 43.65  ? 677  LYS A CD    1 
ATOM   6039 C  CE    . LYS C 3 677 ? 66.613  -12.040 10.696  1.00 47.87  ? 677  LYS A CE    1 
ATOM   6040 N  NZ    . LYS C 3 677 ? 67.142  -10.747 10.194  1.00 56.56  ? 677  LYS A NZ    1 
ATOM   6041 N  N     . GLN C 3 678 ? 69.435  -15.445 6.645   1.00 42.01  ? 678  GLN A N     1 
ATOM   6042 C  CA    . GLN C 3 678 ? 70.862  -15.702 6.879   1.00 43.25  ? 678  GLN A CA    1 
ATOM   6043 C  C     . GLN C 3 678 ? 71.256  -17.060 6.344   1.00 46.17  ? 678  GLN A C     1 
ATOM   6044 O  O     . GLN C 3 678 ? 70.561  -18.030 6.586   1.00 50.22  ? 678  GLN A O     1 
ATOM   6045 C  CB    . GLN C 3 678 ? 71.143  -15.668 8.384   1.00 42.32  ? 678  GLN A CB    1 
ATOM   6046 C  CG    . GLN C 3 678 ? 72.604  -15.740 8.797   1.00 46.61  ? 678  GLN A CG    1 
ATOM   6047 C  CD    . GLN C 3 678 ? 72.785  -15.815 10.322  1.00 58.27  ? 678  GLN A CD    1 
ATOM   6048 O  OE1   . GLN C 3 678 ? 73.914  -15.886 10.826  1.00 62.25  ? 678  GLN A OE1   1 
ATOM   6049 N  NE2   . GLN C 3 678 ? 71.672  -15.802 11.057  1.00 54.35  ? 678  GLN A NE2   1 
ATOM   6050 N  N     . HIS C 3 679 ? 72.376  -17.140 5.634   1.00 47.14  ? 679  HIS A N     1 
ATOM   6051 C  CA    . HIS C 3 679 ? 72.835  -18.427 5.103   1.00 46.79  ? 679  HIS A CA    1 
ATOM   6052 C  C     . HIS C 3 679 ? 73.403  -19.306 6.221   1.00 44.23  ? 679  HIS A C     1 
ATOM   6053 O  O     . HIS C 3 679 ? 74.370  -18.932 6.887   1.00 42.63  ? 679  HIS A O     1 
ATOM   6054 C  CB    . HIS C 3 679 ? 73.905  -18.219 4.026   1.00 48.81  ? 679  HIS A CB    1 
ATOM   6055 C  CG    . HIS C 3 679 ? 74.573  -19.486 3.596   1.00 52.84  ? 679  HIS A CG    1 
ATOM   6056 N  ND1   . HIS C 3 679 ? 75.863  -19.809 3.962   1.00 46.61  ? 679  HIS A ND1   1 
ATOM   6057 C  CD2   . HIS C 3 679 ? 74.114  -20.533 2.871   1.00 52.97  ? 679  HIS A CD2   1 
ATOM   6058 C  CE1   . HIS C 3 679 ? 76.169  -21.000 3.479   1.00 50.21  ? 679  HIS A CE1   1 
ATOM   6059 N  NE2   . HIS C 3 679 ? 75.125  -21.460 2.814   1.00 49.40  ? 679  HIS A NE2   1 
ATOM   6060 N  N     . LEU C 3 680 ? 72.810  -20.483 6.411   1.00 43.25  ? 680  LEU A N     1 
ATOM   6061 C  CA    . LEU C 3 680 ? 73.246  -21.383 7.478   1.00 41.88  ? 680  LEU A CA    1 
ATOM   6062 C  C     . LEU C 3 680 ? 73.402  -22.870 7.124   1.00 36.06  ? 680  LEU A C     1 
ATOM   6063 O  O     . LEU C 3 680 ? 73.651  -23.678 8.002   1.00 40.20  ? 680  LEU A O     1 
ATOM   6064 C  CB    . LEU C 3 680 ? 72.293  -21.232 8.687   1.00 39.54  ? 680  LEU A CB    1 
ATOM   6065 C  CG    . LEU C 3 680 ? 72.284  -19.837 9.339   1.00 37.38  ? 680  LEU A CG    1 
ATOM   6066 C  CD1   . LEU C 3 680 ? 71.265  -19.765 10.461  1.00 41.82  ? 680  LEU A CD1   1 
ATOM   6067 C  CD2   . LEU C 3 680 ? 73.676  -19.527 9.859   1.00 37.57  ? 680  LEU A CD2   1 
ATOM   6068 N  N     . MET C 3 681 ? 73.254  -23.231 5.852   1.00 34.41  ? 681  MET A N     1 
ATOM   6069 C  CA    . MET C 3 681 ? 73.402  -24.622 5.419   1.00 31.67  ? 681  MET A CA    1 
ATOM   6070 C  C     . MET C 3 681 ? 74.884  -25.021 5.246   1.00 38.38  ? 681  MET A C     1 
ATOM   6071 O  O     . MET C 3 681 ? 75.495  -24.809 4.195   1.00 35.61  ? 681  MET A O     1 
ATOM   6072 C  CB    . MET C 3 681 ? 72.662  -24.855 4.100   1.00 28.41  ? 681  MET A CB    1 
ATOM   6073 C  CG    . MET C 3 681 ? 71.209  -24.449 4.107   1.00 36.91  ? 681  MET A CG    1 
ATOM   6074 S  SD    . MET C 3 681 ? 70.138  -25.280 5.308   1.00 39.68  ? 681  MET A SD    1 
ATOM   6075 C  CE    . MET C 3 681 ? 69.234  -26.286 4.216   1.00 44.82  ? 681  MET A CE    1 
ATOM   6076 N  N     . PHE C 3 682 ? 75.447  -25.622 6.288   1.00 38.33  ? 682  PHE A N     1 
ATOM   6077 C  CA    . PHE C 3 682 ? 76.833  -26.038 6.270   1.00 37.42  ? 682  PHE A CA    1 
ATOM   6078 C  C     . PHE C 3 682 ? 76.942  -27.556 6.162   1.00 42.23  ? 682  PHE A C     1 
ATOM   6079 O  O     . PHE C 3 682 ? 76.566  -28.295 7.079   1.00 42.37  ? 682  PHE A O     1 
ATOM   6080 C  CB    . PHE C 3 682 ? 77.526  -25.540 7.524   1.00 38.21  ? 682  PHE A CB    1 
ATOM   6081 C  CG    . PHE C 3 682 ? 77.335  -24.070 7.774   1.00 40.85  ? 682  PHE A CG    1 
ATOM   6082 C  CD1   . PHE C 3 682 ? 77.279  -23.172 6.709   1.00 39.93  ? 682  PHE A CD1   1 
ATOM   6083 C  CD2   . PHE C 3 682 ? 77.257  -23.575 9.080   1.00 34.69  ? 682  PHE A CD2   1 
ATOM   6084 C  CE1   . PHE C 3 682 ? 77.153  -21.811 6.949   1.00 42.93  ? 682  PHE A CE1   1 
ATOM   6085 C  CE2   . PHE C 3 682 ? 77.134  -22.223 9.325   1.00 29.84  ? 682  PHE A CE2   1 
ATOM   6086 C  CZ    . PHE C 3 682 ? 77.083  -21.336 8.267   1.00 38.71  ? 682  PHE A CZ    1 
ATOM   6087 N  N     . MET C 3 683 ? 77.462  -28.016 5.029   1.00 40.21  ? 683  MET A N     1 
ATOM   6088 C  CA    . MET C 3 683 ? 77.594  -29.431 4.783   1.00 43.02  ? 683  MET A CA    1 
ATOM   6089 C  C     . MET C 3 683 ? 79.063  -29.843 4.676   1.00 47.57  ? 683  MET A C     1 
ATOM   6090 O  O     . MET C 3 683 ? 79.715  -29.599 3.665   1.00 49.05  ? 683  MET A O     1 
ATOM   6091 C  CB    . MET C 3 683 ? 76.831  -29.779 3.511   1.00 37.56  ? 683  MET A CB    1 
ATOM   6092 C  CG    . MET C 3 683 ? 76.639  -31.249 3.325   1.00 43.01  ? 683  MET A CG    1 
ATOM   6093 S  SD    . MET C 3 683 ? 75.665  -31.614 1.881   1.00 47.23  ? 683  MET A SD    1 
ATOM   6094 C  CE    . MET C 3 683 ? 76.963  -31.759 0.694   1.00 44.68  ? 683  MET A CE    1 
ATOM   6095 N  N     . ASP C 3 684 ? 79.579  -30.456 5.739   1.00 51.49  ? 684  ASP A N     1 
ATOM   6096 C  CA    . ASP C 3 684 ? 80.965  -30.909 5.775   1.00 51.48  ? 684  ASP A CA    1 
ATOM   6097 C  C     . ASP C 3 684 ? 81.070  -32.419 5.613   1.00 49.41  ? 684  ASP A C     1 
ATOM   6098 O  O     . ASP C 3 684 ? 80.229  -33.175 6.091   1.00 50.78  ? 684  ASP A O     1 
ATOM   6099 C  CB    . ASP C 3 684 ? 81.637  -30.505 7.094   1.00 61.37  ? 684  ASP A CB    1 
ATOM   6100 C  CG    . ASP C 3 684 ? 81.529  -29.010 7.381   1.00 78.00  ? 684  ASP A CG    1 
ATOM   6101 O  OD1   . ASP C 3 684 ? 81.585  -28.205 6.423   1.00 81.74  ? 684  ASP A OD1   1 
ATOM   6102 O  OD2   . ASP C 3 684 ? 81.402  -28.644 8.571   1.00 85.60  ? 684  ASP A OD2   1 
ATOM   6103 N  N     . ARG C 3 685 ? 82.110  -32.852 4.923   1.00 46.80  ? 685  ARG A N     1 
ATOM   6104 C  CA    . ARG C 3 685 ? 82.346  -34.267 4.717   1.00 44.67  ? 685  ARG A CA    1 
ATOM   6105 C  C     . ARG C 3 685 ? 82.622  -34.926 6.058   1.00 39.63  ? 685  ARG A C     1 
ATOM   6106 O  O     . ARG C 3 685 ? 83.320  -34.366 6.897   1.00 38.07  ? 685  ARG A O     1 
ATOM   6107 C  CB    . ARG C 3 685 ? 83.542  -34.460 3.776   1.00 42.79  ? 685  ARG A CB    1 
ATOM   6108 C  CG    . ARG C 3 685 ? 84.164  -35.849 3.813   1.00 42.79  ? 685  ARG A CG    1 
ATOM   6109 C  CD    . ARG C 3 685 ? 85.394  -35.869 4.716   1.00 42.38  ? 685  ARG A CD    1 
ATOM   6110 N  NE    . ARG C 3 685 ? 85.577  -37.169 5.344   1.00 38.54  ? 685  ARG A NE    1 
ATOM   6111 C  CZ    . ARG C 3 685 ? 86.618  -37.501 6.102   1.00 48.17  ? 685  ARG A CZ    1 
ATOM   6112 N  NH1   . ARG C 3 685 ? 87.593  -36.634 6.338   1.00 40.17  ? 685  ARG A NH1   1 
ATOM   6113 N  NH2   . ARG C 3 685 ? 86.676  -38.709 6.633   1.00 52.29  ? 685  ARG A NH2   1 
ATOM   6114 N  N     . GLU C 3 686 ? 82.076  -36.114 6.273   1.00 40.90  ? 686  GLU A N     1 
ATOM   6115 C  CA    . GLU C 3 686 ? 82.323  -36.774 7.540   1.00 46.72  ? 686  GLU A CA    1 
ATOM   6116 C  C     . GLU C 3 686 ? 82.978  -38.144 7.467   1.00 44.13  ? 686  GLU A C     1 
ATOM   6117 O  O     . GLU C 3 686 ? 83.885  -38.426 8.241   1.00 47.88  ? 686  GLU A O     1 
ATOM   6118 C  CB    . GLU C 3 686 ? 81.033  -36.867 8.367   1.00 54.78  ? 686  GLU A CB    1 
ATOM   6119 C  CG    . GLU C 3 686 ? 80.019  -37.854 7.855   1.00 62.00  ? 686  GLU A CG    1 
ATOM   6120 C  CD    . GLU C 3 686 ? 79.203  -38.447 8.992   1.00 73.37  ? 686  GLU A CD    1 
ATOM   6121 O  OE1   . GLU C 3 686 ? 79.469  -38.070 10.157  1.00 71.53  ? 686  GLU A OE1   1 
ATOM   6122 O  OE2   . GLU C 3 686 ? 78.312  -39.287 8.722   1.00 80.11  ? 686  GLU A OE2   1 
ATOM   6123 N  N     . ALA C 3 687 ? 82.552  -39.000 6.545   1.00 39.10  ? 687  ALA A N     1 
ATOM   6124 C  CA    . ALA C 3 687 ? 83.158  -40.325 6.488   1.00 38.40  ? 687  ALA A CA    1 
ATOM   6125 C  C     . ALA C 3 687 ? 83.800  -40.738 5.163   1.00 41.75  ? 687  ALA A C     1 
ATOM   6126 O  O     . ALA C 3 687 ? 83.325  -40.367 4.086   1.00 37.49  ? 687  ALA A O     1 
ATOM   6127 C  CB    . ALA C 3 687 ? 82.137  -41.362 6.909   1.00 30.12  ? 687  ALA A CB    1 
ATOM   6128 N  N     . ILE C 3 688 ? 84.904  -41.485 5.268   1.00 38.91  ? 688  ILE A N     1 
ATOM   6129 C  CA    . ILE C 3 688 ? 85.606  -42.017 4.102   1.00 39.52  ? 688  ILE A CA    1 
ATOM   6130 C  C     . ILE C 3 688 ? 85.687  -43.536 4.255   1.00 38.79  ? 688  ILE A C     1 
ATOM   6131 O  O     . ILE C 3 688 ? 86.114  -44.049 5.295   1.00 35.20  ? 688  ILE A O     1 
ATOM   6132 C  CB    . ILE C 3 688 ? 87.023  -41.451 3.956   1.00 41.63  ? 688  ILE A CB    1 
ATOM   6133 C  CG1   . ILE C 3 688 ? 86.949  -39.943 3.765   1.00 41.66  ? 688  ILE A CG1   1 
ATOM   6134 C  CG2   . ILE C 3 688 ? 87.708  -42.068 2.743   1.00 34.23  ? 688  ILE A CG2   1 
ATOM   6135 C  CD1   . ILE C 3 688 ? 88.290  -39.282 3.634   1.00 46.00  ? 688  ILE A CD1   1 
ATOM   6136 N  N     . ALA C 3 689 ? 85.271  -44.244 3.209   1.00 36.21  ? 689  ALA A N     1 
ATOM   6137 C  CA    . ALA C 3 689 ? 85.234  -45.693 3.240   1.00 33.54  ? 689  ALA A CA    1 
ATOM   6138 C  C     . ALA C 3 689 ? 85.541  -46.391 1.907   1.00 33.93  ? 689  ALA A C     1 
ATOM   6139 O  O     . ALA C 3 689 ? 85.236  -45.883 0.821   1.00 32.02  ? 689  ALA A O     1 
ATOM   6140 C  CB    . ALA C 3 689 ? 83.868  -46.143 3.769   1.00 23.41  ? 689  ALA A CB    1 
ATOM   6141 N  N     . GLY C 3 690 ? 86.141  -47.575 2.034   1.00 33.63  ? 690  GLY A N     1 
ATOM   6142 C  CA    . GLY C 3 690 ? 86.503  -48.393 0.898   1.00 34.32  ? 690  GLY A CA    1 
ATOM   6143 C  C     . GLY C 3 690 ? 87.256  -49.627 1.369   1.00 39.91  ? 690  GLY A C     1 
ATOM   6144 O  O     . GLY C 3 690 ? 87.405  -49.857 2.573   1.00 36.60  ? 690  GLY A O     1 
ATOM   6145 N  N     . PRO C 3 691 ? 87.749  -50.444 0.430   1.00 41.36  ? 691  PRO A N     1 
ATOM   6146 C  CA    . PRO C 3 691 ? 88.491  -51.667 0.738   1.00 42.56  ? 691  PRO A CA    1 
ATOM   6147 C  C     . PRO C 3 691 ? 89.996  -51.461 0.857   1.00 45.94  ? 691  PRO A C     1 
ATOM   6148 O  O     . PRO C 3 691 ? 90.564  -50.645 0.143   1.00 48.27  ? 691  PRO A O     1 
ATOM   6149 C  CB    . PRO C 3 691 ? 88.160  -52.549 -0.446  1.00 41.52  ? 691  PRO A CB    1 
ATOM   6150 C  CG    . PRO C 3 691 ? 88.187  -51.553 -1.588  1.00 37.66  ? 691  PRO A CG    1 
ATOM   6151 C  CD    . PRO C 3 691 ? 87.430  -50.367 -1.012  1.00 41.51  ? 691  PRO A CD    1 
ATOM   6152 N  N     . PRO C 3 692 ? 90.664  -52.226 1.742   1.00 50.23  ? 692  PRO A N     1 
ATOM   6153 C  CA    . PRO C 3 692 ? 92.120  -52.136 1.947   1.00 50.97  ? 692  PRO A CA    1 
ATOM   6154 C  C     . PRO C 3 692 ? 92.837  -52.173 0.601   1.00 51.81  ? 692  PRO A C     1 
ATOM   6155 O  O     . PRO C 3 692 ? 92.476  -52.966 -0.269  1.00 51.00  ? 692  PRO A O     1 
ATOM   6156 C  CB    . PRO C 3 692 ? 92.432  -53.382 2.765   1.00 47.87  ? 692  PRO A CB    1 
ATOM   6157 C  CG    . PRO C 3 692 ? 91.175  -53.582 3.554   1.00 52.72  ? 692  PRO A CG    1 
ATOM   6158 C  CD    . PRO C 3 692 ? 90.089  -53.318 2.548   1.00 46.44  ? 692  PRO A CD    1 
ATOM   6159 N  N     . LEU C 3 693 ? 93.844  -51.321 0.426   1.00 54.12  ? 693  LEU A N     1 
ATOM   6160 C  CA    . LEU C 3 693 ? 94.589  -51.276 -0.834  1.00 55.01  ? 693  LEU A CA    1 
ATOM   6161 C  C     . LEU C 3 693 ? 95.144  -52.634 -1.247  1.00 55.28  ? 693  LEU A C     1 
ATOM   6162 O  O     . LEU C 3 693 ? 95.756  -53.336 -0.440  1.00 51.33  ? 693  LEU A O     1 
ATOM   6163 C  CB    . LEU C 3 693 ? 95.734  -50.280 -0.732  1.00 54.64  ? 693  LEU A CB    1 
ATOM   6164 C  CG    . LEU C 3 693 ? 96.479  -50.015 -2.037  1.00 56.67  ? 693  LEU A CG    1 
ATOM   6165 C  CD1   . LEU C 3 693 ? 95.496  -49.817 -3.202  1.00 49.35  ? 693  LEU A CD1   1 
ATOM   6166 C  CD2   . LEU C 3 693 ? 97.363  -48.786 -1.835  1.00 54.28  ? 693  LEU A CD2   1 
ATOM   6167 N  N     . GLY C 3 694 ? 94.921  -52.996 -2.507  1.00 57.86  ? 694  GLY A N     1 
ATOM   6168 C  CA    . GLY C 3 694 ? 95.400  -54.274 -3.009  1.00 62.39  ? 694  GLY A CA    1 
ATOM   6169 C  C     . GLY C 3 694 ? 94.664  -55.466 -2.422  1.00 62.56  ? 694  GLY A C     1 
ATOM   6170 O  O     . GLY C 3 694 ? 95.273  -56.493 -2.116  1.00 65.01  ? 694  GLY A O     1 
ATOM   6171 N  N     . SER C 3 695 ? 93.351  -55.325 -2.263  1.00 63.92  ? 695  SER A N     1 
ATOM   6172 C  CA    . SER C 3 695 ? 92.514  -56.383 -1.708  1.00 61.36  ? 695  SER A CA    1 
ATOM   6173 C  C     . SER C 3 695 ? 91.357  -56.670 -2.653  1.00 60.08  ? 695  SER A C     1 
ATOM   6174 O  O     . SER C 3 695 ? 91.173  -55.975 -3.645  1.00 59.23  ? 695  SER A O     1 
ATOM   6175 C  CB    . SER C 3 695 ? 91.974  -55.965 -0.334  1.00 59.06  ? 695  SER A CB    1 
ATOM   6176 O  OG    . SER C 3 695 ? 91.150  -56.970 0.232   1.00 62.66  ? 695  SER A OG    1 
ATOM   6177 N  N     . LYS C 3 696 ? 90.584  -57.703 -2.340  1.00 62.88  ? 696  LYS A N     1 
ATOM   6178 C  CA    . LYS C 3 696 ? 89.447  -58.081 -3.168  1.00 63.49  ? 696  LYS A CA    1 
ATOM   6179 C  C     . LYS C 3 696 ? 88.118  -57.660 -2.541  1.00 61.47  ? 696  LYS A C     1 
ATOM   6180 O  O     . LYS C 3 696 ? 87.053  -57.990 -3.061  1.00 59.00  ? 696  LYS A O     1 
ATOM   6181 C  CB    . LYS C 3 696 ? 89.465  -59.591 -3.418  1.00 70.55  ? 696  LYS A CB    1 
ATOM   6182 C  CG    . LYS C 3 696 ? 90.694  -60.058 -4.187  1.00 76.70  ? 696  LYS A CG    1 
ATOM   6183 C  CD    . LYS C 3 696 ? 90.988  -61.529 -3.941  1.00 86.91  ? 696  LYS A CD    1 
ATOM   6184 C  CE    . LYS C 3 696 ? 92.347  -61.923 -4.514  1.00 92.02  ? 696  LYS A CE    1 
ATOM   6185 N  NZ    . LYS C 3 696 ? 92.715  -63.333 -4.191  1.00 95.64  ? 696  LYS A NZ    1 
ATOM   6186 N  N     . GLY C 3 697 ? 88.193  -56.940 -1.417  1.00 60.10  ? 697  GLY A N     1 
ATOM   6187 C  CA    . GLY C 3 697 ? 87.000  -56.449 -0.734  1.00 53.61  ? 697  GLY A CA    1 
ATOM   6188 C  C     . GLY C 3 697 ? 86.167  -55.540 -1.639  1.00 51.15  ? 697  GLY A C     1 
ATOM   6189 O  O     . GLY C 3 697 ? 86.692  -54.953 -2.587  1.00 47.72  ? 697  GLY A O     1 
ATOM   6190 N  N     . ILE C 3 698 ? 84.872  -55.418 -1.358  1.00 44.46  ? 698  ILE A N     1 
ATOM   6191 C  CA    . ILE C 3 698 ? 83.986  -54.597 -2.177  1.00 37.66  ? 698  ILE A CA    1 
ATOM   6192 C  C     . ILE C 3 698 ? 83.754  -53.196 -1.637  1.00 40.59  ? 698  ILE A C     1 
ATOM   6193 O  O     . ILE C 3 698 ? 83.192  -52.350 -2.325  1.00 43.61  ? 698  ILE A O     1 
ATOM   6194 C  CB    . ILE C 3 698 ? 82.625  -55.271 -2.364  1.00 37.38  ? 698  ILE A CB    1 
ATOM   6195 C  CG1   . ILE C 3 698 ? 81.963  -55.502 -1.006  1.00 41.09  ? 698  ILE A CG1   1 
ATOM   6196 C  CG2   . ILE C 3 698 ? 82.801  -56.594 -3.058  1.00 36.45  ? 698  ILE A CG2   1 
ATOM   6197 C  CD1   . ILE C 3 698 ? 80.628  -56.189 -1.097  1.00 40.43  ? 698  ILE A CD1   1 
ATOM   6198 N  N     . GLY C 3 699 ? 84.175  -52.944 -0.402  1.00 40.60  ? 699  GLY A N     1 
ATOM   6199 C  CA    . GLY C 3 699 ? 84.023  -51.618 0.180   1.00 38.88  ? 699  GLY A CA    1 
ATOM   6200 C  C     . GLY C 3 699 ? 82.747  -51.390 0.958   1.00 43.58  ? 699  GLY A C     1 
ATOM   6201 O  O     . GLY C 3 699 ? 82.793  -50.985 2.124   1.00 46.76  ? 699  GLY A O     1 
ATOM   6202 N  N     . GLY C 3 700 ? 81.607  -51.625 0.310   1.00 43.30  ? 700  GLY A N     1 
ATOM   6203 C  CA    . GLY C 3 700 ? 80.319  -51.435 0.966   1.00 37.76  ? 700  GLY A CA    1 
ATOM   6204 C  C     . GLY C 3 700 ? 79.161  -51.774 0.051   1.00 36.35  ? 700  GLY A C     1 
ATOM   6205 O  O     . GLY C 3 700 ? 79.353  -52.003 -1.142  1.00 34.03  ? 700  GLY A O     1 
ATOM   6206 N  N     . PHE C 3 701 ? 77.957  -51.822 0.604   1.00 36.21  ? 701  PHE A N     1 
ATOM   6207 C  CA    . PHE C 3 701 ? 76.780  -52.121 -0.201  1.00 38.76  ? 701  PHE A CA    1 
ATOM   6208 C  C     . PHE C 3 701 ? 75.496  -51.617 0.475   1.00 41.02  ? 701  PHE A C     1 
ATOM   6209 O  O     . PHE C 3 701 ? 75.460  -51.385 1.688   1.00 37.81  ? 701  PHE A O     1 
ATOM   6210 C  CB    . PHE C 3 701 ? 76.667  -53.636 -0.474  1.00 35.15  ? 701  PHE A CB    1 
ATOM   6211 C  CG    . PHE C 3 701 ? 76.455  -54.472 0.771   1.00 32.80  ? 701  PHE A CG    1 
ATOM   6212 C  CD1   . PHE C 3 701 ? 75.183  -54.635 1.301   1.00 20.93  ? 701  PHE A CD1   1 
ATOM   6213 C  CD2   . PHE C 3 701 ? 77.535  -55.023 1.455   1.00 25.71  ? 701  PHE A CD2   1 
ATOM   6214 C  CE1   . PHE C 3 701 ? 74.984  -55.326 2.494   1.00 25.37  ? 701  PHE A CE1   1 
ATOM   6215 C  CE2   . PHE C 3 701 ? 77.341  -55.719 2.654   1.00 33.29  ? 701  PHE A CE2   1 
ATOM   6216 C  CZ    . PHE C 3 701 ? 76.060  -55.867 3.176   1.00 30.30  ? 701  PHE A CZ    1 
ATOM   6217 N  N     . TRP C 3 702 ? 74.459  -51.442 -0.345  1.00 46.09  ? 702  TRP A N     1 
ATOM   6218 C  CA    . TRP C 3 702 ? 73.130  -50.990 0.068   1.00 44.98  ? 702  TRP A CA    1 
ATOM   6219 C  C     . TRP C 3 702 ? 72.119  -52.029 -0.434  1.00 46.21  ? 702  TRP A C     1 
ATOM   6220 O  O     . TRP C 3 702 ? 72.188  -52.479 -1.584  1.00 41.84  ? 702  TRP A O     1 
ATOM   6221 C  CB    . TRP C 3 702 ? 72.810  -49.626 -0.569  1.00 43.28  ? 702  TRP A CB    1 
ATOM   6222 C  CG    . TRP C 3 702 ? 73.120  -48.422 0.296   1.00 46.61  ? 702  TRP A CG    1 
ATOM   6223 C  CD1   . TRP C 3 702 ? 72.254  -47.771 1.127   1.00 39.94  ? 702  TRP A CD1   1 
ATOM   6224 C  CD2   . TRP C 3 702 ? 74.383  -47.749 0.431   1.00 44.46  ? 702  TRP A CD2   1 
ATOM   6225 N  NE1   . TRP C 3 702 ? 72.892  -46.744 1.769   1.00 37.25  ? 702  TRP A NE1   1 
ATOM   6226 C  CE2   . TRP C 3 702 ? 74.199  -46.703 1.363   1.00 43.11  ? 702  TRP A CE2   1 
ATOM   6227 C  CE3   . TRP C 3 702 ? 75.650  -47.928 -0.145  1.00 44.41  ? 702  TRP A CE3   1 
ATOM   6228 C  CZ2   . TRP C 3 702 ? 75.235  -45.840 1.739   1.00 38.76  ? 702  TRP A CZ2   1 
ATOM   6229 C  CZ3   . TRP C 3 702 ? 76.685  -47.068 0.228   1.00 42.97  ? 702  TRP A CZ3   1 
ATOM   6230 C  CH2   . TRP C 3 702 ? 76.468  -46.038 1.161   1.00 43.33  ? 702  TRP A CH2   1 
ATOM   6231 N  N     . THR C 3 703 ? 71.194  -52.429 0.425   1.00 41.61  ? 703  THR A N     1 
ATOM   6232 C  CA    . THR C 3 703 ? 70.181  -53.387 0.012   1.00 41.96  ? 703  THR A CA    1 
ATOM   6233 C  C     . THR C 3 703 ? 68.910  -52.586 -0.274  1.00 43.59  ? 703  THR A C     1 
ATOM   6234 O  O     . THR C 3 703 ? 68.123  -52.914 -1.163  1.00 43.53  ? 703  THR A O     1 
ATOM   6235 C  CB    . THR C 3 703 ? 69.913  -54.425 1.123   1.00 40.88  ? 703  THR A CB    1 
ATOM   6236 O  OG1   . THR C 3 703 ? 69.580  -53.742 2.336   1.00 44.94  ? 703  THR A OG1   1 
ATOM   6237 C  CG2   . THR C 3 703 ? 71.141  -55.305 1.356   1.00 41.16  ? 703  THR A CG2   1 
ATOM   6238 N  N     . GLY C 3 704 ? 68.737  -51.511 0.483   1.00 44.22  ? 704  GLY A N     1 
ATOM   6239 C  CA    . GLY C 3 704 ? 67.591  -50.643 0.307   1.00 45.75  ? 704  GLY A CA    1 
ATOM   6240 C  C     . GLY C 3 704 ? 67.686  -49.444 1.233   1.00 47.64  ? 704  GLY A C     1 
ATOM   6241 O  O     . GLY C 3 704 ? 68.715  -49.222 1.883   1.00 45.74  ? 704  GLY A O     1 
ATOM   6242 N  N     . LYS C 3 705 ? 66.618  -48.662 1.301   1.00 42.01  ? 705  LYS A N     1 
ATOM   6243 C  CA    . LYS C 3 705 ? 66.622  -47.501 2.171   1.00 40.33  ? 705  LYS A CA    1 
ATOM   6244 C  C     . LYS C 3 705 ? 66.970  -47.875 3.613   1.00 42.39  ? 705  LYS A C     1 
ATOM   6245 O  O     . LYS C 3 705 ? 66.359  -48.766 4.197   1.00 39.40  ? 705  LYS A O     1 
ATOM   6246 C  CB    . LYS C 3 705 ? 65.258  -46.809 2.136   1.00 38.56  ? 705  LYS A CB    1 
ATOM   6247 C  CG    . LYS C 3 705 ? 64.944  -46.118 0.823   1.00 36.45  ? 705  LYS A CG    1 
ATOM   6248 C  CD    . LYS C 3 705 ? 63.614  -45.418 0.901   1.00 34.89  ? 705  LYS A CD    1 
ATOM   6249 C  CE    . LYS C 3 705 ? 63.265  -44.743 -0.419  1.00 44.91  ? 705  LYS A CE    1 
ATOM   6250 N  NZ    . LYS C 3 705 ? 61.871  -44.176 -0.424  1.00 46.38  ? 705  LYS A NZ    1 
ATOM   6251 N  N     . LYS C 3 706 ? 67.966  -47.191 4.173   1.00 42.76  ? 706  LYS A N     1 
ATOM   6252 C  CA    . LYS C 3 706 ? 68.397  -47.404 5.554   1.00 43.19  ? 706  LYS A CA    1 
ATOM   6253 C  C     . LYS C 3 706 ? 69.007  -48.779 5.826   1.00 46.04  ? 706  LYS A C     1 
ATOM   6254 O  O     . LYS C 3 706 ? 68.999  -49.257 6.964   1.00 48.30  ? 706  LYS A O     1 
ATOM   6255 C  CB    . LYS C 3 706 ? 67.227  -47.185 6.506   1.00 40.61  ? 706  LYS A CB    1 
ATOM   6256 C  CG    . LYS C 3 706 ? 66.509  -45.858 6.340   1.00 46.14  ? 706  LYS A CG    1 
ATOM   6257 C  CD    . LYS C 3 706 ? 65.313  -45.772 7.295   1.00 50.69  ? 706  LYS A CD    1 
ATOM   6258 C  CE    . LYS C 3 706 ? 64.511  -44.502 7.072   1.00 48.56  ? 706  LYS A CE    1 
ATOM   6259 N  NZ    . LYS C 3 706 ? 65.363  -43.298 7.252   1.00 48.13  ? 706  LYS A NZ    1 
ATOM   6260 N  N     . ARG C 3 707 ? 69.534  -49.413 4.784   1.00 41.64  ? 707  ARG A N     1 
ATOM   6261 C  CA    . ARG C 3 707 ? 70.149  -50.720 4.928   1.00 40.64  ? 707  ARG A CA    1 
ATOM   6262 C  C     . ARG C 3 707 ? 71.452  -50.814 4.143   1.00 40.59  ? 707  ARG A C     1 
ATOM   6263 O  O     . ARG C 3 707 ? 71.472  -51.051 2.927   1.00 37.57  ? 707  ARG A O     1 
ATOM   6264 C  CB    . ARG C 3 707 ? 69.164  -51.795 4.493   1.00 44.94  ? 707  ARG A CB    1 
ATOM   6265 C  CG    . ARG C 3 707 ? 68.282  -52.247 5.632   1.00 55.03  ? 707  ARG A CG    1 
ATOM   6266 C  CD    . ARG C 3 707 ? 67.306  -53.298 5.177   1.00 65.22  ? 707  ARG A CD    1 
ATOM   6267 N  NE    . ARG C 3 707 ? 66.225  -52.669 4.441   1.00 71.65  ? 707  ARG A NE    1 
ATOM   6268 C  CZ    . ARG C 3 707 ? 65.092  -52.257 4.999   1.00 80.44  ? 707  ARG A CZ    1 
ATOM   6269 N  NH1   . ARG C 3 707 ? 64.891  -52.429 6.308   1.00 80.99  ? 707  ARG A NH1   1 
ATOM   6270 N  NH2   . ARG C 3 707 ? 64.176  -51.644 4.253   1.00 80.95  ? 707  ARG A NH2   1 
ATOM   6271 N  N     . TYR C 3 708 ? 72.555  -50.640 4.855   1.00 38.73  ? 708  TYR A N     1 
ATOM   6272 C  CA    . TYR C 3 708 ? 73.848  -50.660 4.204   1.00 35.78  ? 708  TYR A CA    1 
ATOM   6273 C  C     . TYR C 3 708 ? 74.978  -50.956 5.154   1.00 32.23  ? 708  TYR A C     1 
ATOM   6274 O  O     . TYR C 3 708 ? 74.825  -50.897 6.375   1.00 34.58  ? 708  TYR A O     1 
ATOM   6275 C  CB    . TYR C 3 708 ? 74.110  -49.302 3.543   1.00 43.19  ? 708  TYR A CB    1 
ATOM   6276 C  CG    . TYR C 3 708 ? 74.136  -48.121 4.513   1.00 42.95  ? 708  TYR A CG    1 
ATOM   6277 C  CD1   . TYR C 3 708 ? 72.960  -47.603 5.065   1.00 46.95  ? 708  TYR A CD1   1 
ATOM   6278 C  CD2   . TYR C 3 708 ? 75.338  -47.526 4.876   1.00 44.36  ? 708  TYR A CD2   1 
ATOM   6279 C  CE1   . TYR C 3 708 ? 72.987  -46.520 5.956   1.00 45.30  ? 708  TYR A CE1   1 
ATOM   6280 C  CE2   . TYR C 3 708 ? 75.377  -46.446 5.763   1.00 51.41  ? 708  TYR A CE2   1 
ATOM   6281 C  CZ    . TYR C 3 708 ? 74.202  -45.951 6.300   1.00 50.53  ? 708  TYR A CZ    1 
ATOM   6282 O  OH    . TYR C 3 708 ? 74.268  -44.907 7.194   1.00 53.12  ? 708  TYR A OH    1 
ATOM   6283 N  N     . ALA C 3 709 ? 76.120  -51.275 4.569   1.00 27.97  ? 709  ALA A N     1 
ATOM   6284 C  CA    . ALA C 3 709 ? 77.319  -51.554 5.335   1.00 32.68  ? 709  ALA A CA    1 
ATOM   6285 C  C     . ALA C 3 709 ? 78.465  -50.829 4.636   1.00 28.40  ? 709  ALA A C     1 
ATOM   6286 O  O     . ALA C 3 709 ? 78.582  -50.878 3.412   1.00 34.88  ? 709  ALA A O     1 
ATOM   6287 C  CB    . ALA C 3 709 ? 77.579  -53.082 5.401   1.00 33.75  ? 709  ALA A CB    1 
ATOM   6288 N  N     . LEU C 3 710 ? 79.277  -50.128 5.422   1.00 32.70  ? 710  LEU A N     1 
ATOM   6289 C  CA    . LEU C 3 710 ? 80.428  -49.386 4.922   1.00 28.39  ? 710  LEU A CA    1 
ATOM   6290 C  C     . LEU C 3 710 ? 81.685  -49.746 5.717   1.00 31.88  ? 710  LEU A C     1 
ATOM   6291 O  O     . LEU C 3 710 ? 81.622  -49.969 6.931   1.00 30.15  ? 710  LEU A O     1 
ATOM   6292 C  CB    . LEU C 3 710 ? 80.186  -47.884 5.047   1.00 24.95  ? 710  LEU A CB    1 
ATOM   6293 C  CG    . LEU C 3 710 ? 79.195  -47.209 4.106   1.00 35.51  ? 710  LEU A CG    1 
ATOM   6294 C  CD1   . LEU C 3 710 ? 78.989  -45.784 4.571   1.00 38.53  ? 710  LEU A CD1   1 
ATOM   6295 C  CD2   . LEU C 3 710 ? 79.701  -47.243 2.673   1.00 29.35  ? 710  LEU A CD2   1 
ATOM   6296 N  N     . ASN C 3 711 ? 82.826  -49.808 5.034   1.00 30.99  ? 711  ASN A N     1 
ATOM   6297 C  CA    . ASN C 3 711 ? 84.094  -50.107 5.697   1.00 33.87  ? 711  ASN A CA    1 
ATOM   6298 C  C     . ASN C 3 711 ? 84.791  -48.772 5.880   1.00 38.07  ? 711  ASN A C     1 
ATOM   6299 O  O     . ASN C 3 711 ? 85.514  -48.324 4.991   1.00 35.80  ? 711  ASN A O     1 
ATOM   6300 C  CB    . ASN C 3 711 ? 84.958  -51.025 4.834   1.00 36.03  ? 711  ASN A CB    1 
ATOM   6301 C  CG    . ASN C 3 711 ? 86.189  -51.538 5.578   1.00 41.89  ? 711  ASN A CG    1 
ATOM   6302 O  OD1   . ASN C 3 711 ? 86.094  -51.981 6.722   1.00 45.88  ? 711  ASN A OD1   1 
ATOM   6303 N  ND2   . ASN C 3 711 ? 87.343  -51.491 4.927   1.00 40.80  ? 711  ASN A ND2   1 
ATOM   6304 N  N     . VAL C 3 712 ? 84.590  -48.157 7.044   1.00 38.31  ? 712  VAL A N     1 
ATOM   6305 C  CA    . VAL C 3 712 ? 85.124  -46.832 7.343   1.00 40.99  ? 712  VAL A CA    1 
ATOM   6306 C  C     . VAL C 3 712 ? 86.548  -46.627 7.855   1.00 43.19  ? 712  VAL A C     1 
ATOM   6307 O  O     . VAL C 3 712 ? 86.957  -47.201 8.864   1.00 44.87  ? 712  VAL A O     1 
ATOM   6308 C  CB    . VAL C 3 712 ? 84.176  -46.122 8.289   1.00 39.77  ? 712  VAL A CB    1 
ATOM   6309 C  CG1   . VAL C 3 712 ? 84.656  -44.697 8.526   1.00 41.41  ? 712  VAL A CG1   1 
ATOM   6310 C  CG2   . VAL C 3 712 ? 82.788  -46.123 7.683   1.00 42.38  ? 712  VAL A CG2   1 
ATOM   6311 N  N     . TRP C 3 713 ? 87.273  -45.745 7.167   1.00 43.72  ? 713  TRP A N     1 
ATOM   6312 C  CA    . TRP C 3 713 ? 88.664  -45.425 7.498   1.00 44.10  ? 713  TRP A CA    1 
ATOM   6313 C  C     . TRP C 3 713 ? 88.852  -44.125 8.284   1.00 45.45  ? 713  TRP A C     1 
ATOM   6314 O  O     . TRP C 3 713 ? 89.684  -44.048 9.192   1.00 46.58  ? 713  TRP A O     1 
ATOM   6315 C  CB    . TRP C 3 713 ? 89.492  -45.352 6.216   1.00 40.26  ? 713  TRP A CB    1 
ATOM   6316 C  CG    . TRP C 3 713 ? 89.682  -46.665 5.559   1.00 40.31  ? 713  TRP A CG    1 
ATOM   6317 C  CD1   . TRP C 3 713 ? 89.140  -47.082 4.379   1.00 41.33  ? 713  TRP A CD1   1 
ATOM   6318 C  CD2   . TRP C 3 713 ? 90.487  -47.748 6.038   1.00 44.56  ? 713  TRP A CD2   1 
ATOM   6319 N  NE1   . TRP C 3 713 ? 89.560  -48.366 4.091   1.00 45.07  ? 713  TRP A NE1   1 
ATOM   6320 C  CE2   . TRP C 3 713 ? 90.389  -48.796 5.094   1.00 40.92  ? 713  TRP A CE2   1 
ATOM   6321 C  CE3   . TRP C 3 713 ? 91.288  -47.933 7.174   1.00 46.24  ? 713  TRP A CE3   1 
ATOM   6322 C  CZ2   . TRP C 3 713 ? 91.058  -50.010 5.253   1.00 40.44  ? 713  TRP A CZ2   1 
ATOM   6323 C  CZ3   . TRP C 3 713 ? 91.957  -49.144 7.333   1.00 41.48  ? 713  TRP A CZ3   1 
ATOM   6324 C  CH2   . TRP C 3 713 ? 91.837  -50.165 6.378   1.00 40.91  ? 713  TRP A CH2   1 
ATOM   6325 N  N     . ASP C 3 714 ? 88.086  -43.101 7.915   1.00 47.45  ? 714  ASP A N     1 
ATOM   6326 C  CA    . ASP C 3 714 ? 88.155  -41.806 8.583   1.00 47.17  ? 714  ASP A CA    1 
ATOM   6327 C  C     . ASP C 3 714 ? 86.758  -41.250 8.849   1.00 46.44  ? 714  ASP A C     1 
ATOM   6328 O  O     . ASP C 3 714 ? 85.855  -41.319 8.006   1.00 39.58  ? 714  ASP A O     1 
ATOM   6329 C  CB    . ASP C 3 714 ? 88.971  -40.811 7.745   1.00 50.22  ? 714  ASP A CB    1 
ATOM   6330 C  CG    . ASP C 3 714 ? 89.296  -39.525 8.502   1.00 50.44  ? 714  ASP A CG    1 
ATOM   6331 O  OD1   . ASP C 3 714 ? 88.414  -38.646 8.620   1.00 52.07  ? 714  ASP A OD1   1 
ATOM   6332 O  OD2   . ASP C 3 714 ? 90.442  -39.400 8.980   1.00 51.39  ? 714  ASP A OD2   1 
ATOM   6333 N  N     . MET C 3 715 ? 86.600  -40.693 10.041  1.00 47.59  ? 715  MET A N     1 
ATOM   6334 C  CA    . MET C 3 715 ? 85.338  -40.127 10.452  1.00 50.33  ? 715  MET A CA    1 
ATOM   6335 C  C     . MET C 3 715 ? 85.563  -38.713 10.944  1.00 51.72  ? 715  MET A C     1 
ATOM   6336 O  O     . MET C 3 715 ? 86.144  -38.506 12.002  1.00 51.73  ? 715  MET A O     1 
ATOM   6337 C  CB    . MET C 3 715 ? 84.725  -40.971 11.567  1.00 52.33  ? 715  MET A CB    1 
ATOM   6338 C  CG    . MET C 3 715 ? 83.303  -40.601 11.903  1.00 54.05  ? 715  MET A CG    1 
ATOM   6339 S  SD    . MET C 3 715 ? 82.215  -41.002 10.521  1.00 66.49  ? 715  MET A SD    1 
ATOM   6340 C  CE    . MET C 3 715 ? 80.666  -41.325 11.369  1.00 66.11  ? 715  MET A CE    1 
ATOM   6341 N  N     . GLU C 3 716 ? 85.111  -37.747 10.151  1.00 57.51  ? 716  GLU A N     1 
ATOM   6342 C  CA    . GLU C 3 716 ? 85.216  -36.325 10.474  1.00 61.15  ? 716  GLU A CA    1 
ATOM   6343 C  C     . GLU C 3 716 ? 86.613  -35.857 10.845  1.00 59.97  ? 716  GLU A C     1 
ATOM   6344 O  O     . GLU C 3 716 ? 86.760  -34.913 11.618  1.00 60.28  ? 716  GLU A O     1 
ATOM   6345 C  CB    . GLU C 3 716 ? 84.272  -35.967 11.626  1.00 63.78  ? 716  GLU A CB    1 
ATOM   6346 C  CG    . GLU C 3 716 ? 82.812  -36.297 11.394  1.00 71.19  ? 716  GLU A CG    1 
ATOM   6347 C  CD    . GLU C 3 716 ? 81.918  -35.771 12.508  1.00 76.77  ? 716  GLU A CD    1 
ATOM   6348 O  OE1   . GLU C 3 716 ? 82.099  -36.175 13.680  1.00 79.25  ? 716  GLU A OE1   1 
ATOM   6349 O  OE2   . GLU C 3 716 ? 81.034  -34.945 12.207  1.00 82.39  ? 716  GLU A OE2   1 
ATOM   6350 N  N     . GLY C 3 717 ? 87.641  -36.514 10.325  1.00 59.96  ? 717  GLY A N     1 
ATOM   6351 C  CA    . GLY C 3 717 ? 88.980  -36.071 10.654  1.00 58.38  ? 717  GLY A CA    1 
ATOM   6352 C  C     . GLY C 3 717 ? 89.859  -37.017 11.443  1.00 57.80  ? 717  GLY A C     1 
ATOM   6353 O  O     . GLY C 3 717 ? 91.079  -36.933 11.339  1.00 62.76  ? 717  GLY A O     1 
ATOM   6354 N  N     . THR C 3 718 ? 89.281  -37.905 12.238  1.00 54.32  ? 718  THR A N     1 
ATOM   6355 C  CA    . THR C 3 718 ? 90.136  -38.815 12.980  1.00 56.81  ? 718  THR A CA    1 
ATOM   6356 C  C     . THR C 3 718 ? 90.341  -40.097 12.164  1.00 58.91  ? 718  THR A C     1 
ATOM   6357 O  O     . THR C 3 718 ? 89.374  -40.731 11.721  1.00 56.52  ? 718  THR A O     1 
ATOM   6358 C  CB    . THR C 3 718 ? 89.570  -39.134 14.404  1.00 55.54  ? 718  THR A CB    1 
ATOM   6359 O  OG1   . THR C 3 718 ? 89.004  -40.448 14.425  1.00 57.53  ? 718  THR A OG1   1 
ATOM   6360 C  CG2   . THR C 3 718 ? 88.526  -38.098 14.814  1.00 44.75  ? 718  THR A CG2   1 
ATOM   6361 N  N     . ARG C 3 719 ? 91.615  -40.436 11.945  1.00 58.17  ? 719  ARG A N     1 
ATOM   6362 C  CA    . ARG C 3 719 ? 92.014  -41.607 11.169  1.00 54.19  ? 719  ARG A CA    1 
ATOM   6363 C  C     . ARG C 3 719 ? 92.054  -42.825 12.067  1.00 55.57  ? 719  ARG A C     1 
ATOM   6364 O  O     . ARG C 3 719 ? 92.760  -42.839 13.074  1.00 54.42  ? 719  ARG A O     1 
ATOM   6365 C  CB    . ARG C 3 719 ? 93.398  -41.380 10.557  1.00 50.45  ? 719  ARG A CB    1 
ATOM   6366 C  CG    . ARG C 3 719 ? 93.745  -42.310 9.415   1.00 48.34  ? 719  ARG A CG    1 
ATOM   6367 C  CD    . ARG C 3 719 ? 92.773  -42.114 8.265   1.00 54.72  ? 719  ARG A CD    1 
ATOM   6368 N  NE    . ARG C 3 719 ? 92.922  -40.810 7.623   1.00 50.57  ? 719  ARG A NE    1 
ATOM   6369 C  CZ    . ARG C 3 719 ? 93.783  -40.561 6.642   1.00 54.47  ? 719  ARG A CZ    1 
