data_1CMO
# 
_entry.id   1CMO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1CMO         
RCSB  RCSB001041   
WWPDB D_1000001041 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1CMO 
_pdbx_database_status.recvd_initial_deposition_date   1999-05-11 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nagata, T.'    1 
'Gupta, V.'     2 
'Sorce, D.'     3 
'Kim, W.Y.'     4 
'Sali, A.'      5 
'Chait, B.T.'   6 
'Shigesada, K.' 7 
'Ito, Y.'       8 
'Werner, M.H.'  9 
# 
_citation.id                        primary 
_citation.title                     'Immunoglobulin motif DNA recognition and heterodimerization of the PEBP2/CBF Runt domain.' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            6 
_citation.page_first                615 
_citation.page_last                 618 
_citation.year                      1999 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10404214 
_citation.pdbx_database_id_DOI      10.1038/10658 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nagata, T.'    1 
primary 'Gupta, V.'     2 
primary 'Sorce, D.'     3 
primary 'Kim, W.Y.'     4 
primary 'Sali, A.'      5 
primary 'Chait, B.T.'   6 
primary 'Shigesada, K.' 7 
primary 'Ito, Y.'       8 
primary 'Werner, M.H.'  9 
# 
_cell.entry_id           1CMO 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1CMO 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'POLYOMAVIRUS ENHANCER BINDING PROTEIN 2' 
_entity.formula_weight             14008.942 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              C81S 
_entity.pdbx_fragment              'CORE-BINDING FACTOR ALPHA B SUBUNIT, RUNT DOMAIN' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ACUTE MYELOID LEUKEMIA 1 PROTEIN, AML1/OSF2, PEBP2-ALPHA B' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARF
NDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARF
NDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   GLU n 
1 3   VAL n 
1 4   LEU n 
1 5   ALA n 
1 6   ASP n 
1 7   HIS n 
1 8   PRO n 
1 9   GLY n 
1 10  GLU n 
1 11  LEU n 
1 12  VAL n 
1 13  ARG n 
1 14  THR n 
1 15  ASP n 
1 16  SER n 
1 17  PRO n 
1 18  ASN n 
1 19  PHE n 
1 20  LEU n 
1 21  CYS n 
1 22  SER n 
1 23  VAL n 
1 24  LEU n 
1 25  PRO n 
1 26  THR n 
1 27  HIS n 
1 28  TRP n 
1 29  ARG n 
1 30  SER n 
1 31  ASN n 
1 32  LYS n 
1 33  THR n 
1 34  LEU n 
1 35  PRO n 
1 36  ILE n 
1 37  ALA n 
1 38  PHE n 
1 39  LYS n 
1 40  VAL n 
1 41  VAL n 
1 42  ALA n 
1 43  LEU n 
1 44  GLY n 
1 45  ASP n 
1 46  VAL n 
1 47  PRO n 
1 48  ASP n 
1 49  GLY n 
1 50  THR n 
1 51  LEU n 
1 52  VAL n 
1 53  THR n 
1 54  VAL n 
1 55  MET n 
1 56  ALA n 
1 57  GLY n 
1 58  ASN n 
1 59  ASP n 
1 60  GLU n 
1 61  ASN n 
1 62  TYR n 
1 63  SER n 
1 64  ALA n 
1 65  GLU n 
1 66  LEU n 
1 67  ARG n 
1 68  ASN n 
1 69  ALA n 
1 70  THR n 
1 71  ALA n 
1 72  ALA n 
1 73  MET n 
1 74  LYS n 
1 75  ASN n 
1 76  GLN n 
1 77  VAL n 
1 78  ALA n 
1 79  ARG n 
1 80  PHE n 
1 81  ASN n 
1 82  ASP n 
1 83  LEU n 
1 84  ARG n 
1 85  PHE n 
1 86  VAL n 
1 87  GLY n 
1 88  ARG n 
1 89  SER n 
1 90  GLY n 
1 91  ARG n 
1 92  GLY n 
1 93  LYS n 
1 94  SER n 
1 95  PHE n 
1 96  THR n 
1 97  LEU n 
1 98  THR n 
1 99  ILE n 
1 100 THR n 
1 101 VAL n 
1 102 PHE n 
1 103 THR n 
1 104 ASN n 
1 105 PRO n 
1 106 PRO n 
1 107 GLN n 
1 108 VAL n 
1 109 ALA n 
1 110 THR n 
1 111 TYR n 
1 112 HIS n 
1 113 ARG n 
1 114 ALA n 
1 115 ILE n 
1 116 LYS n 
1 117 ILE n 
1 118 THR n 
1 119 VAL n 
1 120 ASP n 
1 121 GLY n 
1 122 PRO n 
1 123 ARG n 
1 124 GLU n 
1 125 PRO n 
1 126 ARG n 
1 127 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    CYTOPLASM 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PQE9 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RUNX1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          Q01196 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1CMO 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 127 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q01196 
_struct_ref_seq.db_align_beg                  52 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  178 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       52 
_struct_ref_seq.pdbx_auth_seq_align_end       178 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1CMO 
_struct_ref_seq_dif.mon_id                       SER 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      30 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q01196 
_struct_ref_seq_dif.db_mon_id                    CYS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          81 
_struct_ref_seq_dif.details                      'SEE REMARK 999' 
_struct_ref_seq_dif.pdbx_auth_seq_num            81 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_exptl.experiment_id   1 
_pdbx_nmr_exptl.conditions_id   1 
_pdbx_nmr_exptl.solution_id     1 
_pdbx_nmr_exptl.type            'ALL STANDARD' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         310 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.pH                  6.8 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      10mM 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '96% H2O/4% D2O' 
_pdbx_nmr_sample_details.solvent_system   ? 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker DMX500 500 
2 ? Bruker DMX600 600 
# 
_pdbx_nmr_refine.entry_id           1CMO 
_pdbx_nmr_refine.method             'HYBRID DISTANCE GEOMETRY/SIMULATED ANNEALING' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1CMO 
_pdbx_nmr_details.text       'ALL STANDARD' 
# 
_pdbx_nmr_ensemble.entry_id                                      1CMO 
_pdbx_nmr_ensemble.conformers_calculated_total_number            300 
_pdbx_nmr_ensemble.conformers_submitted_total_number             43 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
NMRPIPE ?     'structure solution' ?       1 
PIPP    ?     'structure solution' ?       2 
STAPP   ?     'structure solution' ?       3 
X-PLOR  ?     'structure solution' BRUNGER 4 
X-PLOR  3.843 refinement           BRUNGER 5 
# 
_exptl.entry_id          1CMO 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1CMO 
_struct.title                     'IMMUNOGLOBULIN MOTIF DNA-RECOGNITION AND HETERODIMERIZATION FOR THE PEBP2/CBF RUNT-DOMAIN' 
_struct.pdbx_descriptor           'POLYOMAVIRUS ENHANCER BINDING PROTEIN 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1CMO 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'TRANSCRIPTION FACTOR, HEMATOPOIESIS, OSTEOGENESIS, IG-FOLD, TRANSCRIPTION' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       VAL 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        3 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ASP 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        6 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        VAL 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         54 
_struct_conf.end_auth_comp_id        ASP 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         57 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
SO  ? 1 ? 
SA  ? 1 ? 
SB  ? 1 ? 
SC1 ? 1 ? 
SD  ? 1 ? 
SC2 ? 1 ? 
SE1 ? 1 ? 
SE2 ? 1 ? 
SF  ? 1 ? 
SG  ? 1 ? 
SP1 ? 1 ? 
SP2 ? 1 ? 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
SO  1 VAL A 12  ? ARG A 13  ? VAL A 63  ARG A 64  
SA  1 PHE A 19  ? SER A 22  ? PHE A 70  SER A 73  
SB  1 PHE A 38  ? ALA A 42  ? PHE A 89  ALA A 93  
SC1 1 GLY A 49  ? ASN A 58  ? GLY A 100 ASN A 109 
SD  1 SER A 63  ? ARG A 67  ? SER A 114 ARG A 118 
SC2 1 THR A 70  ? LYS A 74  ? THR A 121 LYS A 125 
SE1 1 VAL A 77  ? PHE A 80  ? VAL A 128 PHE A 131 
SE2 1 ARG A 84  ? ARG A 88  ? ARG A 135 ARG A 139 
SF  1 PHE A 95  ? VAL A 101 ? PHE A 146 VAL A 152 
SG  1 GLN A 107 ? ARG A 113 ? GLN A 158 ARG A 164 
SP1 1 HIS A 27  ? ARG A 29  ? HIS A 78  ARG A 80  
SP2 1 LYS A 116 ? THR A 118 ? LYS A 167 THR A 169 
# 
_database_PDB_matrix.entry_id          1CMO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1CMO 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . VAL A 1 1   ? 7.462   -5.991  24.481  1.00 0.00 ? 52  VAL A N    1  
ATOM 2     C CA   . VAL A 1 1   ? 7.898   -4.892  25.386  1.00 0.00 ? 52  VAL A CA   1  
ATOM 3     C C    . VAL A 1 1   ? 6.825   -3.792  25.399  1.00 0.00 ? 52  VAL A C    1  
ATOM 4     O O    . VAL A 1 1   ? 6.662   -3.046  24.453  1.00 0.00 ? 52  VAL A O    1  
ATOM 5     C CB   . VAL A 1 1   ? 9.240   -4.319  24.898  1.00 0.00 ? 52  VAL A CB   1  
ATOM 6     C CG1  . VAL A 1 1   ? 9.955   -3.624  26.056  1.00 0.00 ? 52  VAL A CG1  1  
ATOM 7     C CG2  . VAL A 1 1   ? 10.142  -5.435  24.350  1.00 0.00 ? 52  VAL A CG2  1  
ATOM 8     H H    . VAL A 1 1   ? 7.627   -5.926  23.518  1.00 0.00 ? 52  VAL A H    1  
ATOM 9     H HA   . VAL A 1 1   ? 8.015   -5.287  26.385  1.00 0.00 ? 52  VAL A HA   1  
ATOM 10    H HB   . VAL A 1 1   ? 9.052   -3.601  24.114  1.00 0.00 ? 52  VAL A HB   1  
ATOM 11    H HG11 . VAL A 1 1   ? 9.330   -2.834  26.442  1.00 0.00 ? 52  VAL A HG11 1  
ATOM 12    H HG12 . VAL A 1 1   ? 10.153  -4.342  26.841  1.00 0.00 ? 52  VAL A HG12 1  
ATOM 13    H HG13 . VAL A 1 1   ? 10.890  -3.207  25.706  1.00 0.00 ? 52  VAL A HG13 1  
ATOM 14    H HG21 . VAL A 1 1   ? 10.253  -6.216  25.089  1.00 0.00 ? 52  VAL A HG21 1  
ATOM 15    H HG22 . VAL A 1 1   ? 9.705   -5.849  23.450  1.00 0.00 ? 52  VAL A HG22 1  
ATOM 16    H HG23 . VAL A 1 1   ? 11.114  -5.024  24.117  1.00 0.00 ? 52  VAL A HG23 1  
ATOM 17    N N    . GLU A 1 2   ? 6.093   -3.688  26.479  1.00 0.00 ? 53  GLU A N    1  
ATOM 18    C CA   . GLU A 1 2   ? 5.020   -2.657  26.587  1.00 0.00 ? 53  GLU A CA   1  
ATOM 19    C C    . GLU A 1 2   ? 5.615   -1.249  26.438  1.00 0.00 ? 53  GLU A C    1  
ATOM 20    O O    . GLU A 1 2   ? 4.963   -0.334  25.973  1.00 0.00 ? 53  GLU A O    1  
ATOM 21    C CB   . GLU A 1 2   ? 4.352   -2.787  27.969  1.00 0.00 ? 53  GLU A CB   1  
ATOM 22    C CG   . GLU A 1 2   ? 3.659   -4.147  28.079  1.00 0.00 ? 53  GLU A CG   1  
ATOM 23    C CD   . GLU A 1 2   ? 2.988   -4.269  29.448  1.00 0.00 ? 53  GLU A CD   1  
ATOM 24    O OE1  . GLU A 1 2   ? 3.706   -4.355  30.434  1.00 0.00 ? 53  GLU A OE1  1  
ATOM 25    O OE2  . GLU A 1 2   ? 1.770   -4.270  29.490  1.00 0.00 ? 53  GLU A OE2  1  
ATOM 26    H H    . GLU A 1 2   ? 6.247   -4.307  27.220  1.00 0.00 ? 53  GLU A H    1  
ATOM 27    H HA   . GLU A 1 2   ? 4.280   -2.820  25.819  1.00 0.00 ? 53  GLU A HA   1  
ATOM 28    H HB2  . GLU A 1 2   ? 5.107   -2.711  28.739  1.00 0.00 ? 53  GLU A HB2  1  
ATOM 29    H HB3  . GLU A 1 2   ? 3.623   -2.003  28.099  1.00 0.00 ? 53  GLU A HB3  1  
ATOM 30    H HG2  . GLU A 1 2   ? 2.910   -4.235  27.305  1.00 0.00 ? 53  GLU A HG2  1  
ATOM 31    H HG3  . GLU A 1 2   ? 4.386   -4.937  27.967  1.00 0.00 ? 53  GLU A HG3  1  
ATOM 32    N N    . VAL A 1 3   ? 6.853   -1.065  26.823  1.00 0.00 ? 54  VAL A N    1  
ATOM 33    C CA   . VAL A 1 3   ? 7.479   0.282   26.706  1.00 0.00 ? 54  VAL A CA   1  
ATOM 34    C C    . VAL A 1 3   ? 7.686   0.649   25.230  1.00 0.00 ? 54  VAL A C    1  
ATOM 35    O O    . VAL A 1 3   ? 7.480   1.779   24.828  1.00 0.00 ? 54  VAL A O    1  
ATOM 36    C CB   . VAL A 1 3   ? 8.840   0.266   27.417  1.00 0.00 ? 54  VAL A CB   1  
ATOM 37    C CG1  . VAL A 1 3   ? 9.511   1.632   27.269  1.00 0.00 ? 54  VAL A CG1  1  
ATOM 38    C CG2  . VAL A 1 3   ? 8.630   -0.045  28.900  1.00 0.00 ? 54  VAL A CG2  1  
ATOM 39    H H    . VAL A 1 3   ? 7.356   -1.813  27.201  1.00 0.00 ? 54  VAL A H    1  
ATOM 40    H HA   . VAL A 1 3   ? 6.846   1.019   27.175  1.00 0.00 ? 54  VAL A HA   1  
ATOM 41    H HB   . VAL A 1 3   ? 9.467   -0.495  26.973  1.00 0.00 ? 54  VAL A HB   1  
ATOM 42    H HG11 . VAL A 1 3   ? 8.810   2.409   27.543  1.00 0.00 ? 54  VAL A HG11 1  
ATOM 43    H HG12 . VAL A 1 3   ? 10.375  1.683   27.919  1.00 0.00 ? 54  VAL A HG12 1  
ATOM 44    H HG13 . VAL A 1 3   ? 9.823   1.774   26.244  1.00 0.00 ? 54  VAL A HG13 1  
ATOM 45    H HG21 . VAL A 1 3   ? 7.845   0.587   29.293  1.00 0.00 ? 54  VAL A HG21 1  
ATOM 46    H HG22 . VAL A 1 3   ? 8.350   -1.083  29.016  1.00 0.00 ? 54  VAL A HG22 1  
ATOM 47    H HG23 . VAL A 1 3   ? 9.546   0.144   29.441  1.00 0.00 ? 54  VAL A HG23 1  
ATOM 48    N N    . LEU A 1 4   ? 8.074   -0.299  24.416  1.00 0.00 ? 55  LEU A N    1  
ATOM 49    C CA   . LEU A 1 4   ? 8.301   -0.012  22.962  1.00 0.00 ? 55  LEU A CA   1  
ATOM 50    C C    . LEU A 1 4   ? 7.000   -0.236  22.178  1.00 0.00 ? 55  LEU A C    1  
ATOM 51    O O    . LEU A 1 4   ? 7.013   -0.398  20.973  1.00 0.00 ? 55  LEU A O    1  
ATOM 52    C CB   . LEU A 1 4   ? 9.385   -0.939  22.395  1.00 0.00 ? 55  LEU A CB   1  
ATOM 53    C CG   . LEU A 1 4   ? 10.718  -0.739  23.139  1.00 0.00 ? 55  LEU A CG   1  
ATOM 54    C CD1  . LEU A 1 4   ? 11.774  -1.660  22.524  1.00 0.00 ? 55  LEU A CD1  1  
ATOM 55    C CD2  . LEU A 1 4   ? 11.190  0.722   23.020  1.00 0.00 ? 55  LEU A CD2  1  
ATOM 56    H H    . LEU A 1 4   ? 8.234   -1.196  24.768  1.00 0.00 ? 55  LEU A H    1  
ATOM 57    H HA   . LEU A 1 4   ? 8.610   1.014   22.840  1.00 0.00 ? 55  LEU A HA   1  
ATOM 58    H HB2  . LEU A 1 4   ? 9.068   -1.961  22.505  1.00 0.00 ? 55  LEU A HB2  1  
ATOM 59    H HB3  . LEU A 1 4   ? 9.526   -0.721  21.345  1.00 0.00 ? 55  LEU A HB3  1  
ATOM 60    H HG   . LEU A 1 4   ? 10.589  -0.993  24.178  1.00 0.00 ? 55  LEU A HG   1  
ATOM 61    H HD11 . LEU A 1 4   ? 11.896  -1.416  21.476  1.00 0.00 ? 55  LEU A HD11 1  
ATOM 62    H HD12 . LEU A 1 4   ? 12.714  -1.519  23.037  1.00 0.00 ? 55  LEU A HD12 1  
ATOM 63    H HD13 . LEU A 1 4   ? 11.459  -2.687  22.622  1.00 0.00 ? 55  LEU A HD13 1  
ATOM 64    H HD21 . LEU A 1 4   ? 10.861  1.141   22.077  1.00 0.00 ? 55  LEU A HD21 1  
ATOM 65    H HD22 . LEU A 1 4   ? 10.773  1.297   23.833  1.00 0.00 ? 55  LEU A HD22 1  
ATOM 66    H HD23 . LEU A 1 4   ? 12.273  0.765   23.071  1.00 0.00 ? 55  LEU A HD23 1  
ATOM 67    N N    . ALA A 1 5   ? 5.879   -0.277  22.841  1.00 0.00 ? 56  ALA A N    1  
ATOM 68    C CA   . ALA A 1 5   ? 4.596   -0.520  22.116  1.00 0.00 ? 56  ALA A CA   1  
ATOM 69    C C    . ALA A 1 5   ? 3.992   0.801   21.592  1.00 0.00 ? 56  ALA A C    1  
ATOM 70    O O    . ALA A 1 5   ? 4.022   1.074   20.410  1.00 0.00 ? 56  ALA A O    1  
ATOM 71    C CB   . ALA A 1 5   ? 3.603   -1.167  23.075  1.00 0.00 ? 56  ALA A CB   1  
ATOM 72    H H    . ALA A 1 5   ? 5.880   -0.168  23.816  1.00 0.00 ? 56  ALA A H    1  
ATOM 73    H HA   . ALA A 1 5   ? 4.770   -1.188  21.287  1.00 0.00 ? 56  ALA A HA   1  
ATOM 74    H HB1  . ALA A 1 5   ? 3.570   -0.596  23.993  1.00 0.00 ? 56  ALA A HB1  1  
ATOM 75    H HB2  . ALA A 1 5   ? 2.624   -1.181  22.625  1.00 0.00 ? 56  ALA A HB2  1  
ATOM 76    H HB3  . ALA A 1 5   ? 3.915   -2.177  23.294  1.00 0.00 ? 56  ALA A HB3  1  
ATOM 77    N N    . ASP A 1 6   ? 3.419   1.600   22.466  1.00 0.00 ? 57  ASP A N    1  
ATOM 78    C CA   . ASP A 1 6   ? 2.783   2.891   22.017  1.00 0.00 ? 57  ASP A CA   1  
ATOM 79    C C    . ASP A 1 6   ? 3.832   3.985   21.767  1.00 0.00 ? 57  ASP A C    1  
ATOM 80    O O    . ASP A 1 6   ? 3.675   4.812   20.892  1.00 0.00 ? 57  ASP A O    1  
ATOM 81    C CB   . ASP A 1 6   ? 1.794   3.388   23.082  1.00 0.00 ? 57  ASP A CB   1  
ATOM 82    C CG   . ASP A 1 6   ? 0.939   4.529   22.507  1.00 0.00 ? 57  ASP A CG   1  
ATOM 83    O OD1  . ASP A 1 6   ? 1.152   4.881   21.359  1.00 0.00 ? 57  ASP A OD1  1  
ATOM 84    O OD2  . ASP A 1 6   ? 0.093   5.035   23.231  1.00 0.00 ? 57  ASP A OD2  1  
ATOM 85    H H    . ASP A 1 6   ? 3.392   1.344   23.407  1.00 0.00 ? 57  ASP A H    1  
ATOM 86    H HA   . ASP A 1 6   ? 2.243   2.713   21.099  1.00 0.00 ? 57  ASP A HA   1  
ATOM 87    H HB2  . ASP A 1 6   ? 1.151   2.575   23.388  1.00 0.00 ? 57  ASP A HB2  1  
ATOM 88    H HB3  . ASP A 1 6   ? 2.341   3.751   23.941  1.00 0.00 ? 57  ASP A HB3  1  
ATOM 89    N N    . HIS A 1 7   ? 4.872   4.027   22.554  1.00 0.00 ? 58  HIS A N    1  
ATOM 90    C CA   . HIS A 1 7   ? 5.889   5.106   22.372  1.00 0.00 ? 58  HIS A CA   1  
ATOM 91    C C    . HIS A 1 7   ? 6.330   5.207   20.895  1.00 0.00 ? 58  HIS A C    1  
ATOM 92    O O    . HIS A 1 7   ? 6.179   6.251   20.286  1.00 0.00 ? 58  HIS A O    1  
ATOM 93    C CB   . HIS A 1 7   ? 7.094   4.836   23.308  1.00 0.00 ? 58  HIS A CB   1  
ATOM 94    C CG   . HIS A 1 7   ? 6.917   5.590   24.601  1.00 0.00 ? 58  HIS A CG   1  
ATOM 95    N ND1  . HIS A 1 7   ? 7.086   6.960   24.684  1.00 0.00 ? 58  HIS A ND1  1  
ATOM 96    C CD2  . HIS A 1 7   ? 6.568   5.179   25.861  1.00 0.00 ? 58  HIS A CD2  1  
ATOM 97    C CE1  . HIS A 1 7   ? 6.841   7.324   25.957  1.00 0.00 ? 58  HIS A CE1  1  
ATOM 98    N NE2  . HIS A 1 7   ? 6.523   6.275   26.717  1.00 0.00 ? 58  HIS A NE2  1  
ATOM 99    H H    . HIS A 1 7   ? 4.970   3.375   23.273  1.00 0.00 ? 58  HIS A H    1  
ATOM 100   H HA   . HIS A 1 7   ? 5.436   6.048   22.646  1.00 0.00 ? 58  HIS A HA   1  
ATOM 101   H HB2  . HIS A 1 7   ? 7.140   3.783   23.539  1.00 0.00 ? 58  HIS A HB2  1  
ATOM 102   H HB3  . HIS A 1 7   ? 8.017   5.145   22.833  1.00 0.00 ? 58  HIS A HB3  1  
ATOM 103   H HD1  . HIS A 1 7   ? 7.327   7.561   23.947  1.00 0.00 ? 58  HIS A HD1  1  
ATOM 104   H HD2  . HIS A 1 7   ? 6.349   4.157   26.149  1.00 0.00 ? 58  HIS A HD2  1  
ATOM 105   H HE1  . HIS A 1 7   ? 6.895   8.341   26.316  1.00 0.00 ? 58  HIS A HE1  1  
ATOM 106   N N    . PRO A 1 8   ? 6.850   4.150   20.310  1.00 0.00 ? 59  PRO A N    1  
ATOM 107   C CA   . PRO A 1 8   ? 7.284   4.168   18.873  1.00 0.00 ? 59  PRO A CA   1  
ATOM 108   C C    . PRO A 1 8   ? 6.107   4.110   17.888  1.00 0.00 ? 59  PRO A C    1  
ATOM 109   O O    . PRO A 1 8   ? 4.972   3.892   18.262  1.00 0.00 ? 59  PRO A O    1  
ATOM 110   C CB   . PRO A 1 8   ? 8.146   2.907   18.753  1.00 0.00 ? 59  PRO A CB   1  
ATOM 111   C CG   . PRO A 1 8   ? 7.580   1.966   19.766  1.00 0.00 ? 59  PRO A CG   1  
ATOM 112   C CD   . PRO A 1 8   ? 7.101   2.836   20.930  1.00 0.00 ? 59  PRO A CD   1  
ATOM 113   H HA   . PRO A 1 8   ? 7.889   5.037   18.674  1.00 0.00 ? 59  PRO A HA   1  
ATOM 114   H HB2  . PRO A 1 8   ? 8.079   2.484   17.759  1.00 0.00 ? 59  PRO A HB2  1  
ATOM 115   H HB3  . PRO A 1 8   ? 9.175   3.131   18.994  1.00 0.00 ? 59  PRO A HB3  1  
ATOM 116   H HG2  . PRO A 1 8   ? 6.752   1.414   19.340  1.00 0.00 ? 59  PRO A HG2  1  
ATOM 117   H HG3  . PRO A 1 8   ? 8.346   1.284   20.109  1.00 0.00 ? 59  PRO A HG3  1  
ATOM 118   H HD2  . PRO A 1 8   ? 6.199   2.429   21.364  1.00 0.00 ? 59  PRO A HD2  1  
ATOM 119   H HD3  . PRO A 1 8   ? 7.880   2.919   21.668  1.00 0.00 ? 59  PRO A HD3  1  
ATOM 120   N N    . GLY A 1 9   ? 6.386   4.294   16.627  1.00 0.00 ? 60  GLY A N    1  
ATOM 121   C CA   . GLY A 1 9   ? 5.309   4.247   15.602  1.00 0.00 ? 60  GLY A CA   1  
ATOM 122   C C    . GLY A 1 9   ? 5.951   3.958   14.247  1.00 0.00 ? 60  GLY A C    1  
ATOM 123   O O    . GLY A 1 9   ? 7.160   3.909   14.130  1.00 0.00 ? 60  GLY A O    1  
ATOM 124   H H    . GLY A 1 9   ? 7.310   4.460   16.353  1.00 0.00 ? 60  GLY A H    1  
ATOM 125   H HA2  . GLY A 1 9   ? 4.602   3.469   15.844  1.00 0.00 ? 60  GLY A HA2  1  
ATOM 126   H HA3  . GLY A 1 9   ? 4.803   5.198   15.559  1.00 0.00 ? 60  GLY A HA3  1  
ATOM 127   N N    . GLU A 1 10  ? 5.160   3.761   13.229  1.00 0.00 ? 61  GLU A N    1  
ATOM 128   C CA   . GLU A 1 10  ? 5.733   3.466   11.875  1.00 0.00 ? 61  GLU A CA   1  
ATOM 129   C C    . GLU A 1 10  ? 4.961   4.233   10.791  1.00 0.00 ? 61  GLU A C    1  
ATOM 130   O O    . GLU A 1 10  ? 3.756   4.123   10.677  1.00 0.00 ? 61  GLU A O    1  
ATOM 131   C CB   . GLU A 1 10  ? 5.643   1.960   11.621  1.00 0.00 ? 61  GLU A CB   1  
ATOM 132   C CG   . GLU A 1 10  ? 4.222   1.465   11.904  1.00 0.00 ? 61  GLU A CG   1  
ATOM 133   C CD   . GLU A 1 10  ? 4.200   -0.056  11.818  1.00 0.00 ? 61  GLU A CD   1  
ATOM 134   O OE1  . GLU A 1 10  ? 5.267   -0.643  11.760  1.00 0.00 ? 61  GLU A OE1  1  
ATOM 135   O OE2  . GLU A 1 10  ? 3.115   -0.612  11.798  1.00 0.00 ? 61  GLU A OE2  1  
ATOM 136   H H    . GLU A 1 10  ? 4.188   3.797   13.349  1.00 0.00 ? 61  GLU A H    1  
ATOM 137   H HA   . GLU A 1 10  ? 6.773   3.765   11.843  1.00 0.00 ? 61  GLU A HA   1  
ATOM 138   H HB2  . GLU A 1 10  ? 5.891   1.757   10.591  1.00 0.00 ? 61  GLU A HB2  1  
ATOM 139   H HB3  . GLU A 1 10  ? 6.334   1.444   12.266  1.00 0.00 ? 61  GLU A HB3  1  
ATOM 140   H HG2  . GLU A 1 10  ? 3.914   1.775   12.890  1.00 0.00 ? 61  GLU A HG2  1  
ATOM 141   H HG3  . GLU A 1 10  ? 3.548   1.871   11.178  1.00 0.00 ? 61  GLU A HG3  1  
ATOM 142   N N    . LEU A 1 11  ? 5.653   5.003   9.986   1.00 0.00 ? 62  LEU A N    1  
ATOM 143   C CA   . LEU A 1 11  ? 4.986   5.780   8.891   1.00 0.00 ? 62  LEU A CA   1  
ATOM 144   C C    . LEU A 1 11  ? 5.871   5.760   7.634   1.00 0.00 ? 62  LEU A C    1  
ATOM 145   O O    . LEU A 1 11  ? 7.057   5.508   7.717   1.00 0.00 ? 62  LEU A O    1  
ATOM 146   C CB   . LEU A 1 11  ? 4.803   7.246   9.318   1.00 0.00 ? 62  LEU A CB   1  
ATOM 147   C CG   . LEU A 1 11  ? 3.893   7.355   10.565  1.00 0.00 ? 62  LEU A CG   1  
ATOM 148   C CD1  . LEU A 1 11  ? 4.734   7.325   11.852  1.00 0.00 ? 62  LEU A CD1  1  
ATOM 149   C CD2  . LEU A 1 11  ? 3.100   8.672   10.504  1.00 0.00 ? 62  LEU A CD2  1  
ATOM 150   H H    . LEU A 1 11  ? 6.618   5.067   10.097  1.00 0.00 ? 62  LEU A H    1  
ATOM 151   H HA   . LEU A 1 11  ? 4.024   5.343   8.667   1.00 0.00 ? 62  LEU A HA   1  
ATOM 152   H HB2  . LEU A 1 11  ? 5.772   7.673   9.539   1.00 0.00 ? 62  LEU A HB2  1  
ATOM 153   H HB3  . LEU A 1 11  ? 4.361   7.791   8.496   1.00 0.00 ? 62  LEU A HB3  1  
ATOM 154   H HG   . LEU A 1 11  ? 3.200   6.526   10.577  1.00 0.00 ? 62  LEU A HG   1  
ATOM 155   H HD11 . LEU A 1 11  ? 5.521   6.595   11.757  1.00 0.00 ? 62  LEU A HD11 1  
ATOM 156   H HD12 . LEU A 1 11  ? 5.170   8.300   12.024  1.00 0.00 ? 62  LEU A HD12 1  
ATOM 157   H HD13 . LEU A 1 11  ? 4.101   7.064   12.688  1.00 0.00 ? 62  LEU A HD13 1  
ATOM 158   H HD21 . LEU A 1 11  ? 3.785   9.501   10.376  1.00 0.00 ? 62  LEU A HD21 1  
ATOM 159   H HD22 . LEU A 1 11  ? 2.416   8.640   9.665   1.00 0.00 ? 62  LEU A HD22 1  
ATOM 160   H HD23 . LEU A 1 11  ? 2.540   8.800   11.418  1.00 0.00 ? 62  LEU A HD23 1  
ATOM 161   N N    . VAL A 1 12  ? 5.317   6.062   6.470   1.00 0.00 ? 63  VAL A N    1  
ATOM 162   C CA   . VAL A 1 12  ? 6.147   6.097   5.210   1.00 0.00 ? 63  VAL A CA   1  
ATOM 163   C C    . VAL A 1 12  ? 6.333   7.548   4.756   1.00 0.00 ? 63  VAL A C    1  
ATOM 164   O O    . VAL A 1 12  ? 5.388   8.301   4.654   1.00 0.00 ? 63  VAL A O    1  
ATOM 165   C CB   . VAL A 1 12  ? 5.459   5.333   4.078   1.00 0.00 ? 63  VAL A CB   1  
ATOM 166   C CG1  . VAL A 1 12  ? 6.405   5.286   2.875   1.00 0.00 ? 63  VAL A CG1  1  
ATOM 167   C CG2  . VAL A 1 12  ? 5.142   3.915   4.539   1.00 0.00 ? 63  VAL A CG2  1  
ATOM 168   H H    . VAL A 1 12  ? 4.364   6.285   6.428   1.00 0.00 ? 63  VAL A H    1  
ATOM 169   H HA   . VAL A 1 12  ? 7.117   5.656   5.397   1.00 0.00 ? 63  VAL A HA   1  
ATOM 170   H HB   . VAL A 1 12  ? 4.546   5.841   3.798   1.00 0.00 ? 63  VAL A HB   1  
ATOM 171   H HG11 . VAL A 1 12  ? 7.370   4.920   3.193   1.00 0.00 ? 63  VAL A HG11 1  
ATOM 172   H HG12 . VAL A 1 12  ? 6.005   4.628   2.121   1.00 0.00 ? 63  VAL A HG12 1  
ATOM 173   H HG13 . VAL A 1 12  ? 6.516   6.281   2.469   1.00 0.00 ? 63  VAL A HG13 1  
ATOM 174   H HG21 . VAL A 1 12  ? 4.652   3.953   5.501   1.00 0.00 ? 63  VAL A HG21 1  
ATOM 175   H HG22 . VAL A 1 12  ? 4.492   3.436   3.823   1.00 0.00 ? 63  VAL A HG22 1  
ATOM 176   H HG23 . VAL A 1 12  ? 6.061   3.359   4.624   1.00 0.00 ? 63  VAL A HG23 1  
ATOM 177   N N    . ARG A 1 13  ? 7.549   7.946   4.465   1.00 0.00 ? 64  ARG A N    1  
ATOM 178   C CA   . ARG A 1 13  ? 7.782   9.350   4.005   1.00 0.00 ? 64  ARG A CA   1  
ATOM 179   C C    . ARG A 1 13  ? 7.311   9.457   2.556   1.00 0.00 ? 64  ARG A C    1  
ATOM 180   O O    . ARG A 1 13  ? 7.711   8.684   1.703   1.00 0.00 ? 64  ARG A O    1  
ATOM 181   C CB   . ARG A 1 13  ? 9.289   9.689   4.110   1.00 0.00 ? 64  ARG A CB   1  
ATOM 182   C CG   . ARG A 1 13  ? 9.512   11.198  4.376   1.00 0.00 ? 64  ARG A CG   1  
ATOM 183   C CD   . ARG A 1 13  ? 9.375   12.034  3.082   1.00 0.00 ? 64  ARG A CD   1  
ATOM 184   N NE   . ARG A 1 13  ? 8.500   13.211  3.354   1.00 0.00 ? 64  ARG A NE   1  
ATOM 185   C CZ   . ARG A 1 13  ? 8.489   14.212  2.517   1.00 0.00 ? 64  ARG A CZ   1  
ATOM 186   N NH1  . ARG A 1 13  ? 9.163   14.132  1.403   1.00 0.00 ? 64  ARG A NH1  1  
ATOM 187   N NH2  . ARG A 1 13  ? 7.772   15.275  2.777   1.00 0.00 ? 64  ARG A NH2  1  
ATOM 188   H H    . ARG A 1 13  ? 8.297   7.323   4.543   1.00 0.00 ? 64  ARG A H    1  
ATOM 189   H HA   . ARG A 1 13  ? 7.205   10.025  4.617   1.00 0.00 ? 64  ARG A HA   1  
ATOM 190   H HB2  . ARG A 1 13  ? 9.716   9.124   4.927   1.00 0.00 ? 64  ARG A HB2  1  
ATOM 191   H HB3  . ARG A 1 13  ? 9.791   9.406   3.194   1.00 0.00 ? 64  ARG A HB3  1  
ATOM 192   H HG2  . ARG A 1 13  ? 8.794   11.549  5.100   1.00 0.00 ? 64  ARG A HG2  1  
ATOM 193   H HG3  . ARG A 1 13  ? 10.502  11.337  4.782   1.00 0.00 ? 64  ARG A HG3  1  
ATOM 194   H HD2  . ARG A 1 13  ? 10.351  12.383  2.764   1.00 0.00 ? 64  ARG A HD2  1  
ATOM 195   H HD3  . ARG A 1 13  ? 8.936   11.440  2.293   1.00 0.00 ? 64  ARG A HD3  1  
ATOM 196   H HE   . ARG A 1 13  ? 7.952   13.241  4.171   1.00 0.00 ? 64  ARG A HE   1  
ATOM 197   H HH11 . ARG A 1 13  ? 9.685   13.302  1.195   1.00 0.00 ? 64  ARG A HH11 1  
ATOM 198   H HH12 . ARG A 1 13  ? 9.156   14.893  0.754   1.00 0.00 ? 64  ARG A HH12 1  
ATOM 199   H HH21 . ARG A 1 13  ? 7.226   15.317  3.612   1.00 0.00 ? 64  ARG A HH21 1  
ATOM 200   H HH22 . ARG A 1 13  ? 7.786   16.053  2.149   1.00 0.00 ? 64  ARG A HH22 1  
ATOM 201   N N    . THR A 1 14  ? 6.458   10.407  2.280   1.00 0.00 ? 65  THR A N    1  
ATOM 202   C CA   . THR A 1 14  ? 5.922   10.599  0.911   1.00 0.00 ? 65  THR A CA   1  
ATOM 203   C C    . THR A 1 14  ? 6.259   11.996  0.428   1.00 0.00 ? 65  THR A C    1  
ATOM 204   O O    . THR A 1 14  ? 6.732   12.828  1.179   1.00 0.00 ? 65  THR A O    1  
ATOM 205   C CB   . THR A 1 14  ? 4.409   10.423  0.947   1.00 0.00 ? 65  THR A CB   1  
ATOM 206   O OG1  . THR A 1 14  ? 3.842   11.388  1.828   1.00 0.00 ? 65  THR A OG1  1  
ATOM 207   C CG2  . THR A 1 14  ? 4.082   9.016   1.437   1.00 0.00 ? 65  THR A CG2  1  
ATOM 208   H H    . THR A 1 14  ? 6.155   11.006  2.987   1.00 0.00 ? 65  THR A H    1  
ATOM 209   H HA   . THR A 1 14  ? 6.349   9.874   0.230   1.00 0.00 ? 65  THR A HA   1  
ATOM 210   H HB   . THR A 1 14  ? 4.008   10.562  -0.037  1.00 0.00 ? 65  THR A HB   1  
ATOM 211   H HG1  . THR A 1 14  ? 3.157   11.862  1.351   1.00 0.00 ? 65  THR A HG1  1  
ATOM 212   H HG21 . THR A 1 14  ? 4.615   8.822   2.355   1.00 0.00 ? 65  THR A HG21 1  
ATOM 213   H HG22 . THR A 1 14  ? 3.020   8.929   1.611   1.00 0.00 ? 65  THR A HG22 1  
ATOM 214   H HG23 . THR A 1 14  ? 4.386   8.298   0.688   1.00 0.00 ? 65  THR A HG23 1  
ATOM 215   N N    . ASP A 1 15  ? 6.042   12.260  -0.817  1.00 0.00 ? 66  ASP A N    1  
ATOM 216   C CA   . ASP A 1 15  ? 6.370   13.595  -1.360  1.00 0.00 ? 66  ASP A CA   1  
ATOM 217   C C    . ASP A 1 15  ? 5.522   14.668  -0.672  1.00 0.00 ? 66  ASP A C    1  
ATOM 218   O O    . ASP A 1 15  ? 5.974   15.774  -0.450  1.00 0.00 ? 66  ASP A O    1  
ATOM 219   C CB   . ASP A 1 15  ? 6.117   13.584  -2.867  1.00 0.00 ? 66  ASP A CB   1  
ATOM 220   C CG   . ASP A 1 15  ? 7.137   12.652  -3.537  1.00 0.00 ? 66  ASP A CG   1  
ATOM 221   O OD1  . ASP A 1 15  ? 8.285   12.668  -3.124  1.00 0.00 ? 66  ASP A OD1  1  
ATOM 222   O OD2  . ASP A 1 15  ? 6.750   11.932  -4.441  1.00 0.00 ? 66  ASP A OD2  1  
ATOM 223   H H    . ASP A 1 15  ? 5.672   11.567  -1.408  1.00 0.00 ? 66  ASP A H    1  
ATOM 224   H HA   . ASP A 1 15  ? 7.414   13.795  -1.170  1.00 0.00 ? 66  ASP A HA   1  
ATOM 225   H HB2  . ASP A 1 15  ? 5.118   13.224  -3.064  1.00 0.00 ? 66  ASP A HB2  1  
ATOM 226   H HB3  . ASP A 1 15  ? 6.230   14.580  -3.264  1.00 0.00 ? 66  ASP A HB3  1  
ATOM 227   N N    . SER A 1 16  ? 4.301   14.359  -0.303  1.00 0.00 ? 67  SER A N    1  
ATOM 228   C CA   . SER A 1 16  ? 3.456   15.374  0.387   1.00 0.00 ? 67  SER A CA   1  
ATOM 229   C C    . SER A 1 16  ? 3.801   15.360  1.888   1.00 0.00 ? 67  SER A C    1  
ATOM 230   O O    . SER A 1 16  ? 3.882   14.304  2.484   1.00 0.00 ? 67  SER A O    1  
ATOM 231   C CB   . SER A 1 16  ? 1.974   15.011  0.189   1.00 0.00 ? 67  SER A CB   1  
ATOM 232   O OG   . SER A 1 16  ? 1.531   15.509  -1.069  1.00 0.00 ? 67  SER A OG   1  
ATOM 233   H H    . SER A 1 16  ? 3.950   13.457  -0.468  1.00 0.00 ? 67  SER A H    1  
ATOM 234   H HA   . SER A 1 16  ? 3.647   16.348  -0.036  1.00 0.00 ? 67  SER A HA   1  
ATOM 235   H HB2  . SER A 1 16  ? 1.866   13.938  0.198   1.00 0.00 ? 67  SER A HB2  1  
ATOM 236   H HB3  . SER A 1 16  ? 1.383   15.436  0.986   1.00 0.00 ? 67  SER A HB3  1  
ATOM 237   H HG   . SER A 1 16  ? 1.275   14.758  -1.614  1.00 0.00 ? 67  SER A HG   1  
ATOM 238   N N    . PRO A 1 17  ? 4.012   16.502  2.512   1.00 0.00 ? 68  PRO A N    1  
ATOM 239   C CA   . PRO A 1 17  ? 4.356   16.561  3.961   1.00 0.00 ? 68  PRO A CA   1  
ATOM 240   C C    . PRO A 1 17  ? 3.112   16.440  4.852   1.00 0.00 ? 68  PRO A C    1  
ATOM 241   O O    . PRO A 1 17  ? 3.188   16.579  6.055   1.00 0.00 ? 68  PRO A O    1  
ATOM 242   C CB   . PRO A 1 17  ? 4.982   17.941  4.100   1.00 0.00 ? 68  PRO A CB   1  
ATOM 243   C CG   . PRO A 1 17  ? 4.179   18.761  3.162   1.00 0.00 ? 68  PRO A CG   1  
ATOM 244   C CD   . PRO A 1 17  ? 3.954   17.866  1.939   1.00 0.00 ? 68  PRO A CD   1  
ATOM 245   H HA   . PRO A 1 17  ? 5.075   15.807  4.211   1.00 0.00 ? 68  PRO A HA   1  
ATOM 246   H HB2  . PRO A 1 17  ? 4.899   18.305  5.111   1.00 0.00 ? 68  PRO A HB2  1  
ATOM 247   H HB3  . PRO A 1 17  ? 6.013   17.923  3.780   1.00 0.00 ? 68  PRO A HB3  1  
ATOM 248   H HG2  . PRO A 1 17  ? 3.232   19.015  3.622   1.00 0.00 ? 68  PRO A HG2  1  
ATOM 249   H HG3  . PRO A 1 17  ? 4.714   19.650  2.879   1.00 0.00 ? 68  PRO A HG3  1  
ATOM 250   H HD2  . PRO A 1 17  ? 2.993   18.064  1.490   1.00 0.00 ? 68  PRO A HD2  1  
ATOM 251   H HD3  . PRO A 1 17  ? 4.752   18.000  1.220   1.00 0.00 ? 68  PRO A HD3  1  
ATOM 252   N N    . ASN A 1 18  ? 1.969   16.187  4.256   1.00 0.00 ? 69  ASN A N    1  
ATOM 253   C CA   . ASN A 1 18  ? 0.709   16.060  5.048   1.00 0.00 ? 69  ASN A CA   1  
ATOM 254   C C    . ASN A 1 18  ? 0.166   14.637  4.918   1.00 0.00 ? 69  ASN A C    1  
ATOM 255   O O    . ASN A 1 18  ? -0.519  14.158  5.788   1.00 0.00 ? 69  ASN A O    1  
ATOM 256   C CB   . ASN A 1 18  ? -0.323  17.042  4.496   1.00 0.00 ? 69  ASN A CB   1  
ATOM 257   C CG   . ASN A 1 18  ? 0.218   18.465  4.609   1.00 0.00 ? 69  ASN A CG   1  
ATOM 258   O OD1  . ASN A 1 18  ? 0.056   19.261  3.706   1.00 0.00 ? 69  ASN A OD1  1  
ATOM 259   N ND2  . ASN A 1 18  ? 0.859   18.825  5.688   1.00 0.00 ? 69  ASN A ND2  1  
ATOM 260   H H    . ASN A 1 18  ? 1.935   16.083  3.284   1.00 0.00 ? 69  ASN A H    1  
ATOM 261   H HA   . ASN A 1 18  ? 0.887   16.282  6.090   1.00 0.00 ? 69  ASN A HA   1  
ATOM 262   H HB2  . ASN A 1 18  ? -0.516  16.809  3.458   1.00 0.00 ? 69  ASN A HB2  1  
ATOM 263   H HB3  . ASN A 1 18  ? -1.240  16.957  5.059   1.00 0.00 ? 69  ASN A HB3  1  
ATOM 264   H HD21 . ASN A 1 18  ? 0.994   18.184  6.416   1.00 0.00 ? 69  ASN A HD21 1  
ATOM 265   H HD22 . ASN A 1 18  ? 1.212   19.734  5.766   1.00 0.00 ? 69  ASN A HD22 1  
ATOM 266   N N    . PHE A 1 19  ? 0.465   13.955  3.833   1.00 0.00 ? 70  PHE A N    1  
ATOM 267   C CA   . PHE A 1 19  ? -0.050  12.555  3.642   1.00 0.00 ? 70  PHE A CA   1  
ATOM 268   C C    . PHE A 1 19  ? 1.016   11.525  4.059   1.00 0.00 ? 70  PHE A C    1  
ATOM 269   O O    . PHE A 1 19  ? 2.091   11.471  3.498   1.00 0.00 ? 70  PHE A O    1  
ATOM 270   C CB   . PHE A 1 19  ? -0.424  12.358  2.149   1.00 0.00 ? 70  PHE A CB   1  
ATOM 271   C CG   . PHE A 1 19  ? -1.930  12.337  1.971   1.00 0.00 ? 70  PHE A CG   1  
ATOM 272   C CD1  . PHE A 1 19  ? -2.700  13.430  2.393   1.00 0.00 ? 70  PHE A CD1  1  
ATOM 273   C CD2  . PHE A 1 19  ? -2.551  11.228  1.380   1.00 0.00 ? 70  PHE A CD2  1  
ATOM 274   C CE1  . PHE A 1 19  ? -4.096  13.411  2.227   1.00 0.00 ? 70  PHE A CE1  1  
ATOM 275   C CE2  . PHE A 1 19  ? -3.943  11.211  1.216   1.00 0.00 ? 70  PHE A CE2  1  
ATOM 276   C CZ   . PHE A 1 19  ? -4.716  12.306  1.642   1.00 0.00 ? 70  PHE A CZ   1  
ATOM 277   H H    . PHE A 1 19  ? 1.026   14.367  3.138   1.00 0.00 ? 70  PHE A H    1  
ATOM 278   H HA   . PHE A 1 19  ? -0.926  12.407  4.261   1.00 0.00 ? 70  PHE A HA   1  
ATOM 279   H HB2  . PHE A 1 19  ? -0.010  13.168  1.568   1.00 0.00 ? 70  PHE A HB2  1  
ATOM 280   H HB3  . PHE A 1 19  ? -0.015  11.425  1.794   1.00 0.00 ? 70  PHE A HB3  1  
ATOM 281   H HD1  . PHE A 1 19  ? -2.217  14.282  2.844   1.00 0.00 ? 70  PHE A HD1  1  
ATOM 282   H HD2  . PHE A 1 19  ? -1.954  10.390  1.044   1.00 0.00 ? 70  PHE A HD2  1  
ATOM 283   H HE1  . PHE A 1 19  ? -4.693  14.250  2.555   1.00 0.00 ? 70  PHE A HE1  1  
ATOM 284   H HE2  . PHE A 1 19  ? -4.414  10.349  0.767   1.00 0.00 ? 70  PHE A HE2  1  
ATOM 285   H HZ   . PHE A 1 19  ? -5.792  12.303  1.517   1.00 0.00 ? 70  PHE A HZ   1  
ATOM 286   N N    . LEU A 1 20  ? 0.698   10.691  5.025   1.00 0.00 ? 71  LEU A N    1  
ATOM 287   C CA   . LEU A 1 20  ? 1.658   9.629   5.482   1.00 0.00 ? 71  LEU A CA   1  
ATOM 288   C C    . LEU A 1 20  ? 0.930   8.276   5.523   1.00 0.00 ? 71  LEU A C    1  
ATOM 289   O O    . LEU A 1 20  ? -0.228  8.189   5.880   1.00 0.00 ? 71  LEU A O    1  
ATOM 290   C CB   . LEU A 1 20  ? 2.167   9.940   6.903   1.00 0.00 ? 71  LEU A CB   1  
ATOM 291   C CG   . LEU A 1 20  ? 3.053   11.211  6.956   1.00 0.00 ? 71  LEU A CG   1  
ATOM 292   C CD1  . LEU A 1 20  ? 4.199   11.119  5.939   1.00 0.00 ? 71  LEU A CD1  1  
ATOM 293   C CD2  . LEU A 1 20  ? 2.214   12.497  6.720   1.00 0.00 ? 71  LEU A CD2  1  
ATOM 294   H H    . LEU A 1 20  ? -0.190  10.750  5.439   1.00 0.00 ? 71  LEU A H    1  
ATOM 295   H HA   . LEU A 1 20  ? 2.493   9.562   4.800   1.00 0.00 ? 71  LEU A HA   1  
ATOM 296   H HB2  . LEU A 1 20  ? 1.320   10.069  7.560   1.00 0.00 ? 71  LEU A HB2  1  
ATOM 297   H HB3  . LEU A 1 20  ? 2.749   9.095   7.251   1.00 0.00 ? 71  LEU A HB3  1  
ATOM 298   H HG   . LEU A 1 20  ? 3.497   11.269  7.942   1.00 0.00 ? 71  LEU A HG   1  
ATOM 299   H HD11 . LEU A 1 20  ? 4.520   10.093  5.850   1.00 0.00 ? 71  LEU A HD11 1  
ATOM 300   H HD12 . LEU A 1 20  ? 3.867   11.474  4.978   1.00 0.00 ? 71  LEU A HD12 1  
ATOM 301   H HD13 . LEU A 1 20  ? 5.028   11.722  6.277   1.00 0.00 ? 71  LEU A HD13 1  
ATOM 302   H HD21 . LEU A 1 20  ? 1.161   12.281  6.832   1.00 0.00 ? 71  LEU A HD21 1  
ATOM 303   H HD22 . LEU A 1 20  ? 2.500   13.239  7.448   1.00 0.00 ? 71  LEU A HD22 1  
ATOM 304   H HD23 . LEU A 1 20  ? 2.399   12.887  5.731   1.00 0.00 ? 71  LEU A HD23 1  
ATOM 305   N N    . CYS A 1 21  ? 1.616   7.208   5.187   1.00 0.00 ? 72  CYS A N    1  
ATOM 306   C CA   . CYS A 1 21  ? 0.989   5.847   5.233   1.00 0.00 ? 72  CYS A CA   1  
ATOM 307   C C    . CYS A 1 21  ? 1.425   5.182   6.538   1.00 0.00 ? 72  CYS A C    1  
ATOM 308   O O    . CYS A 1 21  ? 2.592   5.180   6.869   1.00 0.00 ? 72  CYS A O    1  
ATOM 309   C CB   . CYS A 1 21  ? 1.483   5.018   4.048   1.00 0.00 ? 72  CYS A CB   1  
ATOM 310   S SG   . CYS A 1 21  ? 1.287   5.976   2.525   1.00 0.00 ? 72  CYS A SG   1  
ATOM 311   H H    . CYS A 1 21  ? 2.553   7.303   4.923   1.00 0.00 ? 72  CYS A H    1  
ATOM 312   H HA   . CYS A 1 21  ? -0.090  5.927   5.199   1.00 0.00 ? 72  CYS A HA   1  
ATOM 313   H HB2  . CYS A 1 21  ? 2.522   4.773   4.190   1.00 0.00 ? 72  CYS A HB2  1  
ATOM 314   H HB3  . CYS A 1 21  ? 0.901   4.109   3.978   1.00 0.00 ? 72  CYS A HB3  1  
ATOM 315   H HG   . CYS A 1 21  ? 0.935   6.839   2.759   1.00 0.00 ? 72  CYS A HG   1  
ATOM 316   N N    . SER A 1 22  ? 0.506   4.653   7.303   1.00 0.00 ? 73  SER A N    1  
ATOM 317   C CA   . SER A 1 22  ? 0.893   4.032   8.616   1.00 0.00 ? 73  SER A CA   1  
ATOM 318   C C    . SER A 1 22  ? 1.761   2.779   8.446   1.00 0.00 ? 73  SER A C    1  
ATOM 319   O O    . SER A 1 22  ? 2.686   2.562   9.196   1.00 0.00 ? 73  SER A O    1  
ATOM 320   C CB   . SER A 1 22  ? -0.365  3.646   9.388   1.00 0.00 ? 73  SER A CB   1  
ATOM 321   O OG   . SER A 1 22  ? -1.206  4.786   9.529   1.00 0.00 ? 73  SER A OG   1  
ATOM 322   H H    . SER A 1 22  ? -0.444  4.677   7.025   1.00 0.00 ? 73  SER A H    1  
ATOM 323   H HA   . SER A 1 22  ? 1.452   4.755   9.194   1.00 0.00 ? 73  SER A HA   1  
ATOM 324   H HB2  . SER A 1 22  ? -0.893  2.881   8.850   1.00 0.00 ? 73  SER A HB2  1  
ATOM 325   H HB3  . SER A 1 22  ? -0.085  3.268   10.364  1.00 0.00 ? 73  SER A HB3  1  
ATOM 326   H HG   . SER A 1 22  ? -0.649  5.567   9.516   1.00 0.00 ? 73  SER A HG   1  
ATOM 327   N N    . VAL A 1 23  ? 1.466   1.935   7.499   1.00 0.00 ? 74  VAL A N    1  
ATOM 328   C CA   . VAL A 1 23  ? 2.266   0.680   7.334   1.00 0.00 ? 74  VAL A CA   1  
ATOM 329   C C    . VAL A 1 23  ? 3.433   0.912   6.385   1.00 0.00 ? 74  VAL A C    1  
ATOM 330   O O    . VAL A 1 23  ? 3.428   1.825   5.578   1.00 0.00 ? 74  VAL A O    1  
ATOM 331   C CB   . VAL A 1 23  ? 1.386   -0.433  6.767   1.00 0.00 ? 74  VAL A CB   1  
ATOM 332   C CG1  . VAL A 1 23  ? 2.181   -1.742  6.712   1.00 0.00 ? 74  VAL A CG1  1  
ATOM 333   C CG2  . VAL A 1 23  ? 0.151   -0.610  7.654   1.00 0.00 ? 74  VAL A CG2  1  
ATOM 334   H H    . VAL A 1 23  ? 0.700   2.109   6.914   1.00 0.00 ? 74  VAL A H    1  
ATOM 335   H HA   . VAL A 1 23  ? 2.651   0.366   8.297   1.00 0.00 ? 74  VAL A HA   1  
ATOM 336   H HB   . VAL A 1 23  ? 1.082   -0.164  5.771   1.00 0.00 ? 74  VAL A HB   1  
ATOM 337   H HG11 . VAL A 1 23  ? 2.685   -1.904  7.657   1.00 0.00 ? 74  VAL A HG11 1  
ATOM 338   H HG12 . VAL A 1 23  ? 1.507   -2.566  6.522   1.00 0.00 ? 74  VAL A HG12 1  
ATOM 339   H HG13 . VAL A 1 23  ? 2.913   -1.686  5.918   1.00 0.00 ? 74  VAL A HG13 1  
ATOM 340   H HG21 . VAL A 1 23  ? 0.457   -0.803  8.671   1.00 0.00 ? 74  VAL A HG21 1  
ATOM 341   H HG22 . VAL A 1 23  ? -0.449  0.288   7.622   1.00 0.00 ? 74  VAL A HG22 1  
ATOM 342   H HG23 . VAL A 1 23  ? -0.433  -1.443  7.291   1.00 0.00 ? 74  VAL A HG23 1  
ATOM 343   N N    . LEU A 1 24  ? 4.441   0.093   6.488   1.00 0.00 ? 75  LEU A N    1  
ATOM 344   C CA   . LEU A 1 24  ? 5.644   0.229   5.624   1.00 0.00 ? 75  LEU A CA   1  
ATOM 345   C C    . LEU A 1 24  ? 5.663   -0.929  4.613   1.00 0.00 ? 75  LEU A C    1  
ATOM 346   O O    . LEU A 1 24  ? 6.381   -1.892  4.792   1.00 0.00 ? 75  LEU A O    1  
ATOM 347   C CB   . LEU A 1 24  ? 6.900   0.148   6.515   1.00 0.00 ? 75  LEU A CB   1  
ATOM 348   C CG   . LEU A 1 24  ? 6.685   0.937   7.820   1.00 0.00 ? 75  LEU A CG   1  
ATOM 349   C CD1  . LEU A 1 24  ? 7.933   0.811   8.708   1.00 0.00 ? 75  LEU A CD1  1  
ATOM 350   C CD2  . LEU A 1 24  ? 6.428   2.412   7.492   1.00 0.00 ? 75  LEU A CD2  1  
ATOM 351   H H    . LEU A 1 24  ? 4.408   -0.625  7.158   1.00 0.00 ? 75  LEU A H    1  
ATOM 352   H HA   . LEU A 1 24  ? 5.632   1.171   5.106   1.00 0.00 ? 75  LEU A HA   1  
ATOM 353   H HB2  . LEU A 1 24  ? 7.102   -0.886  6.764   1.00 0.00 ? 75  LEU A HB2  1  
ATOM 354   H HB3  . LEU A 1 24  ? 7.745   0.556   5.987   1.00 0.00 ? 75  LEU A HB3  1  
ATOM 355   H HG   . LEU A 1 24  ? 5.838   0.532   8.352   1.00 0.00 ? 75  LEU A HG   1  
ATOM 356   H HD11 . LEU A 1 24  ? 8.822   0.903   8.104   1.00 0.00 ? 75  LEU A HD11 1  
ATOM 357   H HD12 . LEU A 1 24  ? 7.925   1.592   9.458   1.00 0.00 ? 75  LEU A HD12 1  
ATOM 358   H HD13 . LEU A 1 24  ? 7.930   -0.154  9.198   1.00 0.00 ? 75  LEU A HD13 1  
ATOM 359   H HD21 . LEU A 1 24  ? 7.091   2.730   6.701   1.00 0.00 ? 75  LEU A HD21 1  
ATOM 360   H HD22 . LEU A 1 24  ? 5.405   2.530   7.173   1.00 0.00 ? 75  LEU A HD22 1  
ATOM 361   H HD23 . LEU A 1 24  ? 6.601   3.015   8.370   1.00 0.00 ? 75  LEU A HD23 1  
ATOM 362   N N    . PRO A 1 25  ? 4.880   -0.863  3.557   1.00 0.00 ? 76  PRO A N    1  
ATOM 363   C CA   . PRO A 1 25  ? 4.857   -1.959  2.557   1.00 0.00 ? 76  PRO A CA   1  
ATOM 364   C C    . PRO A 1 25  ? 6.168   -2.055  1.778   1.00 0.00 ? 76  PRO A C    1  
ATOM 365   O O    . PRO A 1 25  ? 6.196   -2.533  0.665   1.00 0.00 ? 76  PRO A O    1  
ATOM 366   C CB   . PRO A 1 25  ? 3.689   -1.620  1.627   1.00 0.00 ? 76  PRO A CB   1  
ATOM 367   C CG   . PRO A 1 25  ? 3.481   -0.145  1.774   1.00 0.00 ? 76  PRO A CG   1  
ATOM 368   C CD   . PRO A 1 25  ? 3.944   0.224   3.197   1.00 0.00 ? 76  PRO A CD   1  
ATOM 369   H HA   . PRO A 1 25  ? 4.663   -2.897  3.052   1.00 0.00 ? 76  PRO A HA   1  
ATOM 370   H HB2  . PRO A 1 25  ? 3.932   -1.876  0.602   1.00 0.00 ? 76  PRO A HB2  1  
ATOM 371   H HB3  . PRO A 1 25  ? 2.801   -2.154  1.937   1.00 0.00 ? 76  PRO A HB3  1  
ATOM 372   H HG2  . PRO A 1 25  ? 4.073   0.390   1.038   1.00 0.00 ? 76  PRO A HG2  1  
ATOM 373   H HG3  . PRO A 1 25  ? 2.437   0.103   1.657   1.00 0.00 ? 76  PRO A HG3  1  
ATOM 374   H HD2  . PRO A 1 25  ? 4.439   1.183   3.186   1.00 0.00 ? 76  PRO A HD2  1  
ATOM 375   H HD3  . PRO A 1 25  ? 3.104   0.238   3.875   1.00 0.00 ? 76  PRO A HD3  1  
ATOM 376   N N    . THR A 1 26  ? 7.253   -1.642  2.360   1.00 0.00 ? 77  THR A N    1  
ATOM 377   C CA   . THR A 1 26  ? 8.541   -1.757  1.636   1.00 0.00 ? 77  THR A CA   1  
ATOM 378   C C    . THR A 1 26  ? 8.727   -3.239  1.329   1.00 0.00 ? 77  THR A C    1  
ATOM 379   O O    . THR A 1 26  ? 9.511   -3.639  0.489   1.00 0.00 ? 77  THR A O    1  
ATOM 380   C CB   . THR A 1 26  ? 9.667   -1.237  2.541   1.00 0.00 ? 77  THR A CB   1  
ATOM 381   O OG1  . THR A 1 26  ? 9.870   -2.129  3.624   1.00 0.00 ? 77  THR A OG1  1  
ATOM 382   C CG2  . THR A 1 26  ? 9.269   0.131   3.089   1.00 0.00 ? 77  THR A CG2  1  
ATOM 383   H H    . THR A 1 26  ? 7.227   -1.278  3.269   1.00 0.00 ? 77  THR A H    1  
ATOM 384   H HA   . THR A 1 26  ? 8.505   -1.186  0.720   1.00 0.00 ? 77  THR A HA   1  
ATOM 385   H HB   . THR A 1 26  ? 10.580  -1.141  1.975   1.00 0.00 ? 77  THR A HB   1  
ATOM 386   H HG1  . THR A 1 26  ? 10.573  -1.768  4.171   1.00 0.00 ? 77  THR A HG1  1  
ATOM 387   H HG21 . THR A 1 26  ? 9.000   0.780   2.270   1.00 0.00 ? 77  THR A HG21 1  
ATOM 388   H HG22 . THR A 1 26  ? 8.422   0.017   3.749   1.00 0.00 ? 77  THR A HG22 1  
ATOM 389   H HG23 . THR A 1 26  ? 10.098  0.557   3.634   1.00 0.00 ? 77  THR A HG23 1  
ATOM 390   N N    . HIS A 1 27  ? 7.962   -4.051  2.016   1.00 0.00 ? 78  HIS A N    1  
ATOM 391   C CA   . HIS A 1 27  ? 8.005   -5.530  1.819   1.00 0.00 ? 78  HIS A CA   1  
ATOM 392   C C    . HIS A 1 27  ? 6.582   -6.074  1.709   1.00 0.00 ? 78  HIS A C    1  
ATOM 393   O O    . HIS A 1 27  ? 5.617   -5.373  1.940   1.00 0.00 ? 78  HIS A O    1  
ATOM 394   C CB   . HIS A 1 27  ? 8.644   -6.176  3.049   1.00 0.00 ? 78  HIS A CB   1  
ATOM 395   C CG   . HIS A 1 27  ? 7.810   -5.874  4.277   1.00 0.00 ? 78  HIS A CG   1  
ATOM 396   N ND1  . HIS A 1 27  ? 8.337   -5.213  5.375   1.00 0.00 ? 78  HIS A ND1  1  
ATOM 397   C CD2  . HIS A 1 27  ? 6.493   -6.142  4.605   1.00 0.00 ? 78  HIS A CD2  1  
ATOM 398   C CE1  . HIS A 1 27  ? 7.363   -5.106  6.298   1.00 0.00 ? 78  HIS A CE1  1  
ATOM 399   N NE2  . HIS A 1 27  ? 6.220   -5.654  5.879   1.00 0.00 ? 78  HIS A NE2  1  
ATOM 400   H H    . HIS A 1 27  ? 7.338   -3.676  2.667   1.00 0.00 ? 78  HIS A H    1  
ATOM 401   H HA   . HIS A 1 27  ? 8.571   -5.781  0.935   1.00 0.00 ? 78  HIS A HA   1  
ATOM 402   H HB2  . HIS A 1 27  ? 8.693   -7.245  2.904   1.00 0.00 ? 78  HIS A HB2  1  
ATOM 403   H HB3  . HIS A 1 27  ? 9.640   -5.782  3.186   1.00 0.00 ? 78  HIS A HB3  1  
ATOM 404   H HD1  . HIS A 1 27  ? 9.256   -4.881  5.463   1.00 0.00 ? 78  HIS A HD1  1  
ATOM 405   H HD2  . HIS A 1 27  ? 5.772   -6.649  3.975   1.00 0.00 ? 78  HIS A HD2  1  
ATOM 406   H HE1  . HIS A 1 27  ? 7.494   -4.639  7.262   1.00 0.00 ? 78  HIS A HE1  1  
ATOM 407   N N    . TRP A 1 28  ? 6.447   -7.338  1.409   1.00 0.00 ? 79  TRP A N    1  
ATOM 408   C CA   . TRP A 1 28  ? 5.091   -7.960  1.339   1.00 0.00 ? 79  TRP A CA   1  
ATOM 409   C C    . TRP A 1 28  ? 5.174   -9.418  1.813   1.00 0.00 ? 79  TRP A C    1  
ATOM 410   O O    . TRP A 1 28  ? 6.213   -10.046 1.747   1.00 0.00 ? 79  TRP A O    1  
ATOM 411   C CB   . TRP A 1 28  ? 4.592   -7.950  -0.101  1.00 0.00 ? 79  TRP A CB   1  
ATOM 412   C CG   . TRP A 1 28  ? 3.099   -7.968  -0.149  1.00 0.00 ? 79  TRP A CG   1  
ATOM 413   C CD1  . TRP A 1 28  ? 2.310   -9.057  0.005   1.00 0.00 ? 79  TRP A CD1  1  
ATOM 414   C CD2  . TRP A 1 28  ? 2.220   -6.851  -0.393  1.00 0.00 ? 79  TRP A CD2  1  
ATOM 415   N NE1  . TRP A 1 28  ? 0.990   -8.679  -0.158  1.00 0.00 ? 79  TRP A NE1  1  
ATOM 416   C CE2  . TRP A 1 28  ? 0.885   -7.314  -0.404  1.00 0.00 ? 79  TRP A CE2  1  
ATOM 417   C CE3  . TRP A 1 28  ? 2.464   -5.487  -0.608  1.00 0.00 ? 79  TRP A CE3  1  
ATOM 418   C CZ2  . TRP A 1 28  ? -0.179  -6.442  -0.634  1.00 0.00 ? 79  TRP A CZ2  1  
ATOM 419   C CZ3  . TRP A 1 28  ? 1.398   -4.606  -0.834  1.00 0.00 ? 79  TRP A CZ3  1  
ATOM 420   C CH2  . TRP A 1 28  ? 0.079   -5.080  -0.851  1.00 0.00 ? 79  TRP A CH2  1  
ATOM 421   H H    . TRP A 1 28  ? 7.241   -7.887  1.260   1.00 0.00 ? 79  TRP A H    1  
ATOM 422   H HA   . TRP A 1 28  ? 4.407   -7.414  1.977   1.00 0.00 ? 79  TRP A HA   1  
ATOM 423   H HB2  . TRP A 1 28  ? 4.943   -7.057  -0.595  1.00 0.00 ? 79  TRP A HB2  1  
ATOM 424   H HB3  . TRP A 1 28  ? 4.970   -8.813  -0.626  1.00 0.00 ? 79  TRP A HB3  1  
ATOM 425   H HD1  . TRP A 1 28  ? 2.650   -10.050 0.220   1.00 0.00 ? 79  TRP A HD1  1  
ATOM 426   H HE1  . TRP A 1 28  ? 0.212   -9.294  -0.108  1.00 0.00 ? 79  TRP A HE1  1  
ATOM 427   H HE3  . TRP A 1 28  ? 3.481   -5.118  -0.579  1.00 0.00 ? 79  TRP A HE3  1  
ATOM 428   H HZ2  . TRP A 1 28  ? -1.190  -6.812  -0.640  1.00 0.00 ? 79  TRP A HZ2  1  
ATOM 429   H HZ3  . TRP A 1 28  ? 1.595   -3.555  -1.001  1.00 0.00 ? 79  TRP A HZ3  1  
ATOM 430   H HH2  . TRP A 1 28  ? -0.738  -4.397  -1.026  1.00 0.00 ? 79  TRP A HH2  1  
ATOM 431   N N    . ARG A 1 29  ? 4.073   -9.966  2.254   1.00 0.00 ? 80  ARG A N    1  
ATOM 432   C CA   . ARG A 1 29  ? 4.052   -11.395 2.693   1.00 0.00 ? 80  ARG A CA   1  
ATOM 433   C C    . ARG A 1 29  ? 2.747   -12.028 2.207   1.00 0.00 ? 80  ARG A C    1  
ATOM 434   O O    . ARG A 1 29  ? 1.846   -12.254 2.988   1.00 0.00 ? 80  ARG A O    1  
ATOM 435   C CB   . ARG A 1 29  ? 4.110   -11.453 4.228   1.00 0.00 ? 80  ARG A CB   1  
ATOM 436   C CG   . ARG A 1 29  ? 4.157   -12.911 4.730   1.00 0.00 ? 80  ARG A CG   1  
ATOM 437   C CD   . ARG A 1 29  ? 5.540   -13.519 4.469   1.00 0.00 ? 80  ARG A CD   1  
ATOM 438   N NE   . ARG A 1 29  ? 5.628   -14.856 5.136   1.00 0.00 ? 80  ARG A NE   1  
ATOM 439   C CZ   . ARG A 1 29  ? 5.506   -14.972 6.430   1.00 0.00 ? 80  ARG A CZ   1  
ATOM 440   N NH1  . ARG A 1 29  ? 5.500   -13.903 7.179   1.00 0.00 ? 80  ARG A NH1  1  
ATOM 441   N NH2  . ARG A 1 29  ? 5.443   -16.153 6.977   1.00 0.00 ? 80  ARG A NH2  1  
ATOM 442   H H    . ARG A 1 29  ? 3.246   -9.441  2.268   1.00 0.00 ? 80  ARG A H    1  
ATOM 443   H HA   . ARG A 1 29  ? 4.894   -11.921 2.270   1.00 0.00 ? 80  ARG A HA   1  
ATOM 444   H HB2  . ARG A 1 29  ? 4.993   -10.933 4.571   1.00 0.00 ? 80  ARG A HB2  1  
ATOM 445   H HB3  . ARG A 1 29  ? 3.235   -10.968 4.634   1.00 0.00 ? 80  ARG A HB3  1  
ATOM 446   H HG2  . ARG A 1 29  ? 3.936   -12.926 5.783   1.00 0.00 ? 80  ARG A HG2  1  
ATOM 447   H HG3  . ARG A 1 29  ? 3.412   -13.494 4.211   1.00 0.00 ? 80  ARG A HG3  1  
ATOM 448   H HD2  . ARG A 1 29  ? 5.670   -13.690 3.422   1.00 0.00 ? 80  ARG A HD2  1  
ATOM 449   H HD3  . ARG A 1 29  ? 6.312   -12.830 4.818   1.00 0.00 ? 80  ARG A HD3  1  
ATOM 450   H HE   . ARG A 1 29  ? 5.724   -15.665 4.587   1.00 0.00 ? 80  ARG A HE   1  
ATOM 451   H HH11 . ARG A 1 29  ? 5.588   -12.999 6.759   1.00 0.00 ? 80  ARG A HH11 1  
ATOM 452   H HH12 . ARG A 1 29  ? 5.407   -13.985 8.170   1.00 0.00 ? 80  ARG A HH12 1  
ATOM 453   H HH21 . ARG A 1 29  ? 5.488   -16.974 6.405   1.00 0.00 ? 80  ARG A HH21 1  
ATOM 454   H HH22 . ARG A 1 29  ? 5.347   -16.238 7.970   1.00 0.00 ? 80  ARG A HH22 1  
ATOM 455   N N    . SER A 1 30  ? 2.624   -12.318 0.930   1.00 0.00 ? 81  SER A N    1  
ATOM 456   C CA   . SER A 1 30  ? 1.352   -12.932 0.422   1.00 0.00 ? 81  SER A CA   1  
ATOM 457   C C    . SER A 1 30  ? 1.632   -14.324 -0.121  1.00 0.00 ? 81  SER A C    1  
ATOM 458   O O    . SER A 1 30  ? 2.213   -14.491 -1.175  1.00 0.00 ? 81  SER A O    1  
ATOM 459   C CB   . SER A 1 30  ? 0.781   -12.055 -0.694  1.00 0.00 ? 81  SER A CB   1  
ATOM 460   O OG   . SER A 1 30  ? 0.132   -10.937 -0.109  1.00 0.00 ? 81  SER A OG   1  
ATOM 461   H H    . SER A 1 30  ? 3.359   -12.129 0.308   1.00 0.00 ? 81  SER A H    1  
ATOM 462   H HA   . SER A 1 30  ? 0.626   -13.008 1.216   1.00 0.00 ? 81  SER A HA   1  
ATOM 463   H HB2  . SER A 1 30  ? 1.580   -11.710 -1.335  1.00 0.00 ? 81  SER A HB2  1  
ATOM 464   H HB3  . SER A 1 30  ? 0.069   -12.630 -1.279  1.00 0.00 ? 81  SER A HB3  1  
ATOM 465   H HG   . SER A 1 30  ? -0.276  -10.429 -0.809  1.00 0.00 ? 81  SER A HG   1  
ATOM 466   N N    . ASN A 1 31  ? 1.205   -15.322 0.584   1.00 0.00 ? 82  ASN A N    1  
ATOM 467   C CA   . ASN A 1 31  ? 1.422   -16.702 0.100   1.00 0.00 ? 82  ASN A CA   1  
ATOM 468   C C    . ASN A 1 31  ? 0.658   -16.894 -1.213  1.00 0.00 ? 82  ASN A C    1  
ATOM 469   O O    . ASN A 1 31  ? 1.044   -17.660 -2.073  1.00 0.00 ? 82  ASN A O    1  
ATOM 470   C CB   . ASN A 1 31  ? 0.907   -17.696 1.147   1.00 0.00 ? 82  ASN A CB   1  
ATOM 471   C CG   . ASN A 1 31  ? 1.662   -17.498 2.471   1.00 0.00 ? 82  ASN A CG   1  
ATOM 472   O OD1  . ASN A 1 31  ? 2.694   -16.855 2.501   1.00 0.00 ? 82  ASN A OD1  1  
ATOM 473   N ND2  . ASN A 1 31  ? 1.204   -18.043 3.565   1.00 0.00 ? 82  ASN A ND2  1  
ATOM 474   H H    . ASN A 1 31  ? 0.723   -15.166 1.424   1.00 0.00 ? 82  ASN A H    1  
ATOM 475   H HA   . ASN A 1 31  ? 2.473   -16.862 -0.065  1.00 0.00 ? 82  ASN A HA   1  
ATOM 476   H HB2  . ASN A 1 31  ? -0.151  -17.529 1.307   1.00 0.00 ? 82  ASN A HB2  1  
ATOM 477   H HB3  . ASN A 1 31  ? 1.063   -18.702 0.792   1.00 0.00 ? 82  ASN A HB3  1  
ATOM 478   H HD21 . ASN A 1 31  ? 0.388   -18.582 3.542   1.00 0.00 ? 82  ASN A HD21 1  
ATOM 479   H HD22 . ASN A 1 31  ? 1.674   -17.906 4.415   1.00 0.00 ? 82  ASN A HD22 1  
ATOM 480   N N    . LYS A 1 32  ? -0.439  -16.202 -1.359  1.00 0.00 ? 83  LYS A N    1  
ATOM 481   C CA   . LYS A 1 32  ? -1.257  -16.334 -2.600  1.00 0.00 ? 83  LYS A CA   1  
ATOM 482   C C    . LYS A 1 32  ? -2.163  -15.105 -2.732  1.00 0.00 ? 83  LYS A C    1  
ATOM 483   O O    . LYS A 1 32  ? -1.702  -13.979 -2.720  1.00 0.00 ? 83  LYS A O    1  
ATOM 484   C CB   . LYS A 1 32  ? -2.101  -17.622 -2.524  1.00 0.00 ? 83  LYS A CB   1  
ATOM 485   C CG   . LYS A 1 32  ? -2.811  -17.705 -1.167  1.00 0.00 ? 83  LYS A CG   1  
ATOM 486   C CD   . LYS A 1 32  ? -3.594  -19.028 -1.052  1.00 0.00 ? 83  LYS A CD   1  
ATOM 487   C CE   . LYS A 1 32  ? -4.765  -19.065 -2.048  1.00 0.00 ? 83  LYS A CE   1  
ATOM 488   N NZ   . LYS A 1 32  ? -5.824  -19.971 -1.516  1.00 0.00 ? 83  LYS A NZ   1  
ATOM 489   H H    . LYS A 1 32  ? -0.727  -15.585 -0.646  1.00 0.00 ? 83  LYS A H    1  
ATOM 490   H HA   . LYS A 1 32  ? -0.601  -16.385 -3.458  1.00 0.00 ? 83  LYS A HA   1  
ATOM 491   H HB2  . LYS A 1 32  ? -2.834  -17.619 -3.319  1.00 0.00 ? 83  LYS A HB2  1  
ATOM 492   H HB3  . LYS A 1 32  ? -1.451  -18.477 -2.638  1.00 0.00 ? 83  LYS A HB3  1  
ATOM 493   H HG2  . LYS A 1 32  ? -2.071  -17.663 -0.379  1.00 0.00 ? 83  LYS A HG2  1  
ATOM 494   H HG3  . LYS A 1 32  ? -3.493  -16.877 -1.061  1.00 0.00 ? 83  LYS A HG3  1  
ATOM 495   H HD2  . LYS A 1 32  ? -2.933  -19.858 -1.250  1.00 0.00 ? 83  LYS A HD2  1  
ATOM 496   H HD3  . LYS A 1 32  ? -3.984  -19.120 -0.047  1.00 0.00 ? 83  LYS A HD3  1  
ATOM 497   H HE2  . LYS A 1 32  ? -5.170  -18.073 -2.182  1.00 0.00 ? 83  LYS A HE2  1  
ATOM 498   H HE3  . LYS A 1 32  ? -4.418  -19.443 -3.000  1.00 0.00 ? 83  LYS A HE3  1  
ATOM 499   H HZ1  . LYS A 1 32  ? -5.652  -20.147 -0.505  1.00 0.00 ? 83  LYS A HZ1  1  
ATOM 500   H HZ2  . LYS A 1 32  ? -6.758  -19.529 -1.634  1.00 0.00 ? 83  LYS A HZ2  1  
ATOM 501   H HZ3  . LYS A 1 32  ? -5.800  -20.874 -2.032  1.00 0.00 ? 83  LYS A HZ3  1  
ATOM 502   N N    . THR A 1 33  ? -3.447  -15.309 -2.828  1.00 0.00 ? 84  THR A N    1  
ATOM 503   C CA   . THR A 1 33  ? -4.391  -14.172 -2.918  1.00 0.00 ? 84  THR A CA   1  
ATOM 504   C C    . THR A 1 33  ? -4.595  -13.638 -1.495  1.00 0.00 ? 84  THR A C    1  
ATOM 505   O O    . THR A 1 33  ? -5.697  -13.350 -1.070  1.00 0.00 ? 84  THR A O    1  
ATOM 506   C CB   . THR A 1 33  ? -5.720  -14.666 -3.509  1.00 0.00 ? 84  THR A CB   1  
ATOM 507   O OG1  . THR A 1 33  ? -5.459  -15.391 -4.706  1.00 0.00 ? 84  THR A OG1  1  
ATOM 508   C CG2  . THR A 1 33  ? -6.634  -13.478 -3.832  1.00 0.00 ? 84  THR A CG2  1  
ATOM 509   H H    . THR A 1 33  ? -3.798  -16.216 -2.812  1.00 0.00 ? 84  THR A H    1  
ATOM 510   H HA   . THR A 1 33  ? -3.971  -13.398 -3.544  1.00 0.00 ? 84  THR A HA   1  
ATOM 511   H HB   . THR A 1 33  ? -6.214  -15.313 -2.801  1.00 0.00 ? 84  THR A HB   1  
ATOM 512   H HG1  . THR A 1 33  ? -4.521  -15.585 -4.740  1.00 0.00 ? 84  THR A HG1  1  
ATOM 513   H HG21 . THR A 1 33  ? -6.091  -12.763 -4.430  1.00 0.00 ? 84  THR A HG21 1  
ATOM 514   H HG22 . THR A 1 33  ? -7.495  -13.825 -4.384  1.00 0.00 ? 84  THR A HG22 1  
ATOM 515   H HG23 . THR A 1 33  ? -6.961  -13.009 -2.919  1.00 0.00 ? 84  THR A HG23 1  
ATOM 516   N N    . LEU A 1 34  ? -3.526  -13.514 -0.750  1.00 0.00 ? 85  LEU A N    1  
ATOM 517   C CA   . LEU A 1 34  ? -3.617  -13.012 0.656   1.00 0.00 ? 85  LEU A CA   1  
ATOM 518   C C    . LEU A 1 34  ? -2.819  -11.716 0.746   1.00 0.00 ? 85  LEU A C    1  
ATOM 519   O O    . LEU A 1 34  ? -1.661  -11.730 1.100   1.00 0.00 ? 85  LEU A O    1  
ATOM 520   C CB   . LEU A 1 34  ? -2.991  -14.057 1.589   1.00 0.00 ? 85  LEU A CB   1  
ATOM 521   C CG   . LEU A 1 34  ? -3.032  -13.582 3.044   1.00 0.00 ? 85  LEU A CG   1  
ATOM 522   C CD1  . LEU A 1 34  ? -4.479  -13.261 3.468   1.00 0.00 ? 85  LEU A CD1  1  
ATOM 523   C CD2  . LEU A 1 34  ? -2.472  -14.687 3.935   1.00 0.00 ? 85  LEU A CD2  1  
ATOM 524   H H    . LEU A 1 34  ? -2.649  -13.764 -1.116  1.00 0.00 ? 85  LEU A H    1  
ATOM 525   H HA   . LEU A 1 34  ? -4.639  -12.846 0.935   1.00 0.00 ? 85  LEU A HA   1  
ATOM 526   H HB2  . LEU A 1 34  ? -3.531  -14.988 1.498   1.00 0.00 ? 85  LEU A HB2  1  
ATOM 527   H HB3  . LEU A 1 34  ? -1.958  -14.216 1.302   1.00 0.00 ? 85  LEU A HB3  1  
ATOM 528   H HG   . LEU A 1 34  ? -2.426  -12.694 3.149   1.00 0.00 ? 85  LEU A HG   1  
ATOM 529   H HD11 . LEU A 1 34  ? -5.164  -13.933 2.974   1.00 0.00 ? 85  LEU A HD11 1  
ATOM 530   H HD12 . LEU A 1 34  ? -4.579  -13.369 4.539   1.00 0.00 ? 85  LEU A HD12 1  
ATOM 531   H HD13 . LEU A 1 34  ? -4.714  -12.244 3.189   1.00 0.00 ? 85  LEU A HD13 1  
ATOM 532   H HD21 . LEU A 1 34  ? -1.466  -14.925 3.620   1.00 0.00 ? 85  LEU A HD21 1  
ATOM 533   H HD22 . LEU A 1 34  ? -2.458  -14.352 4.960   1.00 0.00 ? 85  LEU A HD22 1  
ATOM 534   H HD23 . LEU A 1 34  ? -3.094  -15.567 3.851   1.00 0.00 ? 85  LEU A HD23 1  
ATOM 535   N N    . PRO A 1 35  ? -3.420  -10.600 0.398   1.00 0.00 ? 86  PRO A N    1  
ATOM 536   C CA   . PRO A 1 35  ? -2.719  -9.289  0.410   1.00 0.00 ? 86  PRO A CA   1  
ATOM 537   C C    . PRO A 1 35  ? -2.642  -8.661  1.801   1.00 0.00 ? 86  PRO A C    1  
ATOM 538   O O    . PRO A 1 35  ? -3.090  -9.226  2.779   1.00 0.00 ? 86  PRO A O    1  
ATOM 539   C CB   . PRO A 1 35  ? -3.580  -8.428  -0.519  1.00 0.00 ? 86  PRO A CB   1  
ATOM 540   C CG   . PRO A 1 35  ? -4.972  -8.963  -0.368  1.00 0.00 ? 86  PRO A CG   1  
ATOM 541   C CD   . PRO A 1 35  ? -4.831  -10.459 -0.035  1.00 0.00 ? 86  PRO A CD   1  
ATOM 542   H HA   . PRO A 1 35  ? -1.733  -9.393  -0.006  1.00 0.00 ? 86  PRO A HA   1  
ATOM 543   H HB2  . PRO A 1 35  ? -3.535  -7.384  -0.227  1.00 0.00 ? 86  PRO A HB2  1  
ATOM 544   H HB3  . PRO A 1 35  ? -3.253  -8.542  -1.541  1.00 0.00 ? 86  PRO A HB3  1  
ATOM 545   H HG2  . PRO A 1 35  ? -5.482  -8.443  0.435   1.00 0.00 ? 86  PRO A HG2  1  
ATOM 546   H HG3  . PRO A 1 35  ? -5.521  -8.846  -1.290  1.00 0.00 ? 86  PRO A HG3  1  
ATOM 547   H HD2  . PRO A 1 35  ? -5.508  -10.729 0.765   1.00 0.00 ? 86  PRO A HD2  1  
ATOM 548   H HD3  . PRO A 1 35  ? -5.013  -11.066 -0.910  1.00 0.00 ? 86  PRO A HD3  1  
ATOM 549   N N    . ILE A 1 36  ? -2.085  -7.479  1.877   1.00 0.00 ? 87  ILE A N    1  
ATOM 550   C CA   . ILE A 1 36  ? -1.971  -6.762  3.179   1.00 0.00 ? 87  ILE A CA   1  
ATOM 551   C C    . ILE A 1 36  ? -2.738  -5.446  3.023   1.00 0.00 ? 87  ILE A C    1  
ATOM 552   O O    . ILE A 1 36  ? -2.839  -4.914  1.934   1.00 0.00 ? 87  ILE A O    1  
ATOM 553   C CB   . ILE A 1 36  ? -0.477  -6.528  3.513   1.00 0.00 ? 87  ILE A CB   1  
ATOM 554   C CG1  . ILE A 1 36  ? 0.109   -5.313  2.768   1.00 0.00 ? 87  ILE A CG1  1  
ATOM 555   C CG2  . ILE A 1 36  ? 0.301   -7.776  3.086   1.00 0.00 ? 87  ILE A CG2  1  
ATOM 556   C CD1  . ILE A 1 36  ? 1.565   -5.115  3.199   1.00 0.00 ? 87  ILE A CD1  1  
ATOM 557   H H    . ILE A 1 36  ? -1.747  -7.049  1.062   1.00 0.00 ? 87  ILE A H    1  
ATOM 558   H HA   . ILE A 1 36  ? -2.430  -7.345  3.968   1.00 0.00 ? 87  ILE A HA   1  
ATOM 559   H HB   . ILE A 1 36  ? -0.358  -6.401  4.572   1.00 0.00 ? 87  ILE A HB   1  
ATOM 560   H HG12 . ILE A 1 36  ? 0.068   -5.484  1.710   1.00 0.00 ? 87  ILE A HG12 1  
ATOM 561   H HG13 . ILE A 1 36  ? -0.448  -4.422  3.011   1.00 0.00 ? 87  ILE A HG13 1  
ATOM 562   H HG21 . ILE A 1 36  ? -0.176  -8.654  3.498   1.00 0.00 ? 87  ILE A HG21 1  
ATOM 563   H HG22 . ILE A 1 36  ? 0.306   -7.841  2.012   1.00 0.00 ? 87  ILE A HG22 1  
ATOM 564   H HG23 . ILE A 1 36  ? 1.316   -7.711  3.448   1.00 0.00 ? 87  ILE A HG23 1  
ATOM 565   H HD11 . ILE A 1 36  ? 1.611   -5.047  4.275   1.00 0.00 ? 87  ILE A HD11 1  
ATOM 566   H HD12 . ILE A 1 36  ? 2.157   -5.956  2.861   1.00 0.00 ? 87  ILE A HD12 1  
ATOM 567   H HD13 . ILE A 1 36  ? 1.949   -4.206  2.763   1.00 0.00 ? 87  ILE A HD13 1  
ATOM 568   N N    . ALA A 1 37  ? -3.306  -4.933  4.084   1.00 0.00 ? 88  ALA A N    1  
ATOM 569   C CA   . ALA A 1 37  ? -4.094  -3.666  3.995   1.00 0.00 ? 88  ALA A CA   1  
ATOM 570   C C    . ALA A 1 37  ? -3.497  -2.628  4.944   1.00 0.00 ? 88  ALA A C    1  
ATOM 571   O O    . ALA A 1 37  ? -3.135  -2.932  6.064   1.00 0.00 ? 88  ALA A O    1  
ATOM 572   C CB   . ALA A 1 37  ? -5.542  -3.981  4.386   1.00 0.00 ? 88  ALA A CB   1  
ATOM 573   H H    . ALA A 1 37  ? -3.229  -5.394  4.945   1.00 0.00 ? 88  ALA A H    1  
ATOM 574   H HA   . ALA A 1 37  ? -4.078  -3.275  2.984   1.00 0.00 ? 88  ALA A HA   1  
ATOM 575   H HB1  . ALA A 1 37  ? -5.898  -4.804  3.782   1.00 0.00 ? 88  ALA A HB1  1  
ATOM 576   H HB2  . ALA A 1 37  ? -5.577  -4.257  5.427   1.00 0.00 ? 88  ALA A HB2  1  
ATOM 577   H HB3  . ALA A 1 37  ? -6.162  -3.114  4.218   1.00 0.00 ? 88  ALA A HB3  1  
ATOM 578   N N    . PHE A 1 38  ? -3.372  -1.401  4.494   1.00 0.00 ? 89  PHE A N    1  
ATOM 579   C CA   . PHE A 1 38  ? -2.782  -0.318  5.338   1.00 0.00 ? 89  PHE A CA   1  
ATOM 580   C C    . PHE A 1 38  ? -3.762  0.862   5.420   1.00 0.00 ? 89  PHE A C    1  
ATOM 581   O O    . PHE A 1 38  ? -4.729  0.920   4.689   1.00 0.00 ? 89  PHE A O    1  
ATOM 582   C CB   . PHE A 1 38  ? -1.459  0.136   4.720   1.00 0.00 ? 89  PHE A CB   1  
ATOM 583   C CG   . PHE A 1 38  ? -1.691  0.848   3.407   1.00 0.00 ? 89  PHE A CG   1  
ATOM 584   C CD1  . PHE A 1 38  ? -2.160  0.139   2.291   1.00 0.00 ? 89  PHE A CD1  1  
ATOM 585   C CD2  . PHE A 1 38  ? -1.411  2.216   3.291   1.00 0.00 ? 89  PHE A CD2  1  
ATOM 586   C CE1  . PHE A 1 38  ? -2.358  0.796   1.072   1.00 0.00 ? 89  PHE A CE1  1  
ATOM 587   C CE2  . PHE A 1 38  ? -1.603  2.871   2.074   1.00 0.00 ? 89  PHE A CE2  1  
ATOM 588   C CZ   . PHE A 1 38  ? -2.080  2.165   0.964   1.00 0.00 ? 89  PHE A CZ   1  
ATOM 589   H H    . PHE A 1 38  ? -3.669  -1.192  3.583   1.00 0.00 ? 89  PHE A H    1  
ATOM 590   H HA   . PHE A 1 38  ? -2.595  -0.690  6.336   1.00 0.00 ? 89  PHE A HA   1  
ATOM 591   H HB2  . PHE A 1 38  ? -0.966  0.808   5.407   1.00 0.00 ? 89  PHE A HB2  1  
ATOM 592   H HB3  . PHE A 1 38  ? -0.832  -0.723  4.552   1.00 0.00 ? 89  PHE A HB3  1  
ATOM 593   H HD1  . PHE A 1 38  ? -2.372  -0.918  2.374   1.00 0.00 ? 89  PHE A HD1  1  
ATOM 594   H HD2  . PHE A 1 38  ? -1.051  2.766   4.149   1.00 0.00 ? 89  PHE A HD2  1  
ATOM 595   H HE1  . PHE A 1 38  ? -2.724  0.249   0.218   1.00 0.00 ? 89  PHE A HE1  1  
ATOM 596   H HE2  . PHE A 1 38  ? -1.382  3.925   1.987   1.00 0.00 ? 89  PHE A HE2  1  
ATOM 597   H HZ   . PHE A 1 38  ? -2.228  2.673   0.024   1.00 0.00 ? 89  PHE A HZ   1  
ATOM 598   N N    . LYS A 1 39  ? -3.503  1.818   6.282   1.00 0.00 ? 90  LYS A N    1  
ATOM 599   C CA   . LYS A 1 39  ? -4.394  3.016   6.394   1.00 0.00 ? 90  LYS A CA   1  
ATOM 600   C C    . LYS A 1 39  ? -3.563  4.253   6.084   1.00 0.00 ? 90  LYS A C    1  
ATOM 601   O O    . LYS A 1 39  ? -2.362  4.272   6.268   1.00 0.00 ? 90  LYS A O    1  
ATOM 602   C CB   . LYS A 1 39  ? -4.982  3.104   7.810   1.00 0.00 ? 90  LYS A CB   1  
ATOM 603   C CG   . LYS A 1 39  ? -3.859  3.198   8.845   1.00 0.00 ? 90  LYS A CG   1  
ATOM 604   C CD   . LYS A 1 39  ? -4.455  3.028   10.250  1.00 0.00 ? 90  LYS A CD   1  
ATOM 605   C CE   . LYS A 1 39  ? -3.375  3.284   11.309  1.00 0.00 ? 90  LYS A CE   1  
ATOM 606   N NZ   . LYS A 1 39  ? -3.973  3.212   12.676  1.00 0.00 ? 90  LYS A NZ   1  
ATOM 607   H H    . LYS A 1 39  ? -2.700  1.761   6.845   1.00 0.00 ? 90  LYS A H    1  
ATOM 608   H HA   . LYS A 1 39  ? -5.203  2.949   5.679   1.00 0.00 ? 90  LYS A HA   1  
ATOM 609   H HB2  . LYS A 1 39  ? -5.596  3.992   7.878   1.00 0.00 ? 90  LYS A HB2  1  
ATOM 610   H HB3  . LYS A 1 39  ? -5.584  2.235   8.007   1.00 0.00 ? 90  LYS A HB3  1  
ATOM 611   H HG2  . LYS A 1 39  ? -3.134  2.423   8.660   1.00 0.00 ? 90  LYS A HG2  1  
ATOM 612   H HG3  . LYS A 1 39  ? -3.383  4.165   8.773   1.00 0.00 ? 90  LYS A HG3  1  
ATOM 613   H HD2  . LYS A 1 39  ? -5.264  3.733   10.377  1.00 0.00 ? 90  LYS A HD2  1  
ATOM 614   H HD3  . LYS A 1 39  ? -4.834  2.022   10.357  1.00 0.00 ? 90  LYS A HD3  1  
ATOM 615   H HE2  . LYS A 1 39  ? -2.601  2.535   11.220  1.00 0.00 ? 90  LYS A HE2  1  
ATOM 616   H HE3  . LYS A 1 39  ? -2.946  4.261   11.157  1.00 0.00 ? 90  LYS A HE3  1  
ATOM 617   H HZ1  . LYS A 1 39  ? -5.009  3.143   12.601  1.00 0.00 ? 90  LYS A HZ1  1  
ATOM 618   H HZ2  . LYS A 1 39  ? -3.603  2.377   13.171  1.00 0.00 ? 90  LYS A HZ2  1  
ATOM 619   H HZ3  . LYS A 1 39  ? -3.722  4.067   13.210  1.00 0.00 ? 90  LYS A HZ3  1  
ATOM 620   N N    . VAL A 1 40  ? -4.191  5.278   5.579   1.00 0.00 ? 91  VAL A N    1  
ATOM 621   C CA   . VAL A 1 40  ? -3.451  6.513   5.209   1.00 0.00 ? 91  VAL A CA   1  
ATOM 622   C C    . VAL A 1 40  ? -3.736  7.597   6.234   1.00 0.00 ? 91  VAL A C    1  
ATOM 623   O O    . VAL A 1 40  ? -4.864  7.877   6.538   1.00 0.00 ? 91  VAL A O    1  
ATOM 624   C CB   . VAL A 1 40  ? -3.958  6.970   3.843   1.00 0.00 ? 91  VAL A CB   1  
ATOM 625   C CG1  . VAL A 1 40  ? -3.078  8.096   3.305   1.00 0.00 ? 91  VAL A CG1  1  
ATOM 626   C CG2  . VAL A 1 40  ? -3.914  5.790   2.880   1.00 0.00 ? 91  VAL A CG2  1  
ATOM 627   H H    . VAL A 1 40  ? -5.154  5.226   5.420   1.00 0.00 ? 91  VAL A H    1  
ATOM 628   H HA   . VAL A 1 40  ? -2.390  6.324   5.158   1.00 0.00 ? 91  VAL A HA   1  
ATOM 629   H HB   . VAL A 1 40  ? -4.977  7.321   3.933   1.00 0.00 ? 91  VAL A HB   1  
ATOM 630   H HG11 . VAL A 1 40  ? -2.038  7.842   3.453   1.00 0.00 ? 91  VAL A HG11 1  
ATOM 631   H HG12 . VAL A 1 40  ? -3.265  8.224   2.248   1.00 0.00 ? 91  VAL A HG12 1  
ATOM 632   H HG13 . VAL A 1 40  ? -3.306  9.010   3.826   1.00 0.00 ? 91  VAL A HG13 1  
ATOM 633   H HG21 . VAL A 1 40  ? -2.944  5.323   2.943   1.00 0.00 ? 91  VAL A HG21 1  
ATOM 634   H HG22 . VAL A 1 40  ? -4.678  5.074   3.149   1.00 0.00 ? 91  VAL A HG22 1  
ATOM 635   H HG23 . VAL A 1 40  ? -4.081  6.139   1.872   1.00 0.00 ? 91  VAL A HG23 1  
ATOM 636   N N    . VAL A 1 41  ? -2.722  8.228   6.753   1.00 0.00 ? 92  VAL A N    1  
ATOM 637   C CA   . VAL A 1 41  ? -2.942  9.322   7.748   1.00 0.00 ? 92  VAL A CA   1  
ATOM 638   C C    . VAL A 1 41  ? -2.665  10.655  7.065   1.00 0.00 ? 92  VAL A C    1  
ATOM 639   O O    . VAL A 1 41  ? -1.647  10.816  6.423   1.00 0.00 ? 92  VAL A O    1  
ATOM 640   C CB   . VAL A 1 41  ? -1.984  9.127   8.920   1.00 0.00 ? 92  VAL A CB   1  
ATOM 641   C CG1  . VAL A 1 41  ? -2.072  10.328  9.861   1.00 0.00 ? 92  VAL A CG1  1  
ATOM 642   C CG2  . VAL A 1 41  ? -2.395  7.868   9.684   1.00 0.00 ? 92  VAL A CG2  1  
ATOM 643   H H    . VAL A 1 41  ? -1.812  7.992   6.476   1.00 0.00 ? 92  VAL A H    1  
ATOM 644   H HA   . VAL A 1 41  ? -3.962  9.306   8.110   1.00 0.00 ? 92  VAL A HA   1  
ATOM 645   H HB   . VAL A 1 41  ? -0.978  9.020   8.553   1.00 0.00 ? 92  VAL A HB   1  