ATOM   6370 N  NH1   . ARG C 3 719 ? 94.569  -41.527 6.187   1.00 51.68  ? 719  ARG A NH1   1 
ATOM   6371 N  NH2   . ARG C 3 719 ? 93.862  -39.349 6.117   1.00 52.61  ? 719  ARG A NH2   1 
ATOM   6372 N  N     . TYR C 3 720 ? 91.297  -43.851 11.699  1.00 59.54  ? 720  TYR A N     1 
ATOM   6373 C  CA    . TYR C 3 720 ? 91.239  -45.071 12.495  1.00 61.50  ? 720  TYR A CA    1 
ATOM   6374 C  C     . TYR C 3 720 ? 92.423  -45.981 12.247  1.00 62.46  ? 720  TYR A C     1 
ATOM   6375 O  O     . TYR C 3 720 ? 92.827  -46.193 11.096  1.00 61.65  ? 720  TYR A O     1 
ATOM   6376 C  CB    . TYR C 3 720 ? 89.973  -45.859 12.184  1.00 63.05  ? 720  TYR A CB    1 
ATOM   6377 C  CG    . TYR C 3 720 ? 88.683  -45.178 12.556  1.00 62.12  ? 720  TYR A CG    1 
ATOM   6378 C  CD1   . TYR C 3 720 ? 88.460  -44.732 13.857  1.00 62.32  ? 720  TYR A CD1   1 
ATOM   6379 C  CD2   . TYR C 3 720 ? 87.643  -45.060 11.625  1.00 58.61  ? 720  TYR A CD2   1 
ATOM   6380 C  CE1   . TYR C 3 720 ? 87.221  -44.189 14.233  1.00 63.23  ? 720  TYR A CE1   1 
ATOM   6381 C  CE2   . TYR C 3 720 ? 86.404  -44.520 11.990  1.00 62.00  ? 720  TYR A CE2   1 
ATOM   6382 C  CZ    . TYR C 3 720 ? 86.200  -44.089 13.298  1.00 60.88  ? 720  TYR A CZ    1 
ATOM   6383 O  OH    . TYR C 3 720 ? 84.984  -43.570 13.673  1.00 60.21  ? 720  TYR A OH    1 
ATOM   6384 N  N     . ALA C 3 721 ? 92.961  -46.532 13.331  1.00 65.39  ? 721  ALA A N     1 
ATOM   6385 C  CA    . ALA C 3 721 ? 94.094  -47.454 13.250  1.00 69.11  ? 721  ALA A CA    1 
ATOM   6386 C  C     . ALA C 3 721 ? 93.641  -48.715 12.509  1.00 70.56  ? 721  ALA A C     1 
ATOM   6387 O  O     . ALA C 3 721 ? 94.336  -49.215 11.616  1.00 68.55  ? 721  ALA A O     1 
ATOM   6388 C  CB    . ALA C 3 721 ? 94.580  -47.810 14.663  1.00 67.64  ? 721  ALA A CB    1 
ATOM   6389 N  N     . GLU C 3 722 ? 92.469  -49.212 12.903  1.00 70.66  ? 722  GLU A N     1 
ATOM   6390 C  CA    . GLU C 3 722 ? 91.848  -50.394 12.314  1.00 70.55  ? 722  GLU A CA    1 
ATOM   6391 C  C     . GLU C 3 722 ? 90.524  -49.917 11.732  1.00 66.08  ? 722  GLU A C     1 
ATOM   6392 O  O     . GLU C 3 722 ? 89.734  -49.277 12.427  1.00 69.47  ? 722  GLU A O     1 
ATOM   6393 C  CB    . GLU C 3 722 ? 91.566  -51.442 13.398  1.00 80.44  ? 722  GLU A CB    1 
ATOM   6394 C  CG    . GLU C 3 722 ? 92.796  -51.927 14.175  1.00 93.15  ? 722  GLU A CG    1 
ATOM   6395 C  CD    . GLU C 3 722 ? 92.456  -52.438 15.578  1.00 97.75  ? 722  GLU A CD    1 
ATOM   6396 O  OE1   . GLU C 3 722 ? 92.258  -51.604 16.495  1.00 96.92  ? 722  GLU A OE1   1 
ATOM   6397 O  OE2   . GLU C 3 722 ? 92.381  -53.673 15.756  1.00 103.57 ? 722  GLU A OE2   1 
ATOM   6398 N  N     . PRO C 3 723 ? 90.255  -50.221 10.456  1.00 59.21  ? 723  PRO A N     1 
ATOM   6399 C  CA    . PRO C 3 723 ? 88.990  -49.783 9.847   1.00 56.64  ? 723  PRO A CA    1 
ATOM   6400 C  C     . PRO C 3 723 ? 87.790  -50.257 10.657  1.00 56.16  ? 723  PRO A C     1 
ATOM   6401 O  O     . PRO C 3 723 ? 87.832  -51.326 11.269  1.00 56.57  ? 723  PRO A O     1 
ATOM   6402 C  CB    . PRO C 3 723 ? 89.041  -50.413 8.458   1.00 53.12  ? 723  PRO A CB    1 
ATOM   6403 C  CG    . PRO C 3 723 ? 89.822  -51.670 8.698   1.00 53.61  ? 723  PRO A CG    1 
ATOM   6404 C  CD    . PRO C 3 723 ? 90.947  -51.185 9.589   1.00 56.80  ? 723  PRO A CD    1 
ATOM   6405 N  N     . LYS C 3 724 ? 86.726  -49.459 10.670  1.00 53.96  ? 724  LYS A N     1 
ATOM   6406 C  CA    . LYS C 3 724 ? 85.532  -49.822 11.426  1.00 51.36  ? 724  LYS A CA    1 
ATOM   6407 C  C     . LYS C 3 724 ? 84.344  -50.104 10.531  1.00 49.97  ? 724  LYS A C     1 
ATOM   6408 O  O     . LYS C 3 724 ? 84.140  -49.450 9.512   1.00 53.88  ? 724  LYS A O     1 
ATOM   6409 C  CB    . LYS C 3 724 ? 85.172  -48.734 12.441  1.00 50.79  ? 724  LYS A CB    1 
ATOM   6410 C  CG    . LYS C 3 724 ? 86.207  -48.582 13.554  1.00 59.38  ? 724  LYS A CG    1 
ATOM   6411 C  CD    . LYS C 3 724 ? 85.675  -47.794 14.745  1.00 62.16  ? 724  LYS A CD    1 
ATOM   6412 C  CE    . LYS C 3 724 ? 84.597  -48.568 15.501  1.00 70.90  ? 724  LYS A CE    1 
ATOM   6413 N  NZ    . LYS C 3 724 ? 83.358  -48.846 14.694  1.00 75.99  ? 724  LYS A NZ    1 
ATOM   6414 N  N     . LEU C 3 725 ? 83.570  -51.106 10.920  1.00 51.92  ? 725  LEU A N     1 
ATOM   6415 C  CA    . LEU C 3 725 ? 82.397  -51.512 10.172  1.00 50.89  ? 725  LEU A CA    1 
ATOM   6416 C  C     . LEU C 3 725 ? 81.203  -50.721 10.649  1.00 51.04  ? 725  LEU A C     1 
ATOM   6417 O  O     . LEU C 3 725 ? 80.945  -50.652 11.841  1.00 49.65  ? 725  LEU A O     1 
ATOM   6418 C  CB    . LEU C 3 725 ? 82.128  -53.003 10.385  1.00 50.25  ? 725  LEU A CB    1 
ATOM   6419 C  CG    . LEU C 3 725 ? 82.916  -54.024 9.561   1.00 49.74  ? 725  LEU A CG    1 
ATOM   6420 C  CD1   . LEU C 3 725 ? 82.788  -55.369 10.225  1.00 44.59  ? 725  LEU A CD1   1 
ATOM   6421 C  CD2   . LEU C 3 725 ? 82.394  -54.073 8.123   1.00 52.46  ? 725  LEU A CD2   1 
ATOM   6422 N  N     . LYS C 3 726 ? 80.490  -50.115 9.706   1.00 51.54  ? 726  LYS A N     1 
ATOM   6423 C  CA    . LYS C 3 726 ? 79.303  -49.336 10.004  1.00 49.46  ? 726  LYS A CA    1 
ATOM   6424 C  C     . LYS C 3 726 ? 78.125  -50.159 9.486   1.00 51.03  ? 726  LYS A C     1 
ATOM   6425 O  O     . LYS C 3 726 ? 77.993  -50.353 8.280   1.00 48.40  ? 726  LYS A O     1 
ATOM   6426 C  CB    . LYS C 3 726 ? 79.381  -47.992 9.282   1.00 49.76  ? 726  LYS A CB    1 
ATOM   6427 C  CG    . LYS C 3 726 ? 78.173  -47.099 9.466   1.00 53.07  ? 726  LYS A CG    1 
ATOM   6428 C  CD    . LYS C 3 726 ? 77.750  -47.056 10.920  1.00 59.32  ? 726  LYS A CD    1 
ATOM   6429 C  CE    . LYS C 3 726 ? 76.613  -46.072 11.143  1.00 60.20  ? 726  LYS A CE    1 
ATOM   6430 N  NZ    . LYS C 3 726 ? 76.079  -46.200 12.531  1.00 68.79  ? 726  LYS A NZ    1 
ATOM   6431 N  N     . ILE C 3 727 ? 77.281  -50.656 10.392  1.00 50.40  ? 727  ILE A N     1 
ATOM   6432 C  CA    . ILE C 3 727 ? 76.131  -51.472 10.002  1.00 48.34  ? 727  ILE A CA    1 
ATOM   6433 C  C     . ILE C 3 727 ? 74.805  -50.815 10.347  1.00 46.74  ? 727  ILE A C     1 
ATOM   6434 O  O     . ILE C 3 727 ? 74.536  -50.514 11.511  1.00 49.91  ? 727  ILE A O     1 
ATOM   6435 C  CB    . ILE C 3 727 ? 76.201  -52.868 10.658  1.00 46.70  ? 727  ILE A CB    1 
ATOM   6436 C  CG1   . ILE C 3 727 ? 76.883  -53.842 9.714   1.00 52.76  ? 727  ILE A CG1   1 
ATOM   6437 C  CG2   . ILE C 3 727 ? 74.820  -53.398 10.963  1.00 56.79  ? 727  ILE A CG2   1 
ATOM   6438 C  CD1   . ILE C 3 727 ? 78.294  -53.476 9.399   1.00 56.46  ? 727  ILE A CD1   1 
ATOM   6439 N  N     . MET C 3 728 ? 73.978  -50.611 9.322   1.00 44.21  ? 728  MET A N     1 
ATOM   6440 C  CA    . MET C 3 728 ? 72.670  -49.989 9.480   1.00 41.49  ? 728  MET A CA    1 
ATOM   6441 C  C     . MET C 3 728 ? 71.539  -50.857 8.932   1.00 40.71  ? 728  MET A C     1 
ATOM   6442 O  O     . MET C 3 728 ? 71.525  -51.196 7.746   1.00 44.41  ? 728  MET A O     1 
ATOM   6443 C  CB    . MET C 3 728 ? 72.651  -48.640 8.768   1.00 47.99  ? 728  MET A CB    1 
ATOM   6444 C  CG    . MET C 3 728 ? 73.565  -47.603 9.378   1.00 59.37  ? 728  MET A CG    1 
ATOM   6445 S  SD    . MET C 3 728 ? 72.989  -47.127 11.010  1.00 71.26  ? 728  MET A SD    1 
ATOM   6446 C  CE    . MET C 3 728 ? 71.403  -46.346 10.558  1.00 66.89  ? 728  MET A CE    1 
ATOM   6447 N  N     . GLY C 3 729 ? 70.605  -51.207 9.812   1.00 36.11  ? 729  GLY A N     1 
ATOM   6448 C  CA    . GLY C 3 729 ? 69.440  -51.990 9.440   1.00 39.95  ? 729  GLY A CA    1 
ATOM   6449 C  C     . GLY C 3 729 ? 69.582  -53.338 8.752   1.00 43.87  ? 729  GLY A C     1 
ATOM   6450 O  O     . GLY C 3 729 ? 68.711  -53.728 7.970   1.00 44.63  ? 729  GLY A O     1 
ATOM   6451 N  N     . LEU C 3 730 ? 70.653  -54.068 9.021   1.00 42.15  ? 730  LEU A N     1 
ATOM   6452 C  CA    . LEU C 3 730 ? 70.789  -55.356 8.384   1.00 41.17  ? 730  LEU A CA    1 
ATOM   6453 C  C     . LEU C 3 730 ? 70.338  -56.412 9.370   1.00 45.17  ? 730  LEU A C     1 
ATOM   6454 O  O     . LEU C 3 730 ? 70.368  -57.601 9.084   1.00 46.99  ? 730  LEU A O     1 
ATOM   6455 C  CB    . LEU C 3 730 ? 72.233  -55.582 7.924   1.00 36.72  ? 730  LEU A CB    1 
ATOM   6456 C  CG    . LEU C 3 730 ? 72.757  -54.522 6.934   1.00 34.15  ? 730  LEU A CG    1 
ATOM   6457 C  CD1   . LEU C 3 730 ? 74.028  -55.019 6.282   1.00 30.60  ? 730  LEU A CD1   1 
ATOM   6458 C  CD2   . LEU C 3 730 ? 71.726  -54.214 5.863   1.00 30.47  ? 730  LEU A CD2   1 
ATOM   6459 N  N     . GLU C 3 731 ? 69.902  -55.955 10.538  1.00 49.30  ? 731  GLU A N     1 
ATOM   6460 C  CA    . GLU C 3 731 ? 69.407  -56.840 11.585  1.00 54.60  ? 731  GLU A CA    1 
ATOM   6461 C  C     . GLU C 3 731 ? 70.359  -57.970 11.929  1.00 55.64  ? 731  GLU A C     1 
ATOM   6462 O  O     . GLU C 3 731 ? 70.003  -59.148 11.899  1.00 56.44  ? 731  GLU A O     1 
ATOM   6463 C  CB    . GLU C 3 731 ? 68.044  -57.395 11.179  1.00 56.54  ? 731  GLU A CB    1 
ATOM   6464 C  CG    . GLU C 3 731 ? 66.903  -56.437 11.462  1.00 64.14  ? 731  GLU A CG    1 
ATOM   6465 C  CD    . GLU C 3 731 ? 65.709  -56.652 10.550  1.00 70.51  ? 731  GLU A CD    1 
ATOM   6466 O  OE1   . GLU C 3 731 ? 65.244  -57.808 10.412  1.00 74.37  ? 731  GLU A OE1   1 
ATOM   6467 O  OE2   . GLU C 3 731 ? 65.238  -55.649 9.975   1.00 72.18  ? 731  GLU A OE2   1 
ATOM   6468 N  N     . THR C 3 732 ? 71.576  -57.590 12.282  1.00 55.98  ? 732  THR A N     1 
ATOM   6469 C  CA    . THR C 3 732 ? 72.592  -58.557 12.634  1.00 55.63  ? 732  THR A CA    1 
ATOM   6470 C  C     . THR C 3 732 ? 72.646  -58.767 14.145  1.00 55.55  ? 732  THR A C     1 
ATOM   6471 O  O     . THR C 3 732 ? 73.557  -59.417 14.648  1.00 57.76  ? 732  THR A O     1 
ATOM   6472 C  CB    . THR C 3 732 ? 73.971  -58.093 12.127  1.00 56.72  ? 732  THR A CB    1 
ATOM   6473 O  OG1   . THR C 3 732 ? 74.300  -56.831 12.730  1.00 58.64  ? 732  THR A OG1   1 
ATOM   6474 C  CG2   . THR C 3 732 ? 73.946  -57.923 10.603  1.00 56.29  ? 732  THR A CG2   1 
ATOM   6475 N  N     . GLN C 3 733 ? 71.671  -58.222 14.866  1.00 57.59  ? 733  GLN A N     1 
ATOM   6476 C  CA    . GLN C 3 733 ? 71.636  -58.369 16.318  1.00 60.49  ? 733  GLN A CA    1 
ATOM   6477 C  C     . GLN C 3 733 ? 70.273  -58.731 16.876  1.00 61.99  ? 733  GLN A C     1 
ATOM   6478 O  O     . GLN C 3 733 ? 69.987  -58.442 18.041  1.00 61.32  ? 733  GLN A O     1 
ATOM   6479 C  CB    . GLN C 3 733 ? 72.106  -57.089 17.006  1.00 64.11  ? 733  GLN A CB    1 
ATOM   6480 C  CG    . GLN C 3 733 ? 73.526  -56.680 16.682  1.00 72.08  ? 733  GLN A CG    1 
ATOM   6481 C  CD    . GLN C 3 733 ? 74.087  -55.737 17.722  1.00 72.95  ? 733  GLN A CD    1 
ATOM   6482 O  OE1   . GLN C 3 733 ? 74.513  -56.163 18.799  1.00 76.84  ? 733  GLN A OE1   1 
ATOM   6483 N  NE2   . GLN C 3 733 ? 74.073  -54.443 17.415  1.00 74.31  ? 733  GLN A NE2   1 
ATOM   6484 N  N     . LYS C 3 734 ? 69.434  -59.358 16.057  1.00 64.44  ? 734  LYS A N     1 
ATOM   6485 C  CA    . LYS C 3 734 ? 68.102  -59.759 16.503  1.00 60.97  ? 734  LYS A CA    1 
ATOM   6486 C  C     . LYS C 3 734 ? 68.180  -60.563 17.797  1.00 57.82  ? 734  LYS A C     1 
ATOM   6487 O  O     . LYS C 3 734 ? 69.063  -61.402 17.973  1.00 56.09  ? 734  LYS A O     1 
ATOM   6488 C  CB    . LYS C 3 734 ? 67.411  -60.640 15.455  1.00 68.56  ? 734  LYS A CB    1 
ATOM   6489 C  CG    . LYS C 3 734 ? 67.375  -60.096 14.041  1.00 76.20  ? 734  LYS A CG    1 
ATOM   6490 C  CD    . LYS C 3 734 ? 65.948  -59.996 13.512  1.00 75.02  ? 734  LYS A CD    1 
ATOM   6491 C  CE    . LYS C 3 734 ? 65.198  -58.878 14.212  1.00 82.83  ? 734  LYS A CE    1 
ATOM   6492 N  NZ    . LYS C 3 734 ? 65.955  -57.593 14.108  1.00 80.58  ? 734  LYS A NZ    1 
ATOM   6493 N  N     . SER C 3 735 ? 67.247  -60.308 18.701  1.00 56.87  ? 735  SER A N     1 
ATOM   6494 C  CA    . SER C 3 735 ? 67.187  -61.042 19.959  1.00 58.12  ? 735  SER A CA    1 
ATOM   6495 C  C     . SER C 3 735 ? 66.829  -62.494 19.630  1.00 57.92  ? 735  SER A C     1 
ATOM   6496 O  O     . SER C 3 735 ? 67.206  -63.426 20.343  1.00 59.15  ? 735  SER A O     1 
ATOM   6497 C  CB    . SER C 3 735 ? 66.114  -60.428 20.862  1.00 63.02  ? 735  SER A CB    1 
ATOM   6498 O  OG    . SER C 3 735 ? 65.913  -61.204 22.030  1.00 70.36  ? 735  SER A OG    1 
ATOM   6499 N  N     . SER C 3 736 ? 66.112  -62.665 18.524  1.00 55.90  ? 736  SER A N     1 
ATOM   6500 C  CA    . SER C 3 736 ? 65.678  -63.974 18.052  1.00 56.84  ? 736  SER A CA    1 
ATOM   6501 C  C     . SER C 3 736 ? 66.827  -64.814 17.506  1.00 58.40  ? 736  SER A C     1 
ATOM   6502 O  O     . SER C 3 736 ? 66.663  -66.011 17.291  1.00 58.44  ? 736  SER A O     1 
ATOM   6503 C  CB    . SER C 3 736 ? 64.642  -63.807 16.940  1.00 58.00  ? 736  SER A CB    1 
ATOM   6504 O  OG    . SER C 3 736 ? 64.109  -62.497 16.932  1.00 62.84  ? 736  SER A OG    1 
ATOM   6505 N  N     . THR C 3 737 ? 67.981  -64.199 17.263  1.00 59.37  ? 737  THR A N     1 
ATOM   6506 C  CA    . THR C 3 737 ? 69.114  -64.946 16.718  1.00 59.44  ? 737  THR A CA    1 
ATOM   6507 C  C     . THR C 3 737 ? 70.125  -65.356 17.788  1.00 58.41  ? 737  THR A C     1 
ATOM   6508 O  O     . THR C 3 737 ? 70.431  -64.575 18.691  1.00 59.75  ? 737  THR A O     1 
ATOM   6509 C  CB    . THR C 3 737 ? 69.863  -64.128 15.655  1.00 57.75  ? 737  THR A CB    1 
ATOM   6510 O  OG1   . THR C 3 737 ? 68.929  -63.373 14.877  1.00 61.65  ? 737  THR A OG1   1 
ATOM   6511 C  CG2   . THR C 3 737 ? 70.607  -65.050 14.727  1.00 59.54  ? 737  THR A CG2   1 
ATOM   6512 N  N     . PRO C 3 738 ? 70.642  -66.597 17.711  1.00 55.87  ? 738  PRO A N     1 
ATOM   6513 C  CA    . PRO C 3 738 ? 71.627  -67.113 18.667  1.00 54.90  ? 738  PRO A CA    1 
ATOM   6514 C  C     . PRO C 3 738 ? 72.907  -66.283 18.602  1.00 56.94  ? 738  PRO A C     1 
ATOM   6515 O  O     . PRO C 3 738 ? 73.448  -66.052 17.518  1.00 54.44  ? 738  PRO A O     1 
ATOM   6516 C  CB    . PRO C 3 738 ? 71.845  -68.541 18.187  1.00 56.43  ? 738  PRO A CB    1 
ATOM   6517 C  CG    . PRO C 3 738 ? 70.497  -68.910 17.672  1.00 55.87  ? 738  PRO A CG    1 
ATOM   6518 C  CD    . PRO C 3 738 ? 70.132  -67.687 16.863  1.00 54.78  ? 738  PRO A CD    1 
ATOM   6519 N  N     . LYS C 3 739 ? 73.386  -65.842 19.763  1.00 58.20  ? 739  LYS A N     1 
ATOM   6520 C  CA    . LYS C 3 739 ? 74.589  -65.016 19.852  1.00 56.93  ? 739  LYS A CA    1 
ATOM   6521 C  C     . LYS C 3 739 ? 75.692  -65.396 18.853  1.00 54.98  ? 739  LYS A C     1 
ATOM   6522 O  O     . LYS C 3 739 ? 76.345  -64.528 18.282  1.00 54.74  ? 739  LYS A O     1 
ATOM   6523 C  CB    . LYS C 3 739 ? 75.136  -65.067 21.282  1.00 63.80  ? 739  LYS A CB    1 
ATOM   6524 C  CG    . LYS C 3 739 ? 74.135  -64.628 22.357  1.00 70.35  ? 739  LYS A CG    1 
ATOM   6525 C  CD    . LYS C 3 739 ? 74.582  -65.041 23.773  1.00 74.46  ? 739  LYS A CD    1 
ATOM   6526 C  CE    . LYS C 3 739 ? 75.812  -64.275 24.262  1.00 76.70  ? 739  LYS A CE    1 
ATOM   6527 N  NZ    . LYS C 3 739 ? 75.514  -62.839 24.525  1.00 77.96  ? 739  LYS A NZ    1 
ATOM   6528 N  N     . ALA C 3 740 ? 75.887  -66.691 18.634  1.00 52.37  ? 740  ALA A N     1 
ATOM   6529 C  CA    . ALA C 3 740 ? 76.914  -67.169 17.715  1.00 49.89  ? 740  ALA A CA    1 
ATOM   6530 C  C     . ALA C 3 740 ? 76.586  -66.877 16.257  1.00 48.17  ? 740  ALA A C     1 
ATOM   6531 O  O     . ALA C 3 740 ? 77.472  -66.843 15.402  1.00 48.25  ? 740  ALA A O     1 
ATOM   6532 C  CB    . ALA C 3 740 ? 77.125  -68.665 17.901  1.00 51.78  ? 740  ALA A CB    1 
ATOM   6533 N  N     . VAL C 3 741 ? 75.313  -66.675 15.960  1.00 48.20  ? 741  VAL A N     1 
ATOM   6534 C  CA    . VAL C 3 741 ? 74.943  -66.396 14.587  1.00 49.07  ? 741  VAL A CA    1 
ATOM   6535 C  C     . VAL C 3 741 ? 75.044  -64.898 14.354  1.00 48.79  ? 741  VAL A C     1 
ATOM   6536 O  O     . VAL C 3 741 ? 75.170  -64.436 13.219  1.00 46.93  ? 741  VAL A O     1 
ATOM   6537 C  CB    . VAL C 3 741 ? 73.518  -66.901 14.265  1.00 45.07  ? 741  VAL A CB    1 
ATOM   6538 C  CG1   . VAL C 3 741 ? 73.263  -66.784 12.762  1.00 42.67  ? 741  VAL A CG1   1 
ATOM   6539 C  CG2   . VAL C 3 741 ? 73.367  -68.346 14.711  1.00 37.76  ? 741  VAL A CG2   1 
ATOM   6540 N  N     . GLN C 3 742 ? 75.009  -64.137 15.442  1.00 48.67  ? 742  GLN A N     1 
ATOM   6541 C  CA    . GLN C 3 742 ? 75.122  -62.689 15.354  1.00 44.47  ? 742  GLN A CA    1 
ATOM   6542 C  C     . GLN C 3 742 ? 76.569  -62.381 15.011  1.00 44.62  ? 742  GLN A C     1 
ATOM   6543 O  O     . GLN C 3 742 ? 76.865  -61.539 14.152  1.00 47.29  ? 742  GLN A O     1 
ATOM   6544 C  CB    . GLN C 3 742 ? 74.715  -62.064 16.688  1.00 41.07  ? 742  GLN A CB    1 
ATOM   6545 C  CG    . GLN C 3 742 ? 73.233  -62.272 16.984  1.00 48.73  ? 742  GLN A CG    1 
ATOM   6546 C  CD    . GLN C 3 742 ? 72.794  -61.697 18.315  1.00 51.32  ? 742  GLN A CD    1 
ATOM   6547 O  OE1   . GLN C 3 742 ? 73.392  -60.753 18.823  1.00 59.96  ? 742  GLN A OE1   1 
ATOM   6548 N  NE2   . GLN C 3 742 ? 71.728  -62.255 18.876  1.00 55.04  ? 742  GLN A NE2   1 
ATOM   6549 N  N     . LYS C 3 743 ? 77.465  -63.107 15.667  1.00 40.24  ? 743  LYS A N     1 
ATOM   6550 C  CA    . LYS C 3 743 ? 78.889  -62.950 15.457  1.00 41.54  ? 743  LYS A CA    1 
ATOM   6551 C  C     . LYS C 3 743 ? 79.316  -63.458 14.077  1.00 44.39  ? 743  LYS A C     1 
ATOM   6552 O  O     . LYS C 3 743 ? 80.263  -62.948 13.495  1.00 49.98  ? 743  LYS A O     1 
ATOM   6553 C  CB    . LYS C 3 743 ? 79.636  -63.692 16.563  1.00 45.66  ? 743  LYS A CB    1 
ATOM   6554 C  CG    . LYS C 3 743 ? 79.200  -63.266 17.972  1.00 55.98  ? 743  LYS A CG    1 
ATOM   6555 C  CD    . LYS C 3 743 ? 79.749  -64.172 19.084  1.00 61.84  ? 743  LYS A CD    1 
ATOM   6556 C  CE    . LYS C 3 743 ? 79.055  -63.877 20.424  1.00 69.22  ? 743  LYS A CE    1 
ATOM   6557 N  NZ    . LYS C 3 743 ? 79.231  -64.960 21.456  1.00 67.85  ? 743  LYS A NZ    1 
ATOM   6558 N  N     . ALA C 3 744 ? 78.607  -64.452 13.553  1.00 45.04  ? 744  ALA A N     1 
ATOM   6559 C  CA    . ALA C 3 744 ? 78.930  -65.019 12.250  1.00 45.14  ? 744  ALA A CA    1 
ATOM   6560 C  C     . ALA C 3 744 ? 78.408  -64.155 11.108  1.00 47.36  ? 744  ALA A C     1 
ATOM   6561 O  O     . ALA C 3 744 ? 79.046  -64.069 10.050  1.00 48.44  ? 744  ALA A O     1 
ATOM   6562 C  CB    . ALA C 3 744 ? 78.365  -66.419 12.139  1.00 46.30  ? 744  ALA A CB    1 
ATOM   6563 N  N     . LEU C 3 745 ? 77.244  -63.540 11.316  1.00 43.38  ? 745  LEU A N     1 
ATOM   6564 C  CA    . LEU C 3 745 ? 76.637  -62.656 10.321  1.00 40.99  ? 745  LEU A CA    1 
ATOM   6565 C  C     . LEU C 3 745 ? 77.493  -61.410 10.159  1.00 40.85  ? 745  LEU A C     1 
ATOM   6566 O  O     . LEU C 3 745 ? 77.618  -60.860 9.066   1.00 38.01  ? 745  LEU A O     1 
ATOM   6567 C  CB    . LEU C 3 745 ? 75.235  -62.223 10.760  1.00 42.13  ? 745  LEU A CB    1 
ATOM   6568 C  CG    . LEU C 3 745 ? 74.039  -63.107 10.421  1.00 34.37  ? 745  LEU A CG    1 
ATOM   6569 C  CD1   . LEU C 3 745 ? 72.776  -62.544 11.059  1.00 31.12  ? 745  LEU A CD1   1 
ATOM   6570 C  CD2   . LEU C 3 745 ? 73.904  -63.202 8.912   1.00 39.66  ? 745  LEU A CD2   1 
ATOM   6571 N  N     . LYS C 3 746 ? 78.069  -60.957 11.267  1.00 44.44  ? 746  LYS A N     1 
ATOM   6572 C  CA    . LYS C 3 746 ? 78.923  -59.777 11.239  1.00 50.21  ? 746  LYS A CA    1 
ATOM   6573 C  C     . LYS C 3 746 ? 80.236  -60.113 10.540  1.00 50.59  ? 746  LYS A C     1 
ATOM   6574 O  O     . LYS C 3 746 ? 80.865  -59.262 9.896   1.00 52.58  ? 746  LYS A O     1 
ATOM   6575 C  CB    . LYS C 3 746 ? 79.195  -59.293 12.662  1.00 43.02  ? 746  LYS A CB    1 
ATOM   6576 C  CG    . LYS C 3 746 ? 80.172  -58.143 12.720  1.00 42.31  ? 746  LYS A CG    1 
ATOM   6577 C  CD    . LYS C 3 746 ? 80.290  -57.598 14.119  1.00 48.22  ? 746  LYS A CD    1 
ATOM   6578 C  CE    . LYS C 3 746 ? 81.376  -56.553 14.194  1.00 53.66  ? 746  LYS A CE    1 
ATOM   6579 N  NZ    . LYS C 3 746 ? 81.640  -56.228 15.622  1.00 63.57  ? 746  LYS A NZ    1 
ATOM   6580 N  N     . GLU C 3 747 ? 80.624  -61.375 10.663  1.00 48.02  ? 747  GLU A N     1 
ATOM   6581 C  CA    . GLU C 3 747 ? 81.851  -61.863 10.070  1.00 50.48  ? 747  GLU A CA    1 
ATOM   6582 C  C     . GLU C 3 747 ? 81.781  -61.943 8.535   1.00 52.57  ? 747  GLU A C     1 
ATOM   6583 O  O     . GLU C 3 747 ? 82.779  -61.717 7.828   1.00 46.74  ? 747  GLU A O     1 
ATOM   6584 C  CB    . GLU C 3 747 ? 82.178  -63.232 10.659  1.00 53.37  ? 747  GLU A CB    1 
ATOM   6585 C  CG    . GLU C 3 747 ? 83.594  -63.327 11.216  1.00 60.94  ? 747  GLU A CG    1 
ATOM   6586 C  CD    . GLU C 3 747 ? 84.641  -62.741 10.276  1.00 63.77  ? 747  GLU A CD    1 
ATOM   6587 O  OE1   . GLU C 3 747 ? 84.862  -63.324 9.193   1.00 62.15  ? 747  GLU A OE1   1 
ATOM   6588 O  OE2   . GLU C 3 747 ? 85.234  -61.688 10.619  1.00 62.35  ? 747  GLU A OE2   1 
ATOM   6589 N  N     . CYS C 3 748 ? 80.601  -62.260 8.020   1.00 50.15  ? 748  CYS A N     1 
ATOM   6590 C  CA    . CYS C 3 748 ? 80.439  -62.353 6.578   1.00 55.67  ? 748  CYS A CA    1 
ATOM   6591 C  C     . CYS C 3 748 ? 80.449  -60.958 5.972   1.00 54.13  ? 748  CYS A C     1 
ATOM   6592 O  O     . CYS C 3 748 ? 80.852  -60.771 4.823   1.00 50.58  ? 748  CYS A O     1 
ATOM   6593 C  CB    . CYS C 3 748 ? 79.125  -63.063 6.230   1.00 59.94  ? 748  CYS A CB    1 
ATOM   6594 S  SG    . CYS C 3 748 ? 78.979  -64.720 6.925   1.00 58.26  ? 748  CYS A SG    1 
ATOM   6595 N  N     . ILE C 3 749 ? 79.995  -59.979 6.747   1.00 49.89  ? 749  ILE A N     1 
ATOM   6596 C  CA    . ILE C 3 749 ? 79.972  -58.616 6.254   1.00 48.65  ? 749  ILE A CA    1 
ATOM   6597 C  C     . ILE C 3 749 ? 81.400  -58.109 6.155   1.00 47.49  ? 749  ILE A C     1 
ATOM   6598 O  O     . ILE C 3 749 ? 81.777  -57.519 5.131   1.00 44.38  ? 749  ILE A O     1 
ATOM   6599 C  CB    . ILE C 3 749 ? 79.156  -57.680 7.176   1.00 44.46  ? 749  ILE A CB    1 
ATOM   6600 C  CG1   . ILE C 3 749 ? 77.683  -58.080 7.162   1.00 43.75  ? 749  ILE A CG1   1 
ATOM   6601 C  CG2   . ILE C 3 749 ? 79.253  -56.254 6.690   1.00 46.79  ? 749  ILE A CG2   1 
ATOM   6602 C  CD1   . ILE C 3 749 ? 76.841  -57.331 8.160   1.00 38.43  ? 749  ILE A CD1   1 
ATOM   6603 N  N     . ARG C 3 750 ? 82.195  -58.343 7.205   1.00 42.92  ? 750  ARG A N     1 
ATOM   6604 C  CA    . ARG C 3 750 ? 83.593  -57.883 7.199   1.00 49.91  ? 750  ARG A CA    1 
ATOM   6605 C  C     . ARG C 3 750 ? 84.384  -58.497 6.034   1.00 48.99  ? 750  ARG A C     1 
ATOM   6606 O  O     . ARG C 3 750 ? 85.203  -57.834 5.390   1.00 51.16  ? 750  ARG A O     1 
ATOM   6607 C  CB    . ARG C 3 750 ? 84.295  -58.231 8.520   1.00 49.77  ? 750  ARG A CB    1 
ATOM   6608 C  CG    . ARG C 3 750 ? 85.701  -57.630 8.637   1.00 45.88  ? 750  ARG A CG    1 
ATOM   6609 C  CD    . ARG C 3 750 ? 86.449  -58.165 9.854   1.00 47.81  ? 750  ARG A CD    1 
ATOM   6610 N  NE    . ARG C 3 750 ? 86.902  -59.547 9.682   1.00 51.28  ? 750  ARG A NE    1 
ATOM   6611 C  CZ    . ARG C 3 750 ? 87.770  -59.952 8.752   1.00 56.87  ? 750  ARG A CZ    1 
ATOM   6612 N  NH1   . ARG C 3 750 ? 88.287  -59.084 7.891   1.00 59.19  ? 750  ARG A NH1   1 
ATOM   6613 N  NH2   . ARG C 3 750 ? 88.135  -61.228 8.690   1.00 52.55  ? 750  ARG A NH2   1 
ATOM   6614 N  N     . ARG C 3 751 ? 84.129  -59.770 5.769   1.00 44.42  ? 751  ARG A N     1 
ATOM   6615 C  CA    . ARG C 3 751 ? 84.817  -60.453 4.703   1.00 42.17  ? 751  ARG A CA    1 
ATOM   6616 C  C     . ARG C 3 751 ? 84.356  -60.001 3.330   1.00 42.71  ? 751  ARG A C     1 
ATOM   6617 O  O     . ARG C 3 751 ? 85.126  -60.008 2.378   1.00 48.13  ? 751  ARG A O     1 
ATOM   6618 C  CB    . ARG C 3 751 ? 84.635  -61.944 4.869   1.00 44.61  ? 751  ARG A CB    1 
ATOM   6619 C  CG    . ARG C 3 751 ? 85.196  -62.444 6.176   1.00 48.77  ? 751  ARG A CG    1 
ATOM   6620 C  CD    . ARG C 3 751 ? 85.772  -63.815 5.966   1.00 46.18  ? 751  ARG A CD    1 
ATOM   6621 N  NE    . ARG C 3 751 ? 86.276  -64.388 7.203   1.00 50.46  ? 751  ARG A NE    1 
ATOM   6622 C  CZ    . ARG C 3 751 ? 87.052  -65.462 7.250   1.00 50.94  ? 751  ARG A CZ    1 
ATOM   6623 N  NH1   . ARG C 3 751 ? 87.412  -66.068 6.122   1.00 52.71  ? 751  ARG A NH1   1 
ATOM   6624 N  NH2   . ARG C 3 751 ? 87.454  -65.936 8.421   1.00 48.34  ? 751  ARG A NH2   1 
ATOM   6625 N  N     . MET C 3 752 ? 83.101  -59.610 3.213   1.00 42.52  ? 752  MET A N     1 
ATOM   6626 C  CA    . MET C 3 752 ? 82.625  -59.135 1.928   1.00 43.94  ? 752  MET A CA    1 
ATOM   6627 C  C     . MET C 3 752 ? 83.262  -57.786 1.617   1.00 43.55  ? 752  MET A C     1 
ATOM   6628 O  O     . MET C 3 752 ? 83.649  -57.531 0.485   1.00 43.98  ? 752  MET A O     1 
ATOM   6629 C  CB    . MET C 3 752 ? 81.112  -58.963 1.939   1.00 43.89  ? 752  MET A CB    1 
ATOM   6630 C  CG    . MET C 3 752 ? 80.321  -60.237 1.853   1.00 42.76  ? 752  MET A CG    1 
ATOM   6631 S  SD    . MET C 3 752 ? 78.583  -59.870 2.176   1.00 52.95  ? 752  MET A SD    1 
ATOM   6632 C  CE    . MET C 3 752 ? 78.051  -59.089 0.569   1.00 41.88  ? 752  MET A CE    1 
ATOM   6633 N  N     . LEU C 3 753 ? 83.379  -56.934 2.633   1.00 41.32  ? 753  LEU A N     1 
ATOM   6634 C  CA    . LEU C 3 753 ? 83.928  -55.594 2.452   1.00 44.18  ? 753  LEU A CA    1 
ATOM   6635 C  C     . LEU C 3 753 ? 85.441  -55.496 2.412   1.00 49.68  ? 753  LEU A C     1 
ATOM   6636 O  O     . LEU C 3 753 ? 85.998  -54.830 1.532   1.00 47.45  ? 753  LEU A O     1 
ATOM   6637 C  CB    . LEU C 3 753 ? 83.403  -54.653 3.546   1.00 44.85  ? 753  LEU A CB    1 
ATOM   6638 C  CG    . LEU C 3 753 ? 81.869  -54.521 3.641   1.00 45.92  ? 753  LEU A CG    1 
ATOM   6639 C  CD1   . LEU C 3 753 ? 81.521  -53.518 4.712   1.00 42.56  ? 753  LEU A CD1   1 
ATOM   6640 C  CD2   . LEU C 3 753 ? 81.284  -54.100 2.303   1.00 39.24  ? 753  LEU A CD2   1 
ATOM   6641 N  N     . GLN C 3 754 ? 86.099  -56.165 3.360   1.00 51.04  ? 754  GLN A N     1 
ATOM   6642 C  CA    . GLN C 3 754 ? 87.553  -56.132 3.476   1.00 47.19  ? 754  GLN A CA    1 
ATOM   6643 C  C     . GLN C 3 754 ? 88.345  -57.227 2.760   1.00 51.21  ? 754  GLN A C     1 
ATOM   6644 O  O     . GLN C 3 754 ? 89.524  -57.037 2.452   1.00 52.26  ? 754  GLN A O     1 
ATOM   6645 C  CB    . GLN C 3 754 ? 87.934  -56.158 4.941   1.00 37.08  ? 754  GLN A CB    1 
ATOM   6646 C  CG    . GLN C 3 754 ? 87.380  -55.040 5.740   1.00 32.69  ? 754  GLN A CG    1 
ATOM   6647 C  CD    . GLN C 3 754 ? 87.633  -55.262 7.199   1.00 42.75  ? 754  GLN A CD    1 
ATOM   6648 O  OE1   . GLN C 3 754 ? 88.304  -56.221 7.576   1.00 40.01  ? 754  GLN A OE1   1 
ATOM   6649 N  NE2   . GLN C 3 754 ? 87.104  -54.380 8.040   1.00 51.50  ? 754  GLN A NE2   1 
ATOM   6650 N  N     . GLU C 3 755 ? 87.718  -58.370 2.502   1.00 53.08  ? 755  GLU A N     1 
ATOM   6651 C  CA    . GLU C 3 755 ? 88.433  -59.461 1.854   1.00 50.39  ? 755  GLU A CA    1 
ATOM   6652 C  C     . GLU C 3 755 ? 87.931  -59.929 0.489   1.00 51.29  ? 755  GLU A C     1 
ATOM   6653 O  O     . GLU C 3 755 ? 88.743  -60.150 -0.407  1.00 54.78  ? 755  GLU A O     1 
ATOM   6654 C  CB    . GLU C 3 755 ? 88.540  -60.618 2.838   1.00 52.91  ? 755  GLU A CB    1 
ATOM   6655 C  CG    . GLU C 3 755 ? 89.493  -60.279 3.979   1.00 58.90  ? 755  GLU A CG    1 
ATOM   6656 C  CD    . GLU C 3 755 ? 89.507  -61.306 5.093   1.00 63.12  ? 755  GLU A CD    1 
ATOM   6657 O  OE1   . GLU C 3 755 ? 89.316  -62.509 4.817   1.00 68.59  ? 755  GLU A OE1   1 
ATOM   6658 O  OE2   . GLU C 3 755 ? 89.735  -60.903 6.251   1.00 65.38  ? 755  GLU A OE2   1 
ATOM   6659 N  N     . GLY C 3 756 ? 86.619  -60.077 0.314   1.00 50.92  ? 756  GLY A N     1 
ATOM   6660 C  CA    . GLY C 3 756 ? 86.097  -60.490 -0.984  1.00 53.14  ? 756  GLY A CA    1 
ATOM   6661 C  C     . GLY C 3 756 ? 85.198  -61.720 -1.087  1.00 54.30  ? 756  GLY A C     1 
ATOM   6662 O  O     . GLY C 3 756 ? 85.023  -62.477 -0.129  1.00 52.24  ? 756  GLY A O     1 
ATOM   6663 N  N     . GLU C 3 757 ? 84.624  -61.914 -2.273  1.00 55.87  ? 757  GLU A N     1 
ATOM   6664 C  CA    . GLU C 3 757 ? 83.735  -63.047 -2.548  1.00 58.40  ? 757  GLU A CA    1 
ATOM   6665 C  C     . GLU C 3 757 ? 84.352  -64.383 -2.131  1.00 61.89  ? 757  GLU A C     1 
ATOM   6666 O  O     . GLU C 3 757 ? 83.746  -65.177 -1.412  1.00 60.08  ? 757  GLU A O     1 
ATOM   6667 C  CB    . GLU C 3 757 ? 83.405  -63.091 -4.039  1.00 55.00  ? 757  GLU A CB    1 
ATOM   6668 C  CG    . GLU C 3 757 ? 82.590  -64.301 -4.450  1.00 62.30  ? 757  GLU A CG    1 
ATOM   6669 C  CD    . GLU C 3 757 ? 82.244  -64.304 -5.931  1.00 68.11  ? 757  GLU A CD    1 
ATOM   6670 O  OE1   . GLU C 3 757 ? 83.183  -64.369 -6.758  1.00 74.76  ? 757  GLU A OE1   1 
ATOM   6671 O  OE2   . GLU C 3 757 ? 81.035  -64.241 -6.266  1.00 66.68  ? 757  GLU A OE2   1 
ATOM   6672 N  N     . GLU C 3 758 ? 85.568  -64.623 -2.594  1.00 68.20  ? 758  GLU A N     1 
ATOM   6673 C  CA    . GLU C 3 758 ? 86.266  -65.852 -2.282  1.00 66.94  ? 758  GLU A CA    1 
ATOM   6674 C  C     . GLU C 3 758 ? 86.330  -66.053 -0.770  1.00 62.95  ? 758  GLU A C     1 
ATOM   6675 O  O     . GLU C 3 758 ? 85.834  -67.042 -0.243  1.00 64.93  ? 758  GLU A O     1 
ATOM   6676 C  CB    . GLU C 3 758 ? 87.679  -65.793 -2.841  1.00 72.14  ? 758  GLU A CB    1 
ATOM   6677 C  CG    . GLU C 3 758 ? 88.297  -67.145 -3.032  1.00 86.65  ? 758  GLU A CG    1 
ATOM   6678 C  CD    . GLU C 3 758 ? 87.823  -67.806 -4.313  1.00 97.60  ? 758  GLU A CD    1 
ATOM   6679 O  OE1   . GLU C 3 758 ? 86.734  -67.423 -4.810  1.00 98.25  ? 758  GLU A OE1   1 
ATOM   6680 O  OE2   . GLU C 3 758 ? 88.540  -68.709 -4.807  1.00 100.18 ? 758  GLU A OE2   1 
ATOM   6681 N  N     . SER C 3 759 ? 86.946  -65.104 -0.076  1.00 57.13  ? 759  SER A N     1 
ATOM   6682 C  CA    . SER C 3 759 ? 87.079  -65.197 1.369   1.00 53.07  ? 759  SER A CA    1 
ATOM   6683 C  C     . SER C 3 759 ? 85.750  -65.420 2.066   1.00 53.89  ? 759  SER A C     1 
ATOM   6684 O  O     . SER C 3 759 ? 85.697  -66.039 3.132   1.00 55.96  ? 759  SER A O     1 
ATOM   6685 C  CB    . SER C 3 759 ? 87.721  -63.933 1.942   1.00 49.16  ? 759  SER A CB    1 
ATOM   6686 O  OG    . SER C 3 759 ? 87.762  -64.013 3.360   1.00 40.89  ? 759  SER A OG    1 
ATOM   6687 N  N     . LEU C 3 760 ? 84.677  -64.907 1.474   1.00 54.57  ? 760  LEU A N     1 
ATOM   6688 C  CA    . LEU C 3 760 ? 83.352  -65.055 2.059   1.00 51.13  ? 760  LEU A CA    1 
ATOM   6689 C  C     . LEU C 3 760 ? 82.987  -66.529 2.108   1.00 51.92  ? 760  LEU A C     1 
ATOM   6690 O  O     . LEU C 3 760 ? 82.775  -67.101 3.183   1.00 53.84  ? 760  LEU A O     1 
ATOM   6691 C  CB    . LEU C 3 760 ? 82.309  -64.315 1.217   1.00 44.72  ? 760  LEU A CB    1 
ATOM   6692 C  CG    . LEU C 3 760 ? 80.981  -63.873 1.850   1.00 42.03  ? 760  LEU A CG    1 
ATOM   6693 C  CD1   . LEU C 3 760 ? 79.896  -64.044 0.797   1.00 36.69  ? 760  LEU A CD1   1 
ATOM   6694 C  CD2   . LEU C 3 760 ? 80.651  -64.652 3.126   1.00 34.83  ? 760  LEU A CD2   1 
ATOM   6695 N  N     . GLN C 3 761 ? 82.923  -67.137 0.928   1.00 50.78  ? 761  GLN A N     1 
ATOM   6696 C  CA    . GLN C 3 761 ? 82.554  -68.544 0.790   1.00 53.28  ? 761  GLN A CA    1 
ATOM   6697 C  C     . GLN C 3 761 ? 83.308  -69.458 1.736   1.00 56.13  ? 761  GLN A C     1 
ATOM   6698 O  O     . GLN C 3 761 ? 82.693  -70.275 2.422   1.00 62.25  ? 761  GLN A O     1 
ATOM   6699 C  CB    . GLN C 3 761 ? 82.745  -68.974 -0.657  1.00 45.22  ? 761  GLN A CB    1 
ATOM   6700 C  CG    . GLN C 3 761 ? 81.966  -68.086 -1.597  1.00 43.38  ? 761  GLN A CG    1 