ATOM 646   H HG11 . VAL A 1 41  ? -3.108  10.543  10.080  1.00 0.00 ? 92  VAL A HG11 1  
ATOM 647   H HG12 . VAL A 1 41  ? -1.552  10.102  10.779  1.00 0.00 ? 92  VAL A HG12 1  
ATOM 648   H HG13 . VAL A 1 41  ? -1.618  11.190  9.394   1.00 0.00 ? 92  VAL A HG13 1  
ATOM 649   H HG21 . VAL A 1 41  ? -3.433  7.953   9.981   1.00 0.00 ? 92  VAL A HG21 1  
ATOM 650   H HG22 . VAL A 1 41  ? -2.269  7.003   9.048   1.00 0.00 ? 92  VAL A HG22 1  
ATOM 651   H HG23 . VAL A 1 41  ? -1.779  7.763   10.564  1.00 0.00 ? 92  VAL A HG23 1  
ATOM 652   N N    . ALA A 1 42  ? -3.566  11.607  7.172   1.00 0.00 ? 93  ALA A N    1  
ATOM 653   C CA   . ALA A 1 42  ? -3.346  12.925  6.497   1.00 0.00 ? 93  ALA A CA   1  
ATOM 654   C C    . ALA A 1 42  ? -3.426  14.066  7.506   1.00 0.00 ? 93  ALA A C    1  
ATOM 655   O O    . ALA A 1 42  ? -4.375  14.194  8.247   1.00 0.00 ? 93  ALA A O    1  
ATOM 656   C CB   . ALA A 1 42  ? -4.415  13.119  5.428   1.00 0.00 ? 93  ALA A CB   1  
ATOM 657   H H    . ALA A 1 42  ? -4.390  11.454  7.684   1.00 0.00 ? 93  ALA A H    1  
ATOM 658   H HA   . ALA A 1 42  ? -2.383  12.942  6.024   1.00 0.00 ? 93  ALA A HA   1  
ATOM 659   H HB1  . ALA A 1 42  ? -5.393  12.969  5.863   1.00 0.00 ? 93  ALA A HB1  1  
ATOM 660   H HB2  . ALA A 1 42  ? -4.345  14.121  5.028   1.00 0.00 ? 93  ALA A HB2  1  
ATOM 661   H HB3  . ALA A 1 42  ? -4.257  12.402  4.636   1.00 0.00 ? 93  ALA A HB3  1  
ATOM 662   N N    . LEU A 1 43  ? -2.433  14.907  7.532   1.00 0.00 ? 94  LEU A N    1  
ATOM 663   C CA   . LEU A 1 43  ? -2.439  16.055  8.486   1.00 0.00 ? 94  LEU A CA   1  
ATOM 664   C C    . LEU A 1 43  ? -2.956  17.292  7.750   1.00 0.00 ? 94  LEU A C    1  
ATOM 665   O O    . LEU A 1 43  ? -2.858  18.401  8.237   1.00 0.00 ? 94  LEU A O    1  
ATOM 666   C CB   . LEU A 1 43  ? -1.015  16.310  8.978   1.00 0.00 ? 94  LEU A CB   1  
ATOM 667   C CG   . LEU A 1 43  ? -0.382  15.001  9.468   1.00 0.00 ? 94  LEU A CG   1  
ATOM 668   C CD1  . LEU A 1 43  ? 1.044   15.275  9.945   1.00 0.00 ? 94  LEU A CD1  1  
ATOM 669   C CD2  . LEU A 1 43  ? -1.205  14.426  10.632  1.00 0.00 ? 94  LEU A CD2  1  
ATOM 670   H H    . LEU A 1 43  ? -1.679  14.789  6.915   1.00 0.00 ? 94  LEU A H    1  
ATOM 671   H HA   . LEU A 1 43  ? -3.086  15.841  9.326   1.00 0.00 ? 94  LEU A HA   1  
ATOM 672   H HB2  . LEU A 1 43  ? -0.421  16.718  8.172   1.00 0.00 ? 94  LEU A HB2  1  
ATOM 673   H HB3  . LEU A 1 43  ? -1.043  17.020  9.794   1.00 0.00 ? 94  LEU A HB3  1  
ATOM 674   H HG   . LEU A 1 43  ? -0.356  14.288  8.655   1.00 0.00 ? 94  LEU A HG   1  
ATOM 675   H HD11 . LEU A 1 43  ? 1.027   15.992  10.752  1.00 0.00 ? 94  LEU A HD11 1  
ATOM 676   H HD12 . LEU A 1 43  ? 1.491   14.356  10.290  1.00 0.00 ? 94  LEU A HD12 1  
ATOM 677   H HD13 . LEU A 1 43  ? 1.626   15.672  9.126   1.00 0.00 ? 94  LEU A HD13 1  
ATOM 678   H HD21 . LEU A 1 43  ? -1.469  15.220  11.317  1.00 0.00 ? 94  LEU A HD21 1  
ATOM 679   H HD22 . LEU A 1 43  ? -2.100  13.967  10.249  1.00 0.00 ? 94  LEU A HD22 1  
ATOM 680   H HD23 . LEU A 1 43  ? -0.620  13.683  11.155  1.00 0.00 ? 94  LEU A HD23 1  
ATOM 681   N N    . GLY A 1 44  ? -3.492  17.106  6.567   1.00 0.00 ? 95  GLY A N    1  
ATOM 682   C CA   . GLY A 1 44  ? -4.002  18.266  5.774   1.00 0.00 ? 95  GLY A CA   1  
ATOM 683   C C    . GLY A 1 44  ? -5.467  18.528  6.121   1.00 0.00 ? 95  GLY A C    1  
ATOM 684   O O    . GLY A 1 44  ? -6.039  17.875  6.974   1.00 0.00 ? 95  GLY A O    1  
ATOM 685   H H    . GLY A 1 44  ? -3.545  16.201  6.197   1.00 0.00 ? 95  GLY A H    1  
ATOM 686   H HA2  . GLY A 1 44  ? -3.419  19.146  5.993   1.00 0.00 ? 95  GLY A HA2  1  
ATOM 687   H HA3  . GLY A 1 44  ? -3.930  18.035  4.722   1.00 0.00 ? 95  GLY A HA3  1  
ATOM 688   N N    . ASP A 1 45  ? -6.083  19.471  5.455   1.00 0.00 ? 96  ASP A N    1  
ATOM 689   C CA   . ASP A 1 45  ? -7.521  19.762  5.739   1.00 0.00 ? 96  ASP A CA   1  
ATOM 690   C C    . ASP A 1 45  ? -8.372  18.846  4.863   1.00 0.00 ? 96  ASP A C    1  
ATOM 691   O O    . ASP A 1 45  ? -8.538  19.075  3.683   1.00 0.00 ? 96  ASP A O    1  
ATOM 692   C CB   . ASP A 1 45  ? -7.837  21.224  5.413   1.00 0.00 ? 96  ASP A CB   1  
ATOM 693   C CG   . ASP A 1 45  ? -9.294  21.515  5.797   1.00 0.00 ? 96  ASP A CG   1  
ATOM 694   O OD1  . ASP A 1 45  ? -10.175 21.014  5.115   1.00 0.00 ? 96  ASP A OD1  1  
ATOM 695   O OD2  . ASP A 1 45  ? -9.503  22.224  6.768   1.00 0.00 ? 96  ASP A OD2  1  
ATOM 696   H H    . ASP A 1 45  ? -5.607  19.977  4.766   1.00 0.00 ? 96  ASP A H    1  
ATOM 697   H HA   . ASP A 1 45  ? -7.733  19.567  6.781   1.00 0.00 ? 96  ASP A HA   1  
ATOM 698   H HB2  . ASP A 1 45  ? -7.179  21.872  5.978   1.00 0.00 ? 96  ASP A HB2  1  
ATOM 699   H HB3  . ASP A 1 45  ? -7.698  21.405  4.356   1.00 0.00 ? 96  ASP A HB3  1  
ATOM 700   N N    . VAL A 1 46  ? -8.906  17.806  5.431   1.00 0.00 ? 97  VAL A N    1  
ATOM 701   C CA   . VAL A 1 46  ? -9.731  16.874  4.620   1.00 0.00 ? 97  VAL A CA   1  
ATOM 702   C C    . VAL A 1 46  ? -10.508 15.903  5.539   1.00 0.00 ? 97  VAL A C    1  
ATOM 703   O O    . VAL A 1 46  ? -10.348 14.702  5.455   1.00 0.00 ? 97  VAL A O    1  
ATOM 704   C CB   . VAL A 1 46  ? -8.779  16.089  3.701   1.00 0.00 ? 97  VAL A CB   1  
ATOM 705   C CG1  . VAL A 1 46  ? -7.594  15.594  4.532   1.00 0.00 ? 97  VAL A CG1  1  
ATOM 706   C CG2  . VAL A 1 46  ? -9.501  14.901  3.018   1.00 0.00 ? 97  VAL A CG2  1  
ATOM 707   H H    . VAL A 1 46  ? -8.756  17.631  6.380   1.00 0.00 ? 97  VAL A H    1  
ATOM 708   H HA   . VAL A 1 46  ? -10.422 17.436  4.015   1.00 0.00 ? 97  VAL A HA   1  
ATOM 709   H HB   . VAL A 1 46  ? -8.400  16.768  2.944   1.00 0.00 ? 97  VAL A HB   1  
ATOM 710   H HG11 . VAL A 1 46  ? -7.963  15.064  5.400   1.00 0.00 ? 97  VAL A HG11 1  
ATOM 711   H HG12 . VAL A 1 46  ? -6.985  14.933  3.936   1.00 0.00 ? 97  VAL A HG12 1  
ATOM 712   H HG13 . VAL A 1 46  ? -7.002  16.441  4.854   1.00 0.00 ? 97  VAL A HG13 1  
ATOM 713   H HG21 . VAL A 1 46  ? -10.569 15.044  3.064   1.00 0.00 ? 97  VAL A HG21 1  
ATOM 714   H HG22 . VAL A 1 46  ? -9.191  14.838  1.981   1.00 0.00 ? 97  VAL A HG22 1  
ATOM 715   H HG23 . VAL A 1 46  ? -9.249  13.976  3.519   1.00 0.00 ? 97  VAL A HG23 1  
ATOM 716   N N    . PRO A 1 47  ? -11.352 16.416  6.408   1.00 0.00 ? 98  PRO A N    1  
ATOM 717   C CA   . PRO A 1 47  ? -12.168 15.575  7.329   1.00 0.00 ? 98  PRO A CA   1  
ATOM 718   C C    . PRO A 1 47  ? -13.521 15.208  6.706   1.00 0.00 ? 98  PRO A C    1  
ATOM 719   O O    . PRO A 1 47  ? -14.358 14.578  7.327   1.00 0.00 ? 98  PRO A O    1  
ATOM 720   C CB   . PRO A 1 47  ? -12.362 16.500  8.529   1.00 0.00 ? 98  PRO A CB   1  
ATOM 721   C CG   . PRO A 1 47  ? -12.456 17.874  7.934   1.00 0.00 ? 98  PRO A CG   1  
ATOM 722   C CD   . PRO A 1 47  ? -11.637 17.848  6.621   1.00 0.00 ? 98  PRO A CD   1  
ATOM 723   H HA   . PRO A 1 47  ? -11.628 14.693  7.627   1.00 0.00 ? 98  PRO A HA   1  
ATOM 724   H HB2  . PRO A 1 47  ? -13.275 16.246  9.063   1.00 0.00 ? 98  PRO A HB2  1  
ATOM 725   H HB3  . PRO A 1 47  ? -11.512 16.438  9.192   1.00 0.00 ? 98  PRO A HB3  1  
ATOM 726   H HG2  . PRO A 1 47  ? -13.492 18.118  7.724   1.00 0.00 ? 98  PRO A HG2  1  
ATOM 727   H HG3  . PRO A 1 47  ? -12.037 18.608  8.611   1.00 0.00 ? 98  PRO A HG3  1  
ATOM 728   H HD2  . PRO A 1 47  ? -12.216 18.247  5.801   1.00 0.00 ? 98  PRO A HD2  1  
ATOM 729   H HD3  . PRO A 1 47  ? -10.720 18.399  6.743   1.00 0.00 ? 98  PRO A HD3  1  
ATOM 730   N N    . ASP A 1 48  ? -13.744 15.612  5.483   1.00 0.00 ? 99  ASP A N    1  
ATOM 731   C CA   . ASP A 1 48  ? -15.035 15.311  4.798   1.00 0.00 ? 99  ASP A CA   1  
ATOM 732   C C    . ASP A 1 48  ? -14.983 13.916  4.177   1.00 0.00 ? 99  ASP A C    1  
ATOM 733   O O    . ASP A 1 48  ? -14.000 13.213  4.282   1.00 0.00 ? 99  ASP A O    1  
ATOM 734   C CB   . ASP A 1 48  ? -15.309 16.374  3.714   1.00 0.00 ? 99  ASP A CB   1  
ATOM 735   C CG   . ASP A 1 48  ? -14.337 16.237  2.532   1.00 0.00 ? 99  ASP A CG   1  
ATOM 736   O OD1  . ASP A 1 48  ? -13.987 15.122  2.183   1.00 0.00 ? 99  ASP A OD1  1  
ATOM 737   O OD2  . ASP A 1 48  ? -13.978 17.264  1.979   1.00 0.00 ? 99  ASP A OD2  1  
ATOM 738   H H    . ASP A 1 48  ? -13.052 16.124  5.009   1.00 0.00 ? 99  ASP A H    1  
ATOM 739   H HA   . ASP A 1 48  ? -15.834 15.339  5.529   1.00 0.00 ? 99  ASP A HA   1  
ATOM 740   H HB2  . ASP A 1 48  ? -16.318 16.263  3.353   1.00 0.00 ? 99  ASP A HB2  1  
ATOM 741   H HB3  . ASP A 1 48  ? -15.196 17.356  4.146   1.00 0.00 ? 99  ASP A HB3  1  
ATOM 742   N N    . GLY A 1 49  ? -16.037 13.512  3.525   1.00 0.00 ? 100 GLY A N    1  
ATOM 743   C CA   . GLY A 1 49  ? -16.044 12.167  2.883   1.00 0.00 ? 100 GLY A CA   1  
ATOM 744   C C    . GLY A 1 49  ? -15.551 12.308  1.443   1.00 0.00 ? 100 GLY A C    1  
ATOM 745   O O    . GLY A 1 49  ? -16.260 12.784  0.583   1.00 0.00 ? 100 GLY A O    1  
ATOM 746   H H    . GLY A 1 49  ? -16.819 14.099  3.446   1.00 0.00 ? 100 GLY A H    1  
ATOM 747   H HA2  . GLY A 1 49  ? -15.390 11.496  3.428   1.00 0.00 ? 100 GLY A HA2  1  
ATOM 748   H HA3  . GLY A 1 49  ? -17.047 11.774  2.881   1.00 0.00 ? 100 GLY A HA3  1  
ATOM 749   N N    . THR A 1 50  ? -14.328 11.905  1.182   1.00 0.00 ? 101 THR A N    1  
ATOM 750   C CA   . THR A 1 50  ? -13.763 12.021  -0.210  1.00 0.00 ? 101 THR A CA   1  
ATOM 751   C C    . THR A 1 50  ? -13.359 10.640  -0.718  1.00 0.00 ? 101 THR A C    1  
ATOM 752   O O    . THR A 1 50  ? -13.903 9.642   -0.297  1.00 0.00 ? 101 THR A O    1  
ATOM 753   C CB   . THR A 1 50  ? -12.534 12.947  -0.198  1.00 0.00 ? 101 THR A CB   1  
ATOM 754   O OG1  . THR A 1 50  ? -11.905 12.924  -1.476  1.00 0.00 ? 101 THR A OG1  1  
ATOM 755   C CG2  . THR A 1 50  ? -11.551 12.487  0.885   1.00 0.00 ? 101 THR A CG2  1  
ATOM 756   H H    . THR A 1 50  ? -13.777 11.529  1.908   1.00 0.00 ? 101 THR A H    1  
ATOM 757   H HA   . THR A 1 50  ? -14.504 12.431  -0.880  1.00 0.00 ? 101 THR A HA   1  
ATOM 758   H HB   . THR A 1 50  ? -12.858 13.952  0.022   1.00 0.00 ? 101 THR A HB   1  
ATOM 759   H HG1  . THR A 1 50  ? -11.056 13.370  -1.403  1.00 0.00 ? 101 THR A HG1  1  
ATOM 760   H HG21 . THR A 1 50  ? -11.489 11.411  0.879   1.00 0.00 ? 101 THR A HG21 1  
ATOM 761   H HG22 . THR A 1 50  ? -10.575 12.899  0.691   1.00 0.00 ? 101 THR A HG22 1  
ATOM 762   H HG23 . THR A 1 50  ? -11.901 12.827  1.847   1.00 0.00 ? 101 THR A HG23 1  
ATOM 763   N N    . LEU A 1 51  ? -12.421 10.576  -1.626  1.00 0.00 ? 102 LEU A N    1  
ATOM 764   C CA   . LEU A 1 51  ? -11.986 9.257   -2.181  1.00 0.00 ? 102 LEU A CA   1  
ATOM 765   C C    . LEU A 1 51  ? -10.460 9.197   -2.252  1.00 0.00 ? 102 LEU A C    1  
ATOM 766   O O    . LEU A 1 51  ? -9.804  10.139  -2.646  1.00 0.00 ? 102 LEU A O    1  
ATOM 767   C CB   . LEU A 1 51  ? -12.550 9.095   -3.602  1.00 0.00 ? 102 LEU A CB   1  
ATOM 768   C CG   . LEU A 1 51  ? -14.081 8.936   -3.571  1.00 0.00 ? 102 LEU A CG   1  
ATOM 769   C CD1  . LEU A 1 51  ? -14.629 9.061   -4.992  1.00 0.00 ? 102 LEU A CD1  1  
ATOM 770   C CD2  . LEU A 1 51  ? -14.471 7.549   -3.035  1.00 0.00 ? 102 LEU A CD2  1  
ATOM 771   H H    . LEU A 1 51  ? -12.007 11.405  -1.954  1.00 0.00 ? 102 LEU A H    1  
ATOM 772   H HA   . LEU A 1 51  ? -12.332 8.453   -1.560  1.00 0.00 ? 102 LEU A HA   1  
ATOM 773   H HB2  . LEU A 1 51  ? -12.299 9.975   -4.180  1.00 0.00 ? 102 LEU A HB2  1  
ATOM 774   H HB3  . LEU A 1 51  ? -12.106 8.226   -4.068  1.00 0.00 ? 102 LEU A HB3  1  
ATOM 775   H HG   . LEU A 1 51  ? -14.509 9.706   -2.949  1.00 0.00 ? 102 LEU A HG   1  
ATOM 776   H HD11 . LEU A 1 51  ? -14.295 9.989   -5.430  1.00 0.00 ? 102 LEU A HD11 1  
ATOM 777   H HD12 . LEU A 1 51  ? -14.276 8.231   -5.588  1.00 0.00 ? 102 LEU A HD12 1  
ATOM 778   H HD13 . LEU A 1 51  ? -15.709 9.045   -4.961  1.00 0.00 ? 102 LEU A HD13 1  
ATOM 779   H HD21 . LEU A 1 51  ? -13.864 6.793   -3.515  1.00 0.00 ? 102 LEU A HD21 1  
ATOM 780   H HD22 . LEU A 1 51  ? -14.321 7.510   -1.967  1.00 0.00 ? 102 LEU A HD22 1  
ATOM 781   H HD23 . LEU A 1 51  ? -15.513 7.362   -3.253  1.00 0.00 ? 102 LEU A HD23 1  
ATOM 782   N N    . VAL A 1 52  ? -9.904  8.061   -1.912  1.00 0.00 ? 103 VAL A N    1  
ATOM 783   C CA   . VAL A 1 52  ? -8.422  7.866   -1.991  1.00 0.00 ? 103 VAL A CA   1  
ATOM 784   C C    . VAL A 1 52  ? -8.198  6.745   -2.988  1.00 0.00 ? 103 VAL A C    1  
ATOM 785   O O    . VAL A 1 52  ? -8.785  5.692   -2.873  1.00 0.00 ? 103 VAL A O    1  
ATOM 786   C CB   . VAL A 1 52  ? -7.852  7.441   -0.625  1.00 0.00 ? 103 VAL A CB   1  
ATOM 787   C CG1  . VAL A 1 52  ? -6.310  7.450   -0.660  1.00 0.00 ? 103 VAL A CG1  1  
ATOM 788   C CG2  . VAL A 1 52  ? -8.329  8.405   0.457   1.00 0.00 ? 103 VAL A CG2  1  
ATOM 789   H H    . VAL A 1 52  ? -10.475 7.313   -1.632  1.00 0.00 ? 103 VAL A H    1  
ATOM 790   H HA   . VAL A 1 52  ? -7.936  8.770   -2.337  1.00 0.00 ? 103 VAL A HA   1  
ATOM 791   H HB   . VAL A 1 52  ? -8.194  6.442   -0.390  1.00 0.00 ? 103 VAL A HB   1  
ATOM 792   H HG11 . VAL A 1 52  ? -5.965  6.977   -1.567  1.00 0.00 ? 103 VAL A HG11 1  
ATOM 793   H HG12 . VAL A 1 52  ? -5.952  8.466   -0.626  1.00 0.00 ? 103 VAL A HG12 1  
ATOM 794   H HG13 . VAL A 1 52  ? -5.930  6.908   0.196   1.00 0.00 ? 103 VAL A HG13 1  
ATOM 795   H HG21 . VAL A 1 52  ? -8.089  9.416   0.169   1.00 0.00 ? 103 VAL A HG21 1  
ATOM 796   H HG22 . VAL A 1 52  ? -9.396  8.307   0.582   1.00 0.00 ? 103 VAL A HG22 1  
ATOM 797   H HG23 . VAL A 1 52  ? -7.836  8.170   1.390   1.00 0.00 ? 103 VAL A HG23 1  
ATOM 798   N N    . THR A 1 53  ? -7.355  6.951   -3.960  1.00 0.00 ? 104 THR A N    1  
ATOM 799   C CA   . THR A 1 53  ? -7.098  5.885   -4.969  1.00 0.00 ? 104 THR A CA   1  
ATOM 800   C C    . THR A 1 53  ? -5.620  5.537   -4.921  1.00 0.00 ? 104 THR A C    1  
ATOM 801   O O    . THR A 1 53  ? -4.797  6.378   -4.644  1.00 0.00 ? 104 THR A O    1  
ATOM 802   C CB   . THR A 1 53  ? -7.469  6.417   -6.352  1.00 0.00 ? 104 THR A CB   1  
ATOM 803   O OG1  . THR A 1 53  ? -6.547  7.423   -6.727  1.00 0.00 ? 104 THR A OG1  1  
ATOM 804   C CG2  . THR A 1 53  ? -8.891  6.997   -6.308  1.00 0.00 ? 104 THR A CG2  1  
ATOM 805   H H    . THR A 1 53  ? -6.887  7.815   -4.031  1.00 0.00 ? 104 THR A H    1  
ATOM 806   H HA   . THR A 1 53  ? -7.686  4.998   -4.753  1.00 0.00 ? 104 THR A HA   1  
ATOM 807   H HB   . THR A 1 53  ? -7.441  5.608   -7.065  1.00 0.00 ? 104 THR A HB   1  
ATOM 808   H HG1  . THR A 1 53  ? -5.683  7.176   -6.386  1.00 0.00 ? 104 THR A HG1  1  
ATOM 809   H HG21 . THR A 1 53  ? -8.935  7.800   -5.588  1.00 0.00 ? 104 THR A HG21 1  
ATOM 810   H HG22 . THR A 1 53  ? -9.155  7.371   -7.282  1.00 0.00 ? 104 THR A HG22 1  
ATOM 811   H HG23 . THR A 1 53  ? -9.587  6.223   -6.019  1.00 0.00 ? 104 THR A HG23 1  
ATOM 812   N N    . VAL A 1 54  ? -5.273  4.304   -5.164  1.00 0.00 ? 105 VAL A N    1  
ATOM 813   C CA   . VAL A 1 54  ? -3.839  3.900   -5.110  1.00 0.00 ? 105 VAL A CA   1  
ATOM 814   C C    . VAL A 1 54  ? -3.532  2.870   -6.202  1.00 0.00 ? 105 VAL A C    1  
ATOM 815   O O    . VAL A 1 54  ? -4.377  2.082   -6.574  1.00 0.00 ? 105 VAL A O    1  
ATOM 816   C CB   . VAL A 1 54  ? -3.546  3.283   -3.742  1.00 0.00 ? 105 VAL A CB   1  
ATOM 817   C CG1  . VAL A 1 54  ? -4.471  2.084   -3.523  1.00 0.00 ? 105 VAL A CG1  1  
ATOM 818   C CG2  . VAL A 1 54  ? -2.091  2.822   -3.700  1.00 0.00 ? 105 VAL A CG2  1  
ATOM 819   H H    . VAL A 1 54  ? -5.960  3.635   -5.370  1.00 0.00 ? 105 VAL A H    1  
ATOM 820   H HA   . VAL A 1 54  ? -3.202  4.768   -5.250  1.00 0.00 ? 105 VAL A HA   1  
ATOM 821   H HB   . VAL A 1 54  ? -3.726  4.013   -2.965  1.00 0.00 ? 105 VAL A HB   1  
ATOM 822   H HG11 . VAL A 1 54  ? -5.496  2.408   -3.602  1.00 0.00 ? 105 VAL A HG11 1  
ATOM 823   H HG12 . VAL A 1 54  ? -4.271  1.329   -4.268  1.00 0.00 ? 105 VAL A HG12 1  
ATOM 824   H HG13 . VAL A 1 54  ? -4.301  1.675   -2.537  1.00 0.00 ? 105 VAL A HG13 1  
ATOM 825   H HG21 . VAL A 1 54  ? -1.456  3.599   -4.104  1.00 0.00 ? 105 VAL A HG21 1  
ATOM 826   H HG22 . VAL A 1 54  ? -1.804  2.621   -2.679  1.00 0.00 ? 105 VAL A HG22 1  
ATOM 827   H HG23 . VAL A 1 54  ? -1.981  1.924   -4.292  1.00 0.00 ? 105 VAL A HG23 1  
ATOM 828   N N    . MET A 1 55  ? -2.318  2.842   -6.696  1.00 0.00 ? 106 MET A N    1  
ATOM 829   C CA   . MET A 1 55  ? -1.933  1.832   -7.736  1.00 0.00 ? 106 MET A CA   1  
ATOM 830   C C    . MET A 1 55  ? -0.518  1.358   -7.431  1.00 0.00 ? 106 MET A C    1  
ATOM 831   O O    . MET A 1 55  ? 0.163   1.943   -6.618  1.00 0.00 ? 106 MET A O    1  
ATOM 832   C CB   . MET A 1 55  ? -1.991  2.449   -9.139  1.00 0.00 ? 106 MET A CB   1  
ATOM 833   C CG   . MET A 1 55  ? -0.896  3.505   -9.288  1.00 0.00 ? 106 MET A CG   1  
ATOM 834   S SD   . MET A 1 55  ? -1.178  4.472   -10.797 1.00 0.00 ? 106 MET A SD   1  
ATOM 835   C CE   . MET A 1 55  ? 0.559   4.725   -11.244 1.00 0.00 ? 106 MET A CE   1  
ATOM 836   H H    . MET A 1 55  ? -1.646  3.474   -6.361  1.00 0.00 ? 106 MET A H    1  
ATOM 837   H HA   . MET A 1 55  ? -2.610  0.988   -7.687  1.00 0.00 ? 106 MET A HA   1  
ATOM 838   H HB2  . MET A 1 55  ? -1.843  1.667   -9.875  1.00 0.00 ? 106 MET A HB2  1  
ATOM 839   H HB3  . MET A 1 55  ? -2.958  2.905   -9.291  1.00 0.00 ? 106 MET A HB3  1  
ATOM 840   H HG2  . MET A 1 55  ? -0.915  4.163   -8.433  1.00 0.00 ? 106 MET A HG2  1  
ATOM 841   H HG3  . MET A 1 55  ? 0.068   3.021   -9.345  1.00 0.00 ? 106 MET A HG3  1  
ATOM 842   H HE1  . MET A 1 55  ? 1.068   5.236   -10.435 1.00 0.00 ? 106 MET A HE1  1  
ATOM 843   H HE2  . MET A 1 55  ? 1.030   3.766   -11.417 1.00 0.00 ? 106 MET A HE2  1  
ATOM 844   H HE3  . MET A 1 55  ? 0.617   5.319   -12.148 1.00 0.00 ? 106 MET A HE3  1  
ATOM 845   N N    . ALA A 1 56  ? -0.052  0.300   -8.053  1.00 0.00 ? 107 ALA A N    1  
ATOM 846   C CA   . ALA A 1 56  ? 1.334   -0.181  -7.739  1.00 0.00 ? 107 ALA A CA   1  
ATOM 847   C C    . ALA A 1 56  ? 1.948   -0.926  -8.927  1.00 0.00 ? 107 ALA A C    1  
ATOM 848   O O    . ALA A 1 56  ? 2.519   -1.979  -8.769  1.00 0.00 ? 107 ALA A O    1  
ATOM 849   C CB   . ALA A 1 56  ? 1.277   -1.110  -6.527  1.00 0.00 ? 107 ALA A CB   1  
ATOM 850   H H    . ALA A 1 56  ? -0.611  -0.173  -8.703  1.00 0.00 ? 107 ALA A H    1  
ATOM 851   H HA   . ALA A 1 56  ? 1.956   0.657   -7.505  1.00 0.00 ? 107 ALA A HA   1  
ATOM 852   H HB1  . ALA A 1 56  ? 0.556   -0.730  -5.820  1.00 0.00 ? 107 ALA A HB1  1  
ATOM 853   H HB2  . ALA A 1 56  ? 0.981   -2.103  -6.838  1.00 0.00 ? 107 ALA A HB2  1  
ATOM 854   H HB3  . ALA A 1 56  ? 2.250   -1.150  -6.060  1.00 0.00 ? 107 ALA A HB3  1  
ATOM 855   N N    . GLY A 1 57  ? 1.844   -0.395  -10.109 1.00 0.00 ? 108 GLY A N    1  
ATOM 856   C CA   . GLY A 1 57  ? 2.439   -1.085  -11.305 1.00 0.00 ? 108 GLY A CA   1  
ATOM 857   C C    . GLY A 1 57  ? 3.836   -0.529  -11.589 1.00 0.00 ? 108 GLY A C    1  
ATOM 858   O O    . GLY A 1 57  ? 4.174   0.561   -11.167 1.00 0.00 ? 108 GLY A O    1  
ATOM 859   H H    . GLY A 1 57  ? 1.397   0.464   -10.210 1.00 0.00 ? 108 GLY A H    1  
ATOM 860   H HA2  . GLY A 1 57  ? 2.511   -2.145  -11.114 1.00 0.00 ? 108 GLY A HA2  1  
ATOM 861   H HA3  . GLY A 1 57  ? 1.812   -0.922  -12.161 1.00 0.00 ? 108 GLY A HA3  1  
ATOM 862   N N    . ASN A 1 58  ? 4.646   -1.252  -12.328 1.00 0.00 ? 109 ASN A N    1  
ATOM 863   C CA   . ASN A 1 58  ? 6.009   -0.729  -12.651 1.00 0.00 ? 109 ASN A CA   1  
ATOM 864   C C    . ASN A 1 58  ? 5.874   0.403   -13.680 1.00 0.00 ? 109 ASN A C    1  
ATOM 865   O O    . ASN A 1 58  ? 4.926   0.451   -14.438 1.00 0.00 ? 109 ASN A O    1  
ATOM 866   C CB   . ASN A 1 58  ? 6.903   -1.849  -13.228 1.00 0.00 ? 109 ASN A CB   1  
ATOM 867   C CG   . ASN A 1 58  ? 7.082   -2.963  -12.195 1.00 0.00 ? 109 ASN A CG   1  
ATOM 868   O OD1  . ASN A 1 58  ? 7.656   -2.748  -11.145 1.00 0.00 ? 109 ASN A OD1  1  
ATOM 869   N ND2  . ASN A 1 58  ? 6.608   -4.154  -12.448 1.00 0.00 ? 109 ASN A ND2  1  
ATOM 870   H H    . ASN A 1 58  ? 4.348   -2.118  -12.677 1.00 0.00 ? 109 ASN A H    1  
ATOM 871   H HA   . ASN A 1 58  ? 6.454   -0.341  -11.754 1.00 0.00 ? 109 ASN A HA   1  
ATOM 872   H HB2  . ASN A 1 58  ? 6.455   -2.257  -14.119 1.00 0.00 ? 109 ASN A HB2  1  
ATOM 873   H HB3  . ASN A 1 58  ? 7.873   -1.439  -13.474 1.00 0.00 ? 109 ASN A HB3  1  
ATOM 874   H HD21 . ASN A 1 58  ? 6.143   -4.328  -13.292 1.00 0.00 ? 109 ASN A HD21 1  
ATOM 875   H HD22 . ASN A 1 58  ? 6.726   -4.874  -11.795 1.00 0.00 ? 109 ASN A HD22 1  
ATOM 876   N N    . ASP A 1 59  ? 6.795   1.324   -13.710 1.00 0.00 ? 110 ASP A N    1  
ATOM 877   C CA   . ASP A 1 59  ? 6.669   2.451   -14.683 1.00 0.00 ? 110 ASP A CA   1  
ATOM 878   C C    . ASP A 1 59  ? 6.627   1.911   -16.131 1.00 0.00 ? 110 ASP A C    1  
ATOM 879   O O    . ASP A 1 59  ? 5.909   2.433   -16.961 1.00 0.00 ? 110 ASP A O    1  
ATOM 880   C CB   . ASP A 1 59  ? 7.858   3.407   -14.536 1.00 0.00 ? 110 ASP A CB   1  
ATOM 881   C CG   . ASP A 1 59  ? 7.768   4.162   -13.203 1.00 0.00 ? 110 ASP A CG   1  
ATOM 882   O OD1  . ASP A 1 59  ? 6.659   4.448   -12.779 1.00 0.00 ? 110 ASP A OD1  1  
ATOM 883   O OD2  . ASP A 1 59  ? 8.811   4.447   -12.639 1.00 0.00 ? 110 ASP A OD2  1  
ATOM 884   H H    . ASP A 1 59  ? 7.551   1.293   -13.083 1.00 0.00 ? 110 ASP A H    1  
ATOM 885   H HA   . ASP A 1 59  ? 5.757   2.991   -14.482 1.00 0.00 ? 110 ASP A HA   1  
ATOM 886   H HB2  . ASP A 1 59  ? 8.780   2.848   -14.572 1.00 0.00 ? 110 ASP A HB2  1  
ATOM 887   H HB3  . ASP A 1 59  ? 7.841   4.121   -15.350 1.00 0.00 ? 110 ASP A HB3  1  
ATOM 888   N N    . GLU A 1 60  ? 7.381   0.893   -16.455 1.00 0.00 ? 111 GLU A N    1  
ATOM 889   C CA   . GLU A 1 60  ? 7.363   0.370   -17.862 1.00 0.00 ? 111 GLU A CA   1  
ATOM 890   C C    . GLU A 1 60  ? 6.155   -0.543  -18.085 1.00 0.00 ? 111 GLU A C    1  
ATOM 891   O O    . GLU A 1 60  ? 5.939   -1.042  -19.175 1.00 0.00 ? 111 GLU A O    1  
ATOM 892   C CB   . GLU A 1 60  ? 8.643   -0.430  -18.116 1.00 0.00 ? 111 GLU A CB   1  
ATOM 893   C CG   . GLU A 1 60  ? 8.606   -1.741  -17.323 1.00 0.00 ? 111 GLU A CG   1  
ATOM 894   C CD   . GLU A 1 60  ? 9.985   -2.390  -17.350 1.00 0.00 ? 111 GLU A CD   1  
ATOM 895   O OE1  . GLU A 1 60  ? 10.934  -1.701  -17.684 1.00 0.00 ? 111 GLU A OE1  1  
ATOM 896   O OE2  . GLU A 1 60  ? 10.064  -3.567  -17.045 1.00 0.00 ? 111 GLU A OE2  1  
ATOM 897   H H    . GLU A 1 60  ? 7.969   0.477   -15.784 1.00 0.00 ? 111 GLU A H    1  
ATOM 898   H HA   . GLU A 1 60  ? 7.318   1.198   -18.556 1.00 0.00 ? 111 GLU A HA   1  
ATOM 899   H HB2  . GLU A 1 60  ? 8.731   -0.650  -19.170 1.00 0.00 ? 111 GLU A HB2  1  
ATOM 900   H HB3  . GLU A 1 60  ? 9.495   0.151   -17.797 1.00 0.00 ? 111 GLU A HB3  1  
ATOM 901   H HG2  . GLU A 1 60  ? 8.321   -1.534  -16.299 1.00 0.00 ? 111 GLU A HG2  1  
ATOM 902   H HG3  . GLU A 1 60  ? 7.887   -2.417  -17.766 1.00 0.00 ? 111 GLU A HG3  1  
ATOM 903   N N    . ASN A 1 61  ? 5.374   -0.783  -17.066 1.00 0.00 ? 112 ASN A N    1  
ATOM 904   C CA   . ASN A 1 61  ? 4.187   -1.676  -17.204 1.00 0.00 ? 112 ASN A CA   1  
ATOM 905   C C    . ASN A 1 61  ? 2.915   -0.912  -16.897 1.00 0.00 ? 112 ASN A C    1  
ATOM 906   O O    . ASN A 1 61  ? 2.945   0.227   -16.475 1.00 0.00 ? 112 ASN A O    1  
ATOM 907   C CB   . ASN A 1 61  ? 4.291   -2.823  -16.212 1.00 0.00 ? 112 ASN A CB   1  
ATOM 908   C CG   . ASN A 1 61  ? 5.445   -3.739  -16.606 1.00 0.00 ? 112 ASN A CG   1  
ATOM 909   O OD1  . ASN A 1 61  ? 5.881   -3.735  -17.743 1.00 0.00 ? 112 ASN A OD1  1  
ATOM 910   N ND2  . ASN A 1 61  ? 5.969   -4.533  -15.714 1.00 0.00 ? 112 ASN A ND2  1  
ATOM 911   H H    . ASN A 1 61  ? 5.569   -0.373  -16.202 1.00 0.00 ? 112 ASN A H    1  
ATOM 912   H HA   . ASN A 1 61  ? 4.127   -2.078  -18.203 1.00 0.00 ? 112 ASN A HA   1  
ATOM 913   H HB2  . ASN A 1 61  ? 4.460   -2.425  -15.222 1.00 0.00 ? 112 ASN A HB2  1  
ATOM 914   H HB3  . ASN A 1 61  ? 3.370   -3.376  -16.220 1.00 0.00 ? 112 ASN A HB3  1  
ATOM 915   H HD21 . ASN A 1 61  ? 5.616   -4.531  -14.800 1.00 0.00 ? 112 ASN A HD21 1  
ATOM 916   H HD22 . ASN A 1 61  ? 6.702   -5.129  -15.960 1.00 0.00 ? 112 ASN A HD22 1  
ATOM 917   N N    . TYR A 1 62  ? 1.796   -1.555  -17.070 1.00 0.00 ? 113 TYR A N    1  
ATOM 918   C CA   . TYR A 1 62  ? 0.509   -0.895  -16.758 1.00 0.00 ? 113 TYR A CA   1  
ATOM 919   C C    . TYR A 1 62  ? 0.499   -0.561  -15.277 1.00 0.00 ? 113 TYR A C    1  
ATOM 920   O O    . TYR A 1 62  ? 1.370   -0.971  -14.539 1.00 0.00 ? 113 TYR A O    1  
ATOM 921   C CB   . TYR A 1 62  ? -0.665  -1.851  -17.053 1.00 0.00 ? 113 TYR A CB   1  
ATOM 922   C CG   . TYR A 1 62  ? -0.342  -3.243  -16.537 1.00 0.00 ? 113 TYR A CG   1  
ATOM 923   C CD1  . TYR A 1 62  ? -0.291  -3.505  -15.149 1.00 0.00 ? 113 TYR A CD1  1  
ATOM 924   C CD2  . TYR A 1 62  ? -0.081  -4.276  -17.447 1.00 0.00 ? 113 TYR A CD2  1  
ATOM 925   C CE1  . TYR A 1 62  ? 0.023   -4.795  -14.693 1.00 0.00 ? 113 TYR A CE1  1  
ATOM 926   C CE2  . TYR A 1 62  ? 0.226   -5.559  -16.988 1.00 0.00 ? 113 TYR A CE2  1  
ATOM 927   C CZ   . TYR A 1 62  ? 0.281   -5.822  -15.615 1.00 0.00 ? 113 TYR A CZ   1  
ATOM 928   O OH   . TYR A 1 62  ? 0.585   -7.092  -15.172 1.00 0.00 ? 113 TYR A OH   1  
ATOM 929   H H    . TYR A 1 62  ? 1.809   -2.485  -17.386 1.00 0.00 ? 113 TYR A H    1  
ATOM 930   H HA   . TYR A 1 62  ? 0.417   0.005   -17.342 1.00 0.00 ? 113 TYR A HA   1  
ATOM 931   H HB2  . TYR A 1 62  ? -1.561  -1.489  -16.566 1.00 0.00 ? 113 TYR A HB2  1  
ATOM 932   H HB3  . TYR A 1 62  ? -0.830  -1.893  -18.121 1.00 0.00 ? 113 TYR A HB3  1  
ATOM 933   H HD1  . TYR A 1 62  ? -0.498  -2.721  -14.439 1.00 0.00 ? 113 TYR A HD1  1  
ATOM 934   H HD2  . TYR A 1 62  ? -0.125  -4.083  -18.508 1.00 0.00 ? 113 TYR A HD2  1  
ATOM 935   H HE1  . TYR A 1 62  ? 0.068   -4.994  -13.628 1.00 0.00 ? 113 TYR A HE1  1  
ATOM 936   H HE2  . TYR A 1 62  ? 0.425   -6.349  -17.695 1.00 0.00 ? 113 TYR A HE2  1  
ATOM 937   H HH   . TYR A 1 62  ? 0.125   -7.720  -15.735 1.00 0.00 ? 113 TYR A HH   1  
ATOM 938   N N    . SER A 1 63  ? -0.494  0.141   -14.812 1.00 0.00 ? 114 SER A N    1  
ATOM 939   C CA   . SER A 1 63  ? -0.538  0.430   -13.358 1.00 0.00 ? 114 SER A CA   1  
ATOM 940   C C    . SER A 1 63  ? -1.081  -0.832  -12.693 1.00 0.00 ? 114 SER A C    1  
ATOM 941   O O    . SER A 1 63  ? -2.011  -1.435  -13.189 1.00 0.00 ? 114 SER A O    1  
ATOM 942   C CB   . SER A 1 63  ? -1.469  1.614   -13.076 1.00 0.00 ? 114 SER A CB   1  
ATOM 943   O OG   . SER A 1 63  ? -2.818  1.168   -13.102 1.00 0.00 ? 114 SER A OG   1  
ATOM 944   H H    . SER A 1 63  ? -1.213  0.441   -15.408 1.00 0.00 ? 114 SER A H    1  
ATOM 945   H HA   . SER A 1 63  ? 0.451   0.651   -12.996 1.00 0.00 ? 114 SER A HA   1  
ATOM 946   H HB2  . SER A 1 63  ? -1.248  2.017   -12.102 1.00 0.00 ? 114 SER A HB2  1  
ATOM 947   H HB3  . SER A 1 63  ? -1.312  2.379   -13.824 1.00 0.00 ? 114 SER A HB3  1  
ATOM 948   H HG   . SER A 1 63  ? -3.000  0.827   -13.981 1.00 0.00 ? 114 SER A HG   1  
ATOM 949   N N    . ALA A 1 64  ? -0.515  -1.272  -11.600 1.00 0.00 ? 115 ALA A N    1  
ATOM 950   C CA   . ALA A 1 64  ? -1.029  -2.531  -10.979 1.00 0.00 ? 115 ALA A CA   1  
ATOM 951   C C    . ALA A 1 64  ? -2.538  -2.450  -10.857 1.00 0.00 ? 115 ALA A C    1  
ATOM 952   O O    . ALA A 1 64  ? -3.115  -1.383  -10.942 1.00 0.00 ? 115 ALA A O    1  
ATOM 953   C CB   . ALA A 1 64  ? -0.427  -2.740  -9.599  1.00 0.00 ? 115 ALA A CB   1  
ATOM 954   H H    . ALA A 1 64  ? 0.253   -0.799  -11.211 1.00 0.00 ? 115 ALA A H    1  
ATOM 955   H HA   . ALA A 1 64  ? -0.774  -3.368  -11.608 1.00 0.00 ? 115 ALA A HA   1  
ATOM 956   H HB1  . ALA A 1 64  ? -0.599  -1.870  -8.989  1.00 0.00 ? 115 ALA A HB1  1  
ATOM 957   H HB2  . ALA A 1 64  ? -0.888  -3.601  -9.132  1.00 0.00 ? 115 ALA A HB2  1  
ATOM 958   H HB3  . ALA A 1 64  ? 0.621   -2.913  -9.701  1.00 0.00 ? 115 ALA A HB3  1  
ATOM 959   N N    . GLU A 1 65  ? -3.185  -3.569  -10.681 1.00 0.00 ? 116 GLU A N    1  
ATOM 960   C CA   . GLU A 1 65  ? -4.672  -3.564  -10.585 1.00 0.00 ? 116 GLU A CA   1  
ATOM 961   C C    . GLU A 1 65  ? -5.092  -4.024  -9.191  1.00 0.00 ? 116 GLU A C    1  
ATOM 962   O O    . GLU A 1 65  ? -4.952  -5.178  -8.825  1.00 0.00 ? 116 GLU A O    1  
ATOM 963   C CB   . GLU A 1 65  ? -5.228  -4.524  -11.638 1.00 0.00 ? 116 GLU A CB   1  
ATOM 964   C CG   . GLU A 1 65  ? -4.948  -3.987  -13.045 1.00 0.00 ? 116 GLU A CG   1  
ATOM 965   C CD   . GLU A 1 65  ? -5.755  -2.706  -13.279 1.00 0.00 ? 116 GLU A CD   1  
ATOM 966   O OE1  . GLU A 1 65  ? -5.242  -1.639  -12.976 1.00 0.00 ? 116 GLU A OE1  1  
ATOM 967   O OE2  . GLU A 1 65  ? -6.872  -2.812  -13.760 1.00 0.00 ? 116 GLU A OE2  1  
ATOM 968   H H    . GLU A 1 65  ? -2.691  -4.423  -10.631 1.00 0.00 ? 116 GLU A H    1  
ATOM 969   H HA   . GLU A 1 65  ? -5.065  -2.572  -10.763 1.00 0.00 ? 116 GLU A HA   1  
ATOM 970   H HB2  . GLU A 1 65  ? -4.750  -5.488  -11.527 1.00 0.00 ? 116 GLU A HB2  1  
ATOM 971   H HB3  . GLU A 1 65  ? -6.290  -4.634  -11.504 1.00 0.00 ? 116 GLU A HB3  1  
ATOM 972   H HG2  . GLU A 1 65  ? -3.892  -3.769  -13.141 1.00 0.00 ? 116 GLU A HG2  1  
ATOM 973   H HG3  . GLU A 1 65  ? -5.231  -4.724  -13.776 1.00 0.00 ? 116 GLU A HG3  1  
ATOM 974   N N    . LEU A 1 66  ? -5.603  -3.106  -8.407  1.00 0.00 ? 117 LEU A N    1  
ATOM 975   C CA   . LEU A 1 66  ? -6.066  -3.447  -7.032  1.00 0.00 ? 117 LEU A CA   1  
ATOM 976   C C    . LEU A 1 66  ? -7.593  -3.363  -6.976  1.00 0.00 ? 117 LEU A C    1  
ATOM 977   O O    . LEU A 1 66  ? -8.203  -2.565  -7.661  1.00 0.00 ? 117 LEU A O    1  
ATOM 978   C CB   . LEU A 1 66  ? -5.453  -2.473  -6.020  1.00 0.00 ? 117 LEU A CB   1  
ATOM 979   C CG   . LEU A 1 66  ? -3.929  -2.685  -5.933  1.00 0.00 ? 117 LEU A CG   1  
ATOM 980   C CD1  . LEU A 1 66  ? -3.226  -1.976  -7.106  1.00 0.00 ? 117 LEU A CD1  1  
ATOM 981   C CD2  . LEU A 1 66  ? -3.406  -2.120  -4.599  1.00 0.00 ? 117 LEU A CD2  1  
ATOM 982   H H    . LEU A 1 66  ? -5.690  -2.188  -8.731  1.00 0.00 ? 117 LEU A H    1  
ATOM 983   H HA   . LEU A 1 66  ? -5.771  -4.448  -6.791  1.00 0.00 ? 117 LEU A HA   1  
ATOM 984   H HB2  . LEU A 1 66  ? -5.664  -1.465  -6.322  1.00 0.00 ? 117 LEU A HB2  1  
ATOM 985   H HB3  . LEU A 1 66  ? -5.893  -2.655  -5.050  1.00 0.00 ? 117 LEU A HB3  1  
ATOM 986   H HG   . LEU A 1 66  ? -3.712  -3.740  -5.987  1.00 0.00 ? 117 LEU A HG   1  
ATOM 987   H HD11 . LEU A 1 66  ? -3.684  -1.019  -7.281  1.00 0.00 ? 117 LEU A HD11 1  
ATOM 988   H HD12 . LEU A 1 66  ? -2.182  -1.837  -6.869  1.00 0.00 ? 117 LEU A HD12 1  
ATOM 989   H HD13 . LEU A 1 66  ? -3.306  -2.581  -7.995  1.00 0.00 ? 117 LEU A HD13 1  
ATOM 990   H HD21 . LEU A 1 66  ? -3.895  -1.179  -4.391  1.00 0.00 ? 117 LEU A HD21 1  
ATOM 991   H HD22 . LEU A 1 66  ? -3.620  -2.820  -3.803  1.00 0.00 ? 117 LEU A HD22 1  
ATOM 992   H HD23 . LEU A 1 66  ? -2.340  -1.965  -4.663  1.00 0.00 ? 117 LEU A HD23 1  
ATOM 993   N N    . ARG A 1 67  ? -8.214  -4.152  -6.135  1.00 0.00 ? 118 ARG A N    1  
ATOM 994   C CA   . ARG A 1 67  ? -9.710  -4.084  -6.000  1.00 0.00 ? 118 ARG A CA   1  
ATOM 995   C C    . ARG A 1 67  ? -10.039 -3.272  -4.769  1.00 0.00 ? 118 ARG A C    1  
ATOM 996   O O    . ARG A 1 67  ? -9.317  -3.286  -3.799  1.00 0.00 ? 118 ARG A O    1  
ATOM 997   C CB   . ARG A 1 67  ? -10.324 -5.474  -5.852  1.00 0.00 ? 118 ARG A CB   1  
ATOM 998   C CG   . ARG A 1 67  ? -10.194 -6.224  -7.175  1.00 0.00 ? 118 ARG A CG   1  
ATOM 999   C CD   . ARG A 1 67  ? -10.972 -7.531  -7.085  1.00 0.00 ? 118 ARG A CD   1  
ATOM 1000  N NE   . ARG A 1 67  ? -12.428 -7.217  -7.069  1.00 0.00 ? 118 ARG A NE   1  
ATOM 1001  C CZ   . ARG A 1 67  ? -13.305 -8.165  -7.255  1.00 0.00 ? 118 ARG A CZ   1  
ATOM 1002  N NH1  . ARG A 1 67  ? -12.910 -9.392  -7.456  1.00 0.00 ? 118 ARG A NH1  1  
ATOM 1003  N NH2  . ARG A 1 67  ? -14.578 -7.882  -7.233  1.00 0.00 ? 118 ARG A NH2  1  
ATOM 1004  H H    . ARG A 1 67  ? -7.694  -4.757  -5.563  1.00 0.00 ? 118 ARG A H    1  
ATOM 1005  H HA   . ARG A 1 67  ? -10.135 -3.595  -6.869  1.00 0.00 ? 118 ARG A HA   1  
ATOM 1006  H HB2  . ARG A 1 67  ? -9.820  -6.012  -5.067  1.00 0.00 ? 118 ARG A HB2  1  
ATOM 1007  H HB3  . ARG A 1 67  ? -11.371 -5.378  -5.603  1.00 0.00 ? 118 ARG A HB3  1  
ATOM 1008  H HG2  . ARG A 1 67  ? -10.603 -5.616  -7.968  1.00 0.00 ? 118 ARG A HG2  1  
ATOM 1009  H HG3  . ARG A 1 67  ? -9.159  -6.430  -7.386  1.00 0.00 ? 118 ARG A HG3  1  
ATOM 1010  H HD2  . ARG A 1 67  ? -10.743 -8.150  -7.937  1.00 0.00 ? 118 ARG A HD2  1  
ATOM 1011  H HD3  . ARG A 1 67  ? -10.702 -8.045  -6.175  1.00 0.00 ? 118 ARG A HD3  1  
ATOM 1012  H HE   . ARG A 1 67  ? -12.727 -6.298  -6.920  1.00 0.00 ? 118 ARG A HE   1  
ATOM 1013  H HH11 . ARG A 1 67  ? -11.936 -9.609  -7.471  1.00 0.00 ? 118 ARG A HH11 1  
ATOM 1014  H HH12 . ARG A 1 67  ? -13.587 -10.118 -7.589  1.00 0.00 ? 118 ARG A HH12 1  
ATOM 1015  H HH21 . ARG A 1 67  ? -14.880 -6.942  -7.063  1.00 0.00 ? 118 ARG A HH21 1  
ATOM 1016  H HH22 . ARG A 1 67  ? -15.254 -8.601  -7.396  1.00 0.00 ? 118 ARG A HH22 1  
ATOM 1017  N N    . ASN A 1 68  ? -11.102 -2.544  -4.801  1.00 0.00 ? 119 ASN A N    1  
ATOM 1018  C CA   . ASN A 1 68  ? -11.456 -1.714  -3.633  1.00 0.00 ? 119 ASN A CA   1  
ATOM 1019  C C    . ASN A 1 68  ? -10.289 -0.772  -3.316  1.00 0.00 ? 119 ASN A C    1  
ATOM 1020  O O    . ASN A 1 68  ? -10.000 -0.480  -2.173  1.00 0.00 ? 119 ASN A O    1  
ATOM 1021  C CB   . ASN A 1 68  ? -11.743 -2.613  -2.430  1.00 0.00 ? 119 ASN A CB   1  
ATOM 1022  C CG   . ASN A 1 68  ? -12.504 -1.809  -1.373  1.00 0.00 ? 119 ASN A CG   1  
ATOM 1023  O OD1  . ASN A 1 68  ? -13.645 -1.430  -1.574  1.00 0.00 ? 119 ASN A OD1  1  
ATOM 1024  N ND2  . ASN A 1 68  ? -11.897 -1.514  -0.261  1.00 0.00 ? 119 ASN A ND2  1  
ATOM 1025  H H    . ASN A 1 68  ? -11.666 -2.533  -5.602  1.00 0.00 ? 119 ASN A H    1  
ATOM 1026  H HA   . ASN A 1 68  ? -12.333 -1.127  -3.867  1.00 0.00 ? 119 ASN A HA   1  
ATOM 1027  H HB2  . ASN A 1 68  ? -12.338 -3.462  -2.748  1.00 0.00 ? 119 ASN A HB2  1  
ATOM 1028  H HB3  . ASN A 1 68  ? -10.814 -2.966  -2.011  1.00 0.00 ? 119 ASN A HB3  1  
ATOM 1029  H HD21 . ASN A 1 68  ? -10.973 -1.807  -0.116  1.00 0.00 ? 119 ASN A HD21 1  
ATOM 1030  H HD22 . ASN A 1 68  ? -12.356 -0.994  0.430   1.00 0.00 ? 119 ASN A HD22 1  
ATOM 1031  N N    . ALA A 1 69  ? -9.638  -0.277  -4.329  1.00 0.00 ? 120 ALA A N    1  
ATOM 1032  C CA   . ALA A 1 69  ? -8.511  0.670   -4.104  1.00 0.00 ? 120 ALA A CA   1  
ATOM 1033  C C    . ALA A 1 69  ? -9.096  2.070   -3.911  1.00 0.00 ? 120 ALA A C    1  
ATOM 1034  O O    . ALA A 1 69  ? -8.398  3.007   -3.571  1.00 0.00 ? 120 ALA A O    1  
ATOM 1035  C CB   . ALA A 1 69  ? -7.601  0.655   -5.334  1.00 0.00 ? 120 ALA A CB   1  
ATOM 1036  H H    . ALA A 1 69  ? -9.897  -0.513  -5.241  1.00 0.00 ? 120 ALA A H    1  
ATOM 1037  H HA   . ALA A 1 69  ? -7.951  0.379   -3.227  1.00 0.00 ? 120 ALA A HA   1  
ATOM 1038  H HB1  . ALA A 1 69  ? -7.556  -0.348  -5.726  1.00 0.00 ? 120 ALA A HB1  1  
ATOM 1039  H HB2  . ALA A 1 69  ? -7.997  1.318   -6.093  1.00 0.00 ? 120 ALA A HB2  1  
ATOM 1040  H HB3  . ALA A 1 69  ? -6.609  0.980   -5.055  1.00 0.00 ? 120 ALA A HB3  1  
ATOM 1041  N N    . THR A 1 70  ? -10.373 2.218   -4.152  1.00 0.00 ? 121 THR A N    1  
ATOM 1042  C CA   . THR A 1 70  ? -11.032 3.539   -4.019  1.00 0.00 ? 121 THR A CA   1  
ATOM 1043  C C    . THR A 1 70  ? -11.841 3.586   -2.724  1.00 0.00 ? 121 THR A C    1  
ATOM 1044  O O    . THR A 1 70  ? -13.053 3.503   -2.735  1.00 0.00 ? 121 THR A O    1  
ATOM 1045  C CB   . THR A 1 70  ? -11.957 3.725   -5.217  1.00 0.00 ? 121 THR A CB   1  
ATOM 1046  O OG1  . THR A 1 70  ? -13.001 2.755   -5.175  1.00 0.00 ? 121 THR A OG1  1  
ATOM 1047  C CG2  . THR A 1 70  ? -11.149 3.567   -6.514  1.00 0.00 ? 121 THR A CG2  1  
ATOM 1048  H H    . THR A 1 70  ? -10.904 1.452   -4.443  1.00 0.00 ? 121 THR A H    1  
ATOM 1049  H HA   . THR A 1 70  ? -10.291 4.326   -4.015  1.00 0.00 ? 121 THR A HA   1  
ATOM 1050  H HB   . THR A 1 70  ? -12.383 4.707   -5.184  1.00 0.00 ? 121 THR A HB   1  
ATOM 1051  H HG1  . THR A 1 70  ? -12.665 1.968   -4.740  1.00 0.00 ? 121 THR A HG1  1  
ATOM 1052  H HG21 . THR A 1 70  ? -10.166 4.004   -6.388  1.00 0.00 ? 121 THR A HG21 1  
ATOM 1053  H HG22 . THR A 1 70  ? -11.045 2.521   -6.752  1.00 0.00 ? 121 THR A HG22 1  
ATOM 1054  H HG23 . THR A 1 70  ? -11.659 4.070   -7.320  1.00 0.00 ? 121 THR A HG23 1  
ATOM 1055  N N    . ALA A 1 71  ? -11.173 3.724   -1.609  1.00 0.00 ? 122 ALA A N    1  
ATOM 1056  C CA   . ALA A 1 71  ? -11.900 3.785   -0.306  1.00 0.00 ? 122 ALA A CA   1  
ATOM 1057  C C    . ALA A 1 71  ? -12.268 5.233   -0.018  1.00 0.00 ? 122 ALA A C    1  
ATOM 1058  O O    . ALA A 1 71  ? -11.616 6.154   -0.470  1.00 0.00 ? 122 ALA A O    1  
ATOM 1059  C CB   . ALA A 1 71  ? -11.009 3.254   0.826   1.00 0.00 ? 122 ALA A CB   1  
ATOM 1060  H H    . ALA A 1 71  ? -10.199 3.792   -1.629  1.00 0.00 ? 122 ALA A H    1  
ATOM 1061  H HA   . ALA A 1 71  ? -12.799 3.190   -0.362  1.00 0.00 ? 122 ALA A HA   1  
ATOM 1062  H HB1  . ALA A 1 71  ? -10.648 2.269   0.570   1.00 0.00 ? 122 ALA A HB1  1  
ATOM 1063  H HB2  . ALA A 1 71  ? -10.170 3.921   0.974   1.00 0.00 ? 122 ALA A HB2  1  
ATOM 1064  H HB3  . ALA A 1 71  ? -11.588 3.200   1.735   1.00 0.00 ? 122 ALA A HB3  1  
ATOM 1065  N N    . ALA A 1 72  ? -13.323 5.452   0.719   1.00 0.00 ? 123 ALA A N    1  
ATOM 1066  C CA   . ALA A 1 72  ? -13.747 6.847   1.015   1.00 0.00 ? 123 ALA A CA   1  
ATOM 1067  C C    . ALA A 1 72  ? -13.105 7.326   2.309   1.00 0.00 ? 123 ALA A C    1  
ATOM 1068  O O    . ALA A 1 72  ? -13.334 6.769   3.365   1.00 0.00 ? 123 ALA A O    1  
ATOM 1069  C CB   . ALA A 1 72  ? -15.267 6.894   1.168   1.00 0.00 ? 123 ALA A CB   1  
ATOM 1070  H H    . ALA A 1 72  ? -13.845 4.697   1.063   1.00 0.00 ? 123 ALA A H    1  
ATOM 1071  H HA   . ALA A 1 72  ? -13.451 7.489   0.209   1.00 0.00 ? 123 ALA A HA   1  
ATOM 1072  H HB1  . ALA A 1 72  ? -15.581 6.102   1.832   1.00 0.00 ? 123 ALA A HB1  1  
ATOM 1073  H HB2  . ALA A 1 72  ? -15.558 7.850   1.579   1.00 0.00 ? 123 ALA A HB2  1  
ATOM 1074  H HB3  . ALA A 1 72  ? -15.733 6.760   0.203   1.00 0.00 ? 123 ALA A HB3  1  
ATOM 1075  N N    . MET A 1 73  ? -12.316 8.366   2.263   1.00 0.00 ? 124 MET A N    1  
ATOM 1076  C CA   . MET A 1 73  ? -11.703 8.850   3.520   1.00 0.00 ? 124 MET A CA   1  
ATOM 1077  C C    . MET A 1 73  ? -12.831 9.199   4.475   1.00 0.00 ? 124 MET A C    1  
ATOM 1078  O O    . MET A 1 73  ? -13.718 9.970   4.141   1.00 0.00 ? 124 MET A O    1  
ATOM 1079  C CB   . MET A 1 73  ? -10.862 10.105  3.251   1.00 0.00 ? 124 MET A CB   1  
ATOM 1080  C CG   . MET A 1 73  ? -9.958  10.413  4.449   1.00 0.00 ? 124 MET A CG   1  
ATOM 1081  S SD   . MET A 1 73  ? -8.467  9.389   4.377   1.00 0.00 ? 124 MET A SD   1  
ATOM 1082  C CE   . MET A 1 73  ? -7.474  10.473  3.322   1.00 0.00 ? 124 MET A CE   1  
ATOM 1083  H H    . MET A 1 73  ? -12.146 8.823   1.409   1.00 0.00 ? 124 MET A H    1  
ATOM 1084  H HA   . MET A 1 73  ? -11.092 8.083   3.957   1.00 0.00 ? 124 MET A HA   1  
ATOM 1085  H HB2  . MET A 1 73  ? -10.253 9.950   2.372   1.00 0.00 ? 124 MET A HB2  1  
ATOM 1086  H HB3  . MET A 1 73  ? -11.523 10.940  3.090   1.00 0.00 ? 124 MET A HB3  1  
ATOM 1087  H HG2  . MET A 1 73  ? -9.678  11.457  4.431   1.00 0.00 ? 124 MET A HG2  1  
ATOM 1088  H HG3  . MET A 1 73  ? -10.492 10.205  5.364   1.00 0.00 ? 124 MET A HG3  1  
ATOM 1089  H HE1  . MET A 1 73  ? -7.439  11.461  3.749   1.00 0.00 ? 124 MET A HE1  1  
ATOM 1090  H HE2  . MET A 1 73  ? -6.469  10.078  3.251   1.00 0.00 ? 124 MET A HE2  1  
ATOM 1091  H HE3  . MET A 1 73  ? -7.915  10.524  2.339   1.00 0.00 ? 124 MET A HE3  1  
ATOM 1092  N N    . LYS A 1 74  ? -12.811 8.642   5.655   1.00 0.00 ? 125 LYS A N    1  
ATOM 1093  C CA   . LYS A 1 74  ? -13.883 8.957   6.632   1.00 0.00 ? 125 LYS A CA   1  
ATOM 1094  C C    . LYS A 1 74  ? -13.594 10.326  7.226   1.00 0.00 ? 125 LYS A C    1  
ATOM 1095  O O    . LYS A 1 74  ? -14.375 11.250  7.123   1.00 0.00 ? 125 LYS A O    1  
ATOM 1096  C CB   . LYS A 1 74  ? -13.906 7.901   7.741   1.00 0.00 ? 125 LYS A CB   1  
ATOM 1097  C CG   . LYS A 1 74  ? -14.186 6.529   7.131   1.00 0.00 ? 125 LYS A CG   1  
ATOM 1098  C CD   . LYS A 1 74  ? -14.455 5.516   8.248   1.00 0.00 ? 125 LYS A CD   1  
ATOM 1099  C CE   . LYS A 1 74  ? -14.658 4.142   7.619   1.00 0.00 ? 125 LYS A CE   1  
ATOM 1100  N NZ   . LYS A 1 74  ? -15.071 3.170   8.672   1.00 0.00 ? 125 LYS A NZ   1  
ATOM 1101  H H    . LYS A 1 74  ? -12.075 8.030   5.899   1.00 0.00 ? 125 LYS A H    1  
ATOM 1102  H HA   . LYS A 1 74  ? -14.837 8.973   6.128   1.00 0.00 ? 125 LYS A HA   1  
ATOM 1103  H HB2  . LYS A 1 74  ? -12.946 7.887   8.242   1.00 0.00 ? 125 LYS A HB2  1  
ATOM 1104  H HB3  . LYS A 1 74  ? -14.680 8.144   8.450   1.00 0.00 ? 125 LYS A HB3  1  
ATOM 1105  H HG2  . LYS A 1 74  ? -15.056 6.591   6.493   1.00 0.00 ? 125 LYS A HG2  1  
ATOM 1106  H HG3  . LYS A 1 74  ? -13.337 6.206   6.552   1.00 0.00 ? 125 LYS A HG3  1  
ATOM 1107  H HD2  . LYS A 1 74  ? -13.608 5.488   8.922   1.00 0.00 ? 125 LYS A HD2  1  
ATOM 1108  H HD3  . LYS A 1 74  ? -15.342 5.801   8.788   1.00 0.00 ? 125 LYS A HD3  1  
ATOM 1109  H HE2  . LYS A 1 74  ? -15.430 4.203   6.870   1.00 0.00 ? 125 LYS A HE2  1  
ATOM 1110  H HE3  . LYS A 1 74  ? -13.736 3.813   7.165   1.00 0.00 ? 125 LYS A HE3  1  
ATOM 1111  H HZ1  . LYS A 1 74  ? -15.758 3.621   9.310   1.00 0.00 ? 125 LYS A HZ1  1  
ATOM 1112  H HZ2  . LYS A 1 74  ? -15.505 2.342   8.219   1.00 0.00 ? 125 LYS A HZ2  1  
ATOM 1113  H HZ3  . LYS A 1 74  ? -14.235 2.876   9.216   1.00 0.00 ? 125 LYS A HZ3  1  
ATOM 1114  N N    . ASN A 1 75  ? -12.443 10.456  7.815   1.00 0.00 ? 126 ASN A N    1  
ATOM 1115  C CA   . ASN A 1 75  ? -12.001 11.746  8.402   1.00 0.00 ? 126 ASN A CA   1  
ATOM 1116  C C    . ASN A 1 75  ? -10.636 12.047  7.791   1.00 0.00 ? 126 ASN A C    1  
ATOM 1117  O O    . ASN A 1 75  ? -10.500 12.166  6.591   1.00 0.00 ? 126 ASN A O    1  
ATOM 1118  C CB   . ASN A 1 75  ? -11.883 11.598  9.921   1.00 0.00 ? 126 ASN A CB   1  
ATOM 1119  C CG   . ASN A 1 75  ? -10.881 10.493  10.241  1.00 0.00 ? 126 ASN A CG   1  
ATOM 1120  O OD1  . ASN A 1 75  ? -10.388 9.827   9.349   1.00 0.00 ? 126 ASN A OD1  1  
ATOM 1121  N ND2  . ASN A 1 75  ? -10.549 10.266  11.476  1.00 0.00 ? 126 ASN A ND2  1  
ATOM 1122  H H    . ASN A 1 75  ? -11.835 9.687   7.848   1.00 0.00 ? 126 ASN A H    1  
ATOM 1123  H HA   . ASN A 1 75  ? -12.698 12.536  8.156   1.00 0.00 ? 126 ASN A HA   1  
ATOM 1124  H HB2  . ASN A 1 75  ? -11.543 12.532  10.348  1.00 0.00 ? 126 ASN A HB2  1  
ATOM 1125  H HB3  . ASN A 1 75  ? -12.850 11.341  10.336  1.00 0.00 ? 126 ASN A HB3  1  
ATOM 1126  H HD21 . ASN A 1 75  ? -10.945 10.801  12.194  1.00 0.00 ? 126 ASN A HD21 1  
ATOM 1127  H HD22 . ASN A 1 75  ? -9.901  9.566   11.687  1.00 0.00 ? 126 ASN A HD22 1  
ATOM 1128  N N    . GLN A 1 76  ? -9.618  12.134  8.591   1.00 0.00 ? 127 GLN A N    1  
ATOM 1129  C CA   . GLN A 1 76  ? -8.256  12.370  8.039   1.00 0.00 ? 127 GLN A CA   1  
ATOM 1130  C C    . GLN A 1 76  ? -7.595  11.016  7.767   1.00 0.00 ? 127 GLN A C    1  
ATOM 1131  O O    . GLN A 1 76  ? -6.417  10.940  7.474   1.00 0.00 ? 127 GLN A O    1  
ATOM 1132  C CB   . GLN A 1 76  ? -7.423  13.132  9.056   1.00 0.00 ? 127 GLN A CB   1  
ATOM 1133  C CG   . GLN A 1 76  ? -8.024  14.514  9.309   1.00 0.00 ? 127 GLN A CG   1  
ATOM 1134  C CD   . GLN A 1 76  ? -7.155  15.231  10.337  1.00 0.00 ? 127 GLN A CD   1  
ATOM 1135  O OE1  . GLN A 1 76  ? -6.463  14.596  11.105  1.00 0.00 ? 127 GLN A OE1  1  
ATOM 1136  N NE2  . GLN A 1 76  ? -7.133  16.530  10.366  1.00 0.00 ? 127 GLN A NE2  1  
ATOM 1137  H H    . GLN A 1 76  ? -9.736  12.009  9.551   1.00 0.00 ? 127 GLN A H    1  
ATOM 1138  H HA   . GLN A 1 76  ? -8.321  12.942  7.121   1.00 0.00 ? 127 GLN A HA   1  
ATOM 1139  H HB2  . GLN A 1 76  ? -7.399  12.580  9.987   1.00 0.00 ? 127 GLN A HB2  1  
ATOM 1140  H HB3  . GLN A 1 76  ? -6.424  13.243  8.684   1.00 0.00 ? 127 GLN A HB3  1  
ATOM 1141  H HG2  . GLN A 1 76  ? -8.036  15.077  8.385   1.00 0.00 ? 127 GLN A HG2  1  
ATOM 1142  H HG3  . GLN A 1 76  ? -9.030  14.419  9.692   1.00 0.00 ? 127 GLN A HG3  1  
ATOM 1143  H HE21 . GLN A 1 76  ? -7.668  17.043  9.723   1.00 0.00 ? 127 GLN A HE21 1  
ATOM 1144  H HE22 . GLN A 1 76  ? -6.595  16.996  11.037  1.00 0.00 ? 127 GLN A HE22 1  
ATOM 1145  N N    . VAL A 1 77  ? -8.343  9.935   7.886   1.00 0.00 ? 128 VAL A N    1  
ATOM 1146  C CA   . VAL A 1 77  ? -7.760  8.571   7.661   1.00 0.00 ? 128 VAL A CA   1  
ATOM 1147  C C    . VAL A 1 77  ? -8.666  7.711   6.776   1.00 0.00 ? 128 VAL A C    1  
ATOM 1148  O O    . VAL A 1 77  ? -9.877  7.812   6.809   1.00 0.00 ? 128 VAL A O    1  
ATOM 1149  C CB   . VAL A 1 77  ? -7.574  7.866   9.003   1.00 0.00 ? 128 VAL A CB   1  
ATOM 1150  C CG1  . VAL A 1 77  ? -6.773  6.572   8.811   1.00 0.00 ? 128 VAL A CG1  1  
ATOM 1151  C CG2  . VAL A 1 77  ? -6.824  8.793   9.954   1.00 0.00 ? 128 VAL A CG2  1  
ATOM 1152  H H    . VAL A 1 77  ? -9.285  10.022  8.140   1.00 0.00 ? 128 VAL A H    1  
ATOM 1153  H HA   . VAL A 1 77  ? -6.805  8.666   7.182   1.00 0.00 ? 128 VAL A HA   1  
ATOM 1154  H HB   . VAL A 1 77  ? -8.542  7.628   9.421   1.00 0.00 ? 128 VAL A HB   1  
ATOM 1155  H HG11 . VAL A 1 77  ? -7.282  5.935   8.101   1.00 0.00 ? 128 VAL A HG11 1  
ATOM 1156  H HG12 . VAL A 1 77  ? -5.785  6.811   8.442   1.00 0.00 ? 128 VAL A HG12 1  
ATOM 1157  H HG13 . VAL A 1 77  ? -6.688  6.056   9.759   1.00 0.00 ? 128 VAL A HG13 1  
ATOM 1158  H HG21 . VAL A 1 77  ? -5.867  9.046   9.525   1.00 0.00 ? 128 VAL A HG21 1  
ATOM 1159  H HG22 . VAL A 1 77  ? -7.402  9.693   10.105  1.00 0.00 ? 128 VAL A HG22 1  
ATOM 1160  H HG23 . VAL A 1 77  ? -6.676  8.298   10.901  1.00 0.00 ? 128 VAL A HG23 1  
ATOM 1161  N N    . ALA A 1 78  ? -8.061  6.848   5.997   1.00 0.00 ? 129 ALA A N    1  
ATOM 1162  C CA   . ALA A 1 78  ? -8.817  5.920   5.091   1.00 0.00 ? 129 ALA A CA   1  
ATOM 1163  C C    . ALA A 1 78  ? -8.316  4.486   5.340   1.00 0.00 ? 129 ALA A C    1  
ATOM 1164  O O    . ALA A 1 78  ? -7.355  4.275   6.053   1.00 0.00 ? 129 ALA A O    1  
ATOM 1165  C CB   . ALA A 1 78  ? -8.547  6.282   3.619   1.00 0.00 ? 129 ALA A CB   1  
ATOM 1166  H H    . ALA A 1 78  ? -7.087  6.804   6.014   1.00 0.00 ? 129 ALA A H    1  
ATOM 1167  H HA   . ALA A 1 78  ? -9.878  5.985   5.295   1.00 0.00 ? 129 ALA A HA   1  
ATOM 1168  H HB1  . ALA A 1 78  ? -7.531  6.630   3.514   1.00 0.00 ? 129 ALA A HB1  1  
ATOM 1169  H HB2  . ALA A 1 78  ? -8.691  5.411   2.996   1.00 0.00 ? 129 ALA A HB2  1  
ATOM 1170  H HB3  . ALA A 1 78  ? -9.221  7.052   3.301   1.00 0.00 ? 129 ALA A HB3  1  
ATOM 1171  N N    . ARG A 1 79  ? -8.950  3.499   4.748   1.00 0.00 ? 130 ARG A N    1  
ATOM 1172  C CA   . ARG A 1 79  ? -8.492  2.082   4.933   1.00 0.00 ? 130 ARG A CA   1  
ATOM 1173  C C    . ARG A 1 79  ? -9.012  1.237   3.757   1.00 0.00 ? 130 ARG A C    1  
ATOM 1174  O O    . ARG A 1 79  ? -9.986  1.587   3.116   1.00 0.00 ? 130 ARG A O    1  
ATOM 1175  C CB   . ARG A 1 79  ? -9.032  1.520   6.256   1.00 0.00 ? 130 ARG A CB   1  
ATOM 1176  C CG   . ARG A 1 79  ? -8.367  0.171   6.569   1.00 0.00 ? 130 ARG A CG   1  
ATOM 1177  C CD   . ARG A 1 79  ? -8.932  -0.370  7.886   1.00 0.00 ? 130 ARG A CD   1  
ATOM 1178  N NE   . ARG A 1 79  ? -8.255  -1.648  8.269   1.00 0.00 ? 130 ARG A NE   1  
ATOM 1179  C CZ   . ARG A 1 79  ? -8.316  -2.068  9.506   1.00 0.00 ? 130 ARG A CZ   1  
ATOM 1180  N NH1  . ARG A 1 79  ? -9.014  -1.406  10.385  1.00 0.00 ? 130 ARG A NH1  1  
ATOM 1181  N NH2  . ARG A 1 79  ? -7.684  -3.153  9.866   1.00 0.00 ? 130 ARG A NH2  1  
ATOM 1182  H H    . ARG A 1 79  ? -9.716  3.695   4.168   1.00 0.00 ? 130 ARG A H    1  
ATOM 1183  H HA   . ARG A 1 79  ? -7.407  2.051   4.940   1.00 0.00 ? 130 ARG A HA   1  
ATOM 1184  H HB2  . ARG A 1 79  ? -8.819  2.219   7.054   1.00 0.00 ? 130 ARG A HB2  1  
ATOM 1185  H HB3  . ARG A 1 79  ? -10.098 1.378   6.175   1.00 0.00 ? 130 ARG A HB3  1  
ATOM 1186  H HG2  . ARG A 1 79  ? -8.559  -0.529  5.770   1.00 0.00 ? 130 ARG A HG2  1  
ATOM 1187  H HG3  . ARG A 1 79  ? -7.297  0.313   6.670   1.00 0.00 ? 130 ARG A HG3  1  
ATOM 1188  H HD2  . ARG A 1 79  ? -8.770  0.365   8.664   1.00 0.00 ? 130 ARG A HD2  1  
ATOM 1189  H HD3  . ARG A 1 79  ? -9.988  -0.550  7.774   1.00 0.00 ? 130 ARG A HD3  1  
ATOM 1190  H HE   . ARG A 1 79  ? -7.759  -2.165  7.597   1.00 0.00 ? 130 ARG A HE   1  
ATOM 1191  H HH11 . ARG A 1 79  ? -9.504  -0.580  10.116  1.00 0.00 ? 130 ARG A HH11 1  
ATOM 1192  H HH12 . ARG A 1 79  ? -9.060  -1.727  11.331  1.00 0.00 ? 130 ARG A HH12 1  
ATOM 1193  H HH21 . ARG A 1 79  ? -7.156  -3.669  9.197   1.00 0.00 ? 130 ARG A HH21 1  
ATOM 1194  H HH22 . ARG A 1 79  ? -7.724  -3.459  10.817  1.00 0.00 ? 130 ARG A HH22 1  
ATOM 1195  N N    . PHE A 1 80  ? -8.355  0.135   3.459   1.00 0.00 ? 131 PHE A N    1  
ATOM 1196  C CA   . PHE A 1 80  ? -8.769  -0.741  2.306   1.00 0.00 ? 131 PHE A CA   1  
ATOM 1197  C C    . PHE A 1 80  ? -9.163  -2.150  2.824   1.00 0.00 ? 131 PHE A C    1  
ATOM 1198  O O    . PHE A 1 80  ? -8.413  -2.785  3.538   1.00 0.00 ? 131 PHE A O    1  
ATOM 1199  C CB   . PHE A 1 80  ? -7.564  -0.867  1.354   1.00 0.00 ? 131 PHE A CB   1  
ATOM 1200  C CG   . PHE A 1 80  ? -6.819  0.454   1.262   1.00 0.00 ? 131 PHE A CG   1  
ATOM 1201  C CD1  . PHE A 1 80  ? -7.256  1.459   0.388   1.00 0.00 ? 131 PHE A CD1  1  
ATOM 1202  C CD2  . PHE A 1 80  ? -5.678  0.669   2.054   1.00 0.00 ? 131 PHE A CD2  1  
ATOM 1203  C CE1  . PHE A 1 80  ? -6.564  2.676   0.313   1.00 0.00 ? 131 PHE A CE1  1  
ATOM 1204  C CE2  . PHE A 1 80  ? -4.984  1.887   1.979   1.00 0.00 ? 131 PHE A CE2  1  
ATOM 1205  C CZ   . PHE A 1 80  ? -5.430  2.891   1.109   1.00 0.00 ? 131 PHE A CZ   1  
ATOM 1206  H H    . PHE A 1 80  ? -7.570  -0.108  3.983   1.00 0.00 ? 131 PHE A H    1  
ATOM 1207  H HA   . PHE A 1 80  ? -9.604  -0.299  1.779   1.00 0.00 ? 131 PHE A HA   1  
ATOM 1208  H HB2  . PHE A 1 80  ? -6.888  -1.624  1.726   1.00 0.00 ? 131 PHE A HB2  1  
ATOM 1209  H HB3  . PHE A 1 80  ? -7.910  -1.147  0.373   1.00 0.00 ? 131 PHE A HB3  1  
ATOM 1210  H HD1  . PHE A 1 80  ? -8.128  1.296   -0.227  1.00 0.00 ? 131 PHE A HD1  1  
ATOM 1211  H HD2  . PHE A 1 80  ? -5.333  -0.108  2.720   1.00 0.00 ? 131 PHE A HD2  1  
ATOM 1212  H HE1  . PHE A 1 80  ? -6.906  3.450   -0.359  1.00 0.00 ? 131 PHE A HE1  1  
ATOM 1213  H HE2  . PHE A 1 80  ? -4.105  2.057   2.597   1.00 0.00 ? 131 PHE A HE2  1  
ATOM 1214  H HZ   . PHE A 1 80  ? -4.898  3.828   1.052   1.00 0.00 ? 131 PHE A HZ   1  
ATOM 1215  N N    . ASN A 1 81  ? -10.340 -2.636  2.470   1.00 0.00 ? 132 ASN A N    1  
ATOM 1216  C CA   . ASN A 1 81  ? -10.787 -3.997  2.946   1.00 0.00 ? 132 ASN A CA   1  
ATOM 1217  C C    . ASN A 1 81  ? -10.456 -5.108  1.939   1.00 0.00 ? 132 ASN A C    1  
ATOM 1218  O O    . ASN A 1 81  ? -9.497  -5.834  2.090   1.00 0.00 ? 132 ASN A O    1  
ATOM 1219  C CB   . ASN A 1 81  ? -12.301 -3.981  3.164   1.00 0.00 ? 132 ASN A CB   1  
ATOM 1220  C CG   . ASN A 1 81  ? -12.638 -3.074  4.346   1.00 0.00 ? 132 ASN A CG   1  
ATOM 1221  O OD1  . ASN A 1 81  ? -11.790 -2.778  5.163   1.00 0.00 ? 132 ASN A OD1  1  
ATOM 1222  N ND2  . ASN A 1 81  ? -13.858 -2.634  4.482   1.00 0.00 ? 132 ASN A ND2  1  
ATOM 1223  H H    . ASN A 1 81  ? -10.932 -2.105  1.899   1.00 0.00 ? 132 ASN A H    1  
ATOM 1224  H HA   . ASN A 1 81  ? -10.303 -4.225  3.877   1.00 0.00 ? 132 ASN A HA   1  
ATOM 1225  H HB2  . ASN A 1 81  ? -12.782 -3.607  2.273   1.00 0.00 ? 132 ASN A HB2  1  
ATOM 1226  H HB3  . ASN A 1 81  ? -12.646 -4.984  3.367   1.00 0.00 ? 132 ASN A HB3  1  
ATOM 1227  H HD21 . ASN A 1 81  ? -14.544 -2.891  3.833   1.00 0.00 ? 132 ASN A HD21 1  
ATOM 1228  H HD22 . ASN A 1 81  ? -14.085 -2.044  5.232   1.00 0.00 ? 132 ASN A HD22 1  
ATOM 1229  N N    . ASP A 1 82  ? -11.278 -5.266  0.935   1.00 0.00 ? 133 ASP A N    1  
ATOM 1230  C CA   . ASP A 1 82  ? -11.068 -6.355  -0.076  1.00 0.00 ? 133 ASP A CA   1  
ATOM 1231  C C    . ASP A 1 82  ? -9.848  -6.055  -0.937  1.00 0.00 ? 133 ASP A C    1  
ATOM 1232  O O    . ASP A 1 82  ? -9.664  -6.632  -1.993  1.00 0.00 ? 133 ASP A O    1  
ATOM 1233  C CB   . ASP A 1 82  ? -12.300 -6.459  -0.962  1.00 0.00 ? 133 ASP A CB   1  
ATOM 1234  C CG   . ASP A 1 82  ? -13.440 -7.085  -0.164  1.00 0.00 ? 133 ASP A CG   1  
ATOM 1235  O OD1  . ASP A 1 82  ? -13.152 -7.894  0.703   1.00 0.00 ? 133 ASP A OD1  1  
ATOM 1236  O OD2  . ASP A 1 82  ? -14.580 -6.753  -0.433  1.00 0.00 ? 133 ASP A OD2  1  
ATOM 1237  H H    . ASP A 1 82  ? -12.068 -4.685  0.860   1.00 0.00 ? 133 ASP A H    1  
ATOM 1238  H HA   . ASP A 1 82  ? -10.915 -7.295  0.439   1.00 0.00 ? 133 ASP A HA   1  
ATOM 1239  H HB2  . ASP A 1 82  ? -12.592 -5.468  -1.292  1.00 0.00 ? 133 ASP A HB2  1  
ATOM 1240  H HB3  . ASP A 1 82  ? -12.082 -7.075  -1.822  1.00 0.00 ? 133 ASP A HB3  1  
ATOM 1241  N N    . LEU A 1 83  ? -9.043  -5.143  -0.506  1.00 0.00 ? 134 LEU A N    1  
ATOM 1242  C CA   . LEU A 1 83  ? -7.841  -4.749  -1.288  1.00 0.00 ? 134 LEU A CA   1  
ATOM 1243  C C    . LEU A 1 83  ? -7.167  -5.950  -1.951  1.00 0.00 ? 134 LEU A C    1  
ATOM 1244  O O    . LEU A 1 83  ? -6.498  -6.735  -1.309  1.00 0.00 ? 134 LEU A O    1  
ATOM 1245  C CB   . LEU A 1 83  ? -6.828  -4.098  -0.353  1.00 0.00 ? 134 LEU A CB   1  
ATOM 1246  C CG   . LEU A 1 83  ? -5.698  -3.440  -1.170  1.00 0.00 ? 134 LEU A CG   1  
ATOM 1247  C CD1  . LEU A 1 83  ? -6.133  -2.046  -1.677  1.00 0.00 ? 134 LEU A CD1  1  
ATOM 1248  C CD2  . LEU A 1 83  ? -4.451  -3.308  -0.287  1.00 0.00 ? 134 LEU A CD2  1  
ATOM 1249  H H    . LEU A 1 83  ? -9.238  -4.690  0.334   1.00 0.00 ? 134 LEU A H    1  
ATOM 1250  H HA   . LEU A 1 83  ? -8.126  -4.052  -2.036  1.00 0.00 ? 134 LEU A HA   1  
ATOM 1251  H HB2  . LEU A 1 83  ? -7.328  -3.356  0.243   1.00 0.00 ? 134 LEU A HB2  1  
ATOM 1252  H HB3  . LEU A 1 83  ? -6.410  -4.855  0.299   1.00 0.00 ? 134 LEU A HB3  1  
ATOM 1253  H HG   . LEU A 1 83  ? -5.457  -4.058  -2.021  1.00 0.00 ? 134 LEU A HG   1  
ATOM 1254  H HD11 . LEU A 1 83  ? -7.201  -2.023  -1.831  1.00 0.00 ? 134 LEU A HD11 1  
ATOM 1255  H HD12 . LEU A 1 83  ? -5.866  -1.290  -0.952  1.00 0.00 ? 134 LEU A HD12 1  
ATOM 1256  H HD13 . LEU A 1 83  ? -5.633  -1.837  -2.613  1.00 0.00 ? 134 LEU A HD13 1  
ATOM 1257  H HD21 . LEU A 1 83  ? -4.730  -2.893  0.670   1.00 0.00 ? 134 LEU A HD21 1  
ATOM 1258  H HD22 . LEU A 1 83  ? -4.012  -4.285  -0.140  1.00 0.00 ? 134 LEU A HD22 1  
ATOM 1259  H HD23 . LEU A 1 83  ? -3.735  -2.661  -0.766  1.00 0.00 ? 134 LEU A HD23 1  
ATOM 1260  N N    . ARG A 1 84  ? -7.290  -6.044  -3.243  1.00 0.00 ? 135 ARG A N    1  
ATOM 1261  C CA   . ARG A 1 84  ? -6.609  -7.135  -3.996  1.00 0.00 ? 135 ARG A CA   1  
ATOM 1262  C C    . ARG A 1 84  ? -5.260  -6.576  -4.440  1.00 0.00 ? 135 ARG A C    1  
ATOM 1263  O O    . ARG A 1 84  ? -5.180  -5.446  -4.875  1.00 0.00 ? 135 ARG A O    1  
ATOM 1264  C CB   . ARG A 1 84  ? -7.455  -7.524  -5.211  1.00 0.00 ? 135 ARG A CB   1  
ATOM 1265  C CG   . ARG A 1 84  ? -6.815  -8.696  -5.977  1.00 0.00 ? 135 ARG A CG   1  
ATOM 1266  C CD   . ARG A 1 84  ? -6.888  -9.999  -5.152  1.00 0.00 ? 135 ARG A CD   1  
ATOM 1267  N NE   . ARG A 1 84  ? -6.836  -11.184 -6.077  1.00 0.00 ? 135 ARG A NE   1  
ATOM 1268  C CZ   . ARG A 1 84  ? -7.768  -11.407 -6.963  1.00 0.00 ? 135 ARG A CZ   1  
ATOM 1269  N NH1  . ARG A 1 84  ? -8.814  -10.623 -7.028  1.00 0.00 ? 135 ARG A NH1  1  
ATOM 1270  N NH2  . ARG A 1 84  ? -7.660  -12.425 -7.777  1.00 0.00 ? 135 ARG A NH2  1  
ATOM 1271  H H    . ARG A 1 84  ? -7.796  -5.359  -3.732  1.00 0.00 ? 135 ARG A H    1  
ATOM 1272  H HA   . ARG A 1 84  ? -6.455  -7.994  -3.355  1.00 0.00 ? 135 ARG A HA   1  
ATOM 1273  H HB2  . ARG A 1 84  ? -8.440  -7.817  -4.880  1.00 0.00 ? 135 ARG A HB2  1  
ATOM 1274  H HB3  . ARG A 1 84  ? -7.537  -6.676  -5.864  1.00 0.00 ? 135 ARG A HB3  1  
ATOM 1275  H HG2  . ARG A 1 84  ? -7.322  -8.822  -6.915  1.00 0.00 ? 135 ARG A HG2  1  
ATOM 1276  H HG3  . ARG A 1 84  ? -5.774  -8.456  -6.171  1.00 0.00 ? 135 ARG A HG3  1  
ATOM 1277  H HD2  . ARG A 1 84  ? -6.036  -10.071 -4.509  1.00 0.00 ? 135 ARG A HD2  1  
ATOM 1278  H HD3  . ARG A 1 84  ? -7.791  -9.997  -4.538  1.00 0.00 ? 135 ARG A HD3  1  
ATOM 1279  H HE   . ARG A 1 84  ? -6.076  -11.799 -6.020  1.00 0.00 ? 135 ARG A HE   1  
ATOM 1280  H HH11 . ARG A 1 84  ? -8.893  -9.848  -6.401  1.00 0.00 ? 135 ARG A HH11 1  
ATOM 1281  H HH12 . ARG A 1 84  ? -9.539  -10.808 -7.690  1.00 0.00 ? 135 ARG A HH12 1  
ATOM 1282  H HH21 . ARG A 1 84  ? -6.864  -13.030 -7.716  1.00 0.00 ? 135 ARG A HH21 1  
ATOM 1283  H HH22 . ARG A 1 84  ? -8.367  -12.598 -8.463  1.00 0.00 ? 135 ARG A HH22 1  
ATOM 1284  N N    . PHE A 1 85  ? -4.195  -7.322  -4.293  1.00 0.00 ? 136 PHE A N    1  
ATOM 1285  C CA   . PHE A 1 85  ? -2.840  -6.814  -4.667  1.00 0.00 ? 136 PHE A CA   1  
ATOM 1286  C C    . PHE A 1 85  ? -2.291  -7.632  -5.827  1.00 0.00 ? 136 PHE A C    1  
ATOM 1287  O O    . PHE A 1 85  ? -1.664  -8.654  -5.612  1.00 0.00 ? 136 PHE A O    1  
ATOM 1288  C CB   . PHE A 1 85  ? -1.948  -6.988  -3.424  1.00 0.00 ? 136 PHE A CB   1  
ATOM 1289  C CG   . PHE A 1 85  ? -0.589  -6.329  -3.580  1.00 0.00 ? 136 PHE A CG   1  
ATOM 1290  C CD1  . PHE A 1 85  ? -0.482  -4.962  -3.883  1.00 0.00 ? 136 PHE A CD1  1  
ATOM 1291  C CD2  . PHE A 1 85  ? 0.581   -7.083  -3.371  1.00 0.00 ? 136 PHE A CD2  1  
ATOM 1292  C CE1  . PHE A 1 85  ? 0.776   -4.365  -3.985  1.00 0.00 ? 136 PHE A CE1  1  
ATOM 1293  C CE2  . PHE A 1 85  ? 1.835   -6.483  -3.475  1.00 0.00 ? 136 PHE A CE2  1  
ATOM 1294  C CZ   . PHE A 1 85  ? 1.940   -5.121  -3.783  1.00 0.00 ? 136 PHE A CZ   1  
ATOM 1295  H H    . PHE A 1 85  ? -4.279  -8.212  -3.903  1.00 0.00 ? 136 PHE A H    1  
ATOM 1296  H HA   . PHE A 1 85  ? -2.889  -5.772  -4.942  1.00 0.00 ? 136 PHE A HA   1  
ATOM 1297  H HB2  . PHE A 1 85  ? -2.447  -6.568  -2.568  1.00 0.00 ? 136 PHE A HB2  1  
ATOM 1298  H HB3  . PHE A 1 85  ? -1.806  -8.047  -3.258  1.00 0.00 ? 136 PHE A HB3  1  
ATOM 1299  H HD1  . PHE A 1 85  ? -1.366  -4.371  -4.039  1.00 0.00 ? 136 PHE A HD1  1  
ATOM 1300  H HD2  . PHE A 1 85  ? 0.509   -8.134  -3.132  1.00 0.00 ? 136 PHE A HD2  1  
ATOM 1301  H HE1  . PHE A 1 85  ? 0.854   -3.317  -4.222  1.00 0.00 ? 136 PHE A HE1  1  
ATOM 1302  H HE2  . PHE A 1 85  ? 2.724   -7.070  -3.310  1.00 0.00 ? 136 PHE A HE2  1  
ATOM 1303  H HZ   . PHE A 1 85  ? 2.910   -4.655  -3.865  1.00 0.00 ? 136 PHE A HZ   1  
ATOM 1304  N N    . VAL A 1 86  ? -2.500  -7.207  -7.063  1.00 0.00 ? 137 VAL A N    1  
ATOM 1305  C CA   . VAL A 1 86  ? -1.946  -8.000  -8.217  1.00 0.00 ? 137 VAL A CA   1  
ATOM 1306  C C    . VAL A 1 86  ? -1.204  -7.081  -9.196  1.00 0.00 ? 137 VAL A C    1  
ATOM 1307  O O    . VAL A 1 86  ? -1.630  -6.816  -10.307 1.00 0.00 ? 137 VAL A O    1  
ATOM 1308  C CB   . VAL A 1 86  ? -3.076  -8.756  -8.930  1.00 0.00 ? 137 VAL A CB   1  
ATOM 1309  C CG1  . VAL A 1 86  ? -4.220  -7.794  -9.252  1.00 0.00 ? 137 VAL A CG1  1  
ATOM 1310  C CG2  . VAL A 1 86  ? -2.544  -9.412  -10.226 1.00 0.00 ? 137 VAL A CG2  1  
ATOM 1311  H H    . VAL A 1 86  ? -3.008  -6.373  -7.224  1.00 0.00 ? 137 VAL A H    1  
ATOM 1312  H HA   . VAL A 1 86  ? -1.233  -8.724  -7.850  1.00 0.00 ? 137 VAL A HA   1  
ATOM 1313  H HB   . VAL A 1 86  ? -3.444  -9.528  -8.264  1.00 0.00 ? 137 VAL A HB   1  
ATOM 1314  H HG11 . VAL A 1 86  ? -3.843  -6.958  -9.812  1.00 0.00 ? 137 VAL A HG11 1  
ATOM 1315  H HG12 . VAL A 1 86  ? -4.968  -8.310  -9.836  1.00 0.00 ? 137 VAL A HG12 1  
ATOM 1316  H HG13 . VAL A 1 86  ? -4.663  -7.444  -8.332  1.00 0.00 ? 137 VAL A HG13 1  
ATOM 1317  H HG21 . VAL A 1 86  ? -1.486  -9.620  -10.126 1.00 0.00 ? 137 VAL A HG21 1  
ATOM 1318  H HG22 . VAL A 1 86  ? -3.072  -10.340 -10.401 1.00 0.00 ? 137 VAL A HG22 1  
ATOM 1319  H HG23 . VAL A 1 86  ? -2.702  -8.755  -11.065 1.00 0.00 ? 137 VAL A HG23 1  
ATOM 1320  N N    . GLY A 1 87  ? -0.051  -6.643  -8.787  1.00 0.00 ? 138 GLY A N    1  
ATOM 1321  C CA   . GLY A 1 87  ? 0.814   -5.799  -9.656  1.00 0.00 ? 138 GLY A CA   1  
ATOM 1322  C C    . GLY A 1 87  ? 1.928   -6.706  -10.175 1.00 0.00 ? 138 GLY A C    1  
ATOM 1323  O O    . GLY A 1 87  ? 2.166   -7.760  -9.616  1.00 0.00 ? 138 GLY A O    1  
ATOM 1324  H H    . GLY A 1 87  ? 0.272   -6.911  -7.904  1.00 0.00 ? 138 GLY A H    1  
ATOM 1325  H HA2  . GLY A 1 87  ? 0.239   -5.390  -10.482 1.00 0.00 ? 138 GLY A HA2  1  
ATOM 1326  H HA3  . GLY A 1 87  ? 1.246   -5.003  -9.075  1.00 0.00 ? 138 GLY A HA3  1  
ATOM 1327  N N    . ARG A 1 88  ? 2.624   -6.342  -11.210 1.00 0.00 ? 139 ARG A N    1  
ATOM 1328  C CA   . ARG A 1 88  ? 3.711   -7.243  -11.683 1.00 0.00 ? 139 ARG A CA   1  
ATOM 1329  C C    . ARG A 1 88  ? 4.827   -7.306  -10.629 1.00 0.00 ? 139 ARG A C    1  
ATOM 1330  O O    . ARG A 1 88  ? 5.036   -6.373  -9.874  1.00 0.00 ? 139 ARG A O    1  
ATOM 1331  C CB   . ARG A 1 88  ? 4.269   -6.761  -13.018 1.00 0.00 ? 139 ARG A CB   1  
ATOM 1332  C CG   . ARG A 1 88  ? 3.199   -6.937  -14.098 1.00 0.00 ? 139 ARG A CG   1  
ATOM 1333  C CD   . ARG A 1 88  ? 3.778   -6.534  -15.454 1.00 0.00 ? 139 ARG A CD   1  
ATOM 1334  N NE   . ARG A 1 88  ? 2.880   -7.007  -16.564 1.00 0.00 ? 139 ARG A NE   1  
ATOM 1335  C CZ   . ARG A 1 88  ? 2.632   -8.274  -16.747 1.00 0.00 ? 139 ARG A CZ   1  
ATOM 1336  N NH1  . ARG A 1 88  ? 3.278   -9.183  -16.064 1.00 0.00 ? 139 ARG A NH1  1  
ATOM 1337  N NH2  . ARG A 1 88  ? 1.768   -8.642  -17.658 1.00 0.00 ? 139 ARG A NH2  1  
ATOM 1338  H H    . ARG A 1 88  ? 2.443   -5.491  -11.663 1.00 0.00 ? 139 ARG A H    1  
ATOM 1339  H HA   . ARG A 1 88  ? 3.305   -8.238  -11.808 1.00 0.00 ? 139 ARG A HA   1  
ATOM 1340  H HB2  . ARG A 1 88  ? 4.541   -5.719  -12.943 1.00 0.00 ? 139 ARG A HB2  1  
ATOM 1341  H HB3  . ARG A 1 88  ? 5.136   -7.344  -13.276 1.00 0.00 ? 139 ARG A HB3  1  
ATOM 1342  H HG2  . ARG A 1 88  ? 2.875   -7.965  -14.120 1.00 0.00 ? 139 ARG A HG2  1  
ATOM 1343  H HG3  . ARG A 1 88  ? 2.356   -6.301  -13.867 1.00 0.00 ? 139 ARG A HG3  1  
ATOM 1344  H HD2  . ARG A 1 88  ? 3.809   -5.471  -15.511 1.00 0.00 ? 139 ARG A HD2  1  
ATOM 1345  H HD3  . ARG A 1 88  ? 4.794   -6.923  -15.550 1.00 0.00 ? 139 ARG A HD3  1  
ATOM 1346  H HE   . ARG A 1 88  ? 2.446   -6.343  -17.140 1.00 0.00 ? 139 ARG A HE   1  
ATOM 1347  H HH11 . ARG A 1 88  ? 3.970   -8.904  -15.395 1.00 0.00 ? 139 ARG A HH11 1  
ATOM 1348  H HH12 . ARG A 1 88  ? 3.086   -10.155 -16.208 1.00 0.00 ? 139 ARG A HH12 1  
ATOM 1349  H HH21 . ARG A 1 88  ? 1.307   -7.948  -18.216 1.00 0.00 ? 139 ARG A HH21 1  
ATOM 1350  H HH22 . ARG A 1 88  ? 1.562   -9.610  -17.797 1.00 0.00 ? 139 ARG A HH22 1  
ATOM 1351  N N    . SER A 1 89  ? 5.518   -8.426  -10.558 1.00 0.00 ? 140 SER A N    1  
ATOM 1352  C CA   . SER A 1 89  ? 6.605   -8.614  -9.541  1.00 0.00 ? 140 SER A CA   1  
ATOM 1353  C C    . SER A 1 89  ? 7.996   -8.639  -10.205 1.00 0.00 ? 140 SER A C    1  
ATOM 1354  O O    . SER A 1 89  ? 8.958   -9.087  -9.612  1.00 0.00 ? 140 SER A O    1  
ATOM 1355  C CB   . SER A 1 89  ? 6.374   -9.950  -8.830  1.00 0.00 ? 140 SER A CB   1  
ATOM 1356  O OG   . SER A 1 89  ? 5.106   -9.919  -8.178  1.00 0.00 ? 140 SER A OG   1  
ATOM 1357  H H    . SER A 1 89  ? 5.301   -9.158  -11.166 1.00 0.00 ? 140 SER A H    1  
ATOM 1358  H HA   . SER A 1 89  ? 6.568   -7.816  -8.813  1.00 0.00 ? 140 SER A HA   1  
ATOM 1359  H HB2  . SER A 1 89  ? 6.379   -10.749 -9.555  1.00 0.00 ? 140 SER A HB2  1  
ATOM 1360  H HB3  . SER A 1 89  ? 7.158   -10.118 -8.104  1.00 0.00 ? 140 SER A HB3  1  
ATOM 1361  H HG   . SER A 1 89  ? 5.140   -10.519 -7.430  1.00 0.00 ? 140 SER A HG   1  
ATOM 1362  N N    . GLY A 1 90  ? 8.121   -8.178  -11.418 1.00 0.00 ? 141 GLY A N    1  
ATOM 1363  C CA   . GLY A 1 90  ? 9.470   -8.206  -12.075 1.00 0.00 ? 141 GLY A CA   1  
ATOM 1364  C C    . GLY A 1 90  ? 10.491  -7.529  -11.156 1.00 0.00 ? 141 GLY A C    1  
ATOM 1365  O O    . GLY A 1 90  ? 10.483  -6.329  -10.991 1.00 0.00 ? 141 GLY A O    1  
ATOM 1366  H H    . GLY A 1 90  ? 7.346   -7.821  -11.897 1.00 0.00 ? 141 GLY A H    1  
ATOM 1367  H HA2  . GLY A 1 90  ? 9.758   -9.232  -12.256 1.00 0.00 ? 141 GLY A HA2  1  
ATOM 1368  H HA3  . GLY A 1 90  ? 9.420   -7.672  -13.009 1.00 0.00 ? 141 GLY A HA3  1  
ATOM 1369  N N    . ARG A 1 91  ? 11.380  -8.283  -10.558 1.00 0.00 ? 142 ARG A N    1  
ATOM 1370  C CA   . ARG A 1 91  ? 12.378  -7.656  -9.639  1.00 0.00 ? 142 ARG A CA   1  
ATOM 1371  C C    . ARG A 1 91  ? 13.246  -6.646  -10.388 1.00 0.00 ? 142 ARG A C    1  
ATOM 1372  O O    . ARG A 1 91  ? 13.593  -5.612  -9.853  1.00 0.00 ? 142 ARG A O    1  
ATOM 1373  C CB   . ARG A 1 91  ? 13.281  -8.733  -9.037  1.00 0.00 ? 142 ARG A CB   1  
ATOM 1374  C CG   . ARG A 1 91  ? 12.440  -9.704  -8.208  1.00 0.00 ? 142 ARG A CG   1  
ATOM 1375  C CD   . ARG A 1 91  ? 13.369  -10.667 -7.463  1.00 0.00 ? 142 ARG A CD   1  
ATOM 1376  N NE   . ARG A 1 91  ? 14.225  -11.401 -8.452  1.00 0.00 ? 142 ARG A NE   1  
ATOM 1377  C CZ   . ARG A 1 91  ? 13.695  -12.152 -9.369  1.00 0.00 ? 142 ARG A CZ   1  
ATOM 1378  N NH1  . ARG A 1 91  ? 12.421  -12.419 -9.333  1.00 0.00 ? 142 ARG A NH1  1  
ATOM 1379  N NH2  . ARG A 1 91  ? 14.448  -12.688 -10.292 1.00 0.00 ? 142 ARG A NH2  1  
ATOM 1380  H H    . ARG A 1 91  ? 11.372  -9.257  -10.687 1.00 0.00 ? 142 ARG A H    1  