ATOM   6701 C  CD    . GLN C 3 761 ? 82.359  -68.267 -3.040  1.00 50.62  ? 761  GLN A CD    1 
ATOM   6702 O  OE1   . GLN C 3 761 ? 83.547  -68.280 -3.370  1.00 54.01  ? 761  GLN A OE1   1 
ATOM   6703 N  NE2   . GLN C 3 761 ? 81.366  -68.387 -3.917  1.00 47.82  ? 761  GLN A NE2   1 
ATOM   6704 N  N     . GLU C 3 762 ? 84.629  -69.323 1.772   1.00 53.97  ? 762  GLU A N     1 
ATOM   6705 C  CA    . GLU C 3 762 ? 85.443  -70.127 2.668   1.00 49.63  ? 762  GLU A CA    1 
ATOM   6706 C  C     . GLU C 3 762 ? 84.784  -70.168 4.033   1.00 47.38  ? 762  GLU A C     1 
ATOM   6707 O  O     . GLU C 3 762 ? 84.549  -71.232 4.592   1.00 50.33  ? 762  GLU A O     1 
ATOM   6708 C  CB    . GLU C 3 762 ? 86.836  -69.510 2.810   1.00 51.37  ? 762  GLU A CB    1 
ATOM   6709 C  CG    . GLU C 3 762 ? 87.639  -69.975 4.035   1.00 58.42  ? 762  GLU A CG    1 
ATOM   6710 C  CD    . GLU C 3 762 ? 89.093  -69.481 4.022   1.00 69.90  ? 762  GLU A CD    1 
ATOM   6711 O  OE1   . GLU C 3 762 ? 89.328  -68.271 3.792   1.00 76.81  ? 762  GLU A OE1   1 
ATOM   6712 O  OE2   . GLU C 3 762 ? 90.004  -70.307 4.245   1.00 74.53  ? 762  GLU A OE2   1 
ATOM   6713 N  N     . TYR C 3 763 ? 84.471  -68.991 4.553   1.00 47.29  ? 763  TYR A N     1 
ATOM   6714 C  CA    . TYR C 3 763 ? 83.885  -68.867 5.878   1.00 48.34  ? 763  TYR A CA    1 
ATOM   6715 C  C     . TYR C 3 763 ? 82.471  -69.417 6.066   1.00 45.68  ? 763  TYR A C     1 
ATOM   6716 O  O     . TYR C 3 763 ? 82.144  -69.933 7.136   1.00 45.04  ? 763  TYR A O     1 
ATOM   6717 C  CB    . TYR C 3 763 ? 83.942  -67.404 6.328   1.00 49.52  ? 763  TYR A CB    1 
ATOM   6718 C  CG    . TYR C 3 763 ? 83.362  -67.204 7.704   1.00 45.55  ? 763  TYR A CG    1 
ATOM   6719 C  CD1   . TYR C 3 763 ? 84.086  -67.564 8.836   1.00 43.41  ? 763  TYR A CD1   1 
ATOM   6720 C  CD2   . TYR C 3 763 ? 82.068  -66.711 7.877   1.00 35.53  ? 763  TYR A CD2   1 
ATOM   6721 C  CE1   . TYR C 3 763 ? 83.536  -67.444 10.111  1.00 43.03  ? 763  TYR A CE1   1 
ATOM   6722 C  CE2   . TYR C 3 763 ? 81.507  -66.584 9.149   1.00 32.73  ? 763  TYR A CE2   1 
ATOM   6723 C  CZ    . TYR C 3 763 ? 82.247  -66.955 10.258  1.00 39.05  ? 763  TYR A CZ    1 
ATOM   6724 O  OH    . TYR C 3 763 ? 81.716  -66.848 11.520  1.00 41.25  ? 763  TYR A OH    1 
ATOM   6725 N  N     . PHE C 3 764 ? 81.629  -69.296 5.048   1.00 44.33  ? 764  PHE A N     1 
ATOM   6726 C  CA    . PHE C 3 764 ? 80.267  -69.819 5.138   1.00 45.77  ? 764  PHE A CA    1 
ATOM   6727 C  C     . PHE C 3 764 ? 80.357  -71.326 5.361   1.00 50.66  ? 764  PHE A C     1 
ATOM   6728 O  O     . PHE C 3 764 ? 79.583  -71.920 6.123   1.00 50.22  ? 764  PHE A O     1 
ATOM   6729 C  CB    . PHE C 3 764 ? 79.504  -69.552 3.838   1.00 43.68  ? 764  PHE A CB    1 
ATOM   6730 C  CG    . PHE C 3 764 ? 78.110  -70.113 3.829   1.00 42.24  ? 764  PHE A CG    1 
ATOM   6731 C  CD1   . PHE C 3 764 ? 77.122  -69.567 4.645   1.00 44.76  ? 764  PHE A CD1   1 
ATOM   6732 C  CD2   . PHE C 3 764 ? 77.785  -71.199 3.013   1.00 41.59  ? 764  PHE A CD2   1 
ATOM   6733 C  CE1   . PHE C 3 764 ? 75.831  -70.090 4.652   1.00 43.80  ? 764  PHE A CE1   1 
ATOM   6734 C  CE2   . PHE C 3 764 ? 76.494  -71.733 3.010   1.00 35.72  ? 764  PHE A CE2   1 
ATOM   6735 C  CZ    . PHE C 3 764 ? 75.513  -71.177 3.834   1.00 44.05  ? 764  PHE A CZ    1 
ATOM   6736 N  N     . LYS C 3 765 ? 81.310  -71.937 4.671   1.00 53.77  ? 765  LYS A N     1 
ATOM   6737 C  CA    . LYS C 3 765 ? 81.539  -73.364 4.772   1.00 58.65  ? 765  LYS A CA    1 
ATOM   6738 C  C     . LYS C 3 765 ? 81.945  -73.682 6.212   1.00 56.96  ? 765  LYS A C     1 
ATOM   6739 O  O     . LYS C 3 765 ? 81.432  -74.616 6.820   1.00 58.31  ? 765  LYS A O     1 
ATOM   6740 C  CB    . LYS C 3 765 ? 82.655  -73.760 3.799   1.00 66.92  ? 765  LYS A CB    1 
ATOM   6741 C  CG    . LYS C 3 765 ? 82.947  -75.243 3.713   1.00 76.02  ? 765  LYS A CG    1 
ATOM   6742 C  CD    . LYS C 3 765 ? 81.923  -75.988 2.873   1.00 82.36  ? 765  LYS A CD    1 
ATOM   6743 C  CE    . LYS C 3 765 ? 82.169  -77.501 2.952   1.00 86.87  ? 765  LYS A CE    1 
ATOM   6744 N  NZ    . LYS C 3 765 ? 81.235  -78.301 2.110   1.00 81.28  ? 765  LYS A NZ    1 
ATOM   6745 N  N     . GLU C 3 766 ? 82.850  -72.878 6.761   1.00 58.13  ? 766  GLU A N     1 
ATOM   6746 C  CA    . GLU C 3 766 ? 83.332  -73.084 8.122   1.00 58.92  ? 766  GLU A CA    1 
ATOM   6747 C  C     . GLU C 3 766 ? 82.227  -73.018 9.171   1.00 56.55  ? 766  GLU A C     1 
ATOM   6748 O  O     . GLU C 3 766 ? 82.079  -73.936 9.972   1.00 60.69  ? 766  GLU A O     1 
ATOM   6749 C  CB    . GLU C 3 766 ? 84.446  -72.074 8.462   1.00 60.82  ? 766  GLU A CB    1 
ATOM   6750 C  CG    . GLU C 3 766 ? 85.630  -72.102 7.477   1.00 71.10  ? 766  GLU A CG    1 
ATOM   6751 C  CD    . GLU C 3 766 ? 86.931  -71.506 8.040   1.00 78.71  ? 766  GLU A CD    1 
ATOM   6752 O  OE1   . GLU C 3 766 ? 87.008  -70.274 8.266   1.00 76.97  ? 766  GLU A OE1   1 
ATOM   6753 O  OE2   . GLU C 3 766 ? 87.886  -72.286 8.256   1.00 81.68  ? 766  GLU A OE2   1 
ATOM   6754 N  N     . PHE C 3 767 ? 81.442  -71.946 9.160   1.00 55.76  ? 767  PHE A N     1 
ATOM   6755 C  CA    . PHE C 3 767 ? 80.373  -71.779 10.146  1.00 53.42  ? 767  PHE A CA    1 
ATOM   6756 C  C     . PHE C 3 767 ? 79.298  -72.838 10.013  1.00 52.94  ? 767  PHE A C     1 
ATOM   6757 O  O     . PHE C 3 767 ? 78.649  -73.198 10.995  1.00 47.34  ? 767  PHE A O     1 
ATOM   6758 C  CB    . PHE C 3 767 ? 79.733  -70.388 10.028  1.00 48.91  ? 767  PHE A CB    1 
ATOM   6759 C  CG    . PHE C 3 767 ? 78.663  -70.124 11.059  1.00 42.65  ? 767  PHE A CG    1 
ATOM   6760 C  CD1   . PHE C 3 767 ? 78.965  -70.151 12.423  1.00 31.45  ? 767  PHE A CD1   1 
ATOM   6761 C  CD2   . PHE C 3 767 ? 77.347  -69.873 10.670  1.00 34.15  ? 767  PHE A CD2   1 
ATOM   6762 C  CE1   . PHE C 3 767 ? 77.973  -69.934 13.388  1.00 31.90  ? 767  PHE A CE1   1 
ATOM   6763 C  CE2   . PHE C 3 767 ? 76.348  -69.656 11.630  1.00 32.68  ? 767  PHE A CE2   1 
ATOM   6764 C  CZ    . PHE C 3 767 ? 76.663  -69.687 12.992  1.00 30.67  ? 767  PHE A CZ    1 
ATOM   6765 N  N     . GLU C 3 768 ? 79.117  -73.316 8.785   1.00 60.83  ? 768  GLU A N     1 
ATOM   6766 C  CA    . GLU C 3 768 ? 78.141  -74.354 8.454   1.00 67.83  ? 768  GLU A CA    1 
ATOM   6767 C  C     . GLU C 3 768 ? 78.273  -75.526 9.419   1.00 66.82  ? 768  GLU A C     1 
ATOM   6768 O  O     . GLU C 3 768 ? 77.360  -75.808 10.198  1.00 64.63  ? 768  GLU A O     1 
ATOM   6769 C  CB    . GLU C 3 768 ? 78.391  -74.858 7.027   1.00 80.03  ? 768  GLU A CB    1 
ATOM   6770 C  CG    . GLU C 3 768 ? 77.271  -75.678 6.407   1.00 94.42  ? 768  GLU A CG    1 
ATOM   6771 C  CD    . GLU C 3 768 ? 76.291  -74.814 5.619   1.00 103.51 ? 768  GLU A CD    1 
ATOM   6772 O  OE1   . GLU C 3 768 ? 76.432  -73.570 5.664   1.00 107.44 ? 768  GLU A OE1   1 
ATOM   6773 O  OE2   . GLU C 3 768 ? 75.387  -75.379 4.957   1.00 106.41 ? 768  GLU A OE2   1 
ATOM   6774 N  N     . LYS C 3 769 ? 79.424  -76.192 9.374   1.00 66.48  ? 769  LYS A N     1 
ATOM   6775 C  CA    . LYS C 3 769 ? 79.667  -77.349 10.228  1.00 71.00  ? 769  LYS A CA    1 
ATOM   6776 C  C     . LYS C 3 769 ? 79.855  -77.065 11.719  1.00 71.68  ? 769  LYS A C     1 
ATOM   6777 O  O     . LYS C 3 769 ? 79.449  -77.881 12.553  1.00 71.24  ? 769  LYS A O     1 
ATOM   6778 C  CB    . LYS C 3 769 ? 80.854  -78.179 9.689   1.00 71.41  ? 769  LYS A CB    1 
ATOM   6779 C  CG    . LYS C 3 769 ? 82.101  -77.394 9.299   1.00 74.86  ? 769  LYS A CG    1 
ATOM   6780 C  CD    . LYS C 3 769 ? 83.160  -78.311 8.672   1.00 78.33  ? 769  LYS A CD    1 
ATOM   6781 C  CE    . LYS C 3 769 ? 84.356  -77.528 8.112   1.00 84.19  ? 769  LYS A CE    1 
ATOM   6782 N  NZ    . LYS C 3 769 ? 85.040  -76.657 9.131   1.00 87.30  ? 769  LYS A NZ    1 
ATOM   6783 N  N     . GLU C 3 770 ? 80.442  -75.920 12.062  1.00 72.13  ? 770  GLU A N     1 
ATOM   6784 C  CA    . GLU C 3 770 ? 80.661  -75.602 13.466  1.00 69.98  ? 770  GLU A CA    1 
ATOM   6785 C  C     . GLU C 3 770 ? 79.335  -75.304 14.151  1.00 67.31  ? 770  GLU A C     1 
ATOM   6786 O  O     . GLU C 3 770 ? 79.189  -75.513 15.355  1.00 68.69  ? 770  GLU A O     1 
ATOM   6787 C  CB    . GLU C 3 770 ? 81.622  -74.415 13.623  1.00 76.49  ? 770  GLU A CB    1 
ATOM   6788 C  CG    . GLU C 3 770 ? 80.968  -73.039 13.684  1.00 85.55  ? 770  GLU A CG    1 
ATOM   6789 C  CD    . GLU C 3 770 ? 81.953  -71.930 14.080  1.00 89.55  ? 770  GLU A CD    1 
ATOM   6790 O  OE1   . GLU C 3 770 ? 82.831  -71.571 13.263  1.00 89.52  ? 770  GLU A OE1   1 
ATOM   6791 O  OE2   . GLU C 3 770 ? 81.850  -71.422 15.219  1.00 88.04  ? 770  GLU A OE2   1 
ATOM   6792 N  N     . PHE C 3 771 ? 78.362  -74.831 13.378  1.00 64.52  ? 771  PHE A N     1 
ATOM   6793 C  CA    . PHE C 3 771 ? 77.043  -74.518 13.922  1.00 61.89  ? 771  PHE A CA    1 
ATOM   6794 C  C     . PHE C 3 771 ? 76.244  -75.788 14.218  1.00 63.15  ? 771  PHE A C     1 
ATOM   6795 O  O     . PHE C 3 771 ? 75.506  -75.851 15.208  1.00 56.28  ? 771  PHE A O     1 
ATOM   6796 C  CB    . PHE C 3 771 ? 76.248  -73.639 12.945  1.00 59.48  ? 771  PHE A CB    1 
ATOM   6797 C  CG    . PHE C 3 771 ? 74.803  -73.429 13.347  1.00 51.25  ? 771  PHE A CG    1 
ATOM   6798 C  CD1   . PHE C 3 771 ? 74.475  -72.663 14.460  1.00 51.03  ? 771  PHE A CD1   1 
ATOM   6799 C  CD2   . PHE C 3 771 ? 73.776  -74.016 12.622  1.00 48.82  ? 771  PHE A CD2   1 
ATOM   6800 C  CE1   . PHE C 3 771 ? 73.139  -72.484 14.845  1.00 43.81  ? 771  PHE A CE1   1 
ATOM   6801 C  CE2   . PHE C 3 771 ? 72.440  -73.845 12.996  1.00 50.28  ? 771  PHE A CE2   1 
ATOM   6802 C  CZ    . PHE C 3 771 ? 72.121  -73.076 14.110  1.00 45.47  ? 771  PHE A CZ    1 
ATOM   6803 N  N     . ARG C 3 772 ? 76.387  -76.792 13.354  1.00 64.20  ? 772  ARG A N     1 
ATOM   6804 C  CA    . ARG C 3 772 ? 75.668  -78.057 13.520  1.00 64.64  ? 772  ARG A CA    1 
ATOM   6805 C  C     . ARG C 3 772 ? 76.201  -78.848 14.715  1.00 64.26  ? 772  ARG A C     1 
ATOM   6806 O  O     . ARG C 3 772 ? 75.581  -79.809 15.162  1.00 64.43  ? 772  ARG A O     1 
ATOM   6807 C  CB    . ARG C 3 772 ? 75.787  -78.903 12.248  1.00 62.53  ? 772  ARG A CB    1 
ATOM   6808 C  CG    . ARG C 3 772 ? 75.689  -78.084 10.969  1.00 72.74  ? 772  ARG A CG    1 
ATOM   6809 C  CD    . ARG C 3 772 ? 74.879  -78.760 9.865   1.00 73.26  ? 772  ARG A CD    1 
ATOM   6810 N  NE    . ARG C 3 772 ? 73.471  -78.913 10.225  1.00 78.39  ? 772  ARG A NE    1 
ATOM   6811 C  CZ    . ARG C 3 772 ? 72.455  -78.629 9.412   1.00 79.05  ? 772  ARG A CZ    1 
ATOM   6812 N  NH1   . ARG C 3 772 ? 72.683  -78.173 8.187   1.00 75.33  ? 772  ARG A NH1   1 
ATOM   6813 N  NH2   . ARG C 3 772 ? 71.207  -78.797 9.827   1.00 79.98  ? 772  ARG A NH2   1 
ATOM   6814 N  N     . GLN C 3 773 ? 77.342  -78.424 15.241  1.00 64.83  ? 773  GLN A N     1 
ATOM   6815 C  CA    . GLN C 3 773 ? 77.954  -79.098 16.371  1.00 64.68  ? 773  GLN A CA    1 
ATOM   6816 C  C     . GLN C 3 773 ? 77.900  -78.279 17.659  1.00 61.89  ? 773  GLN A C     1 
ATOM   6817 O  O     . GLN C 3 773 ? 78.751  -78.430 18.528  1.00 64.59  ? 773  GLN A O     1 
ATOM   6818 C  CB    . GLN C 3 773 ? 79.402  -79.455 16.026  1.00 66.64  ? 773  GLN A CB    1 
ATOM   6819 C  CG    . GLN C 3 773 ? 79.503  -80.352 14.807  1.00 77.33  ? 773  GLN A CG    1 
ATOM   6820 C  CD    . GLN C 3 773 ? 80.920  -80.513 14.325  1.00 85.04  ? 773  GLN A CD    1 
ATOM   6821 O  OE1   . GLN C 3 773 ? 81.177  -81.166 13.305  1.00 83.74  ? 773  GLN A OE1   1 
ATOM   6822 N  NE2   . GLN C 3 773 ? 81.860  -79.915 15.056  1.00 89.71  ? 773  GLN A NE2   1 
ATOM   6823 N  N     . LEU C 3 774 ? 76.899  -77.419 17.791  1.00 59.26  ? 774  LEU A N     1 
ATOM   6824 C  CA    . LEU C 3 774 ? 76.774  -76.615 19.001  1.00 60.46  ? 774  LEU A CA    1 
ATOM   6825 C  C     . LEU C 3 774 ? 75.774  -77.229 19.978  1.00 60.92  ? 774  LEU A C     1 
ATOM   6826 O  O     . LEU C 3 774 ? 74.781  -77.835 19.576  1.00 62.46  ? 774  LEU A O     1 
ATOM   6827 C  CB    . LEU C 3 774 ? 76.334  -75.188 18.660  1.00 63.22  ? 774  LEU A CB    1 
ATOM   6828 C  CG    . LEU C 3 774 ? 77.206  -74.408 17.671  1.00 67.82  ? 774  LEU A CG    1 
ATOM   6829 C  CD1   . LEU C 3 774 ? 76.533  -73.081 17.347  1.00 66.18  ? 774  LEU A CD1   1 
ATOM   6830 C  CD2   . LEU C 3 774 ? 78.596  -74.188 18.250  1.00 67.52  ? 774  LEU A CD2   1 
ATOM   6831 N  N     . ASN C 3 775 ? 76.055  -77.079 21.266  1.00 59.40  ? 775  ASN A N     1 
ATOM   6832 C  CA    . ASN C 3 775 ? 75.186  -77.587 22.316  1.00 57.96  ? 775  ASN A CA    1 
ATOM   6833 C  C     . ASN C 3 775 ? 73.770  -77.077 22.047  1.00 57.20  ? 775  ASN A C     1 
ATOM   6834 O  O     . ASN C 3 775 ? 73.608  -76.016 21.457  1.00 58.93  ? 775  ASN A O     1 
ATOM   6835 C  CB    . ASN C 3 775 ? 75.710  -77.081 23.662  1.00 61.40  ? 775  ASN A CB    1 
ATOM   6836 C  CG    . ASN C 3 775 ? 74.611  -76.842 24.669  1.00 67.09  ? 775  ASN A CG    1 
ATOM   6837 O  OD1   . ASN C 3 775 ? 73.678  -76.076 24.417  1.00 71.92  ? 775  ASN A OD1   1 
ATOM   6838 N  ND2   . ASN C 3 775 ? 74.718  -77.485 25.824  1.00 67.58  ? 775  ASN A ND2   1 
ATOM   6839 N  N     . TYR C 3 776 ? 72.745  -77.812 22.475  1.00 56.94  ? 776  TYR A N     1 
ATOM   6840 C  CA    . TYR C 3 776 ? 71.367  -77.377 22.224  1.00 54.47  ? 776  TYR A CA    1 
ATOM   6841 C  C     . TYR C 3 776 ? 71.015  -76.076 22.907  1.00 56.31  ? 776  TYR A C     1 
ATOM   6842 O  O     . TYR C 3 776 ? 70.708  -75.086 22.241  1.00 59.09  ? 776  TYR A O     1 
ATOM   6843 C  CB    . TYR C 3 776 ? 70.359  -78.445 22.638  1.00 45.50  ? 776  TYR A CB    1 
ATOM   6844 C  CG    . TYR C 3 776 ? 70.451  -78.878 24.078  1.00 43.61  ? 776  TYR A CG    1 
ATOM   6845 C  CD1   . TYR C 3 776 ? 71.633  -79.421 24.593  1.00 43.21  ? 776  TYR A CD1   1 
ATOM   6846 C  CD2   . TYR C 3 776 ? 69.333  -78.814 24.914  1.00 42.91  ? 776  TYR A CD2   1 
ATOM   6847 C  CE1   . TYR C 3 776 ? 71.696  -79.902 25.916  1.00 43.76  ? 776  TYR A CE1   1 
ATOM   6848 C  CE2   . TYR C 3 776 ? 69.378  -79.290 26.231  1.00 41.42  ? 776  TYR A CE2   1 
ATOM   6849 C  CZ    . TYR C 3 776 ? 70.559  -79.831 26.730  1.00 44.82  ? 776  TYR A CZ    1 
ATOM   6850 O  OH    . TYR C 3 776 ? 70.598  -80.275 28.036  1.00 41.06  ? 776  TYR A OH    1 
ATOM   6851 N  N     . ILE C 3 777 ? 71.037  -76.082 24.236  1.00 57.26  ? 777  ILE A N     1 
ATOM   6852 C  CA    . ILE C 3 777 ? 70.736  -74.883 25.016  1.00 55.19  ? 777  ILE A CA    1 
ATOM   6853 C  C     . ILE C 3 777 ? 71.448  -73.651 24.433  1.00 48.97  ? 777  ILE A C     1 
ATOM   6854 O  O     . ILE C 3 777 ? 70.984  -72.531 24.590  1.00 45.82  ? 777  ILE A O     1 
ATOM   6855 C  CB    . ILE C 3 777 ? 71.106  -75.102 26.532  1.00 53.48  ? 777  ILE A CB    1 
ATOM   6856 C  CG1   . ILE C 3 777 ? 71.749  -73.848 27.125  1.00 56.46  ? 777  ILE A CG1   1 
ATOM   6857 C  CG2   . ILE C 3 777 ? 72.015  -76.302 26.687  1.00 51.76  ? 777  ILE A CG2   1 
ATOM   6858 C  CD1   . ILE C 3 777 ? 70.784  -72.733 27.441  1.00 56.50  ? 777  ILE A CD1   1 
ATOM   6859 N  N     . SER C 3 778 ? 72.568  -73.861 23.751  1.00 49.34  ? 778  SER A N     1 
ATOM   6860 C  CA    . SER C 3 778 ? 73.281  -72.747 23.142  1.00 54.35  ? 778  SER A CA    1 
ATOM   6861 C  C     . SER C 3 778 ? 72.314  -72.012 22.236  1.00 58.77  ? 778  SER A C     1 
ATOM   6862 O  O     . SER C 3 778 ? 71.975  -70.859 22.487  1.00 61.09  ? 778  SER A O     1 
ATOM   6863 C  CB    . SER C 3 778 ? 74.451  -73.237 22.292  1.00 53.18  ? 778  SER A CB    1 
ATOM   6864 O  OG    . SER C 3 778 ? 75.346  -74.015 23.059  1.00 65.69  ? 778  SER A OG    1 
ATOM   6865 N  N     . ILE C 3 779 ? 71.856  -72.699 21.191  1.00 60.33  ? 779  ILE A N     1 
ATOM   6866 C  CA    . ILE C 3 779 ? 70.947  -72.112 20.205  1.00 61.07  ? 779  ILE A CA    1 
ATOM   6867 C  C     . ILE C 3 779 ? 69.462  -72.020 20.558  1.00 58.78  ? 779  ILE A C     1 
ATOM   6868 O  O     . ILE C 3 779 ? 68.664  -71.527 19.758  1.00 56.10  ? 779  ILE A O     1 
ATOM   6869 C  CB    . ILE C 3 779 ? 71.086  -72.838 18.867  1.00 59.29  ? 779  ILE A CB    1 
ATOM   6870 C  CG1   . ILE C 3 779 ? 70.957  -74.342 19.087  1.00 60.63  ? 779  ILE A CG1   1 
ATOM   6871 C  CG2   . ILE C 3 779 ? 72.435  -72.505 18.237  1.00 62.57  ? 779  ILE A CG2   1 
ATOM   6872 C  CD1   . ILE C 3 779 ? 71.292  -75.162 17.871  1.00 58.77  ? 779  ILE A CD1   1 
ATOM   6873 N  N     . ALA C 3 780 ? 69.098  -72.477 21.752  1.00 59.44  ? 780  ALA A N     1 
ATOM   6874 C  CA    . ALA C 3 780 ? 67.706  -72.423 22.208  1.00 58.92  ? 780  ALA A CA    1 
ATOM   6875 C  C     . ALA C 3 780 ? 67.207  -70.988 22.291  1.00 57.50  ? 780  ALA A C     1 
ATOM   6876 O  O     . ALA C 3 780 ? 67.899  -70.050 21.895  1.00 59.80  ? 780  ALA A O     1 
ATOM   6877 C  CB    . ALA C 3 780 ? 67.573  -73.094 23.575  1.00 59.71  ? 780  ALA A CB    1 
ATOM   6878 N  N     . SER C 3 781 ? 66.001  -70.830 22.820  1.00 55.18  ? 781  SER A N     1 
ATOM   6879 C  CA    . SER C 3 781 ? 65.395  -69.524 22.951  1.00 53.95  ? 781  SER A CA    1 
ATOM   6880 C  C     . SER C 3 781 ? 64.622  -69.386 24.245  1.00 58.53  ? 781  SER A C     1 
ATOM   6881 O  O     . SER C 3 781 ? 64.265  -70.370 24.891  1.00 60.20  ? 781  SER A O     1 
ATOM   6882 C  CB    . SER C 3 781 ? 64.473  -69.259 21.772  1.00 53.70  ? 781  SER A CB    1 
ATOM   6883 O  OG    . SER C 3 781 ? 65.220  -69.269 20.568  1.00 67.98  ? 781  SER A OG    1 
ATOM   6884 N  N     . VAL C 3 782 ? 64.361  -68.143 24.617  1.00 61.62  ? 782  VAL A N     1 
ATOM   6885 C  CA    . VAL C 3 782 ? 63.648  -67.870 25.843  1.00 62.02  ? 782  VAL A CA    1 
ATOM   6886 C  C     . VAL C 3 782 ? 62.435  -66.993 25.618  1.00 59.83  ? 782  VAL A C     1 
ATOM   6887 O  O     . VAL C 3 782 ? 62.367  -66.218 24.659  1.00 57.88  ? 782  VAL A O     1 
ATOM   6888 C  CB    . VAL C 3 782 ? 64.573  -67.192 26.855  1.00 67.28  ? 782  VAL A CB    1 
ATOM   6889 C  CG1   . VAL C 3 782 ? 65.691  -68.135 27.230  1.00 65.71  ? 782  VAL A CG1   1 
ATOM   6890 C  CG2   . VAL C 3 782 ? 65.149  -65.916 26.252  1.00 72.16  ? 782  VAL A CG2   1 
ATOM   6891 N  N     . SER C 3 783 ? 61.479  -67.142 26.524  1.00 57.54  ? 783  SER A N     1 
ATOM   6892 C  CA    . SER C 3 783 ? 60.224  -66.404 26.520  1.00 62.33  ? 783  SER A CA    1 
ATOM   6893 C  C     . SER C 3 783 ? 59.488  -67.045 27.674  1.00 60.83  ? 783  SER A C     1 
ATOM   6894 O  O     . SER C 3 783 ? 59.949  -68.044 28.213  1.00 56.92  ? 783  SER A O     1 
ATOM   6895 C  CB    . SER C 3 783 ? 59.447  -66.613 25.204  1.00 67.33  ? 783  SER A CB    1 
ATOM   6896 O  OG    . SER C 3 783 ? 59.388  -65.426 24.420  1.00 72.96  ? 783  SER A OG    1 
ATOM   6897 N  N     . SER C 3 784 ? 58.356  -66.483 28.066  1.00 65.72  ? 784  SER A N     1 
ATOM   6898 C  CA    . SER C 3 784 ? 57.622  -67.061 29.178  1.00 68.41  ? 784  SER A CA    1 
ATOM   6899 C  C     . SER C 3 784 ? 56.201  -67.413 28.805  1.00 69.48  ? 784  SER A C     1 
ATOM   6900 O  O     . SER C 3 784 ? 55.653  -66.904 27.828  1.00 70.36  ? 784  SER A O     1 
ATOM   6901 C  CB    . SER C 3 784 ? 57.618  -66.107 30.372  1.00 71.61  ? 784  SER A CB    1 
ATOM   6902 O  OG    . SER C 3 784 ? 57.111  -64.846 29.999  1.00 73.71  ? 784  SER A OG    1 
ATOM   6903 N  N     . ALA C 3 785 ? 55.612  -68.301 29.592  1.00 72.49  ? 785  ALA A N     1 
ATOM   6904 C  CA    . ALA C 3 785 ? 54.248  -68.743 29.357  1.00 80.10  ? 785  ALA A CA    1 
ATOM   6905 C  C     . ALA C 3 785 ? 53.324  -68.068 30.362  1.00 83.82  ? 785  ALA A C     1 
ATOM   6906 O  O     . ALA C 3 785 ? 53.236  -68.494 31.519  1.00 82.41  ? 785  ALA A O     1 
ATOM   6907 C  CB    . ALA C 3 785 ? 54.166  -70.249 29.510  1.00 81.67  ? 785  ALA A CB    1 
ATOM   6908 N  N     . ASN C 3 786 ? 52.623  -67.029 29.917  1.00 86.82  ? 786  ASN A N     1 
ATOM   6909 C  CA    . ASN C 3 786 ? 51.731  -66.299 30.805  1.00 89.78  ? 786  ASN A CA    1 
ATOM   6910 C  C     . ASN C 3 786 ? 50.346  -66.150 30.209  1.00 90.01  ? 786  ASN A C     1 
ATOM   6911 O  O     . ASN C 3 786 ? 49.822  -65.042 30.090  1.00 95.06  ? 786  ASN A O     1 
ATOM   6912 C  CB    . ASN C 3 786 ? 52.328  -64.931 31.114  1.00 91.78  ? 786  ASN A CB    1 
ATOM   6913 C  CG    . ASN C 3 786 ? 53.840  -64.960 31.127  1.00 94.95  ? 786  ASN A CG    1 
ATOM   6914 O  OD1   . ASN C 3 786 ? 54.461  -65.787 31.812  1.00 97.82  ? 786  ASN A OD1   1 
ATOM   6915 N  ND2   . ASN C 3 786 ? 54.449  -64.061 30.359  1.00 93.82  ? 786  ASN A ND2   1 
ATOM   6916 N  N     . ASN C 3 787 ? 49.780  -67.300 29.853  1.00 87.59  ? 787  ASN A N     1 
ATOM   6917 C  CA    . ASN C 3 787 ? 48.453  -67.454 29.269  1.00 85.33  ? 787  ASN A CA    1 
ATOM   6918 C  C     . ASN C 3 787 ? 48.443  -68.709 28.456  1.00 82.71  ? 787  ASN A C     1 
ATOM   6919 O  O     . ASN C 3 787 ? 48.155  -68.675 27.261  1.00 84.50  ? 787  ASN A O     1 
ATOM   6920 C  CB    . ASN C 3 787 ? 48.091  -66.311 28.342  1.00 86.97  ? 787  ASN A CB    1 
ATOM   6921 C  CG    . ASN C 3 787 ? 47.414  -65.194 29.063  1.00 86.02  ? 787  ASN A CG    1 
ATOM   6922 O  OD1   . ASN C 3 787 ? 46.454  -65.407 29.815  1.00 80.98  ? 787  ASN A OD1   1 
ATOM   6923 N  ND2   . ASN C 3 787 ? 47.909  -63.986 28.847  1.00 82.56  ? 787  ASN A ND2   1 
ATOM   6924 N  N     . ILE C 3 788 ? 48.786  -69.814 29.103  1.00 79.23  ? 788  ILE A N     1 
ATOM   6925 C  CA    . ILE C 3 788 ? 48.819  -71.102 28.437  1.00 75.79  ? 788  ILE A CA    1 
ATOM   6926 C  C     . ILE C 3 788 ? 47.463  -71.749 28.642  1.00 73.58  ? 788  ILE A C     1 
ATOM   6927 O  O     . ILE C 3 788 ? 46.900  -72.338 27.727  1.00 73.66  ? 788  ILE A O     1 
ATOM   6928 C  CB    . ILE C 3 788 ? 49.943  -72.024 29.014  1.00 74.89  ? 788  ILE A CB    1 
ATOM   6929 C  CG1   . ILE C 3 788 ? 49.583  -72.543 30.407  1.00 75.14  ? 788  ILE A CG1   1 
ATOM   6930 C  CG2   . ILE C 3 788 ? 51.230  -71.240 29.145  1.00 77.91  ? 788  ILE A CG2   1 
ATOM   6931 C  CD1   . ILE C 3 788 ? 50.710  -73.318 31.077  1.00 70.03  ? 788  ILE A CD1   1 
ATOM   6932 N  N     . ALA C 3 789 ? 46.935  -71.604 29.852  1.00 76.33  ? 789  ALA A N     1 
ATOM   6933 C  CA    . ALA C 3 789 ? 45.647  -72.177 30.221  1.00 76.34  ? 789  ALA A CA    1 
ATOM   6934 C  C     . ALA C 3 789 ? 44.558  -71.892 29.192  1.00 75.56  ? 789  ALA A C     1 
ATOM   6935 O  O     . ALA C 3 789 ? 43.724  -72.753 28.898  1.00 70.54  ? 789  ALA A O     1 
ATOM   6936 C  CB    . ALA C 3 789 ? 45.228  -71.658 31.587  1.00 75.53  ? 789  ALA A CB    1 
ATOM   6937 N  N     . LYS C 3 790 ? 44.566  -70.683 28.644  1.00 78.05  ? 790  LYS A N     1 
ATOM   6938 C  CA    . LYS C 3 790 ? 43.568  -70.314 27.651  1.00 82.44  ? 790  LYS A CA    1 
ATOM   6939 C  C     . LYS C 3 790 ? 43.879  -70.994 26.328  1.00 82.09  ? 790  LYS A C     1 
ATOM   6940 O  O     . LYS C 3 790 ? 43.062  -71.752 25.802  1.00 84.41  ? 790  LYS A O     1 
ATOM   6941 C  CB    . LYS C 3 790 ? 43.538  -68.802 27.450  1.00 87.88  ? 790  LYS A CB    1 
ATOM   6942 C  CG    . LYS C 3 790 ? 42.515  -68.379 26.407  1.00 93.24  ? 790  LYS A CG    1 
ATOM   6943 C  CD    . LYS C 3 790 ? 42.468  -66.882 26.236  1.00 95.57  ? 790  LYS A CD    1 
ATOM   6944 C  CE    . LYS C 3 790 ? 43.838  -66.333 25.884  1.00 98.01  ? 790  LYS A CE    1 
ATOM   6945 N  NZ    . LYS C 3 790 ? 43.773  -64.899 25.494  1.00 102.99 ? 790  LYS A NZ    1 
ATOM   6946 N  N     . TYR C 3 791 ? 45.065  -70.707 25.798  1.00 80.30  ? 791  TYR A N     1 
ATOM   6947 C  CA    . TYR C 3 791 ? 45.535  -71.276 24.540  1.00 75.94  ? 791  TYR A CA    1 
ATOM   6948 C  C     . TYR C 3 791 ? 45.468  -72.798 24.493  1.00 75.04  ? 791  TYR A C     1 
ATOM   6949 O  O     . TYR C 3 791 ? 45.631  -73.398 23.433  1.00 75.79  ? 791  TYR A O     1 
ATOM   6950 C  CB    . TYR C 3 791 ? 46.967  -70.829 24.297  1.00 75.24  ? 791  TYR A CB    1 
ATOM   6951 C  CG    . TYR C 3 791 ? 47.057  -69.427 23.770  1.00 79.88  ? 791  TYR A CG    1 
ATOM   6952 C  CD1   . TYR C 3 791 ? 46.083  -68.928 22.906  1.00 81.22  ? 791  TYR A CD1   1 
ATOM   6953 C  CD2   . TYR C 3 791 ? 48.142  -68.612 24.082  1.00 82.82  ? 791  TYR A CD2   1 
ATOM   6954 C  CE1   . TYR C 3 791 ? 46.193  -67.654 22.359  1.00 83.34  ? 791  TYR A CE1   1 
ATOM   6955 C  CE2   . TYR C 3 791 ? 48.257  -67.333 23.544  1.00 84.26  ? 791  TYR A CE2   1 
ATOM   6956 C  CZ    . TYR C 3 791 ? 47.283  -66.864 22.682  1.00 83.05  ? 791  TYR A CZ    1 
ATOM   6957 O  OH    . TYR C 3 791 ? 47.414  -65.612 22.130  1.00 84.21  ? 791  TYR A OH    1 
ATOM   6958 N  N     . ASP C 3 792 ? 45.213  -73.415 25.641  1.00 74.51  ? 792  ASP A N     1 
ATOM   6959 C  CA    . ASP C 3 792 ? 45.147  -74.868 25.734  1.00 72.30  ? 792  ASP A CA    1 
ATOM   6960 C  C     . ASP C 3 792 ? 43.768  -75.424 25.449  1.00 70.80  ? 792  ASP A C     1 
ATOM   6961 O  O     . ASP C 3 792 ? 42.823  -75.177 26.201  1.00 74.07  ? 792  ASP A O     1 
ATOM   6962 C  CB    . ASP C 3 792 ? 45.580  -75.331 27.123  1.00 72.97  ? 792  ASP A CB    1 
ATOM   6963 C  CG    . ASP C 3 792 ? 45.515  -76.844 27.278  1.00 76.34  ? 792  ASP A CG    1 
ATOM   6964 O  OD1   . ASP C 3 792 ? 44.395  -77.397 27.323  1.00 72.79  ? 792  ASP A OD1   1 
ATOM   6965 O  OD2   . ASP C 3 792 ? 46.588  -77.477 27.349  1.00 80.03  ? 792  ASP A OD2   1 
ATOM   6966 N  N     . VAL C 3 793 ? 43.661  -76.198 24.375  1.00 67.35  ? 793  VAL A N     1 
ATOM   6967 C  CA    . VAL C 3 793 ? 42.389  -76.800 23.997  1.00 62.31  ? 793  VAL A CA    1 
ATOM   6968 C  C     . VAL C 3 793 ? 42.488  -78.316 24.054  1.00 60.10  ? 793  VAL A C     1 
ATOM   6969 O  O     . VAL C 3 793 ? 42.998  -78.941 23.128  1.00 61.43  ? 793  VAL A O     1 
ATOM   6970 C  CB    . VAL C 3 793 ? 41.969  -76.394 22.563  1.00 59.60  ? 793  VAL A CB    1 
ATOM   6971 C  CG1   . VAL C 3 793 ? 40.584  -76.917 22.274  1.00 52.38  ? 793  VAL A CG1   1 
ATOM   6972 C  CG2   . VAL C 3 793 ? 42.011  -74.880 22.400  1.00 53.48  ? 793  VAL A CG2   1 
ATOM   6973 N  N     . GLY C 3 794 ? 41.994  -78.900 25.143  1.00 61.37  ? 794  GLY A N     1 
ATOM   6974 C  CA    . GLY C 3 794 ? 42.036  -80.347 25.306  1.00 61.21  ? 794  GLY A CA    1 
ATOM   6975 C  C     . GLY C 3 794 ? 43.432  -80.959 25.246  1.00 58.38  ? 794  GLY A C     1 
ATOM   6976 O  O     . GLY C 3 794 ? 43.586  -82.144 24.949  1.00 54.78  ? 794  GLY A O     1 
ATOM   6977 N  N     . GLY C 3 795 ? 44.451  -80.154 25.531  1.00 56.08  ? 795  GLY A N     1 
ATOM   6978 C  CA    . GLY C 3 795 ? 45.813  -80.649 25.498  1.00 56.25  ? 795  GLY A CA    1 
ATOM   6979 C  C     . GLY C 3 795 ? 46.591  -80.228 24.266  1.00 58.62  ? 795  GLY A C     1 
ATOM   6980 O  O     . GLY C 3 795 ? 47.805  -80.430 24.195  1.00 60.48  ? 795  GLY A O     1 
ATOM   6981 N  N     . PHE C 3 796 ? 45.902  -79.631 23.297  1.00 60.93  ? 796  PHE A N     1 
ATOM   6982 C  CA    . PHE C 3 796 ? 46.550  -79.193 22.065  1.00 64.45  ? 796  PHE A CA    1 
ATOM   6983 C  C     . PHE C 3 796 ? 46.530  -77.680 21.839  1.00 64.99  ? 796  PHE A C     1 
ATOM   6984 O  O     . PHE C 3 796 ? 45.726  -76.952 22.428  1.00 66.76  ? 796  PHE A O     1 
ATOM   6985 C  CB    . PHE C 3 796 ? 45.914  -79.894 20.854  1.00 67.74  ? 796  PHE A CB    1 
ATOM   6986 C  CG    . PHE C 3 796 ? 46.277  -81.345 20.739  1.00 72.66  ? 796  PHE A CG    1 
ATOM   6987 C  CD1   . PHE C 3 796 ? 45.521  -82.319 21.383  1.00 73.37  ? 796  PHE A CD1   1 
ATOM   6988 C  CD2   . PHE C 3 796 ? 47.415  -81.735 20.035  1.00 72.97  ? 796  PHE A CD2   1 
ATOM   6989 C  CE1   . PHE C 3 796 ? 45.896  -83.662 21.333  1.00 72.75  ? 796  PHE A CE1   1 
ATOM   6990 C  CE2   . PHE C 3 796 ? 47.796  -83.075 19.980  1.00 74.48  ? 796  PHE A CE2   1 
ATOM   6991 C  CZ    . PHE C 3 796 ? 47.035  -84.037 20.631  1.00 71.68  ? 796  PHE A CZ    1 
ATOM   6992 N  N     . PRO C 3 797 ? 47.425  -77.184 20.974  1.00 62.09  ? 797  PRO A N     1 
ATOM   6993 C  CA    . PRO C 3 797 ? 47.435  -75.745 20.730  1.00 61.81  ? 797  PRO A CA    1 
ATOM   6994 C  C     . PRO C 3 797 ? 46.093  -75.274 20.180  1.00 61.00  ? 797  PRO A C     1 
ATOM   6995 O  O     . PRO C 3 797 ? 45.559  -75.864 19.248  1.00 63.21  ? 797  PRO A O     1 
ATOM   6996 C  CB    . PRO C 3 797 ? 48.582  -75.574 19.730  1.00 59.83  ? 797  PRO A CB    1 
ATOM   6997 C  CG    . PRO C 3 797 ? 48.602  -76.869 19.010  1.00 60.45  ? 797  PRO A CG    1 
ATOM   6998 C  CD    . PRO C 3 797 ? 48.408  -77.869 20.119  1.00 60.82  ? 797  PRO A CD    1 
ATOM   6999 N  N     . GLY C 3 798 ? 45.542  -74.225 20.778  1.00 64.74  ? 798  GLY A N     1 
ATOM   7000 C  CA    . GLY C 3 798 ? 44.279  -73.689 20.308  1.00 65.27  ? 798  GLY A CA    1 
ATOM   7001 C  C     . GLY C 3 798 ? 44.529  -72.757 19.135  1.00 67.32  ? 798  GLY A C     1 
ATOM   7002 O  O     . GLY C 3 798 ? 45.658  -72.666 18.653  1.00 65.45  ? 798  GLY A O     1 
ATOM   7003 N  N     . PRO C 3 799 ? 43.503  -72.049 18.647  1.00 70.40  ? 799  PRO A N     1 
ATOM   7004 C  CA    . PRO C 3 799 ? 43.719  -71.143 17.515  1.00 72.38  ? 799  PRO A CA    1 
ATOM   7005 C  C     . PRO C 3 799 ? 44.633  -69.967 17.848  1.00 74.66  ? 799  PRO A C     1 
ATOM   7006 O  O     . PRO C 3 799 ? 44.617  -69.459 18.971  1.00 73.58  ? 799  PRO A O     1 
ATOM   7007 C  CB    . PRO C 3 799 ? 42.299  -70.715 17.141  1.00 71.16  ? 799  PRO A CB    1 
ATOM   7008 C  CG    . PRO C 3 799 ? 41.564  -70.795 18.443  1.00 69.79  ? 799  PRO A CG    1 
ATOM   7009 C  CD    . PRO C 3 799 ? 42.087  -72.069 19.054  1.00 71.53  ? 799  PRO A CD    1 
ATOM   7010 N  N     . LYS C 3 800 ? 45.437  -69.560 16.863  1.00 79.12  ? 800  LYS A N     1 
ATOM   7011 C  CA    . LYS C 3 800 ? 46.395  -68.447 16.982  1.00 81.59  ? 800  LYS A CA    1 
ATOM   7012 C  C     . LYS C 3 800 ? 47.384  -68.563 18.142  1.00 79.50  ? 800  LYS A C     1 
ATOM   7013 O  O     . LYS C 3 800 ? 47.908  -67.560 18.624  1.00 81.20  ? 800  LYS A O     1 
ATOM   7014 C  CB    . LYS C 3 800 ? 45.655  -67.102 17.066  1.00 88.06  ? 800  LYS A CB    1 
ATOM   7015 C  CG    . LYS C 3 800 ? 45.255  -66.525 15.701  1.00 92.61  ? 800  LYS A CG    1 
ATOM   7016 C  CD    . LYS C 3 800 ? 44.385  -65.278 15.815  1.00 94.72  ? 800  LYS A CD    1 
ATOM   7017 C  CE    . LYS C 3 800 ? 42.990  -65.604 16.342  1.00 97.01  ? 800  LYS A CE    1 
ATOM   7018 N  NZ    . LYS C 3 800 ? 43.014  -66.164 17.725  1.00 94.27  ? 800  LYS A NZ    1 
ATOM   7019 N  N     . CYS C 3 801 ? 47.643  -69.796 18.565  1.00 75.47  ? 801  CYS A N     1 
ATOM   7020 C  CA    . CYS C 3 801 ? 48.562  -70.091 19.656  1.00 69.65  ? 801  CYS A CA    1 
ATOM   7021 C  C     . CYS C 3 801 ? 50.009  -69.679 19.326  1.00 66.85  ? 801  CYS A C     1 
ATOM   7022 O  O     . CYS C 3 801 ? 50.454  -69.815 18.189  1.00 65.84  ? 801  CYS A O     1 
ATOM   7023 C  CB    . CYS C 3 801 ? 48.497  -71.591 19.953  1.00 70.18  ? 801  CYS A CB    1 
ATOM   7024 S  SG    . CYS C 3 801 ? 49.630  -72.219 21.208  1.00 67.40  ? 801  CYS A SG    1 
ATOM   7025 N  N     . PRO C 3 802 ? 50.748  -69.139 20.319  1.00 64.76  ? 802  PRO A N     1 
ATOM   7026 C  CA    . PRO C 3 802 ? 52.143  -68.708 20.148  1.00 60.87  ? 802  PRO A CA    1 
ATOM   7027 C  C     . PRO C 3 802 ? 53.090  -69.905 20.157  1.00 59.45  ? 802  PRO A C     1 
ATOM   7028 O  O     . PRO C 3 802 ? 52.875  -70.886 20.877  1.00 57.47  ? 802  PRO A O     1 
ATOM   7029 C  CB    . PRO C 3 802 ? 52.389  -67.802 21.358  1.00 60.50  ? 802  PRO A CB    1 
ATOM   7030 C  CG    . PRO C 3 802 ? 51.018  -67.363 21.769  1.00 61.40  ? 802  PRO A CG    1 
ATOM   7031 C  CD    . PRO C 3 802 ? 50.208  -68.616 21.584  1.00 62.29  ? 802  PRO A CD    1 
ATOM   7032 N  N     . PHE C 3 803 ? 54.148  -69.800 19.366  1.00 55.27  ? 803  PHE A N     1 