ATOM 1381  H HA   . ARG A 1 91  ? 11.857  -7.149  -8.845  1.00 0.00 ? 142 ARG A HA   1  
ATOM 1382  H HB2  . ARG A 1 91  ? 13.781  -9.268  -9.827  1.00 0.00 ? 142 ARG A HB2  1  
ATOM 1383  H HB3  . ARG A 1 91  ? 14.015  -8.263  -8.398  1.00 0.00 ? 142 ARG A HB3  1  
ATOM 1384  H HG2  . ARG A 1 91  ? 11.853  -9.145  -7.489  1.00 0.00 ? 142 ARG A HG2  1  
ATOM 1385  H HG3  . ARG A 1 91  ? 11.782  -10.252 -8.854  1.00 0.00 ? 142 ARG A HG3  1  
ATOM 1386  H HD2  . ARG A 1 91  ? 14.024  -10.112 -6.823  1.00 0.00 ? 142 ARG A HD2  1  
ATOM 1387  H HD3  . ARG A 1 91  ? 12.770  -11.347 -6.855  1.00 0.00 ? 142 ARG A HD3  1  
ATOM 1388  H HE   . ARG A 1 91  ? 15.197  -11.271 -8.433  1.00 0.00 ? 142 ARG A HE   1  
ATOM 1389  H HH11 . ARG A 1 91  ? 11.854  -12.043 -8.598  1.00 0.00 ? 142 ARG A HH11 1  
ATOM 1390  H HH12 . ARG A 1 91  ? 12.005  -12.986 -10.040 1.00 0.00 ? 142 ARG A HH12 1  
ATOM 1391  H HH21 . ARG A 1 91  ? 15.433  -12.519 -10.295 1.00 0.00 ? 142 ARG A HH21 1  
ATOM 1392  H HH22 . ARG A 1 91  ? 14.036  -13.269 -10.995 1.00 0.00 ? 142 ARG A HH22 1  
ATOM 1393  N N    . GLY A 1 92  ? 13.624  -6.926  -11.602 1.00 0.00 ? 143 GLY A N    1  
ATOM 1394  C CA   . GLY A 1 92  ? 14.487  -5.967  -12.344 1.00 0.00 ? 143 GLY A CA   1  
ATOM 1395  C C    . GLY A 1 92  ? 13.661  -4.761  -12.791 1.00 0.00 ? 143 GLY A C    1  
ATOM 1396  O O    . GLY A 1 92  ? 14.163  -3.852  -13.421 1.00 0.00 ? 143 GLY A O    1  
ATOM 1397  H H    . GLY A 1 92  ? 13.353  -7.772  -12.022 1.00 0.00 ? 143 GLY A H    1  
ATOM 1398  H HA2  . GLY A 1 92  ? 15.289  -5.634  -11.696 1.00 0.00 ? 143 GLY A HA2  1  
ATOM 1399  H HA3  . GLY A 1 92  ? 14.906  -6.455  -13.211 1.00 0.00 ? 143 GLY A HA3  1  
ATOM 1400  N N    . LYS A 1 93  ? 12.388  -4.752  -12.492 1.00 0.00 ? 144 LYS A N    1  
ATOM 1401  C CA   . LYS A 1 93  ? 11.516  -3.618  -12.909 1.00 0.00 ? 144 LYS A CA   1  
ATOM 1402  C C    . LYS A 1 93  ? 11.406  -2.617  -11.761 1.00 0.00 ? 144 LYS A C    1  
ATOM 1403  O O    . LYS A 1 93  ? 11.473  -2.981  -10.604 1.00 0.00 ? 144 LYS A O    1  
ATOM 1404  C CB   . LYS A 1 93  ? 10.119  -4.150  -13.257 1.00 0.00 ? 144 LYS A CB   1  
ATOM 1405  C CG   . LYS A 1 93  ? 10.219  -5.169  -14.400 1.00 0.00 ? 144 LYS A CG   1  
ATOM 1406  C CD   . LYS A 1 93  ? 8.812   -5.545  -14.887 1.00 0.00 ? 144 LYS A CD   1  
ATOM 1407  C CE   . LYS A 1 93  ? 8.905   -6.605  -15.992 1.00 0.00 ? 144 LYS A CE   1  
ATOM 1408  N NZ   . LYS A 1 93  ? 9.286   -7.911  -15.391 1.00 0.00 ? 144 LYS A NZ   1  
ATOM 1409  H H    . LYS A 1 93  ? 12.004  -5.493  -11.984 1.00 0.00 ? 144 LYS A H    1  
ATOM 1410  H HA   . LYS A 1 93  ? 11.943  -3.126  -13.774 1.00 0.00 ? 144 LYS A HA   1  
ATOM 1411  H HB2  . LYS A 1 93  ? 9.684   -4.625  -12.391 1.00 0.00 ? 144 LYS A HB2  1  
ATOM 1412  H HB3  . LYS A 1 93  ? 9.490   -3.330  -13.569 1.00 0.00 ? 144 LYS A HB3  1  
ATOM 1413  H HG2  . LYS A 1 93  ? 10.784  -4.737  -15.211 1.00 0.00 ? 144 LYS A HG2  1  
ATOM 1414  H HG3  . LYS A 1 93  ? 10.728  -6.053  -14.048 1.00 0.00 ? 144 LYS A HG3  1  
ATOM 1415  H HD2  . LYS A 1 93  ? 8.238   -5.941  -14.061 1.00 0.00 ? 144 LYS A HD2  1  
ATOM 1416  H HD3  . LYS A 1 93  ? 8.320   -4.668  -15.278 1.00 0.00 ? 144 LYS A HD3  1  
ATOM 1417  H HE2  . LYS A 1 93  ? 7.949   -6.701  -16.483 1.00 0.00 ? 144 LYS A HE2  1  
ATOM 1418  H HE3  . LYS A 1 93  ? 9.654   -6.309  -16.715 1.00 0.00 ? 144 LYS A HE3  1  
ATOM 1419  H HZ1  . LYS A 1 93  ? 8.611   -8.157  -14.642 1.00 0.00 ? 144 LYS A HZ1  1  
ATOM 1420  H HZ2  . LYS A 1 93  ? 9.274   -8.646  -16.127 1.00 0.00 ? 144 LYS A HZ2  1  
ATOM 1421  H HZ3  . LYS A 1 93  ? 10.241  -7.839  -14.985 1.00 0.00 ? 144 LYS A HZ3  1  
ATOM 1422  N N    . SER A 1 94  ? 11.213  -1.365  -12.057 1.00 0.00 ? 145 SER A N    1  
ATOM 1423  C CA   . SER A 1 94  ? 11.077  -0.371  -10.957 1.00 0.00 ? 145 SER A CA   1  
ATOM 1424  C C    . SER A 1 94  ? 9.616   -0.379  -10.517 1.00 0.00 ? 145 SER A C    1  
ATOM 1425  O O    . SER A 1 94  ? 8.719   -0.243  -11.324 1.00 0.00 ? 145 SER A O    1  
ATOM 1426  C CB   . SER A 1 94  ? 11.467  1.011   -11.470 1.00 0.00 ? 145 SER A CB   1  
ATOM 1427  O OG   . SER A 1 94  ? 12.808  0.971   -11.931 1.00 0.00 ? 145 SER A OG   1  
ATOM 1428  H H    . SER A 1 94  ? 11.147  -1.077  -12.993 1.00 0.00 ? 145 SER A H    1  
ATOM 1429  H HA   . SER A 1 94  ? 11.711  -0.655  -10.130 1.00 0.00 ? 145 SER A HA   1  
ATOM 1430  H HB2  . SER A 1 94  ? 10.818  1.293   -12.282 1.00 0.00 ? 145 SER A HB2  1  
ATOM 1431  H HB3  . SER A 1 94  ? 11.373  1.730   -10.666 1.00 0.00 ? 145 SER A HB3  1  
ATOM 1432  H HG   . SER A 1 94  ? 12.807  1.211   -12.859 1.00 0.00 ? 145 SER A HG   1  
ATOM 1433  N N    . PHE A 1 95  ? 9.354   -0.571  -9.254  1.00 0.00 ? 146 PHE A N    1  
ATOM 1434  C CA   . PHE A 1 95  ? 7.948   -0.629  -8.786  1.00 0.00 ? 146 PHE A CA   1  
ATOM 1435  C C    . PHE A 1 95  ? 7.483   0.774   -8.415  1.00 0.00 ? 146 PHE A C    1  
ATOM 1436  O O    . PHE A 1 95  ? 8.131   1.471   -7.656  1.00 0.00 ? 146 PHE A O    1  
ATOM 1437  C CB   . PHE A 1 95  ? 7.918   -1.561  -7.576  1.00 0.00 ? 146 PHE A CB   1  
ATOM 1438  C CG   . PHE A 1 95  ? 6.516   -2.043  -7.304  1.00 0.00 ? 146 PHE A CG   1  
ATOM 1439  C CD1  . PHE A 1 95  ? 5.845   -2.805  -8.265  1.00 0.00 ? 146 PHE A CD1  1  
ATOM 1440  C CD2  . PHE A 1 95  ? 5.896   -1.742  -6.085  1.00 0.00 ? 146 PHE A CD2  1  
ATOM 1441  C CE1  . PHE A 1 95  ? 4.556   -3.270  -8.014  1.00 0.00 ? 146 PHE A CE1  1  
ATOM 1442  C CE2  . PHE A 1 95  ? 4.602   -2.201  -5.833  1.00 0.00 ? 146 PHE A CE2  1  
ATOM 1443  C CZ   . PHE A 1 95  ? 3.931   -2.967  -6.797  1.00 0.00 ? 146 PHE A CZ   1  
ATOM 1444  H H    . PHE A 1 95  ? 10.087  -0.703  -8.610  1.00 0.00 ? 146 PHE A H    1  
ATOM 1445  H HA   . PHE A 1 95  ? 7.310   -1.019  -9.569  1.00 0.00 ? 146 PHE A HA   1  
ATOM 1446  H HB2  . PHE A 1 95  ? 8.549   -2.413  -7.779  1.00 0.00 ? 146 PHE A HB2  1  
ATOM 1447  H HB3  . PHE A 1 95  ? 8.297   -1.039  -6.715  1.00 0.00 ? 146 PHE A HB3  1  
ATOM 1448  H HD1  . PHE A 1 95  ? 6.321   -3.041  -9.200  1.00 0.00 ? 146 PHE A HD1  1  
ATOM 1449  H HD2  . PHE A 1 95  ? 6.414   -1.158  -5.343  1.00 0.00 ? 146 PHE A HD2  1  
ATOM 1450  H HE1  . PHE A 1 95  ? 4.038   -3.853  -8.764  1.00 0.00 ? 146 PHE A HE1  1  
ATOM 1451  H HE2  . PHE A 1 95  ? 4.125   -1.958  -4.898  1.00 0.00 ? 146 PHE A HE2  1  
ATOM 1452  H HZ   . PHE A 1 95  ? 2.934   -3.332  -6.597  1.00 0.00 ? 146 PHE A HZ   1  
ATOM 1453  N N    . THR A 1 96  ? 6.379   1.202   -8.977  1.00 0.00 ? 147 THR A N    1  
ATOM 1454  C CA   . THR A 1 96  ? 5.869   2.579   -8.709  1.00 0.00 ? 147 THR A CA   1  
ATOM 1455  C C    . THR A 1 96  ? 4.482   2.561   -8.062  1.00 0.00 ? 147 THR A C    1  
ATOM 1456  O O    . THR A 1 96  ? 3.545   1.947   -8.556  1.00 0.00 ? 147 THR A O    1  
ATOM 1457  C CB   . THR A 1 96  ? 5.784   3.318   -10.044 1.00 0.00 ? 147 THR A CB   1  
ATOM 1458  O OG1  . THR A 1 96  ? 7.082   3.377   -10.624 1.00 0.00 ? 147 THR A OG1  1  
ATOM 1459  C CG2  . THR A 1 96  ? 5.250   4.731   -9.825  1.00 0.00 ? 147 THR A CG2  1  
ATOM 1460  H H    . THR A 1 96  ? 5.900   0.622   -9.608  1.00 0.00 ? 147 THR A H    1  
ATOM 1461  H HA   . THR A 1 96  ? 6.550   3.113   -8.065  1.00 0.00 ? 147 THR A HA   1  
ATOM 1462  H HB   . THR A 1 96  ? 5.118   2.781   -10.707 1.00 0.00 ? 147 THR A HB   1  
ATOM 1463  H HG1  . THR A 1 96  ? 7.023   3.044   -11.522 1.00 0.00 ? 147 THR A HG1  1  
ATOM 1464  H HG21 . THR A 1 96  ? 5.654   5.137   -8.907  1.00 0.00 ? 147 THR A HG21 1  
ATOM 1465  H HG22 . THR A 1 96  ? 5.547   5.357   -10.652 1.00 0.00 ? 147 THR A HG22 1  
ATOM 1466  H HG23 . THR A 1 96  ? 4.171   4.704   -9.763  1.00 0.00 ? 147 THR A HG23 1  
ATOM 1467  N N    . LEU A 1 97  ? 4.355   3.282   -6.972  1.00 0.00 ? 148 LEU A N    1  
ATOM 1468  C CA   . LEU A 1 97  ? 3.054   3.394   -6.240  1.00 0.00 ? 148 LEU A CA   1  
ATOM 1469  C C    . LEU A 1 97  ? 2.630   4.867   -6.244  1.00 0.00 ? 148 LEU A C    1  
ATOM 1470  O O    . LEU A 1 97  ? 3.424   5.746   -5.969  1.00 0.00 ? 148 LEU A O    1  
ATOM 1471  C CB   . LEU A 1 97  ? 3.261   2.929   -4.785  1.00 0.00 ? 148 LEU A CB   1  
ATOM 1472  C CG   . LEU A 1 97  ? 3.241   1.372   -4.675  1.00 0.00 ? 148 LEU A CG   1  
ATOM 1473  C CD1  . LEU A 1 97  ? 4.394   0.882   -3.782  1.00 0.00 ? 148 LEU A CD1  1  
ATOM 1474  C CD2  . LEU A 1 97  ? 1.915   0.918   -4.039  1.00 0.00 ? 148 LEU A CD2  1  
ATOM 1475  H H    . LEU A 1 97  ? 5.131   3.779   -6.637  1.00 0.00 ? 148 LEU A H    1  
ATOM 1476  H HA   . LEU A 1 97  ? 2.301   2.798   -6.718  1.00 0.00 ? 148 LEU A HA   1  
ATOM 1477  H HB2  . LEU A 1 97  ? 4.213   3.302   -4.439  1.00 0.00 ? 148 LEU A HB2  1  
ATOM 1478  H HB3  . LEU A 1 97  ? 2.479   3.349   -4.165  1.00 0.00 ? 148 LEU A HB3  1  
ATOM 1479  H HG   . LEU A 1 97  ? 3.340   0.930   -5.656  1.00 0.00 ? 148 LEU A HG   1  
ATOM 1480  H HD11 . LEU A 1 97  ? 4.491   1.534   -2.927  1.00 0.00 ? 148 LEU A HD11 1  
ATOM 1481  H HD12 . LEU A 1 97  ? 4.194   -0.124  -3.443  1.00 0.00 ? 148 LEU A HD12 1  
ATOM 1482  H HD13 . LEU A 1 97  ? 5.313   0.889   -4.349  1.00 0.00 ? 148 LEU A HD13 1  
ATOM 1483  H HD21 . LEU A 1 97  ? 1.091   1.255   -4.645  1.00 0.00 ? 148 LEU A HD21 1  
ATOM 1484  H HD22 . LEU A 1 97  ? 1.897   -0.158  -3.971  1.00 0.00 ? 148 LEU A HD22 1  
ATOM 1485  H HD23 . LEU A 1 97  ? 1.830   1.344   -3.051  1.00 0.00 ? 148 LEU A HD23 1  
ATOM 1486  N N    . THR A 1 98  ? 1.381   5.155   -6.551  1.00 0.00 ? 149 THR A N    1  
ATOM 1487  C CA   . THR A 1 98  ? 0.912   6.580   -6.562  1.00 0.00 ? 149 THR A CA   1  
ATOM 1488  C C    . THR A 1 98  ? -0.468  6.693   -5.898  1.00 0.00 ? 149 THR A C    1  
ATOM 1489  O O    . THR A 1 98  ? -1.397  5.988   -6.237  1.00 0.00 ? 149 THR A O    1  
ATOM 1490  C CB   . THR A 1 98  ? 0.836   7.085   -8.011  1.00 0.00 ? 149 THR A CB   1  
ATOM 1491  O OG1  . THR A 1 98  ? -0.138  6.340   -8.732  1.00 0.00 ? 149 THR A OG1  1  
ATOM 1492  C CG2  . THR A 1 98  ? 2.209   6.908   -8.665  1.00 0.00 ? 149 THR A CG2  1  
ATOM 1493  H H    . THR A 1 98  ? 0.756   4.431   -6.768  1.00 0.00 ? 149 THR A H    1  
ATOM 1494  H HA   . THR A 1 98  ? 1.603   7.197   -6.017  1.00 0.00 ? 149 THR A HA   1  
ATOM 1495  H HB   . THR A 1 98  ? 0.573   8.130   -8.017  1.00 0.00 ? 149 THR A HB   1  
ATOM 1496  H HG1  . THR A 1 98  ? -0.938  6.871   -8.782  1.00 0.00 ? 149 THR A HG1  1  
ATOM 1497  H HG21 . THR A 1 98  ? 2.493   5.868   -8.634  1.00 0.00 ? 149 THR A HG21 1  
ATOM 1498  H HG22 . THR A 1 98  ? 2.169   7.241   -9.690  1.00 0.00 ? 149 THR A HG22 1  
ATOM 1499  H HG23 . THR A 1 98  ? 2.941   7.491   -8.126  1.00 0.00 ? 149 THR A HG23 1  
ATOM 1500  N N    . ILE A 1 99  ? -0.585  7.587   -4.944  1.00 0.00 ? 150 ILE A N    1  
ATOM 1501  C CA   . ILE A 1 99  ? -1.881  7.796   -4.221  1.00 0.00 ? 150 ILE A CA   1  
ATOM 1502  C C    . ILE A 1 99  ? -2.332  9.245   -4.433  1.00 0.00 ? 150 ILE A C    1  
ATOM 1503  O O    . ILE A 1 99  ? -1.564  10.159  -4.228  1.00 0.00 ? 150 ILE A O    1  
ATOM 1504  C CB   . ILE A 1 99  ? -1.679  7.570   -2.724  1.00 0.00 ? 150 ILE A CB   1  
ATOM 1505  C CG1  . ILE A 1 99  ? -1.161  6.144   -2.480  1.00 0.00 ? 150 ILE A CG1  1  
ATOM 1506  C CG2  . ILE A 1 99  ? -3.014  7.769   -1.995  1.00 0.00 ? 150 ILE A CG2  1  
ATOM 1507  C CD1  . ILE A 1 99  ? -0.809  5.958   -1.000  1.00 0.00 ? 150 ILE A CD1  1  
ATOM 1508  H H    . ILE A 1 99  ? 0.189   8.134   -4.705  1.00 0.00 ? 150 ILE A H    1  
ATOM 1509  H HA   . ILE A 1 99  ? -2.631  7.123   -4.593  1.00 0.00 ? 150 ILE A HA   1  
ATOM 1510  H HB   . ILE A 1 99  ? -0.966  8.287   -2.350  1.00 0.00 ? 150 ILE A HB   1  
ATOM 1511  H HG12 . ILE A 1 99  ? -1.927  5.437   -2.757  1.00 0.00 ? 150 ILE A HG12 1  
ATOM 1512  H HG13 . ILE A 1 99  ? -0.281  5.973   -3.082  1.00 0.00 ? 150 ILE A HG13 1  
ATOM 1513  H HG21 . ILE A 1 99  ? -3.775  7.169   -2.469  1.00 0.00 ? 150 ILE A HG21 1  
ATOM 1514  H HG22 . ILE A 1 99  ? -2.910  7.474   -0.963  1.00 0.00 ? 150 ILE A HG22 1  
ATOM 1515  H HG23 . ILE A 1 99  ? -3.294  8.811   -2.043  1.00 0.00 ? 150 ILE A HG23 1  
ATOM 1516  H HD11 . ILE A 1 99  ? -0.336  6.853   -0.621  1.00 0.00 ? 150 ILE A HD11 1  
ATOM 1517  H HD12 . ILE A 1 99  ? -1.713  5.766   -0.439  1.00 0.00 ? 150 ILE A HD12 1  
ATOM 1518  H HD13 . ILE A 1 99  ? -0.137  5.118   -0.894  1.00 0.00 ? 150 ILE A HD13 1  
ATOM 1519  N N    . THR A 1 100 ? -3.564  9.467   -4.821  1.00 0.00 ? 151 THR A N    1  
ATOM 1520  C CA   . THR A 1 100 ? -4.035  10.882  -5.023  1.00 0.00 ? 151 THR A CA   1  
ATOM 1521  C C    . THR A 1 100 ? -5.410  11.081  -4.389  1.00 0.00 ? 151 THR A C    1  
ATOM 1522  O O    . THR A 1 100 ? -6.278  10.236  -4.493  1.00 0.00 ? 151 THR A O    1  
ATOM 1523  C CB   . THR A 1 100 ? -4.157  11.183  -6.520  1.00 0.00 ? 151 THR A CB   1  
ATOM 1524  O OG1  . THR A 1 100 ? -5.054  10.259  -7.122  1.00 0.00 ? 151 THR A OG1  1  
ATOM 1525  C CG2  . THR A 1 100 ? -2.784  11.093  -7.184  1.00 0.00 ? 151 THR A CG2  1  
ATOM 1526  H H    . THR A 1 100 ? -4.177  8.717   -4.974  1.00 0.00 ? 151 THR A H    1  
ATOM 1527  H HA   . THR A 1 100 ? -3.340  11.577  -4.578  1.00 0.00 ? 151 THR A HA   1  
ATOM 1528  H HB   . THR A 1 100 ? -4.541  12.183  -6.644  1.00 0.00 ? 151 THR A HB   1  
ATOM 1529  H HG1  . THR A 1 100 ? -4.537  9.614   -7.609  1.00 0.00 ? 151 THR A HG1  1  
ATOM 1530  H HG21 . THR A 1 100 ? -2.290  10.186  -6.874  1.00 0.00 ? 151 THR A HG21 1  
ATOM 1531  H HG22 . THR A 1 100 ? -2.903  11.089  -8.258  1.00 0.00 ? 151 THR A HG22 1  
ATOM 1532  H HG23 . THR A 1 100 ? -2.189  11.945  -6.893  1.00 0.00 ? 151 THR A HG23 1  
ATOM 1533  N N    . VAL A 1 101 ? -5.623  12.212  -3.757  1.00 0.00 ? 152 VAL A N    1  
ATOM 1534  C CA   . VAL A 1 101 ? -6.960  12.506  -3.143  1.00 0.00 ? 152 VAL A CA   1  
ATOM 1535  C C    . VAL A 1 101 ? -7.439  13.857  -3.650  1.00 0.00 ? 152 VAL A C    1  
ATOM 1536  O O    . VAL A 1 101 ? -6.701  14.834  -3.623  1.00 0.00 ? 152 VAL A O    1  
ATOM 1537  C CB   . VAL A 1 101 ? -6.845  12.512  -1.619  1.00 0.00 ? 152 VAL A CB   1  
ATOM 1538  C CG1  . VAL A 1 101 ? -8.243  12.573  -0.994  1.00 0.00 ? 152 VAL A CG1  1  
ATOM 1539  C CG2  . VAL A 1 101 ? -6.120  11.231  -1.167  1.00 0.00 ? 152 VAL A CG2  1  
ATOM 1540  H H    . VAL A 1 101 ? -4.906  12.885  -3.709  1.00 0.00 ? 152 VAL A H    1  
ATOM 1541  H HA   . VAL A 1 101 ? -7.678  11.752  -3.443  1.00 0.00 ? 152 VAL A HA   1  
ATOM 1542  H HB   . VAL A 1 101 ? -6.280  13.384  -1.310  1.00 0.00 ? 152 VAL A HB   1  
ATOM 1543  H HG11 . VAL A 1 101 ? -8.777  13.423  -1.387  1.00 0.00 ? 152 VAL A HG11 1  
ATOM 1544  H HG12 . VAL A 1 101 ? -8.782  11.668  -1.227  1.00 0.00 ? 152 VAL A HG12 1  
ATOM 1545  H HG13 . VAL A 1 101 ? -8.153  12.668  0.079   1.00 0.00 ? 152 VAL A HG13 1  
ATOM 1546  H HG21 . VAL A 1 101 ? -6.371  10.413  -1.829  1.00 0.00 ? 152 VAL A HG21 1  
ATOM 1547  H HG22 . VAL A 1 101 ? -5.054  11.396  -1.190  1.00 0.00 ? 152 VAL A HG22 1  
ATOM 1548  H HG23 . VAL A 1 101 ? -6.419  10.975  -0.164  1.00 0.00 ? 152 VAL A HG23 1  
ATOM 1549  N N    . PHE A 1 102 ? -8.658  13.915  -4.132  1.00 0.00 ? 153 PHE A N    1  
ATOM 1550  C CA   . PHE A 1 102 ? -9.213  15.187  -4.692  1.00 0.00 ? 153 PHE A CA   1  
ATOM 1551  C C    . PHE A 1 102 ? -10.245 15.797  -3.733  1.00 0.00 ? 153 PHE A C    1  
ATOM 1552  O O    . PHE A 1 102 ? -11.406 15.935  -4.072  1.00 0.00 ? 153 PHE A O    1  
ATOM 1553  C CB   . PHE A 1 102 ? -9.875  14.886  -6.044  1.00 0.00 ? 153 PHE A CB   1  
ATOM 1554  C CG   . PHE A 1 102 ? -9.050  13.848  -6.778  1.00 0.00 ? 153 PHE A CG   1  
ATOM 1555  C CD1  . PHE A 1 102 ? -7.875  14.233  -7.433  1.00 0.00 ? 153 PHE A CD1  1  
ATOM 1556  C CD2  . PHE A 1 102 ? -9.442  12.501  -6.783  1.00 0.00 ? 153 PHE A CD2  1  
ATOM 1557  C CE1  . PHE A 1 102 ? -7.091  13.279  -8.089  1.00 0.00 ? 153 PHE A CE1  1  
ATOM 1558  C CE2  . PHE A 1 102 ? -8.656  11.542  -7.441  1.00 0.00 ? 153 PHE A CE2  1  
ATOM 1559  C CZ   . PHE A 1 102 ? -7.477  11.932  -8.093  1.00 0.00 ? 153 PHE A CZ   1  
ATOM 1560  H H    . PHE A 1 102 ? -9.206  13.102  -4.154  1.00 0.00 ? 153 PHE A H    1  
ATOM 1561  H HA   . PHE A 1 102 ? -8.411  15.896  -4.844  1.00 0.00 ? 153 PHE A HA   1  
ATOM 1562  H HB2  . PHE A 1 102 ? -10.878 14.507  -5.886  1.00 0.00 ? 153 PHE A HB2  1  
ATOM 1563  H HB3  . PHE A 1 102 ? -9.921  15.791  -6.633  1.00 0.00 ? 153 PHE A HB3  1  
ATOM 1564  H HD1  . PHE A 1 102 ? -7.574  15.271  -7.432  1.00 0.00 ? 153 PHE A HD1  1  
ATOM 1565  H HD2  . PHE A 1 102 ? -10.352 12.200  -6.283  1.00 0.00 ? 153 PHE A HD2  1  
ATOM 1566  H HE1  . PHE A 1 102 ? -6.184  13.580  -8.595  1.00 0.00 ? 153 PHE A HE1  1  
ATOM 1567  H HE2  . PHE A 1 102 ? -8.955  10.499  -7.444  1.00 0.00 ? 153 PHE A HE2  1  
ATOM 1568  H HZ   . PHE A 1 102 ? -6.868  11.195  -8.598  1.00 0.00 ? 153 PHE A HZ   1  
ATOM 1569  N N    . THR A 1 103 ? -9.836  16.183  -2.548  1.00 0.00 ? 154 THR A N    1  
ATOM 1570  C CA   . THR A 1 103 ? -10.802 16.808  -1.590  1.00 0.00 ? 154 THR A CA   1  
ATOM 1571  C C    . THR A 1 103 ? -10.700 18.331  -1.726  1.00 0.00 ? 154 THR A C    1  
ATOM 1572  O O    . THR A 1 103 ? -10.928 18.877  -2.790  1.00 0.00 ? 154 THR A O    1  
ATOM 1573  C CB   . THR A 1 103 ? -10.450 16.405  -0.156  1.00 0.00 ? 154 THR A CB   1  
ATOM 1574  O OG1  . THR A 1 103 ? -10.273 15.003  -0.101  1.00 0.00 ? 154 THR A OG1  1  
ATOM 1575  C CG2  . THR A 1 103 ? -11.579 16.817  0.801   1.00 0.00 ? 154 THR A CG2  1  
ATOM 1576  H H    . THR A 1 103 ? -8.892  16.071  -2.291  1.00 0.00 ? 154 THR A H    1  
ATOM 1577  H HA   . THR A 1 103 ? -11.812 16.488  -1.819  1.00 0.00 ? 154 THR A HA   1  
ATOM 1578  H HB   . THR A 1 103 ? -9.540  16.888  0.144   1.00 0.00 ? 154 THR A HB   1  
ATOM 1579  H HG1  . THR A 1 103 ? -10.045 14.699  -0.982  1.00 0.00 ? 154 THR A HG1  1  
ATOM 1580  H HG21 . THR A 1 103 ? -11.973 17.780  0.514   1.00 0.00 ? 154 THR A HG21 1  
ATOM 1581  H HG22 . THR A 1 103 ? -12.369 16.086  0.761   1.00 0.00 ? 154 THR A HG22 1  
ATOM 1582  H HG23 . THR A 1 103 ? -11.198 16.875  1.808   1.00 0.00 ? 154 THR A HG23 1  
ATOM 1583  N N    . ASN A 1 104 ? -10.353 19.027  -0.670  1.00 0.00 ? 155 ASN A N    1  
ATOM 1584  C CA   . ASN A 1 104 ? -10.233 20.513  -0.749  1.00 0.00 ? 155 ASN A CA   1  
ATOM 1585  C C    . ASN A 1 104 ? -8.779  20.871  -1.119  1.00 0.00 ? 155 ASN A C    1  
ATOM 1586  O O    . ASN A 1 104 ? -8.551  21.635  -2.037  1.00 0.00 ? 155 ASN A O    1  
ATOM 1587  C CB   . ASN A 1 104 ? -10.644 21.154  0.610   1.00 0.00 ? 155 ASN A CB   1  
ATOM 1588  C CG   . ASN A 1 104 ? -11.838 22.104  0.428   1.00 0.00 ? 155 ASN A CG   1  
ATOM 1589  O OD1  . ASN A 1 104 ? -11.945 22.769  -0.585  1.00 0.00 ? 155 ASN A OD1  1  
ATOM 1590  N ND2  . ASN A 1 104 ? -12.744 22.191  1.366   1.00 0.00 ? 155 ASN A ND2  1  
ATOM 1591  H H    . ASN A 1 104 ? -10.172 18.566  0.177   1.00 0.00 ? 155 ASN A H    1  
ATOM 1592  H HA   . ASN A 1 104 ? -10.883 20.878  -1.536  1.00 0.00 ? 155 ASN A HA   1  
ATOM 1593  H HB2  . ASN A 1 104 ? -10.925 20.376  1.300   1.00 0.00 ? 155 ASN A HB2  1  
ATOM 1594  H HB3  . ASN A 1 104 ? -9.812  21.712  1.025   1.00 0.00 ? 155 ASN A HB3  1  
ATOM 1595  H HD21 . ASN A 1 104 ? -12.665 21.651  2.180   1.00 0.00 ? 155 ASN A HD21 1  
ATOM 1596  H HD22 . ASN A 1 104 ? -13.505 22.804  1.258   1.00 0.00 ? 155 ASN A HD22 1  
ATOM 1597  N N    . PRO A 1 105 ? -7.794  20.319  -0.432  1.00 0.00 ? 156 PRO A N    1  
ATOM 1598  C CA   . PRO A 1 105 ? -6.363  20.570  -0.707  1.00 0.00 ? 156 PRO A CA   1  
ATOM 1599  C C    . PRO A 1 105 ? -5.673  19.325  -1.309  1.00 0.00 ? 156 PRO A C    1  
ATOM 1600  O O    . PRO A 1 105 ? -4.939  18.640  -0.628  1.00 0.00 ? 156 PRO A O    1  
ATOM 1601  C CB   . PRO A 1 105 ? -5.863  20.806  0.713   1.00 0.00 ? 156 PRO A CB   1  
ATOM 1602  C CG   . PRO A 1 105 ? -6.631  19.795  1.541   1.00 0.00 ? 156 PRO A CG   1  
ATOM 1603  C CD   . PRO A 1 105 ? -7.885  19.408  0.718   1.00 0.00 ? 156 PRO A CD   1  
ATOM 1604  H HA   . PRO A 1 105 ? -6.215  21.450  -1.307  1.00 0.00 ? 156 PRO A HA   1  
ATOM 1605  H HB2  . PRO A 1 105 ? -4.800  20.634  0.776   1.00 0.00 ? 156 PRO A HB2  1  
ATOM 1606  H HB3  . PRO A 1 105 ? -6.109  21.807  1.037   1.00 0.00 ? 156 PRO A HB3  1  
ATOM 1607  H HG2  . PRO A 1 105 ? -6.015  18.918  1.725   1.00 0.00 ? 156 PRO A HG2  1  
ATOM 1608  H HG3  . PRO A 1 105 ? -6.927  20.236  2.480   1.00 0.00 ? 156 PRO A HG3  1  
ATOM 1609  H HD2  . PRO A 1 105 ? -7.822  18.376  0.396   1.00 0.00 ? 156 PRO A HD2  1  
ATOM 1610  H HD3  . PRO A 1 105 ? -8.782  19.577  1.276   1.00 0.00 ? 156 PRO A HD3  1  
ATOM 1611  N N    . PRO A 1 106 ? -5.931  19.019  -2.559  1.00 0.00 ? 157 PRO A N    1  
ATOM 1612  C CA   . PRO A 1 106 ? -5.362  17.818  -3.239  1.00 0.00 ? 157 PRO A CA   1  
ATOM 1613  C C    . PRO A 1 106 ? -3.964  17.440  -2.756  1.00 0.00 ? 157 PRO A C    1  
ATOM 1614  O O    . PRO A 1 106 ? -2.990  18.114  -3.031  1.00 0.00 ? 157 PRO A O    1  
ATOM 1615  C CB   . PRO A 1 106 ? -5.360  18.217  -4.712  1.00 0.00 ? 157 PRO A CB   1  
ATOM 1616  C CG   . PRO A 1 106 ? -6.554  19.114  -4.855  1.00 0.00 ? 157 PRO A CG   1  
ATOM 1617  C CD   . PRO A 1 106 ? -6.780  19.784  -3.483  1.00 0.00 ? 157 PRO A CD   1  
ATOM 1618  H HA   . PRO A 1 106 ? -6.026  16.986  -3.104  1.00 0.00 ? 157 PRO A HA   1  
ATOM 1619  H HB2  . PRO A 1 106 ? -4.447  18.745  -4.958  1.00 0.00 ? 157 PRO A HB2  1  
ATOM 1620  H HB3  . PRO A 1 106 ? -5.471  17.342  -5.342  1.00 0.00 ? 157 PRO A HB3  1  
ATOM 1621  H HG2  . PRO A 1 106 ? -6.367  19.862  -5.616  1.00 0.00 ? 157 PRO A HG2  1  
ATOM 1622  H HG3  . PRO A 1 106 ? -7.423  18.526  -5.120  1.00 0.00 ? 157 PRO A HG3  1  
ATOM 1623  H HD2  . PRO A 1 106 ? -6.473  20.819  -3.516  1.00 0.00 ? 157 PRO A HD2  1  
ATOM 1624  H HD3  . PRO A 1 106 ? -7.814  19.704  -3.190  1.00 0.00 ? 157 PRO A HD3  1  
ATOM 1625  N N    . GLN A 1 107 ? -3.863  16.346  -2.042  1.00 0.00 ? 158 GLN A N    1  
ATOM 1626  C CA   . GLN A 1 107 ? -2.539  15.888  -1.529  1.00 0.00 ? 158 GLN A CA   1  
ATOM 1627  C C    . GLN A 1 107 ? -1.991  14.806  -2.457  1.00 0.00 ? 158 GLN A C    1  
ATOM 1628  O O    . GLN A 1 107 ? -2.706  13.910  -2.866  1.00 0.00 ? 158 GLN A O    1  
ATOM 1629  C CB   . GLN A 1 107 ? -2.708  15.308  -0.119  1.00 0.00 ? 158 GLN A CB   1  
ATOM 1630  C CG   . GLN A 1 107 ? -3.277  16.376  0.814   1.00 0.00 ? 158 GLN A CG   1  
ATOM 1631  C CD   . GLN A 1 107 ? -2.332  17.567  0.879   1.00 0.00 ? 158 GLN A CD   1  
ATOM 1632  O OE1  . GLN A 1 107 ? -1.137  17.429  0.709   1.00 0.00 ? 158 GLN A OE1  1  
ATOM 1633  N NE2  . GLN A 1 107 ? -2.826  18.741  1.141   1.00 0.00 ? 158 GLN A NE2  1  
ATOM 1634  H H    . GLN A 1 107 ? -4.677  15.818  -1.849  1.00 0.00 ? 158 GLN A H    1  
ATOM 1635  H HA   . GLN A 1 107 ? -1.838  16.714  -1.497  1.00 0.00 ? 158 GLN A HA   1  
ATOM 1636  H HB2  . GLN A 1 107 ? -3.390  14.471  -0.160  1.00 0.00 ? 158 GLN A HB2  1  
ATOM 1637  H HB3  . GLN A 1 107 ? -1.750  14.977  0.256   1.00 0.00 ? 158 GLN A HB3  1  
ATOM 1638  H HG2  . GLN A 1 107 ? -4.235  16.700  0.444   1.00 0.00 ? 158 GLN A HG2  1  
ATOM 1639  H HG3  . GLN A 1 107 ? -3.394  15.970  1.802   1.00 0.00 ? 158 GLN A HG3  1  
ATOM 1640  H HE21 . GLN A 1 107 ? -3.788  18.837  1.292   1.00 0.00 ? 158 GLN A HE21 1  
ATOM 1641  H HE22 . GLN A 1 107 ? -2.238  19.517  1.198   1.00 0.00 ? 158 GLN A HE22 1  
ATOM 1642  N N    . VAL A 1 108 ? -0.726  14.875  -2.791  1.00 0.00 ? 159 VAL A N    1  
ATOM 1643  C CA   . VAL A 1 108 ? -0.122  13.851  -3.694  1.00 0.00 ? 159 VAL A CA   1  
ATOM 1644  C C    . VAL A 1 108 ? 0.811   12.968  -2.877  1.00 0.00 ? 159 VAL A C    1  
ATOM 1645  O O    . VAL A 1 108 ? 1.656   13.452  -2.153  1.00 0.00 ? 159 VAL A O    1  
ATOM 1646  C CB   . VAL A 1 108 ? 0.690   14.569  -4.769  1.00 0.00 ? 159 VAL A CB   1  
ATOM 1647  C CG1  . VAL A 1 108 ? 1.128   13.566  -5.838  1.00 0.00 ? 159 VAL A CG1  1  
ATOM 1648  C CG2  . VAL A 1 108 ? -0.177  15.654  -5.409  1.00 0.00 ? 159 VAL A CG2  1  
ATOM 1649  H H    . VAL A 1 108 ? -0.176  15.608  -2.445  1.00 0.00 ? 159 VAL A H    1  
ATOM 1650  H HA   . VAL A 1 108 ? -0.888  13.247  -4.161  1.00 0.00 ? 159 VAL A HA   1  
ATOM 1651  H HB   . VAL A 1 108 ? 1.561   15.020  -4.319  1.00 0.00 ? 159 VAL A HB   1  
ATOM 1652  H HG11 . VAL A 1 108 ? 0.260   13.097  -6.274  1.00 0.00 ? 159 VAL A HG11 1  
ATOM 1653  H HG12 . VAL A 1 108 ? 1.684   14.080  -6.608  1.00 0.00 ? 159 VAL A HG12 1  
ATOM 1654  H HG13 . VAL A 1 108 ? 1.757   12.808  -5.389  1.00 0.00 ? 159 VAL A HG13 1  
ATOM 1655  H HG21 . VAL A 1 108 ? -1.123  15.228  -5.704  1.00 0.00 ? 159 VAL A HG21 1  
ATOM 1656  H HG22 . VAL A 1 108 ? -0.347  16.445  -4.693  1.00 0.00 ? 159 VAL A HG22 1  
ATOM 1657  H HG23 . VAL A 1 108 ? 0.327   16.051  -6.276  1.00 0.00 ? 159 VAL A HG23 1  
ATOM 1658  N N    . ALA A 1 109 ? 0.665   11.672  -2.980  1.00 0.00 ? 160 ALA A N    1  
ATOM 1659  C CA   . ALA A 1 109 ? 1.540   10.747  -2.195  1.00 0.00 ? 160 ALA A CA   1  
ATOM 1660  C C    . ALA A 1 109 ? 1.988   9.580   -3.083  1.00 0.00 ? 160 ALA A C    1  
ATOM 1661  O O    . ALA A 1 109 ? 1.173   8.803   -3.539  1.00 0.00 ? 160 ALA A O    1  
ATOM 1662  C CB   . ALA A 1 109 ? 0.736   10.204  -1.007  1.00 0.00 ? 160 ALA A CB   1  
ATOM 1663  H H    . ALA A 1 109 ? -0.033  11.306  -3.567  1.00 0.00 ? 160 ALA A H    1  
ATOM 1664  H HA   . ALA A 1 109 ? 2.412   11.274  -1.832  1.00 0.00 ? 160 ALA A HA   1  
ATOM 1665  H HB1  . ALA A 1 109 ? -0.316  10.334  -1.203  1.00 0.00 ? 160 ALA A HB1  1  
ATOM 1666  H HB2  . ALA A 1 109 ? 0.945   9.152   -0.858  1.00 0.00 ? 160 ALA A HB2  1  
ATOM 1667  H HB3  . ALA A 1 109 ? 1.005   10.744  -0.115  1.00 0.00 ? 160 ALA A HB3  1  
ATOM 1668  N N    . THR A 1 110 ? 3.271   9.439   -3.304  1.00 0.00 ? 161 THR A N    1  
ATOM 1669  C CA   . THR A 1 110 ? 3.767   8.300   -4.144  1.00 0.00 ? 161 THR A CA   1  
ATOM 1670  C C    . THR A 1 110 ? 4.985   7.654   -3.500  1.00 0.00 ? 161 THR A C    1  
ATOM 1671  O O    . THR A 1 110 ? 5.698   8.252   -2.722  1.00 0.00 ? 161 THR A O    1  
ATOM 1672  C CB   . THR A 1 110 ? 4.164   8.824   -5.518  1.00 0.00 ? 161 THR A CB   1  
ATOM 1673  O OG1  . THR A 1 110 ? 5.452   9.429   -5.442  1.00 0.00 ? 161 THR A OG1  1  
ATOM 1674  C CG2  . THR A 1 110 ? 3.136   9.853   -5.982  1.00 0.00 ? 161 THR A CG2  1  
ATOM 1675  H H    . THR A 1 110 ? 3.907   10.067  -2.911  1.00 0.00 ? 161 THR A H    1  
ATOM 1676  H HA   . THR A 1 110 ? 2.995   7.558   -4.251  1.00 0.00 ? 161 THR A HA   1  
ATOM 1677  H HB   . THR A 1 110 ? 4.193   8.005   -6.219  1.00 0.00 ? 161 THR A HB   1  
ATOM 1678  H HG1  . THR A 1 110 ? 5.520   9.882   -4.600  1.00 0.00 ? 161 THR A HG1  1  
ATOM 1679  H HG21 . THR A 1 110 ? 2.142   9.442   -5.874  1.00 0.00 ? 161 THR A HG21 1  
ATOM 1680  H HG22 . THR A 1 110 ? 3.220   10.746  -5.377  1.00 0.00 ? 161 THR A HG22 1  
ATOM 1681  H HG23 . THR A 1 110 ? 3.309   10.101  -7.017  1.00 0.00 ? 161 THR A HG23 1  
ATOM 1682  N N    . TYR A 1 111 ? 5.226   6.416   -3.844  1.00 0.00 ? 162 TYR A N    1  
ATOM 1683  C CA   . TYR A 1 111 ? 6.393   5.675   -3.294  1.00 0.00 ? 162 TYR A CA   1  
ATOM 1684  C C    . TYR A 1 111 ? 7.002   4.836   -4.433  1.00 0.00 ? 162 TYR A C    1  
ATOM 1685  O O    . TYR A 1 111 ? 6.306   4.096   -5.097  1.00 0.00 ? 162 TYR A O    1  
ATOM 1686  C CB   . TYR A 1 111 ? 5.887   4.786   -2.147  1.00 0.00 ? 162 TYR A CB   1  
ATOM 1687  C CG   . TYR A 1 111 ? 6.964   3.841   -1.659  1.00 0.00 ? 162 TYR A CG   1  
ATOM 1688  C CD1  . TYR A 1 111 ? 7.205   2.637   -2.337  1.00 0.00 ? 162 TYR A CD1  1  
ATOM 1689  C CD2  . TYR A 1 111 ? 7.714   4.164   -0.520  1.00 0.00 ? 162 TYR A CD2  1  
ATOM 1690  C CE1  . TYR A 1 111 ? 8.196   1.760   -1.872  1.00 0.00 ? 162 TYR A CE1  1  
ATOM 1691  C CE2  . TYR A 1 111 ? 8.702   3.282   -0.056  1.00 0.00 ? 162 TYR A CE2  1  
ATOM 1692  C CZ   . TYR A 1 111 ? 8.941   2.083   -0.733  1.00 0.00 ? 162 TYR A CZ   1  
ATOM 1693  O OH   . TYR A 1 111 ? 9.918   1.211   -0.278  1.00 0.00 ? 162 TYR A OH   1  
ATOM 1694  H H    . TYR A 1 111 ? 4.626   5.973   -4.479  1.00 0.00 ? 162 TYR A H    1  
ATOM 1695  H HA   . TYR A 1 111 ? 7.132   6.366   -2.921  1.00 0.00 ? 162 TYR A HA   1  
ATOM 1696  H HB2  . TYR A 1 111 ? 5.579   5.422   -1.328  1.00 0.00 ? 162 TYR A HB2  1  
ATOM 1697  H HB3  . TYR A 1 111 ? 5.036   4.218   -2.484  1.00 0.00 ? 162 TYR A HB3  1  
ATOM 1698  H HD1  . TYR A 1 111 ? 6.631   2.385   -3.212  1.00 0.00 ? 162 TYR A HD1  1  
ATOM 1699  H HD2  . TYR A 1 111 ? 7.526   5.089   0.003   1.00 0.00 ? 162 TYR A HD2  1  
ATOM 1700  H HE1  . TYR A 1 111 ? 8.379   0.833   -2.397  1.00 0.00 ? 162 TYR A HE1  1  
ATOM 1701  H HE2  . TYR A 1 111 ? 9.277   3.533   0.826   1.00 0.00 ? 162 TYR A HE2  1  
ATOM 1702  H HH   . TYR A 1 111 ? 10.069  1.391   0.653   1.00 0.00 ? 162 TYR A HH   1  
ATOM 1703  N N    . HIS A 1 112 ? 8.291   4.957   -4.683  1.00 0.00 ? 163 HIS A N    1  
ATOM 1704  C CA   . HIS A 1 112 ? 8.925   4.174   -5.798  1.00 0.00 ? 163 HIS A CA   1  
ATOM 1705  C C    . HIS A 1 112 ? 10.230  3.535   -5.319  1.00 0.00 ? 163 HIS A C    1  
ATOM 1706  O O    . HIS A 1 112 ? 11.176  4.207   -4.954  1.00 0.00 ? 163 HIS A O    1  
ATOM 1707  C CB   . HIS A 1 112 ? 9.205   5.095   -6.991  1.00 0.00 ? 163 HIS A CB   1  
ATOM 1708  C CG   . HIS A 1 112 ? 10.285  6.079   -6.640  1.00 0.00 ? 163 HIS A CG   1  
ATOM 1709  N ND1  . HIS A 1 112 ? 10.021  7.244   -5.935  1.00 0.00 ? 163 HIS A ND1  1  
ATOM 1710  C CD2  . HIS A 1 112 ? 11.638  6.094   -6.886  1.00 0.00 ? 163 HIS A CD2  1  
ATOM 1711  C CE1  . HIS A 1 112 ? 11.183  7.903   -5.788  1.00 0.00 ? 163 HIS A CE1  1  
ATOM 1712  N NE2  . HIS A 1 112 ? 12.202  7.245   -6.347  1.00 0.00 ? 163 HIS A NE2  1  
ATOM 1713  H H    . HIS A 1 112 ? 8.837   5.571   -4.148  1.00 0.00 ? 163 HIS A H    1  
ATOM 1714  H HA   . HIS A 1 112 ? 8.257   3.382   -6.116  1.00 0.00 ? 163 HIS A HA   1  
ATOM 1715  H HB2  . HIS A 1 112 ? 9.524   4.500   -7.838  1.00 0.00 ? 163 HIS A HB2  1  
ATOM 1716  H HB3  . HIS A 1 112 ? 8.303   5.630   -7.253  1.00 0.00 ? 163 HIS A HB3  1  
ATOM 1717  H HD1  . HIS A 1 112 ? 9.145   7.530   -5.604  1.00 0.00 ? 163 HIS A HD1  1  
ATOM 1718  H HD2  . HIS A 1 112 ? 12.180  5.330   -7.425  1.00 0.00 ? 163 HIS A HD2  1  
ATOM 1719  H HE1  . HIS A 1 112 ? 11.279  8.859   -5.292  1.00 0.00 ? 163 HIS A HE1  1  
ATOM 1720  N N    . ARG A 1 113 ? 10.273  2.239   -5.324  1.00 0.00 ? 164 ARG A N    1  
ATOM 1721  C CA   . ARG A 1 113 ? 11.492  1.513   -4.880  1.00 0.00 ? 164 ARG A CA   1  
ATOM 1722  C C    . ARG A 1 113 ? 11.366  0.061   -5.357  1.00 0.00 ? 164 ARG A C    1  
ATOM 1723  O O    . ARG A 1 113 ? 10.363  -0.321  -5.929  1.00 0.00 ? 164 ARG A O    1  
ATOM 1724  C CB   . ARG A 1 113 ? 11.586  1.581   -3.348  1.00 0.00 ? 164 ARG A CB   1  
ATOM 1725  C CG   . ARG A 1 113 ? 13.001  1.223   -2.868  1.00 0.00 ? 164 ARG A CG   1  
ATOM 1726  C CD   . ARG A 1 113 ? 13.059  1.302   -1.343  1.00 0.00 ? 164 ARG A CD   1  
ATOM 1727  N NE   . ARG A 1 113 ? 12.482  2.600   -0.846  1.00 0.00 ? 164 ARG A NE   1  
ATOM 1728  C CZ   . ARG A 1 113 ? 12.913  3.776   -1.251  1.00 0.00 ? 164 ARG A CZ   1  
ATOM 1729  N NH1  . ARG A 1 113 ? 13.959  3.888   -2.018  1.00 0.00 ? 164 ARG A NH1  1  
ATOM 1730  N NH2  . ARG A 1 113 ? 12.317  4.859   -0.826  1.00 0.00 ? 164 ARG A NH2  1  
ATOM 1731  H H    . ARG A 1 113 ? 9.493   1.731   -5.629  1.00 0.00 ? 164 ARG A H    1  
ATOM 1732  H HA   . ARG A 1 113 ? 12.369  1.969   -5.323  1.00 0.00 ? 164 ARG A HA   1  
ATOM 1733  H HB2  . ARG A 1 113 ? 11.348  2.585   -3.028  1.00 0.00 ? 164 ARG A HB2  1  
ATOM 1734  H HB3  . ARG A 1 113 ? 10.877  0.891   -2.918  1.00 0.00 ? 164 ARG A HB3  1  
ATOM 1735  H HG2  . ARG A 1 113 ? 13.238  0.216   -3.169  1.00 0.00 ? 164 ARG A HG2  1  
ATOM 1736  H HG3  . ARG A 1 113 ? 13.716  1.899   -3.297  1.00 0.00 ? 164 ARG A HG3  1  
ATOM 1737  H HD2  . ARG A 1 113 ? 12.460  0.505   -0.935  1.00 0.00 ? 164 ARG A HD2  1  
ATOM 1738  H HD3  . ARG A 1 113 ? 14.087  1.166   -1.016  1.00 0.00 ? 164 ARG A HD3  1  
ATOM 1739  H HE   . ARG A 1 113 ? 11.737  2.568   -0.210  1.00 0.00 ? 164 ARG A HE   1  
ATOM 1740  H HH11 . ARG A 1 113 ? 14.462  3.079   -2.309  1.00 0.00 ? 164 ARG A HH11 1  
ATOM 1741  H HH12 . ARG A 1 113 ? 14.259  4.796   -2.320  1.00 0.00 ? 164 ARG A HH12 1  
ATOM 1742  H HH21 . ARG A 1 113 ? 11.546  4.794   -0.194  1.00 0.00 ? 164 ARG A HH21 1  
ATOM 1743  H HH22 . ARG A 1 113 ? 12.632  5.757   -1.135  1.00 0.00 ? 164 ARG A HH22 1  
ATOM 1744  N N    . ALA A 1 114 ? 12.367  -0.750  -5.153  1.00 0.00 ? 165 ALA A N    1  
ATOM 1745  C CA   . ALA A 1 114 ? 12.281  -2.173  -5.596  1.00 0.00 ? 165 ALA A CA   1  
ATOM 1746  C C    . ALA A 1 114 ? 11.257  -2.910  -4.721  1.00 0.00 ? 165 ALA A C    1  
ATOM 1747  O O    . ALA A 1 114 ? 10.865  -2.423  -3.677  1.00 0.00 ? 165 ALA A O    1  
ATOM 1748  C CB   . ALA A 1 114 ? 13.651  -2.841  -5.459  1.00 0.00 ? 165 ALA A CB   1  