ATOM   7033 C  CA    . PHE C 3 803 ? 55.149  -70.846 19.247  1.00 53.44  ? 803  PHE A CA    1 
ATOM   7034 C  C     . PHE C 3 803 ? 55.570  -71.454 20.591  1.00 54.14  ? 803  PHE A C     1 
ATOM   7035 O  O     . PHE C 3 803 ? 55.477  -72.669 20.783  1.00 52.70  ? 803  PHE A O     1 
ATOM   7036 C  CB    . PHE C 3 803 ? 56.358  -70.271 18.517  1.00 48.21  ? 803  PHE A CB    1 
ATOM   7037 C  CG    . PHE C 3 803 ? 57.312  -71.304 17.985  1.00 52.09  ? 803  PHE A CG    1 
ATOM   7038 C  CD1   . PHE C 3 803 ? 58.299  -71.850 18.798  1.00 49.81  ? 803  PHE A CD1   1 
ATOM   7039 C  CD2   . PHE C 3 803 ? 57.264  -71.684 16.643  1.00 54.97  ? 803  PHE A CD2   1 
ATOM   7040 C  CE1   . PHE C 3 803 ? 59.232  -72.755 18.279  1.00 51.77  ? 803  PHE A CE1   1 
ATOM   7041 C  CE2   . PHE C 3 803 ? 58.190  -72.585 16.113  1.00 54.49  ? 803  PHE A CE2   1 
ATOM   7042 C  CZ    . PHE C 3 803 ? 59.178  -73.121 16.932  1.00 54.46  ? 803  PHE A CZ    1 
ATOM   7043 N  N     . HIS C 3 804 ? 56.026  -70.624 21.523  1.00 55.31  ? 804  HIS A N     1 
ATOM   7044 C  CA    . HIS C 3 804 ? 56.462  -71.153 22.809  1.00 55.31  ? 804  HIS A CA    1 
ATOM   7045 C  C     . HIS C 3 804 ? 55.346  -71.859 23.564  1.00 54.52  ? 804  HIS A C     1 
ATOM   7046 O  O     . HIS C 3 804 ? 55.615  -72.741 24.371  1.00 56.62  ? 804  HIS A O     1 
ATOM   7047 C  CB    . HIS C 3 804 ? 57.080  -70.059 23.688  1.00 55.85  ? 804  HIS A CB    1 
ATOM   7048 C  CG    . HIS C 3 804 ? 56.181  -68.893 23.926  1.00 55.18  ? 804  HIS A CG    1 
ATOM   7049 N  ND1   . HIS C 3 804 ? 55.960  -67.921 22.972  1.00 57.82  ? 804  HIS A ND1   1 
ATOM   7050 C  CD2   . HIS C 3 804 ? 55.402  -68.570 24.985  1.00 52.12  ? 804  HIS A CD2   1 
ATOM   7051 C  CE1   . HIS C 3 804 ? 55.078  -67.051 23.433  1.00 56.41  ? 804  HIS A CE1   1 
ATOM   7052 N  NE2   . HIS C 3 804 ? 54.724  -67.421 24.651  1.00 57.28  ? 804  HIS A NE2   1 
ATOM   7053 N  N     . ILE C 3 805 ? 54.097  -71.484 23.317  1.00 54.56  ? 805  ILE A N     1 
ATOM   7054 C  CA    . ILE C 3 805 ? 52.987  -72.157 23.990  1.00 57.94  ? 805  ILE A CA    1 
ATOM   7055 C  C     . ILE C 3 805 ? 52.764  -73.530 23.334  1.00 58.70  ? 805  ILE A C     1 
ATOM   7056 O  O     . ILE C 3 805 ? 52.315  -74.483 23.977  1.00 57.56  ? 805  ILE A O     1 
ATOM   7057 C  CB    . ILE C 3 805 ? 51.681  -71.317 23.907  1.00 58.67  ? 805  ILE A CB    1 
ATOM   7058 C  CG1   . ILE C 3 805 ? 51.860  -70.024 24.697  1.00 55.41  ? 805  ILE A CG1   1 
ATOM   7059 C  CG2   . ILE C 3 805 ? 50.486  -72.104 24.476  1.00 60.30  ? 805  ILE A CG2   1 
ATOM   7060 C  CD1   . ILE C 3 805 ? 52.196  -70.255 26.156  1.00 47.28  ? 805  ILE A CD1   1 
ATOM   7061 N  N     . ARG C 3 806 ? 53.093  -73.618 22.048  1.00 58.22  ? 806  ARG A N     1 
ATOM   7062 C  CA    . ARG C 3 806 ? 52.946  -74.851 21.291  1.00 58.74  ? 806  ARG A CA    1 
ATOM   7063 C  C     . ARG C 3 806 ? 53.900  -75.850 21.932  1.00 62.62  ? 806  ARG A C     1 
ATOM   7064 O  O     . ARG C 3 806 ? 53.539  -77.000 22.196  1.00 62.84  ? 806  ARG A O     1 
ATOM   7065 C  CB    . ARG C 3 806 ? 53.336  -74.610 19.831  1.00 59.66  ? 806  ARG A CB    1 
ATOM   7066 C  CG    . ARG C 3 806 ? 52.665  -75.533 18.835  1.00 63.12  ? 806  ARG A CG    1 
ATOM   7067 C  CD    . ARG C 3 806 ? 53.016  -75.122 17.410  1.00 63.16  ? 806  ARG A CD    1 
ATOM   7068 N  NE    . ARG C 3 806 ? 52.018  -75.590 16.454  1.00 66.78  ? 806  ARG A NE    1 
ATOM   7069 C  CZ    . ARG C 3 806 ? 50.794  -75.082 16.337  1.00 68.73  ? 806  ARG A CZ    1 
ATOM   7070 N  NH1   . ARG C 3 806 ? 50.404  -74.076 17.112  1.00 73.04  ? 806  ARG A NH1   1 
ATOM   7071 N  NH2   . ARG C 3 806 ? 49.954  -75.584 15.444  1.00 72.01  ? 806  ARG A NH2   1 
ATOM   7072 N  N     . GLY C 3 807 ? 55.118  -75.390 22.197  1.00 60.13  ? 807  GLY A N     1 
ATOM   7073 C  CA    . GLY C 3 807 ? 56.094  -76.257 22.816  1.00 59.72  ? 807  GLY A CA    1 
ATOM   7074 C  C     . GLY C 3 807 ? 55.692  -76.642 24.226  1.00 60.58  ? 807  GLY A C     1 
ATOM   7075 O  O     . GLY C 3 807 ? 55.791  -77.806 24.625  1.00 58.05  ? 807  GLY A O     1 
ATOM   7076 N  N     . ILE C 3 808 ? 55.224  -75.657 24.984  1.00 59.19  ? 808  ILE A N     1 
ATOM   7077 C  CA    . ILE C 3 808 ? 54.829  -75.883 26.362  1.00 57.00  ? 808  ILE A CA    1 
ATOM   7078 C  C     . ILE C 3 808 ? 53.674  -76.857 26.458  1.00 57.12  ? 808  ILE A C     1 
ATOM   7079 O  O     . ILE C 3 808 ? 53.380  -77.384 27.531  1.00 58.72  ? 808  ILE A O     1 
ATOM   7080 C  CB    . ILE C 3 808 ? 54.505  -74.537 27.057  1.00 55.89  ? 808  ILE A CB    1 
ATOM   7081 C  CG1   . ILE C 3 808 ? 55.817  -73.779 27.258  1.00 53.96  ? 808  ILE A CG1   1 
ATOM   7082 C  CG2   . ILE C 3 808 ? 53.778  -74.753 28.380  1.00 50.01  ? 808  ILE A CG2   1 
ATOM   7083 C  CD1   . ILE C 3 808 ? 55.733  -72.647 28.231  1.00 63.88  ? 808  ILE A CD1   1 
ATOM   7084 N  N     . LEU C 3 809 ? 53.028  -77.116 25.328  1.00 54.49  ? 809  LEU A N     1 
ATOM   7085 C  CA    . LEU C 3 809 ? 51.923  -78.062 25.299  1.00 53.35  ? 809  LEU A CA    1 
ATOM   7086 C  C     . LEU C 3 809 ? 52.462  -79.404 24.827  1.00 53.72  ? 809  LEU A C     1 
ATOM   7087 O  O     . LEU C 3 809 ? 52.058  -80.453 25.330  1.00 52.64  ? 809  LEU A O     1 
ATOM   7088 C  CB    . LEU C 3 809 ? 50.823  -77.572 24.358  1.00 55.32  ? 809  LEU A CB    1 
ATOM   7089 C  CG    . LEU C 3 809 ? 50.005  -76.382 24.869  1.00 57.92  ? 809  LEU A CG    1 
ATOM   7090 C  CD1   . LEU C 3 809 ? 49.108  -75.847 23.764  1.00 61.12  ? 809  LEU A CD1   1 
ATOM   7091 C  CD2   . LEU C 3 809 ? 49.175  -76.814 26.059  1.00 49.94  ? 809  LEU A CD2   1 
ATOM   7092 N  N     . THR C 3 810 ? 53.375  -79.350 23.856  1.00 51.17  ? 810  THR A N     1 
ATOM   7093 C  CA    . THR C 3 810 ? 54.011  -80.542 23.307  1.00 49.42  ? 810  THR A CA    1 
ATOM   7094 C  C     . THR C 3 810 ? 54.760  -81.243 24.436  1.00 49.07  ? 810  THR A C     1 
ATOM   7095 O  O     . THR C 3 810 ? 54.732  -82.464 24.552  1.00 53.05  ? 810  THR A O     1 
ATOM   7096 C  CB    . THR C 3 810 ? 55.025  -80.183 22.200  1.00 51.51  ? 810  THR A CB    1 
ATOM   7097 O  OG1   . THR C 3 810 ? 54.369  -79.467 21.148  1.00 54.18  ? 810  THR A OG1   1 
ATOM   7098 C  CG2   . THR C 3 810 ? 55.636  -81.434 21.626  1.00 52.31  ? 810  THR A CG2   1 
ATOM   7099 N  N     . TYR C 3 811 ? 55.443  -80.450 25.254  1.00 53.61  ? 811  TYR A N     1 
ATOM   7100 C  CA    . TYR C 3 811 ? 56.194  -80.947 26.409  1.00 54.46  ? 811  TYR A CA    1 
ATOM   7101 C  C     . TYR C 3 811 ? 55.175  -81.563 27.359  1.00 55.15  ? 811  TYR A C     1 
ATOM   7102 O  O     . TYR C 3 811 ? 55.323  -82.688 27.834  1.00 53.54  ? 811  TYR A O     1 
ATOM   7103 C  CB    . TYR C 3 811 ? 56.885  -79.773 27.118  1.00 54.65  ? 811  TYR A CB    1 
ATOM   7104 C  CG    . TYR C 3 811 ? 57.579  -80.151 28.417  1.00 59.18  ? 811  TYR A CG    1 
ATOM   7105 C  CD1   . TYR C 3 811 ? 58.900  -80.613 28.425  1.00 58.23  ? 811  TYR A CD1   1 
ATOM   7106 C  CD2   . TYR C 3 811 ? 56.903  -80.075 29.640  1.00 54.42  ? 811  TYR A CD2   1 
ATOM   7107 C  CE1   . TYR C 3 811 ? 59.531  -80.988 29.619  1.00 54.76  ? 811  TYR A CE1   1 
ATOM   7108 C  CE2   . TYR C 3 811 ? 57.525  -80.450 30.836  1.00 54.53  ? 811  TYR A CE2   1 
ATOM   7109 C  CZ    . TYR C 3 811 ? 58.840  -80.904 30.817  1.00 54.00  ? 811  TYR A CZ    1 
ATOM   7110 O  OH    . TYR C 3 811 ? 59.459  -81.251 31.999  1.00 47.44  ? 811  TYR A OH    1 
ATOM   7111 N  N     . ASN C 3 812 ? 54.147  -80.769 27.623  1.00 59.06  ? 812  ASN A N     1 
ATOM   7112 C  CA    . ASN C 3 812 ? 53.046  -81.117 28.489  1.00 60.20  ? 812  ASN A CA    1 
ATOM   7113 C  C     . ASN C 3 812 ? 52.430  -82.468 28.142  1.00 57.04  ? 812  ASN A C     1 
ATOM   7114 O  O     . ASN C 3 812 ? 51.905  -83.149 29.011  1.00 59.89  ? 812  ASN A O     1 
ATOM   7115 C  CB    . ASN C 3 812 ? 51.985  -80.022 28.390  1.00 69.92  ? 812  ASN A CB    1 
ATOM   7116 C  CG    . ASN C 3 812 ? 51.643  -79.426 29.731  1.00 76.21  ? 812  ASN A CG    1 
ATOM   7117 O  OD1   . ASN C 3 812 ? 51.330  -80.146 30.673  1.00 87.65  ? 812  ASN A OD1   1 
ATOM   7118 N  ND2   . ASN C 3 812 ? 51.699  -78.103 29.827  1.00 75.41  ? 812  ASN A ND2   1 
ATOM   7119 N  N     . ARG C 3 813 ? 52.494  -82.851 26.873  1.00 55.76  ? 813  ARG A N     1 
ATOM   7120 C  CA    . ARG C 3 813 ? 51.926  -84.119 26.415  1.00 52.01  ? 813  ARG A CA    1 
ATOM   7121 C  C     . ARG C 3 813 ? 52.824  -85.341 26.621  1.00 56.06  ? 813  ARG A C     1 
ATOM   7122 O  O     . ARG C 3 813 ? 52.334  -86.464 26.764  1.00 60.45  ? 813  ARG A O     1 
ATOM   7123 C  CB    . ARG C 3 813 ? 51.567  -84.033 24.924  1.00 50.02  ? 813  ARG A CB    1 
ATOM   7124 C  CG    . ARG C 3 813 ? 50.302  -83.247 24.601  1.00 58.86  ? 813  ARG A CG    1 
ATOM   7125 C  CD    . ARG C 3 813 ? 49.959  -83.338 23.117  1.00 60.86  ? 813  ARG A CD    1 
ATOM   7126 N  NE    . ARG C 3 813 ? 50.151  -82.062 22.437  1.00 66.39  ? 813  ARG A NE    1 
ATOM   7127 C  CZ    . ARG C 3 813 ? 50.922  -81.894 21.369  1.00 69.26  ? 813  ARG A CZ    1 
ATOM   7128 N  NH1   . ARG C 3 813 ? 51.579  -82.927 20.851  1.00 68.53  ? 813  ARG A NH1   1 
ATOM   7129 N  NH2   . ARG C 3 813 ? 51.041  -80.689 20.826  1.00 74.23  ? 813  ARG A NH2   1 
ATOM   7130 N  N     . ALA C 3 814 ? 54.135  -85.133 26.624  1.00 53.50  ? 814  ALA A N     1 
ATOM   7131 C  CA    . ALA C 3 814 ? 55.068  -86.232 26.780  1.00 52.82  ? 814  ALA A CA    1 
ATOM   7132 C  C     . ALA C 3 814 ? 55.396  -86.554 28.246  1.00 56.62  ? 814  ALA A C     1 
ATOM   7133 O  O     . ALA C 3 814 ? 56.069  -87.542 28.541  1.00 57.78  ? 814  ALA A O     1 
ATOM   7134 C  CB    . ALA C 3 814 ? 56.344  -85.920 26.000  1.00 49.55  ? 814  ALA A CB    1 
ATOM   7135 N  N     . ILE C 3 815 ? 54.885  -85.737 29.160  1.00 60.23  ? 815  ILE A N     1 
ATOM   7136 C  CA    . ILE C 3 815 ? 55.133  -85.904 30.590  1.00 60.55  ? 815  ILE A CA    1 
ATOM   7137 C  C     . ILE C 3 815 ? 53.915  -86.365 31.403  1.00 64.09  ? 815  ILE A C     1 
ATOM   7138 O  O     . ILE C 3 815 ? 54.016  -86.581 32.610  1.00 63.50  ? 815  ILE A O     1 
ATOM   7139 C  CB    . ILE C 3 815 ? 55.720  -84.571 31.170  1.00 59.57  ? 815  ILE A CB    1 
ATOM   7140 C  CG1   . ILE C 3 815 ? 57.232  -84.693 31.249  1.00 60.29  ? 815  ILE A CG1   1 
ATOM   7141 C  CG2   . ILE C 3 815 ? 55.138  -84.226 32.536  1.00 52.48  ? 815  ILE A CG2   1 
ATOM   7142 C  CD1   . ILE C 3 815 ? 57.864  -85.031 29.939  1.00 64.12  ? 815  ILE A CD1   1 
ATOM   7143 N  N     . LYS C 3 816 ? 52.771  -86.535 30.749  1.00 64.89  ? 816  LYS A N     1 
ATOM   7144 C  CA    . LYS C 3 816 ? 51.577  -86.976 31.460  1.00 71.55  ? 816  LYS A CA    1 
ATOM   7145 C  C     . LYS C 3 816 ? 51.856  -88.250 32.246  1.00 76.73  ? 816  LYS A C     1 
ATOM   7146 O  O     . LYS C 3 816 ? 52.363  -89.225 31.690  1.00 78.57  ? 816  LYS A O     1 
ATOM   7147 C  CB    . LYS C 3 816 ? 50.439  -87.247 30.483  1.00 73.85  ? 816  LYS A CB    1 
ATOM   7148 C  CG    . LYS C 3 816 ? 50.089  -86.080 29.588  1.00 77.79  ? 816  LYS A CG    1 
ATOM   7149 C  CD    . LYS C 3 816 ? 48.741  -86.297 28.940  1.00 79.28  ? 816  LYS A CD    1 
ATOM   7150 C  CE    . LYS C 3 816 ? 47.636  -86.291 29.989  1.00 84.11  ? 816  LYS A CE    1 
ATOM   7151 N  NZ    . LYS C 3 816 ? 46.282  -86.515 29.389  1.00 89.26  ? 816  LYS A NZ    1 
ATOM   7152 N  N     . GLY C 3 817 ? 51.523  -88.237 33.536  1.00 80.79  ? 817  GLY A N     1 
ATOM   7153 C  CA    . GLY C 3 817 ? 51.736  -89.405 34.377  1.00 83.84  ? 817  GLY A CA    1 
ATOM   7154 C  C     . GLY C 3 817 ? 53.164  -89.609 34.863  1.00 87.25  ? 817  GLY A C     1 
ATOM   7155 O  O     . GLY C 3 817 ? 53.721  -90.702 34.731  1.00 88.78  ? 817  GLY A O     1 
ATOM   7156 N  N     . ASN C 3 818 ? 53.754  -88.555 35.420  1.00 88.68  ? 818  ASN A N     1 
ATOM   7157 C  CA    . ASN C 3 818 ? 55.116  -88.584 35.953  1.00 90.61  ? 818  ASN A CA    1 
ATOM   7158 C  C     . ASN C 3 818 ? 55.164  -87.507 37.014  1.00 92.35  ? 818  ASN A C     1 
ATOM   7159 O  O     . ASN C 3 818 ? 54.517  -86.469 36.878  1.00 94.43  ? 818  ASN A O     1 
ATOM   7160 C  CB    . ASN C 3 818 ? 56.139  -88.269 34.863  1.00 90.68  ? 818  ASN A CB    1 
ATOM   7161 C  CG    . ASN C 3 818 ? 56.209  -89.349 33.804  1.00 96.27  ? 818  ASN A CG    1 
ATOM   7162 O  OD1   . ASN C 3 818 ? 56.996  -90.298 33.912  1.00 92.63  ? 818  ASN A OD1   1 
ATOM   7163 N  ND2   . ASN C 3 818 ? 55.371  -89.222 32.775  1.00 101.35 ? 818  ASN A ND2   1 
ATOM   7164 N  N     . ILE C 3 819 ? 55.927  -87.742 38.070  1.00 94.49  ? 819  ILE A N     1 
ATOM   7165 C  CA    . ILE C 3 819 ? 56.001  -86.763 39.141  1.00 95.12  ? 819  ILE A CA    1 
ATOM   7166 C  C     . ILE C 3 819 ? 57.392  -86.165 39.311  1.00 97.51  ? 819  ILE A C     1 
ATOM   7167 O  O     . ILE C 3 819 ? 57.538  -85.091 39.896  1.00 101.25 ? 819  ILE A O     1 
ATOM   7168 C  CB    . ILE C 3 819 ? 55.515  -87.379 40.478  1.00 94.06  ? 819  ILE A CB    1 
ATOM   7169 C  CG1   . ILE C 3 819 ? 54.022  -87.719 40.371  1.00 91.63  ? 819  ILE A CG1   1 
ATOM   7170 C  CG2   . ILE C 3 819 ? 55.752  -86.403 41.632  1.00 93.93  ? 819  ILE A CG2   1 
ATOM   7171 C  CD1   . ILE C 3 819 ? 53.399  -88.249 41.654  1.00 92.19  ? 819  ILE A CD1   1 
ATOM   7172 N  N     . ASP C 3 820 ? 58.408  -86.847 38.790  1.00 96.87  ? 820  ASP A N     1 
ATOM   7173 C  CA    . ASP C 3 820 ? 59.771  -86.344 38.895  1.00 95.51  ? 820  ASP A CA    1 
ATOM   7174 C  C     . ASP C 3 820 ? 60.035  -85.217 37.911  1.00 91.96  ? 820  ASP A C     1 
ATOM   7175 O  O     . ASP C 3 820 ? 60.884  -84.358 38.156  1.00 92.20  ? 820  ASP A O     1 
ATOM   7176 C  CB    . ASP C 3 820 ? 60.785  -87.460 38.636  1.00 100.44 ? 820  ASP A CB    1 
ATOM   7177 C  CG    . ASP C 3 820 ? 61.144  -88.233 39.896  1.00 106.83 ? 820  ASP A CG    1 
ATOM   7178 O  OD1   . ASP C 3 820 ? 61.804  -87.648 40.786  1.00 110.33 ? 820  ASP A OD1   1 
ATOM   7179 O  OD2   . ASP C 3 820 ? 60.760  -89.420 39.991  1.00 106.44 ? 820  ASP A OD2   1 
ATOM   7180 N  N     . ALA C 3 821 ? 59.300  -85.230 36.800  1.00 87.90  ? 821  ALA A N     1 
ATOM   7181 C  CA    . ALA C 3 821 ? 59.457  -84.235 35.734  1.00 81.99  ? 821  ALA A CA    1 
ATOM   7182 C  C     . ALA C 3 821 ? 59.137  -82.793 36.123  1.00 76.77  ? 821  ALA A C     1 
ATOM   7183 O  O     . ALA C 3 821 ? 58.100  -82.517 36.724  1.00 78.05  ? 821  ALA A O     1 
ATOM   7184 C  CB    . ALA C 3 821 ? 58.616  -84.640 34.528  1.00 79.78  ? 821  ALA A CB    1 
ATOM   7185 N  N     . PRO C 3 822 ? 60.035  -81.854 35.783  1.00 72.97  ? 822  PRO A N     1 
ATOM   7186 C  CA    . PRO C 3 822 ? 59.854  -80.430 36.089  1.00 74.27  ? 822  PRO A CA    1 
ATOM   7187 C  C     . PRO C 3 822 ? 58.654  -79.901 35.308  1.00 74.61  ? 822  PRO A C     1 
ATOM   7188 O  O     . PRO C 3 822 ? 58.686  -79.846 34.083  1.00 76.79  ? 822  PRO A O     1 
ATOM   7189 C  CB    . PRO C 3 822 ? 61.163  -79.804 35.614  1.00 73.55  ? 822  PRO A CB    1 
ATOM   7190 C  CG    . PRO C 3 822 ? 62.155  -80.925 35.764  1.00 74.33  ? 822  PRO A CG    1 
ATOM   7191 C  CD    . PRO C 3 822 ? 61.375  -82.101 35.228  1.00 70.54  ? 822  PRO A CD    1 
ATOM   7192 N  N     . GLN C 3 823 ? 57.597  -79.513 36.010  1.00 73.36  ? 823  GLN A N     1 
ATOM   7193 C  CA    . GLN C 3 823 ? 56.406  -79.019 35.339  1.00 71.84  ? 823  GLN A CA    1 
ATOM   7194 C  C     . GLN C 3 823 ? 56.496  -77.540 34.978  1.00 70.65  ? 823  GLN A C     1 
ATOM   7195 O  O     . GLN C 3 823 ? 57.159  -76.767 35.669  1.00 65.94  ? 823  GLN A O     1 
ATOM   7196 C  CB    . GLN C 3 823 ? 55.177  -79.280 36.215  1.00 70.48  ? 823  GLN A CB    1 
ATOM   7197 C  CG    . GLN C 3 823 ? 54.979  -80.750 36.521  1.00 71.04  ? 823  GLN A CG    1 
ATOM   7198 C  CD    . GLN C 3 823 ? 53.540  -81.190 36.375  1.00 75.85  ? 823  GLN A CD    1 
ATOM   7199 O  OE1   . GLN C 3 823 ? 52.663  -80.754 37.130  1.00 81.16  ? 823  GLN A OE1   1 
ATOM   7200 N  NE2   . GLN C 3 823 ? 53.283  -82.058 35.396  1.00 71.59  ? 823  GLN A NE2   1 
ATOM   7201 N  N     . VAL C 3 824 ? 55.852  -77.158 33.874  1.00 70.49  ? 824  VAL A N     1 
ATOM   7202 C  CA    . VAL C 3 824 ? 55.846  -75.762 33.447  1.00 70.65  ? 824  VAL A CA    1 
ATOM   7203 C  C     . VAL C 3 824 ? 54.645  -75.111 34.117  1.00 70.92  ? 824  VAL A C     1 
ATOM   7204 O  O     . VAL C 3 824 ? 53.535  -75.640 34.068  1.00 68.14  ? 824  VAL A O     1 
ATOM   7205 C  CB    . VAL C 3 824 ? 55.708  -75.614 31.915  1.00 68.09  ? 824  VAL A CB    1 
ATOM   7206 C  CG1   . VAL C 3 824 ? 54.297  -75.964 31.474  1.00 74.26  ? 824  VAL A CG1   1 
ATOM   7207 C  CG2   . VAL C 3 824 ? 56.044  -74.192 31.508  1.00 64.40  ? 824  VAL A CG2   1 
ATOM   7208 N  N     . VAL C 3 825 ? 54.873  -73.971 34.755  1.00 72.79  ? 825  VAL A N     1 
ATOM   7209 C  CA    . VAL C 3 825 ? 53.802  -73.277 35.446  1.00 74.26  ? 825  VAL A CA    1 
ATOM   7210 C  C     . VAL C 3 825 ? 53.497  -71.913 34.836  1.00 77.75  ? 825  VAL A C     1 
ATOM   7211 O  O     . VAL C 3 825 ? 54.380  -71.247 34.291  1.00 79.94  ? 825  VAL A O     1 
ATOM   7212 C  CB    . VAL C 3 825 ? 54.145  -73.112 36.940  1.00 72.15  ? 825  VAL A CB    1 
ATOM   7213 C  CG1   . VAL C 3 825 ? 53.093  -72.255 37.633  1.00 73.67  ? 825  VAL A CG1   1 
ATOM   7214 C  CG2   . VAL C 3 825 ? 54.230  -74.491 37.599  1.00 68.57  ? 825  VAL A CG2   1 
ATOM   7215 N  N     . GLU C 3 826 ? 52.228  -71.521 34.922  1.00 79.72  ? 826  GLU A N     1 
ATOM   7216 C  CA    . GLU C 3 826 ? 51.755  -70.240 34.406  1.00 80.82  ? 826  GLU A CA    1 
ATOM   7217 C  C     . GLU C 3 826 ? 52.648  -69.101 34.904  1.00 80.34  ? 826  GLU A C     1 
ATOM   7218 O  O     . GLU C 3 826 ? 52.806  -68.915 36.113  1.00 80.08  ? 826  GLU A O     1 
ATOM   7219 C  CB    . GLU C 3 826 ? 50.313  -70.018 34.872  1.00 81.01  ? 826  GLU A CB    1 
ATOM   7220 C  CG    . GLU C 3 826 ? 49.689  -68.682 34.507  1.00 84.79  ? 826  GLU A CG    1 
ATOM   7221 C  CD    . GLU C 3 826 ? 49.593  -68.461 33.008  1.00 89.50  ? 826  GLU A CD    1 
ATOM   7222 O  OE1   . GLU C 3 826 ? 49.265  -69.428 32.281  1.00 88.48  ? 826  GLU A OE1   1 
ATOM   7223 O  OE2   . GLU C 3 826 ? 49.829  -67.313 32.567  1.00 92.37  ? 826  GLU A OE2   1 
ATOM   7224 N  N     . GLY C 3 827 ? 53.245  -68.357 33.976  1.00 78.97  ? 827  GLY A N     1 
ATOM   7225 C  CA    . GLY C 3 827 ? 54.102  -67.247 34.364  1.00 82.05  ? 827  GLY A CA    1 
ATOM   7226 C  C     . GLY C 3 827 ? 55.587  -67.554 34.476  1.00 84.28  ? 827  GLY A C     1 
ATOM   7227 O  O     . GLY C 3 827 ? 56.403  -66.631 34.568  1.00 84.73  ? 827  GLY A O     1 
ATOM   7228 N  N     . GLU C 3 828 ? 55.947  -68.835 34.460  1.00 83.39  ? 828  GLU A N     1 
ATOM   7229 C  CA    . GLU C 3 828 ? 57.346  -69.219 34.569  1.00 83.45  ? 828  GLU A CA    1 
ATOM   7230 C  C     . GLU C 3 828 ? 58.116  -68.797 33.331  1.00 83.22  ? 828  GLU A C     1 
ATOM   7231 O  O     . GLU C 3 828 ? 57.641  -67.992 32.536  1.00 83.80  ? 828  GLU A O     1 
ATOM   7232 C  CB    . GLU C 3 828 ? 57.482  -70.733 34.732  1.00 88.79  ? 828  GLU A CB    1 
ATOM   7233 C  CG    . GLU C 3 828 ? 56.628  -71.361 35.821  1.00 97.70  ? 828  GLU A CG    1 
ATOM   7234 C  CD    . GLU C 3 828 ? 56.603  -70.544 37.098  1.00 104.80 ? 828  GLU A CD    1 
ATOM   7235 O  OE1   . GLU C 3 828 ? 57.609  -69.857 37.384  1.00 106.50 ? 828  GLU A OE1   1 
ATOM   7236 O  OE2   . GLU C 3 828 ? 55.580  -70.600 37.818  1.00 108.73 ? 828  GLU A OE2   1 
ATOM   7237 N  N     . LYS C 3 829 ? 59.314  -69.355 33.183  1.00 86.08  ? 829  LYS A N     1 
ATOM   7238 C  CA    . LYS C 3 829 ? 60.189  -69.076 32.044  1.00 85.83  ? 829  LYS A CA    1 
ATOM   7239 C  C     . LYS C 3 829 ? 60.580  -70.411 31.386  1.00 82.98  ? 829  LYS A C     1 
ATOM   7240 O  O     . LYS C 3 829 ? 60.772  -71.420 32.075  1.00 80.50  ? 829  LYS A O     1 
ATOM   7241 C  CB    . LYS C 3 829 ? 61.434  -68.321 32.517  1.00 91.20  ? 829  LYS A CB    1 
ATOM   7242 C  CG    . LYS C 3 829 ? 62.116  -68.942 33.734  1.00 99.07  ? 829  LYS A CG    1 
ATOM   7243 C  CD    . LYS C 3 829 ? 63.407  -68.201 34.062  1.00 104.97 ? 829  LYS A CD    1 
ATOM   7244 C  CE    . LYS C 3 829 ? 64.192  -68.885 35.176  1.00 107.30 ? 829  LYS A CE    1 
ATOM   7245 N  NZ    . LYS C 3 829 ? 65.586  -68.351 35.252  1.00 107.69 ? 829  LYS A NZ    1 
ATOM   7246 N  N     . VAL C 3 830 ? 60.712  -70.413 30.060  1.00 77.45  ? 830  VAL A N     1 
ATOM   7247 C  CA    . VAL C 3 830 ? 61.019  -71.644 29.335  1.00 71.90  ? 830  VAL A CA    1 
ATOM   7248 C  C     . VAL C 3 830 ? 62.017  -71.540 28.173  1.00 68.93  ? 830  VAL A C     1 
ATOM   7249 O  O     . VAL C 3 830 ? 62.366  -70.450 27.718  1.00 68.27  ? 830  VAL A O     1 
ATOM   7250 C  CB    . VAL C 3 830 ? 59.684  -72.254 28.806  1.00 70.53  ? 830  VAL A CB    1 
ATOM   7251 C  CG1   . VAL C 3 830 ? 59.932  -73.399 27.870  1.00 76.37  ? 830  VAL A CG1   1 
ATOM   7252 C  CG2   . VAL C 3 830 ? 58.853  -72.741 29.968  1.00 72.36  ? 830  VAL A CG2   1 
ATOM   7253 N  N     . TYR C 3 831 ? 62.484  -72.706 27.727  1.00 68.16  ? 831  TYR A N     1 
ATOM   7254 C  CA    . TYR C 3 831 ? 63.388  -72.846 26.586  1.00 66.41  ? 831  TYR A CA    1 
ATOM   7255 C  C     . TYR C 3 831 ? 62.596  -73.432 25.407  1.00 61.89  ? 831  TYR A C     1 
ATOM   7256 O  O     . TYR C 3 831 ? 61.684  -74.238 25.595  1.00 60.32  ? 831  TYR A O     1 
ATOM   7257 C  CB    . TYR C 3 831 ? 64.550  -73.781 26.913  1.00 69.51  ? 831  TYR A CB    1 
ATOM   7258 C  CG    . TYR C 3 831 ? 65.720  -73.099 27.573  1.00 73.01  ? 831  TYR A CG    1 
ATOM   7259 C  CD1   . TYR C 3 831 ? 66.710  -72.488 26.804  1.00 75.41  ? 831  TYR A CD1   1 
ATOM   7260 C  CD2   . TYR C 3 831 ? 65.861  -73.090 28.960  1.00 72.77  ? 831  TYR A CD2   1 
ATOM   7261 C  CE1   . TYR C 3 831 ? 67.805  -71.894 27.394  1.00 74.76  ? 831  TYR A CE1   1 
ATOM   7262 C  CE2   . TYR C 3 831 ? 66.962  -72.499 29.561  1.00 73.19  ? 831  TYR A CE2   1 
ATOM   7263 C  CZ    . TYR C 3 831 ? 67.931  -71.904 28.771  1.00 75.49  ? 831  TYR A CZ    1 
ATOM   7264 O  OH    . TYR C 3 831 ? 69.033  -71.326 29.347  1.00 81.62  ? 831  TYR A OH    1 
ATOM   7265 N  N     . VAL C 3 832 ? 62.949  -73.035 24.191  1.00 56.80  ? 832  VAL A N     1 
ATOM   7266 C  CA    . VAL C 3 832 ? 62.238  -73.522 23.021  1.00 55.62  ? 832  VAL A CA    1 
ATOM   7267 C  C     . VAL C 3 832 ? 63.186  -73.929 21.885  1.00 54.76  ? 832  VAL A C     1 
ATOM   7268 O  O     . VAL C 3 832 ? 64.153  -73.227 21.566  1.00 48.04  ? 832  VAL A O     1 
ATOM   7269 C  CB    . VAL C 3 832 ? 61.218  -72.443 22.516  1.00 57.42  ? 832  VAL A CB    1 
ATOM   7270 C  CG1   . VAL C 3 832 ? 61.600  -71.961 21.119  1.00 61.20  ? 832  VAL A CG1   1 
ATOM   7271 C  CG2   . VAL C 3 832 ? 59.798  -73.008 22.524  1.00 55.35  ? 832  VAL A CG2   1 
ATOM   7272 N  N     . LEU C 3 833 ? 62.902  -75.084 21.290  1.00 50.61  ? 833  LEU A N     1 
ATOM   7273 C  CA    . LEU C 3 833 ? 63.699  -75.591 20.177  1.00 48.96  ? 833  LEU A CA    1 
ATOM   7274 C  C     . LEU C 3 833 ? 62.792  -76.108 19.090  1.00 49.46  ? 833  LEU A C     1 
ATOM   7275 O  O     . LEU C 3 833 ? 61.793  -76.779 19.377  1.00 47.92  ? 833  LEU A O     1 
ATOM   7276 C  CB    . LEU C 3 833 ? 64.598  -76.742 20.610  1.00 47.72  ? 833  LEU A CB    1 
ATOM   7277 C  CG    . LEU C 3 833 ? 65.991  -76.415 21.116  1.00 52.44  ? 833  LEU A CG    1 
ATOM   7278 C  CD1   . LEU C 3 833 ? 66.653  -77.663 21.681  1.00 59.07  ? 833  LEU A CD1   1 
ATOM   7279 C  CD2   . LEU C 3 833 ? 66.800  -75.864 19.966  1.00 53.56  ? 833  LEU A CD2   1 
ATOM   7280 N  N     . PRO C 3 834 ? 63.127  -75.810 17.821  1.00 48.35  ? 834  PRO A N     1 
ATOM   7281 C  CA    . PRO C 3 834 ? 62.338  -76.257 16.667  1.00 45.53  ? 834  PRO A CA    1 
ATOM   7282 C  C     . PRO C 3 834 ? 62.593  -77.753 16.425  1.00 43.89  ? 834  PRO A C     1 
ATOM   7283 O  O     . PRO C 3 834 ? 63.739  -78.197 16.378  1.00 46.75  ? 834  PRO A O     1 
ATOM   7284 C  CB    . PRO C 3 834 ? 62.872  -75.379 15.541  1.00 40.87  ? 834  PRO A CB    1 
ATOM   7285 C  CG    . PRO C 3 834 ? 64.326  -75.271 15.892  1.00 38.66  ? 834  PRO A CG    1 
ATOM   7286 C  CD    . PRO C 3 834 ? 64.291  -75.016 17.384  1.00 42.61  ? 834  PRO A CD    1 
ATOM   7287 N  N     . LEU C 3 835 ? 61.530  -78.534 16.289  1.00 42.63  ? 835  LEU A N     1 
ATOM   7288 C  CA    . LEU C 3 835 ? 61.698  -79.970 16.063  1.00 41.90  ? 835  LEU A CA    1 
ATOM   7289 C  C     . LEU C 3 835 ? 61.594  -80.341 14.600  1.00 40.03  ? 835  LEU A C     1 
ATOM   7290 O  O     . LEU C 3 835 ? 60.836  -79.756 13.827  1.00 44.75  ? 835  LEU A O     1 
ATOM   7291 C  CB    . LEU C 3 835 ? 60.671  -80.779 16.873  1.00 42.01  ? 835  LEU A CB    1 
ATOM   7292 C  CG    . LEU C 3 835 ? 61.099  -81.588 18.115  1.00 40.57  ? 835  LEU A CG    1 
ATOM   7293 C  CD1   . LEU C 3 835 ? 62.552  -81.393 18.449  1.00 36.70  ? 835  LEU A CD1   1 
ATOM   7294 C  CD2   . LEU C 3 835 ? 60.247  -81.170 19.283  1.00 40.00  ? 835  LEU A CD2   1 
ATOM   7295 N  N     . ARG C 3 836 ? 62.387  -81.321 14.220  1.00 40.37  ? 836  ARG A N     1 
ATOM   7296 C  CA    . ARG C 3 836 ? 62.412  -81.799 12.847  1.00 42.47  ? 836  ARG A CA    1 
ATOM   7297 C  C     . ARG C 3 836 ? 61.103  -82.560 12.531  1.00 42.90  ? 836  ARG A C     1 
ATOM   7298 O  O     . ARG C 3 836 ? 60.554  -83.267 13.379  1.00 36.07  ? 836  ARG A O     1 
ATOM   7299 C  CB    . ARG C 3 836 ? 63.644  -82.698 12.696  1.00 38.67  ? 836  ARG A CB    1 
ATOM   7300 C  CG    . ARG C 3 836 ? 64.252  -82.791 11.328  1.00 34.99  ? 836  ARG A CG    1 
ATOM   7301 C  CD    . ARG C 3 836 ? 65.741  -83.107 11.456  1.00 31.72  ? 836  ARG A CD    1 
ATOM   7302 N  NE    . ARG C 3 836 ? 66.056  -84.214 12.365  1.00 36.77  ? 836  ARG A NE    1 
ATOM   7303 C  CZ    . ARG C 3 836 ? 65.866  -85.505 12.091  1.00 39.27  ? 836  ARG A CZ    1 
ATOM   7304 N  NH1   . ARG C 3 836 ? 65.354  -85.871 10.923  1.00 35.12  ? 836  ARG A NH1   1 
ATOM   7305 N  NH2   . ARG C 3 836 ? 66.209  -86.438 12.976  1.00 30.96  ? 836  ARG A NH2   1 
ATOM   7306 N  N     . GLU C 3 837 ? 60.601  -82.400 11.311  1.00 45.86  ? 837  GLU A N     1 
ATOM   7307 C  CA    . GLU C 3 837 ? 59.359  -83.061 10.886  1.00 49.33  ? 837  GLU A CA    1 
ATOM   7308 C  C     . GLU C 3 837 ? 59.470  -84.585 10.846  1.00 46.11  ? 837  GLU A C     1 
ATOM   7309 O  O     . GLU C 3 837 ? 60.275  -85.141 10.100  1.00 46.63  ? 837  GLU A O     1 
ATOM   7310 C  CB    . GLU C 3 837 ? 58.926  -82.539 9.507   1.00 52.30  ? 837  GLU A CB    1 
ATOM   7311 C  CG    . GLU C 3 837 ? 57.659  -83.182 8.945   1.00 61.17  ? 837  GLU A CG    1 
ATOM   7312 C  CD    . GLU C 3 837 ? 57.125  -82.473 7.685   1.00 68.58  ? 837  GLU A CD    1 
ATOM   7313 O  OE1   . GLU C 3 837 ? 57.924  -82.194 6.761   1.00 68.74  ? 837  GLU A OE1   1 
ATOM   7314 O  OE2   . GLU C 3 837 ? 55.903  -82.205 7.617   1.00 69.25  ? 837  GLU A OE2   1 
ATOM   7315 N  N     . GLY C 3 838 ? 58.638  -85.245 11.645  1.00 41.99  ? 838  GLY A N     1 
ATOM   7316 C  CA    . GLY C 3 838 ? 58.646  -86.693 11.709  1.00 37.10  ? 838  GLY A CA    1 
ATOM   7317 C  C     . GLY C 3 838 ? 59.051  -87.181 13.085  1.00 42.20  ? 838  GLY A C     1 
ATOM   7318 O  O     . GLY C 3 838 ? 59.179  -88.384 13.300  1.00 42.51  ? 838  GLY A O     1 
ATOM   7319 N  N     . ASN C 3 839 ? 59.237  -86.237 14.014  1.00 43.17  ? 839  ASN A N     1 
ATOM   7320 C  CA    . ASN C 3 839 ? 59.647  -86.516 15.393  1.00 40.12  ? 839  ASN A CA    1 
ATOM   7321 C  C     . ASN C 3 839 ? 58.566  -87.210 16.199  1.00 39.64  ? 839  ASN A C     1 
ATOM   7322 O  O     . ASN C 3 839 ? 57.390  -87.140 15.859  1.00 38.06  ? 839  ASN A O     1 
ATOM   7323 C  CB    . ASN C 3 839 ? 60.053  -85.213 16.095  1.00 44.28  ? 839  ASN A CB    1 
ATOM   7324 C  CG    . ASN C 3 839 ? 58.919  -84.212 16.169  1.00 42.93  ? 839  ASN A CG    1 
ATOM   7325 O  OD1   . ASN C 3 839 ? 58.135  -84.194 17.129  1.00 40.68  ? 839  ASN A OD1   1 
ATOM   7326 N  ND2   . ASN C 3 839 ? 58.814  -83.380 15.144  1.00 36.82  ? 839  ASN A ND2   1 
ATOM   7327 N  N     . PRO C 3 840 ? 58.961  -87.895 17.285  1.00 41.48  ? 840  PRO A N     1 
ATOM   7328 C  CA    . PRO C 3 840 ? 58.061  -88.627 18.175  1.00 40.92  ? 840  PRO A CA    1 
ATOM   7329 C  C     . PRO C 3 840 ? 57.209  -87.738 19.053  1.00 41.11  ? 840  PRO A C     1 
ATOM   7330 O  O     . PRO C 3 840 ? 56.386  -88.219 19.828  1.00 39.00  ? 840  PRO A O     1 
ATOM   7331 C  CB    . PRO C 3 840 ? 59.024  -89.473 18.992  1.00 40.74  ? 840  PRO A CB    1 
ATOM   7332 C  CG    . PRO C 3 840 ? 60.196  -88.603 19.101  1.00 37.23  ? 840  PRO A CG    1 
ATOM   7333 C  CD    . PRO C 3 840 ? 60.356  -88.141 17.680  1.00 39.18  ? 840  PRO A CD    1 
ATOM   7334 N  N     . PHE C 3 841 ? 57.409  -86.436 18.939  1.00 45.21  ? 841  PHE A N     1 
ATOM   7335 C  CA    . PHE C 3 841 ? 56.642  -85.523 19.756  1.00 44.86  ? 841  PHE A CA    1 
ATOM   7336 C  C     . PHE C 3 841 ? 55.339  -85.081 19.097  1.00 46.24  ? 841  PHE A C     1 
ATOM   7337 O  O     . PHE C 3 841 ? 54.383  -84.704 19.784  1.00 44.75  ? 841  PHE A O     1 
ATOM   7338 C  CB    . PHE C 3 841 ? 57.525  -84.343 20.152  1.00 41.73  ? 841  PHE A CB    1 
ATOM   7339 C  CG    . PHE C 3 841 ? 58.694  -84.742 21.020  1.00 42.62  ? 841  PHE A CG    1 
ATOM   7340 C  CD1   . PHE C 3 841 ? 58.517  -84.968 22.383  1.00 39.54  ? 841  PHE A CD1   1 
ATOM   7341 C  CD2   . PHE C 3 841 ? 59.962  -84.929 20.475  1.00 44.86  ? 841  PHE A CD2   1 
ATOM   7342 C  CE1   . PHE C 3 841 ? 59.581  -85.371 23.185  1.00 38.31  ? 841  PHE A CE1   1 
ATOM   7343 C  CE2   . PHE C 3 841 ? 61.031  -85.333 21.281  1.00 42.16  ? 841  PHE A CE2   1 
ATOM   7344 C  CZ    . PHE C 3 841 ? 60.837  -85.553 22.636  1.00 34.22  ? 841  PHE A CZ    1 
ATOM   7345 N  N     . GLY C 3 842 ? 55.295  -85.151 17.769  1.00 45.98  ? 842  GLY A N     1 
ATOM   7346 C  CA    . GLY C 3 842 ? 54.087  -84.792 17.048  1.00 48.62  ? 842  GLY A CA    1 
ATOM   7347 C  C     . GLY C 3 842 ? 53.751  -83.319 16.909  1.00 50.76  ? 842  GLY A C     1 
ATOM   7348 O  O     . GLY C 3 842 ? 52.583  -82.943 16.899  1.00 54.48  ? 842  GLY A O     1 
ATOM   7349 N  N     . ASP C 3 843 ? 54.773  -82.481 16.808  1.00 52.02  ? 843  ASP A N     1 
ATOM   7350 C  CA    . ASP C 3 843 ? 54.573  -81.050 16.634  1.00 49.87  ? 843  ASP A CA    1 
ATOM   7351 C  C     . ASP C 3 843 ? 55.887  -80.472 16.140  1.00 47.79  ? 843  ASP A C     1 
ATOM   7352 O  O     . ASP C 3 843 ? 56.919  -81.134 16.212  1.00 41.56  ? 843  ASP A O     1 
ATOM   7353 C  CB    . ASP C 3 843 ? 54.116  -80.403 17.941  1.00 57.06  ? 843  ASP A CB    1 
ATOM   7354 C  CG    . ASP C 3 843 ? 52.922  -79.471 17.739  1.00 64.42  ? 843  ASP A CG    1 
ATOM   7355 O  OD1   . ASP C 3 843 ? 52.859  -78.798 16.682  1.00 58.24  ? 843  ASP A OD1   1 
ATOM   7356 O  OD2   . ASP C 3 843 ? 52.051  -79.411 18.641  1.00 65.69  ? 843  ASP A OD2   1 
ATOM   7357 N  N     . LYS C 3 844 ? 55.864  -79.251 15.624  1.00 50.31  ? 844  LYS A N     1 
ATOM   7358 C  CA    . LYS C 3 844 ? 57.092  -78.680 15.085  1.00 56.25  ? 844  LYS A CA    1 
ATOM   7359 C  C     . LYS C 3 844 ? 58.082  -78.115 16.073  1.00 53.85  ? 844  LYS A C     1 
ATOM   7360 O  O     . LYS C 3 844 ? 59.176  -77.711 15.678  1.00 54.75  ? 844  LYS A O     1 
ATOM   7361 C  CB    . LYS C 3 844 ? 56.773  -77.625 14.022  1.00 61.82  ? 844  LYS A CB    1 
ATOM   7362 C  CG    . LYS C 3 844 ? 55.847  -76.523 14.455  1.00 62.75  ? 844  LYS A CG    1 
ATOM   7363 C  CD    . LYS C 3 844 ? 55.116  -75.973 13.236  1.00 69.99  ? 844  LYS A CD    1 