ATOM 1749  H H    . ALA A 1 114 ? 13.176  -0.427  -4.706  1.00 0.00 ? 165 ALA A H    1  
ATOM 1750  H HA   . ALA A 1 114 ? 11.961  -2.206  -6.631  1.00 0.00 ? 165 ALA A HA   1  
ATOM 1751  H HB1  . ALA A 1 114 ? 14.049  -2.650  -4.474  1.00 0.00 ? 165 ALA A HB1  1  
ATOM 1752  H HB2  . ALA A 1 114 ? 13.546  -3.908  -5.603  1.00 0.00 ? 165 ALA A HB2  1  
ATOM 1753  H HB3  . ALA A 1 114 ? 14.327  -2.442  -6.200  1.00 0.00 ? 165 ALA A HB3  1  
ATOM 1754  N N    . ILE A 1 115 ? 10.824  -4.078  -5.125  1.00 0.00 ? 166 ILE A N    1  
ATOM 1755  C CA   . ILE A 1 115 ? 9.825   -4.853  -4.313  1.00 0.00 ? 166 ILE A CA   1  
ATOM 1756  C C    . ILE A 1 115 ? 10.512  -6.062  -3.689  1.00 0.00 ? 166 ILE A C    1  
ATOM 1757  O O    . ILE A 1 115 ? 11.352  -6.698  -4.298  1.00 0.00 ? 166 ILE A O    1  
ATOM 1758  C CB   . ILE A 1 115 ? 8.695   -5.332  -5.227  1.00 0.00 ? 166 ILE A CB   1  
ATOM 1759  C CG1  . ILE A 1 115 ? 9.319   -5.830  -6.533  1.00 0.00 ? 166 ILE A CG1  1  
ATOM 1760  C CG2  . ILE A 1 115 ? 7.717   -4.185  -5.513  1.00 0.00 ? 166 ILE A CG2  1  
ATOM 1761  C CD1  . ILE A 1 115 ? 8.278   -6.598  -7.342  1.00 0.00 ? 166 ILE A CD1  1  
ATOM 1762  H H    . ILE A 1 115 ? 11.158  -4.455  -5.971  1.00 0.00 ? 166 ILE A H    1  
ATOM 1763  H HA   . ILE A 1 115 ? 9.417   -4.232  -3.528  1.00 0.00 ? 166 ILE A HA   1  
ATOM 1764  H HB   . ILE A 1 115 ? 8.163   -6.144  -4.748  1.00 0.00 ? 166 ILE A HB   1  
ATOM 1765  H HG12 . ILE A 1 115 ? 9.658   -4.974  -7.106  1.00 0.00 ? 166 ILE A HG12 1  
ATOM 1766  H HG13 . ILE A 1 115 ? 10.157  -6.474  -6.319  1.00 0.00 ? 166 ILE A HG13 1  
ATOM 1767  H HG21 . ILE A 1 115 ? 8.265   -3.260  -5.624  1.00 0.00 ? 166 ILE A HG21 1  
ATOM 1768  H HG22 . ILE A 1 115 ? 7.177   -4.391  -6.425  1.00 0.00 ? 166 ILE A HG22 1  
ATOM 1769  H HG23 . ILE A 1 115 ? 7.017   -4.086  -4.696  1.00 0.00 ? 166 ILE A HG23 1  
ATOM 1770  H HD11 . ILE A 1 115 ? 7.420   -5.963  -7.522  1.00 0.00 ? 166 ILE A HD11 1  
ATOM 1771  H HD12 . ILE A 1 115 ? 8.705   -6.900  -8.284  1.00 0.00 ? 166 ILE A HD12 1  
ATOM 1772  H HD13 . ILE A 1 115 ? 7.968   -7.472  -6.789  1.00 0.00 ? 166 ILE A HD13 1  
ATOM 1773  N N    . LYS A 1 116 ? 10.163  -6.375  -2.467  1.00 0.00 ? 167 LYS A N    1  
ATOM 1774  C CA   . LYS A 1 116 ? 10.794  -7.540  -1.764  1.00 0.00 ? 167 LYS A CA   1  
ATOM 1775  C C    . LYS A 1 116 ? 9.751   -8.642  -1.538  1.00 0.00 ? 167 LYS A C    1  
ATOM 1776  O O    . LYS A 1 116 ? 9.620   -9.167  -0.453  1.00 0.00 ? 167 LYS A O    1  
ATOM 1777  C CB   . LYS A 1 116 ? 11.361  -7.065  -0.411  1.00 0.00 ? 167 LYS A CB   1  
ATOM 1778  C CG   . LYS A 1 116 ? 12.270  -8.139  0.231   1.00 0.00 ? 167 LYS A CG   1  
ATOM 1779  C CD   . LYS A 1 116 ? 13.662  -8.112  -0.419  1.00 0.00 ? 167 LYS A CD   1  
ATOM 1780  C CE   . LYS A 1 116 ? 14.566  -9.162  0.226   1.00 0.00 ? 167 LYS A CE   1  
ATOM 1781  N NZ   . LYS A 1 116 ? 15.948  -9.009  -0.323  1.00 0.00 ? 167 LYS A NZ   1  
ATOM 1782  H H    . LYS A 1 116 ? 9.484   -5.832  -2.009  1.00 0.00 ? 167 LYS A H    1  
ATOM 1783  H HA   . LYS A 1 116 ? 11.592  -7.940  -2.367  1.00 0.00 ? 167 LYS A HA   1  
ATOM 1784  H HB2  . LYS A 1 116 ? 11.938  -6.162  -0.568  1.00 0.00 ? 167 LYS A HB2  1  
ATOM 1785  H HB3  . LYS A 1 116 ? 10.544  -6.845  0.258   1.00 0.00 ? 167 LYS A HB3  1  
ATOM 1786  H HG2  . LYS A 1 116 ? 12.361  -7.943  1.290   1.00 0.00 ? 167 LYS A HG2  1  
ATOM 1787  H HG3  . LYS A 1 116 ? 11.836  -9.112  0.088   1.00 0.00 ? 167 LYS A HG3  1  
ATOM 1788  H HD2  . LYS A 1 116 ? 13.574  -8.326  -1.468  1.00 0.00 ? 167 LYS A HD2  1  
ATOM 1789  H HD3  . LYS A 1 116 ? 14.102  -7.134  -0.290  1.00 0.00 ? 167 LYS A HD3  1  
ATOM 1790  H HE2  . LYS A 1 116 ? 14.582  -9.025  1.298   1.00 0.00 ? 167 LYS A HE2  1  
ATOM 1791  H HE3  . LYS A 1 116 ? 14.194  -10.145 -0.009  1.00 0.00 ? 167 LYS A HE3  1  
ATOM 1792  H HZ1  . LYS A 1 116 ? 16.184  -8.000  -0.394  1.00 0.00 ? 167 LYS A HZ1  1  
ATOM 1793  H HZ2  . LYS A 1 116 ? 16.626  -9.481  0.309   1.00 0.00 ? 167 LYS A HZ2  1  
ATOM 1794  H HZ3  . LYS A 1 116 ? 15.995  -9.441  -1.267  1.00 0.00 ? 167 LYS A HZ3  1  
ATOM 1795  N N    . ILE A 1 117 ? 9.016   -9.010  -2.562  1.00 0.00 ? 168 ILE A N    1  
ATOM 1796  C CA   . ILE A 1 117 ? 7.991   -10.099 -2.407  1.00 0.00 ? 168 ILE A CA   1  
ATOM 1797  C C    . ILE A 1 117 ? 8.436   -11.318 -3.228  1.00 0.00 ? 168 ILE A C    1  
ATOM 1798  O O    . ILE A 1 117 ? 8.796   -11.201 -4.381  1.00 0.00 ? 168 ILE A O    1  
ATOM 1799  C CB   . ILE A 1 117 ? 6.625   -9.609  -2.908  1.00 0.00 ? 168 ILE A CB   1  
ATOM 1800  C CG1  . ILE A 1 117 ? 5.553   -10.652 -2.566  1.00 0.00 ? 168 ILE A CG1  1  
ATOM 1801  C CG2  . ILE A 1 117 ? 6.648   -9.384  -4.420  1.00 0.00 ? 168 ILE A CG2  1  
ATOM 1802  C CD1  . ILE A 1 117 ? 4.155   -10.122 -2.915  1.00 0.00 ? 168 ILE A CD1  1  
ATOM 1803  H H    . ILE A 1 117 ? 9.137   -8.584  -3.437  1.00 0.00 ? 168 ILE A H    1  
ATOM 1804  H HA   . ILE A 1 117 ? 7.903   -10.379 -1.363  1.00 0.00 ? 168 ILE A HA   1  
ATOM 1805  H HB   . ILE A 1 117 ? 6.389   -8.675  -2.421  1.00 0.00 ? 168 ILE A HB   1  
ATOM 1806  H HG12 . ILE A 1 117 ? 5.742   -11.554 -3.132  1.00 0.00 ? 168 ILE A HG12 1  
ATOM 1807  H HG13 . ILE A 1 117 ? 5.598   -10.877 -1.513  1.00 0.00 ? 168 ILE A HG13 1  
ATOM 1808  H HG21 . ILE A 1 117 ? 7.544   -8.848  -4.690  1.00 0.00 ? 168 ILE A HG21 1  
ATOM 1809  H HG22 . ILE A 1 117 ? 6.626   -10.337 -4.926  1.00 0.00 ? 168 ILE A HG22 1  
ATOM 1810  H HG23 . ILE A 1 117 ? 5.779   -8.806  -4.702  1.00 0.00 ? 168 ILE A HG23 1  
ATOM 1811  H HD11 . ILE A 1 117 ? 4.130   -9.044  -2.824  1.00 0.00 ? 168 ILE A HD11 1  
ATOM 1812  H HD12 . ILE A 1 117 ? 3.905   -10.400 -3.928  1.00 0.00 ? 168 ILE A HD12 1  
ATOM 1813  H HD13 . ILE A 1 117 ? 3.434   -10.547 -2.236  1.00 0.00 ? 168 ILE A HD13 1  
ATOM 1814  N N    . THR A 1 118 ? 8.419   -12.491 -2.640  1.00 0.00 ? 169 THR A N    1  
ATOM 1815  C CA   . THR A 1 118 ? 8.836   -13.717 -3.377  1.00 0.00 ? 169 THR A CA   1  
ATOM 1816  C C    . THR A 1 118 ? 7.932   -14.869 -2.946  1.00 0.00 ? 169 THR A C    1  
ATOM 1817  O O    . THR A 1 118 ? 7.311   -14.825 -1.904  1.00 0.00 ? 169 THR A O    1  
ATOM 1818  C CB   . THR A 1 118 ? 10.298  -14.067 -3.048  1.00 0.00 ? 169 THR A CB   1  
ATOM 1819  O OG1  . THR A 1 118 ? 10.745  -15.083 -3.935  1.00 0.00 ? 169 THR A OG1  1  
ATOM 1820  C CG2  . THR A 1 118 ? 10.416  -14.571 -1.606  1.00 0.00 ? 169 THR A CG2  1  
ATOM 1821  H H    . THR A 1 118 ? 8.125   -12.573 -1.714  1.00 0.00 ? 169 THR A H    1  
ATOM 1822  H HA   . THR A 1 118 ? 8.731   -13.558 -4.443  1.00 0.00 ? 169 THR A HA   1  
ATOM 1823  H HB   . THR A 1 118 ? 10.910  -13.187 -3.168  1.00 0.00 ? 169 THR A HB   1  
ATOM 1824  H HG1  . THR A 1 118 ? 10.839  -14.694 -4.808  1.00 0.00 ? 169 THR A HG1  1  
ATOM 1825  H HG21 . THR A 1 118 ? 9.864   -13.918 -0.945  1.00 0.00 ? 169 THR A HG21 1  
ATOM 1826  H HG22 . THR A 1 118 ? 10.013  -15.571 -1.539  1.00 0.00 ? 169 THR A HG22 1  
ATOM 1827  H HG23 . THR A 1 118 ? 11.455  -14.586 -1.314  1.00 0.00 ? 169 THR A HG23 1  
ATOM 1828  N N    . VAL A 1 119 ? 7.864   -15.897 -3.727  1.00 0.00 ? 170 VAL A N    1  
ATOM 1829  C CA   . VAL A 1 119 ? 7.008   -17.058 -3.361  1.00 0.00 ? 170 VAL A CA   1  
ATOM 1830  C C    . VAL A 1 119 ? 7.479   -17.632 -2.011  1.00 0.00 ? 170 VAL A C    1  
ATOM 1831  O O    . VAL A 1 119 ? 8.648   -17.897 -1.812  1.00 0.00 ? 170 VAL A O    1  
ATOM 1832  C CB   . VAL A 1 119 ? 7.175   -18.107 -4.456  1.00 0.00 ? 170 VAL A CB   1  
ATOM 1833  C CG1  . VAL A 1 119 ? 6.539   -19.430 -4.031  1.00 0.00 ? 170 VAL A CG1  1  
ATOM 1834  C CG2  . VAL A 1 119 ? 6.509   -17.619 -5.744  1.00 0.00 ? 170 VAL A CG2  1  
ATOM 1835  H H    . VAL A 1 119 ? 8.378   -15.913 -4.563  1.00 0.00 ? 170 VAL A H    1  
ATOM 1836  H HA   . VAL A 1 119 ? 5.974   -16.753 -3.298  1.00 0.00 ? 170 VAL A HA   1  
ATOM 1837  H HB   . VAL A 1 119 ? 8.230   -18.247 -4.631  1.00 0.00 ? 170 VAL A HB   1  
ATOM 1838  H HG11 . VAL A 1 119 ? 5.577   -19.237 -3.578  1.00 0.00 ? 170 VAL A HG11 1  
ATOM 1839  H HG12 . VAL A 1 119 ? 6.408   -20.067 -4.898  1.00 0.00 ? 170 VAL A HG12 1  
ATOM 1840  H HG13 . VAL A 1 119 ? 7.187   -19.921 -3.321  1.00 0.00 ? 170 VAL A HG13 1  
ATOM 1841  H HG21 . VAL A 1 119 ? 5.495   -17.319 -5.532  1.00 0.00 ? 170 VAL A HG21 1  
ATOM 1842  H HG22 . VAL A 1 119 ? 7.059   -16.779 -6.141  1.00 0.00 ? 170 VAL A HG22 1  
ATOM 1843  H HG23 . VAL A 1 119 ? 6.505   -18.419 -6.470  1.00 0.00 ? 170 VAL A HG23 1  
ATOM 1844  N N    . ASP A 1 120 ? 6.578   -17.810 -1.076  1.00 0.00 ? 171 ASP A N    1  
ATOM 1845  C CA   . ASP A 1 120 ? 6.965   -18.345 0.267   1.00 0.00 ? 171 ASP A CA   1  
ATOM 1846  C C    . ASP A 1 120 ? 7.133   -19.877 0.217   1.00 0.00 ? 171 ASP A C    1  
ATOM 1847  O O    . ASP A 1 120 ? 8.205   -20.397 0.439   1.00 0.00 ? 171 ASP A O    1  
ATOM 1848  C CB   . ASP A 1 120 ? 5.885   -17.972 1.286   1.00 0.00 ? 171 ASP A CB   1  
ATOM 1849  C CG   . ASP A 1 120 ? 6.090   -16.537 1.792   1.00 0.00 ? 171 ASP A CG   1  
ATOM 1850  O OD1  . ASP A 1 120 ? 7.163   -15.998 1.590   1.00 0.00 ? 171 ASP A OD1  1  
ATOM 1851  O OD2  . ASP A 1 120 ? 5.157   -16.002 2.371   1.00 0.00 ? 171 ASP A OD2  1  
ATOM 1852  H H    . ASP A 1 120 ? 5.640   -17.576 -1.252  1.00 0.00 ? 171 ASP A H    1  
ATOM 1853  H HA   . ASP A 1 120 ? 7.913   -17.912 0.560   1.00 0.00 ? 171 ASP A HA   1  
ATOM 1854  H HB2  . ASP A 1 120 ? 4.915   -18.050 0.819   1.00 0.00 ? 171 ASP A HB2  1  
ATOM 1855  H HB3  . ASP A 1 120 ? 5.928   -18.653 2.129   1.00 0.00 ? 171 ASP A HB3  1  
ATOM 1856  N N    . GLY A 1 121 ? 6.084   -20.613 -0.037  1.00 0.00 ? 172 GLY A N    1  
ATOM 1857  C CA   . GLY A 1 121 ? 6.245   -22.096 -0.062  1.00 0.00 ? 172 GLY A CA   1  
ATOM 1858  C C    . GLY A 1 121 ? 4.913   -22.798 -0.343  1.00 0.00 ? 172 GLY A C    1  
ATOM 1859  O O    . GLY A 1 121 ? 4.549   -23.736 0.335   1.00 0.00 ? 172 GLY A O    1  
ATOM 1860  H H    . GLY A 1 121 ? 5.211   -20.203 -0.203  1.00 0.00 ? 172 GLY A H    1  
ATOM 1861  H HA2  . GLY A 1 121 ? 6.958   -22.365 -0.829  1.00 0.00 ? 172 GLY A HA2  1  
ATOM 1862  H HA3  . GLY A 1 121 ? 6.617   -22.423 0.895   1.00 0.00 ? 172 GLY A HA3  1  
ATOM 1863  N N    . PRO A 1 122 ? 4.200   -22.361 -1.342  1.00 0.00 ? 173 PRO A N    1  
ATOM 1864  C CA   . PRO A 1 122 ? 2.897   -22.978 -1.715  1.00 0.00 ? 173 PRO A CA   1  
ATOM 1865  C C    . PRO A 1 122 ? 3.064   -24.463 -2.086  1.00 0.00 ? 173 PRO A C    1  
ATOM 1866  O O    . PRO A 1 122 ? 4.042   -25.088 -1.730  1.00 0.00 ? 173 PRO A O    1  
ATOM 1867  C CB   . PRO A 1 122 ? 2.411   -22.131 -2.912  1.00 0.00 ? 173 PRO A CB   1  
ATOM 1868  C CG   . PRO A 1 122 ? 3.627   -21.408 -3.416  1.00 0.00 ? 173 PRO A CG   1  
ATOM 1869  C CD   . PRO A 1 122 ? 4.556   -21.247 -2.214  1.00 0.00 ? 173 PRO A CD   1  
ATOM 1870  H HA   . PRO A 1 122 ? 2.200   -22.882 -0.897  1.00 0.00 ? 173 PRO A HA   1  
ATOM 1871  H HB2  . PRO A 1 122 ? 1.998   -22.764 -3.687  1.00 0.00 ? 173 PRO A HB2  1  
ATOM 1872  H HB3  . PRO A 1 122 ? 1.671   -21.415 -2.583  1.00 0.00 ? 173 PRO A HB3  1  
ATOM 1873  H HG2  . PRO A 1 122 ? 4.111   -21.980 -4.190  1.00 0.00 ? 173 PRO A HG2  1  
ATOM 1874  H HG3  . PRO A 1 122 ? 3.354   -20.433 -3.797  1.00 0.00 ? 173 PRO A HG3  1  
ATOM 1875  H HD2  . PRO A 1 122 ? 5.587   -21.325 -2.518  1.00 0.00 ? 173 PRO A HD2  1  
ATOM 1876  H HD3  . PRO A 1 122 ? 4.371   -20.310 -1.716  1.00 0.00 ? 173 PRO A HD3  1  
ATOM 1877  N N    . ARG A 1 123 ? 2.097   -25.037 -2.765  1.00 0.00 ? 174 ARG A N    1  
ATOM 1878  C CA   . ARG A 1 123 ? 2.179   -26.491 -3.140  1.00 0.00 ? 174 ARG A CA   1  
ATOM 1879  C C    . ARG A 1 123 ? 2.775   -26.666 -4.554  1.00 0.00 ? 174 ARG A C    1  
ATOM 1880  O O    . ARG A 1 123 ? 3.087   -27.760 -4.976  1.00 0.00 ? 174 ARG A O    1  
ATOM 1881  C CB   . ARG A 1 123 ? 0.762   -27.088 -3.136  1.00 0.00 ? 174 ARG A CB   1  
ATOM 1882  C CG   . ARG A 1 123 ? 0.837   -28.620 -3.087  1.00 0.00 ? 174 ARG A CG   1  
ATOM 1883  C CD   . ARG A 1 123 ? -0.542  -29.221 -3.387  1.00 0.00 ? 174 ARG A CD   1  
ATOM 1884  N NE   . ARG A 1 123 ? -0.763  -29.218 -4.864  1.00 0.00 ? 174 ARG A NE   1  
ATOM 1885  C CZ   . ARG A 1 123 ? -1.717  -29.938 -5.384  1.00 0.00 ? 174 ARG A CZ   1  
ATOM 1886  N NH1  . ARG A 1 123 ? -2.479  -30.672 -4.613  1.00 0.00 ? 174 ARG A NH1  1  
ATOM 1887  N NH2  . ARG A 1 123 ? -1.914  -29.933 -6.683  1.00 0.00 ? 174 ARG A NH2  1  
ATOM 1888  H H    . ARG A 1 123 ? 1.308   -24.516 -3.015  1.00 0.00 ? 174 ARG A H    1  
ATOM 1889  H HA   . ARG A 1 123 ? 2.790   -27.021 -2.424  1.00 0.00 ? 174 ARG A HA   1  
ATOM 1890  H HB2  . ARG A 1 123 ? 0.230   -26.727 -2.267  1.00 0.00 ? 174 ARG A HB2  1  
ATOM 1891  H HB3  . ARG A 1 123 ? 0.242   -26.783 -4.031  1.00 0.00 ? 174 ARG A HB3  1  
ATOM 1892  H HG2  . ARG A 1 123 ? 1.541   -28.973 -3.822  1.00 0.00 ? 174 ARG A HG2  1  
ATOM 1893  H HG3  . ARG A 1 123 ? 1.160   -28.934 -2.106  1.00 0.00 ? 174 ARG A HG3  1  
ATOM 1894  H HD2  . ARG A 1 123 ? -0.584  -30.234 -3.014  1.00 0.00 ? 174 ARG A HD2  1  
ATOM 1895  H HD3  . ARG A 1 123 ? -1.309  -28.627 -2.907  1.00 0.00 ? 174 ARG A HD3  1  
ATOM 1896  H HE   . ARG A 1 123 ? -0.188  -28.673 -5.445  1.00 0.00 ? 174 ARG A HE   1  
ATOM 1897  H HH11 . ARG A 1 123 ? -2.329  -30.672 -3.622  1.00 0.00 ? 174 ARG A HH11 1  
ATOM 1898  H HH12 . ARG A 1 123 ? -3.203  -31.234 -5.008  1.00 0.00 ? 174 ARG A HH12 1  
ATOM 1899  H HH21 . ARG A 1 123 ? -1.324  -29.376 -7.270  1.00 0.00 ? 174 ARG A HH21 1  
ATOM 1900  H HH22 . ARG A 1 123 ? -2.644  -30.482 -7.084  1.00 0.00 ? 174 ARG A HH22 1  
ATOM 1901  N N    . GLU A 1 124 ? 2.925   -25.604 -5.295  1.00 0.00 ? 175 GLU A N    1  
ATOM 1902  C CA   . GLU A 1 124 ? 3.471   -25.741 -6.673  1.00 0.00 ? 175 GLU A CA   1  
ATOM 1903  C C    . GLU A 1 124 ? 4.960   -26.138 -6.653  1.00 0.00 ? 175 GLU A C    1  
ATOM 1904  O O    . GLU A 1 124 ? 5.401   -26.858 -7.509  1.00 0.00 ? 175 GLU A O    1  
ATOM 1905  C CB   . GLU A 1 124 ? 3.250   -24.431 -7.451  1.00 0.00 ? 175 GLU A CB   1  
ATOM 1906  C CG   . GLU A 1 124 ? 1.804   -24.366 -7.975  1.00 0.00 ? 175 GLU A CG   1  
ATOM 1907  C CD   . GLU A 1 124 ? 0.825   -24.387 -6.798  1.00 0.00 ? 175 GLU A CD   1  
ATOM 1908  O OE1  . GLU A 1 124 ? 0.751   -23.388 -6.098  1.00 0.00 ? 175 GLU A OE1  1  
ATOM 1909  O OE2  . GLU A 1 124 ? 0.156   -25.392 -6.623  1.00 0.00 ? 175 GLU A OE2  1  
ATOM 1910  H H    . GLU A 1 124 ? 2.676   -24.724 -4.957  1.00 0.00 ? 175 GLU A H    1  
ATOM 1911  H HA   . GLU A 1 124 ? 2.927   -26.533 -7.169  1.00 0.00 ? 175 GLU A HA   1  
ATOM 1912  H HB2  . GLU A 1 124 ? 3.430   -23.589 -6.806  1.00 0.00 ? 175 GLU A HB2  1  
ATOM 1913  H HB3  . GLU A 1 124 ? 3.931   -24.391 -8.289  1.00 0.00 ? 175 GLU A HB3  1  
ATOM 1914  H HG2  . GLU A 1 124 ? 1.668   -23.453 -8.537  1.00 0.00 ? 175 GLU A HG2  1  
ATOM 1915  H HG3  . GLU A 1 124 ? 1.610   -25.215 -8.615  1.00 0.00 ? 175 GLU A HG3  1  
ATOM 1916  N N    . PRO A 1 125 ? 5.740   -25.682 -5.707  1.00 0.00 ? 176 PRO A N    1  
ATOM 1917  C CA   . PRO A 1 125 ? 7.195   -26.019 -5.640  1.00 0.00 ? 176 PRO A CA   1  
ATOM 1918  C C    . PRO A 1 125 ? 7.461   -27.535 -5.664  1.00 0.00 ? 176 PRO A C    1  
ATOM 1919  O O    . PRO A 1 125 ? 8.586   -27.976 -5.542  1.00 0.00 ? 176 PRO A O    1  
ATOM 1920  C CB   . PRO A 1 125 ? 7.642   -25.429 -4.296  1.00 0.00 ? 176 PRO A CB   1  
ATOM 1921  C CG   . PRO A 1 125 ? 6.680   -24.327 -4.031  1.00 0.00 ? 176 PRO A CG   1  
ATOM 1922  C CD   . PRO A 1 125 ? 5.348   -24.799 -4.604  1.00 0.00 ? 176 PRO A CD   1  
ATOM 1923  H HA   . PRO A 1 125 ? 7.714   -25.533 -6.439  1.00 0.00 ? 176 PRO A HA   1  
ATOM 1924  H HB2  . PRO A 1 125 ? 7.582   -26.180 -3.514  1.00 0.00 ? 176 PRO A HB2  1  
ATOM 1925  H HB3  . PRO A 1 125 ? 8.646   -25.042 -4.369  1.00 0.00 ? 176 PRO A HB3  1  
ATOM 1926  H HG2  . PRO A 1 125 ? 6.591   -24.154 -2.962  1.00 0.00 ? 176 PRO A HG2  1  
ATOM 1927  H HG3  . PRO A 1 125 ? 6.990   -23.422 -4.533  1.00 0.00 ? 176 PRO A HG3  1  
ATOM 1928  H HD2  . PRO A 1 125 ? 4.805   -25.346 -3.861  1.00 0.00 ? 176 PRO A HD2  1  
ATOM 1929  H HD3  . PRO A 1 125 ? 4.772   -23.977 -4.976  1.00 0.00 ? 176 PRO A HD3  1  
ATOM 1930  N N    . ARG A 1 126 ? 6.437   -28.324 -5.786  1.00 0.00 ? 177 ARG A N    1  
ATOM 1931  C CA   . ARG A 1 126 ? 6.623   -29.802 -5.771  1.00 0.00 ? 177 ARG A CA   1  
ATOM 1932  C C    . ARG A 1 126 ? 7.356   -30.309 -7.021  1.00 0.00 ? 177 ARG A C    1  
ATOM 1933  O O    . ARG A 1 126 ? 7.989   -31.343 -6.984  1.00 0.00 ? 177 ARG A O    1  
ATOM 1934  C CB   . ARG A 1 126 ? 5.260   -30.475 -5.674  1.00 0.00 ? 177 ARG A CB   1  
ATOM 1935  C CG   . ARG A 1 126 ? 4.492   -30.285 -6.981  1.00 0.00 ? 177 ARG A CG   1  
ATOM 1936  C CD   . ARG A 1 126 ? 3.052   -30.732 -6.777  1.00 0.00 ? 177 ARG A CD   1  
ATOM 1937  N NE   . ARG A 1 126 ? 2.347   -30.665 -8.082  1.00 0.00 ? 177 ARG A NE   1  
ATOM 1938  C CZ   . ARG A 1 126 ? 1.195   -31.246 -8.232  1.00 0.00 ? 177 ARG A CZ   1  
ATOM 1939  N NH1  . ARG A 1 126 ? 0.596   -31.775 -7.209  1.00 0.00 ? 177 ARG A NH1  1  
ATOM 1940  N NH2  . ARG A 1 126 ? 0.627   -31.284 -9.403  1.00 0.00 ? 177 ARG A NH2  1  
ATOM 1941  H H    . ARG A 1 126 ? 5.532   -27.946 -5.849  1.00 0.00 ? 177 ARG A H    1  
ATOM 1942  H HA   . ARG A 1 126 ? 7.201   -30.073 -4.900  1.00 0.00 ? 177 ARG A HA   1  
ATOM 1943  H HB2  . ARG A 1 126 ? 5.386   -31.528 -5.484  1.00 0.00 ? 177 ARG A HB2  1  
ATOM 1944  H HB3  . ARG A 1 126 ? 4.698   -30.030 -4.866  1.00 0.00 ? 177 ARG A HB3  1  
ATOM 1945  H HG2  . ARG A 1 126 ? 4.506   -29.241 -7.263  1.00 0.00 ? 177 ARG A HG2  1  
ATOM 1946  H HG3  . ARG A 1 126 ? 4.942   -30.881 -7.760  1.00 0.00 ? 177 ARG A HG3  1  
ATOM 1947  H HD2  . ARG A 1 126 ? 3.041   -31.755 -6.420  1.00 0.00 ? 177 ARG A HD2  1  
ATOM 1948  H HD3  . ARG A 1 126 ? 2.566   -30.096 -6.061  1.00 0.00 ? 177 ARG A HD3  1  
ATOM 1949  H HE   . ARG A 1 126 ? 2.775   -30.215 -8.841  1.00 0.00 ? 177 ARG A HE   1  
ATOM 1950  H HH11 . ARG A 1 126 ? 1.023   -31.732 -6.306  1.00 0.00 ? 177 ARG A HH11 1  
ATOM 1951  H HH12 . ARG A 1 126 ? -0.283  -32.234 -7.328  1.00 0.00 ? 177 ARG A HH12 1  
ATOM 1952  H HH21 . ARG A 1 126 ? 1.081   -30.869 -10.190 1.00 0.00 ? 177 ARG A HH21 1  
ATOM 1953  H HH22 . ARG A 1 126 ? -0.257  -31.734 -9.513  1.00 0.00 ? 177 ARG A HH22 1  
ATOM 1954  N N    . ARG A 1 127 ? 7.279   -29.623 -8.130  1.00 0.00 ? 178 ARG A N    1  
ATOM 1955  C CA   . ARG A 1 127 ? 7.986   -30.142 -9.343  1.00 0.00 ? 178 ARG A CA   1  
ATOM 1956  C C    . ARG A 1 127 ? 9.483   -29.853 -9.212  1.00 0.00 ? 178 ARG A C    1  
ATOM 1957  O O    . ARG A 1 127 ? 10.062  -29.119 -9.988  1.00 0.00 ? 178 ARG A O    1  
ATOM 1958  C CB   . ARG A 1 127 ? 7.447   -29.465 -10.615 1.00 0.00 ? 178 ARG A CB   1  
ATOM 1959  C CG   . ARG A 1 127 ? 5.887   -29.539 -10.669 1.00 0.00 ? 178 ARG A CG   1  
ATOM 1960  C CD   . ARG A 1 127 ? 5.285   -28.202 -10.222 1.00 0.00 ? 178 ARG A CD   1  
ATOM 1961  N NE   . ARG A 1 127 ? 3.902   -28.398 -9.660  1.00 0.00 ? 178 ARG A NE   1  
ATOM 1962  C CZ   . ARG A 1 127 ? 2.915   -28.886 -10.377 1.00 0.00 ? 178 ARG A CZ   1  
ATOM 1963  N NH1  . ARG A 1 127 ? 3.081   -29.180 -11.644 1.00 0.00 ? 178 ARG A NH1  1  
ATOM 1964  N NH2  . ARG A 1 127 ? 1.740   -29.043 -9.825  1.00 0.00 ? 178 ARG A NH2  1  
ATOM 1965  H H    . ARG A 1 127 ? 6.761   -28.794 -8.171  1.00 0.00 ? 178 ARG A H    1  
ATOM 1966  H HA   . ARG A 1 127 ? 7.833   -31.209 -9.415  1.00 0.00 ? 178 ARG A HA   1  
ATOM 1967  H HB2  . ARG A 1 127 ? 7.770   -28.431 -10.628 1.00 0.00 ? 178 ARG A HB2  1  
ATOM 1968  H HB3  . ARG A 1 127 ? 7.856   -29.970 -11.475 1.00 0.00 ? 178 ARG A HB3  1  
ATOM 1969  H HG2  . ARG A 1 127 ? 5.575   -29.749 -11.681 1.00 0.00 ? 178 ARG A HG2  1  
ATOM 1970  H HG3  . ARG A 1 127 ? 5.534   -30.329 -10.017 1.00 0.00 ? 178 ARG A HG3  1  
ATOM 1971  H HD2  . ARG A 1 127 ? 5.881   -27.799 -9.440  1.00 0.00 ? 178 ARG A HD2  1  
ATOM 1972  H HD3  . ARG A 1 127 ? 5.293   -27.510 -11.058 1.00 0.00 ? 178 ARG A HD3  1  
ATOM 1973  H HE   . ARG A 1 127 ? 3.736   -28.155 -8.719  1.00 0.00 ? 178 ARG A HE   1  
ATOM 1974  H HH11 . ARG A 1 127 ? 3.962   -29.031 -12.084 1.00 0.00 ? 178 ARG A HH11 1  
ATOM 1975  H HH12 . ARG A 1 127 ? 2.322   -29.564 -12.167 1.00 0.00 ? 178 ARG A HH12 1  
ATOM 1976  H HH21 . ARG A 1 127 ? 1.599   -28.791 -8.868  1.00 0.00 ? 178 ARG A HH21 1  
ATOM 1977  H HH22 . ARG A 1 127 ? 0.982   -29.418 -10.356 1.00 0.00 ? 178 ARG A HH22 1  
ATOM 1978  N N    . VAL A 1 1   ? 4.070   10.211  24.593  1.00 0.00 ? 52  VAL A N    2  
ATOM 1979  C CA   . VAL A 1 1   ? 3.880   8.981   25.416  1.00 0.00 ? 52  VAL A CA   2  
ATOM 1980  C C    . VAL A 1 1   ? 4.952   7.950   25.076  1.00 0.00 ? 52  VAL A C    2  
ATOM 1981  O O    . VAL A 1 1   ? 4.905   7.293   24.056  1.00 0.00 ? 52  VAL A O    2  
ATOM 1982  C CB   . VAL A 1 1   ? 2.492   8.383   25.142  1.00 0.00 ? 52  VAL A CB   2  
ATOM 1983  C CG1  . VAL A 1 1   ? 2.039   7.543   26.341  1.00 0.00 ? 52  VAL A CG1  2  
ATOM 1984  C CG2  . VAL A 1 1   ? 1.495   9.518   24.925  1.00 0.00 ? 52  VAL A CG2  2  
ATOM 1985  H H    . VAL A 1 1   ? 4.495   10.157  23.714  1.00 0.00 ? 52  VAL A H    2  
ATOM 1986  H HA   . VAL A 1 1   ? 3.960   9.240   26.460  1.00 0.00 ? 52  VAL A HA   2  
ATOM 1987  H HB   . VAL A 1 1   ? 2.528   7.761   24.259  1.00 0.00 ? 52  VAL A HB   2  
ATOM 1988  H HG11 . VAL A 1 1   ? 2.836   6.881   26.644  1.00 0.00 ? 52  VAL A HG11 2  
ATOM 1989  H HG12 . VAL A 1 1   ? 1.785   8.198   27.159  1.00 0.00 ? 52  VAL A HG12 2  
ATOM 1990  H HG13 . VAL A 1 1   ? 1.173   6.962   26.064  1.00 0.00 ? 52  VAL A HG13 2  
ATOM 1991  H HG21 . VAL A 1 1   ? 1.656   10.281  25.671  1.00 0.00 ? 52  VAL A HG21 2  
ATOM 1992  H HG22 . VAL A 1 1   ? 1.642   9.937   23.943  1.00 0.00 ? 52  VAL A HG22 2  
ATOM 1993  H HG23 . VAL A 1 1   ? 0.491   9.132   25.010  1.00 0.00 ? 52  VAL A HG23 2  
ATOM 1994  N N    . GLU A 1 2   ? 5.897   7.789   25.944  1.00 0.00 ? 53  GLU A N    2  
ATOM 1995  C CA   . GLU A 1 2   ? 6.967   6.792   25.694  1.00 0.00 ? 53  GLU A CA   2  
ATOM 1996  C C    . GLU A 1 2   ? 6.345   5.395   25.587  1.00 0.00 ? 53  GLU A C    2  
ATOM 1997  O O    . GLU A 1 2   ? 6.867   4.529   24.916  1.00 0.00 ? 53  GLU A O    2  
ATOM 1998  C CB   . GLU A 1 2   ? 7.961   6.804   26.860  1.00 0.00 ? 53  GLU A CB   2  
ATOM 1999  C CG   . GLU A 1 2   ? 8.599   8.190   26.971  1.00 0.00 ? 53  GLU A CG   2  
ATOM 2000  C CD   . GLU A 1 2   ? 9.540   8.232   28.174  1.00 0.00 ? 53  GLU A CD   2  
ATOM 2001  O OE1  . GLU A 1 2   ? 9.110   7.850   29.252  1.00 0.00 ? 53  GLU A OE1  2  
ATOM 2002  O OE2  . GLU A 1 2   ? 10.669  8.654   28.002  1.00 0.00 ? 53  GLU A OE2  2  
ATOM 2003  H H    . GLU A 1 2   ? 5.905   8.326   26.764  1.00 0.00 ? 53  GLU A H    2  
ATOM 2004  H HA   . GLU A 1 2   ? 7.482   7.032   24.779  1.00 0.00 ? 53  GLU A HA   2  
ATOM 2005  H HB2  . GLU A 1 2   ? 7.446   6.565   27.779  1.00 0.00 ? 53  GLU A HB2  2  
ATOM 2006  H HB3  . GLU A 1 2   ? 8.732   6.072   26.676  1.00 0.00 ? 53  GLU A HB3  2  
ATOM 2007  H HG2  . GLU A 1 2   ? 9.164   8.394   26.073  1.00 0.00 ? 53  GLU A HG2  2  
ATOM 2008  H HG3  . GLU A 1 2   ? 7.829   8.936   27.090  1.00 0.00 ? 53  GLU A HG3  2  
ATOM 2009  N N    . VAL A 1 3   ? 5.241   5.162   26.254  1.00 0.00 ? 54  VAL A N    2  
ATOM 2010  C CA   . VAL A 1 3   ? 4.614   3.805   26.205  1.00 0.00 ? 54  VAL A CA   2  
ATOM 2011  C C    . VAL A 1 3   ? 4.133   3.492   24.786  1.00 0.00 ? 54  VAL A C    2  
ATOM 2012  O O    . VAL A 1 3   ? 4.292   2.389   24.304  1.00 0.00 ? 54  VAL A O    2  
ATOM 2013  C CB   . VAL A 1 3   ? 3.430   3.761   27.174  1.00 0.00 ? 54  VAL A CB   2  
ATOM 2014  C CG1  . VAL A 1 3   ? 2.713   2.407   27.055  1.00 0.00 ? 54  VAL A CG1  2  
ATOM 2015  C CG2  . VAL A 1 3   ? 3.954   3.962   28.603  1.00 0.00 ? 54  VAL A CG2  2  
ATOM 2016  H H    . VAL A 1 3   ? 4.842   5.868   26.804  1.00 0.00 ? 54  VAL A H    2  
ATOM 2017  H HA   . VAL A 1 3   ? 5.341   3.070   26.501  1.00 0.00 ? 54  VAL A HA   2  
ATOM 2018  H HB   . VAL A 1 3   ? 2.737   4.552   26.931  1.00 0.00 ? 54  VAL A HB   2  
ATOM 2019  H HG11 . VAL A 1 3   ? 3.441   1.608   27.020  1.00 0.00 ? 54  VAL A HG11 2  
ATOM 2020  H HG12 . VAL A 1 3   ? 2.061   2.261   27.902  1.00 0.00 ? 54  VAL A HG12 2  
ATOM 2021  H HG13 . VAL A 1 3   ? 2.124   2.394   26.147  1.00 0.00 ? 54  VAL A HG13 2  
ATOM 2022  H HG21 . VAL A 1 3   ? 4.528   4.876   28.646  1.00 0.00 ? 54  VAL A HG21 2  
ATOM 2023  H HG22 . VAL A 1 3   ? 3.126   4.028   29.289  1.00 0.00 ? 54  VAL A HG22 2  
ATOM 2024  H HG23 . VAL A 1 3   ? 4.584   3.131   28.880  1.00 0.00 ? 54  VAL A HG23 2  
ATOM 2025  N N    . LEU A 1 4   ? 3.580   4.457   24.102  1.00 0.00 ? 55  LEU A N    2  
ATOM 2026  C CA   . LEU A 1 4   ? 3.115   4.211   22.702  1.00 0.00 ? 55  LEU A CA   2  
ATOM 2027  C C    . LEU A 1 4   ? 4.280   4.480   21.756  1.00 0.00 ? 55  LEU A C    2  
ATOM 2028  O O    . LEU A 1 4   ? 4.819   5.571   21.717  1.00 0.00 ? 55  LEU A O    2  
ATOM 2029  C CB   . LEU A 1 4   ? 1.960   5.157   22.367  1.00 0.00 ? 55  LEU A CB   2  
ATOM 2030  C CG   . LEU A 1 4   ? 0.793   4.917   23.334  1.00 0.00 ? 55  LEU A CG   2  
ATOM 2031  C CD1  . LEU A 1 4   ? -0.366  5.856   22.980  1.00 0.00 ? 55  LEU A CD1  2  
ATOM 2032  C CD2  . LEU A 1 4   ? 0.308   3.459   23.238  1.00 0.00 ? 55  LEU A CD2  2  
ATOM 2033  H H    . LEU A 1 4   ? 3.474   5.342   24.503  1.00 0.00 ? 55  LEU A H    2  
ATOM 2034  H HA   . LEU A 1 4   ? 2.797   3.184   22.589  1.00 0.00 ? 55  LEU A HA   2  
ATOM 2035  H HB2  . LEU A 1 4   ? 2.303   6.178   22.465  1.00 0.00 ? 55  LEU A HB2  2  
ATOM 2036  H HB3  . LEU A 1 4   ? 1.633   4.984   21.354  1.00 0.00 ? 55  LEU A HB3  2  
ATOM 2037  H HG   . LEU A 1 4   ? 1.123   5.121   24.343  1.00 0.00 ? 55  LEU A HG   2  
ATOM 2038  H HD11 . LEU A 1 4   ? -0.524  5.848   21.912  1.00 0.00 ? 55  LEU A HD11 2  
ATOM 2039  H HD12 . LEU A 1 4   ? -1.265  5.518   23.477  1.00 0.00 ? 55  LEU A HD12 2  
ATOM 2040  H HD13 . LEU A 1 4   ? -0.133  6.860   23.303  1.00 0.00 ? 55  LEU A HD13 2  
ATOM 2041  H HD21 . LEU A 1 4   ? 0.379   3.117   22.215  1.00 0.00 ? 55  LEU A HD21 2  
ATOM 2042  H HD22 . LEU A 1 4   ? 0.921   2.832   23.870  1.00 0.00 ? 55  LEU A HD22 2  
ATOM 2043  H HD23 . LEU A 1 4   ? -0.719  3.394   23.567  1.00 0.00 ? 55  LEU A HD23 2  
ATOM 2044  N N    . ALA A 1 5   ? 4.682   3.486   21.006  1.00 0.00 ? 56  ALA A N    2  
ATOM 2045  C CA   . ALA A 1 5   ? 5.824   3.668   20.068  1.00 0.00 ? 56  ALA A CA   2  
ATOM 2046  C C    . ALA A 1 5   ? 5.849   2.527   19.033  1.00 0.00 ? 56  ALA A C    2  
ATOM 2047  O O    . ALA A 1 5   ? 6.640   2.532   18.112  1.00 0.00 ? 56  ALA A O    2  
ATOM 2048  C CB   . ALA A 1 5   ? 7.124   3.652   20.873  1.00 0.00 ? 56  ALA A CB   2  
ATOM 2049  H H    . ALA A 1 5   ? 4.235   2.619   21.068  1.00 0.00 ? 56  ALA A H    2  
ATOM 2050  H HA   . ALA A 1 5   ? 5.727   4.618   19.558  1.00 0.00 ? 56  ALA A HA   2  
ATOM 2051  H HB1  . ALA A 1 5   ? 7.054   4.357   21.686  1.00 0.00 ? 56  ALA A HB1  2  
ATOM 2052  H HB2  . ALA A 1 5   ? 7.282   2.659   21.270  1.00 0.00 ? 56  ALA A HB2  2  
ATOM 2053  H HB3  . ALA A 1 5   ? 7.950   3.920   20.232  1.00 0.00 ? 56  ALA A HB3  2  
ATOM 2054  N N    . ASP A 1 6   ? 5.005   1.538   19.192  1.00 0.00 ? 57  ASP A N    2  
ATOM 2055  C CA   . ASP A 1 6   ? 4.997   0.391   18.230  1.00 0.00 ? 57  ASP A CA   2  
ATOM 2056  C C    . ASP A 1 6   ? 4.124   0.746   17.014  1.00 0.00 ? 57  ASP A C    2  
ATOM 2057  O O    . ASP A 1 6   ? 4.505   1.525   16.162  1.00 0.00 ? 57  ASP A O    2  
ATOM 2058  C CB   . ASP A 1 6   ? 4.422   -0.847  18.931  1.00 0.00 ? 57  ASP A CB   2  
ATOM 2059  C CG   . ASP A 1 6   ? 5.271   -1.197  20.159  1.00 0.00 ? 57  ASP A CG   2  
ATOM 2060  O OD1  . ASP A 1 6   ? 6.136   -0.407  20.505  1.00 0.00 ? 57  ASP A OD1  2  
ATOM 2061  O OD2  . ASP A 1 6   ? 5.044   -2.252  20.731  1.00 0.00 ? 57  ASP A OD2  2  
ATOM 2062  H H    . ASP A 1 6   ? 4.385   1.541   19.949  1.00 0.00 ? 57  ASP A H    2  
ATOM 2063  H HA   . ASP A 1 6   ? 6.008   0.184   17.902  1.00 0.00 ? 57  ASP A HA   2  
ATOM 2064  H HB2  . ASP A 1 6   ? 3.409   -0.642  19.245  1.00 0.00 ? 57  ASP A HB2  2  
ATOM 2065  H HB3  . ASP A 1 6   ? 4.425   -1.683  18.246  1.00 0.00 ? 57  ASP A HB3  2  
ATOM 2066  N N    . HIS A 1 7   ? 2.944   0.182   16.946  1.00 0.00 ? 58  HIS A N    2  
ATOM 2067  C CA   . HIS A 1 7   ? 2.022   0.483   15.818  1.00 0.00 ? 58  HIS A CA   2  
ATOM 2068  C C    . HIS A 1 7   ? 1.849   2.005   15.622  1.00 0.00 ? 58  HIS A C    2  
ATOM 2069  O O    . HIS A 1 7   ? 1.942   2.481   14.509  1.00 0.00 ? 58  HIS A O    2  
ATOM 2070  C CB   . HIS A 1 7   ? 0.665   -0.206  16.066  1.00 0.00 ? 58  HIS A CB   2  
ATOM 2071  C CG   . HIS A 1 7   ? 0.762   -1.667  15.703  1.00 0.00 ? 58  HIS A CG   2  
ATOM 2072  N ND1  . HIS A 1 7   ? 1.175   -2.640  16.605  1.00 0.00 ? 58  HIS A ND1  2  
ATOM 2073  C CD2  . HIS A 1 7   ? 0.483   -2.338  14.537  1.00 0.00 ? 58  HIS A CD2  2  
ATOM 2074  C CE1  . HIS A 1 7   ? 1.127   -3.828  15.972  1.00 0.00 ? 58  HIS A CE1  2  
ATOM 2075  N NE2  . HIS A 1 7   ? 0.709   -3.700  14.712  1.00 0.00 ? 58  HIS A NE2  2  
ATOM 2076  H H    . HIS A 1 7   ? 2.658   -0.431  17.652  1.00 0.00 ? 58  HIS A H    2  
ATOM 2077  H HA   . HIS A 1 7   ? 2.452   0.080   14.913  1.00 0.00 ? 58  HIS A HA   2  
ATOM 2078  H HB2  . HIS A 1 7   ? 0.399   -0.123  17.105  1.00 0.00 ? 58  HIS A HB2  2  
ATOM 2079  H HB3  . HIS A 1 7   ? -0.098  0.265   15.462  1.00 0.00 ? 58  HIS A HB3  2  
ATOM 2080  H HD1  . HIS A 1 7   ? 1.470   -2.486  17.529  1.00 0.00 ? 58  HIS A HD1  2  
ATOM 2081  H HD2  . HIS A 1 7   ? 0.161   -1.877  13.617  1.00 0.00 ? 58  HIS A HD2  2  
ATOM 2082  H HE1  . HIS A 1 7   ? 1.389   -4.771  16.431  1.00 0.00 ? 58  HIS A HE1  2  
ATOM 2083  N N    . PRO A 1 8   ? 1.605   2.784   16.669  1.00 0.00 ? 59  PRO A N    2  
ATOM 2084  C CA   . PRO A 1 8   ? 1.431   4.263   16.526  1.00 0.00 ? 59  PRO A CA   2  
ATOM 2085  C C    . PRO A 1 8   ? 2.774   4.984   16.407  1.00 0.00 ? 59  PRO A C    2  
ATOM 2086  O O    . PRO A 1 8   ? 3.125   5.800   17.239  1.00 0.00 ? 59  PRO A O    2  
ATOM 2087  C CB   . PRO A 1 8   ? 0.723   4.650   17.828  1.00 0.00 ? 59  PRO A CB   2  
ATOM 2088  C CG   . PRO A 1 8   ? 1.305   3.720   18.827  1.00 0.00 ? 59  PRO A CG   2  
ATOM 2089  C CD   . PRO A 1 8   ? 1.463   2.384   18.091  1.00 0.00 ? 59  PRO A CD   2  
ATOM 2090  H HA   . PRO A 1 8   ? 0.801   4.490   15.686  1.00 0.00 ? 59  PRO A HA   2  
ATOM 2091  H HB2  . PRO A 1 8   ? 0.928   5.679   18.089  1.00 0.00 ? 59  PRO A HB2  2  
ATOM 2092  H HB3  . PRO A 1 8   ? -0.340  4.482   17.746  1.00 0.00 ? 59  PRO A HB3  2  
ATOM 2093  H HG2  . PRO A 1 8   ? 2.271   4.089   19.156  1.00 0.00 ? 59  PRO A HG2  2  
ATOM 2094  H HG3  . PRO A 1 8   ? 0.640   3.602   19.670  1.00 0.00 ? 59  PRO A HG3  2  
ATOM 2095  H HD2  . PRO A 1 8   ? 2.336   1.869   18.448  1.00 0.00 ? 59  PRO A HD2  2  
ATOM 2096  H HD3  . PRO A 1 8   ? 0.584   1.787   18.225  1.00 0.00 ? 59  PRO A HD3  2  
ATOM 2097  N N    . GLY A 1 9   ? 3.532   4.691   15.386  1.00 0.00 ? 60  GLY A N    2  
ATOM 2098  C CA   . GLY A 1 9   ? 4.850   5.368   15.235  1.00 0.00 ? 60  GLY A CA   2  
ATOM 2099  C C    . GLY A 1 9   ? 5.538   4.945   13.934  1.00 0.00 ? 60  GLY A C    2  
ATOM 2100  O O    . GLY A 1 9   ? 6.722   5.161   13.769  1.00 0.00 ? 60  GLY A O    2  
ATOM 2101  H H    . GLY A 1 9   ? 3.239   4.028   14.727  1.00 0.00 ? 60  GLY A H    2  
ATOM 2102  H HA2  . GLY A 1 9   ? 4.699   6.437   15.228  1.00 0.00 ? 60  GLY A HA2  2  
ATOM 2103  H HA3  . GLY A 1 9   ? 5.480   5.105   16.071  1.00 0.00 ? 60  GLY A HA3  2  
ATOM 2104  N N    . GLU A 1 10  ? 4.815   4.358   13.000  1.00 0.00 ? 61  GLU A N    2  
ATOM 2105  C CA   . GLU A 1 10  ? 5.445   3.943   11.700  1.00 0.00 ? 61  GLU A CA   2  
ATOM 2106  C C    . GLU A 1 10  ? 4.765   4.670   10.534  1.00 0.00 ? 61  GLU A C    2  
ATOM 2107  O O    . GLU A 1 10  ? 3.602   4.464   10.252  1.00 0.00 ? 61  GLU A O    2  
ATOM 2108  C CB   . GLU A 1 10  ? 5.319   2.421   11.517  1.00 0.00 ? 61  GLU A CB   2  
ATOM 2109  C CG   . GLU A 1 10  ? 3.875   1.948   11.749  1.00 0.00 ? 61  GLU A CG   2  
ATOM 2110  C CD   . GLU A 1 10  ? 3.856   0.415   11.835  1.00 0.00 ? 61  GLU A CD   2  
ATOM 2111  O OE1  . GLU A 1 10  ? 4.537   -0.214  11.038  1.00 0.00 ? 61  GLU A OE1  2  
ATOM 2112  O OE2  . GLU A 1 10  ? 3.168   -0.104  12.696  1.00 0.00 ? 61  GLU A OE2  2  
ATOM 2113  H H    . GLU A 1 10  ? 3.860   4.201   13.149  1.00 0.00 ? 61  GLU A H    2  
ATOM 2114  H HA   . GLU A 1 10  ? 6.499   4.202   11.700  1.00 0.00 ? 61  GLU A HA   2  
ATOM 2115  H HB2  . GLU A 1 10  ? 5.615   2.165   10.513  1.00 0.00 ? 61  GLU A HB2  2  
ATOM 2116  H HB3  . GLU A 1 10  ? 5.973   1.920   12.216  1.00 0.00 ? 61  GLU A HB3  2  
ATOM 2117  H HG2  . GLU A 1 10  ? 3.499   2.364   12.668  1.00 0.00 ? 61  GLU A HG2  2  
ATOM 2118  H HG3  . GLU A 1 10  ? 3.251   2.262   10.928  1.00 0.00 ? 61  GLU A HG3  2  
ATOM 2119  N N    . LEU A 1 11  ? 5.502   5.513   9.844   1.00 0.00 ? 62  LEU A N    2  
ATOM 2120  C CA   . LEU A 1 11  ? 4.935   6.262   8.670   1.00 0.00 ? 62  LEU A CA   2  
ATOM 2121  C C    . LEU A 1 11  ? 6.016   6.381   7.585   1.00 0.00 ? 62  LEU A C    2  
ATOM 2122  O O    . LEU A 1 11  ? 7.194   6.260   7.862   1.00 0.00 ? 62  LEU A O    2  
ATOM 2123  C CB   . LEU A 1 11  ? 4.480   7.673   9.095   1.00 0.00 ? 62  LEU A CB   2  
ATOM 2124  C CG   . LEU A 1 11  ? 3.339   7.585   10.146  1.00 0.00 ? 62  LEU A CG   2  
ATOM 2125  C CD1  . LEU A 1 11  ? 3.914   7.656   11.568  1.00 0.00 ? 62  LEU A CD1  2  
ATOM 2126  C CD2  . LEU A 1 11  ? 2.342   8.738   9.946   1.00 0.00 ? 62  LEU A CD2  2  
ATOM 2127  H H    . LEU A 1 11  ? 6.436   5.645   10.091  1.00 0.00 ? 62  LEU A H    2  
ATOM 2128  H HA   . LEU A 1 11  ? 4.089   5.720   8.271   1.00 0.00 ? 62  LEU A HA   2  
ATOM 2129  H HB2  . LEU A 1 11  ? 5.323   8.213   9.508   1.00 0.00 ? 62  LEU A HB2  2  
ATOM 2130  H HB3  . LEU A 1 11  ? 4.124   8.201   8.221   1.00 0.00 ? 62  LEU A HB3  2  
ATOM 2131  H HG   . LEU A 1 11  ? 2.817   6.648   10.029  1.00 0.00 ? 62  LEU A HG   2  
ATOM 2132  H HD11 . LEU A 1 11  ? 4.829   7.089   11.618  1.00 0.00 ? 62  LEU A HD11 2  
ATOM 2133  H HD12 . LEU A 1 11  ? 4.116   8.687   11.830  1.00 0.00 ? 62  LEU A HD12 2  
ATOM 2134  H HD13 . LEU A 1 11  ? 3.199   7.244   12.263  1.00 0.00 ? 62  LEU A HD13 2  
ATOM 2135  H HD21 . LEU A 1 11  ? 2.876   9.677   9.897   1.00 0.00 ? 62  LEU A HD21 2  
ATOM 2136  H HD22 . LEU A 1 11  ? 1.796   8.584   9.026   1.00 0.00 ? 62  LEU A HD22 2  
ATOM 2137  H HD23 . LEU A 1 11  ? 1.650   8.759   10.777  1.00 0.00 ? 62  LEU A HD23 2  
ATOM 2138  N N    . VAL A 1 12  ? 5.629   6.635   6.349   1.00 0.00 ? 63  VAL A N    2  
ATOM 2139  C CA   . VAL A 1 12  ? 6.631   6.779   5.239   1.00 0.00 ? 63  VAL A CA   2  
ATOM 2140  C C    . VAL A 1 12  ? 6.533   8.185   4.649   1.00 0.00 ? 63  VAL A C    2  
ATOM 2141  O O    . VAL A 1 12  ? 5.457   8.706   4.435   1.00 0.00 ? 63  VAL A O    2  
ATOM 2142  C CB   . VAL A 1 12  ? 6.330   5.774   4.129   1.00 0.00 ? 63  VAL A CB   2  
ATOM 2143  C CG1  . VAL A 1 12  ? 7.375   5.923   3.014   1.00 0.00 ? 63  VAL A CG1  2  
ATOM 2144  C CG2  . VAL A 1 12  ? 6.389   4.357   4.695   1.00 0.00 ? 63  VAL A CG2  2  
ATOM 2145  H H    . VAL A 1 12  ? 4.674   6.742   6.155   1.00 0.00 ? 63  VAL A H    2  
ATOM 2146  H HA   . VAL A 1 12  ? 7.633   6.617   5.610   1.00 0.00 ? 63  VAL A HA   2  
ATOM 2147  H HB   . VAL A 1 12  ? 5.344   5.966   3.729   1.00 0.00 ? 63  VAL A HB   2  
ATOM 2148  H HG11 . VAL A 1 12  ? 8.364   5.812   3.435   1.00 0.00 ? 63  VAL A HG11 2  
ATOM 2149  H HG12 . VAL A 1 12  ? 7.215   5.164   2.264   1.00 0.00 ? 63  VAL A HG12 2  
ATOM 2150  H HG13 . VAL A 1 12  ? 7.287   6.896   2.558   1.00 0.00 ? 63  VAL A HG13 2  
ATOM 2151  H HG21 . VAL A 1 12  ? 5.757   4.292   5.571   1.00 0.00 ? 63  VAL A HG21 2  
ATOM 2152  H HG22 . VAL A 1 12  ? 6.042   3.659   3.946   1.00 0.00 ? 63  VAL A HG22 2  
ATOM 2153  H HG23 . VAL A 1 12  ? 7.404   4.117   4.964   1.00 0.00 ? 63  VAL A HG23 2  
ATOM 2154  N N    . ARG A 1 13  ? 7.644   8.798   4.366   1.00 0.00 ? 64  ARG A N    2  
ATOM 2155  C CA   . ARG A 1 13  ? 7.590   10.156  3.775   1.00 0.00 ? 64  ARG A CA   2  
ATOM 2156  C C    . ARG A 1 13  ? 7.083   10.073  2.347   1.00 0.00 ? 64  ARG A C    2  
ATOM 2157  O O    . ARG A 1 13  ? 7.456   9.199   1.589   1.00 0.00 ? 64  ARG A O    2  
ATOM 2158  C CB   . ARG A 1 13  ? 8.975   10.799  3.790   1.00 0.00 ? 64  ARG A CB   2  
ATOM 2159  C CG   . ARG A 1 13  ? 8.945   12.132  3.007   1.00 0.00 ? 64  ARG A CG   2  
ATOM 2160  C CD   . ARG A 1 13  ? 9.915   13.136  3.633   1.00 0.00 ? 64  ARG A CD   2  
ATOM 2161  N NE   . ARG A 1 13  ? 9.157   13.873  4.675   1.00 0.00 ? 64  ARG A NE   2  
ATOM 2162  C CZ   . ARG A 1 13  ? 9.775   14.637  5.534   1.00 0.00 ? 64  ARG A CZ   2  
ATOM 2163  N NH1  . ARG A 1 13  ? 11.071  14.749  5.487   1.00 0.00 ? 64  ARG A NH1  2  
ATOM 2164  N NH2  . ARG A 1 13  ? 9.094   15.280  6.444   1.00 0.00 ? 64  ARG A NH2  2  
ATOM 2165  H H    . ARG A 1 13  ? 8.507   8.365   4.530   1.00 0.00 ? 64  ARG A H    2  
ATOM 2166  H HA   . ARG A 1 13  ? 6.913   10.767  4.351   1.00 0.00 ? 64  ARG A HA   2  
ATOM 2167  H HB2  . ARG A 1 13  ? 9.267   10.980  4.815   1.00 0.00 ? 64  ARG A HB2  2  
ATOM 2168  H HB3  . ARG A 1 13  ? 9.688   10.128  3.328   1.00 0.00 ? 64  ARG A HB3  2  
ATOM 2169  H HG2  . ARG A 1 13  ? 9.219   11.958  1.976   1.00 0.00 ? 64  ARG A HG2  2  
ATOM 2170  H HG3  . ARG A 1 13  ? 7.946   12.553  3.039   1.00 0.00 ? 64  ARG A HG3  2  
ATOM 2171  H HD2  . ARG A 1 13  ? 10.754  12.619  4.081   1.00 0.00 ? 64  ARG A HD2  2  
ATOM 2172  H HD3  . ARG A 1 13  ? 10.276  13.823  2.880   1.00 0.00 ? 64  ARG A HD3  2  
ATOM 2173  H HE   . ARG A 1 13  ? 8.180   13.779  4.714   1.00 0.00 ? 64  ARG A HE   2  
ATOM 2174  H HH11 . ARG A 1 13  ? 11.591  14.249  4.798   1.00 0.00 ? 64  ARG A HH11 2  
ATOM 2175  H HH12 . ARG A 1 13  ? 11.544  15.338  6.143   1.00 0.00 ? 64  ARG A HH12 2  
ATOM 2176  H HH21 . ARG A 1 13  ? 8.098   15.186  6.486   1.00 0.00 ? 64  ARG A HH21 2  
ATOM 2177  H HH22 . ARG A 1 13  ? 9.567   15.870  7.100   1.00 0.00 ? 64  ARG A HH22 2  
ATOM 2178  N N    . THR A 1 14  ? 6.225   10.989  1.984   1.00 0.00 ? 65  THR A N    2  
ATOM 2179  C CA   . THR A 1 14  ? 5.662   11.026  0.617   1.00 0.00 ? 65  THR A CA   2  
ATOM 2180  C C    . THR A 1 14  ? 5.959   12.390  0.006   1.00 0.00 ? 65  THR A C    2  
ATOM 2181  O O    . THR A 1 14  ? 6.449   13.281  0.676   1.00 0.00 ? 65  THR A O    2  
ATOM 2182  C CB   . THR A 1 14  ? 4.154   10.820  0.685   1.00 0.00 ? 65  THR A CB   2  
ATOM 2183  O OG1  . THR A 1 14  ? 3.558   11.935  1.331   1.00 0.00 ? 65  THR A OG1  2  
ATOM 2184  C CG2  . THR A 1 14  ? 3.837   9.545   1.467   1.00 0.00 ? 65  THR A CG2  2  
ATOM 2185  H H    . THR A 1 14  ? 5.954   11.674  2.621   1.00 0.00 ? 65  THR A H    2  
ATOM 2186  H HA   . THR A 1 14  ? 6.111   10.257  0.009   1.00 0.00 ? 65  THR A HA   2  
ATOM 2187  H HB   . THR A 1 14  ? 3.765   10.732  -0.310  1.00 0.00 ? 65  THR A HB   2  
ATOM 2188  H HG1  . THR A 1 14  ? 3.790   12.721  0.839   1.00 0.00 ? 65  THR A HG1  2  
ATOM 2189  H HG21 . THR A 1 14  ? 4.229   9.630   2.467   1.00 0.00 ? 65  THR A HG21 2  
ATOM 2190  H HG22 . THR A 1 14  ? 2.767   9.408   1.510   1.00 0.00 ? 65  THR A HG22 2  
ATOM 2191  H HG23 . THR A 1 14  ? 4.289   8.695   0.974   1.00 0.00 ? 65  THR A HG23 2  
ATOM 2192  N N    . ASP A 1 15  ? 5.668   12.573  -1.250  1.00 0.00 ? 66  ASP A N    2  
ATOM 2193  C CA   . ASP A 1 15  ? 5.944   13.893  -1.877  1.00 0.00 ? 66  ASP A CA   2  
ATOM 2194  C C    . ASP A 1 15  ? 5.119   14.966  -1.164  1.00 0.00 ? 66  ASP A C    2  
ATOM 2195  O O    . ASP A 1 15  ? 5.538   16.100  -1.045  1.00 0.00 ? 66  ASP A O    2  
ATOM 2196  C CB   . ASP A 1 15  ? 5.570   13.864  -3.357  1.00 0.00 ? 66  ASP A CB   2  
ATOM 2197  C CG   . ASP A 1 15  ? 6.115   15.127  -4.031  1.00 0.00 ? 66  ASP A CG   2  
ATOM 2198  O OD1  . ASP A 1 15  ? 6.741   15.915  -3.340  1.00 0.00 ? 66  ASP A OD1  2  
ATOM 2199  O OD2  . ASP A 1 15  ? 5.892   15.289  -5.220  1.00 0.00 ? 66  ASP A OD2  2  
ATOM 2200  H H    . ASP A 1 15  ? 5.272   11.847  -1.775  1.00 0.00 ? 66  ASP A H    2  
ATOM 2201  H HA   . ASP A 1 15  ? 6.991   14.121  -1.772  1.00 0.00 ? 66  ASP A HA   2  
ATOM 2202  H HB2  . ASP A 1 15  ? 5.999   12.991  -3.823  1.00 0.00 ? 66  ASP A HB2  2  
ATOM 2203  H HB3  . ASP A 1 15  ? 4.493   13.838  -3.462  1.00 0.00 ? 66  ASP A HB3  2  
ATOM 2204  N N    . SER A 1 16  ? 3.963   14.614  -0.666  1.00 0.00 ? 67  SER A N    2  
ATOM 2205  C CA   . SER A 1 16  ? 3.135   15.616  0.066   1.00 0.00 ? 67  SER A CA   2  
ATOM 2206  C C    . SER A 1 16  ? 3.641   15.652  1.518   1.00 0.00 ? 67  SER A C    2  
ATOM 2207  O O    . SER A 1 16  ? 3.898   14.613  2.091   1.00 0.00 ? 67  SER A O    2  
ATOM 2208  C CB   . SER A 1 16  ? 1.667   15.188  0.049   1.00 0.00 ? 67  SER A CB   2  
ATOM 2209  O OG   . SER A 1 16  ? 1.162   15.306  -1.273  1.00 0.00 ? 67  SER A OG   2  
ATOM 2210  H H    . SER A 1 16  ? 3.652   13.690  -0.756  1.00 0.00 ? 67  SER A H    2  
ATOM 2211  H HA   . SER A 1 16  ? 3.240   16.579  -0.402  1.00 0.00 ? 67  SER A HA   2  
ATOM 2212  H HB2  . SER A 1 16  ? 1.585   14.164  0.367   1.00 0.00 ? 67  SER A HB2  2  
ATOM 2213  H HB3  . SER A 1 16  ? 1.100   15.821  0.720   1.00 0.00 ? 67  SER A HB3  2  
ATOM 2214  H HG   . SER A 1 16  ? 1.172   16.236  -1.512  1.00 0.00 ? 67  SER A HG   2  
ATOM 2215  N N    . PRO A 1 17  ? 3.805   16.814  2.115   1.00 0.00 ? 68  PRO A N    2  
ATOM 2216  C CA   . PRO A 1 17  ? 4.313   16.912  3.516   1.00 0.00 ? 68  PRO A CA   2  
ATOM 2217  C C    . PRO A 1 17  ? 3.257   16.536  4.566   1.00 0.00 ? 68  PRO A C    2  
ATOM 2218  O O    . PRO A 1 17  ? 3.559   16.449  5.740   1.00 0.00 ? 68  PRO A O    2  
ATOM 2219  C CB   . PRO A 1 17  ? 4.721   18.383  3.645   1.00 0.00 ? 68  PRO A CB   2  
ATOM 2220  C CG   . PRO A 1 17  ? 3.814   19.112  2.711   1.00 0.00 ? 68  PRO A CG   2  
ATOM 2221  C CD   . PRO A 1 17  ? 3.533   18.152  1.548   1.00 0.00 ? 68  PRO A CD   2  
ATOM 2222  H HA   . PRO A 1 17  ? 5.180   16.294  3.636   1.00 0.00 ? 68  PRO A HA   2  
ATOM 2223  H HB2  . PRO A 1 17  ? 4.586   18.733  4.661   1.00 0.00 ? 68  PRO A HB2  2  
ATOM 2224  H HB3  . PRO A 1 17  ? 5.749   18.515  3.340   1.00 0.00 ? 68  PRO A HB3  2  
ATOM 2225  H HG2  . PRO A 1 17  ? 2.894   19.370  3.217   1.00 0.00 ? 68  PRO A HG2  2  
ATOM 2226  H HG3  . PRO A 1 17  ? 4.299   20.002  2.342   1.00 0.00 ? 68  PRO A HG3  2  
ATOM 2227  H HD2  . PRO A 1 17  ? 2.504   18.232  1.229   1.00 0.00 ? 68  PRO A HD2  2  
ATOM 2228  H HD3  . PRO A 1 17  ? 4.202   18.349  0.724   1.00 0.00 ? 68  PRO A HD3  2  
ATOM 2229  N N    . ASN A 1 18  ? 2.021   16.327  4.162   1.00 0.00 ? 69  ASN A N    2  
ATOM 2230  C CA   . ASN A 1 18  ? 0.951   15.976  5.161   1.00 0.00 ? 69  ASN A CA   2  
ATOM 2231  C C    . ASN A 1 18  ? 0.364   14.586  4.887   1.00 0.00 ? 69  ASN A C    2  
ATOM 2232  O O    . ASN A 1 18  ? -0.242  13.985  5.754   1.00 0.00 ? 69  ASN A O    2  
ATOM 2233  C CB   . ASN A 1 18  ? -0.174  17.006  5.048   1.00 0.00 ? 69  ASN A CB   2  
ATOM 2234  C CG   . ASN A 1 18  ? 0.361   18.406  5.365   1.00 0.00 ? 69  ASN A CG   2  
ATOM 2235  O OD1  . ASN A 1 18  ? 1.373   18.551  6.019   1.00 0.00 ? 69  ASN A OD1  2  
ATOM 2236  N ND2  . ASN A 1 18  ? -0.272  19.453  4.904   1.00 0.00 ? 69  ASN A ND2  2  
ATOM 2237  H H    . ASN A 1 18  ? 1.793   16.412  3.209   1.00 0.00 ? 69  ASN A H    2  
ATOM 2238  H HA   . ASN A 1 18  ? 1.349   15.997  6.164   1.00 0.00 ? 69  ASN A HA   2  
ATOM 2239  H HB2  . ASN A 1 18  ? -0.567  16.992  4.044   1.00 0.00 ? 69  ASN A HB2  2  
ATOM 2240  H HB3  . ASN A 1 18  ? -0.958  16.758  5.746   1.00 0.00 ? 69  ASN A HB3  2  
ATOM 2241  H HD21 . ASN A 1 18  ? -1.077  19.337  4.357   1.00 0.00 ? 69  ASN A HD21 2  
ATOM 2242  H HD22 . ASN A 1 18  ? 0.051   20.354  5.113   1.00 0.00 ? 69  ASN A HD22 2  
ATOM 2243  N N    . PHE A 1 19  ? 0.512   14.066  3.699   1.00 0.00 ? 70  PHE A N    2  
ATOM 2244  C CA   . PHE A 1 19  ? -0.073  12.720  3.391   1.00 0.00 ? 70  PHE A CA   2  
ATOM 2245  C C    . PHE A 1 19  ? 0.974   11.618  3.640   1.00 0.00 ? 70  PHE A C    2  
ATOM 2246  O O    . PHE A 1 19  ? 2.054   11.650  3.087   1.00 0.00 ? 70  PHE A O    2  
ATOM 2247  C CB   . PHE A 1 19  ? -0.522  12.708  1.907   1.00 0.00 ? 70  PHE A CB   2  
ATOM 2248  C CG   . PHE A 1 19  ? -1.984  12.339  1.784   1.00 0.00 ? 70  PHE A CG   2  
ATOM 2249  C CD1  . PHE A 1 19  ? -2.946  13.131  2.419   1.00 0.00 ? 70  PHE A CD1  2  
ATOM 2250  C CD2  . PHE A 1 19  ? -2.376  11.240  1.012   1.00 0.00 ? 70  PHE A CD2  2  
ATOM 2251  C CE1  . PHE A 1 19  ? -4.304  12.826  2.284   1.00 0.00 ? 70  PHE A CE1  2  
ATOM 2252  C CE2  . PHE A 1 19  ? -3.735  10.931  0.878   1.00 0.00 ? 70  PHE A CE2  2  
ATOM 2253  C CZ   . PHE A 1 19  ? -4.701  11.731  1.515   1.00 0.00 ? 70  PHE A CZ   2  
ATOM 2254  H H    . PHE A 1 19  ? 0.990   14.568  3.004   1.00 0.00 ? 70  PHE A H    2  
ATOM 2255  H HA   . PHE A 1 19  ? -0.929  12.546  4.033   1.00 0.00 ? 70  PHE A HA   2  
ATOM 2256  H HB2  . PHE A 1 19  ? -0.380  13.693  1.487   1.00 0.00 ? 70  PHE A HB2  2  
ATOM 2257  H HB3  . PHE A 1 19  ? 0.072   11.999  1.347   1.00 0.00 ? 70  PHE A HB3  2  
ATOM 2258  H HD1  . PHE A 1 19  ? -2.636  13.973  3.020   1.00 0.00 ? 70  PHE A HD1  2  
ATOM 2259  H HD2  . PHE A 1 19  ? -1.627  10.625  0.523   1.00 0.00 ? 70  PHE A HD2  2  
ATOM 2260  H HE1  . PHE A 1 19  ? -5.045  13.440  2.771   1.00 0.00 ? 70  PHE A HE1  2  
ATOM 2261  H HE2  . PHE A 1 19  ? -4.038  10.081  0.288   1.00 0.00 ? 70  PHE A HE2  2  
ATOM 2262  H HZ   . PHE A 1 19  ? -5.751  11.507  1.410   1.00 0.00 ? 70  PHE A HZ   2  
ATOM 2263  N N    . LEU A 1 20  ? 0.656   10.634  4.451   1.00 0.00 ? 71  LEU A N    2  
ATOM 2264  C CA   . LEU A 1 20  ? 1.630   9.518   4.718   1.00 0.00 ? 71  LEU A CA   2  
ATOM 2265  C C    . LEU A 1 20  ? 0.873   8.184   4.811   1.00 0.00 ? 71  LEU A C    2  
ATOM 2266  O O    . LEU A 1 20  ? -0.331  8.156   4.977   1.00 0.00 ? 71  LEU A O    2  
ATOM 2267  C CB   . LEU A 1 20  ? 2.372   9.758   6.042   1.00 0.00 ? 71  LEU A CB   2  
ATOM 2268  C CG   . LEU A 1 20  ? 3.244   11.035  5.959   1.00 0.00 ? 71  LEU A CG   2  
ATOM 2269  C CD1  . LEU A 1 20  ? 2.427   12.283  6.376   1.00 0.00 ? 71  LEU A CD1  2  
ATOM 2270  C CD2  . LEU A 1 20  ? 4.467   10.878  6.883   1.00 0.00 ? 71  LEU A CD2  2  
ATOM 2271  H H    . LEU A 1 20  ? -0.231  10.623  4.878   1.00 0.00 ? 71  LEU A H    2  
ATOM 2272  H HA   . LEU A 1 20  ? 2.349   9.460   3.910   1.00 0.00 ? 71  LEU A HA   2  
ATOM 2273  H HB2  . LEU A 1 20  ? 1.647   9.862   6.837   1.00 0.00 ? 71  LEU A HB2  2  
ATOM 2274  H HB3  . LEU A 1 20  ? 3.000   8.902   6.246   1.00 0.00 ? 71  LEU A HB3  2  
ATOM 2275  H HG   . LEU A 1 20  ? 3.589   11.166  4.941   1.00 0.00 ? 71  LEU A HG   2  
ATOM 2276  H HD11 . LEU A 1 20  ? 1.375   12.112  6.198   1.00 0.00 ? 71  LEU A HD11 2  
ATOM 2277  H HD12 . LEU A 1 20  ? 2.576   12.492  7.425   1.00 0.00 ? 71  LEU A HD12 2  
ATOM 2278  H HD13 . LEU A 1 20  ? 2.753   13.134  5.791   1.00 0.00 ? 71  LEU A HD13 2  
ATOM 2279  H HD21 . LEU A 1 20  ? 4.136   10.664  7.887   1.00 0.00 ? 71  LEU A HD21 2  
ATOM 2280  H HD22 . LEU A 1 20  ? 5.084   10.066  6.526   1.00 0.00 ? 71  LEU A HD22 2  
ATOM 2281  H HD23 . LEU A 1 20  ? 5.041   11.790  6.882   1.00 0.00 ? 71  LEU A HD23 2  
ATOM 2282  N N    . CYS A 1 21  ? 1.577   7.076   4.719   1.00 0.00 ? 72  CYS A N    2  
ATOM 2283  C CA   . CYS A 1 21  ? 0.917   5.730   4.815   1.00 0.00 ? 72  CYS A CA   2  
ATOM 2284  C C    . CYS A 1 21  ? 1.519   4.958   5.991   1.00 0.00 ? 72  CYS A C    2  
ATOM 2285  O O    . CYS A 1 21  ? 2.721   4.917   6.174   1.00 0.00 ? 72  CYS A O    2  
ATOM 2286  C CB   . CYS A 1 21  ? 1.153   4.956   3.517   1.00 0.00 ? 72  CYS A CB   2  
ATOM 2287  S SG   . CYS A 1 21  ? 2.933   4.790   3.236   1.00 0.00 ? 72  CYS A SG   2  
ATOM 2288  H H    . CYS A 1 21  ? 2.547   7.129   4.594   1.00 0.00 ? 72  CYS A H    2  
ATOM 2289  H HA   . CYS A 1 21  ? -0.142  5.841   4.976   1.00 0.00 ? 72  CYS A HA   2  
ATOM 2290  H HB2  . CYS A 1 21  ? 0.705   3.977   3.596   1.00 0.00 ? 72  CYS A HB2  2  
ATOM 2291  H HB3  . CYS A 1 21  ? 0.705   5.491   2.693   1.00 0.00 ? 72  CYS A HB3  2  
ATOM 2292  H HG   . CYS A 1 21  ? 3.199   5.474   2.618   1.00 0.00 ? 72  CYS A HG   2  
ATOM 2293  N N    . SER A 1 22  ? 0.683   4.355   6.790   1.00 0.00 ? 73  SER A N    2  
ATOM 2294  C CA   . SER A 1 22  ? 1.176   3.587   7.973   1.00 0.00 ? 73  SER A CA   2  
ATOM 2295  C C    . SER A 1 22  ? 2.110   2.470   7.542   1.00 0.00 ? 73  SER A C    2  
ATOM 2296  O O    . SER A 1 22  ? 2.988   2.071   8.281   1.00 0.00 ? 73  SER A O    2  
ATOM 2297  C CB   . SER A 1 22  ? -0.014  2.981   8.708   1.00 0.00 ? 73  SER A CB   2  
ATOM 2298  O OG   . SER A 1 22  ? -0.531  1.900   7.947   1.00 0.00 ? 73  SER A OG   2  
ATOM 2299  H H    . SER A 1 22  ? -0.282  4.406   6.614   1.00 0.00 ? 73  SER A H    2  
ATOM 2300  H HA   . SER A 1 22  ? 1.706   4.254   8.637   1.00 0.00 ? 73  SER A HA   2  
ATOM 2301  H HB2  . SER A 1 22  ? 0.302   2.613   9.669   1.00 0.00 ? 73  SER A HB2  2  
ATOM 2302  H HB3  . SER A 1 22  ? -0.773  3.742   8.846   1.00 0.00 ? 73  SER A HB3  2  
ATOM 2303  H HG   . SER A 1 22  ? -0.962  1.292   8.555   1.00 0.00 ? 73  SER A HG   2  
ATOM 2304  N N    . VAL A 1 23  ? 1.926   1.931   6.375   1.00 0.00 ? 74  VAL A N    2  
ATOM 2305  C CA   . VAL A 1 23  ? 2.815   0.821   5.960   1.00 0.00 ? 74  VAL A CA   2  
ATOM 2306  C C    . VAL A 1 23  ? 4.241   1.332   5.762   1.00 0.00 ? 74  VAL A C    2  
ATOM 2307  O O    . VAL A 1 23  ? 4.484   2.283   5.046   1.00 0.00 ? 74  VAL A O    2  
ATOM 2308  C CB   . VAL A 1 23  ? 2.303   0.200   4.656   1.00 0.00 ? 74  VAL A CB   2  
ATOM 2309  C CG1  . VAL A 1 23  ? 2.520   1.172   3.489   1.00 0.00 ? 74  VAL A CG1  2  
ATOM 2310  C CG2  . VAL A 1 23  ? 3.059   -1.107  4.403   1.00 0.00 ? 74  VAL A CG2  2  
ATOM 2311  H H    . VAL A 1 23  ? 1.202   2.242   5.791   1.00 0.00 ? 74  VAL A H    2  
ATOM 2312  H HA   . VAL A 1 23  ? 2.816   0.068   6.733   1.00 0.00 ? 74  VAL A HA   2  
ATOM 2313  H HB   . VAL A 1 23  ? 1.251   -0.008  4.749   1.00 0.00 ? 74  VAL A HB   2  
ATOM 2314  H HG11 . VAL A 1 23  ? 2.233   2.170   3.794   1.00 0.00 ? 74  VAL A HG11 2  
ATOM 2315  H HG12 . VAL A 1 23  ? 3.561   1.167   3.198   1.00 0.00 ? 74  VAL A HG12 2  
ATOM 2316  H HG13 . VAL A 1 23  ? 1.913   0.870   2.650   1.00 0.00 ? 74  VAL A HG13 2  
ATOM 2317  H HG21 . VAL A 1 23  ? 3.003   -1.729  5.286   1.00 0.00 ? 74  VAL A HG21 2  
ATOM 2318  H HG22 . VAL A 1 23  ? 2.616   -1.625  3.566   1.00 0.00 ? 74  VAL A HG22 2  
ATOM 2319  H HG23 . VAL A 1 23  ? 4.095   -0.889  4.186   1.00 0.00 ? 74  VAL A HG23 2  
ATOM 2320  N N    . LEU A 1 24  ? 5.185   0.693   6.409   1.00 0.00 ? 75  LEU A N    2  
ATOM 2321  C CA   . LEU A 1 24  ? 6.624   1.096   6.302   1.00 0.00 ? 75  LEU A CA   2  
ATOM 2322  C C    . LEU A 1 24  ? 7.456   -0.046  5.670   1.00 0.00 ? 75  LEU A C    2  
ATOM 2323  O O    . LEU A 1 24  ? 8.349   0.199   4.888   1.00 0.00 ? 75  LEU A O    2  
ATOM 2324  C CB   . LEU A 1 24  ? 7.154   1.419   7.720   1.00 0.00 ? 75  LEU A CB   2  
ATOM 2325  C CG   . LEU A 1 24  ? 8.001   2.701   7.710   1.00 0.00 ? 75  LEU A CG   2  
ATOM 2326  C CD1  . LEU A 1 24  ? 8.361   3.079   9.145   1.00 0.00 ? 75  LEU A CD1  2  
ATOM 2327  C CD2  . LEU A 1 24  ? 9.291   2.470   6.923   1.00 0.00 ? 75  LEU A CD2  2  
ATOM 2328  H H    . LEU A 1 24  ? 4.939   -0.057  6.983   1.00 0.00 ? 75  LEU A H    2  
ATOM 2329  H HA   . LEU A 1 24  ? 6.708   1.969   5.675   1.00 0.00 ? 75  LEU A HA   2  
ATOM 2330  H HB2  . LEU A 1 24  ? 6.313   1.564   8.380   1.00 0.00 ? 75  LEU A HB2  2  
ATOM 2331  H HB3  . LEU A 1 24  ? 7.754   0.601   8.094   1.00 0.00 ? 75  LEU A HB3  2  
ATOM 2332  H HG   . LEU A 1 24  ? 7.438   3.505   7.258   1.00 0.00 ? 75  LEU A HG   2  
ATOM 2333  H HD11 . LEU A 1 24  ? 8.707   2.201   9.668   1.00 0.00 ? 75  LEU A HD11 2  
ATOM 2334  H HD12 . LEU A 1 24  ? 9.140   3.826   9.137   1.00 0.00 ? 75  LEU A HD12 2  
ATOM 2335  H HD13 . LEU A 1 24  ? 7.486   3.473   9.640   1.00 0.00 ? 75  LEU A HD13 2  
ATOM 2336  H HD21 . LEU A 1 24  ? 9.055   2.086   5.948   1.00 0.00 ? 75  LEU A HD21 2  
ATOM 2337  H HD22 . LEU A 1 24  ? 9.819   3.407   6.820   1.00 0.00 ? 75  LEU A HD22 2  
ATOM 2338  H HD23 . LEU A 1 24  ? 9.914   1.764   7.452   1.00 0.00 ? 75  LEU A HD23 2  
ATOM 2339  N N    . PRO A 1 25  ? 7.182   -1.285  6.010   1.00 0.00 ? 76  PRO A N    2  
ATOM 2340  C CA   . PRO A 1 25  ? 7.949   -2.448  5.468   1.00 0.00 ? 76  PRO A CA   2  
ATOM 2341  C C    . PRO A 1 25  ? 7.985   -2.460  3.938   1.00 0.00 ? 76  PRO A C    2  
ATOM 2342  O O    . PRO A 1 25  ? 6.972   -2.389  3.274   1.00 0.00 ? 76  PRO A O    2  
ATOM 2343  C CB   . PRO A 1 25  ? 7.205   -3.673  6.023   1.00 0.00 ? 76  PRO A CB   2  
ATOM 2344  C CG   . PRO A 1 25  ? 6.508   -3.168  7.243   1.00 0.00 ? 76  PRO A CG   2  
ATOM 2345  C CD   . PRO A 1 25  ? 6.121   -1.726  6.924   1.00 0.00 ? 76  PRO A CD   2  
ATOM 2346  H HA   . PRO A 1 25  ? 8.956   -2.434  5.858   1.00 0.00 ? 76  PRO A HA   2  
ATOM 2347  H HB2  . PRO A 1 25  ? 6.487   -4.038  5.300   1.00 0.00 ? 76  PRO A HB2  2  
ATOM 2348  H HB3  . PRO A 1 25  ? 7.900   -4.454  6.289   1.00 0.00 ? 76  PRO A HB3  2  
ATOM 2349  H HG2  . PRO A 1 25  ? 5.623   -3.762  7.440   1.00 0.00 ? 76  PRO A HG2  2  
ATOM 2350  H HG3  . PRO A 1 25  ? 7.169   -3.188  8.096   1.00 0.00 ? 76  PRO A HG3  2  
ATOM 2351  H HD2  . PRO A 1 25  ? 5.161   -1.701  6.429   1.00 0.00 ? 76  PRO A HD2  2  
ATOM 2352  H HD3  . PRO A 1 25  ? 6.114   -1.120  7.814   1.00 0.00 ? 76  PRO A HD3  2  
ATOM 2353  N N    . THR A 1 26  ? 9.156   -2.541  3.384   1.00 0.00 ? 77  THR A N    2  
ATOM 2354  C CA   . THR A 1 26  ? 9.291   -2.550  1.902   1.00 0.00 ? 77  THR A CA   2  
ATOM 2355  C C    . THR A 1 26  ? 8.766   -3.869  1.327   1.00 0.00 ? 77  THR A C    2  
ATOM 2356  O O    . THR A 1 26  ? 8.783   -4.078  0.129   1.00 0.00 ? 77  THR A O    2  
ATOM 2357  C CB   . THR A 1 26  ? 10.765  -2.387  1.536   1.00 0.00 ? 77  THR A CB   2  
ATOM 2358  O OG1  . THR A 1 26  ? 11.487  -3.520  2.001   1.00 0.00 ? 77  THR A OG1  2  
ATOM 2359  C CG2  . THR A 1 26  ? 11.325  -1.117  2.191   1.00 0.00 ? 77  THR A CG2  2  
ATOM 2360  H H    . THR A 1 26  ? 9.958   -2.593  3.945   1.00 0.00 ? 77  THR A H    2  
ATOM 2361  H HA   . THR A 1 26  ? 8.726   -1.728  1.490   1.00 0.00 ? 77  THR A HA   2  
ATOM 2362  H HB   . THR A 1 26  ? 10.863  -2.311  0.466   1.00 0.00 ? 77  THR A HB   2  
ATOM 2363  H HG1  . THR A 1 26  ? 12.417  -3.382  1.807   1.00 0.00 ? 77  THR A HG1  2  
ATOM 2364  H HG21 . THR A 1 26  ? 10.570  -0.342  2.196   1.00 0.00 ? 77  THR A HG21 2  
ATOM 2365  H HG22 . THR A 1 26  ? 11.620  -1.337  3.206   1.00 0.00 ? 77  THR A HG22 2  
ATOM 2366  H HG23 . THR A 1 26  ? 12.183  -0.776  1.635   1.00 0.00 ? 77  THR A HG23 2  
ATOM 2367  N N    . HIS A 1 27  ? 8.321   -4.765  2.170   1.00 0.00 ? 78  HIS A N    2  
ATOM 2368  C CA   . HIS A 1 27  ? 7.809   -6.087  1.683   1.00 0.00 ? 78  HIS A CA   2  
ATOM 2369  C C    . HIS A 1 27  ? 6.509   -6.443  2.404   1.00 0.00 ? 78  HIS A C    2  
ATOM 2370  O O    . HIS A 1 27  ? 6.158   -5.832  3.392   1.00 0.00 ? 78  HIS A O    2  
ATOM 2371  C CB   . HIS A 1 27  ? 8.850   -7.167  1.981   1.00 0.00 ? 78  HIS A CB   2  
ATOM 2372  C CG   . HIS A 1 27  ? 9.030   -7.298  3.471   1.00 0.00 ? 78  HIS A CG   2  
ATOM 2373  N ND1  . HIS A 1 27  ? 9.909   -6.503  4.197   1.00 0.00 ? 78  HIS A ND1  2  
ATOM 2374  C CD2  . HIS A 1 27  ? 8.449   -8.142  4.378   1.00 0.00 ? 78  HIS A CD2  2  
ATOM 2375  C CE1  . HIS A 1 27  ? 9.832   -6.893  5.485   1.00 0.00 ? 78  HIS A CE1  2  
ATOM 2376  N NE2  . HIS A 1 27  ? 8.956   -7.886  5.651   1.00 0.00 ? 78  HIS A NE2  2  
ATOM 2377  H H    . HIS A 1 27  ? 8.333   -4.574  3.129   1.00 0.00 ? 78  HIS A H    2  
ATOM 2378  H HA   . HIS A 1 27  ? 7.627   -6.049  0.632   1.00 0.00 ? 78  HIS A HA   2  
ATOM 2379  H HB2  . HIS A 1 27  ? 8.504   -8.111  1.582   1.00 0.00 ? 78  HIS A HB2  2  
ATOM 2380  H HB3  . HIS A 1 27  ? 9.791   -6.903  1.523   1.00 0.00 ? 78  HIS A HB3  2  
ATOM 2381  H HD1  . HIS A 1 27  ? 10.475  -5.782  3.841   1.00 0.00 ? 78  HIS A HD1  2  
ATOM 2382  H HD2  . HIS A 1 27  ? 7.710   -8.892  4.136   1.00 0.00 ? 78  HIS A HD2  2  
ATOM 2383  H HE1  . HIS A 1 27  ? 10.422  -6.468  6.283   1.00 0.00 ? 78  HIS A HE1  2  
ATOM 2384  N N    . TRP A 1 28  ? 5.787   -7.432  1.904   1.00 0.00 ? 79  TRP A N    2  
ATOM 2385  C CA   . TRP A 1 28  ? 4.492   -7.831  2.557   1.00 0.00 ? 79  TRP A CA   2  
ATOM 2386  C C    . TRP A 1 28  ? 4.608   -9.282  3.091   1.00 0.00 ? 79  TRP A C    2  
ATOM 2387  O O    . TRP A 1 28  ? 5.694   -9.823  3.181   1.00 0.00 ? 79  TRP A O    2  
ATOM 2388  C CB   . TRP A 1 28  ? 3.370   -7.660  1.507   1.00 0.00 ? 79  TRP A CB   2  
ATOM 2389  C CG   . TRP A 1 28  ? 2.976   -8.949  0.868   1.00 0.00 ? 79  TRP A CG   2  
ATOM 2390  C CD1  . TRP A 1 28  ? 1.703   -9.259  0.545   1.00 0.00 ? 79  TRP A CD1  2  
ATOM 2391  C CD2  . TRP A 1 28  ? 3.797   -10.089 0.460   1.00 0.00 ? 79  TRP A CD2  2  
ATOM 2392  N NE1  . TRP A 1 28  ? 1.680   -10.508 -0.025  1.00 0.00 ? 79  TRP A NE1  2  
ATOM 2393  C CE2  . TRP A 1 28  ? 2.938   -11.066 -0.092  1.00 0.00 ? 79  TRP A CE2  2  
ATOM 2394  C CE3  . TRP A 1 28  ? 5.175   -10.385 0.519   1.00 0.00 ? 79  TRP A CE3  2  
ATOM 2395  C CZ2  . TRP A 1 28  ? 3.422   -12.279 -0.566  1.00 0.00 ? 79  TRP A CZ2  2  
ATOM 2396  C CZ3  . TRP A 1 28  ? 5.660   -11.612 0.040   1.00 0.00 ? 79  TRP A CZ3  2  
ATOM 2397  C CH2  . TRP A 1 28  ? 4.782   -12.554 -0.501  1.00 0.00 ? 79  TRP A CH2  2  
ATOM 2398  H H    . TRP A 1 28  ? 6.084   -7.896  1.075   1.00 0.00 ? 79  TRP A H    2  
ATOM 2399  H HA   . TRP A 1 28  ? 4.291   -7.178  3.397   1.00 0.00 ? 79  TRP A HA   2  
ATOM 2400  H HB2  . TRP A 1 28  ? 2.500   -7.235  1.982   1.00 0.00 ? 79  TRP A HB2  2  
ATOM 2401  H HB3  . TRP A 1 28  ? 3.713   -6.984  0.741   1.00 0.00 ? 79  TRP A HB3  2  
ATOM 2402  H HD1  . TRP A 1 28  ? 0.843   -8.629  0.703   1.00 0.00 ? 79  TRP A HD1  2  
ATOM 2403  H HE1  . TRP A 1 28  ? 0.869   -10.965 -0.338  1.00 0.00 ? 79  TRP A HE1  2  
ATOM 2404  H HE3  . TRP A 1 28  ? 5.870   -9.659  0.910   1.00 0.00 ? 79  TRP A HE3  2  
ATOM 2405  H HZ2  . TRP A 1 28  ? 2.749   -12.999 -1.000  1.00 0.00 ? 79  TRP A HZ2  2  
ATOM 2406  H HZ3  . TRP A 1 28  ? 6.717   -11.830 0.086   1.00 0.00 ? 79  TRP A HZ3  2  
ATOM 2407  H HH2  . TRP A 1 28  ? 5.158   -13.489 -0.864  1.00 0.00 ? 79  TRP A HH2  2  
ATOM 2408  N N    . ARG A 1 29  ? 3.519   -9.905  3.489   1.00 0.00 ? 80  ARG A N    2  
ATOM 2409  C CA   . ARG A 1 29  ? 3.617   -11.308 4.044   1.00 0.00 ? 80  ARG A CA   2  
ATOM 2410  C C    . ARG A 1 29  ? 2.427   -12.182 3.620   1.00 0.00 ? 80  ARG A C    2  
ATOM 2411  O O    . ARG A 1 29  ? 1.619   -12.554 4.450   1.00 0.00 ? 80  ARG A O    2  
ATOM 2412  C CB   . ARG A 1 29  ? 3.652   -11.264 5.577   1.00 0.00 ? 80  ARG A CB   2  
ATOM 2413  C CG   . ARG A 1 29  ? 4.949   -10.602 6.052   1.00 0.00 ? 80  ARG A CG   2  
ATOM 2414  C CD   . ARG A 1 29  ? 5.103   -10.813 7.557   1.00 0.00 ? 80  ARG A CD   2  
ATOM 2415  N NE   . ARG A 1 29  ? 6.092   -9.827  8.103   1.00 0.00 ? 80  ARG A NE   2  
ATOM 2416  C CZ   . ARG A 1 29  ? 7.317   -9.748  7.644   1.00 0.00 ? 80  ARG A CZ   2  
ATOM 2417  N NH1  . ARG A 1 29  ? 7.778   -10.629 6.800   1.00 0.00 ? 80  ARG A NH1  2  
ATOM 2418  N NH2  . ARG A 1 29  ? 8.106   -8.808  8.085   1.00 0.00 ? 80  ARG A NH2  2  
ATOM 2419  H H    . ARG A 1 29  ? 2.652   -9.456  3.440   1.00 0.00 ? 80  ARG A H    2  
ATOM 2420  H HA   . ARG A 1 29  ? 4.527   -11.774 3.693   1.00 0.00 ? 80  ARG A HA   2  
ATOM 2421  H HB2  . ARG A 1 29  ? 2.807   -10.695 5.938   1.00 0.00 ? 80  ARG A HB2  2  
ATOM 2422  H HB3  . ARG A 1 29  ? 3.596   -12.267 5.967   1.00 0.00 ? 80  ARG A HB3  2  
ATOM 2423  H HG2  . ARG A 1 29  ? 5.785   -11.041 5.534   1.00 0.00 ? 80  ARG A HG2  2  
ATOM 2424  H HG3  . ARG A 1 29  ? 4.910   -9.542  5.846   1.00 0.00 ? 80  ARG A HG3  2  
ATOM 2425  H HD2  . ARG A 1 29  ? 4.162   -10.639 8.044   1.00 0.00 ? 80  ARG A HD2  2  
ATOM 2426  H HD3  . ARG A 1 29  ? 5.414   -11.842 7.740   1.00 0.00 ? 80  ARG A HD3  2  
ATOM 2427  H HE   . ARG A 1 29  ? 5.802   -9.197  8.793   1.00 0.00 ? 80  ARG A HE   2  
ATOM 2428  H HH11 . ARG A 1 29  ? 7.198   -11.381 6.494   1.00 0.00 ? 80  ARG A HH11 2  
ATOM 2429  H HH12 . ARG A 1 29  ? 8.716   -10.553 6.462   1.00 0.00 ? 80  ARG A HH12 2  
ATOM 2430  H HH21 . ARG A 1 29  ? 7.774   -8.159  8.768   1.00 0.00 ? 80  ARG A HH21 2  
ATOM 2431  H HH22 . ARG A 1 29  ? 9.041   -8.737  7.739   1.00 0.00 ? 80  ARG A HH22 2  
ATOM 2432  N N    . SER A 1 30  ? 2.319   -12.546 2.357   1.00 0.00 ? 81  SER A N    2  
ATOM 2433  C CA   . SER A 1 30  ? 1.181   -13.434 1.920   1.00 0.00 ? 81  SER A CA   2  
ATOM 2434  C C    . SER A 1 30  ? 1.725   -14.714 1.293   1.00 0.00 ? 81  SER A C    2  
ATOM 2435  O O    . SER A 1 30  ? 2.669   -14.700 0.529   1.00 0.00 ? 81  SER A O    2  
ATOM 2436  C CB   . SER A 1 30  ? 0.310   -12.714 0.894   1.00 0.00 ? 81  SER A CB   2  
ATOM 2437  O OG   . SER A 1 30  ? 0.030   -11.412 1.373   1.00 0.00 ? 81  SER A OG   2  
ATOM 2438  H H    . SER A 1 30  ? 2.993   -12.255 1.709   1.00 0.00 ? 81  SER A H    2  
ATOM 2439  H HA   . SER A 1 30  ? 0.569   -13.704 2.769   1.00 0.00 ? 81  SER A HA   2  
ATOM 2440  H HB2  . SER A 1 30  ? 0.814   -12.654 -0.051  1.00 0.00 ? 81  SER A HB2  2  
ATOM 2441  H HB3  . SER A 1 30  ? -0.607  -13.266 0.756   1.00 0.00 ? 81  SER A HB3  2  
ATOM 2442  H HG   . SER A 1 30  ? 0.131   -11.416 2.326   1.00 0.00 ? 81  SER A HG   2  
ATOM 2443  N N    . ASN A 1 31  ? 1.117   -15.823 1.590   1.00 0.00 ? 82  ASN A N    2  
ATOM 2444  C CA   . ASN A 1 31  ? 1.570   -17.093 0.978   1.00 0.00 ? 82  ASN A CA   2  
ATOM 2445  C C    . ASN A 1 31  ? 1.189   -17.063 -0.500  1.00 0.00 ? 82  ASN A C    2  
ATOM 2446  O O    . ASN A 1 31  ? 1.925   -17.520 -1.355  1.00 0.00 ? 82  ASN A O    2  
ATOM 2447  C CB   . ASN A 1 31  ? 0.894   -18.285 1.664   1.00 0.00 ? 82  ASN A CB   2  
ATOM 2448  C CG   . ASN A 1 31  ? 1.291   -18.340 3.145   1.00 0.00 ? 82  ASN A CG   2  
ATOM 2449  O OD1  . ASN A 1 31  ? 0.446   -18.267 4.016   1.00 0.00 ? 82  ASN A OD1  2  
ATOM 2450  N ND2  . ASN A 1 31  ? 2.549   -18.497 3.465   1.00 0.00 ? 82  ASN A ND2  2  
ATOM 2451  H H    . ASN A 1 31  ? 0.341   -15.811 2.189   1.00 0.00 ? 82  ASN A H    2  
ATOM 2452  H HA   . ASN A 1 31  ? 2.647   -17.179 1.069   1.00 0.00 ? 82  ASN A HA   2  
ATOM 2453  H HB2  . ASN A 1 31  ? -0.180  -18.182 1.584   1.00 0.00 ? 82  ASN A HB2  2  
ATOM 2454  H HB3  . ASN A 1 31  ? 1.200   -19.198 1.178   1.00 0.00 ? 82  ASN A HB3  2  
ATOM 2455  H HD21 . ASN A 1 31  ? 3.225   -18.584 2.763   1.00 0.00 ? 82  ASN A HD21 2  
ATOM 2456  H HD22 . ASN A 1 31  ? 2.817   -18.524 4.409   1.00 0.00 ? 82  ASN A HD22 2  
ATOM 2457  N N    . LYS A 1 32  ? 0.025   -16.531 -0.803  1.00 0.00 ? 83  LYS A N    2  
ATOM 2458  C CA   . LYS A 1 32  ? -0.430  -16.469 -2.224  1.00 0.00 ? 83  LYS A CA   2  
ATOM 2459  C C    . LYS A 1 32  ? -1.411  -15.299 -2.417  1.00 0.00 ? 83  LYS A C    2  
ATOM 2460  O O    . LYS A 1 32  ? -1.023  -14.154 -2.537  1.00 0.00 ? 83  LYS A O    2  
ATOM 2461  C CB   . LYS A 1 32  ? -1.124  -17.787 -2.588  1.00 0.00 ? 83  LYS A CB   2  
ATOM 2462  C CG   . LYS A 1 32  ? -1.898  -18.299 -1.370  1.00 0.00 ? 83  LYS A CG   2  
ATOM 2463  C CD   . LYS A 1 32  ? -2.864  -19.412 -1.794  1.00 0.00 ? 83  LYS A CD   2  
ATOM 2464  C CE   . LYS A 1 32  ? -2.084  -20.680 -2.135  1.00 0.00 ? 83  LYS A CE   2  
ATOM 2465  N NZ   . LYS A 1 32  ? -3.040  -21.811 -2.282  1.00 0.00 ? 83  LYS A NZ   2  
ATOM 2466  H H    . LYS A 1 32  ? -0.553  -16.176 -0.089  1.00 0.00 ? 83  LYS A H    2  
ATOM 2467  H HA   . LYS A 1 32  ? 0.424   -16.327 -2.868  1.00 0.00 ? 83  LYS A HA   2  
ATOM 2468  H HB2  . LYS A 1 32  ? -1.804  -17.628 -3.416  1.00 0.00 ? 83  LYS A HB2  2  
ATOM 2469  H HB3  . LYS A 1 32  ? -0.380  -18.518 -2.870  1.00 0.00 ? 83  LYS A HB3  2  
ATOM 2470  H HG2  . LYS A 1 32  ? -1.203  -18.688 -0.642  1.00 0.00 ? 83  LYS A HG2  2  
ATOM 2471  H HG3  . LYS A 1 32  ? -2.458  -17.491 -0.930  1.00 0.00 ? 83  LYS A HG3  2  
ATOM 2472  H HD2  . LYS A 1 32  ? -3.548  -19.618 -0.984  1.00 0.00 ? 83  LYS A HD2  2  
ATOM 2473  H HD3  . LYS A 1 32  ? -3.427  -19.093 -2.661  1.00 0.00 ? 83  LYS A HD3  2  
ATOM 2474  H HE2  . LYS A 1 32  ? -1.547  -20.536 -3.060  1.00 0.00 ? 83  LYS A HE2  2  
ATOM 2475  H HE3  . LYS A 1 32  ? -1.388  -20.898 -1.342  1.00 0.00 ? 83  LYS A HE3  2  
ATOM 2476  H HZ1  . LYS A 1 32  ? -3.892  -21.483 -2.779  1.00 0.00 ? 83  LYS A HZ1  2  
ATOM 2477  H HZ2  . LYS A 1 32  ? -2.591  -22.574 -2.827  1.00 0.00 ? 83  LYS A HZ2  2  
ATOM 2478  H HZ3  . LYS A 1 32  ? -3.304  -22.165 -1.344  1.00 0.00 ? 83  LYS A HZ3  2  
ATOM 2479  N N    . THR A 1 33  ? -2.687  -15.596 -2.471  1.00 0.00 ? 84  THR A N    2  
ATOM 2480  C CA   . THR A 1 33  ? -3.717  -14.539 -2.676  1.00 0.00 ? 84  THR A CA   2  
ATOM 2481  C C    . THR A 1 33  ? -4.173  -14.005 -1.315  1.00 0.00 ? 84  THR A C    2  
ATOM 2482  O O    . THR A 1 33  ? -5.297  -13.572 -1.156  1.00 0.00 ? 84  THR A O    2  
ATOM 2483  C CB   . THR A 1 33  ? -4.908  -15.137 -3.444  1.00 0.00 ? 84  THR A CB   2  