ATOM   7364 C  CE    . LYS C 3 844 ? 54.063  -74.951 13.639  1.00 76.02  ? 844  LYS A CE    1 
ATOM   7365 N  NZ    . LYS C 3 844 ? 53.104  -74.642 12.531  1.00 75.19  ? 844  LYS A NZ    1 
ATOM   7366 N  N     . CYS C 3 845 ? 57.716  -78.099 17.349  1.00 48.73  ? 845  CYS A N     1 
ATOM   7367 C  CA    . CYS C 3 845 ? 58.613  -77.576 18.365  1.00 48.37  ? 845  CYS A CA    1 
ATOM   7368 C  C     . CYS C 3 845 ? 58.270  -78.108 19.745  1.00 45.24  ? 845  CYS A C     1 
ATOM   7369 O  O     . CYS C 3 845 ? 57.242  -78.759 19.940  1.00 42.71  ? 845  CYS A O     1 
ATOM   7370 C  CB    . CYS C 3 845 ? 58.546  -76.045 18.386  1.00 48.75  ? 845  CYS A CB    1 
ATOM   7371 S  SG    . CYS C 3 845 ? 57.103  -75.385 19.255  1.00 56.72  ? 845  CYS A SG    1 
ATOM   7372 N  N     . ILE C 3 846 ? 59.147  -77.830 20.701  1.00 43.02  ? 846  ILE A N     1 
ATOM   7373 C  CA    . ILE C 3 846 ? 58.926  -78.252 22.075  1.00 49.14  ? 846  ILE A CA    1 
ATOM   7374 C  C     . ILE C 3 846 ? 59.628  -77.303 23.033  1.00 51.43  ? 846  ILE A C     1 
ATOM   7375 O  O     . ILE C 3 846 ? 60.620  -76.655 22.679  1.00 54.06  ? 846  ILE A O     1 
ATOM   7376 C  CB    . ILE C 3 846 ? 59.433  -79.698 22.334  1.00 49.93  ? 846  ILE A CB    1 
ATOM   7377 C  CG1   . ILE C 3 846 ? 59.101  -80.107 23.769  1.00 49.00  ? 846  ILE A CG1   1 
ATOM   7378 C  CG2   . ILE C 3 846 ? 60.942  -79.784 22.123  1.00 45.99  ? 846  ILE A CG2   1 
ATOM   7379 C  CD1   . ILE C 3 846 ? 59.279  -81.578 24.052  1.00 57.57  ? 846  ILE A CD1   1 
ATOM   7380 N  N     . ALA C 3 847 ? 59.097  -77.217 24.246  1.00 48.94  ? 847  ALA A N     1 
ATOM   7381 C  CA    . ALA C 3 847 ? 59.666  -76.348 25.265  1.00 51.64  ? 847  ALA A CA    1 
ATOM   7382 C  C     . ALA C 3 847 ? 59.885  -77.099 26.569  1.00 54.79  ? 847  ALA A C     1 
ATOM   7383 O  O     . ALA C 3 847 ? 59.445  -78.241 26.733  1.00 59.79  ? 847  ALA A O     1 
ATOM   7384 C  CB    . ALA C 3 847 ? 58.742  -75.144 25.499  1.00 49.56  ? 847  ALA A CB    1 
ATOM   7385 N  N     . TRP C 3 848 ? 60.576  -76.454 27.498  1.00 53.92  ? 848  TRP A N     1 
ATOM   7386 C  CA    . TRP C 3 848 ? 60.827  -77.069 28.790  1.00 52.86  ? 848  TRP A CA    1 
ATOM   7387 C  C     . TRP C 3 848 ? 61.285  -76.038 29.820  1.00 51.60  ? 848  TRP A C     1 
ATOM   7388 O  O     . TRP C 3 848 ? 61.756  -74.957 29.456  1.00 51.52  ? 848  TRP A O     1 
ATOM   7389 C  CB    . TRP C 3 848 ? 61.856  -78.200 28.636  1.00 48.95  ? 848  TRP A CB    1 
ATOM   7390 C  CG    . TRP C 3 848 ? 63.302  -77.778 28.459  1.00 46.30  ? 848  TRP A CG    1 
ATOM   7391 C  CD1   . TRP C 3 848 ? 64.224  -77.591 29.448  1.00 44.11  ? 848  TRP A CD1   1 
ATOM   7392 C  CD2   . TRP C 3 848 ? 63.995  -77.547 27.216  1.00 47.01  ? 848  TRP A CD2   1 
ATOM   7393 N  NE1   . TRP C 3 848 ? 65.446  -77.265 28.904  1.00 46.19  ? 848  TRP A NE1   1 
ATOM   7394 C  CE2   . TRP C 3 848 ? 65.338  -77.233 27.540  1.00 44.16  ? 848  TRP A CE2   1 
ATOM   7395 C  CE3   . TRP C 3 848 ? 63.613  -77.579 25.864  1.00 47.70  ? 848  TRP A CE3   1 
ATOM   7396 C  CZ2   . TRP C 3 848 ? 66.307  -76.952 26.559  1.00 44.90  ? 848  TRP A CZ2   1 
ATOM   7397 C  CZ3   . TRP C 3 848 ? 64.586  -77.293 24.877  1.00 48.37  ? 848  TRP A CZ3   1 
ATOM   7398 C  CH2   . TRP C 3 848 ? 65.913  -76.988 25.238  1.00 52.24  ? 848  TRP A CH2   1 
ATOM   7399 N  N     . PRO C 3 849 ? 61.119  -76.351 31.121  1.00 49.85  ? 849  PRO A N     1 
ATOM   7400 C  CA    . PRO C 3 849 ? 61.508  -75.475 32.231  1.00 52.23  ? 849  PRO A CA    1 
ATOM   7401 C  C     . PRO C 3 849 ? 62.961  -75.004 32.172  1.00 58.02  ? 849  PRO A C     1 
ATOM   7402 O  O     . PRO C 3 849 ? 63.886  -75.798 31.989  1.00 58.31  ? 849  PRO A O     1 
ATOM   7403 C  CB    . PRO C 3 849 ? 61.196  -76.329 33.454  1.00 53.42  ? 849  PRO A CB    1 
ATOM   7404 C  CG    . PRO C 3 849 ? 59.924  -77.047 33.022  1.00 49.08  ? 849  PRO A CG    1 
ATOM   7405 C  CD    . PRO C 3 849 ? 60.316  -77.492 31.613  1.00 51.01  ? 849  PRO A CD    1 
ATOM   7406 N  N     . SER C 3 850 ? 63.133  -73.696 32.335  1.00 61.47  ? 850  SER A N     1 
ATOM   7407 C  CA    . SER C 3 850 ? 64.437  -73.052 32.294  1.00 66.55  ? 850  SER A CA    1 
ATOM   7408 C  C     . SER C 3 850 ? 65.208  -73.142 33.616  1.00 71.37  ? 850  SER A C     1 
ATOM   7409 O  O     . SER C 3 850 ? 66.443  -73.041 33.634  1.00 72.42  ? 850  SER A O     1 
ATOM   7410 C  CB    . SER C 3 850 ? 64.262  -71.583 31.900  1.00 69.17  ? 850  SER A CB    1 
ATOM   7411 O  OG    . SER C 3 850 ? 65.516  -70.947 31.745  1.00 70.00  ? 850  SER A OG    1 
ATOM   7412 N  N     . GLY C 3 851 ? 64.480  -73.336 34.715  1.00 73.53  ? 851  GLY A N     1 
ATOM   7413 C  CA    . GLY C 3 851 ? 65.110  -73.430 36.024  1.00 76.31  ? 851  GLY A CA    1 
ATOM   7414 C  C     . GLY C 3 851 ? 65.832  -74.737 36.322  1.00 77.38  ? 851  GLY A C     1 
ATOM   7415 O  O     . GLY C 3 851 ? 66.694  -74.788 37.204  1.00 76.83  ? 851  GLY A O     1 
ATOM   7416 N  N     . THR C 3 852 ? 65.484  -75.792 35.590  1.00 79.08  ? 852  THR A N     1 
ATOM   7417 C  CA    . THR C 3 852 ? 66.089  -77.109 35.773  1.00 79.83  ? 852  THR A CA    1 
ATOM   7418 C  C     . THR C 3 852 ? 66.459  -77.683 34.394  1.00 81.15  ? 852  THR A C     1 
ATOM   7419 O  O     . THR C 3 852 ? 66.167  -77.070 33.357  1.00 83.05  ? 852  THR A O     1 
ATOM   7420 C  CB    . THR C 3 852 ? 65.093  -78.055 36.486  1.00 79.48  ? 852  THR A CB    1 
ATOM   7421 O  OG1   . THR C 3 852 ? 64.546  -77.386 37.630  1.00 80.31  ? 852  THR A OG1   1 
ATOM   7422 C  CG2   . THR C 3 852 ? 65.784  -79.342 36.933  1.00 82.66  ? 852  THR A CG2   1 
ATOM   7423 N  N     . GLU C 3 853 ? 67.099  -78.848 34.363  1.00 78.52  ? 853  GLU A N     1 
ATOM   7424 C  CA    . GLU C 3 853 ? 67.458  -79.421 33.076  1.00 77.26  ? 853  GLU A CA    1 
ATOM   7425 C  C     . GLU C 3 853 ? 66.482  -80.464 32.550  1.00 72.01  ? 853  GLU A C     1 
ATOM   7426 O  O     . GLU C 3 853 ? 65.797  -81.134 33.322  1.00 70.99  ? 853  GLU A O     1 
ATOM   7427 C  CB    . GLU C 3 853 ? 68.876  -79.988 33.119  1.00 79.89  ? 853  GLU A CB    1 
ATOM   7428 C  CG    . GLU C 3 853 ? 69.229  -80.732 34.377  1.00 84.90  ? 853  GLU A CG    1 
ATOM   7429 C  CD    . GLU C 3 853 ? 70.700  -80.564 34.704  1.00 90.25  ? 853  GLU A CD    1 
ATOM   7430 O  OE1   . GLU C 3 853 ? 71.540  -80.781 33.794  1.00 88.05  ? 853  GLU A OE1   1 
ATOM   7431 O  OE2   . GLU C 3 853 ? 71.013  -80.208 35.865  1.00 92.36  ? 853  GLU A OE2   1 
ATOM   7432 N  N     . ILE C 3 854 ? 66.421  -80.552 31.220  1.00 66.56  ? 854  ILE A N     1 
ATOM   7433 C  CA    . ILE C 3 854 ? 65.568  -81.478 30.481  1.00 59.89  ? 854  ILE A CA    1 
ATOM   7434 C  C     . ILE C 3 854 ? 65.472  -82.843 31.124  1.00 59.65  ? 854  ILE A C     1 
ATOM   7435 O  O     . ILE C 3 854 ? 66.485  -83.449 31.464  1.00 63.60  ? 854  ILE A O     1 
ATOM   7436 C  CB    . ILE C 3 854 ? 66.106  -81.694 29.067  1.00 59.67  ? 854  ILE A CB    1 
ATOM   7437 C  CG1   . ILE C 3 854 ? 67.633  -81.796 29.131  1.00 60.24  ? 854  ILE A CG1   1 
ATOM   7438 C  CG2   . ILE C 3 854 ? 65.615  -80.598 28.135  1.00 58.28  ? 854  ILE A CG2   1 
ATOM   7439 C  CD1   . ILE C 3 854 ? 68.315  -81.971 27.786  1.00 67.14  ? 854  ILE A CD1   1 
ATOM   7440 N  N     . THR C 3 855 ? 64.248  -83.334 31.270  1.00 59.64  ? 855  THR A N     1 
ATOM   7441 C  CA    . THR C 3 855 ? 64.027  -84.645 31.860  1.00 58.58  ? 855  THR A CA    1 
ATOM   7442 C  C     . THR C 3 855 ? 64.693  -85.651 30.953  1.00 56.97  ? 855  THR A C     1 
ATOM   7443 O  O     . THR C 3 855 ? 64.732  -85.456 29.734  1.00 49.59  ? 855  THR A O     1 
ATOM   7444 C  CB    . THR C 3 855 ? 62.545  -85.032 31.891  1.00 60.26  ? 855  THR A CB    1 
ATOM   7445 O  OG1   . THR C 3 855 ? 61.745  -83.854 32.000  1.00 69.36  ? 855  THR A OG1   1 
ATOM   7446 C  CG2   . THR C 3 855 ? 62.267  -85.958 33.070  1.00 60.67  ? 855  THR A CG2   1 
ATOM   7447 N  N     . ASP C 3 856 ? 65.212  -86.720 31.549  1.00 58.83  ? 856  ASP A N     1 
ATOM   7448 C  CA    . ASP C 3 856 ? 65.846  -87.774 30.781  1.00 59.16  ? 856  ASP A CA    1 
ATOM   7449 C  C     . ASP C 3 856 ? 64.718  -88.476 30.037  1.00 56.98  ? 856  ASP A C     1 
ATOM   7450 O  O     . ASP C 3 856 ? 64.947  -89.348 29.208  1.00 54.58  ? 856  ASP A O     1 
ATOM   7451 C  CB    . ASP C 3 856 ? 66.577  -88.749 31.705  1.00 67.53  ? 856  ASP A CB    1 
ATOM   7452 C  CG    . ASP C 3 856 ? 67.865  -88.160 32.293  1.00 71.15  ? 856  ASP A CG    1 
ATOM   7453 O  OD1   . ASP C 3 856 ? 68.679  -87.593 31.526  1.00 67.50  ? 856  ASP A OD1   1 
ATOM   7454 O  OD2   . ASP C 3 856 ? 68.071  -88.286 33.522  1.00 72.69  ? 856  ASP A OD2   1 
ATOM   7455 N  N     . LEU C 3 857 ? 63.492  -88.060 30.345  1.00 56.08  ? 857  LEU A N     1 
ATOM   7456 C  CA    . LEU C 3 857 ? 62.282  -88.590 29.720  1.00 55.93  ? 857  LEU A CA    1 
ATOM   7457 C  C     . LEU C 3 857 ? 62.270  -88.284 28.233  1.00 54.10  ? 857  LEU A C     1 
ATOM   7458 O  O     . LEU C 3 857 ? 61.850  -89.110 27.429  1.00 55.99  ? 857  LEU A O     1 
ATOM   7459 C  CB    . LEU C 3 857 ? 61.035  -87.940 30.328  1.00 58.57  ? 857  LEU A CB    1 
ATOM   7460 C  CG    . LEU C 3 857 ? 60.175  -88.628 31.388  1.00 57.45  ? 857  LEU A CG    1 
ATOM   7461 C  CD1   . LEU C 3 857 ? 61.036  -89.131 32.540  1.00 63.14  ? 857  LEU A CD1   1 
ATOM   7462 C  CD2   . LEU C 3 857 ? 59.135  -87.630 31.881  1.00 56.28  ? 857  LEU A CD2   1 
ATOM   7463 N  N     . ILE C 3 858 ? 62.728  -87.086 27.882  1.00 53.64  ? 858  ILE A N     1 
ATOM   7464 C  CA    . ILE C 3 858 ? 62.741  -86.637 26.495  1.00 52.56  ? 858  ILE A CA    1 
ATOM   7465 C  C     . ILE C 3 858 ? 64.093  -86.212 25.922  1.00 50.63  ? 858  ILE A C     1 
ATOM   7466 O  O     . ILE C 3 858 ? 64.259  -86.202 24.705  1.00 55.80  ? 858  ILE A O     1 
ATOM   7467 C  CB    . ILE C 3 858 ? 61.773  -85.454 26.298  1.00 46.87  ? 858  ILE A CB    1 
ATOM   7468 C  CG1   . ILE C 3 858 ? 62.157  -84.307 27.238  1.00 50.09  ? 858  ILE A CG1   1 
ATOM   7469 C  CG2   . ILE C 3 858 ? 60.370  -85.908 26.553  1.00 40.84  ? 858  ILE A CG2   1 
ATOM   7470 C  CD1   . ILE C 3 858 ? 61.430  -83.008 26.982  1.00 46.64  ? 858  ILE A CD1   1 
ATOM   7471 N  N     . LYS C 3 859 ? 65.045  -85.862 26.782  1.00 48.51  ? 859  LYS A N     1 
ATOM   7472 C  CA    . LYS C 3 859 ? 66.378  -85.404 26.351  1.00 48.98  ? 859  LYS A CA    1 
ATOM   7473 C  C     . LYS C 3 859 ? 66.973  -85.986 25.065  1.00 46.82  ? 859  LYS A C     1 
ATOM   7474 O  O     . LYS C 3 859 ? 67.379  -85.244 24.172  1.00 47.94  ? 859  LYS A O     1 
ATOM   7475 C  CB    . LYS C 3 859 ? 67.390  -85.604 27.483  1.00 47.39  ? 859  LYS A CB    1 
ATOM   7476 C  CG    . LYS C 3 859 ? 68.813  -85.244 27.104  1.00 49.76  ? 859  LYS A CG    1 
ATOM   7477 C  CD    . LYS C 3 859 ? 69.687  -85.156 28.348  1.00 59.91  ? 859  LYS A CD    1 
ATOM   7478 C  CE    . LYS C 3 859 ? 71.180  -85.223 28.029  1.00 64.87  ? 859  LYS A CE    1 
ATOM   7479 N  NZ    . LYS C 3 859 ? 71.622  -84.138 27.118  1.00 66.70  ? 859  LYS A NZ    1 
ATOM   7480 N  N     . ASP C 3 860 ? 67.025  -87.310 24.981  1.00 46.28  ? 860  ASP A N     1 
ATOM   7481 C  CA    . ASP C 3 860 ? 67.588  -87.991 23.822  1.00 46.24  ? 860  ASP A CA    1 
ATOM   7482 C  C     . ASP C 3 860 ? 66.841  -87.745 22.519  1.00 43.90  ? 860  ASP A C     1 
ATOM   7483 O  O     . ASP C 3 860 ? 67.460  -87.520 21.479  1.00 38.50  ? 860  ASP A O     1 
ATOM   7484 C  CB    . ASP C 3 860 ? 67.691  -89.484 24.109  1.00 53.40  ? 860  ASP A CB    1 
ATOM   7485 C  CG    . ASP C 3 860 ? 68.529  -89.775 25.343  1.00 68.73  ? 860  ASP A CG    1 
ATOM   7486 O  OD1   . ASP C 3 860 ? 68.735  -88.837 26.149  1.00 76.47  ? 860  ASP A OD1   1 
ATOM   7487 O  OD2   . ASP C 3 860 ? 68.975  -90.932 25.516  1.00 73.84  ? 860  ASP A OD2   1 
ATOM   7488 N  N     . ASP C 3 861 ? 65.516  -87.793 22.562  1.00 44.81  ? 861  ASP A N     1 
ATOM   7489 C  CA    . ASP C 3 861 ? 64.737  -87.536 21.354  1.00 49.79  ? 861  ASP A CA    1 
ATOM   7490 C  C     . ASP C 3 861 ? 64.883  -86.069 20.933  1.00 50.18  ? 861  ASP A C     1 
ATOM   7491 O  O     . ASP C 3 861 ? 65.017  -85.763 19.745  1.00 47.08  ? 861  ASP A O     1 
ATOM   7492 C  CB    . ASP C 3 861 ? 63.252  -87.838 21.574  1.00 50.61  ? 861  ASP A CB    1 
ATOM   7493 C  CG    . ASP C 3 861 ? 62.988  -89.294 21.874  1.00 54.13  ? 861  ASP A CG    1 
ATOM   7494 O  OD1   . ASP C 3 861 ? 63.651  -90.151 21.259  1.00 52.20  ? 861  ASP A OD1   1 
ATOM   7495 O  OD2   . ASP C 3 861 ? 62.104  -89.584 22.716  1.00 62.81  ? 861  ASP A OD2   1 
ATOM   7496 N  N     . VAL C 3 862 ? 64.844  -85.171 21.919  1.00 48.12  ? 862  VAL A N     1 
ATOM   7497 C  CA    . VAL C 3 862 ? 64.972  -83.743 21.674  1.00 42.64  ? 862  VAL A CA    1 
ATOM   7498 C  C     . VAL C 3 862 ? 66.283  -83.473 20.980  1.00 40.23  ? 862  VAL A C     1 
ATOM   7499 O  O     . VAL C 3 862 ? 66.328  -82.803 19.948  1.00 43.98  ? 862  VAL A O     1 
ATOM   7500 C  CB    . VAL C 3 862 ? 64.954  -82.938 22.969  1.00 38.76  ? 862  VAL A CB    1 
ATOM   7501 C  CG1   . VAL C 3 862 ? 65.067  -81.465 22.644  1.00 43.94  ? 862  VAL A CG1   1 
ATOM   7502 C  CG2   . VAL C 3 862 ? 63.681  -83.211 23.739  1.00 40.93  ? 862  VAL A CG2   1 
ATOM   7503 N  N     . LEU C 3 863 ? 67.361  -83.998 21.533  1.00 37.82  ? 863  LEU A N     1 
ATOM   7504 C  CA    . LEU C 3 863 ? 68.656  -83.777 20.913  1.00 40.05  ? 863  LEU A CA    1 
ATOM   7505 C  C     . LEU C 3 863 ? 68.735  -84.367 19.518  1.00 39.15  ? 863  LEU A C     1 
ATOM   7506 O  O     . LEU C 3 863 ? 69.308  -83.759 18.622  1.00 43.08  ? 863  LEU A O     1 
ATOM   7507 C  CB    . LEU C 3 863 ? 69.767  -84.345 21.790  1.00 37.94  ? 863  LEU A CB    1 
ATOM   7508 C  CG    . LEU C 3 863 ? 70.099  -83.472 23.001  1.00 41.24  ? 863  LEU A CG    1 
ATOM   7509 C  CD1   . LEU C 3 863 ? 71.025  -84.222 23.937  1.00 44.21  ? 863  LEU A CD1   1 
ATOM   7510 C  CD2   . LEU C 3 863 ? 70.720  -82.173 22.523  1.00 41.78  ? 863  LEU A CD2   1 
ATOM   7511 N  N     . HIS C 3 864 ? 68.140  -85.543 19.330  1.00 43.72  ? 864  HIS A N     1 
ATOM   7512 C  CA    . HIS C 3 864 ? 68.162  -86.210 18.034  1.00 35.05  ? 864  HIS A CA    1 
ATOM   7513 C  C     . HIS C 3 864 ? 67.263  -85.543 16.991  1.00 35.40  ? 864  HIS A C     1 
ATOM   7514 O  O     . HIS C 3 864 ? 67.566  -85.574 15.803  1.00 38.74  ? 864  HIS A O     1 
ATOM   7515 C  CB    . HIS C 3 864 ? 67.752  -87.668 18.192  1.00 34.28  ? 864  HIS A CB    1 
ATOM   7516 C  CG    . HIS C 3 864 ? 67.983  -88.495 16.962  1.00 45.70  ? 864  HIS A CG    1 
ATOM   7517 N  ND1   . HIS C 3 864 ? 67.458  -89.758 16.797  1.00 50.72  ? 864  HIS A ND1   1 
ATOM   7518 C  CD2   . HIS C 3 864 ? 68.756  -88.270 15.872  1.00 51.93  ? 864  HIS A CD2   1 
ATOM   7519 C  CE1   . HIS C 3 864 ? 67.903  -90.277 15.665  1.00 51.10  ? 864  HIS A CE1   1 
ATOM   7520 N  NE2   . HIS C 3 864 ? 68.694  -89.395 15.086  1.00 42.42  ? 864  HIS A NE2   1 
ATOM   7521 N  N     . TRP C 3 865 ? 66.168  -84.926 17.418  1.00 34.48  ? 865  TRP A N     1 
ATOM   7522 C  CA    . TRP C 3 865 ? 65.263  -84.309 16.454  1.00 39.03  ? 865  TRP A CA    1 
ATOM   7523 C  C     . TRP C 3 865 ? 65.350  -82.792 16.323  1.00 42.89  ? 865  TRP A C     1 
ATOM   7524 O  O     . TRP C 3 865 ? 64.587  -82.183 15.562  1.00 42.01  ? 865  TRP A O     1 
ATOM   7525 C  CB    . TRP C 3 865 ? 63.812  -84.739 16.741  1.00 41.68  ? 865  TRP A CB    1 
ATOM   7526 C  CG    . TRP C 3 865 ? 63.573  -86.208 16.489  1.00 35.84  ? 865  TRP A CG    1 
ATOM   7527 C  CD1   . TRP C 3 865 ? 63.762  -87.241 17.373  1.00 34.89  ? 865  TRP A CD1   1 
ATOM   7528 C  CD2   . TRP C 3 865 ? 63.198  -86.813 15.245  1.00 29.83  ? 865  TRP A CD2   1 
ATOM   7529 N  NE1   . TRP C 3 865 ? 63.541  -88.442 16.750  1.00 33.56  ? 865  TRP A NE1   1 
ATOM   7530 C  CE2   . TRP C 3 865 ? 63.206  -88.212 15.440  1.00 32.31  ? 865  TRP A CE2   1 
ATOM   7531 C  CE3   . TRP C 3 865 ? 62.888  -86.312 13.973  1.00 30.59  ? 865  TRP A CE3   1 
ATOM   7532 C  CZ2   . TRP C 3 865 ? 62.882  -89.113 14.414  1.00 15.62  ? 865  TRP A CZ2   1 
ATOM   7533 C  CZ3   . TRP C 3 865 ? 62.568  -87.214 12.954  1.00 22.52  ? 865  TRP A CZ3   1 
ATOM   7534 C  CH2   . TRP C 3 865 ? 62.582  -88.590 13.182  1.00 26.97  ? 865  TRP A CH2   1 
ATOM   7535 N  N     . MET C 3 866 ? 66.266  -82.180 17.071  1.00 47.71  ? 866  MET A N     1 
ATOM   7536 C  CA    . MET C 3 866 ? 66.477  -80.740 16.986  1.00 46.92  ? 866  MET A CA    1 
ATOM   7537 C  C     . MET C 3 866 ? 66.601  -80.400 15.505  1.00 48.79  ? 866  MET A C     1 
ATOM   7538 O  O     . MET C 3 866 ? 67.341  -81.071 14.768  1.00 39.99  ? 866  MET A O     1 
ATOM   7539 C  CB    . MET C 3 866 ? 67.784  -80.357 17.661  1.00 53.25  ? 866  MET A CB    1 
ATOM   7540 C  CG    . MET C 3 866 ? 67.717  -80.039 19.119  1.00 59.72  ? 866  MET A CG    1 
ATOM   7541 S  SD    . MET C 3 866 ? 69.399  -79.645 19.634  1.00 68.03  ? 866  MET A SD    1 
ATOM   7542 C  CE    . MET C 3 866 ? 69.661  -78.113 18.738  1.00 63.87  ? 866  MET A CE    1 
ATOM   7543 N  N     . ASP C 3 867 ? 65.890  -79.357 15.081  1.00 49.70  ? 867  ASP A N     1 
ATOM   7544 C  CA    . ASP C 3 867 ? 65.885  -78.905 13.683  1.00 54.79  ? 867  ASP A CA    1 
ATOM   7545 C  C     . ASP C 3 867 ? 67.002  -77.882 13.384  1.00 56.98  ? 867  ASP A C     1 
ATOM   7546 O  O     . ASP C 3 867 ? 66.726  -76.698 13.150  1.00 59.25  ? 867  ASP A O     1 
ATOM   7547 C  CB    . ASP C 3 867 ? 64.520  -78.271 13.358  1.00 54.18  ? 867  ASP A CB    1 
ATOM   7548 C  CG    . ASP C 3 867 ? 64.119  -78.429 11.890  1.00 59.43  ? 867  ASP A CG    1 
ATOM   7549 O  OD1   . ASP C 3 867 ? 65.014  -78.615 11.014  1.00 53.45  ? 867  ASP A OD1   1 
ATOM   7550 O  OD2   . ASP C 3 867 ? 62.893  -78.351 11.619  1.00 50.74  ? 867  ASP A OD2   1 
ATOM   7551 N  N     . TYR C 3 868 ? 68.254  -78.338 13.386  1.00 55.05  ? 868  TYR A N     1 
ATOM   7552 C  CA    . TYR C 3 868 ? 69.388  -77.459 13.111  1.00 49.67  ? 868  TYR A CA    1 
ATOM   7553 C  C     . TYR C 3 868 ? 69.183  -76.723 11.802  1.00 49.96  ? 868  TYR A C     1 
ATOM   7554 O  O     . TYR C 3 868 ? 69.246  -75.498 11.759  1.00 57.48  ? 868  TYR A O     1 
ATOM   7555 C  CB    . TYR C 3 868 ? 70.702  -78.242 13.006  1.00 50.82  ? 868  TYR A CB    1 
ATOM   7556 C  CG    . TYR C 3 868 ? 71.333  -78.660 14.315  1.00 53.96  ? 868  TYR A CG    1 
ATOM   7557 C  CD1   . TYR C 3 868 ? 71.674  -77.724 15.287  1.00 55.04  ? 868  TYR A CD1   1 
ATOM   7558 C  CD2   . TYR C 3 868 ? 71.614  -79.999 14.571  1.00 62.56  ? 868  TYR A CD2   1 
ATOM   7559 C  CE1   . TYR C 3 868 ? 72.280  -78.119 16.481  1.00 59.25  ? 868  TYR A CE1   1 
ATOM   7560 C  CE2   . TYR C 3 868 ? 72.216  -80.398 15.757  1.00 63.54  ? 868  TYR A CE2   1 
ATOM   7561 C  CZ    . TYR C 3 868 ? 72.547  -79.461 16.704  1.00 59.15  ? 868  TYR A CZ    1 
ATOM   7562 O  OH    . TYR C 3 868 ? 73.141  -79.878 17.868  1.00 60.31  ? 868  TYR A OH    1 
ATOM   7563 N  N     . THR C 3 869 ? 68.946  -77.472 10.733  1.00 47.78  ? 869  THR A N     1 
ATOM   7564 C  CA    . THR C 3 869 ? 68.756  -76.881 9.412   1.00 48.43  ? 869  THR A CA    1 
ATOM   7565 C  C     . THR C 3 869 ? 67.763  -75.721 9.338   1.00 47.77  ? 869  THR A C     1 
ATOM   7566 O  O     . THR C 3 869 ? 68.062  -74.698 8.740   1.00 52.27  ? 869  THR A O     1 
ATOM   7567 C  CB    . THR C 3 869 ? 68.321  -77.936 8.375   1.00 49.87  ? 869  THR A CB    1 
ATOM   7568 O  OG1   . THR C 3 869 ? 69.376  -78.889 8.176   1.00 52.59  ? 869  THR A OG1   1 
ATOM   7569 C  CG2   . THR C 3 869 ? 67.995  -77.255 7.047   1.00 47.65  ? 869  THR A CG2   1 
ATOM   7570 N  N     . VAL C 3 870 ? 66.582  -75.871 9.924   1.00 43.15  ? 870  VAL A N     1 
ATOM   7571 C  CA    . VAL C 3 870 ? 65.604  -74.791 9.880   1.00 42.64  ? 870  VAL A CA    1 
ATOM   7572 C  C     . VAL C 3 870 ? 66.110  -73.512 10.561  1.00 50.12  ? 870  VAL A C     1 
ATOM   7573 O  O     . VAL C 3 870 ? 65.837  -72.406 10.077  1.00 52.00  ? 870  VAL A O     1 
ATOM   7574 C  CB    . VAL C 3 870 ? 64.268  -75.236 10.508  1.00 39.67  ? 870  VAL A CB    1 
ATOM   7575 C  CG1   . VAL C 3 870 ? 63.328  -74.067 10.667  1.00 35.81  ? 870  VAL A CG1   1 
ATOM   7576 C  CG2   . VAL C 3 870 ? 63.627  -76.289 9.621   1.00 48.65  ? 870  VAL A CG2   1 
ATOM   7577 N  N     . LEU C 3 871 ? 66.842  -73.650 11.672  1.00 48.19  ? 871  LEU A N     1 
ATOM   7578 C  CA    . LEU C 3 871 ? 67.386  -72.479 12.370  1.00 46.12  ? 871  LEU A CA    1 
ATOM   7579 C  C     . LEU C 3 871 ? 68.475  -71.853 11.523  1.00 47.10  ? 871  LEU A C     1 
ATOM   7580 O  O     . LEU C 3 871 ? 68.503  -70.641 11.320  1.00 42.84  ? 871  LEU A O     1 
ATOM   7581 C  CB    . LEU C 3 871 ? 68.004  -72.855 13.719  1.00 41.17  ? 871  LEU A CB    1 
ATOM   7582 C  CG    . LEU C 3 871 ? 67.096  -73.076 14.924  1.00 39.33  ? 871  LEU A CG    1 
ATOM   7583 C  CD1   . LEU C 3 871 ? 67.947  -73.339 16.149  1.00 36.52  ? 871  LEU A CD1   1 
ATOM   7584 C  CD2   . LEU C 3 871 ? 66.222  -71.861 15.127  1.00 39.17  ? 871  LEU A CD2   1 
ATOM   7585 N  N     . LEU C 3 872 ? 69.368  -72.702 11.029  1.00 48.18  ? 872  LEU A N     1 
ATOM   7586 C  CA    . LEU C 3 872 ? 70.479  -72.259 10.205  1.00 51.34  ? 872  LEU A CA    1 
ATOM   7587 C  C     . LEU C 3 872 ? 69.980  -71.478 9.003   1.00 53.83  ? 872  LEU A C     1 
ATOM   7588 O  O     . LEU C 3 872 ? 70.545  -70.449 8.665   1.00 59.14  ? 872  LEU A O     1 
ATOM   7589 C  CB    . LEU C 3 872 ? 71.298  -73.465 9.745   1.00 48.94  ? 872  LEU A CB    1 
ATOM   7590 C  CG    . LEU C 3 872 ? 72.735  -73.228 9.286   1.00 51.14  ? 872  LEU A CG    1 
ATOM   7591 C  CD1   . LEU C 3 872 ? 73.368  -74.564 8.957   1.00 57.93  ? 872  LEU A CD1   1 
ATOM   7592 C  CD2   . LEU C 3 872 ? 72.767  -72.331 8.082   1.00 54.72  ? 872  LEU A CD2   1 
ATOM   7593 N  N     . GLU C 3 873 ? 68.925  -71.955 8.355   1.00 57.45  ? 873  GLU A N     1 
ATOM   7594 C  CA    . GLU C 3 873 ? 68.413  -71.242 7.195   1.00 64.55  ? 873  GLU A CA    1 
ATOM   7595 C  C     . GLU C 3 873 ? 67.486  -70.089 7.556   1.00 60.46  ? 873  GLU A C     1 
ATOM   7596 O  O     . GLU C 3 873 ? 67.314  -69.156 6.783   1.00 63.12  ? 873  GLU A O     1 
ATOM   7597 C  CB    . GLU C 3 873 ? 67.701  -72.201 6.232   1.00 70.60  ? 873  GLU A CB    1 
ATOM   7598 C  CG    . GLU C 3 873 ? 68.640  -73.232 5.611   1.00 86.45  ? 873  GLU A CG    1 
ATOM   7599 C  CD    . GLU C 3 873 ? 68.101  -73.841 4.314   1.00 93.16  ? 873  GLU A CD    1 
ATOM   7600 O  OE1   . GLU C 3 873 ? 66.953  -74.346 4.319   1.00 95.70  ? 873  GLU A OE1   1 
ATOM   7601 O  OE2   . GLU C 3 873 ? 68.833  -73.816 3.295   1.00 93.33  ? 873  GLU A OE2   1 
ATOM   7602 N  N     . LYS C 3 874 ? 66.897  -70.125 8.735   1.00 55.52  ? 874  LYS A N     1 
ATOM   7603 C  CA    . LYS C 3 874 ? 66.001  -69.046 9.085   1.00 53.28  ? 874  LYS A CA    1 
ATOM   7604 C  C     . LYS C 3 874 ? 66.726  -67.838 9.662   1.00 56.12  ? 874  LYS A C     1 
ATOM   7605 O  O     . LYS C 3 874 ? 66.389  -66.697 9.341   1.00 62.58  ? 874  LYS A O     1 
ATOM   7606 C  CB    . LYS C 3 874 ? 64.937  -69.541 10.066  1.00 52.53  ? 874  LYS A CB    1 
ATOM   7607 C  CG    . LYS C 3 874 ? 63.895  -68.493 10.439  1.00 53.39  ? 874  LYS A CG    1 
ATOM   7608 C  CD    . LYS C 3 874 ? 62.724  -69.073 11.259  1.00 63.72  ? 874  LYS A CD    1 
ATOM   7609 C  CE    . LYS C 3 874 ? 61.622  -69.720 10.380  1.00 70.69  ? 874  LYS A CE    1 
ATOM   7610 N  NZ    . LYS C 3 874 ? 61.978  -71.020 9.716   1.00 66.09  ? 874  LYS A NZ    1 
ATOM   7611 N  N     . THR C 3 875 ? 67.739  -68.072 10.487  1.00 52.37  ? 875  THR A N     1 
ATOM   7612 C  CA    . THR C 3 875 ? 68.438  -66.965 11.121  1.00 45.73  ? 875  THR A CA    1 
ATOM   7613 C  C     . THR C 3 875 ? 69.795  -66.596 10.525  1.00 52.29  ? 875  THR A C     1 
ATOM   7614 O  O     . THR C 3 875 ? 70.331  -65.518 10.817  1.00 55.40  ? 875  THR A O     1 
ATOM   7615 C  CB    . THR C 3 875 ? 68.615  -67.235 12.639  1.00 43.22  ? 875  THR A CB    1 
ATOM   7616 O  OG1   . THR C 3 875 ? 69.560  -68.292 12.835  1.00 37.38  ? 875  THR A OG1   1 
ATOM   7617 C  CG2   . THR C 3 875 ? 67.283  -67.630 13.282  1.00 37.63  ? 875  THR A CG2   1 
ATOM   7618 N  N     . PHE C 3 876 ? 70.348  -67.463 9.679   1.00 51.99  ? 876  PHE A N     1 
ATOM   7619 C  CA    . PHE C 3 876 ? 71.655  -67.180 9.096   1.00 49.92  ? 876  PHE A CA    1 
ATOM   7620 C  C     . PHE C 3 876 ? 71.763  -67.109 7.572   1.00 49.21  ? 876  PHE A C     1 
ATOM   7621 O  O     . PHE C 3 876 ? 72.568  -66.344 7.052   1.00 51.37  ? 876  PHE A O     1 
ATOM   7622 C  CB    . PHE C 3 876 ? 72.696  -68.187 9.610   1.00 48.85  ? 876  PHE A CB    1 
ATOM   7623 C  CG    . PHE C 3 876 ? 74.079  -67.978 9.030   1.00 48.49  ? 876  PHE A CG    1 
ATOM   7624 C  CD1   . PHE C 3 876 ? 74.900  -66.941 9.483   1.00 50.49  ? 876  PHE A CD1   1 
ATOM   7625 C  CD2   . PHE C 3 876 ? 74.534  -68.779 7.988   1.00 42.10  ? 876  PHE A CD2   1 
ATOM   7626 C  CE1   . PHE C 3 876 ? 76.151  -66.711 8.895   1.00 45.73  ? 876  PHE A CE1   1 
ATOM   7627 C  CE2   . PHE C 3 876 ? 75.775  -68.559 7.397   1.00 38.64  ? 876  PHE A CE2   1 
ATOM   7628 C  CZ    . PHE C 3 876 ? 76.583  -67.528 7.846   1.00 47.78  ? 876  PHE A CZ    1 
ATOM   7629 N  N     . ILE C 3 877 ? 70.977  -67.893 6.848   1.00 48.22  ? 877  ILE A N     1 
ATOM   7630 C  CA    . ILE C 3 877 ? 71.092  -67.864 5.396   1.00 49.31  ? 877  ILE A CA    1 
ATOM   7631 C  C     . ILE C 3 877 ? 70.087  -66.958 4.693   1.00 51.73  ? 877  ILE A C     1 
ATOM   7632 O  O     . ILE C 3 877 ? 70.367  -66.435 3.614   1.00 52.02  ? 877  ILE A O     1 
ATOM   7633 C  CB    . ILE C 3 877 ? 70.982  -69.272 4.812   1.00 50.54  ? 877  ILE A CB    1 
ATOM   7634 C  CG1   . ILE C 3 877 ? 71.898  -70.218 5.594   1.00 54.43  ? 877  ILE A CG1   1 
ATOM   7635 C  CG2   . ILE C 3 877 ? 71.414  -69.259 3.355   1.00 48.35  ? 877  ILE A CG2   1 
ATOM   7636 C  CD1   . ILE C 3 877 ? 71.933  -71.636 5.064   1.00 52.07  ? 877  ILE A CD1   1 
ATOM   7637 N  N     . LYS C 3 878 ? 68.921  -66.768 5.297   1.00 49.53  ? 878  LYS A N     1 
ATOM   7638 C  CA    . LYS C 3 878 ? 67.927  -65.922 4.682   1.00 49.03  ? 878  LYS A CA    1 
ATOM   7639 C  C     . LYS C 3 878 ? 68.448  -64.498 4.695   1.00 51.00  ? 878  LYS A C     1 
ATOM   7640 O  O     . LYS C 3 878 ? 68.430  -63.826 3.665   1.00 54.41  ? 878  LYS A O     1 
ATOM   7641 C  CB    . LYS C 3 878 ? 66.591  -65.999 5.424   1.00 52.62  ? 878  LYS A CB    1 
ATOM   7642 C  CG    . LYS C 3 878 ? 65.451  -65.316 4.673   1.00 61.78  ? 878  LYS A CG    1 
ATOM   7643 C  CD    . LYS C 3 878 ? 64.187  -65.195 5.518   1.00 68.43  ? 878  LYS A CD    1 
ATOM   7644 C  CE    . LYS C 3 878 ? 63.087  -64.469 4.749   1.00 69.14  ? 878  LYS A CE    1 
ATOM   7645 N  NZ    . LYS C 3 878 ? 61.946  -64.070 5.636   1.00 72.96  ? 878  LYS A NZ    1 
ATOM   7646 N  N     . PRO C 3 879 ? 68.925  -64.017 5.862   1.00 48.58  ? 879  PRO A N     1 
ATOM   7647 C  CA    . PRO C 3 879 ? 69.438  -62.648 5.922   1.00 44.85  ? 879  PRO A CA    1 
ATOM   7648 C  C     . PRO C 3 879 ? 70.748  -62.495 5.166   1.00 45.75  ? 879  PRO A C     1 
ATOM   7649 O  O     . PRO C 3 879 ? 70.976  -61.474 4.523   1.00 46.67  ? 879  PRO A O     1 
ATOM   7650 C  CB    . PRO C 3 879 ? 69.586  -62.393 7.424   1.00 38.91  ? 879  PRO A CB    1 
ATOM   7651 C  CG    . PRO C 3 879 ? 69.854  -63.713 7.982   1.00 44.47  ? 879  PRO A CG    1 
ATOM   7652 C  CD    . PRO C 3 879 ? 68.925  -64.629 7.206   1.00 49.21  ? 879  PRO A CD    1 
ATOM   7653 N  N     . LEU C 3 880 ? 71.596  -63.518 5.218   1.00 45.10  ? 880  LEU A N     1 
ATOM   7654 C  CA    . LEU C 3 880 ? 72.885  -63.463 4.537   1.00 44.99  ? 880  LEU A CA    1 
ATOM   7655 C  C     . LEU C 3 880 ? 72.717  -63.258 3.039   1.00 48.90  ? 880  LEU A C     1 
ATOM   7656 O  O     . LEU C 3 880 ? 73.505  -62.562 2.410   1.00 52.20  ? 880  LEU A O     1 
ATOM   7657 C  CB    . LEU C 3 880 ? 73.663  -64.750 4.764   1.00 44.17  ? 880  LEU A CB    1 
ATOM   7658 C  CG    . LEU C 3 880 ? 75.187  -64.711 4.704   1.00 46.07  ? 880  LEU A CG    1 
ATOM   7659 C  CD1   . LEU C 3 880 ? 75.668  -66.117 4.454   1.00 50.14  ? 880  LEU A CD1   1 
ATOM   7660 C  CD2   . LEU C 3 880 ? 75.692  -63.799 3.612   1.00 48.17  ? 880  LEU A CD2   1 
ATOM   7661 N  N     . GLU C 3 881 ? 71.696  -63.873 2.459   1.00 55.86  ? 881  GLU A N     1 
ATOM   7662 C  CA    . GLU C 3 881 ? 71.486  -63.727 1.032   1.00 59.53  ? 881  GLU A CA    1 
ATOM   7663 C  C     . GLU C 3 881 ? 71.063  -62.317 0.661   1.00 61.58  ? 881  GLU A C     1 
ATOM   7664 O  O     . GLU C 3 881 ? 71.395  -61.823 -0.422  1.00 63.34  ? 881  GLU A O     1 
ATOM   7665 C  CB    . GLU C 3 881 ? 70.437  -64.688 0.520   1.00 65.23  ? 881  GLU A CB    1 
ATOM   7666 C  CG    . GLU C 3 881 ? 70.231  -64.471 -0.955  1.00 76.08  ? 881  GLU A CG    1 
ATOM   7667 C  CD    . GLU C 3 881 ? 69.169  -65.353 -1.536  1.00 83.86  ? 881  GLU A CD    1 
ATOM   7668 O  OE1   . GLU C 3 881 ? 69.270  -66.587 -1.352  1.00 91.67  ? 881  GLU A OE1   1 
ATOM   7669 O  OE2   . GLU C 3 881 ? 68.245  -64.806 -2.179  1.00 83.59  ? 881  GLU A OE2   1 
ATOM   7670 N  N     . GLY C 3 882 ? 70.309  -61.677 1.548   1.00 61.01  ? 882  GLY A N     1 
ATOM   7671 C  CA    . GLY C 3 882 ? 69.888  -60.319 1.288   1.00 54.99  ? 882  GLY A CA    1 
ATOM   7672 C  C     . GLY C 3 882 ? 71.132  -59.525 0.967   1.00 51.55  ? 882  GLY A C     1 
ATOM   7673 O  O     . GLY C 3 882 ? 71.176  -58.795 -0.024  1.00 53.67  ? 882  GLY A O     1 
ATOM   7674 N  N     . PHE C 3 883 ? 72.165  -59.692 1.786   1.00 48.07  ? 883  PHE A N     1 
ATOM   7675 C  CA    . PHE C 3 883 ? 73.414  -58.971 1.572   1.00 48.58  ? 883  PHE A CA    1 
ATOM   7676 C  C     . PHE C 3 883 ? 74.089  -59.354 0.264   1.00 47.14  ? 883  PHE A C     1 
ATOM   7677 O  O     . PHE C 3 883 ? 74.446  -58.489 -0.544  1.00 47.12  ? 883  PHE A O     1 
ATOM   7678 C  CB    . PHE C 3 883 ? 74.390  -59.248 2.717   1.00 43.34  ? 883  PHE A CB    1 
ATOM   7679 C  CG    . PHE C 3 883 ? 73.774  -59.133 4.073   1.00 41.99  ? 883  PHE A CG    1 
ATOM   7680 C  CD1   . PHE C 3 883 ? 72.721  -58.257 4.293   1.00 39.72  ? 883  PHE A CD1   1 
ATOM   7681 C  CD2   . PHE C 3 883 ? 74.258  -59.888 5.142   1.00 42.58  ? 883  PHE A CD2   1 
ATOM   7682 C  CE1   . PHE C 3 883 ? 72.155  -58.132 5.557   1.00 46.48  ? 883  PHE A CE1   1 
ATOM   7683 C  CE2   . PHE C 3 883 ? 73.700  -59.772 6.417   1.00 39.54  ? 883  PHE A CE2   1 
ATOM   7684 C  CZ    . PHE C 3 883 ? 72.646  -58.893 6.625   1.00 44.13  ? 883  PHE A CZ    1 
ATOM   7685 N  N     . THR C 3 884 ? 74.245  -60.662 0.074   1.00 45.23  ? 884  THR A N     1 
ATOM   7686 C  CA    . THR C 3 884 ? 74.912  -61.217 -1.092  1.00 44.27  ? 884  THR A CA    1 
ATOM   7687 C  C     . THR C 3 884 ? 74.218  -60.943 -2.397  1.00 42.33  ? 884  THR A C     1 
ATOM   7688 O  O     . THR C 3 884 ? 74.868  -60.587 -3.375  1.00 41.66  ? 884  THR A O     1 
ATOM   7689 C  CB    . THR C 3 884 ? 75.108  -62.721 -0.949  1.00 47.58  ? 884  THR A CB    1 
ATOM   7690 O  OG1   . THR C 3 884 ? 73.834  -63.379 -0.976  1.00 50.68  ? 884  THR A OG1   1 
ATOM   7691 C  CG2   . THR C 3 884 ? 75.820  -63.019 0.363   1.00 43.76  ? 884  THR A CG2   1 
ATOM   7692 N  N     . SER C 3 885 ? 72.906  -61.121 -2.436  1.00 44.52  ? 885  SER A N     1 
ATOM   7693 C  CA    . SER C 3 885 ? 72.189  -60.846 -3.674  1.00 49.43  ? 885  SER A CA    1 
ATOM   7694 C  C     . SER C 3 885 ? 72.401  -59.378 -4.065  1.00 48.17  ? 885  SER A C     1 
ATOM   7695 O  O     . SER C 3 885 ? 72.866  -59.073 -5.160  1.00 49.15  ? 885  SER A O     1 
ATOM   7696 C  CB    . SER C 3 885 ? 70.696  -61.119 -3.503  1.00 48.51  ? 885  SER A CB    1 
ATOM   7697 O  OG    . SER C 3 885 ? 70.130  -60.285 -2.510  1.00 60.31  ? 885  SER A OG    1 
ATOM   7698 N  N     . ALA C 3 886 ? 72.085  -58.475 -3.144  1.00 46.16  ? 886  ALA A N     1 
ATOM   7699 C  CA    . ALA C 3 886 ? 72.216  -57.051 -3.397  1.00 46.35  ? 886  ALA A CA    1 
ATOM   7700 C  C     . ALA C 3 886 ? 73.624  -56.654 -3.807  1.00 45.81  ? 886  ALA A C     1 
ATOM   7701 O  O     . ALA C 3 886 ? 73.806  -55.828 -4.703  1.00 49.27  ? 886  ALA A O     1 
ATOM   7702 C  CB    . ALA C 3 886 ? 71.790  -56.272 -2.172  1.00 46.10  ? 886  ALA A CB    1 
ATOM   7703 N  N     . ALA C 3 887 ? 74.620  -57.245 -3.160  1.00 42.83  ? 887  ALA A N     1 
ATOM   7704 C  CA    . ALA C 3 887 ? 76.012  -56.933 -3.463  1.00 41.34  ? 887  ALA A CA    1 
ATOM   7705 C  C     . ALA C 3 887 ? 76.543  -57.648 -4.692  1.00 44.07  ? 887  ALA A C     1 
ATOM   7706 O  O     . ALA C 3 887 ? 77.680  -57.417 -5.093  1.00 44.57  ? 887  ALA A O     1 
ATOM   7707 C  CB    . ALA C 3 887 ? 76.883  -57.263 -2.260  1.00 32.86  ? 887  ALA A CB    1 
ATOM   7708 N  N     . LYS C 3 888 ? 75.722  -58.517 -5.284  1.00 50.54  ? 888  LYS A N     1 
ATOM   7709 C  CA    . LYS C 3 888 ? 76.096  -59.282 -6.486  1.00 55.20  ? 888  LYS A CA    1 
ATOM   7710 C  C     . LYS C 3 888 ? 77.121  -60.377 -6.193  1.00 59.10  ? 888  LYS A C     1 
ATOM   7711 O  O     . LYS C 3 888 ? 78.073  -60.544 -6.958  1.00 59.90  ? 888  LYS A O     1 
ATOM   7712 C  CB    . LYS C 3 888 ? 76.695  -58.367 -7.561  1.00 56.49  ? 888  LYS A CB    1 
ATOM   7713 C  CG    . LYS C 3 888 ? 76.022  -57.018 -7.761  1.00 58.41  ? 888  LYS A CG    1 
ATOM   7714 C  CD    . LYS C 3 888 ? 74.812  -57.090 -8.666  1.00 58.54  ? 888  LYS A CD    1 
ATOM   7715 C  CE    . LYS C 3 888 ? 74.370  -55.683 -9.035  1.00 59.11  ? 888  LYS A CE    1 
ATOM   7716 N  NZ    . LYS C 3 888 ? 73.196  -55.669 -9.939  1.00 61.08  ? 888  LYS A NZ    1 
ATOM   7717 N  N     . LEU C 3 889 ? 76.937  -61.111 -5.093  1.00 61.74  ? 889  LEU A N     1 
ATOM   7718 C  CA    . LEU C 3 889 ? 77.861  -62.193 -4.718  1.00 60.57  ? 889  LEU A CA    1 
ATOM   7719 C  C     . LEU C 3 889 ? 77.165  -63.533 -4.500  1.00 60.12  ? 889  LEU A C     1 
ATOM   7720 O  O     . LEU C 3 889 ? 75.945  -63.640 -4.607  1.00 58.10  ? 889  LEU A O     1 
ATOM   7721 C  CB    . LEU C 3 889 ? 78.618  -61.839 -3.437  1.00 56.67  ? 889  LEU A CB    1 
ATOM   7722 C  CG    . LEU C 3 889 ? 79.483  -60.589 -3.457  1.00 50.23  ? 889  LEU A CG    1 
ATOM   7723 C  CD1   . LEU C 3 889 ? 80.193  -60.457 -2.123  1.00 50.83  ? 889  LEU A CD1   1 
ATOM   7724 C  CD2   . LEU C 3 889 ? 80.479  -60.672 -4.602  1.00 50.58  ? 889  LEU A CD2   1 
ATOM   7725 N  N     . ASP C 3 890 ? 77.969  -64.545 -4.178  1.00 62.53  ? 890  ASP A N     1 
ATOM   7726 C  CA    . ASP C 3 890 ? 77.487  -65.904 -3.924  1.00 62.91  ? 890  ASP A CA    1 
ATOM   7727 C  C     . ASP C 3 890 ? 78.201  -66.495 -2.707  1.00 60.05  ? 890  ASP A C     1 
ATOM   7728 O  O     . ASP C 3 890 ? 79.424  -66.602 -2.703  1.00 61.13  ? 890  ASP A O     1 
ATOM   7729 C  CB    . ASP C 3 890 ? 77.763  -66.796 -5.141  1.00 65.05  ? 890  ASP A CB    1 
ATOM   7730 C  CG    . ASP C 3 890 ? 76.970  -66.379 -6.367  1.00 69.42  ? 890  ASP A CG    1 
ATOM   7731 O  OD1   . ASP C 3 890 ? 75.726  -66.509 -6.342  1.00 72.61  ? 890  ASP A OD1   1 
ATOM   7732 O  OD2   . ASP C 3 890 ? 77.588  -65.922 -7.353  1.00 69.14  ? 890  ASP A OD2   1 
ATOM   7733 N  N     . TYR C 3 891 ? 77.456  -66.890 -1.680  1.00 56.85  ? 891  TYR A N     1 
ATOM   7734 C  CA    . TYR C 3 891 ? 78.101  -67.464 -0.502  1.00 56.53  ? 891  TYR A CA    1 
ATOM   7735 C  C     . TYR C 3 891 ? 78.520  -68.919 -0.705  1.00 59.62  ? 891  TYR A C     1 
ATOM   7736 O  O     . TYR C 3 891 ? 79.073  -69.539 0.204   1.00 61.83  ? 891  TYR A O     1 
ATOM   7737 C  CB    . TYR C 3 891 ? 77.184  -67.349 0.726   1.00 55.11  ? 891  TYR A CB    1 
ATOM   7738 C  CG    . TYR C 3 891 ? 75.780  -67.861 0.505   1.00 57.05  ? 891  TYR A CG    1 
ATOM   7739 C  CD1   . TYR C 3 891 ? 75.500  -69.226 0.535   1.00 61.74  ? 891  TYR A CD1   1 
ATOM   7740 C  CD2   . TYR C 3 891 ? 74.731  -66.981 0.239   1.00 56.07  ? 891  TYR A CD2   1 
ATOM   7741 C  CE1   . TYR C 3 891 ? 74.206  -69.708 0.302   1.00 61.84  ? 891  TYR A CE1   1 
ATOM   7742 C  CE2   . TYR C 3 891 ? 73.433  -67.451 0.005   1.00 59.44  ? 891  TYR A CE2   1 
ATOM   7743 C  CZ    . TYR C 3 891 ? 73.181  -68.816 0.037   1.00 60.58  ? 891  TYR A CZ    1 
ATOM   7744 O  OH    . TYR C 3 891 ? 71.915  -69.295 -0.207  1.00 56.21  ? 891  TYR A OH    1 
ATOM   7745 N  N     . GLU C 3 892 ? 78.258  -69.458 -1.894  1.00 61.72  ? 892  GLU A N     1 
ATOM   7746 C  CA    . GLU C 3 892 ? 78.613  -70.838 -2.218  1.00 65.76  ? 892  GLU A CA    1 
ATOM   7747 C  C     . GLU C 3 892 ? 78.749  -70.997 -3.724  1.00 70.93  ? 892  GLU A C     1 
ATOM   7748 O  O     . GLU C 3 892 ? 77.885  -70.556 -4.484  1.00 72.38  ? 892  GLU A O     1 
ATOM   7749 C  CB    . GLU C 3 892 ? 77.546  -71.804 -1.697  1.00 66.41  ? 892  GLU A CB    1 
ATOM   7750 C  CG    . GLU C 3 892 ? 76.188  -71.651 -2.365  1.00 73.25  ? 892  GLU A CG    1 
ATOM   7751 C  CD    . GLU C 3 892 ? 75.121  -72.555 -1.762  1.00 74.86  ? 892  GLU A CD    1 
ATOM   7752 O  OE1   . GLU C 3 892 ? 75.481  -73.549 -1.089  1.00 70.76  ? 892  GLU A OE1   1 
ATOM   7753 O  OE2   . GLU C 3 892 ? 73.923  -72.266 -1.974  1.00 74.46  ? 892  GLU A OE2   1 
ATOM   7754 N  N     . LYS C 3 893 ? 79.842  -71.607 -4.166  1.00 78.14  ? 893  LYS A N     1 
ATOM   7755 C  CA    . LYS C 3 893 ? 80.027  -71.816 -5.597  1.00 83.65  ? 893  LYS A CA    1 
ATOM   7756 C  C     . LYS C 3 893 ? 79.188  -73.013 -6.025  1.00 86.32  ? 893  LYS A C     1 
ATOM   7757 O  O     . LYS C 3 893 ? 79.047  -73.978 -5.272  1.00 84.56  ? 893  LYS A O     1 
ATOM   7758 C  CB    . LYS C 3 893 ? 81.495  -72.082 -5.924  1.00 87.93  ? 893  LYS A CB    1 
ATOM   7759 C  CG    . LYS C 3 893 ? 81.762  -72.268 -7.412  1.00 92.74  ? 893  LYS A CG    1 
ATOM   7760 C  CD    . LYS C 3 893 ? 81.274  -71.065 -8.207  1.00 97.41  ? 893  LYS A CD    1 
ATOM   7761 C  CE    . LYS C 3 893 ? 81.604  -71.202 -9.683  1.00 101.07 ? 893  LYS A CE    1 
ATOM   7762 N  NZ    . LYS C 3 893 ? 81.204  -69.985 -10.451 1.00 105.31 ? 893  LYS A NZ    1 
ATOM   7763 N  N     . LYS C 3 894 ? 78.621  -72.950 -7.225  1.00 91.79  ? 894  LYS A N     1 
ATOM   7764 C  CA    . LYS C 3 894 ? 77.807  -74.056 -7.715  1.00 96.79  ? 894  LYS A CA    1 
ATOM   7765 C  C     . LYS C 3 894 ? 78.683  -75.182 -8.274  1.00 97.73  ? 894  LYS A C     1 
ATOM   7766 O  O     . LYS C 3 894 ? 78.377  -76.365 -8.093  1.00 97.97  ? 894  LYS A O     1 
ATOM   7767 C  CB    . LYS C 3 894 ? 76.825  -73.570 -8.791  1.00 99.24  ? 894  LYS A CB    1 
ATOM   7768 C  CG    . LYS C 3 894 ? 77.469  -73.051 -10.066 1.00 104.44 ? 894  LYS A CG    1 
ATOM   7769 C  CD    . LYS C 3 894 ? 76.395  -72.642 -11.074 1.00 110.90 ? 894  LYS A CD    1 
ATOM   7770 C  CE    . LYS C 3 894 ? 77.011  -72.147 -12.383 1.00 114.17 ? 894  LYS A CE    1 
ATOM   7771 N  NZ    . LYS C 3 894 ? 75.985  -71.750 -13.404 1.00 112.86 ? 894  LYS A NZ    1 
ATOM   7772 N  N     . ALA C 3 895 ? 79.782  -74.809 -8.931  1.00 98.34  ? 895  ALA A N     1 
ATOM   7773 C  CA    . ALA C 3 895 ? 80.700  -75.784 -9.527  1.00 98.02  ? 895  ALA A CA    1 
ATOM   7774 C  C     . ALA C 3 895 ? 82.122  -75.702 -8.956  1.00 96.67  ? 895  ALA A C     1 
ATOM   7775 O  O     . ALA C 3 895 ? 82.753  -74.644 -9.006  1.00 96.87  ? 895  ALA A O     1 
ATOM   7776 C  CB    . ALA C 3 895 ? 80.735  -75.590 -11.038 1.00 97.57  ? 895  ALA A CB    1 
ATOM   7777 N  N     . SER C 3 896 ? 82.627  -76.819 -8.429  1.00 94.81  ? 896  SER A N     1 
ATOM   7778 C  CA    . SER C 3 896 ? 83.970  -76.845 -7.854  1.00 94.68  ? 896  SER A CA    1 
ATOM   7779 C  C     . SER C 3 896 ? 84.938  -77.905 -8.394  1.00 91.34  ? 896  SER A C     1 
ATOM   7780 O  O     . SER C 3 896 ? 84.557  -78.828 -9.108  1.00 90.65  ? 896  SER A O     1 
ATOM   7781 C  CB    . SER C 3 896 ? 83.882  -76.962 -6.329  1.00 98.43  ? 896  SER A CB    1 
ATOM   7782 O  OG    . SER C 3 896 ? 83.362  -75.769 -5.762  1.00 102.22 ? 896  SER A OG    1 
ATOM   7783 N  N     . LEU C 3 897 ? 86.200  -77.729 -8.010  1.00 90.83  ? 897  LEU A N     1 
ATOM   7784 C  CA    . LEU C 3 897 ? 87.357  -78.551 -8.378  1.00 87.50  ? 897  LEU A CA    1 
ATOM   7785 C  C     . LEU C 3 897 ? 87.156  -80.008 -8.765  1.00 86.27  ? 897  LEU A C     1 
ATOM   7786 O  O     . LEU C 3 897 ? 87.852  -80.519 -9.642  1.00 83.52  ? 897  LEU A O     1 
ATOM   7787 C  CB    . LEU C 3 897 ? 88.378  -78.498 -7.243  1.00 84.96  ? 897  LEU A CB    1 
ATOM   7788 C  CG    . LEU C 3 897 ? 88.457  -77.132 -6.564  1.00 86.22  ? 897  LEU A CG    1 
ATOM   7789 C  CD1   . LEU C 3 897 ? 89.295  -77.241 -5.317  1.00 83.70  ? 897  LEU A CD1   1 
ATOM   7790 C  CD2   . LEU C 3 897 ? 89.025  -76.098 -7.535  1.00 88.41  ? 897  LEU A CD2   1 
ATOM   7791 N  N     . PHE C 3 898 ? 86.230  -80.690 -8.104  1.00 86.22  ? 898  PHE A N     1 
ATOM   7792 C  CA    . PHE C 3 898 ? 85.997  -82.098 -8.401  1.00 85.13  ? 898  PHE A CA    1 
ATOM   7793 C  C     . PHE C 3 898 ? 85.523  -82.427 -9.815  1.00 85.27  ? 898  PHE A C     1 
ATOM   7794 O  O     . PHE C 3 898 ? 85.866  -83.478 -10.353 1.00 84.55  ? 898  PHE A O     1 
ATOM   7795 C  CB    . PHE C 3 898 ? 85.025  -82.697 -7.385  1.00 82.28  ? 898  PHE A CB    1 
ATOM   7796 C  CG    . PHE C 3 898 ? 85.703  -83.363 -6.226  1.00 80.51  ? 898  PHE A CG    1 
ATOM   7797 C  CD1   . PHE C 3 898 ? 86.324  -84.593 -6.391  1.00 80.77  ? 898  PHE A CD1   1 
ATOM   7798 C  CD2   . PHE C 3 898 ? 85.725  -82.768 -4.972  1.00 78.68  ? 898  PHE A CD2   1 
ATOM   7799 C  CE1   . PHE C 3 898 ? 86.950  -85.216 -5.328  1.00 76.72  ? 898  PHE A CE1   1 
ATOM   7800 C  CE2   . PHE C 3 898 ? 86.353  -83.392 -3.907  1.00 74.22  ? 898  PHE A CE2   1 
ATOM   7801 C  CZ    . PHE C 3 898 ? 86.964  -84.615 -4.087  1.00 73.37  ? 898  PHE A CZ    1 
ATOM   7802 N  N     . ASP C 3 899 ? 84.748  -81.538 -10.425 1.00 88.99  ? 899  ASP A N     1 
ATOM   7803 C  CA    . ASP C 3 899 ? 84.242  -81.780 -11.774 1.00 92.24  ? 899  ASP A CA    1 
ATOM   7804 C  C     . ASP C 3 899 ? 85.330  -81.593 -12.836 1.00 89.97  ? 899  ASP A C     1 
ATOM   7805 O  O     . ASP C 3 899 ? 85.086  -81.046 -13.912 1.00 88.38  ? 899  ASP A O     1 
ATOM   7806 C  CB    . ASP C 3 899 ? 83.067  -80.845 -12.059 1.00 98.19  ? 899  ASP A CB    1 
ATOM   7807 C  CG    . ASP C 3 899 ? 83.510  -79.408 -12.275 1.00 105.66 ? 899  ASP A CG    1 
ATOM   7808 O  OD1   . ASP C 3 899 ? 84.436  -78.955 -11.567 1.00 107.78 ? 899  ASP A OD1   1 
ATOM   7809 O  OD2   . ASP C 3 899 ? 82.926  -78.736 -13.152 1.00 112.11 ? 899  ASP A OD2   1 
ATOM   7810 N  N     . MET C 3 900 ? 86.535  -82.043 -12.515 1.00 90.22  ? 900  MET A N     1 
ATOM   7811 C  CA    . MET C 3 900 ? 87.670  -81.957 -13.426 1.00 92.60  ? 900  MET A CA    1 
ATOM   7812 C  C     . MET C 3 900 ? 88.058  -83.410 -13.578 1.00 93.14  ? 900  MET A C     1 
ATOM   7813 O  O     . MET C 3 900 ? 88.565  -83.836 -14.619 1.00 91.37  ? 900  MET A O     1 
ATOM   7814 C  CB    . MET C 3 900 ? 88.797  -81.163 -12.784 1.00 94.47  ? 900  MET A CB    1 
ATOM   7815 C  CG    . MET C 3 900 ? 88.289  -79.951 -12.037 1.00 99.70  ? 900  MET A CG    1 
ATOM   7816 S  SD    . MET C 3 900 ? 88.339  -78.392 -12.909 1.00 106.16 ? 900  MET A SD    1 
ATOM   7817 C  CE    . MET C 3 900 ? 89.572  -77.525 -11.910 1.00 106.43 ? 900  MET A CE    1 
ATOM   7818 N  N     . PHE C 3 901 ? 87.818  -84.156 -12.500 1.00 97.23  ? 901  PHE A N     1 
ATOM   7819 C  CA    . PHE C 3 901 ? 88.043  -85.595 -12.461 1.00 99.96  ? 901  PHE A CA    1 
ATOM   7820 C  C     . PHE C 3 901 ? 86.775  -86.067 -13.109 1.00 103.01 ? 901  PHE A C     1 
ATOM   7821 O  O     . PHE C 3 901 ? 85.686  -85.840 -12.573 1.00 103.49 ? 901  PHE A O     1 
ATOM   7822 C  CB    . PHE C 3 901 ? 88.076  -86.124 -11.034 1.00 96.30  ? 901  PHE A CB    1 
ATOM   7823 C  CG    . PHE C 3 901 ? 89.343  -85.853 -10.334 1.00 93.25  ? 901  PHE A CG    1 
ATOM   7824 C  CD1   . PHE C 3 901 ? 90.392  -86.750 -10.435 1.00 93.84  ? 901  PHE A CD1   1 
ATOM   7825 C  CD2   . PHE C 3 901 ? 89.515  -84.681 -9.617  1.00 92.15  ? 901  PHE A CD2   1 
ATOM   7826 C  CE1   . PHE C 3 901 ? 91.600  -86.489 -9.837  1.00 99.10  ? 901  PHE A CE1   1 
ATOM   7827 C  CE2   . PHE C 3 901 ? 90.723  -84.403 -9.010  1.00 95.22  ? 901  PHE A CE2   1 
ATOM   7828 C  CZ    . PHE C 3 901 ? 91.772  -85.310 -9.120  1.00 99.33  ? 901  PHE A CZ    1 
ATOM   7829 N  N     . ASP C 3 902 ? 86.895  -86.708 -14.260 1.00 106.45 ? 902  ASP A N     1 
ATOM   7830 C  CA    . ASP C 3 902 ? 85.698  -87.135 -14.944 1.00 111.40 ? 902  ASP A CA    1 
ATOM   7831 C  C     . ASP C 3 902 ? 85.084  -88.390 -14.336 1.00 112.21 ? 902  ASP A C     1 
ATOM   7832 O  O     . ASP C 3 902 ? 84.917  -89.414 -15.005 1.00 111.55 ? 902  ASP A O     1 
ATOM   7833 C  CB    . ASP C 3 902 ? 85.993  -87.289 -16.438 1.00 113.94 ? 902  ASP A CB    1 
ATOM   7834 C  CG    . ASP C 3 902 ? 86.724  -86.066 -17.013 1.00 115.76 ? 902  ASP A CG    1 
ATOM   7835 O  OD1   . ASP C 3 902 ? 86.576  -84.952 -16.453 1.00 115.81 ? 902  ASP A OD1   1 
ATOM   7836 O  OD2   . ASP C 3 902 ? 87.441  -86.219 -18.023 1.00 117.19 ? 902  ASP A OD2   1 
ATOM   7837 N  N     . PHE C 3 903 ? 84.769  -88.285 -13.043 1.00 114.04 ? 903  PHE A N     1 
ATOM   7838 C  CA    . PHE C 3 903 ? 84.125  -89.358 -12.291 1.00 114.97 ? 903  PHE A CA    1 
ATOM   7839 C  C     . PHE C 3 903 ? 82.677  -89.394 -12.782 1.00 119.58 ? 903  PHE A C     1 
ATOM   7840 O  O     . PHE C 3 903 ? 81.785  -89.175 -11.929 1.00 122.09 ? 903  PHE A O     1 
ATOM   7841 C  CB    . PHE C 3 903 ? 84.077  -89.047 -10.791 1.00 109.34 ? 903  PHE A CB    1 
ATOM   7842 C  CG    . PHE C 3 903 ? 85.369  -89.230 -10.073 1.00 105.49 ? 903  PHE A CG    1 
ATOM   7843 C  CD1   . PHE C 3 903 ? 85.870  -90.501 -9.836  1.00 105.81 ? 903  PHE A CD1   1 
ATOM   7844 C  CD2   . PHE C 3 903 ? 86.047  -88.135 -9.558  1.00 100.92 ? 903  PHE A CD2   1 
ATOM   7845 C  CE1   . PHE C 3 903 ? 87.024  -90.678 -9.093  1.00 106.01 ? 903  PHE A CE1   1 
ATOM   7846 C  CE2   . PHE C 3 903 ? 87.201  -88.303 -8.813  1.00 102.99 ? 903  PHE A CE2   1 
ATOM   7847 C  CZ    . PHE C 3 903 ? 87.691  -89.580 -8.577  1.00 105.28 ? 903  PHE A CZ    1 
ATOM   7848 O  OXT   . PHE C 3 903 ? 82.451  -89.614 -13.995 1.00 122.09 ? 903  PHE A OXT   1 
HETATM 7849 CA CA    . CA  D 4 .   ? 46.416  -66.439 7.402   1.00 122.09 ? 1024 CA  E CA    1 
HETATM 7850 CA CA    . CA  E 4 .   ? 64.230  -55.627 40.768  1.00 73.36  ? 1003 CA  D CA    1 
HETATM 7851 CA CA    . CA  F 4 .   ? 42.350  -60.451 18.742  1.00 78.36  ? 1009 CA  D CA    1 
HETATM 7852 CA CA    . CA  G 4 .   ? 106.360 -28.356 43.742  1.00 63.81  ? 1001 CA  A CA    1 
HETATM 7853 CA CA    . CA  H 4 .   ? 65.964  -59.261 41.613  1.00 97.95  ? 1002 CA  A CA    1 
HETATM 7854 CA CA    . CA  I 4 .   ? 58.353  -46.732 32.610  1.00 58.60  ? 1004 CA  A CA    1 
HETATM 7855 CA CA    . CA  J 4 .   ? 80.529  -32.429 10.655  1.00 94.06  ? 1005 CA  A CA    1 
HETATM 7856 CA CA    . CA  K 4 .   ? 69.351  -14.163 1.382   1.00 107.85 ? 1006 CA  A CA    1 
HETATM 7857 CA CA    . CA  L 4 .   ? 73.161  -38.198 9.403   1.00 82.34  ? 1025 CA  A CA    1 
HETATM 7858 P  PB    . GDP M 5 .   ? 56.377  -6.158  36.928  1.00 122.09 ? 999  GDP A PB    1 
HETATM 7859 O  O1B   . GDP M 5 .   ? 56.599  -5.317  35.690  1.00 122.09 ? 999  GDP A O1B   1 
HETATM 7860 O  O2B   . GDP M 5 .   ? 57.565  -6.676  37.493  1.00 122.09 ? 999  GDP A O2B   1 
HETATM 7861 O  O3B   . GDP M 5 .   ? 55.404  -5.350  37.986  1.00 122.09 ? 999  GDP A O3B   1 
HETATM 7862 O  O3A   . GDP M 5 .   ? 55.577  -7.455  36.465  1.00 121.10 ? 999  GDP A O3A   1 
HETATM 7863 P  PA    . GDP M 5 .   ? 56.037  -9.063  36.576  1.00 115.23 ? 999  GDP A PA    1 
HETATM 7864 O  O1A   . GDP M 5 .   ? 57.245  -9.317  35.675  1.00 115.18 ? 999  GDP A O1A   1 
HETATM 7865 O  O2A   . GDP M 5 .   ? 56.260  -9.320  38.053  1.00 118.04 ? 999  GDP A O2A   1 
HETATM 7866 O  "O5'" . GDP M 5 .   ? 54.835  -9.744  35.940  1.00 105.58 ? 999  GDP A "O5'" 1 
HETATM 7867 C  "C5'" . GDP M 5 .   ? 54.798  -11.183 35.960  1.00 89.81  ? 999  GDP A "C5'" 1 
HETATM 7868 C  "C4'" . GDP M 5 .   ? 53.569  -11.785 36.408  1.00 80.14  ? 999  GDP A "C4'" 1 
HETATM 7869 O  "O4'" . GDP M 5 .   ? 52.859  -12.296 35.176  1.00 78.83  ? 999  GDP A "O4'" 1 
HETATM 7870 C  "C3'" . GDP M 5 .   ? 53.777  -13.103 37.233  1.00 76.99  ? 999  GDP A "C3'" 1 
HETATM 7871 O  "O3'" . GDP M 5 .   ? 52.583  -13.223 38.126  1.00 85.45  ? 999  GDP A "O3'" 1 
HETATM 7872 C  "C2'" . GDP M 5 .   ? 53.790  -14.246 36.159  1.00 76.70  ? 999  GDP A "C2'" 1 
HETATM 7873 O  "O2'" . GDP M 5 .   ? 53.628  -15.615 36.549  1.00 88.48  ? 999  GDP A "O2'" 1 
HETATM 7874 C  "C1'" . GDP M 5 .   ? 52.630  -13.775 35.271  1.00 68.46  ? 999  GDP A "C1'" 1 
HETATM 7875 N  N9    . GDP M 5 .   ? 52.515  -14.374 33.915  1.00 51.90  ? 999  GDP A N9    1 
HETATM 7876 C  C8    . GDP M 5 .   ? 51.654  -15.588 33.780  1.00 54.34  ? 999  GDP A C8    1 
HETATM 7877 N  N7    . GDP M 5 .   ? 51.863  -15.736 32.412  1.00 51.75  ? 999  GDP A N7    1 
HETATM 7878 C  C5    . GDP M 5 .   ? 52.628  -14.876 31.743  1.00 48.17  ? 999  GDP A C5    1 
HETATM 7879 C  C6    . GDP M 5 .   ? 53.180  -14.537 30.466  1.00 46.90  ? 999  GDP A C6    1 
HETATM 7880 O  O6    . GDP M 5 .   ? 52.824  -15.302 29.411  1.00 54.39  ? 999  GDP A O6    1 
HETATM 7881 N  N1    . GDP M 5 .   ? 53.989  -13.482 30.257  1.00 44.76  ? 999  GDP A N1    1 
HETATM 7882 C  C2    . GDP M 5 .   ? 54.374  -12.639 31.429  1.00 41.22  ? 999  GDP A C2    1 
HETATM 7883 N  N2    . GDP M 5 .   ? 55.160  -11.667 31.023  1.00 35.85  ? 999  GDP A N2    1 
HETATM 7884 N  N3    . GDP M 5 .   ? 53.921  -12.895 32.595  1.00 42.30  ? 999  GDP A N3    1 
HETATM 7885 C  C4    . GDP M 5 .   ? 53.126  -13.962 32.780  1.00 48.61  ? 999  GDP A C4    1 
HETATM 7886 O  O     . HOH N 6 .   ? 44.652  -48.942 27.582  1.00 53.20  ? 1025 HOH E O     1 
HETATM 7887 O  O     . HOH N 6 .   ? 50.305  -41.522 22.280  1.00 58.94  ? 1026 HOH E O     1 
HETATM 7888 O  O     . HOH N 6 .   ? 60.439  -51.083 28.627  1.00 48.50  ? 1027 HOH E O     1 
HETATM 7889 O  O     . HOH N 6 .   ? 48.300  -49.251 22.060  1.00 54.15  ? 1028 HOH E O     1 
HETATM 7890 O  O     . HOH N 6 .   ? 53.269  -69.005 14.595  1.00 52.99  ? 1029 HOH E O     1 
HETATM 7891 O  O     . HOH O 6 .   ? 53.129  -63.798 27.974  1.00 44.84  ? 1010 HOH D O     1 
HETATM 7892 O  O     . HOH O 6 .   ? 41.082  -55.880 13.711  1.00 59.76  ? 1011 HOH D O     1 
HETATM 7893 O  O     . HOH O 6 .   ? 51.774  -67.488 -4.827  1.00 58.48  ? 1012 HOH D O     1 
HETATM 7894 O  O     . HOH O 6 .   ? 60.567  -60.814 -1.023  1.00 52.49  ? 1013 HOH D O     1 
HETATM 7895 O  O     . HOH P 6 .   ? 46.482  -69.915 14.271  1.00 41.77  ? 1026 HOH A O     1 
HETATM 7896 O  O     . HOH P 6 .   ? 83.852  -26.415 5.933   1.00 51.56  ? 1027 HOH A O     1 
HETATM 7897 O  O     . HOH P 6 .   ? 60.459  -36.120 55.652  1.00 38.23  ? 1028 HOH A O     1 
HETATM 7898 O  O     . HOH P 6 .   ? 58.183  -41.604 31.930  1.00 52.34  ? 1029 HOH A O     1 
HETATM 7899 O  O     . HOH P 6 .   ? 59.417  -3.583  34.073  1.00 46.16  ? 1030 HOH A O     1 
HETATM 7900 O  O     . HOH P 6 .   ? 61.416  -26.896 56.877  1.00 47.52  ? 1031 HOH A O     1 
HETATM 7901 O  O     . HOH P 6 .   ? 50.158  -23.227 2.459   1.00 40.55  ? 1032 HOH A O     1 
HETATM 7902 O  O     . HOH P 6 .   ? 64.438  -41.804 -5.014  1.00 45.48  ? 1033 HOH A O     1 
HETATM 7903 O  O     . HOH P 6 .   ? 80.238  -46.730 46.583  1.00 36.71  ? 1034 HOH A O     1 
HETATM 7904 O  O     . HOH P 6 .   ? 89.616  -57.323 11.778  1.00 56.70  ? 1035 HOH A O     1 
HETATM 7905 O  O     . HOH P 6 .   ? 57.015  -33.736 24.122  1.00 48.64  ? 1036 HOH A O     1 
HETATM 7906 O  O     . HOH P 6 .   ? 69.520  -81.088 11.309  1.00 44.73  ? 1037 HOH A O     1 
HETATM 7907 O  O     . HOH P 6 .   ? 83.379  -50.672 30.397  1.00 58.49  ? 1038 HOH A O     1 
HETATM 7908 O  O     . HOH P 6 .   ? 61.234  -42.849 2.294   1.00 57.55  ? 1039 HOH A O     1 
HETATM 7909 O  O     . HOH P 6 .   ? 66.076  -46.831 59.824  1.00 52.73  ? 1040 HOH A O     1 
HETATM 7910 O  O     . HOH P 6 .   ? 61.555  -71.509 14.114  1.00 45.89  ? 1041 HOH A O     1 
HETATM 7911 O  O     . HOH P 6 .   ? 89.459  -23.186 49.851  1.00 54.53  ? 1042 HOH A O     1 
HETATM 7912 O  O     . HOH P 6 .   ? 68.042  -20.851 34.099  1.00 42.46  ? 1043 HOH A O     1 
HETATM 7913 O  O     . HOH P 6 .   ? 71.943  -54.041 12.157  1.00 62.14  ? 1044 HOH A O     1 
HETATM 7914 O  O     . HOH P 6 .   ? 63.780  -36.524 55.076  1.00 57.39  ? 1045 HOH A O     1 
HETATM 7915 O  O     . HOH P 6 .   ? 43.649  -9.788  43.667  1.00 44.33  ? 1046 HOH A O     1 
HETATM 7916 O  O     . HOH P 6 .   ? 74.908  -62.976 -7.436  1.00 58.74  ? 1047 HOH A O     1 
HETATM 7917 O  O     . HOH P 6 .   ? 76.847  -43.682 8.121   1.00 41.90  ? 1048 HOH A O     1 
HETATM 7918 O  O     . HOH P 6 .   ? 58.148  -80.122 11.838  1.00 50.11  ? 1049 HOH A O     1 
HETATM 7919 O  O     . HOH P 6 .   ? 55.522  -3.824  20.889  1.00 52.73  ? 1050 HOH A O     1 
HETATM 7920 O  O     . HOH P 6 .   ? 83.139  -44.048 34.454  1.00 54.11  ? 1051 HOH A O     1 
HETATM 7921 O  O     . HOH P 6 .   ? 85.164  -22.792 39.381  1.00 56.82  ? 1052 HOH A O     1 
HETATM 7922 O  O     . HOH P 6 .   ? 83.419  -51.584 34.808  1.00 53.65  ? 1053 HOH A O     1 
HETATM 7923 O  O     . HOH P 6 .   ? 74.470  -38.906 37.172  1.00 56.43  ? 1054 HOH A O     1 
HETATM 7924 O  O     . HOH P 6 .   ? 74.727  -14.981 6.101   1.00 57.56  ? 1055 HOH A O     1 
HETATM 7925 O  O     . HOH P 6 .   ? 73.989  -36.570 -13.475 1.00 60.59  ? 1056 HOH A O     1 
HETATM 7926 O  O     . HOH P 6 .   ? 73.813  -37.768 41.749  1.00 27.48  ? 1057 HOH A O     1 
HETATM 7927 O  O     . HOH P 6 .   ? 54.277  -40.309 37.373  1.00 48.85  ? 1058 HOH A O     1 
HETATM 7928 O  O     . HOH P 6 .   ? 46.753  -16.169 15.174  1.00 49.43  ? 1059 HOH A O     1 
HETATM 7929 O  O     . HOH P 6 .   ? 41.682  -74.649 28.689  1.00 55.36  ? 1060 HOH A O     1 
HETATM 7930 O  O     . HOH P 6 .   ? 64.661  -49.855 8.472   1.00 55.90  ? 1061 HOH A O     1 
HETATM 7931 O  O     . HOH P 6 .   ? 39.515  -17.213 20.793  1.00 50.48  ? 1062 HOH A O     1 
HETATM 7932 O  O     . HOH P 6 .   ? 60.166  -37.338 23.304  1.00 46.01  ? 1063 HOH A O     1 
HETATM 7933 O  O     . HOH P 6 .   ? 80.845  -25.496 44.910  1.00 58.43  ? 1064 HOH A O     1 
HETATM 7934 O  O     . HOH P 6 .   ? 40.340  -27.313 13.364  1.00 56.47  ? 1065 HOH A O     1 
HETATM 7935 O  O     . HOH P 6 .   ? 58.746  -46.335 26.248  1.00 55.19  ? 1066 HOH A O     1 
HETATM 7936 O  O     . HOH P 6 .   ? 92.053  -28.978 -7.734  1.00 56.53  ? 1067 HOH A O     1 
HETATM 7937 O  O     . HOH P 6 .   ? 57.608  -34.052 42.224  1.00 56.57  ? 1068 HOH A O     1 
HETATM 7938 O  O     . HOH P 6 .   ? 83.968  -52.752 13.405  1.00 55.21  ? 1069 HOH A O     1 
HETATM 7939 O  O     . HOH P 6 .   ? 62.191  -4.665  31.594  1.00 56.41  ? 1070 HOH A O     1 
HETATM 7940 O  O     . HOH P 6 .   ? 72.242  -38.108 12.288  1.00 53.73  ? 1071 HOH A O     1 
HETATM 7941 O  O     . HOH P 6 .   ? 86.958  -16.576 42.501  1.00 57.08  ? 1072 HOH A O     1 
HETATM 7942 O  O     . HOH P 6 .   ? 51.304  -34.140 16.510  1.00 47.03  ? 1073 HOH A O     1 
HETATM 7943 O  O     . HOH P 6 .   ? 91.689  -46.704 -14.512 1.00 49.27  ? 1074 HOH A O     1 
HETATM 7944 O  O     . HOH P 6 .   ? 64.254  -18.904 46.852  1.00 53.85  ? 1075 HOH A O     1 
HETATM 7945 O  O     . HOH P 6 .   ? 87.942  -54.739 10.554  1.00 42.10  ? 1076 HOH A O     1 
HETATM 7946 O  O     . HOH P 6 .   ? 91.880  -48.231 15.668  1.00 51.73  ? 1077 HOH A O     1 
HETATM 7947 O  O     . HOH P 6 .   ? 63.496  -33.291 17.019  1.00 46.57  ? 1078 HOH A O     1 
HETATM 7948 O  O     . HOH P 6 .   ? 55.853  -85.584 13.686  1.00 38.24  ? 1079 HOH A O     1 
HETATM 7949 O  O     . HOH P 6 .   ? 57.141  -34.595 10.732  1.00 44.01  ? 1080 HOH A O     1 
HETATM 7950 O  O     . HOH P 6 .   ? 70.798  -21.499 42.567  1.00 53.88  ? 1081 HOH A O     1 
HETATM 7951 O  O     . HOH P 6 .   ? 69.871  -55.657 14.939  1.00 42.68  ? 1082 HOH A O     1 
HETATM 7952 O  O     . HOH P 6 .   ? 51.650  -30.308 40.796  1.00 40.62  ? 1083 HOH A O     1 
HETATM 7953 O  O     . HOH P 6 .   ? 65.910  -70.650 3.928   1.00 46.27  ? 1084 HOH A O     1 
HETATM 7954 O  O     . HOH P 6 .   ? 81.540  -25.167 36.714  1.00 50.18  ? 1085 HOH A O     1 
HETATM 7955 O  O     . HOH P 6 .   ? 68.002  -31.717 12.412  1.00 52.95  ? 1086 HOH A O     1 
HETATM 7956 O  O     . HOH P 6 .   ? 64.779  -22.622 61.100  1.00 58.20  ? 1087 HOH A O     1 
HETATM 7957 O  O     . HOH P 6 .   ? 56.364  -28.915 34.900  1.00 56.50  ? 1088 HOH A O     1 
HETATM 7958 O  O     . HOH P 6 .   ? 66.869  -34.987 21.742  1.00 56.82  ? 1089 HOH A O     1 
HETATM 7959 O  O     . HOH P 6 .   ? 79.327  -44.417 27.443  1.00 56.61  ? 1090 HOH A O     1 
HETATM 7960 O  O     . HOH P 6 .   ? 76.599  -43.302 40.913  1.00 46.88  ? 1091 HOH A O     1 
HETATM 7961 O  O     . HOH P 6 .   ? 97.131  -21.190 32.196  1.00 29.89  ? 1092 HOH A O     1 
HETATM 7962 O  O     . HOH P 6 .   ? 50.208  -12.328 7.309   1.00 49.19  ? 1093 HOH A O     1 
HETATM 7963 O  O     . HOH P 6 .   ? 73.527  -70.566 43.910  1.00 51.90  ? 1094 HOH A O     1 
HETATM 7964 O  O     . HOH P 6 .   ? 76.007  -52.424 14.078  1.00 55.58  ? 1095 HOH A O     1 
HETATM 7965 O  O     . HOH P 6 .   ? 45.316  -21.065 7.948   1.00 56.07  ? 1096 HOH A O     1 
HETATM 7966 O  O     . HOH P 6 .   ? 62.223  -49.125 3.252   1.00 47.15  ? 1097 HOH A O     1 
HETATM 7967 O  O     . HOH P 6 .   ? 74.460  -68.308 23.974  1.00 44.59  ? 1098 HOH A O     1 
HETATM 7968 O  O     . HOH P 6 .   ? 55.334  -16.976 -7.168  1.00 62.10  ? 1099 HOH A O     1 
HETATM 7969 O  O     . HOH P 6 .   ? 41.822  -23.120 16.898  1.00 55.04  ? 1100 HOH A O     1 
HETATM 7970 O  O     . HOH P 6 .   ? 45.334  -36.290 41.735  1.00 57.69  ? 1101 HOH A O     1 
HETATM 7971 O  O     . HOH P 6 .   ? 68.820  -33.760 53.478  1.00 53.76  ? 1102 HOH A O     1 
HETATM 7972 O  O     . HOH P 6 .   ? 92.538  -23.460 -9.973  1.00 49.70  ? 1103 HOH A O     1 
HETATM 7973 O  O     . HOH P 6 .   ? 84.605  -43.679 48.661  1.00 57.18  ? 1104 HOH A O     1 
HETATM 7974 O  O     . HOH P 6 .   ? 52.469  -77.863 39.299  1.00 49.17  ? 1105 HOH A O     1 
HETATM 7975 O  O     . HOH P 6 .   ? 63.125  -12.086 20.331  1.00 53.09  ? 1106 HOH A O     1 
HETATM 7976 O  O     . HOH P 6 .   ? 36.950  -7.287  34.784  1.00 61.01  ? 1107 HOH A O     1 
HETATM 7977 O  O     . HOH P 6 .   ? 82.471  -46.443 55.830  1.00 55.52  ? 1108 HOH A O     1 
HETATM 7978 O  O     . HOH P 6 .   ? 79.520  -29.838 43.483  1.00 47.24  ? 1109 HOH A O     1 
HETATM 7979 O  O     . HOH P 6 .   ? 92.577  -34.354 12.629  1.00 55.33  ? 1110 HOH A O     1 
HETATM 7980 O  O     . HOH P 6 .   ? 63.480  -37.901 23.400  1.00 61.52  ? 1111 HOH A O     1 
HETATM 7981 O  O     . HOH P 6 .   ? 68.671  -59.784 4.803   1.00 55.67  ? 1112 HOH A O     1 
HETATM 7982 O  O     . HOH P 6 .   ? 67.434  -59.678 -3.534  1.00 50.82  ? 1113 HOH A O     1 
HETATM 7983 O  O     . HOH P 6 .   ? 97.288  -30.695 1.829   1.00 54.67  ? 1114 HOH A O     1 
HETATM 7984 O  O     . HOH P 6 .   ? 45.766  -29.874 6.299   1.00 58.18  ? 1115 HOH A O     1 
HETATM 7985 O  O     . HOH P 6 .   ? 58.250  -18.290 47.620  1.00 43.26  ? 1116 HOH A O     1 
HETATM 7986 O  O     . HOH P 6 .   ? 60.202  -47.527 -1.015  1.00 57.10  ? 1117 HOH A O     1 
HETATM 7987 O  O     . HOH P 6 .   ? 78.105  -29.599 54.564  1.00 62.30  ? 1118 HOH A O     1 
HETATM 7988 O  O     . HOH P 6 .   ? 60.500  -22.654 54.875  1.00 38.07  ? 1119 HOH A O     1 
HETATM 7989 O  O     . HOH P 6 .   ? 68.347  -73.154 59.030  1.00 59.17  ? 1120 HOH A O     1 
HETATM 7990 O  O     . HOH P 6 .   ? 81.059  -47.146 36.386  1.00 58.05  ? 1121 HOH A O     1 
HETATM 7991 O  O     . HOH P 6 .   ? 68.501  -78.911 30.484  1.00 47.85  ? 1122 HOH A O     1 
HETATM 7992 O  O     . HOH P 6 .   ? 93.114  -22.465 -7.445  1.00 49.00  ? 1123 HOH A O     1 
HETATM 7993 O  O     . HOH P 6 .   ? 92.508  -18.597 36.667  1.00 66.68  ? 1124 HOH A O     1 
HETATM 7994 O  O     . HOH P 6 .   ? 81.381  -35.106 44.814  1.00 55.84  ? 1125 HOH A O     1 
HETATM 7995 O  O     . HOH P 6 .   ? 65.202  -34.088 4.057   1.00 42.42  ? 1126 HOH A O     1 
HETATM 7996 O  O     . HOH P 6 .   ? 77.728  -48.461 -8.675  1.00 50.53  ? 1127 HOH A O     1 
HETATM 7997 O  O     . HOH P 6 .   ? 70.912  -12.625 11.923  1.00 56.54  ? 1128 HOH A O     1 
HETATM 7998 O  O     . HOH P 6 .   ? 97.384  -36.540 -1.285  1.00 45.73  ? 1129 HOH A O     1 
HETATM 7999 O  O     . HOH P 6 .   ? 84.096  -27.134 20.639  1.00 54.82  ? 1130 HOH A O     1 
HETATM 8000 O  O     . HOH P 6 .   ? 73.477  -27.055 7.904   1.00 43.03  ? 1131 HOH A O     1 
HETATM 8001 O  O     . HOH P 6 .   ? 58.038  -32.333 -7.998  1.00 50.14  ? 1132 HOH A O     1 
HETATM 8002 O  O     . HOH P 6 .   ? 54.536  -9.763  14.378  1.00 60.18  ? 1133 HOH A O     1 
HETATM 8003 O  O     . HOH P 6 .   ? 70.583  -22.764 35.157  1.00 58.75  ? 1134 HOH A O     1 
HETATM 8004 O  O     . HOH P 6 .   ? 38.157  -11.116 20.215  1.00 60.12  ? 1135 HOH A O     1 
HETATM 8005 O  O     . HOH P 6 .   ? 72.870  -56.525 62.586  1.00 58.12  ? 1136 HOH A O     1 
HETATM 8006 O  O     . HOH P 6 .   ? 94.536  -61.638 -7.791  1.00 53.50  ? 1137 HOH A O     1 
HETATM 8007 O  O     . HOH P 6 .   ? 75.238  -43.328 -13.834 1.00 65.30  ? 1138 HOH A O     1 
HETATM 8008 O  O     . HOH P 6 .   ? 89.428  -44.389 -15.519 1.00 55.12  ? 1139 HOH A O     1 
HETATM 8009 O  O     . HOH P 6 .   ? 51.028  -17.950 50.967  1.00 44.14  ? 1140 HOH A O     1 
HETATM 8010 O  O     . HOH P 6 .   ? 51.071  -29.618 30.610  1.00 44.13  ? 1141 HOH A O     1 
HETATM 8011 O  O     . HOH P 6 .   ? 71.364  -25.311 35.103  1.00 48.82  ? 1142 HOH A O     1 
HETATM 8012 O  O     . HOH P 6 .   ? 61.970  -12.318 -7.643  1.00 52.10  ? 1143 HOH A O     1 
HETATM 8013 O  O     . HOH P 6 .   ? 71.795  -14.920 20.594  1.00 56.66  ? 1144 HOH A O     1 
HETATM 8014 O  O     . HOH P 6 .   ? 97.778  -27.462 30.077  1.00 45.43  ? 1145 HOH A O     1 
HETATM 8015 O  O     . HOH P 6 .   ? 99.708  -22.907 30.871  1.00 54.68  ? 1146 HOH A O     1 
HETATM 8016 O  O     . HOH P 6 .   ? 82.348  -42.581 -9.317  1.00 48.87  ? 1147 HOH A O     1 
HETATM 8017 O  O     . HOH P 6 .   ? 52.075  -85.099 34.492  1.00 58.31  ? 1148 HOH A O     1 
HETATM 8018 O  O     . HOH P 6 .   ? 69.355  -46.095 -13.053 1.00 51.41  ? 1149 HOH A O     1 
HETATM 8019 O  O     . HOH P 6 .   ? 74.191  -35.916 11.174  1.00 52.37  ? 1150 HOH A O     1 
HETATM 8020 O  O     . HOH P 6 .   ? 74.283  -36.265 18.895  1.00 52.65  ? 1151 HOH A O     1 
HETATM 8021 O  O     . HOH P 6 .   ? 84.281  -67.303 54.391  1.00 54.76  ? 1152 HOH A O     1 
HETATM 8022 O  O     . HOH P 6 .   ? 48.851  -14.643 -2.986  1.00 57.25  ? 1153 HOH A O     1 
HETATM 8023 O  O     . HOH P 6 .   ? 84.856  -62.464 55.566  1.00 54.07  ? 1154 HOH A O     1 
HETATM 8024 O  O     . HOH P 6 .   ? 60.402  -42.721 34.929  1.00 55.01  ? 1155 HOH A O     1 
HETATM 8025 O  O     . HOH P 6 .   ? 63.545  -69.043 15.129  1.00 57.54  ? 1156 HOH A O     1 
HETATM 8026 O  O     . HOH P 6 .   ? 86.368  -36.346 32.954  1.00 56.83  ? 1157 HOH A O     1 
HETATM 8027 O  O     . HOH P 6 .   ? 79.650  -55.420 40.128  1.00 61.56  ? 1158 HOH A O     1 
HETATM 8028 O  O     . HOH P 6 .   ? 53.282  -84.233 39.844  1.00 52.81  ? 1159 HOH A O     1 
HETATM 8029 O  O     . HOH P 6 .   ? 42.832  -36.870 38.114  1.00 57.85  ? 1160 HOH A O     1 
HETATM 8030 O  O     . HOH P 6 .   ? 83.735  -45.981 47.297  1.00 59.71  ? 1161 HOH A O     1 
HETATM 8031 O  O     . HOH P 6 .   ? 68.116  -50.457 41.783  1.00 40.25  ? 1162 HOH A O     1 
HETATM 8032 O  O     . HOH P 6 .   ? 78.160  -50.359 13.312  1.00 50.26  ? 1163 HOH A O     1 
HETATM 8033 O  O     . HOH P 6 .   ? 72.037  -83.862 16.192  1.00 47.69  ? 1164 HOH A O     1 
HETATM 8034 O  O     . HOH P 6 .   ? 87.587  -26.589 -8.596  1.00 45.17  ? 1165 HOH A O     1 
HETATM 8035 O  O     . HOH P 6 .   ? 73.743  -31.159 16.862  1.00 53.68  ? 1166 HOH A O     1 
HETATM 8036 O  O     . HOH P 6 .   ? 79.573  -16.271 35.426  1.00 63.16  ? 1167 HOH A O     1 
HETATM 8037 O  O     . HOH P 6 .   ? 55.717  -31.302 -5.731  1.00 54.82  ? 1168 HOH A O     1 
HETATM 8038 O  O     . HOH P 6 .   ? 78.452  -50.089 21.051  1.00 61.85  ? 1169 HOH A O     1 
HETATM 8039 O  O     . HOH P 6 .   ? 57.033  -89.302 25.650  1.00 54.45  ? 1170 HOH A O     1 
HETATM 8040 O  O     . HOH P 6 .   ? 47.836  -25.080 12.951  1.00 52.64  ? 1171 HOH A O     1 
HETATM 8041 O  O     . HOH P 6 .   ? 58.695  -68.526 11.036  1.00 56.51  ? 1172 HOH A O     1 
HETATM 8042 O  O     . HOH P 6 .   ? 62.551  -7.427  2.659   1.00 54.91  ? 1173 HOH A O     1 
HETATM 8043 O  O     . HOH P 6 .   ? 88.044  -61.319 13.017  1.00 60.91  ? 1174 HOH A O     1 
HETATM 8044 O  O     . HOH P 6 .   ? 75.913  -17.191 13.429  1.00 51.31  ? 1175 HOH A O     1 
HETATM 8045 O  O     . HOH P 6 .   ? 36.258  -25.938 34.646  1.00 61.87  ? 1176 HOH A O     1 
HETATM 8046 O  O     . HOH P 6 .   ? 50.892  -47.941 61.931  1.00 58.60  ? 1177 HOH A O     1 
HETATM 8047 O  O     . HOH P 6 .   ? 86.494  -26.061 3.284   1.00 42.73  ? 1178 HOH A O     1 
HETATM 8048 O  O     . HOH P 6 .   ? 61.340  -51.086 24.542  1.00 46.70  ? 1179 HOH A O     1 
HETATM 8049 O  O     . HOH P 6 .   ? 71.833  -15.044 37.177  1.00 35.57  ? 1180 HOH A O     1 
HETATM 8050 O  O     . HOH P 6 .   ? 48.319  -24.897 36.327  1.00 47.52  ? 1181 HOH A O     1 
HETATM 8051 O  O     . HOH P 6 .   ? 78.547  -53.050 -10.116 1.00 49.93  ? 1182 HOH A O     1 
HETATM 8052 O  O     . HOH P 6 .   ? 63.324  -5.541  -1.171  1.00 48.73  ? 1183 HOH A O     1 
HETATM 8053 O  O     . HOH P 6 .   ? 55.544  -21.166 54.710  1.00 57.40  ? 1184 HOH A O     1 
HETATM 8054 O  O     . HOH P 6 .   ? 63.268  -53.342 39.702  1.00 53.38  ? 1185 HOH A O     1 
HETATM 8055 O  O     . HOH P 6 .   ? 59.676  -21.767 34.649  1.00 33.05  ? 1186 HOH A O     1 
HETATM 8056 O  O     . HOH P 6 .   ? 84.219  -53.495 40.859  1.00 56.17  ? 1187 HOH A O     1 
HETATM 8057 O  O     . HOH P 6 .   ? 56.020  -42.590 39.784  1.00 44.27  ? 1188 HOH A O     1 
HETATM 8058 O  O     . HOH P 6 .   ? 47.693  -26.565 33.050  1.00 58.13  ? 1189 HOH A O     1 
HETATM 8059 O  O     . HOH P 6 .   ? 84.942  -19.081 42.547  1.00 52.79  ? 1190 HOH A O     1 
HETATM 8060 O  O     . HOH P 6 .   ? 68.962  -47.478 60.857  1.00 54.05  ? 1191 HOH A O     1 
HETATM 8061 O  O     . HOH P 6 .   ? 48.707  -15.319 6.651   1.00 49.42  ? 1192 HOH A O     1 
HETATM 8062 O  O     . HOH P 6 .   ? 68.342  -60.847 -7.032  1.00 50.12  ? 1193 HOH A O     1 
HETATM 8063 O  O     . HOH P 6 .   ? 39.131  -32.641 13.234  1.00 49.97  ? 1194 HOH A O     1 
HETATM 8064 O  O     . HOH P 6 .   ? 45.319  -59.239 48.589  1.00 48.26  ? 1195 HOH A O     1 
HETATM 8065 O  O     . HOH P 6 .   ? 97.871  -27.477 -1.807  1.00 52.76  ? 1196 HOH A O     1 
HETATM 8066 O  O     . HOH P 6 .   ? 91.301  -50.565 -2.617  1.00 49.22  ? 1197 HOH A O     1 
HETATM 8067 O  O     . HOH P 6 .   ? 100.641 -40.534 -16.519 1.00 54.11  ? 1198 HOH A O     1 
HETATM 8068 O  O     . HOH P 6 .   ? 38.070  -26.143 41.335  1.00 49.48  ? 1199 HOH A O     1 
HETATM 8069 O  O     . HOH P 6 .   ? 42.565  -49.956 30.472  1.00 58.55  ? 1200 HOH A O     1 
HETATM 8070 O  O     . HOH P 6 .   ? 73.978  -24.405 49.006  1.00 52.86  ? 1201 HOH A O     1 
HETATM 8071 O  O     . HOH P 6 .   ? 57.035  -30.284 46.378  1.00 49.51  ? 1202 HOH A O     1 
HETATM 8072 O  O     . HOH P 6 .   ? 75.888  -59.806 58.205  1.00 57.84  ? 1203 HOH A O     1 
HETATM 8073 O  O     . HOH P 6 .   ? 61.897  -42.352 -2.859  1.00 53.05  ? 1204 HOH A O     1 
HETATM 8074 O  O     . HOH P 6 .   ? 84.207  -51.525 52.126  1.00 55.80  ? 1205 HOH A O     1 
HETATM 8075 O  O     . HOH P 6 .   ? 76.662  -23.882 -7.737  1.00 50.25  ? 1206 HOH A O     1 
HETATM 8076 O  O     . HOH P 6 .   ? 72.936  -15.144 23.583  1.00 49.05  ? 1207 HOH A O     1 
HETATM 8077 O  O     . HOH P 6 .   ? 78.478  -45.073 -15.752 1.00 54.67  ? 1208 HOH A O     1 
HETATM 8078 O  O     . HOH P 6 .   ? 48.335  -4.032  32.743  1.00 44.85  ? 1209 HOH A O     1 
HETATM 8079 O  O     . HOH P 6 .   ? 51.600  -80.574 33.672  1.00 58.95  ? 1210 HOH A O     1 
HETATM 8080 O  O     . HOH P 6 .   ? 46.003  -31.839 40.654  1.00 60.97  ? 1211 HOH A O     1 
HETATM 8081 O  O     . HOH P 6 .   ? 90.996  -33.640 8.707   1.00 67.89  ? 1212 HOH A O     1 
HETATM 8082 O  O     . HOH P 6 .   ? 86.218  -36.954 37.049  1.00 65.04  ? 1213 HOH A O     1 
HETATM 8083 O  O     . HOH P 6 .   ? 57.676  -79.318 38.796  1.00 50.32  ? 1214 HOH A O     1 
HETATM 8084 O  O     . HOH P 6 .   ? 61.690  -31.536 40.733  1.00 40.12  ? 1215 HOH A O     1 
HETATM 8085 O  O     . HOH P 6 .   ? 68.809  -12.956 31.448  1.00 57.92  ? 1216 HOH A O     1 
HETATM 8086 O  O     . HOH P 6 .   ? 41.526  -11.606 25.335  1.00 44.20  ? 1217 HOH A O     1 
HETATM 8087 O  O     . HOH P 6 .   ? 66.022  -12.102 23.376  1.00 55.98  ? 1218 HOH A O     1 
HETATM 8088 O  O     . HOH P 6 .   ? 97.644  -57.065 -4.614  1.00 45.76  ? 1219 HOH A O     1 
HETATM 8089 O  O     . HOH P 6 .   ? 40.759  -10.104 40.088  1.00 48.90  ? 1220 HOH A O     1 
HETATM 8090 O  O     . HOH P 6 .   ? 69.749  -44.129 6.639   1.00 52.39  ? 1221 HOH A O     1 
HETATM 8091 O  O     . HOH P 6 .   ? 41.254  -12.463 21.707  1.00 52.64  ? 1222 HOH A O     1 
HETATM 8092 O  O     . HOH P 6 .   ? 76.430  -17.494 25.901  1.00 55.98  ? 1223 HOH A O     1 
HETATM 8093 O  O     . HOH P 6 .   ? 52.280  -14.576 45.297  1.00 56.07  ? 1224 HOH A O     1 
HETATM 8094 O  O     . HOH P 6 .   ? 71.800  -30.685 -13.408 1.00 51.20  ? 1225 HOH A O     1 
HETATM 8095 O  O     . HOH P 6 .   ? 79.378  -24.902 33.027  1.00 51.57  ? 1226 HOH A O     1 
HETATM 8096 O  O     . HOH P 6 .   ? 37.533  -19.530 19.368  1.00 52.15  ? 1227 HOH A O     1 
HETATM 8097 O  O     . HOH P 6 .   ? 64.169  -29.105 -15.512 1.00 53.50  ? 1228 HOH A O     1 
HETATM 8098 O  O     . HOH P 6 .   ? 55.849  -20.745 26.766  1.00 51.66  ? 1229 HOH A O     1 
HETATM 8099 O  O     . HOH P 6 .   ? 46.208  -19.684 45.331  1.00 44.01  ? 1230 HOH A O     1 
HETATM 8100 O  O     . HOH P 6 .   ? 43.262  -11.434 19.437  1.00 60.03  ? 1231 HOH A O     1 
HETATM 8101 O  O     . HOH P 6 .   ? 54.797  -12.868 -3.589  1.00 47.67  ? 1232 HOH A O     1 
HETATM 8102 O  O     . HOH P 6 .   ? 88.764  -22.787 25.838  1.00 54.18  ? 1233 HOH A O     1 
HETATM 8103 O  O     . HOH P 6 .   ? 51.414  -25.605 -10.652 1.00 51.30  ? 1234 HOH A O     1 
HETATM 8104 O  O     . HOH P 6 .   ? 85.255  -26.188 -5.991  1.00 47.19  ? 1235 HOH A O     1 
HETATM 8105 O  O     . HOH P 6 .   ? 68.845  -61.558 10.463  1.00 54.56  ? 1236 HOH A O     1 
HETATM 8106 O  O     . HOH P 6 .   ? 47.025  -11.286 18.563  1.00 50.05  ? 1237 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   2   2   DG  G   E . n 
A 1 2   DC  2   3   3   DC  C   E . n 
A 1 3   DG  3   4   4   DG  G   E . n 
A 1 4   DG  4   5   5   DG  G   E . n 
A 1 5   DA  5   6   6   DA  A   E . n 
A 1 6   DA  6   7   7   DA  A   E . n 
A 1 7   DC  7   8   8   DC  C   E . n 
A 1 8   DT  8   9   9   DT  T   E . n 
A 1 9   DA  9   10  10  DA  A   E . n 
A 1 10  DC  10  11  11  DC  C   E . n 
A 1 11  DT  11  12  12  DT  T   E . n 
B 2 1   DA  1   12  12  DA  A   D . n 
B 2 2   DG  2   11  11  DG  G   D . n 
B 2 3   DT  3   10  10  DT  T   D . n 
B 2 4   DA  4   9   9   DA  A   D . n 
B 2 5   DG  5   8   8   DG  G   D . n 
B 2 6   DT  6   7   7   DT  T   D . n 
B 2 7   DT  7   6   6   DT  T   D . n 
B 2 8   DC  8   5   5   DC  C   D . n 
B 2 9   DC  9   4   4   DC  C   D . n 
B 2 10  DG  10  3   3   DG  G   D . n 
B 2 11  DC  11  2   2   DC  C   D . n 
B 2 12  DG  12  1   1   DG  G   D . n 
C 3 1   MET 1   1   1   MET MET A . n 
C 3 2   LYS 2   2   2   LYS LYS A . n 
C 3 3   GLU 3   3   3   GLU GLU A . n 
C 3 4   PHE 4   4   4   PHE PHE A . n 
C 3 5   TYR 5   5   5   TYR TYR A . n 
C 3 6   LEU 6   6   6   LEU LEU A . n 
C 3 7   THR 7   7   7   THR THR A . n 
C 3 8   VAL 8   8   8   VAL VAL A . n 
C 3 9   GLU 9   9   9   GLU GLU A . n 
C 3 10  GLN 10  10  10  GLN GLN A . n 
C 3 11  ILE 11  11  11  ILE ILE A . n 
C 3 12  GLY 12  12  12  GLY GLY A . n 
C 3 13  ASP 13  13  13  ASP ASP A . n 
C 3 14  SER 14  14  14  SER SER A . n 
C 3 15  ILE 15  15  15  ILE ILE A . n 
C 3 16  PHE 16  16  16  PHE PHE A . n 
C 3 17  GLU 17  17  17  GLU GLU A . n 
C 3 18  ARG 18  18  18  ARG ARG A . n 
C 3 19  TYR 19  19  19  TYR TYR A . n 
C 3 20  ILE 20  20  20  ILE ILE A . n 
C 3 21  ASP 21  21  21  ASP ASP A . n 
C 3 22  SER 22  22  22  SER SER A . n 
C 3 23  ASN 23  23  23  ASN ASN A . n 
C 3 24  GLY 24  24  24  GLY GLY A . n 
C 3 25  ARG 25  25  25  ARG ARG A . n 
C 3 26  GLU 26  26  26  GLU GLU A . n 
C 3 27  ARG 27  27  27  ARG ARG A . n 
C 3 28  THR 28  28  28  THR THR A . n 
C 3 29  ARG 29  29  29  ARG ARG A . n 
C 3 30  GLU 30  30  30  GLU GLU A . n 
C 3 31  VAL 31  31  31  VAL VAL A . n 
C 3 32  GLU 32  32  32  GLU GLU A . n 
C 3 33  TYR 33  33  33  TYR TYR A . n 
C 3 34  LYS 34  34  34  LYS LYS A . n 
C 3 35  PRO 35  35  35  PRO PRO A . n 
C 3 36  SER 36  36  36  SER SER A . n 
C 3 37  LEU 37  37  37  LEU LEU A . n 
C 3 38  PHE 38  38  38  PHE PHE A . n 
C 3 39  ALA 39  39  39  ALA ALA A . n 
C 3 40  HIS 40  40  40  HIS HIS A . n 
C 3 41  CYS 41  41  41  CYS CYS A . n 
C 3 42  PRO 42  42  42  PRO PRO A . n 
C 3 43  GLU 43  43  43  GLU GLU A . n 
C 3 44  SER 44  44  44  SER SER A . n 
C 3 45  GLN 45  45  45  GLN GLN A . n 
C 3 46  ALA 46  46  46  ALA ALA A . n 
C 3 47  THR 47  47  47  THR THR A . n 
C 3 48  LYS 48  48  48  LYS LYS A . n 
C 3 49  TYR 49  49  49  TYR TYR A . n 
C 3 50  PHE 50  50  50  PHE PHE A . n 
C 3 51  ASP 51  51  51  ASP ASP A . n 
C 3 52  ILE 52  52  52  ILE ILE A . n 
C 3 53  TYR 53  53  53  TYR TYR A . n 
C 3 54  GLY 54  54  54  GLY GLY A . n 
C 3 55  LYS 55  55  55  LYS LYS A . n 
C 3 56  PRO 56  56  56  PRO PRO A . n 
C 3 57  CYS 57  57  57  CYS CYS A . n 
C 3 58  THR 58  58  58  THR THR A . n 
C 3 59  ARG 59  59  59  ARG ARG A . n 
C 3 60  LYS 60  60  60  LYS LYS A . n 
C 3 61  LEU 61  61  61  LEU LEU A . n 
C 3 62  PHE 62  62  62  PHE PHE A . n 
C 3 63  ALA 63  63  63  ALA ALA A . n 
C 3 64  ASN 64  64  64  ASN ASN A . n 
C 3 65  MET 65  65  65  MET MET A . n 
C 3 66  ARG 66  66  66  ARG ARG A . n 
C 3 67  ASP 67  67  67  ASP ASP A . n 
C 3 68  ALA 68  68  68  ALA ALA A . n 
C 3 69  SER 69  69  69  SER SER A . n 
C 3 70  GLN 70  70  70  GLN GLN A . n 
C 3 71  TRP 71  71  71  TRP TRP A . n 
C 3 72  ILE 72  72  72  ILE ILE A . n 
C 3 73  LYS 73  73  73  LYS LYS A . n 
C 3 74  ARG 74  74  74  ARG ARG A . n 
C 3 75  MET 75  75  75  MET MET A . n 
C 3 76  GLU 76  76  76  GLU GLU A . n 
C 3 77  ASP 77  77  77  ASP ASP A . n 
C 3 78  ILE 78  78  78  ILE ILE A . n 
C 3 79  GLY 79  79  79  GLY GLY A . n 
C 3 80  LEU 80  80  80  LEU LEU A . n 
C 3 81  GLU 81  81  81  GLU GLU A . n 
C 3 82  ALA 82  82  82  ALA ALA A . n 
C 3 83  LEU 83  83  83  LEU LEU A . n 
C 3 84  GLY 84  84  84  GLY GLY A . n 
C 3 85  MET 85  85  85  MET MET A . n 
C 3 86  ASP 86  86  86  ASP ASP A . n 
C 3 87  ASP 87  87  87  ASP ASP A . n 
C 3 88  PHE 88  88  88  PHE PHE A . n 
C 3 89  LYS 89  89  89  LYS LYS A . n 
C 3 90  LEU 90  90  90  LEU LEU A . n 
C 3 91  ALA 91  91  91  ALA ALA A . n 
C 3 92  TYR 92  92  92  TYR TYR A . n 
C 3 93  LEU 93  93  93  LEU LEU A . n 
C 3 94  SER 94  94  94  SER SER A . n 
C 3 95  ASP 95  95  95  ASP ASP A . n 
C 3 96  THR 96  96  96  THR THR A . n 
C 3 97  TYR 97  97  97  TYR TYR A . n 
C 3 98  ASN 98  98  98  ASN ASN A . n 
C 3 99  TYR 99  99  99  TYR TYR A . n 
C 3 100 GLU 100 100 100 GLU GLU A . n 
C 3 101 ILE 101 101 101 ILE ILE A . n 
C 3 102 LYS 102 102 102 LYS LYS A . n 
C 3 103 TYR 103 103 103 TYR TYR A . n 
C 3 104 ASP 104 104 104 ASP ASP A . n 
C 3 105 HIS 105 105 105 HIS HIS A . n 
C 3 106 THR 106 106 106 THR THR A . n 
C 3 107 LYS 107 107 107 LYS LYS A . n 
C 3 108 ILE 108 108 108 ILE ILE A . n 
C 3 109 ARG 109 109 109 ARG ARG A . n 
C 3 110 VAL 110 110 110 VAL VAL A . n 
C 3 111 ALA 111 111 111 ALA ALA A . n 
C 3 112 ASN 112 112 112 ASN ASN A . n 
C 3 113 PHE 113 113 113 PHE PHE A . n 
C 3 114 ASP 114 114 114 ASP ASP A . n 
C 3 115 ILE 115 115 115 ILE ILE A . n 
C 3 116 GLU 116 116 116 GLU GLU A . n 
C 3 117 VAL 117 117 117 VAL VAL A . n 
C 3 118 THR 118 118 118 THR THR A . n 
C 3 119 SER 119 119 119 SER SER A . n 
C 3 120 PRO 120 120 120 PRO PRO A . n 
C 3 121 ASP 121 121 121 ASP ASP A . n 
C 3 122 GLY 122 122 122 GLY GLY A . n 
C 3 123 PHE 123 123 123 PHE PHE A . n 
C 3 124 PRO 124 124 124 PRO PRO A . n 
C 3 125 GLU 125 125 125 GLU GLU A . n 
C 3 126 PRO 126 126 126 PRO PRO A . n 
C 3 127 SER 127 127 127 SER SER A . n 
C 3 128 GLN 128 128 128 GLN GLN A . n 
C 3 129 ALA 129 129 129 ALA ALA A . n 
C 3 130 LYS 130 130 130 LYS LYS A . n 
C 3 131 HIS 131 131 131 HIS HIS A . n 
C 3 132 PRO 132 132 132 PRO PRO A . n 
C 3 133 ILE 133 133 133 ILE ILE A . n 
C 3 134 ASP 134 134 134 ASP ASP A . n 
C 3 135 ALA 135 135 135 ALA ALA A . n 
C 3 136 ILE 136 136 136 ILE ILE A . n 
C 3 137 THR 137 137 137 THR THR A . n 
C 3 138 HIS 138 138 138 HIS HIS A . n 
C 3 139 TYR 139 139 139 TYR TYR A . n 
C 3 140 ASP 140 140 140 ASP ASP A . n 
C 3 141 SER 141 141 141 SER SER A . n 
C 3 142 ILE 142 142 142 ILE ILE A . n 
C 3 143 ASP 143 143 143 ASP ASP A . n 
C 3 144 ASP 144 144 144 ASP ASP A . n 
C 3 145 ARG 145 145 145 ARG ARG A . n 
C 3 146 PHE 146 146 146 PHE PHE A . n 
C 3 147 TYR 147 147 147 TYR TYR A . n 
C 3 148 VAL 148 148 148 VAL VAL A . n 
C 3 149 PHE 149 149 149 PHE PHE A . n 
C 3 150 ASP 150 150 150 ASP ASP A . n 
C 3 151 LEU 151 151 151 LEU LEU A . n 
C 3 152 LEU 152 152 152 LEU LEU A . n 
C 3 153 ASN 153 153 153 ASN ASN A . n 
C 3 154 SER 154 154 154 SER SER A . n 
C 3 155 PRO 155 155 155 PRO PRO A . n 
C 3 156 TYR 156 156 156 TYR TYR A . n 
C 3 157 GLY 157 157 157 GLY GLY A . n 
C 3 158 ASN 158 158 158 ASN ASN A . n 
C 3 159 VAL 159 159 159 VAL VAL A . n 
C 3 160 GLU 160 160 160 GLU GLU A . n 
C 3 161 GLU 161 161 161 GLU GLU A . n 
C 3 162 TRP 162 162 162 TRP TRP A . n 
C 3 163 SER 163 163 163 SER SER A . n 
C 3 164 ILE 164 164 164 ILE ILE A . n 
C 3 165 GLU 165 165 165 GLU GLU A . n 
C 3 166 ILE 166 166 166 ILE ILE A . n 
C 3 167 ALA 167 167 167 ALA ALA A . n 
C 3 168 ALA 168 168 168 ALA ALA A . n 
C 3 169 LYS 169 169 169 LYS LYS A . n 
C 3 170 LEU 170 170 170 LEU LEU A . n 
C 3 171 GLN 171 171 171 GLN GLN A . n 
C 3 172 GLU 172 172 172 GLU GLU A . n 
C 3 173 GLN 173 173 173 GLN GLN A . n 
C 3 174 GLY 174 174 174 GLY GLY A . n 
C 3 175 GLY 175 175 175 GLY GLY A . n 
C 3 176 ASP 176 176 176 ASP ASP A . n 
C 3 177 GLU 177 177 177 GLU GLU A . n 
C 3 178 VAL 178 178 178 VAL VAL A . n 
C 3 179 PRO 179 179 179 PRO PRO A . n 
C 3 180 SER 180 180 180 SER SER A . n 
C 3 181 GLU 181 181 181 GLU GLU A . n 
C 3 182 ILE 182 182 182 ILE ILE A . n 
C 3 183 ILE 183 183 183 ILE ILE A . n 
C 3 184 ASP 184 184 184 ASP ASP A . n 
C 3 185 LYS 185 185 185 LYS LYS A . n 
C 3 186 ILE 186 186 186 ILE ILE A . n 
C 3 187 ILE 187 187 187 ILE ILE A . n 
C 3 188 TYR 188 188 188 TYR TYR A . n 
C 3 189 MET 189 189 189 MET MET A . n 
C 3 190 PRO 190 190 190 PRO PRO A . n 
C 3 191 PHE 191 191 191 PHE PHE A . n 
C 3 192 ASP 192 192 192 ASP ASP A . n 
C 3 193 ASN 193 193 193 ASN ASN A . n 
C 3 194 GLU 194 194 194 GLU GLU A . n 
C 3 195 LYS 195 195 195 LYS LYS A . n 
C 3 196 GLU 196 196 196 GLU GLU A . n 
C 3 197 LEU 197 197 197 LEU LEU A . n 
C 3 198 LEU 198 198 198 LEU LEU A . n 
C 3 199 MET 199 199 199 MET MET A . n 
C 3 200 GLU 200 200 200 GLU GLU A . n 
C 3 201 TYR 201 201 201 TYR TYR A . n 
C 3 202 LEU 202 202 202 LEU LEU A . n 
C 3 203 ASN 203 203 203 ASN ASN A . n 
C 3 204 PHE 204 204 204 PHE PHE A . n 
C 3 205 TRP 205 205 205 TRP TRP A . n 
C 3 206 GLN 206 206 206 GLN GLN A . n 
C 3 207 GLN 207 207 207 GLN GLN A . n 
C 3 208 LYS 208 208 208 LYS LYS A . n 
C 3 209 THR 209 209 209 THR THR A . n 
C 3 210 PRO 210 210 210 PRO PRO A . n 
C 3 211 VAL 211 211 211 VAL VAL A . n 
C 3 212 ILE 212 212 212 ILE ILE A . n 
C 3 213 LEU 213 213 213 LEU LEU A . n 
C 3 214 THR 214 214 214 THR THR A . n 
C 3 215 GLY 215 215 215 GLY GLY A . n 
C 3 216 TRP 216 216 216 TRP TRP A . n 
C 3 217 ASN 217 217 217 ASN ASN A . n 
C 3 218 VAL 218 218 218 VAL VAL A . n 
C 3 219 GLU 219 219 219 GLU GLU A . n 
C 3 220 SER 220 220 220 SER SER A . n 
C 3 221 PHE 221 221 221 PHE PHE A . n 
C 3 222 ASP 222 222 222 ASP ASP A . n 
C 3 223 ILE 223 223 223 ILE ILE A . n 
C 3 224 PRO 224 224 224 PRO PRO A . n 
C 3 225 TYR 225 225 225 TYR TYR A . n 
C 3 226 VAL 226 226 226 VAL VAL A . n 
C 3 227 TYR 227 227 227 TYR TYR A . n 
C 3 228 ASN 228 228 228 ASN ASN A . n 
C 3 229 ARG 229 229 229 ARG ARG A . n 
C 3 230 ILE 230 230 230 ILE ILE A . n 
C 3 231 LYS 231 231 231 LYS LYS A . n 
C 3 232 ASN 232 232 232 ASN ASN A . n 
C 3 233 ILE 233 233 233 ILE ILE A . n 
C 3 234 PHE 234 234 234 PHE PHE A . n 
C 3 235 GLY 235 235 235 GLY GLY A . n 
C 3 236 GLU 236 236 236 GLU GLU A . n 
C 3 237 SER 237 237 237 SER SER A . n 
C 3 238 THR 238 238 238 THR THR A . n 
C 3 239 ALA 239 239 239 ALA ALA A . n 
C 3 240 LYS 240 240 240 LYS LYS A . n 
C 3 241 ARG 241 241 241 ARG ARG A . n 
C 3 242 LEU 242 242 242 LEU LEU A . n 
C 3 243 SER 243 243 243 SER SER A . n 
C 3 244 PRO 244 244 244 PRO PRO A . n 
C 3 245 HIS 245 245 245 HIS HIS A . n 
C 3 246 ARG 246 246 246 ARG ARG A . n 
C 3 247 LYS 247 247 247 LYS LYS A . n 
C 3 248 THR 248 248 248 THR THR A . n 
C 3 249 ARG 249 249 249 ARG ARG A . n 
C 3 250 VAL 250 250 250 VAL VAL A . n 
C 3 251 LYS 251 251 251 LYS LYS A . n 
C 3 252 VAL 252 252 252 VAL VAL A . n 
C 3 253 ILE 253 253 253 ILE ILE A . n 
C 3 254 GLU 254 254 254 GLU GLU A . n 
C 3 255 ASN 255 255 255 ASN ASN A . n 
C 3 256 MET 256 256 256 MET MET A . n 
C 3 257 TYR 257 257 257 TYR TYR A . n 
C 3 258 GLY 258 258 258 GLY GLY A . n 
C 3 259 SER 259 259 259 SER SER A . n 
C 3 260 ARG 260 260 260 ARG ARG A . n 
C 3 261 GLU 261 261 261 GLU GLU A . n 
C 3 262 ILE 262 262 262 ILE ILE A . n 
C 3 263 ILE 263 263 263 ILE ILE A . n 
C 3 264 THR 264 264 264 THR THR A . n 
C 3 265 LEU 265 265 265 LEU LEU A . n 
C 3 266 PHE 266 266 266 PHE PHE A . n 
C 3 267 GLY 267 267 267 GLY GLY A . n 
C 3 268 ILE 268 268 268 ILE ILE A . n 
C 3 269 SER 269 269 269 SER SER A . n 
C 3 270 VAL 270 270 270 VAL VAL A . n 
C 3 271 LEU 271 271 271 LEU LEU A . n 
C 3 272 ASP 272 272 272 ASP ASP A . n 
C 3 273 TYR 273 273 273 TYR TYR A . n 
C 3 274 ILE 274 274 274 ILE ILE A . n 
C 3 275 ASP 275 275 275 ASP ASP A . n 
C 3 276 LEU 276 276 276 LEU LEU A . n 
C 3 277 TYR 277 277 277 TYR TYR A . n 
C 3 278 LYS 278 278 278 LYS LYS A . n 
C 3 279 LYS 279 279 279 LYS LYS A . n 
C 3 280 PHE 280 280 280 PHE PHE A . n 
C 3 281 SER 281 281 281 SER SER A . n 
C 3 282 PHE 282 282 282 PHE PHE A . n 
C 3 283 THR 283 283 283 THR THR A . n 
C 3 284 ASN 284 284 284 ASN ASN A . n 
C 3 285 GLN 285 285 285 GLN GLN A . n 
C 3 286 PRO 286 286 286 PRO PRO A . n 
C 3 287 SER 287 287 287 SER SER A . n 
C 3 288 TYR 288 288 288 TYR TYR A . n 
C 3 289 SER 289 289 289 SER SER A . n 
C 3 290 LEU 290 290 290 LEU LEU A . n 
C 3 291 ASP 291 291 291 ASP ASP A . n 
C 3 292 TYR 292 292 292 TYR TYR A . n 
C 3 293 ILE 293 293 293 ILE ILE A . n 
C 3 294 SER 294 294 294 SER SER A . n 
C 3 295 GLU 295 295 295 GLU GLU A . n 
C 3 296 PHE 296 296 296 PHE PHE A . n 
C 3 297 GLU 297 297 297 GLU GLU A . n 
C 3 298 LEU 298 298 298 LEU LEU A . n 
C 3 299 ASN 299 299 299 ASN ASN A . n 
C 3 300 VAL 300 300 300 VAL VAL A . n 
C 3 301 GLY 301 301 301 GLY GLY A . n 
C 3 302 LYS 302 302 302 LYS LYS A . n 
C 3 303 LEU 303 303 303 LEU LEU A . n 
C 3 304 LYS 304 304 304 LYS LYS A . n 
C 3 305 TYR 305 305 305 TYR TYR A . n 
C 3 306 ASP 306 306 306 ASP ASP A . n 
C 3 307 GLY 307 307 307 GLY GLY A . n 
C 3 308 PRO 308 308 308 PRO PRO A . n 
C 3 309 ILE 309 309 309 ILE ILE A . n 
C 3 310 SER 310 310 310 SER SER A . n 
C 3 311 LYS 311 311 311 LYS LYS A . n 
C 3 312 LEU 312 312 312 LEU LEU A . n 
C 3 313 ARG 313 313 313 ARG ARG A . n 
C 3 314 GLU 314 314 314 GLU GLU A . n 
C 3 315 SER 315 315 315 SER SER A . n 
C 3 316 ASN 316 316 316 ASN ASN A . n 
C 3 317 HIS 317 317 317 HIS HIS A . n 
C 3 318 GLN 318 318 318 GLN GLN A . n 
C 3 319 ARG 319 319 319 ARG ARG A . n 
C 3 320 TYR 320 320 320 TYR TYR A . n 
C 3 321 ILE 321 321 321 ILE ILE A . n 
C 3 322 SER 322 322 322 SER SER A . n 
C 3 323 TYR 323 323 323 TYR TYR A . n 
C 3 324 ASN 324 324 324 ASN ASN A . n 
C 3 325 ILE 325 325 325 ILE ILE A . n 
C 3 326 ILE 326 326 326 ILE ILE A . n 
C 3 327 ASP 327 327 327 ASP ASP A . n 
C 3 328 VAL 328 328 328 VAL VAL A . n 
C 3 329 TYR 329 329 329 TYR TYR A . n 
C 3 330 ARG 330 330 330 ARG ARG A . n 
C 3 331 VAL 331 331 331 VAL VAL A . n 
C 3 332 LEU 332 332 332 LEU LEU A . n 
C 3 333 GLN 333 333 333 GLN GLN A . n 
C 3 334 ILE 334 334 334 ILE ILE A . n 
C 3 335 ASP 335 335 335 ASP ASP A . n 
C 3 336 ALA 336 336 336 ALA ALA A . n 
C 3 337 LYS 337 337 337 LYS LYS A . n 
C 3 338 ARG 338 338 338 ARG ARG A . n 
C 3 339 GLN 339 339 339 GLN GLN A . n 
C 3 340 PHE 340 340 340 PHE PHE A . n 
C 3 341 ILE 341 341 341 ILE ILE A . n 
C 3 342 ASN 342 342 342 ASN ASN A . n 
C 3 343 LEU 343 343 343 LEU LEU A . n 
C 3 344 SER 344 344 344 SER SER A . n 
C 3 345 LEU 345 345 345 LEU LEU A . n 
C 3 346 ASP 346 346 346 ASP ASP A . n 
C 3 347 MET 347 347 347 MET MET A . n 
C 3 348 GLY 348 348 348 GLY GLY A . n 
C 3 349 TYR 349 349 349 TYR TYR A . n 
C 3 350 TYR 350 350 350 TYR TYR A . n 
C 3 351 ALA 351 351 351 ALA ALA A . n 
C 3 352 LYS 352 352 352 LYS LYS A . n 
C 3 353 ILE 353 353 353 ILE ILE A . n 
C 3 354 GLN 354 354 354 GLN GLN A . n 
C 3 355 ILE 355 355 355 ILE ILE A . n 
C 3 356 GLN 356 356 356 GLN GLN A . n 
C 3 357 SER 357 357 357 SER SER A . n 
C 3 358 VAL 358 358 358 VAL VAL A . n 
C 3 359 PHE 359 359 359 PHE PHE A . n 
C 3 360 SER 360 360 360 SER SER A . n 
C 3 361 PRO 361 361 361 PRO PRO A . n 
C 3 362 ILE 362 362 362 ILE ILE A . n 
C 3 363 LYS 363 363 363 LYS LYS A . n 
C 3 364 THR 364 364 364 THR THR A . n 
C 3 365 TRP 365 365 365 TRP TRP A . n 
C 3 366 ASP 366 366 366 ASP ASP A . n 
C 3 367 ALA 367 367 367 ALA ALA A . n 
C 3 368 ILE 368 368 368 ILE ILE A . n 
C 3 369 ILE 369 369 369 ILE ILE A . n 
C 3 370 PHE 370 370 370 PHE PHE A . n 
C 3 371 ASN 371 371 371 ASN ASN A . n 
C 3 372 SER 372 372 372 SER SER A . n 
C 3 373 LEU 373 373 373 LEU LEU A . n 
C 3 374 LYS 374 374 374 LYS LYS A . n 
C 3 375 GLU 375 375 375 GLU GLU A . n 
C 3 376 GLN 376 376 376 GLN GLN A . n 
C 3 377 ASN 377 377 377 ASN ASN A . n 
C 3 378 LYS 378 378 378 LYS LYS A . n 
C 3 379 VAL 379 379 379 VAL VAL A . n 
C 3 380 ILE 380 380 380 ILE ILE A . n 
C 3 381 PRO 381 381 381 PRO PRO A . n 
C 3 382 GLN 382 382 382 GLN GLN A . n 
C 3 383 GLY 383 383 383 GLY GLY A . n 
C 3 384 ARG 384 384 384 ARG ARG A . n 
C 3 385 SER 385 385 385 SER SER A . n 
C 3 386 HIS 386 386 386 HIS HIS A . n 
C 3 387 PRO 387 387 387 PRO PRO A . n 
C 3 388 VAL 388 388 388 VAL VAL A . n 
C 3 389 GLN 389 389 389 GLN GLN A . n 
C 3 390 PRO 390 390 390 PRO PRO A . n 
C 3 391 TYR 391 391 391 TYR TYR A . n 
C 3 392 PRO 392 392 392 PRO PRO A . n 
C 3 393 GLY 393 393 393 GLY GLY A . n 
C 3 394 ALA 394 394 394 ALA ALA A . n 
C 3 395 PHE 395 395 395 PHE PHE A . n 
C 3 396 VAL 396 396 396 VAL VAL A . n 
C 3 397 LYS 397 397 397 LYS LYS A . n 
C 3 398 GLU 398 398 398 GLU GLU A . n 
C 3 399 PRO 399 399 399 PRO PRO A . n 
C 3 400 ILE 400 400 400 ILE ILE A . n 
C 3 401 PRO 401 401 401 PRO PRO A . n 
C 3 402 ASN 402 402 402 ASN ASN A . n 
C 3 403 ARG 403 403 403 ARG ARG A . n 
C 3 404 TYR 404 404 404 TYR TYR A . n 
C 3 405 LYS 405 405 405 LYS LYS A . n 
C 3 406 TYR 406 406 406 TYR TYR A . n 
C 3 407 VAL 407 407 407 VAL VAL A . n 
C 3 408 MET 408 408 408 MET MET A . n 
C 3 409 SER 409 409 409 SER SER A . n 
C 3 410 PHE 410 410 410 PHE PHE A . n 
C 3 411 ASP 411 411 411 ASP ASP A . n 
C 3 412 LEU 412 412 412 LEU LEU A . n 
C 3 413 THR 413 413 413 THR THR A . n 
C 3 414 SER 414 414 414 SER SER A . n 
C 3 415 LEU 415 415 415 LEU LEU A . n 
C 3 416 TYR 416 416 416 TYR TYR A . n 
C 3 417 PRO 417 417 417 PRO PRO A . n 
C 3 418 SER 418 418 418 SER SER A . n 
C 3 419 ILE 419 419 419 ILE ILE A . n 
C 3 420 ILE 420 420 420 ILE ILE A . n 
C 3 421 ARG 421 421 421 ARG ARG A . n 
C 3 422 GLN 422 422 422 GLN GLN A . n 
C 3 423 VAL 423 423 423 VAL VAL A . n 
C 3 424 ASN 424 424 424 ASN ASN A . n 
C 3 425 ILE 425 425 425 ILE ILE A . n 
C 3 426 SER 426 426 426 SER SER A . n 
C 3 427 PRO 427 427 427 PRO PRO A . n 
C 3 428 GLU 428 428 428 GLU GLU A . n 
C 3 429 THR 429 429 429 THR THR A . n 
C 3 430 ILE 430 430 430 ILE ILE A . n 
C 3 431 ALA 431 431 431 ALA ALA A . n 
C 3 432 GLY 432 432 432 GLY GLY A . n 
C 3 433 THR 433 433 433 THR THR A . n 
C 3 434 PHE 434 434 434 PHE PHE A . n 
C 3 435 LYS 435 435 435 LYS LYS A . n 
C 3 436 VAL 436 436 436 VAL VAL A . n 
C 3 437 ALA 437 437 437 ALA ALA A . n 
C 3 438 PRO 438 438 438 PRO PRO A . n 
C 3 439 LEU 439 439 439 LEU LEU A . n 
C 3 440 HIS 440 440 440 HIS HIS A . n 
C 3 441 ASP 441 441 441 ASP ASP A . n 
C 3 442 TYR 442 442 442 TYR TYR A . n 
C 3 443 ILE 443 443 443 ILE ILE A . n 
C 3 444 ASN 444 444 444 ASN ASN A . n 
C 3 445 ALA 445 445 445 ALA ALA A . n 
C 3 446 VAL 446 446 446 VAL VAL A . n 
C 3 447 ALA 447 447 447 ALA ALA A . n 
C 3 448 GLU 448 448 448 GLU GLU A . n 
C 3 449 ARG 449 449 449 ARG ARG A . n 
C 3 450 PRO 450 450 450 PRO PRO A . n 
C 3 451 SER 451 451 451 SER SER A . n 
C 3 452 ASP 452 452 452 ASP ASP A . n 
C 3 453 VAL 453 453 453 VAL VAL A . n 
C 3 454 TYR 454 454 454 TYR TYR A . n 
C 3 455 SER 455 455 455 SER SER A . n 
C 3 456 CYS 456 456 456 CYS CYS A . n 
C 3 457 SER 457 457 457 SER SER A . n 
C 3 458 PRO 458 458 458 PRO PRO A . n 
C 3 459 ASN 459 459 459 ASN ASN A . n 
C 3 460 GLY 460 460 460 GLY GLY A . n 
C 3 461 MET 461 461 461 MET MET A . n 
C 3 462 MET 462 462 462 MET MET A . n 
C 3 463 TYR 463 463 463 TYR TYR A . n 
C 3 464 TYR 464 464 464 TYR TYR A . n 
C 3 465 LYS 465 465 465 LYS LYS A . n 
C 3 466 ASP 466 466 466 ASP ASP A . n 
C 3 467 ARG 467 467 467 ARG ARG A . n 
C 3 468 ASP 468 468 468 ASP ASP A . n 
C 3 469 GLY 469 469 469 GLY GLY A . n 
C 3 470 VAL 470 470 470 VAL VAL A . n 
C 3 471 VAL 471 471 471 VAL VAL A . n 
C 3 472 PRO 472 472 472 PRO PRO A . n 
C 3 473 THR 473 473 473 THR THR A . n 
C 3 474 GLU 474 474 474 GLU GLU A . n 
C 3 475 ILE 475 475 475 ILE ILE A . n 
C 3 476 THR 476 476 476 THR THR A . n 
C 3 477 LYS 477 477 477 LYS LYS A . n 
C 3 478 VAL 478 478 478 VAL VAL A . n 
C 3 479 PHE 479 479 479 PHE PHE A . n 
C 3 480 ASN 480 480 480 ASN ASN A . n 
C 3 481 GLN 481 481 481 GLN GLN A . n 
C 3 482 ARG 482 482 482 ARG ARG A . n 
C 3 483 LYS 483 483 483 LYS LYS A . n 
C 3 484 GLU 484 484 484 GLU GLU A . n 
C 3 485 HIS 485 485 485 HIS HIS A . n 
C 3 486 LYS 486 486 486 LYS LYS A . n 
C 3 487 GLY 487 487 487 GLY GLY A . n 
C 3 488 TYR 488 488 488 TYR TYR A . n 
C 3 489 MET 489 489 489 MET MET A . n 
C 3 490 LEU 490 490 490 LEU LEU A . n 
C 3 491 ALA 491 491 491 ALA ALA A . n 
C 3 492 ALA 492 492 492 ALA ALA A . n 
C 3 493 GLN 493 493 493 GLN GLN A . n 
C 3 494 ARG 494 494 494 ARG ARG A . n 
C 3 495 ASN 495 495 495 ASN ASN A . n 
C 3 496 GLY 496 496 496 GLY GLY A . n 
C 3 497 GLU 497 497 497 GLU GLU A . n 
C 3 498 ILE 498 498 498 ILE ILE A . n 
C 3 499 ILE 499 499 499 ILE ILE A . n 
C 3 500 LYS 500 500 500 LYS LYS A . n 
C 3 501 GLU 501 501 501 GLU GLU A . n 
C 3 502 ALA 502 502 502 ALA ALA A . n 
C 3 503 LEU 503 503 503 LEU LEU A . n 
C 3 504 HIS 504 504 504 HIS HIS A . n 
C 3 505 ASN 505 505 505 ASN ASN A . n 
C 3 506 PRO 506 506 506 PRO PRO A . n 
C 3 507 ASN 507 507 507 ASN ASN A . n 
C 3 508 LEU 508 508 508 LEU LEU A . n 
C 3 509 SER 509 509 509 SER SER A . n 
C 3 510 VAL 510 510 510 VAL VAL A . n 
C 3 511 ASP 511 511 511 ASP ASP A . n 
C 3 512 GLU 512 512 512 GLU GLU A . n 
C 3 513 PRO 513 513 513 PRO PRO A . n 
C 3 514 LEU 514 514 514 LEU LEU A . n 
C 3 515 ASP 515 515 515 ASP ASP A . n 
C 3 516 VAL 516 516 516 VAL VAL A . n 
C 3 517 ASP 517 517 517 ASP ASP A . n 
C 3 518 TYR 518 518 518 TYR TYR A . n 
C 3 519 ARG 519 519 519 ARG ARG A . n 
C 3 520 PHE 520 520 520 PHE PHE A . n 
C 3 521 ASP 521 521 521 ASP ASP A . n 
C 3 522 PHE 522 522 522 PHE PHE A . n 
C 3 523 SER 523 523 523 SER SER A . n 
C 3 524 ASP 524 524 524 ASP ASP A . n 
C 3 525 GLU 525 525 525 GLU GLU A . n 
C 3 526 ILE 526 526 526 ILE ILE A . n 
C 3 527 LYS 527 527 527 LYS LYS A . n 
C 3 528 GLU 528 528 528 GLU GLU A . n 
C 3 529 LYS 529 529 529 LYS LYS A . n 
C 3 530 ILE 530 530 530 ILE ILE A . n 
C 3 531 LYS 531 531 531 LYS LYS A . n 
C 3 532 LYS 532 532 532 LYS LYS A . n 
C 3 533 LEU 533 533 533 LEU LEU A . n 
C 3 534 SER 534 534 534 SER SER A . n 
C 3 535 ALA 535 535 535 ALA ALA A . n 
C 3 536 LYS 536 536 536 LYS LYS A . n 
C 3 537 SER 537 537 537 SER SER A . n 
C 3 538 LEU 538 538 538 LEU LEU A . n 
C 3 539 ASN 539 539 539 ASN ASN A . n 
C 3 540 GLU 540 540 540 GLU GLU A . n 
C 3 541 MET 541 541 541 MET MET A . n 
C 3 542 LEU 542 542 542 LEU LEU A . n 
C 3 543 PHE 543 543 543 PHE PHE A . n 
C 3 544 ARG 544 544 544 ARG ARG A . n 
C 3 545 ALA 545 545 545 ALA ALA A . n 
C 3 546 GLN 546 546 546 GLN GLN A . n 
C 3 547 ARG 547 547 547 ARG ARG A . n 
C 3 548 THR 548 548 548 THR THR A . n 
C 3 549 GLU 549 549 549 GLU GLU A . n 
C 3 550 VAL 550 550 550 VAL VAL A . n 
C 3 551 ALA 551 551 551 ALA ALA A . n 
C 3 552 GLY 552 552 552 GLY GLY A . n 
C 3 553 MET 553 553 553 MET MET A . n 
C 3 554 THR 554 554 554 THR THR A . n 
C 3 555 ALA 555 555 555 ALA ALA A . n 
C 3 556 GLN 556 556 556 GLN GLN A . n 
C 3 557 ILE 557 557 557 ILE ILE A . n 
C 3 558 ASN 558 558 558 ASN ASN A . n 
C 3 559 ARG 559 559 559 ARG ARG A . n 
C 3 560 LYS 560 560 560 LYS LYS A . n 
C 3 561 LEU 561 561 561 LEU LEU A . n 
C 3 562 LEU 562 562 562 LEU LEU A . n 
C 3 563 ILE 563 563 563 ILE ILE A . n 
C 3 564 ASN 564 564 564 ASN ASN A . n 
C 3 565 SER 565 565 565 SER SER A . n 
C 3 566 LEU 566 566 566 LEU LEU A . n 
C 3 567 TYR 567 567 567 TYR TYR A . n 
C 3 568 GLY 568 568 568 GLY GLY A . n 
C 3 569 ALA 569 569 569 ALA ALA A . n 
C 3 570 LEU 570 570 570 LEU LEU A . n 
C 3 571 GLY 571 571 571 GLY GLY A . n 
C 3 572 ASN 572 572 572 ASN ASN A . n 
C 3 573 VAL 573 573 573 VAL VAL A . n 
C 3 574 TRP 574 574 574 TRP TRP A . n 
C 3 575 PHE 575 575 575 PHE PHE A . n 
C 3 576 ARG 576 576 576 ARG ARG A . n 
C 3 577 TYR 577 577 577 TYR TYR A . n 
C 3 578 TYR 578 578 578 TYR TYR A . n 
C 3 579 ASP 579 579 579 ASP ASP A . n 
C 3 580 LEU 580 580 580 LEU LEU A . n 
C 3 581 ARG 581 581 581 ARG ARG A . n 
C 3 582 ASN 582 582 582 ASN ASN A . n 
C 3 583 ALA 583 583 583 ALA ALA A . n 
C 3 584 THR 584 584 584 THR THR A . n 
C 3 585 ALA 585 585 585 ALA ALA A . n 
C 3 586 ILE 586 586 586 ILE ILE A . n 
C 3 587 THR 587 587 587 THR THR A . n 
C 3 588 THR 588 588 588 THR THR A . n 
C 3 589 PHE 589 589 589 PHE PHE A . n 
C 3 590 GLY 590 590 590 GLY GLY A . n 
C 3 591 GLN 591 591 591 GLN GLN A . n 
C 3 592 MET 592 592 592 MET MET A . n 
C 3 593 ALA 593 593 593 ALA ALA A . n 
C 3 594 LEU 594 594 594 LEU LEU A . n 
C 3 595 GLN 595 595 595 GLN GLN A . n 
C 3 596 TRP 596 596 596 TRP TRP A . n 
C 3 597 ILE 597 597 597 ILE ILE A . n 
C 3 598 GLU 598 598 598 GLU GLU A . n 
C 3 599 ARG 599 599 599 ARG ARG A . n 
C 3 600 LYS 600 600 600 LYS LYS A . n 
C 3 601 VAL 601 601 601 VAL VAL A . n 
C 3 602 ASN 602 602 602 ASN ASN A . n 
C 3 603 GLU 603 603 603 GLU GLU A . n 
C 3 604 TYR 604 604 604 TYR TYR A . n 
C 3 605 LEU 605 605 605 LEU LEU A . n 
C 3 606 ASN 606 606 606 ASN ASN A . n 
C 3 607 GLU 607 607 607 GLU GLU A . n 
C 3 608 VAL 608 608 608 VAL VAL A . n 
C 3 609 CYS 609 609 609 CYS CYS A . n 
C 3 610 GLY 610 610 610 GLY GLY A . n 
C 3 611 THR 611 611 611 THR THR A . n 
C 3 612 GLU 612 612 612 GLU GLU A . n 
C 3 613 GLY 613 613 613 GLY GLY A . n 
C 3 614 GLU 614 614 614 GLU GLU A . n 
C 3 615 ALA 615 615 615 ALA ALA A . n 
C 3 616 PHE 616 616 616 PHE PHE A . n 
C 3 617 VAL 617 617 617 VAL VAL A . n 
C 3 618 LEU 618 618 618 LEU LEU A . n 
C 3 619 TYR 619 619 619 TYR TYR A . n 
C 3 620 GLY 620 620 620 GLY GLY A . n 
C 3 621 ASP 621 621 621 ASP ASP A . n 
C 3 622 THR 622 622 622 THR THR A . n 
C 3 623 ASP 623 623 623 ASP ASP A . n 
C 3 624 SER 624 624 624 SER SER A . n 
C 3 625 ILE 625 625 625 ILE ILE A . n 
C 3 626 TYR 626 626 626 TYR TYR A . n 
C 3 627 VAL 627 627 627 VAL VAL A . n 
C 3 628 SER 628 628 628 SER SER A . n 
C 3 629 ALA 629 629 629 ALA ALA A . n 
C 3 630 ASP 630 630 630 ASP ASP A . n 
C 3 631 LYS 631 631 631 LYS LYS A . n 
C 3 632 ILE 632 632 632 ILE ILE A . n 
C 3 633 ILE 633 633 633 ILE ILE A . n 
C 3 634 ASP 634 634 634 ASP ASP A . n 
C 3 635 LYS 635 635 635 LYS LYS A . n 
C 3 636 VAL 636 636 636 VAL VAL A . n 
C 3 637 GLY 637 637 637 GLY GLY A . n 
C 3 638 GLU 638 638 638 GLU GLU A . n 
C 3 639 SER 639 639 639 SER SER A . n 
C 3 640 LYS 640 640 640 LYS LYS A . n 
C 3 641 PHE 641 641 641 PHE PHE A . n 
C 3 642 ARG 642 642 642 ARG ARG A . n 
C 3 643 ASP 643 643 643 ASP ASP A . n 
C 3 644 THR 644 644 644 THR THR A . n 
C 3 645 ASN 645 645 645 ASN ASN A . n 
C 3 646 HIS 646 646 646 HIS HIS A . n 
C 3 647 TRP 647 647 647 TRP TRP A . n 
C 3 648 VAL 648 648 648 VAL VAL A . n 
C 3 649 ASP 649 649 649 ASP ASP A . n 
C 3 650 PHE 650 650 650 PHE PHE A . n 
C 3 651 LEU 651 651 651 LEU LEU A . n 
C 3 652 ASP 652 652 652 ASP ASP A . n 
C 3 653 LYS 653 653 653 LYS LYS A . n 
C 3 654 PHE 654 654 654 PHE PHE A . n 
C 3 655 ALA 655 655 655 ALA ALA A . n 
C 3 656 ARG 656 656 656 ARG ARG A . n 
C 3 657 GLU 657 657 657 GLU GLU A . n 
C 3 658 ARG 658 658 658 ARG ARG A . n 
C 3 659 MET 659 659 659 MET MET A . n 
C 3 660 GLU 660 660 660 GLU GLU A . n 
C 3 661 PRO 661 661 661 PRO PRO A . n 
C 3 662 ALA 662 662 662 ALA ALA A . n 
C 3 663 ILE 663 663 663 ILE ILE A . n 
C 3 664 ASP 664 664 664 ASP ASP A . n 
C 3 665 ARG 665 665 665 ARG ARG A . n 
C 3 666 GLY 666 666 666 GLY GLY A . n 
C 3 667 PHE 667 667 667 PHE PHE A . n 
C 3 668 ARG 668 668 668 ARG ARG A . n 
C 3 669 GLU 669 669 669 GLU GLU A . n 
C 3 670 MET 670 670 670 MET MET A . n 
C 3 671 CYS 671 671 671 CYS CYS A . n 
C 3 672 GLU 672 672 672 GLU GLU A . n 
C 3 673 TYR 673 673 673 TYR TYR A . n 
C 3 674 MET 674 674 674 MET MET A . n 
C 3 675 ASN 675 675 675 ASN ASN A . n 
C 3 676 ASN 676 676 676 ASN ASN A . n 
C 3 677 LYS 677 677 677 LYS LYS A . n 
C 3 678 GLN 678 678 678 GLN GLN A . n 
C 3 679 HIS 679 679 679 HIS HIS A . n 
C 3 680 LEU 680 680 680 LEU LEU A . n 
C 3 681 MET 681 681 681 MET MET A . n 
C 3 682 PHE 682 682 682 PHE PHE A . n 
C 3 683 MET 683 683 683 MET MET A . n 
C 3 684 ASP 684 684 684 ASP ASP A . n 
C 3 685 ARG 685 685 685 ARG ARG A . n 
C 3 686 GLU 686 686 686 GLU GLU A . n 
C 3 687 ALA 687 687 687 ALA ALA A . n 
C 3 688 ILE 688 688 688 ILE ILE A . n 
C 3 689 ALA 689 689 689 ALA ALA A . n 
C 3 690 GLY 690 690 690 GLY GLY A . n 
C 3 691 PRO 691 691 691 PRO PRO A . n 
C 3 692 PRO 692 692 692 PRO PRO A . n 
C 3 693 LEU 693 693 693 LEU LEU A . n 
C 3 694 GLY 694 694 694 GLY GLY A . n 
C 3 695 SER 695 695 695 SER SER A . n 
C 3 696 LYS 696 696 696 LYS LYS A . n 
C 3 697 GLY 697 697 697 GLY GLY A . n 
C 3 698 ILE 698 698 698 ILE ILE A . n 
C 3 699 GLY 699 699 699 GLY GLY A . n 
C 3 700 GLY 700 700 700 GLY GLY A . n 
C 3 701 PHE 701 701 701 PHE PHE A . n 
C 3 702 TRP 702 702 702 TRP TRP A . n 
C 3 703 THR 703 703 703 THR THR A . n 
C 3 704 GLY 704 704 704 GLY GLY A . n 
C 3 705 LYS 705 705 705 LYS LYS A . n 
C 3 706 LYS 706 706 706 LYS LYS A . n 
C 3 707 ARG 707 707 707 ARG ARG A . n 
C 3 708 TYR 708 708 708 TYR TYR A . n 
C 3 709 ALA 709 709 709 ALA ALA A . n 
C 3 710 LEU 710 710 710 LEU LEU A . n 
C 3 711 ASN 711 711 711 ASN ASN A . n 
C 3 712 VAL 712 712 712 VAL VAL A . n 
C 3 713 TRP 713 713 713 TRP TRP A . n 
C 3 714 ASP 714 714 714 ASP ASP A . n 
C 3 715 MET 715 715 715 MET MET A . n 
C 3 716 GLU 716 716 716 GLU GLU A . n 
C 3 717 GLY 717 717 717 GLY GLY A . n 
C 3 718 THR 718 718 718 THR THR A . n 
C 3 719 ARG 719 719 719 ARG ARG A . n 
C 3 720 TYR 720 720 720 TYR TYR A . n 
C 3 721 ALA 721 721 721 ALA ALA A . n 
C 3 722 GLU 722 722 722 GLU GLU A . n 
C 3 723 PRO 723 723 723 PRO PRO A . n 
C 3 724 LYS 724 724 724 LYS LYS A . n 
C 3 725 LEU 725 725 725 LEU LEU A . n 
C 3 726 LYS 726 726 726 LYS LYS A . n 
C 3 727 ILE 727 727 727 ILE ILE A . n 
C 3 728 MET 728 728 728 MET MET A . n 
C 3 729 GLY 729 729 729 GLY GLY A . n 
C 3 730 LEU 730 730 730 LEU LEU A . n 
C 3 731 GLU 731 731 731 GLU GLU A . n 
C 3 732 THR 732 732 732 THR THR A . n 
C 3 733 GLN 733 733 733 GLN GLN A . n 
C 3 734 LYS 734 734 734 LYS LYS A . n 
C 3 735 SER 735 735 735 SER SER A . n 
C 3 736 SER 736 736 736 SER SER A . n 
C 3 737 THR 737 737 737 THR THR A . n 
C 3 738 PRO 738 738 738 PRO PRO A . n 
C 3 739 LYS 739 739 739 LYS LYS A . n 
C 3 740 ALA 740 740 740 ALA ALA A . n 
C 3 741 VAL 741 741 741 VAL VAL A . n 
C 3 742 GLN 742 742 742 GLN GLN A . n 
C 3 743 LYS 743 743 743 LYS LYS A . n 
C 3 744 ALA 744 744 744 ALA ALA A . n 
C 3 745 LEU 745 745 745 LEU LEU A . n 
C 3 746 LYS 746 746 746 LYS LYS A . n 
C 3 747 GLU 747 747 747 GLU GLU A . n 
C 3 748 CYS 748 748 748 CYS CYS A . n 
C 3 749 ILE 749 749 749 ILE ILE A . n 
C 3 750 ARG 750 750 750 ARG ARG A . n 
C 3 751 ARG 751 751 751 ARG ARG A . n 
C 3 752 MET 752 752 752 MET MET A . n 
C 3 753 LEU 753 753 753 LEU LEU A . n 
C 3 754 GLN 754 754 754 GLN GLN A . n 
C 3 755 GLU 755 755 755 GLU GLU A . n 
C 3 756 GLY 756 756 756 GLY GLY A . n 
C 3 757 GLU 757 757 757 GLU GLU A . n 
C 3 758 GLU 758 758 758 GLU GLU A . n 
C 3 759 SER 759 759 759 SER SER A . n 
C 3 760 LEU 760 760 760 LEU LEU A . n 
C 3 761 GLN 761 761 761 GLN GLN A . n 
C 3 762 GLU 762 762 762 GLU GLU A . n 
C 3 763 TYR 763 763 763 TYR TYR A . n 
C 3 764 PHE 764 764 764 PHE PHE A . n 
C 3 765 LYS 765 765 765 LYS LYS A . n 
C 3 766 GLU 766 766 766 GLU GLU A . n 
C 3 767 PHE 767 767 767 PHE PHE A . n 
C 3 768 GLU 768 768 768 GLU GLU A . n 
C 3 769 LYS 769 769 769 LYS LYS A . n 
C 3 770 GLU 770 770 770 GLU GLU A . n 
C 3 771 PHE 771 771 771 PHE PHE A . n 
C 3 772 ARG 772 772 772 ARG ARG A . n 
C 3 773 GLN 773 773 773 GLN GLN A . n 
C 3 774 LEU 774 774 774 LEU LEU A . n 
C 3 775 ASN 775 775 775 ASN ASN A . n 
C 3 776 TYR 776 776 776 TYR TYR A . n 
C 3 777 ILE 777 777 777 ILE ILE A . n 
C 3 778 SER 778 778 778 SER SER A . n 
C 3 779 ILE 779 779 779 ILE ILE A . n 
C 3 780 ALA 780 780 780 ALA ALA A . n 
C 3 781 SER 781 781 781 SER SER A . n 
C 3 782 VAL 782 782 782 VAL VAL A . n 
C 3 783 SER 783 783 783 SER SER A . n 
C 3 784 SER 784 784 784 SER SER A . n 
C 3 785 ALA 785 785 785 ALA ALA A . n 
C 3 786 ASN 786 786 786 ASN ASN A . n 
C 3 787 ASN 787 787 787 ASN ASN A . n 
C 3 788 ILE 788 788 788 ILE ILE A . n 
C 3 789 ALA 789 789 789 ALA ALA A . n 
C 3 790 LYS 790 790 790 LYS LYS A . n 
C 3 791 TYR 791 791 791 TYR TYR A . n 
C 3 792 ASP 792 792 792 ASP ASP A . n 
C 3 793 VAL 793 793 793 VAL VAL A . n 
C 3 794 GLY 794 794 794 GLY GLY A . n 
C 3 795 GLY 795 795 795 GLY GLY A . n 
C 3 796 PHE 796 796 796 PHE PHE A . n 
C 3 797 PRO 797 797 797 PRO PRO A . n 
C 3 798 GLY 798 798 798 GLY GLY A . n 
C 3 799 PRO 799 799 799 PRO PRO A . n 
C 3 800 LYS 800 800 800 LYS LYS A . n 
C 3 801 CYS 801 801 801 CYS CYS A . n 
C 3 802 PRO 802 802 802 PRO PRO A . n 
C 3 803 PHE 803 803 803 PHE PHE A . n 
C 3 804 HIS 804 804 804 HIS HIS A . n 
C 3 805 ILE 805 805 805 ILE ILE A . n 
C 3 806 ARG 806 806 806 ARG ARG A . n 
C 3 807 GLY 807 807 807 GLY GLY A . n 
C 3 808 ILE 808 808 808 ILE ILE A . n 
C 3 809 LEU 809 809 809 LEU LEU A . n 
C 3 810 THR 810 810 810 THR THR A . n 
C 3 811 TYR 811 811 811 TYR TYR A . n 
C 3 812 ASN 812 812 812 ASN ASN A . n 
C 3 813 ARG 813 813 813 ARG ARG A . n 
C 3 814 ALA 814 814 814 ALA ALA A . n 
C 3 815 ILE 815 815 815 ILE ILE A . n 
C 3 816 LYS 816 816 816 LYS LYS A . n 
C 3 817 GLY 817 817 817 GLY GLY A . n 
C 3 818 ASN 818 818 818 ASN ASN A . n 
C 3 819 ILE 819 819 819 ILE ILE A . n 
C 3 820 ASP 820 820 820 ASP ASP A . n 
C 3 821 ALA 821 821 821 ALA ALA A . n 
C 3 822 PRO 822 822 822 PRO PRO A . n 
C 3 823 GLN 823 823 823 GLN GLN A . n 
C 3 824 VAL 824 824 824 VAL VAL A . n 
C 3 825 VAL 825 825 825 VAL VAL A . n 
C 3 826 GLU 826 826 826 GLU GLU A . n 
C 3 827 GLY 827 827 827 GLY GLY A . n 
C 3 828 GLU 828 828 828 GLU GLU A . n 
C 3 829 LYS 829 829 829 LYS LYS A . n 
C 3 830 VAL 830 830 830 VAL VAL A . n 
C 3 831 TYR 831 831 831 TYR TYR A . n 
C 3 832 VAL 832 832 832 VAL VAL A . n 
C 3 833 LEU 833 833 833 LEU LEU A . n 
C 3 834 PRO 834 834 834 PRO PRO A . n 
C 3 835 LEU 835 835 835 LEU LEU A . n 
C 3 836 ARG 836 836 836 ARG ARG A . n 
C 3 837 GLU 837 837 837 GLU GLU A . n 
C 3 838 GLY 838 838 838 GLY GLY A . n 
C 3 839 ASN 839 839 839 ASN ASN A . n 
C 3 840 PRO 840 840 840 PRO PRO A . n 
C 3 841 PHE 841 841 841 PHE PHE A . n 
C 3 842 GLY 842 842 842 GLY GLY A . n 
C 3 843 ASP 843 843 843 ASP ASP A . n 
C 3 844 LYS 844 844 844 LYS LYS A . n 
C 3 845 CYS 845 845 845 CYS CYS A . n 
C 3 846 ILE 846 846 846 ILE ILE A . n 
C 3 847 ALA 847 847 847 ALA ALA A . n 
C 3 848 TRP 848 848 848 TRP TRP A . n 
C 3 849 PRO 849 849 849 PRO PRO A . n 
C 3 850 SER 850 850 850 SER SER A . n 
C 3 851 GLY 851 851 851 GLY GLY A . n 
C 3 852 THR 852 852 852 THR THR A . n 
C 3 853 GLU 853 853 853 GLU GLU A . n 
C 3 854 ILE 854 854 854 ILE ILE A . n 
C 3 855 THR 855 855 855 THR THR A . n 
C 3 856 ASP 856 856 856 ASP ASP A . n 
C 3 857 LEU 857 857 857 LEU LEU A . n 
C 3 858 ILE 858 858 858 ILE ILE A . n 
C 3 859 LYS 859 859 859 LYS LYS A . n 
C 3 860 ASP 860 860 860 ASP ASP A . n 
C 3 861 ASP 861 861 861 ASP ASP A . n 
C 3 862 VAL 862 862 862 VAL VAL A . n 
C 3 863 LEU 863 863 863 LEU LEU A . n 
C 3 864 HIS 864 864 864 HIS HIS A . n 
C 3 865 TRP 865 865 865 TRP TRP A . n 
C 3 866 MET 866 866 866 MET MET A . n 
C 3 867 ASP 867 867 867 ASP ASP A . n 
C 3 868 TYR 868 868 868 TYR TYR A . n 
C 3 869 THR 869 869 869 THR THR A . n 
C 3 870 VAL 870 870 870 VAL VAL A . n 
C 3 871 LEU 871 871 871 LEU LEU A . n 
C 3 872 LEU 872 872 872 LEU LEU A . n 
C 3 873 GLU 873 873 873 GLU GLU A . n 
C 3 874 LYS 874 874 874 LYS LYS A . n 
C 3 875 THR 875 875 875 THR THR A . n 
C 3 876 PHE 876 876 876 PHE PHE A . n 
C 3 877 ILE 877 877 877 ILE ILE A . n 
C 3 878 LYS 878 878 878 LYS LYS A . n 
C 3 879 PRO 879 879 879 PRO PRO A . n 
C 3 880 LEU 880 880 880 LEU LEU A . n 
C 3 881 GLU 881 881 881 GLU GLU A . n 
C 3 882 GLY 882 882 882 GLY GLY A . n 
C 3 883 PHE 883 883 883 PHE PHE A . n 
C 3 884 THR 884 884 884 THR THR A . n 
C 3 885 SER 885 885 885 SER SER A . n 
C 3 886 ALA 886 886 886 ALA ALA A . n 
C 3 887 ALA 887 887 887 ALA ALA A . n 
C 3 888 LYS 888 888 888 LYS LYS A . n 
C 3 889 LEU 889 889 889 LEU LEU A . n 
C 3 890 ASP 890 890 890 ASP ASP A . n 
C 3 891 TYR 891 891 891 TYR TYR A . n 
C 3 892 GLU 892 892 892 GLU GLU A . n 
C 3 893 LYS 893 893 893 LYS LYS A . n 
C 3 894 LYS 894 894 894 LYS LYS A . n 
C 3 895 ALA 895 895 895 ALA ALA A . n 
C 3 896 SER 896 896 896 SER SER A . n 
C 3 897 LEU 897 897 897 LEU LEU A . n 
C 3 898 PHE 898 898 898 PHE PHE A . n 
C 3 899 ASP 899 899 899 ASP ASP A . n 
C 3 900 MET 900 900 900 MET MET A . n 
C 3 901 PHE 901 901 901 PHE PHE A . n 
C 3 902 ASP 902 902 902 ASP ASP A . n 
C 3 903 PHE 903 903 903 PHE PHE A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O     ? C ASN 505 ? A ASN 505  ? 1_555 CA ? G CA . ? A CA 1001 ? 1_555 OD1   ? C ASN 507 ? A ASN 507  ? 1_555 83.3  ? 
2  O     ? C ASN 505 ? A ASN 505  ? 1_555 CA ? G CA . ? A CA 1001 ? 1_555 O     ? C LYS 531 ? A LYS 531  ? 1_555 146.7 ? 
3  OD1   ? C ASN 507 ? A ASN 507  ? 1_555 CA ? G CA . ? A CA 1001 ? 1_555 O     ? C LYS 531 ? A LYS 531  ? 1_555 70.4  ? 
4  OP1   ? B DG  12  ? D DG  1    ? 1_555 CA ? H CA . ? A CA 1002 ? 1_555 OE1   ? C GLU 116 ? A GLU 116  ? 1_555 84.2  ? 
5  OP1   ? B DG  12  ? D DG  1    ? 1_555 CA ? H CA . ? A CA 1002 ? 1_555 OE2   ? C GLU 116 ? A GLU 116  ? 1_555 107.3 ? 
6  OE1   ? C GLU 116 ? A GLU 116  ? 1_555 CA ? H CA . ? A CA 1002 ? 1_555 OE2   ? C GLU 116 ? A GLU 116  ? 1_555 44.5  ? 
7  OD1   ? C ASP 275 ? A ASP 275  ? 1_555 CA ? I CA . ? A CA 1004 ? 1_555 OE1   ? C GLU 219 ? A GLU 219  ? 1_555 84.8  ? 
8  OD1   ? C ASP 275 ? A ASP 275  ? 1_555 CA ? I CA . ? A CA 1004 ? 1_555 OD2   ? C ASP 275 ? A ASP 275  ? 1_555 52.1  ? 
9  OE1   ? C GLU 219 ? A GLU 219  ? 1_555 CA ? I CA . ? A CA 1004 ? 1_555 OD2   ? C ASP 275 ? A ASP 275  ? 1_555 73.6  ? 
10 O     ? C ASN 676 ? A ASN 676  ? 1_555 CA ? K CA . ? A CA 1006 ? 1_555 N     ? C ASN 676 ? A ASN 676  ? 1_555 55.5  ? 
11 OD2   ? C ASP 621 ? A ASP 621  ? 1_555 CA ? L CA . ? A CA 1025 ? 1_555 OG    ? C SER 624 ? A SER 624  ? 1_555 63.8  ? 
12 OD2   ? C ASP 621 ? A ASP 621  ? 1_555 CA ? L CA . ? A CA 1025 ? 1_555 OD1   ? C ASP 623 ? A ASP 623  ? 1_555 71.0  ? 
13 OG    ? C SER 624 ? A SER 624  ? 1_555 CA ? L CA . ? A CA 1025 ? 1_555 OD1   ? C ASP 623 ? A ASP 623  ? 1_555 59.9  ? 
14 OD2   ? C ASP 621 ? A ASP 621  ? 1_555 CA ? L CA . ? A CA 1025 ? 1_555 O     ? P HOH .   ? A HOH 1071 ? 1_555 110.8 ? 
15 OG    ? C SER 624 ? A SER 624  ? 1_555 CA ? L CA . ? A CA 1025 ? 1_555 O     ? P HOH .   ? A HOH 1071 ? 1_555 164.2 ? 
16 OD1   ? C ASP 623 ? A ASP 623  ? 1_555 CA ? L CA . ? A CA 1025 ? 1_555 O     ? P HOH .   ? A HOH 1071 ? 1_555 104.6 ? 
17 OD2   ? C ASP 621 ? A ASP 621  ? 1_555 CA ? L CA . ? A CA 1025 ? 1_555 O     ? P HOH .   ? A HOH 1150 ? 1_555 145.6 ? 
18 OG    ? C SER 624 ? A SER 624  ? 1_555 CA ? L CA . ? A CA 1025 ? 1_555 O     ? P HOH .   ? A HOH 1150 ? 1_555 113.2 ? 
19 OD1   ? C ASP 623 ? A ASP 623  ? 1_555 CA ? L CA . ? A CA 1025 ? 1_555 O     ? P HOH .   ? A HOH 1150 ? 1_555 78.4  ? 
20 O     ? P HOH .   ? A HOH 1071 ? 1_555 CA ? L CA . ? A CA 1025 ? 1_555 O     ? P HOH .   ? A HOH 1150 ? 1_555 62.0  ? 
21 "O3'" ? B DC  11  ? D DC  2    ? 1_555 CA ? E CA . ? D CA 1003 ? 1_555 OP1   ? B DG  12  ? D DG  1    ? 1_555 54.0  ? 
22 "O3'" ? B DC  11  ? D DC  2    ? 1_555 CA ? E CA . ? D CA 1003 ? 1_555 O     ? P HOH .   ? A HOH 1185 ? 1_555 91.9  ? 
23 OP1   ? B DG  12  ? D DG  1    ? 1_555 CA ? E CA . ? D CA 1003 ? 1_555 O     ? P HOH .   ? A HOH 1185 ? 1_555 145.1 ? 
24 "O3'" ? B DC  11  ? D DC  2    ? 1_555 CA ? E CA . ? D CA 1003 ? 1_555 OD2   ? C ASP 114 ? A ASP 114  ? 1_555 143.4 ? 
25 OP1   ? B DG  12  ? D DG  1    ? 1_555 CA ? E CA . ? D CA 1003 ? 1_555 OD2   ? C ASP 114 ? A ASP 114  ? 1_555 90.4  ? 
26 O     ? P HOH .   ? A HOH 1185 ? 1_555 CA ? E CA . ? D CA 1003 ? 1_555 OD2   ? C ASP 114 ? A ASP 114  ? 1_555 124.4 ? 
27 "O3'" ? B DC  11  ? D DC  2    ? 1_555 CA ? E CA . ? D CA 1003 ? 1_555 OD1   ? C ASP 114 ? A ASP 114  ? 1_555 150.8 ? 
28 OP1   ? B DG  12  ? D DG  1    ? 1_555 CA ? E CA . ? D CA 1003 ? 1_555 OD1   ? C ASP 114 ? A ASP 114  ? 1_555 119.3 ? 
29 O     ? P HOH .   ? A HOH 1185 ? 1_555 CA ? E CA . ? D CA 1003 ? 1_555 OD1   ? C ASP 114 ? A ASP 114  ? 1_555 86.0  ? 
30 OD2   ? C ASP 114 ? A ASP 114  ? 1_555 CA ? E CA . ? D CA 1003 ? 1_555 OD1   ? C ASP 114 ? A ASP 114  ? 1_555 50.3  ? 
31 "O5'" ? B DT  6   ? D DT  7    ? 1_555 CA ? F CA . ? D CA 1009 ? 1_555 OP2   ? B DT  6   ? D DT  7    ? 1_555 49.6  ? 
32 "O5'" ? A DC  10  ? E DC  11   ? 1_555 CA ? D CA . ? E CA 1024 ? 1_555 "O3'" ? A DA  9   ? E DA  10   ? 1_555 56.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-10-28 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       . ? 1 
DENZO     'data reduction' . ? 2 
SCALEPACK 'data scaling'   . ? 3 
CNS       phasing          . ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   "O5'" 
_pdbx_validate_close_contact.auth_asym_id_1   E 
_pdbx_validate_close_contact.auth_comp_id_1   DG 
_pdbx_validate_close_contact.auth_seq_id_1    2 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   N 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ASN 
_pdbx_validate_close_contact.auth_seq_id_2    255 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.07 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O5'" E DG  2   ? ? "C5'" E DG  2   ? ? "C4'" E DG  2   ? ? 101.68 109.40 -7.72  0.80 N 
2  1 "O4'" E DG  2   ? ? "C1'" E DG  2   ? ? N9    E DG  2   ? ? 110.15 108.30 1.85   0.30 N 
3  1 "O4'" E DA  7   ? ? "C1'" E DA  7   ? ? N9    E DA  7   ? ? 110.73 108.30 2.43   0.30 N 
4  1 "O4'" E DT  12  ? ? "C1'" E DT  12  ? ? N1    E DT  12  ? ? 113.56 108.30 5.26   0.30 N 
5  1 "O5'" D DA  12  ? ? "C5'" D DA  12  ? ? "C4'" D DA  12  ? ? 104.05 109.40 -5.35  0.80 N 
6  1 "O4'" D DA  12  ? ? "C1'" D DA  12  ? ? "C2'" D DA  12  ? ? 113.98 106.80 7.18   0.50 N 
7  1 N9    D DA  12  ? ? "C1'" D DA  12  ? ? "C2'" D DA  12  ? ? 127.94 114.30 13.64  1.40 N 
8  1 "O4'" D DA  12  ? ? "C1'" D DA  12  ? ? N9    D DA  12  ? ? 114.28 108.30 5.98   0.30 N 
9  1 C8    D DA  12  ? ? N9    D DA  12  ? ? "C1'" D DA  12  ? ? 142.09 127.70 14.39  1.80 N 
10 1 C4    D DA  12  ? ? N9    D DA  12  ? ? "C1'" D DA  12  ? ? 112.01 126.30 -14.29 1.80 N 
11 1 "O4'" D DA  9   ? ? "C1'" D DA  9   ? ? "C2'" D DA  9   ? ? 110.09 106.80 3.29   0.50 N 
12 1 "O4'" D DG  8   ? ? "C1'" D DG  8   ? ? "C2'" D DG  8   ? ? 110.63 106.80 3.83   0.50 N 
13 1 "O4'" D DC  5   ? ? "C1'" D DC  5   ? ? "C2'" D DC  5   ? ? 110.06 106.80 3.26   0.50 N 
14 1 "O4'" D DC  4   ? ? "C1'" D DC  4   ? ? N1    D DC  4   ? ? 110.35 108.30 2.05   0.30 N 
15 1 CA    A LEU 412 ? ? CB    A LEU 412 ? ? CG    A LEU 412 ? ? 134.96 115.30 19.66  2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 43  ? ? -64.06  15.39   
2  1 THR A 47  ? ? -128.66 -107.12 
3  1 TYR A 99  ? ? 176.20  156.46  
4  1 ASP A 121 ? ? -76.02  -144.09 
5  1 ILE A 136 ? ? -172.60 115.27  
6  1 LEU A 152 ? ? -144.23 -4.60   
7  1 ILE A 166 ? ? -59.46  -71.46  
8  1 ALA A 167 ? ? -15.28  -39.72  
9  1 GLU A 172 ? ? -61.41  26.19   
10 1 GLN A 173 ? ? -151.71 -12.01  
11 1 PRO A 179 ? ? -34.46  146.30  
12 1 GLU A 181 ? ? -61.34  20.11   
13 1 GLU A 196 ? ? -59.47  -74.53  
14 1 LYS A 208 ? ? -153.03 63.68   
15 1 ASN A 217 ? ? 82.41   29.96   
16 1 PHE A 221 ? ? -141.62 -69.08  
17 1 LYS A 240 ? ? -69.55  0.02    
18 1 MET A 256 ? ? 44.89   -80.85  
19 1 LYS A 302 ? ? -61.32  93.50   
20 1 LEU A 303 ? ? -34.07  122.65  
21 1 TYR A 305 ? ? -174.46 134.61  
22 1 LYS A 352 ? ? 64.26   67.22   
23 1 ASN A 402 ? ? 179.12  -178.30 
24 1 SER A 414 ? ? 28.54   52.09   
25 1 ASN A 424 ? ? 78.04   46.95   
26 1 LEU A 508 ? ? -61.08  98.77   
27 1 SER A 509 ? ? 179.39  -170.87 
28 1 ASP A 511 ? ? -140.92 -157.18 
29 1 LYS A 536 ? ? -61.24  -73.28  
30 1 ASP A 621 ? ? -76.16  -154.90 
31 1 ASP A 623 ? ? -143.55 11.41   
32 1 ARG A 642 ? ? -57.97  -89.20  
33 1 ASN A 645 ? ? -59.28  -2.75   
34 1 ASN A 675 ? ? 50.96   74.95   
35 1 LYS A 739 ? ? -37.33  -39.44  
36 1 ALA A 780 ? ? -61.59  -173.62 
37 1 SER A 783 ? ? 175.31  171.29  
38 1 ASN A 787 ? ? 153.81  56.07   
39 1 GLU A 828 ? ? -67.90  -165.28 
40 1 ILE A 854 ? ? -38.71  131.29  
41 1 LYS A 888 ? ? 71.85   43.02   
42 1 LEU A 897 ? ? -25.76  -37.12  
43 1 ASP A 899 ? ? -74.90  39.35   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DT  E 12  ? ? 0.195 'SIDE CHAIN' 
2 1 TYR A 567 ? ? 0.064 'SIDE CHAIN' 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1CLQ 'double helix'         
1CLQ 'b-form double helix'  
1CLQ 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 1  1_555 B DG 10 1_555 6.067  -0.737 1.074  -5.403  11.740  -103.673 1  E_DG2:DG3_D   E 2  ? D 3  ? 7  ? 
1 A DG 3  1_555 B DC 9  1_555 -0.262 -0.033 0.299  -11.979 -7.751  -1.763   2  E_DG4:DC4_D   E 4  ? D 4  ? 19 1 
1 A DG 4  1_555 B DC 8  1_555 -1.247 -1.037 0.236  2.332   7.282   3.568    3  E_DG5:DC5_D   E 5  ? D 5  ? 19 1 
1 A DA 5  1_555 B DT 7  1_555 0.240  0.161  -0.351 5.412   -15.708 -23.097  4  E_DA6:DT6_D   E 6  ? D 6  ? 20 1 
1 A DA 6  1_555 B DT 6  1_555 0.214  0.027  -0.284 10.601  4.934   -9.047   5  E_DA7:DT7_D   E 7  ? D 7  ? 20 1 
1 A DC 7  1_555 B DG 5  1_555 -2.018 -0.455 0.168  1.965   5.059   -12.160  6  E_DC8:DG8_D   E 8  ? D 8  ? 19 1 
1 A DT 8  1_555 B DA 4  1_555 -0.475 -0.427 0.693  -1.972  -22.455 -12.853  7  E_DT9:DA9_D   E 9  ? D 9  ? 20 1 
1 A DA 9  1_555 B DT 3  1_555 -0.040 -0.215 0.652  -3.341  -2.266  -13.816  8  E_DA10:DT10_D E 10 ? D 10 ? 20 1 
1 A DC 10 1_555 B DG 2  1_555 -0.229 -0.179 0.495  4.454   -9.517  -18.459  9  E_DC11:DG11_D E 11 ? D 11 ? 19 1 
1 A DT 11 1_555 B DA 1  1_555 1.183  -2.820 -1.181 -8.420  0.516   150.643  10 E_DT12:DA12_D E 12 ? D 12 ? ?  2 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 1  1_555 B DG 10 1_555 A DG 3  1_555 B DC 9 1_555 -1.548 6.845  -1.846 -81.330 -107.789 -21.163 -2.907 -1.428 4.076  68.374 
-51.590 -135.835 1 EE_DG2DG4:DC4DG3_DD     E 2  ? D 3  ? E 4  ? D 4  ? 
1 A DG 3  1_555 B DC 9  1_555 A DG 4  1_555 B DC 8 1_555 1.326  0.065  3.001  -1.347  -4.351   24.212  1.359  -3.482 2.869  
-10.256 3.175   24.630   2 EE_DG4DG5:DC5DC4_DD     E 4  ? D 4  ? E 5  ? D 5  ? 
1 A DG 4  1_555 B DC 8  1_555 A DA 5  1_555 B DT 7 1_555 -2.135 0.566  3.474  1.047   -6.394   39.804  1.573  3.221  3.293  -9.317 
-1.526  40.307   3 EE_DG5DA6:DT6DC5_DD     E 5  ? D 5  ? E 6  ? D 6  ? 
1 A DA 5  1_555 B DT 7  1_555 A DA 6  1_555 B DT 6 1_555 1.598  -0.879 3.118  -0.398  0.792    32.331  -1.710 -2.936 3.077  1.423 
0.714   32.343   4 EE_DA6DA7:DT7DT6_DD     E 6  ? D 6  ? E 7  ? D 7  ? 
1 A DA 6  1_555 B DT 6  1_555 A DC 7  1_555 B DG 5 1_555 -0.112 -1.845 3.396  -9.054  3.775    29.241  -4.217 -1.574 3.038  7.226 
17.331  30.808   5 EE_DA7DC8:DG8DT7_DD     E 7  ? D 7  ? E 8  ? D 8  ? 
1 A DC 7  1_555 B DG 5  1_555 A DT 8  1_555 B DA 4 1_555 -0.113 -0.901 3.468  3.132   -9.032   46.584  -0.327 0.414  3.560  
-11.282 -3.912  47.501   6 EE_DC8DT9:DA9DG8_DD     E 8  ? D 8  ? E 9  ? D 9  ? 
1 A DT 8  1_555 B DA 4  1_555 A DA 9  1_555 B DT 3 1_555 -0.055 -1.086 2.961  0.326   1.845    34.091  -2.112 0.140  2.899  3.145 
-0.555  34.141   7 EE_DT9DA10:DT10DA9_DD   E 9  ? D 9  ? E 10 ? D 10 ? 
1 A DA 9  1_555 B DT 3  1_555 A DC 10 1_555 B DG 2 1_555 -0.471 -0.791 3.008  4.227   -7.681   33.816  -0.227 1.386  3.031  
-12.937 -7.120  34.902   8 EE_DA10DC11:DG11DT10_DD E 10 ? D 10 ? E 11 ? D 11 ? 
1 A DC 10 1_555 B DG 2  1_555 A DT 11 1_555 B DA 1 1_555 1.782  3.573  -0.448 168.744 -5.011   162.477 1.786  -0.915 -0.189 -2.507 
-84.437 178.299  9 EE_DC11DT12:DA12DG11_DD E 11 ? D 11 ? E 12 ? D 12 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'CALCIUM ION'              CA  
5 "GUANOSINE-5'-DIPHOSPHATE" GDP 
6 water                      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 CA  1   1024 1024 CA  CA  E . 
E 4 CA  1   1003 1003 CA  CA  D . 
F 4 CA  1   1009 1009 CA  CA  D . 
G 4 CA  1   1001 1001 CA  CA  A . 
H 4 CA  1   1002 1002 CA  CA  A . 
I 4 CA  1   1004 1004 CA  CA  A . 
J 4 CA  1   1005 1005 CA  CA  A . 
K 4 CA  1   1006 1006 CA  CA  A . 
L 4 CA  1   1025 1025 CA  CA  A . 
M 5 GDP 1   999  999  GDP GDP A . 
N 6 HOH 1   1025 12   HOH HOH E . 
N 6 HOH 2   1026 35   HOH HOH E . 
N 6 HOH 3   1027 39   HOH HOH E . 
N 6 HOH 4   1028 42   HOH HOH E . 
N 6 HOH 5   1029 84   HOH HOH E . 
O 6 HOH 1   1010 6    HOH HOH D . 
O 6 HOH 2   1011 14   HOH HOH D . 
O 6 HOH 3   1012 46   HOH HOH D . 
O 6 HOH 4   1013 65   HOH HOH D . 
P 6 HOH 1   1026 1    HOH HOH A . 
P 6 HOH 2   1027 2    HOH HOH A . 
P 6 HOH 3   1028 3    HOH HOH A . 
P 6 HOH 4   1029 4    HOH HOH A . 
P 6 HOH 5   1030 5    HOH HOH A . 
P 6 HOH 6   1031 7    HOH HOH A . 
P 6 HOH 7   1032 8    HOH HOH A . 
P 6 HOH 8   1033 9    HOH HOH A . 
P 6 HOH 9   1034 10   HOH HOH A . 
P 6 HOH 10  1035 11   HOH HOH A . 
P 6 HOH 11  1036 13   HOH HOH A . 
P 6 HOH 12  1037 15   HOH HOH A . 
P 6 HOH 13  1038 16   HOH HOH A . 
P 6 HOH 14  1039 17   HOH HOH A . 
P 6 HOH 15  1040 18   HOH HOH A . 
P 6 HOH 16  1041 19   HOH HOH A . 
P 6 HOH 17  1042 20   HOH HOH A . 
P 6 HOH 18  1043 21   HOH HOH A . 
P 6 HOH 19  1044 22   HOH HOH A . 
P 6 HOH 20  1045 24   HOH HOH A . 
P 6 HOH 21  1046 25   HOH HOH A . 
P 6 HOH 22  1047 26   HOH HOH A . 
P 6 HOH 23  1048 27   HOH HOH A . 
P 6 HOH 24  1049 28   HOH HOH A . 
P 6 HOH 25  1050 29   HOH HOH A . 
P 6 HOH 26  1051 30   HOH HOH A . 
P 6 HOH 27  1052 31   HOH HOH A . 
P 6 HOH 28  1053 32   HOH HOH A . 
P 6 HOH 29  1054 33   HOH HOH A . 
P 6 HOH 30  1055 34   HOH HOH A . 
P 6 HOH 31  1056 36   HOH HOH A . 
P 6 HOH 32  1057 37   HOH HOH A . 
P 6 HOH 33  1058 38   HOH HOH A . 
P 6 HOH 34  1059 40   HOH HOH A . 
P 6 HOH 35  1060 41   HOH HOH A . 
P 6 HOH 36  1061 43   HOH HOH A . 
P 6 HOH 37  1062 44   HOH HOH A . 
P 6 HOH 38  1063 45   HOH HOH A . 
P 6 HOH 39  1064 47   HOH HOH A . 
P 6 HOH 40  1065 48   HOH HOH A . 
P 6 HOH 41  1066 49   HOH HOH A . 
P 6 HOH 42  1067 50   HOH HOH A . 
P 6 HOH 43  1068 51   HOH HOH A . 
P 6 HOH 44  1069 52   HOH HOH A . 
P 6 HOH 45  1070 53   HOH HOH A . 
P 6 HOH 46  1071 54   HOH HOH A . 
P 6 HOH 47  1072 55   HOH HOH A . 
P 6 HOH 48  1073 56   HOH HOH A . 
P 6 HOH 49  1074 57   HOH HOH A . 
P 6 HOH 50  1075 58   HOH HOH A . 
P 6 HOH 51  1076 59   HOH HOH A . 
P 6 HOH 52  1077 60   HOH HOH A . 
P 6 HOH 53  1078 61   HOH HOH A . 
P 6 HOH 54  1079 62   HOH HOH A . 
P 6 HOH 55  1080 63   HOH HOH A . 
P 6 HOH 56  1081 64   HOH HOH A . 
P 6 HOH 57  1082 66   HOH HOH A . 
P 6 HOH 58  1083 67   HOH HOH A . 
P 6 HOH 59  1084 68   HOH HOH A . 
P 6 HOH 60  1085 69   HOH HOH A . 
P 6 HOH 61  1086 70   HOH HOH A . 
P 6 HOH 62  1087 71   HOH HOH A . 
P 6 HOH 63  1088 72   HOH HOH A . 
P 6 HOH 64  1089 73   HOH HOH A . 
P 6 HOH 65  1090 74   HOH HOH A . 
P 6 HOH 66  1091 75   HOH HOH A . 
P 6 HOH 67  1092 76   HOH HOH A . 
P 6 HOH 68  1093 77   HOH HOH A . 
P 6 HOH 69  1094 78   HOH HOH A . 
P 6 HOH 70  1095 79   HOH HOH A . 
P 6 HOH 71  1096 80   HOH HOH A . 
P 6 HOH 72  1097 81   HOH HOH A . 
P 6 HOH 73  1098 82   HOH HOH A . 
P 6 HOH 74  1099 83   HOH HOH A . 
P 6 HOH 75  1100 85   HOH HOH A . 
P 6 HOH 76  1101 86   HOH HOH A . 
P 6 HOH 77  1102 87   HOH HOH A . 
P 6 HOH 78  1103 88   HOH HOH A . 
P 6 HOH 79  1104 89   HOH HOH A . 
P 6 HOH 80  1105 90   HOH HOH A . 
P 6 HOH 81  1106 91   HOH HOH A . 
P 6 HOH 82  1107 92   HOH HOH A . 
P 6 HOH 83  1108 93   HOH HOH A . 
P 6 HOH 84  1109 94   HOH HOH A . 
P 6 HOH 85  1110 95   HOH HOH A . 
P 6 HOH 86  1111 96   HOH HOH A . 
P 6 HOH 87  1112 97   HOH HOH A . 
P 6 HOH 88  1113 98   HOH HOH A . 
P 6 HOH 89  1114 99   HOH HOH A . 
P 6 HOH 90  1115 100  HOH HOH A . 
P 6 HOH 91  1116 101  HOH HOH A . 
P 6 HOH 92  1117 102  HOH HOH A . 
P 6 HOH 93  1118 103  HOH HOH A . 
P 6 HOH 94  1119 104  HOH HOH A . 
P 6 HOH 95  1120 105  HOH HOH A . 
P 6 HOH 96  1121 106  HOH HOH A . 
P 6 HOH 97  1122 107  HOH HOH A . 
P 6 HOH 98  1123 108  HOH HOH A . 
P 6 HOH 99  1124 109  HOH HOH A . 
P 6 HOH 100 1125 110  HOH HOH A . 
P 6 HOH 101 1126 111  HOH HOH A . 
P 6 HOH 102 1127 112  HOH HOH A . 
P 6 HOH 103 1128 113  HOH HOH A . 
P 6 HOH 104 1129 114  HOH HOH A . 
P 6 HOH 105 1130 115  HOH HOH A . 
P 6 HOH 106 1131 116  HOH HOH A . 
P 6 HOH 107 1132 117  HOH HOH A . 
P 6 HOH 108 1133 118  HOH HOH A . 
P 6 HOH 109 1134 119  HOH HOH A . 
P 6 HOH 110 1135 120  HOH HOH A . 
P 6 HOH 111 1136 121  HOH HOH A . 
P 6 HOH 112 1137 122  HOH HOH A . 
P 6 HOH 113 1138 123  HOH HOH A . 
P 6 HOH 114 1139 124  HOH HOH A . 
P 6 HOH 115 1140 125  HOH HOH A . 
P 6 HOH 116 1141 126  HOH HOH A . 
P 6 HOH 117 1142 127  HOH HOH A . 
P 6 HOH 118 1143 128  HOH HOH A . 
P 6 HOH 119 1144 129  HOH HOH A . 
P 6 HOH 120 1145 130  HOH HOH A . 
P 6 HOH 121 1146 131  HOH HOH A . 
P 6 HOH 122 1147 132  HOH HOH A . 
P 6 HOH 123 1148 133  HOH HOH A . 
P 6 HOH 124 1149 134  HOH HOH A . 
P 6 HOH 125 1150 135  HOH HOH A . 
P 6 HOH 126 1151 136  HOH HOH A . 
P 6 HOH 127 1152 137  HOH HOH A . 
P 6 HOH 128 1153 138  HOH HOH A . 
P 6 HOH 129 1154 139  HOH HOH A . 
P 6 HOH 130 1155 140  HOH HOH A . 
P 6 HOH 131 1156 141  HOH HOH A . 
P 6 HOH 132 1157 142  HOH HOH A . 
P 6 HOH 133 1158 143  HOH HOH A . 
P 6 HOH 134 1159 144  HOH HOH A . 
P 6 HOH 135 1160 145  HOH HOH A . 
P 6 HOH 136 1161 146  HOH HOH A . 
P 6 HOH 137 1162 147  HOH HOH A . 
P 6 HOH 138 1163 148  HOH HOH A . 
P 6 HOH 139 1164 149  HOH HOH A . 
P 6 HOH 140 1165 150  HOH HOH A . 
P 6 HOH 141 1166 151  HOH HOH A . 
P 6 HOH 142 1167 152  HOH HOH A . 
P 6 HOH 143 1168 153  HOH HOH A . 
P 6 HOH 144 1169 154  HOH HOH A . 
P 6 HOH 145 1170 155  HOH HOH A . 
P 6 HOH 146 1171 156  HOH HOH A . 
P 6 HOH 147 1172 157  HOH HOH A . 
P 6 HOH 148 1173 158  HOH HOH A . 
P 6 HOH 149 1174 159  HOH HOH A . 
P 6 HOH 150 1175 160  HOH HOH A . 
P 6 HOH 151 1176 161  HOH HOH A . 
P 6 HOH 152 1177 162  HOH HOH A . 
P 6 HOH 153 1178 163  HOH HOH A . 
P 6 HOH 154 1179 164  HOH HOH A . 
P 6 HOH 155 1180 165  HOH HOH A . 
P 6 HOH 156 1181 166  HOH HOH A . 
P 6 HOH 157 1182 168  HOH HOH A . 
P 6 HOH 158 1183 169  HOH HOH A . 
P 6 HOH 159 1184 170  HOH HOH A . 
P 6 HOH 160 1185 171  HOH HOH A . 
P 6 HOH 161 1186 172  HOH HOH A . 
P 6 HOH 162 1187 173  HOH HOH A . 
P 6 HOH 163 1188 174  HOH HOH A . 
P 6 HOH 164 1189 175  HOH HOH A . 
P 6 HOH 165 1190 176  HOH HOH A . 
P 6 HOH 166 1191 177  HOH HOH A . 
P 6 HOH 167 1192 178  HOH HOH A . 
P 6 HOH 168 1193 179  HOH HOH A . 
P 6 HOH 169 1194 180  HOH HOH A . 
P 6 HOH 170 1195 181  HOH HOH A . 
P 6 HOH 171 1196 182  HOH HOH A . 
P 6 HOH 172 1197 183  HOH HOH A . 
P 6 HOH 173 1198 184  HOH HOH A . 
P 6 HOH 174 1199 185  HOH HOH A . 
P 6 HOH 175 1200 186  HOH HOH A . 
P 6 HOH 176 1201 187  HOH HOH A . 
P 6 HOH 177 1202 188  HOH HOH A . 
P 6 HOH 178 1203 189  HOH HOH A . 
P 6 HOH 179 1204 190  HOH HOH A . 
P 6 HOH 180 1205 191  HOH HOH A . 
P 6 HOH 181 1206 192  HOH HOH A . 
P 6 HOH 182 1207 193  HOH HOH A . 
P 6 HOH 183 1208 194  HOH HOH A . 
P 6 HOH 184 1209 195  HOH HOH A . 
P 6 HOH 185 1210 196  HOH HOH A . 
P 6 HOH 186 1211 197  HOH HOH A . 
P 6 HOH 187 1212 198  HOH HOH A . 
P 6 HOH 188 1213 199  HOH HOH A . 
P 6 HOH 189 1214 200  HOH HOH A . 
P 6 HOH 190 1215 201  HOH HOH A . 
P 6 HOH 191 1216 202  HOH HOH A . 
P 6 HOH 192 1217 203  HOH HOH A . 
P 6 HOH 193 1218 204  HOH HOH A . 
P 6 HOH 194 1219 205  HOH HOH A . 
P 6 HOH 195 1220 206  HOH HOH A . 
P 6 HOH 196 1221 207  HOH HOH A . 
P 6 HOH 197 1222 208  HOH HOH A . 
P 6 HOH 198 1223 209  HOH HOH A . 
P 6 HOH 199 1224 210  HOH HOH A . 
P 6 HOH 200 1225 211  HOH HOH A . 
P 6 HOH 201 1226 212  HOH HOH A . 
P 6 HOH 202 1227 213  HOH HOH A . 
P 6 HOH 203 1228 214  HOH HOH A . 
P 6 HOH 204 1229 215  HOH HOH A . 
P 6 HOH 205 1230 216  HOH HOH A . 
P 6 HOH 206 1231 217  HOH HOH A . 
P 6 HOH 207 1232 218  HOH HOH A . 
P 6 HOH 208 1233 219  HOH HOH A . 
P 6 HOH 209 1234 220  HOH HOH A . 
P 6 HOH 210 1235 221  HOH HOH A . 
P 6 HOH 211 1236 222  HOH HOH A . 
P 6 HOH 212 1237 223  HOH HOH A . 
#