ATOM 2484  O OG1  . THR A 1 33  ? -4.419  -16.018 -4.446  1.00 0.00 ? 84  THR A OG1  2  
ATOM 2485  C CG2  . THR A 1 33  ? -5.718  -14.018 -4.106  1.00 0.00 ? 84  THR A CG2  2  
ATOM 2486  H H    . THR A 1 33  ? -2.971  -16.525 -2.386  1.00 0.00 ? 84  THR A H    2  
ATOM 2487  H HA   . THR A 1 33  ? -3.292  -13.729 -3.252  1.00 0.00 ? 84  THR A HA   2  
ATOM 2488  H HB   . THR A 1 33  ? -5.543  -15.682 -2.763  1.00 0.00 ? 84  THR A HB   2  
ATOM 2489  H HG1  . THR A 1 33  ? -4.067  -16.797 -4.010  1.00 0.00 ? 84  THR A HG1  2  
ATOM 2490  H HG21 . THR A 1 33  ? -5.906  -13.233 -3.390  1.00 0.00 ? 84  THR A HG21 2  
ATOM 2491  H HG22 . THR A 1 33  ? -5.159  -13.616 -4.939  1.00 0.00 ? 84  THR A HG22 2  
ATOM 2492  H HG23 . THR A 1 33  ? -6.659  -14.414 -4.460  1.00 0.00 ? 84  THR A HG23 2  
ATOM 2493  N N    . LEU A 1 34  ? -3.295  -14.016 -0.334  1.00 0.00 ? 85  LEU A N    2  
ATOM 2494  C CA   . LEU A 1 34  ? -3.656  -13.492 1.030   1.00 0.00 ? 85  LEU A CA   2  
ATOM 2495  C C    . LEU A 1 34  ? -2.881  -12.189 1.303   1.00 0.00 ? 85  LEU A C    2  
ATOM 2496  O O    . LEU A 1 34  ? -2.025  -12.151 2.161   1.00 0.00 ? 85  LEU A O    2  
ATOM 2497  C CB   . LEU A 1 34  ? -3.286  -14.539 2.110   1.00 0.00 ? 85  LEU A CB   2  
ATOM 2498  C CG   . LEU A 1 34  ? -4.423  -15.567 2.297   1.00 0.00 ? 85  LEU A CG   2  
ATOM 2499  C CD1  . LEU A 1 34  ? -5.635  -14.928 3.010   1.00 0.00 ? 85  LEU A CD1  2  
ATOM 2500  C CD2  . LEU A 1 34  ? -4.851  -16.106 0.927   1.00 0.00 ? 85  LEU A CD2  2  
ATOM 2501  H H    . LEU A 1 34  ? -2.394  -14.355 -0.501  1.00 0.00 ? 85  LEU A H    2  
ATOM 2502  H HA   . LEU A 1 34  ? -4.700  -13.295 1.077   1.00 0.00 ? 85  LEU A HA   2  
ATOM 2503  H HB2  . LEU A 1 34  ? -2.393  -15.062 1.798   1.00 0.00 ? 85  LEU A HB2  2  
ATOM 2504  H HB3  . LEU A 1 34  ? -3.091  -14.045 3.052   1.00 0.00 ? 85  LEU A HB3  2  
ATOM 2505  H HG   . LEU A 1 34  ? -4.060  -16.388 2.899   1.00 0.00 ? 85  LEU A HG   2  
ATOM 2506  H HD11 . LEU A 1 34  ? -5.293  -14.224 3.755   1.00 0.00 ? 85  LEU A HD11 2  
ATOM 2507  H HD12 . LEU A 1 34  ? -6.259  -14.414 2.293   1.00 0.00 ? 85  LEU A HD12 2  
ATOM 2508  H HD13 . LEU A 1 34  ? -6.217  -15.700 3.492   1.00 0.00 ? 85  LEU A HD13 2  
ATOM 2509  H HD21 . LEU A 1 34  ? -3.980  -16.217 0.293   1.00 0.00 ? 85  LEU A HD21 2  
ATOM 2510  H HD22 . LEU A 1 34  ? -5.323  -17.069 1.050   1.00 0.00 ? 85  LEU A HD22 2  
ATOM 2511  H HD23 . LEU A 1 34  ? -5.545  -15.418 0.468   1.00 0.00 ? 85  LEU A HD23 2  
ATOM 2512  N N    . PRO A 1 35  ? -3.186  -11.123 0.590   1.00 0.00 ? 86  PRO A N    2  
ATOM 2513  C CA   . PRO A 1 35  ? -2.497  -9.801  0.764   1.00 0.00 ? 86  PRO A CA   2  
ATOM 2514  C C    . PRO A 1 35  ? -2.824  -9.156  2.106   1.00 0.00 ? 86  PRO A C    2  
ATOM 2515  O O    . PRO A 1 35  ? -3.480  -9.742  2.943   1.00 0.00 ? 86  PRO A O    2  
ATOM 2516  C CB   . PRO A 1 35  ? -3.029  -8.961  -0.399  1.00 0.00 ? 86  PRO A CB   2  
ATOM 2517  C CG   . PRO A 1 35  ? -4.361  -9.548  -0.708  1.00 0.00 ? 86  PRO A CG   2  
ATOM 2518  C CD   . PRO A 1 35  ? -4.221  -11.040 -0.457  1.00 0.00 ? 86  PRO A CD   2  
ATOM 2519  H HA   . PRO A 1 35  ? -1.434  -9.912  0.659   1.00 0.00 ? 86  PRO A HA   2  
ATOM 2520  H HB2  . PRO A 1 35  ? -3.128  -7.922  -0.110  1.00 0.00 ? 86  PRO A HB2  2  
ATOM 2521  H HB3  . PRO A 1 35  ? -2.372  -9.055  -1.259  1.00 0.00 ? 86  PRO A HB3  2  
ATOM 2522  H HG2  . PRO A 1 35  ? -5.116  -9.121  -0.056  1.00 0.00 ? 86  PRO A HG2  2  
ATOM 2523  H HG3  . PRO A 1 35  ? -4.615  -9.377  -1.738  1.00 0.00 ? 86  PRO A HG3  2  
ATOM 2524  H HD2  . PRO A 1 35  ? -5.157  -11.450 -0.113  1.00 0.00 ? 86  PRO A HD2  2  
ATOM 2525  H HD3  . PRO A 1 35  ? -3.885  -11.534 -1.349  1.00 0.00 ? 86  PRO A HD3  2  
ATOM 2526  N N    . ILE A 1 36  ? -2.368  -7.948  2.313   1.00 0.00 ? 87  ILE A N    2  
ATOM 2527  C CA   . ILE A 1 36  ? -2.641  -7.240  3.598   1.00 0.00 ? 87  ILE A CA   2  
ATOM 2528  C C    . ILE A 1 36  ? -3.245  -5.868  3.308   1.00 0.00 ? 87  ILE A C    2  
ATOM 2529  O O    . ILE A 1 36  ? -3.269  -5.414  2.178   1.00 0.00 ? 87  ILE A O    2  
ATOM 2530  C CB   . ILE A 1 36  ? -1.328  -7.088  4.375   1.00 0.00 ? 87  ILE A CB   2  
ATOM 2531  C CG1  . ILE A 1 36  ? -0.315  -6.279  3.545   1.00 0.00 ? 87  ILE A CG1  2  
ATOM 2532  C CG2  . ILE A 1 36  ? -0.741  -8.477  4.683   1.00 0.00 ? 87  ILE A CG2  2  
ATOM 2533  C CD1  . ILE A 1 36  ? 0.969   -6.076  4.356   1.00 0.00 ? 87  ILE A CD1  2  
ATOM 2534  H H    . ILE A 1 36  ? -1.839  -7.502  1.617   1.00 0.00 ? 87  ILE A H    2  
ATOM 2535  H HA   . ILE A 1 36  ? -3.339  -7.808  4.196   1.00 0.00 ? 87  ILE A HA   2  
ATOM 2536  H HB   . ILE A 1 36  ? -1.525  -6.573  5.302   1.00 0.00 ? 87  ILE A HB   2  
ATOM 2537  H HG12 . ILE A 1 36  ? -0.082  -6.821  2.638   1.00 0.00 ? 87  ILE A HG12 2  
ATOM 2538  H HG13 . ILE A 1 36  ? -0.734  -5.317  3.290   1.00 0.00 ? 87  ILE A HG13 2  
ATOM 2539  H HG21 . ILE A 1 36  ? -1.539  -9.164  4.930   1.00 0.00 ? 87  ILE A HG21 2  
ATOM 2540  H HG22 . ILE A 1 36  ? -0.202  -8.844  3.818   1.00 0.00 ? 87  ILE A HG22 2  
ATOM 2541  H HG23 . ILE A 1 36  ? -0.063  -8.401  5.521   1.00 0.00 ? 87  ILE A HG23 2  
ATOM 2542  H HD11 . ILE A 1 36  ? 0.720   -5.891  5.391   1.00 0.00 ? 87  ILE A HD11 2  
ATOM 2543  H HD12 . ILE A 1 36  ? 1.581   -6.962  4.287   1.00 0.00 ? 87  ILE A HD12 2  
ATOM 2544  H HD13 . ILE A 1 36  ? 1.513   -5.234  3.959   1.00 0.00 ? 87  ILE A HD13 2  
ATOM 2545  N N    . ALA A 1 37  ? -3.748  -5.206  4.320   1.00 0.00 ? 88  ALA A N    2  
ATOM 2546  C CA   . ALA A 1 37  ? -4.365  -3.861  4.131   1.00 0.00 ? 88  ALA A CA   2  
ATOM 2547  C C    . ALA A 1 37  ? -3.637  -2.854  5.017   1.00 0.00 ? 88  ALA A C    2  
ATOM 2548  O O    . ALA A 1 37  ? -3.257  -3.155  6.131   1.00 0.00 ? 88  ALA A O    2  
ATOM 2549  C CB   . ALA A 1 37  ? -5.838  -3.924  4.538   1.00 0.00 ? 88  ALA A CB   2  
ATOM 2550  H H    . ALA A 1 37  ? -3.716  -5.601  5.217   1.00 0.00 ? 88  ALA A H    2  
ATOM 2551  H HA   . ALA A 1 37  ? -4.290  -3.549  3.098   1.00 0.00 ? 88  ALA A HA   2  
ATOM 2552  H HB1  . ALA A 1 37  ? -5.938  -4.533  5.425   1.00 0.00 ? 88  ALA A HB1  2  
ATOM 2553  H HB2  . ALA A 1 37  ? -6.206  -2.930  4.736   1.00 0.00 ? 88  ALA A HB2  2  
ATOM 2554  H HB3  . ALA A 1 37  ? -6.412  -4.363  3.735   1.00 0.00 ? 88  ALA A HB3  2  
ATOM 2555  N N    . PHE A 1 38  ? -3.454  -1.655  4.529   1.00 0.00 ? 89  PHE A N    2  
ATOM 2556  C CA   . PHE A 1 38  ? -2.764  -0.592  5.322   1.00 0.00 ? 89  PHE A CA   2  
ATOM 2557  C C    . PHE A 1 38  ? -3.715  0.592   5.466   1.00 0.00 ? 89  PHE A C    2  
ATOM 2558  O O    . PHE A 1 38  ? -4.796  0.591   4.913   1.00 0.00 ? 89  PHE A O    2  
ATOM 2559  C CB   . PHE A 1 38  ? -1.472  -0.147  4.618   1.00 0.00 ? 89  PHE A CB   2  
ATOM 2560  C CG   . PHE A 1 38  ? -1.775  0.546   3.306   1.00 0.00 ? 89  PHE A CG   2  
ATOM 2561  C CD1  . PHE A 1 38  ? -2.281  -0.185  2.225   1.00 0.00 ? 89  PHE A CD1  2  
ATOM 2562  C CD2  . PHE A 1 38  ? -1.537  1.921   3.166   1.00 0.00 ? 89  PHE A CD2  2  
ATOM 2563  C CE1  . PHE A 1 38  ? -2.547  0.457   1.004   1.00 0.00 ? 89  PHE A CE1  2  
ATOM 2564  C CE2  . PHE A 1 38  ? -1.799  2.563   1.950   1.00 0.00 ? 89  PHE A CE2  2  
ATOM 2565  C CZ   . PHE A 1 38  ? -2.304  1.830   0.867   1.00 0.00 ? 89  PHE A CZ   2  
ATOM 2566  H H    . PHE A 1 38  ? -3.787  -1.445  3.631   1.00 0.00 ? 89  PHE A H    2  
ATOM 2567  H HA   . PHE A 1 38  ? -2.523  -0.964  6.311   1.00 0.00 ? 89  PHE A HA   2  
ATOM 2568  H HB2  . PHE A 1 38  ? -0.937  0.531   5.266   1.00 0.00 ? 89  PHE A HB2  2  
ATOM 2569  H HB3  . PHE A 1 38  ? -0.854  -1.016  4.428   1.00 0.00 ? 89  PHE A HB3  2  
ATOM 2570  H HD1  . PHE A 1 38  ? -2.467  -1.245  2.332   1.00 0.00 ? 89  PHE A HD1  2  
ATOM 2571  H HD2  . PHE A 1 38  ? -1.146  2.486   3.998   1.00 0.00 ? 89  PHE A HD2  2  
ATOM 2572  H HE1  . PHE A 1 38  ? -2.938  -0.109  0.171   1.00 0.00 ? 89  PHE A HE1  2  
ATOM 2573  H HE2  . PHE A 1 38  ? -1.614  3.620   1.847   1.00 0.00 ? 89  PHE A HE2  2  
ATOM 2574  H HZ   . PHE A 1 38  ? -2.507  2.328   -0.072  1.00 0.00 ? 89  PHE A HZ   2  
ATOM 2575  N N    . LYS A 1 39  ? -3.329  1.593   6.216   1.00 0.00 ? 90  LYS A N    2  
ATOM 2576  C CA   . LYS A 1 39  ? -4.215  2.788   6.410   1.00 0.00 ? 90  LYS A CA   2  
ATOM 2577  C C    . LYS A 1 39  ? -3.446  4.050   6.037   1.00 0.00 ? 90  LYS A C    2  
ATOM 2578  O O    . LYS A 1 39  ? -2.232  4.091   6.100   1.00 0.00 ? 90  LYS A O    2  
ATOM 2579  C CB   . LYS A 1 39  ? -4.663  2.850   7.873   1.00 0.00 ? 90  LYS A CB   2  
ATOM 2580  C CG   . LYS A 1 39  ? -3.483  3.164   8.790   1.00 0.00 ? 90  LYS A CG   2  
ATOM 2581  C CD   . LYS A 1 39  ? -3.955  3.029   10.240  1.00 0.00 ? 90  LYS A CD   2  
ATOM 2582  C CE   . LYS A 1 39  ? -2.895  3.560   11.200  1.00 0.00 ? 90  LYS A CE   2  
ATOM 2583  N NZ   . LYS A 1 39  ? -3.538  3.826   12.519  1.00 0.00 ? 90  LYS A NZ   2  
ATOM 2584  H H    . LYS A 1 39  ? -2.454  1.562   6.656   1.00 0.00 ? 90  LYS A H    2  
ATOM 2585  H HA   . LYS A 1 39  ? -5.087  2.713   5.776   1.00 0.00 ? 90  LYS A HA   2  
ATOM 2586  H HB2  . LYS A 1 39  ? -5.413  3.618   7.985   1.00 0.00 ? 90  LYS A HB2  2  
ATOM 2587  H HB3  . LYS A 1 39  ? -5.080  1.897   8.153   1.00 0.00 ? 90  LYS A HB3  2  
ATOM 2588  H HG2  . LYS A 1 39  ? -2.689  2.459   8.599   1.00 0.00 ? 90  LYS A HG2  2  
ATOM 2589  H HG3  . LYS A 1 39  ? -3.137  4.171   8.613   1.00 0.00 ? 90  LYS A HG3  2  
ATOM 2590  H HD2  . LYS A 1 39  ? -4.866  3.594   10.370  1.00 0.00 ? 90  LYS A HD2  2  
ATOM 2591  H HD3  . LYS A 1 39  ? -4.143  1.989   10.457  1.00 0.00 ? 90  LYS A HD3  2  
ATOM 2592  H HE2  . LYS A 1 39  ? -2.117  2.819   11.321  1.00 0.00 ? 90  LYS A HE2  2  
ATOM 2593  H HE3  . LYS A 1 39  ? -2.472  4.475   10.812  1.00 0.00 ? 90  LYS A HE3  2  
ATOM 2594  H HZ1  . LYS A 1 39  ? -4.288  3.124   12.687  1.00 0.00 ? 90  LYS A HZ1  2  
ATOM 2595  H HZ2  . LYS A 1 39  ? -2.825  3.760   13.274  1.00 0.00 ? 90  LYS A HZ2  2  
ATOM 2596  H HZ3  . LYS A 1 39  ? -3.953  4.779   12.516  1.00 0.00 ? 90  LYS A HZ3  2  
ATOM 2597  N N    . VAL A 1 40  ? -4.149  5.082   5.634   1.00 0.00 ? 91  VAL A N    2  
ATOM 2598  C CA   . VAL A 1 40  ? -3.471  6.352   5.229   1.00 0.00 ? 91  VAL A CA   2  
ATOM 2599  C C    . VAL A 1 40  ? -3.743  7.442   6.263   1.00 0.00 ? 91  VAL A C    2  
ATOM 2600  O O    . VAL A 1 40  ? -4.865  7.696   6.619   1.00 0.00 ? 91  VAL A O    2  
ATOM 2601  C CB   . VAL A 1 40  ? -4.034  6.808   3.873   1.00 0.00 ? 91  VAL A CB   2  
ATOM 2602  C CG1  . VAL A 1 40  ? -3.195  7.972   3.343   1.00 0.00 ? 91  VAL A CG1  2  
ATOM 2603  C CG2  . VAL A 1 40  ? -3.988  5.645   2.873   1.00 0.00 ? 91  VAL A CG2  2  
ATOM 2604  H H    . VAL A 1 40  ? -5.124  5.015   5.583   1.00 0.00 ? 91  VAL A H    2  
ATOM 2605  H HA   . VAL A 1 40  ? -2.409  6.200   5.137   1.00 0.00 ? 91  VAL A HA   2  
ATOM 2606  H HB   . VAL A 1 40  ? -5.057  7.132   4.002   1.00 0.00 ? 91  VAL A HB   2  
ATOM 2607  H HG11 . VAL A 1 40  ? -3.180  8.764   4.073   1.00 0.00 ? 91  VAL A HG11 2  
ATOM 2608  H HG12 . VAL A 1 40  ? -2.189  7.635   3.157   1.00 0.00 ? 91  VAL A HG12 2  
ATOM 2609  H HG13 . VAL A 1 40  ? -3.628  8.340   2.425   1.00 0.00 ? 91  VAL A HG13 2  
ATOM 2610  H HG21 . VAL A 1 40  ? -3.056  5.112   2.975   1.00 0.00 ? 91  VAL A HG21 2  
ATOM 2611  H HG22 . VAL A 1 40  ? -4.811  4.972   3.068   1.00 0.00 ? 91  VAL A HG22 2  
ATOM 2612  H HG23 . VAL A 1 40  ? -4.071  6.031   1.866   1.00 0.00 ? 91  VAL A HG23 2  
ATOM 2613  N N    . VAL A 1 41  ? -2.714  8.101   6.726   1.00 0.00 ? 92  VAL A N    2  
ATOM 2614  C CA   . VAL A 1 41  ? -2.882  9.208   7.723   1.00 0.00 ? 92  VAL A CA   2  
ATOM 2615  C C    . VAL A 1 41  ? -2.632  10.532  7.011   1.00 0.00 ? 92  VAL A C    2  
ATOM 2616  O O    . VAL A 1 41  ? -1.657  10.679  6.299   1.00 0.00 ? 92  VAL A O    2  
ATOM 2617  C CB   . VAL A 1 41  ? -1.864  9.046   8.860   1.00 0.00 ? 92  VAL A CB   2  
ATOM 2618  C CG1  . VAL A 1 41  ? -2.028  10.184  9.869   1.00 0.00 ? 92  VAL A CG1  2  
ATOM 2619  C CG2  . VAL A 1 41  ? -2.104  7.708   9.563   1.00 0.00 ? 92  VAL A CG2  2  
ATOM 2620  H H    . VAL A 1 41  ? -1.822  7.880   6.400   1.00 0.00 ? 92  VAL A H    2  
ATOM 2621  H HA   . VAL A 1 41  ? -3.887  9.200   8.128   1.00 0.00 ? 92  VAL A HA   2  
ATOM 2622  H HB   . VAL A 1 41  ? -0.862  9.068   8.455   1.00 0.00 ? 92  VAL A HB   2  
ATOM 2623  H HG11 . VAL A 1 41  ? -3.072  10.280  10.137  1.00 0.00 ? 92  VAL A HG11 2  
ATOM 2624  H HG12 . VAL A 1 41  ? -1.446  9.967   10.754  1.00 0.00 ? 92  VAL A HG12 2  
ATOM 2625  H HG13 . VAL A 1 41  ? -1.681  11.109  9.432   1.00 0.00 ? 92  VAL A HG13 2  
ATOM 2626  H HG21 . VAL A 1 41  ? -3.160  7.581   9.746   1.00 0.00 ? 92  VAL A HG21 2  
ATOM 2627  H HG22 . VAL A 1 41  ? -1.751  6.905   8.935   1.00 0.00 ? 92  VAL A HG22 2  
ATOM 2628  H HG23 . VAL A 1 41  ? -1.574  7.694   10.505  1.00 0.00 ? 92  VAL A HG23 2  
ATOM 2629  N N    . ALA A 1 42  ? -3.513  11.487  7.180   1.00 0.00 ? 93  ALA A N    2  
ATOM 2630  C CA   . ALA A 1 42  ? -3.345  12.806  6.497   1.00 0.00 ? 93  ALA A CA   2  
ATOM 2631  C C    . ALA A 1 42  ? -3.342  13.910  7.545   1.00 0.00 ? 93  ALA A C    2  
ATOM 2632  O O    . ALA A 1 42  ? -4.190  13.975  8.412   1.00 0.00 ? 93  ALA A O    2  
ATOM 2633  C CB   . ALA A 1 42  ? -4.495  13.007  5.511   1.00 0.00 ? 93  ALA A CB   2  
ATOM 2634  H H    . ALA A 1 42  ? -4.296  11.335  7.750   1.00 0.00 ? 93  ALA A H    2  
ATOM 2635  H HA   . ALA A 1 42  ? -2.407  12.834  5.960   1.00 0.00 ? 93  ALA A HA   2  
ATOM 2636  H HB1  . ALA A 1 42  ? -4.525  12.165  4.831   1.00 0.00 ? 93  ALA A HB1  2  
ATOM 2637  H HB2  . ALA A 1 42  ? -5.431  13.073  6.049   1.00 0.00 ? 93  ALA A HB2  2  
ATOM 2638  H HB3  . ALA A 1 42  ? -4.336  13.915  4.949   1.00 0.00 ? 93  ALA A HB3  2  
ATOM 2639  N N    . LEU A 1 43  ? -2.370  14.769  7.471   1.00 0.00 ? 94  LEU A N    2  
ATOM 2640  C CA   . LEU A 1 43  ? -2.266  15.881  8.458   1.00 0.00 ? 94  LEU A CA   2  
ATOM 2641  C C    . LEU A 1 43  ? -2.819  17.161  7.848   1.00 0.00 ? 94  LEU A C    2  
ATOM 2642  O O    . LEU A 1 43  ? -2.750  18.216  8.440   1.00 0.00 ? 94  LEU A O    2  
ATOM 2643  C CB   . LEU A 1 43  ? -0.792  16.072  8.821   1.00 0.00 ? 94  LEU A CB   2  
ATOM 2644  C CG   . LEU A 1 43  ? -0.181  14.731  9.258   1.00 0.00 ? 94  LEU A CG   2  
ATOM 2645  C CD1  . LEU A 1 43  ? 1.272   14.945  9.705   1.00 0.00 ? 94  LEU A CD1  2  
ATOM 2646  C CD2  . LEU A 1 43  ? -0.975  14.127  10.421  1.00 0.00 ? 94  LEU A CD2  2  
ATOM 2647  H H    . LEU A 1 43  ? -1.696  14.683  6.764   1.00 0.00 ? 94  LEU A H    2  
ATOM 2648  H HA   . LEU A 1 43  ? -2.827  15.645  9.349   1.00 0.00 ? 94  LEU A HA   2  
ATOM 2649  H HB2  . LEU A 1 43  ? -0.259  16.440  7.955   1.00 0.00 ? 94  LEU A HB2  2  
ATOM 2650  H HB3  . LEU A 1 43  ? -0.710  16.787  9.627   1.00 0.00 ? 94  LEU A HB3  2  
ATOM 2651  H HG   . LEU A 1 43  ? -0.200  14.044  8.419   1.00 0.00 ? 94  LEU A HG   2  
ATOM 2652  H HD11 . LEU A 1 43  ? 1.313   15.755  10.419  1.00 0.00 ? 94  LEU A HD11 2  
ATOM 2653  H HD12 . LEU A 1 43  ? 1.640   14.040  10.166  1.00 0.00 ? 94  LEU A HD12 2  
ATOM 2654  H HD13 . LEU A 1 43  ? 1.883   15.190  8.849   1.00 0.00 ? 94  LEU A HD13 2  
ATOM 2655  H HD21 . LEU A 1 43  ? -1.201  14.895  11.145  1.00 0.00 ? 94  LEU A HD21 2  
ATOM 2656  H HD22 . LEU A 1 43  ? -1.895  13.698  10.050  1.00 0.00 ? 94  LEU A HD22 2  
ATOM 2657  H HD23 . LEU A 1 43  ? -0.387  13.351  10.892  1.00 0.00 ? 94  LEU A HD23 2  
ATOM 2658  N N    . GLY A 1 44  ? -3.374  17.085  6.668   1.00 0.00 ? 95  GLY A N    2  
ATOM 2659  C CA   . GLY A 1 44  ? -3.931  18.316  6.029   1.00 0.00 ? 95  GLY A CA   2  
ATOM 2660  C C    . GLY A 1 44  ? -5.396  18.462  6.398   1.00 0.00 ? 95  GLY A C    2  
ATOM 2661  O O    . GLY A 1 44  ? -5.894  17.808  7.295   1.00 0.00 ? 95  GLY A O    2  
ATOM 2662  H H    . GLY A 1 44  ? -3.424  16.223  6.203   1.00 0.00 ? 95  GLY A H    2  
ATOM 2663  H HA2  . GLY A 1 44  ? -3.392  19.187  6.376   1.00 0.00 ? 95  GLY A HA2  2  
ATOM 2664  H HA3  . GLY A 1 44  ? -3.847  18.240  4.956   1.00 0.00 ? 95  GLY A HA3  2  
ATOM 2665  N N    . ASP A 1 45  ? -6.096  19.320  5.709   1.00 0.00 ? 96  ASP A N    2  
ATOM 2666  C CA   . ASP A 1 45  ? -7.539  19.515  6.006   1.00 0.00 ? 96  ASP A CA   2  
ATOM 2667  C C    . ASP A 1 45  ? -8.353  18.573  5.128   1.00 0.00 ? 96  ASP A C    2  
ATOM 2668  O O    . ASP A 1 45  ? -8.457  18.753  3.930   1.00 0.00 ? 96  ASP A O    2  
ATOM 2669  C CB   . ASP A 1 45  ? -7.923  20.968  5.702   1.00 0.00 ? 96  ASP A CB   2  
ATOM 2670  C CG   . ASP A 1 45  ? -7.103  21.899  6.591   1.00 0.00 ? 96  ASP A CG   2  
ATOM 2671  O OD1  . ASP A 1 45  ? -6.339  21.394  7.400   1.00 0.00 ? 96  ASP A OD1  2  
ATOM 2672  O OD2  . ASP A 1 45  ? -7.253  23.103  6.456   1.00 0.00 ? 96  ASP A OD2  2  
ATOM 2673  H H    . ASP A 1 45  ? -5.671  19.832  4.989   1.00 0.00 ? 96  ASP A H    2  
ATOM 2674  H HA   . ASP A 1 45  ? -7.733  19.301  7.048   1.00 0.00 ? 96  ASP A HA   2  
ATOM 2675  H HB2  . ASP A 1 45  ? -7.720  21.189  4.662   1.00 0.00 ? 96  ASP A HB2  2  
ATOM 2676  H HB3  . ASP A 1 45  ? -8.974  21.113  5.905   1.00 0.00 ? 96  ASP A HB3  2  
ATOM 2677  N N    . VAL A 1 46  ? -8.935  17.564  5.708   1.00 0.00 ? 97  VAL A N    2  
ATOM 2678  C CA   . VAL A 1 46  ? -9.732  16.620  4.895   1.00 0.00 ? 97  VAL A CA   2  
ATOM 2679  C C    . VAL A 1 46  ? -10.590 15.725  5.803   1.00 0.00 ? 97  VAL A C    2  
ATOM 2680  O O    . VAL A 1 46  ? -10.720 14.546  5.561   1.00 0.00 ? 97  VAL A O    2  
ATOM 2681  C CB   . VAL A 1 46  ? -8.758  15.759  4.083   1.00 0.00 ? 97  VAL A CB   2  
ATOM 2682  C CG1  . VAL A 1 46  ? -7.928  14.892  5.040   1.00 0.00 ? 97  VAL A CG1  2  
ATOM 2683  C CG2  . VAL A 1 46  ? -9.519  14.856  3.088   1.00 0.00 ? 97  VAL A CG2  2  
ATOM 2684  H H    . VAL A 1 46  ? -8.834  17.425  6.673   1.00 0.00 ? 97  VAL A H    2  
ATOM 2685  H HA   . VAL A 1 46  ? -10.362 17.175  4.221   1.00 0.00 ? 97  VAL A HA   2  
ATOM 2686  H HB   . VAL A 1 46  ? -8.094  16.410  3.536   1.00 0.00 ? 97  VAL A HB   2  
ATOM 2687  H HG11 . VAL A 1 46  ? -7.740  15.430  5.960   1.00 0.00 ? 97  VAL A HG11 2  
ATOM 2688  H HG12 . VAL A 1 46  ? -8.464  13.983  5.259   1.00 0.00 ? 97  VAL A HG12 2  
ATOM 2689  H HG13 . VAL A 1 46  ? -6.985  14.646  4.574   1.00 0.00 ? 97  VAL A HG13 2  
ATOM 2690  H HG21 . VAL A 1 46  ? -10.398 15.364  2.728   1.00 0.00 ? 97  VAL A HG21 2  
ATOM 2691  H HG22 . VAL A 1 46  ? -8.872  14.625  2.254   1.00 0.00 ? 97  VAL A HG22 2  
ATOM 2692  H HG23 . VAL A 1 46  ? -9.809  13.931  3.571   1.00 0.00 ? 97  VAL A HG23 2  
ATOM 2693  N N    . PRO A 1 47  ? -11.186 16.259  6.844   1.00 0.00 ? 98  PRO A N    2  
ATOM 2694  C CA   . PRO A 1 47  ? -12.034 15.440  7.761   1.00 0.00 ? 98  PRO A CA   2  
ATOM 2695  C C    . PRO A 1 47  ? -13.338 15.034  7.077   1.00 0.00 ? 98  PRO A C    2  
ATOM 2696  O O    . PRO A 1 47  ? -14.098 14.228  7.582   1.00 0.00 ? 98  PRO A O    2  
ATOM 2697  C CB   . PRO A 1 47  ? -12.311 16.380  8.938   1.00 0.00 ? 98  PRO A CB   2  
ATOM 2698  C CG   . PRO A 1 47  ? -12.219 17.751  8.350   1.00 0.00 ? 98  PRO A CG   2  
ATOM 2699  C CD   . PRO A 1 47  ? -11.136 17.677  7.271   1.00 0.00 ? 98  PRO A CD   2  
ATOM 2700  H HA   . PRO A 1 47  ? -11.497 14.566  8.098   1.00 0.00 ? 98  PRO A HA   2  
ATOM 2701  H HB2  . PRO A 1 47  ? -13.300 16.204  9.345   1.00 0.00 ? 98  PRO A HB2  2  
ATOM 2702  H HB3  . PRO A 1 47  ? -11.563 16.253  9.704   1.00 0.00 ? 98  PRO A HB3  2  
ATOM 2703  H HG2  . PRO A 1 47  ? -13.169 18.029  7.907   1.00 0.00 ? 98  PRO A HG2  2  
ATOM 2704  H HG3  . PRO A 1 47  ? -11.936 18.467  9.108   1.00 0.00 ? 98  PRO A HG3  2  
ATOM 2705  H HD2  . PRO A 1 47  ? -11.372 18.341  6.447   1.00 0.00 ? 98  PRO A HD2  2  
ATOM 2706  H HD3  . PRO A 1 47  ? -10.172 17.912  7.693   1.00 0.00 ? 98  PRO A HD3  2  
ATOM 2707  N N    . ASP A 1 48  ? -13.594 15.597  5.937   1.00 0.00 ? 99  ASP A N    2  
ATOM 2708  C CA   . ASP A 1 48  ? -14.838 15.276  5.200   1.00 0.00 ? 99  ASP A CA   2  
ATOM 2709  C C    . ASP A 1 48  ? -14.687 13.898  4.564   1.00 0.00 ? 99  ASP A C    2  
ATOM 2710  O O    . ASP A 1 48  ? -13.641 13.286  4.637   1.00 0.00 ? 99  ASP A O    2  
ATOM 2711  C CB   . ASP A 1 48  ? -15.057 16.329  4.114   1.00 0.00 ? 99  ASP A CB   2  
ATOM 2712  C CG   . ASP A 1 48  ? -14.016 16.157  3.004   1.00 0.00 ? 99  ASP A CG   2  
ATOM 2713  O OD1  . ASP A 1 48  ? -12.923 15.702  3.309   1.00 0.00 ? 99  ASP A OD1  2  
ATOM 2714  O OD2  . ASP A 1 48  ? -14.327 16.474  1.870   1.00 0.00 ? 99  ASP A OD2  2  
ATOM 2715  H H    . ASP A 1 48  ? -12.962 16.245  5.564   1.00 0.00 ? 99  ASP A H    2  
ATOM 2716  H HA   . ASP A 1 48  ? -15.677 15.273  5.881   1.00 0.00 ? 99  ASP A HA   2  
ATOM 2717  H HB2  . ASP A 1 48  ? -16.049 16.220  3.700   1.00 0.00 ? 99  ASP A HB2  2  
ATOM 2718  H HB3  . ASP A 1 48  ? -14.954 17.314  4.545   1.00 0.00 ? 99  ASP A HB3  2  
ATOM 2719  N N    . GLY A 1 49  ? -15.715 13.407  3.935   1.00 0.00 ? 100 GLY A N    2  
ATOM 2720  C CA   . GLY A 1 49  ? -15.618 12.070  3.291   1.00 0.00 ? 100 GLY A CA   2  
ATOM 2721  C C    . GLY A 1 49  ? -15.136 12.244  1.850   1.00 0.00 ? 100 GLY A C    2  
ATOM 2722  O O    . GLY A 1 49  ? -15.839 12.794  1.029   1.00 0.00 ? 100 GLY A O    2  
ATOM 2723  H H    . GLY A 1 49  ? -16.550 13.919  3.882   1.00 0.00 ? 100 GLY A H    2  
ATOM 2724  H HA2  . GLY A 1 49  ? -14.927 11.455  3.840   1.00 0.00 ? 100 GLY A HA2  2  
ATOM 2725  H HA3  . GLY A 1 49  ? -16.588 11.601  3.287   1.00 0.00 ? 100 GLY A HA3  2  
ATOM 2726  N N    . THR A 1 50  ? -13.942 11.781  1.535   1.00 0.00 ? 101 THR A N    2  
ATOM 2727  C CA   . THR A 1 50  ? -13.407 11.930  0.129   1.00 0.00 ? 101 THR A CA   2  
ATOM 2728  C C    . THR A 1 50  ? -13.130 10.550  -0.464  1.00 0.00 ? 101 THR A C    2  
ATOM 2729  O O    . THR A 1 50  ? -13.714 9.564   -0.067  1.00 0.00 ? 101 THR A O    2  
ATOM 2730  C CB   . THR A 1 50  ? -12.113 12.765  0.128   1.00 0.00 ? 101 THR A CB   2  
ATOM 2731  O OG1  . THR A 1 50  ? -11.543 12.753  -1.177  1.00 0.00 ? 101 THR A OG1  2  
ATOM 2732  C CG2  . THR A 1 50  ? -11.092 12.192  1.111   1.00 0.00 ? 101 THR A CG2  2  
ATOM 2733  H H    . THR A 1 50  ? -13.391 11.339  2.223   1.00 0.00 ? 101 THR A H    2  
ATOM 2734  H HA   . THR A 1 50  ? -14.144 12.427  -0.488  1.00 0.00 ? 101 THR A HA   2  
ATOM 2735  H HB   . THR A 1 50  ? -12.342 13.783  0.407   1.00 0.00 ? 101 THR A HB   2  
ATOM 2736  H HG1  . THR A 1 50  ? -12.066 13.327  -1.738  1.00 0.00 ? 101 THR A HG1  2  
ATOM 2737  H HG21 . THR A 1 50  ? -11.062 11.117  1.013   1.00 0.00 ? 101 THR A HG21 2  
ATOM 2738  H HG22 . THR A 1 50  ? -10.116 12.602  0.891   1.00 0.00 ? 101 THR A HG22 2  
ATOM 2739  H HG23 . THR A 1 50  ? -11.376 12.459  2.118   1.00 0.00 ? 101 THR A HG23 2  
ATOM 2740  N N    . LEU A 1 51  ? -12.247 10.479  -1.432  1.00 0.00 ? 102 LEU A N    2  
ATOM 2741  C CA   . LEU A 1 51  ? -11.936 9.165   -2.073  1.00 0.00 ? 102 LEU A CA   2  
ATOM 2742  C C    . LEU A 1 51  ? -10.428 9.081   -2.326  1.00 0.00 ? 102 LEU A C    2  
ATOM 2743  O O    . LEU A 1 51  ? -9.800  10.046  -2.713  1.00 0.00 ? 102 LEU A O    2  
ATOM 2744  C CB   . LEU A 1 51  ? -12.712 9.072   -3.399  1.00 0.00 ? 102 LEU A CB   2  
ATOM 2745  C CG   . LEU A 1 51  ? -12.691 7.624   -3.959  1.00 0.00 ? 102 LEU A CG   2  
ATOM 2746  C CD1  . LEU A 1 51  ? -13.978 7.350   -4.746  1.00 0.00 ? 102 LEU A CD1  2  
ATOM 2747  C CD2  . LEU A 1 51  ? -11.503 7.428   -4.908  1.00 0.00 ? 102 LEU A CD2  2  
ATOM 2748  H H    . LEU A 1 51  ? -11.801 11.290  -1.744  1.00 0.00 ? 102 LEU A H    2  
ATOM 2749  H HA   . LEU A 1 51  ? -12.228 8.364   -1.427  1.00 0.00 ? 102 LEU A HA   2  
ATOM 2750  H HB2  . LEU A 1 51  ? -13.737 9.380   -3.220  1.00 0.00 ? 102 LEU A HB2  2  
ATOM 2751  H HB3  . LEU A 1 51  ? -12.265 9.747   -4.117  1.00 0.00 ? 102 LEU A HB3  2  
ATOM 2752  H HG   . LEU A 1 51  ? -12.621 6.917   -3.147  1.00 0.00 ? 102 LEU A HG   2  
ATOM 2753  H HD11 . LEU A 1 51  ? -14.145 8.150   -5.453  1.00 0.00 ? 102 LEU A HD11 2  
ATOM 2754  H HD12 . LEU A 1 51  ? -13.882 6.414   -5.274  1.00 0.00 ? 102 LEU A HD12 2  
ATOM 2755  H HD13 . LEU A 1 51  ? -14.812 7.294   -4.061  1.00 0.00 ? 102 LEU A HD13 2  
ATOM 2756  H HD21 . LEU A 1 51  ? -11.516 8.194   -5.669  1.00 0.00 ? 102 LEU A HD21 2  
ATOM 2757  H HD22 . LEU A 1 51  ? -10.581 7.484   -4.352  1.00 0.00 ? 102 LEU A HD22 2  
ATOM 2758  H HD23 . LEU A 1 51  ? -11.582 6.457   -5.375  1.00 0.00 ? 102 LEU A HD23 2  
ATOM 2759  N N    . VAL A 1 52  ? -9.846  7.926   -2.089  1.00 0.00 ? 103 VAL A N    2  
ATOM 2760  C CA   . VAL A 1 52  ? -8.367  7.748   -2.291  1.00 0.00 ? 103 VAL A CA   2  
ATOM 2761  C C    . VAL A 1 52  ? -8.139  6.716   -3.391  1.00 0.00 ? 103 VAL A C    2  
ATOM 2762  O O    . VAL A 1 52  ? -8.688  5.637   -3.351  1.00 0.00 ? 103 VAL A O    2  
ATOM 2763  C CB   . VAL A 1 52  ? -7.760  7.231   -0.980  1.00 0.00 ? 103 VAL A CB   2  
ATOM 2764  C CG1  . VAL A 1 52  ? -6.230  7.131   -1.105  1.00 0.00 ? 103 VAL A CG1  2  
ATOM 2765  C CG2  . VAL A 1 52  ? -8.130  8.184   0.165   1.00 0.00 ? 103 VAL A CG2  2  
ATOM 2766  H H    . VAL A 1 52  ? -10.382 7.171   -1.768  1.00 0.00 ? 103 VAL A H    2  
ATOM 2767  H HA   . VAL A 1 52  ? -7.902  8.687   -2.560  1.00 0.00 ? 103 VAL A HA   2  
ATOM 2768  H HB   . VAL A 1 52  ? -8.162  6.248   -0.773  1.00 0.00 ? 103 VAL A HB   2  
ATOM 2769  H HG11 . VAL A 1 52  ? -5.853  7.999   -1.627  1.00 0.00 ? 103 VAL A HG11 2  
ATOM 2770  H HG12 . VAL A 1 52  ? -5.790  7.085   -0.118  1.00 0.00 ? 103 VAL A HG12 2  
ATOM 2771  H HG13 . VAL A 1 52  ? -5.967  6.238   -1.653  1.00 0.00 ? 103 VAL A HG13 2  
ATOM 2772  H HG21 . VAL A 1 52  ? -8.117  9.204   -0.188  1.00 0.00 ? 103 VAL A HG21 2  
ATOM 2773  H HG22 . VAL A 1 52  ? -9.121  7.943   0.527   1.00 0.00 ? 103 VAL A HG22 2  
ATOM 2774  H HG23 . VAL A 1 52  ? -7.424  8.074   0.973   1.00 0.00 ? 103 VAL A HG23 2  
ATOM 2775  N N    . THR A 1 53  ? -7.322  7.030   -4.367  1.00 0.00 ? 104 THR A N    2  
ATOM 2776  C CA   . THR A 1 53  ? -7.049  6.061   -5.478  1.00 0.00 ? 104 THR A CA   2  
ATOM 2777  C C    . THR A 1 53  ? -5.565  5.697   -5.461  1.00 0.00 ? 104 THR A C    2  
ATOM 2778  O O    . THR A 1 53  ? -4.721  6.550   -5.276  1.00 0.00 ? 104 THR A O    2  
ATOM 2779  C CB   . THR A 1 53  ? -7.393  6.733   -6.819  1.00 0.00 ? 104 THR A CB   2  
ATOM 2780  O OG1  . THR A 1 53  ? -6.523  7.837   -7.029  1.00 0.00 ? 104 THR A OG1  2  
ATOM 2781  C CG2  . THR A 1 53  ? -8.837  7.224   -6.791  1.00 0.00 ? 104 THR A CG2  2  
ATOM 2782  H H    . THR A 1 53  ? -6.878  7.910   -4.368  1.00 0.00 ? 104 THR A H    2  
ATOM 2783  H HA   . THR A 1 53  ? -7.650  5.162   -5.359  1.00 0.00 ? 104 THR A HA   2  
ATOM 2784  H HB   . THR A 1 53  ? -7.274  6.028   -7.624  1.00 0.00 ? 104 THR A HB   2  
ATOM 2785  H HG1  . THR A 1 53  ? -6.774  8.258   -7.857  1.00 0.00 ? 104 THR A HG1  2  
ATOM 2786  H HG21 . THR A 1 53  ? -9.487  6.416   -6.495  1.00 0.00 ? 104 THR A HG21 2  
ATOM 2787  H HG22 . THR A 1 53  ? -8.929  8.035   -6.086  1.00 0.00 ? 104 THR A HG22 2  
ATOM 2788  H HG23 . THR A 1 53  ? -9.119  7.569   -7.777  1.00 0.00 ? 104 THR A HG23 2  
ATOM 2789  N N    . VAL A 1 54  ? -5.234  4.440   -5.650  1.00 0.00 ? 105 VAL A N    2  
ATOM 2790  C CA   . VAL A 1 54  ? -3.793  4.026   -5.639  1.00 0.00 ? 105 VAL A CA   2  
ATOM 2791  C C    . VAL A 1 54  ? -3.504  2.999   -6.743  1.00 0.00 ? 105 VAL A C    2  
ATOM 2792  O O    . VAL A 1 54  ? -4.346  2.208   -7.119  1.00 0.00 ? 105 VAL A O    2  
ATOM 2793  C CB   . VAL A 1 54  ? -3.436  3.419   -4.272  1.00 0.00 ? 105 VAL A CB   2  
ATOM 2794  C CG1  . VAL A 1 54  ? -4.381  2.262   -3.938  1.00 0.00 ? 105 VAL A CG1  2  
ATOM 2795  C CG2  . VAL A 1 54  ? -1.995  2.895   -4.323  1.00 0.00 ? 105 VAL A CG2  2  
ATOM 2796  H H    . VAL A 1 54  ? -5.938  3.770   -5.792  1.00 0.00 ? 105 VAL A H    2  
ATOM 2797  H HA   . VAL A 1 54  ? -3.168  4.894   -5.806  1.00 0.00 ? 105 VAL A HA   2  
ATOM 2798  H HB   . VAL A 1 54  ? -3.521  4.176   -3.507  1.00 0.00 ? 105 VAL A HB   2  
ATOM 2799  H HG11 . VAL A 1 54  ? -4.479  1.612   -4.796  1.00 0.00 ? 105 VAL A HG11 2  
ATOM 2800  H HG12 . VAL A 1 54  ? -3.980  1.698   -3.106  1.00 0.00 ? 105 VAL A HG12 2  
ATOM 2801  H HG13 . VAL A 1 54  ? -5.349  2.654   -3.667  1.00 0.00 ? 105 VAL A HG13 2  
ATOM 2802  H HG21 . VAL A 1 54  ? -1.363  3.623   -4.810  1.00 0.00 ? 105 VAL A HG21 2  
ATOM 2803  H HG22 . VAL A 1 54  ? -1.637  2.721   -3.321  1.00 0.00 ? 105 VAL A HG22 2  
ATOM 2804  H HG23 . VAL A 1 54  ? -1.973  1.968   -4.877  1.00 0.00 ? 105 VAL A HG23 2  
ATOM 2805  N N    . MET A 1 55  ? -2.296  3.004   -7.238  1.00 0.00 ? 106 MET A N    2  
ATOM 2806  C CA   . MET A 1 55  ? -1.877  2.042   -8.301  1.00 0.00 ? 106 MET A CA   2  
ATOM 2807  C C    . MET A 1 55  ? -0.480  1.561   -7.946  1.00 0.00 ? 106 MET A C    2  
ATOM 2808  O O    . MET A 1 55  ? 0.187   2.168   -7.134  1.00 0.00 ? 106 MET A O    2  
ATOM 2809  C CB   . MET A 1 55  ? -1.862  2.727   -9.661  1.00 0.00 ? 106 MET A CB   2  
ATOM 2810  C CG   . MET A 1 55  ? -1.037  4.013   -9.561  1.00 0.00 ? 106 MET A CG   2  
ATOM 2811  S SD   . MET A 1 55  ? -1.120  4.927   -11.121 1.00 0.00 ? 106 MET A SD   2  
ATOM 2812  C CE   . MET A 1 55  ? 0.431   4.325   -11.834 1.00 0.00 ? 106 MET A CE   2  
ATOM 2813  H H    . MET A 1 55  ? -1.640  3.647   -6.894  1.00 0.00 ? 106 MET A H    2  
ATOM 2814  H HA   . MET A 1 55  ? -2.548  1.198   -8.324  1.00 0.00 ? 106 MET A HA   2  
ATOM 2815  H HB2  . MET A 1 55  ? -1.415  2.062   -10.386 1.00 0.00 ? 106 MET A HB2  2  
ATOM 2816  H HB3  . MET A 1 55  ? -2.872  2.963   -9.958  1.00 0.00 ? 106 MET A HB3  2  
ATOM 2817  H HG2  . MET A 1 55  ? -1.429  4.628   -8.765  1.00 0.00 ? 106 MET A HG2  2  
ATOM 2818  H HG3  . MET A 1 55  ? -0.011  3.762   -9.342  1.00 0.00 ? 106 MET A HG3  2  
ATOM 2819  H HE1  . MET A 1 55  ? 0.543   3.272   -11.617 1.00 0.00 ? 106 MET A HE1  2  
ATOM 2820  H HE2  . MET A 1 55  ? 0.419   4.471   -12.901 1.00 0.00 ? 106 MET A HE2  2  
ATOM 2821  H HE3  . MET A 1 55  ? 1.258   4.873   -11.409 1.00 0.00 ? 106 MET A HE3  2  
ATOM 2822  N N    . ALA A 1 56  ? -0.031  0.471   -8.506  1.00 0.00 ? 107 ALA A N    2  
ATOM 2823  C CA   . ALA A 1 56  ? 1.325   -0.037  -8.135  1.00 0.00 ? 107 ALA A CA   2  
ATOM 2824  C C    . ALA A 1 56  ? 2.006   -0.730  -9.317  1.00 0.00 ? 107 ALA A C    2  
ATOM 2825  O O    . ALA A 1 56  ? 2.586   -1.785  -9.178  1.00 0.00 ? 107 ALA A O    2  
ATOM 2826  C CB   . ALA A 1 56  ? 1.156   -1.021  -6.969  1.00 0.00 ? 107 ALA A CB   2  
ATOM 2827  H H    . ALA A 1 56  ? -0.590  -0.025  -9.143  1.00 0.00 ? 107 ALA A H    2  
ATOM 2828  H HA   . ALA A 1 56  ? 1.941   0.786   -7.821  1.00 0.00 ? 107 ALA A HA   2  
ATOM 2829  H HB1  . ALA A 1 56  ? 0.292   -0.738  -6.389  1.00 0.00 ? 107 ALA A HB1  2  
ATOM 2830  H HB2  . ALA A 1 56  ? 1.008   -2.023  -7.351  1.00 0.00 ? 107 ALA A HB2  2  
ATOM 2831  H HB3  . ALA A 1 56  ? 2.032   -0.998  -6.345  1.00 0.00 ? 107 ALA A HB3  2  
ATOM 2832  N N    . GLY A 1 57  ? 1.955   -0.137  -10.471 1.00 0.00 ? 108 GLY A N    2  
ATOM 2833  C CA   . GLY A 1 57  ? 2.626   -0.733  -11.664 1.00 0.00 ? 108 GLY A CA   2  
ATOM 2834  C C    . GLY A 1 57  ? 4.041   -0.176  -11.764 1.00 0.00 ? 108 GLY A C    2  
ATOM 2835  O O    . GLY A 1 57  ? 4.379   0.768   -11.087 1.00 0.00 ? 108 GLY A O    2  
ATOM 2836  H H    . GLY A 1 57  ? 1.508   0.720   -10.546 1.00 0.00 ? 108 GLY A H    2  
ATOM 2837  H HA2  . GLY A 1 57  ? 2.671   -1.807  -11.560 1.00 0.00 ? 108 GLY A HA2  2  
ATOM 2838  H HA3  . GLY A 1 57  ? 2.073   -0.475  -12.555 1.00 0.00 ? 108 GLY A HA3  2  
ATOM 2839  N N    . ASN A 1 58  ? 4.868   -0.732  -12.612 1.00 0.00 ? 109 ASN A N    2  
ATOM 2840  C CA   . ASN A 1 58  ? 6.255   -0.195  -12.759 1.00 0.00 ? 109 ASN A CA   2  
ATOM 2841  C C    . ASN A 1 58  ? 6.230   1.094   -13.588 1.00 0.00 ? 109 ASN A C    2  
ATOM 2842  O O    . ASN A 1 58  ? 5.300   1.361   -14.323 1.00 0.00 ? 109 ASN A O    2  
ATOM 2843  C CB   . ASN A 1 58  ? 7.159   -1.200  -13.486 1.00 0.00 ? 109 ASN A CB   2  
ATOM 2844  C CG   . ASN A 1 58  ? 7.245   -2.512  -12.710 1.00 0.00 ? 109 ASN A CG   2  
ATOM 2845  O OD1  . ASN A 1 58  ? 6.967   -2.554  -11.538 1.00 0.00 ? 109 ASN A OD1  2  
ATOM 2846  N ND2  . ASN A 1 58  ? 7.623   -3.599  -13.329 1.00 0.00 ? 109 ASN A ND2  2  
ATOM 2847  H H    . ASN A 1 58  ? 4.571   -1.485  -13.162 1.00 0.00 ? 109 ASN A H    2  
ATOM 2848  H HA   . ASN A 1 58  ? 6.658   0.015   -11.782 1.00 0.00 ? 109 ASN A HA   2  
ATOM 2849  H HB2  . ASN A 1 58  ? 6.763   -1.391  -14.466 1.00 0.00 ? 109 ASN A HB2  2  
ATOM 2850  H HB3  . ASN A 1 58  ? 8.149   -0.778  -13.580 1.00 0.00 ? 109 ASN A HB3  2  
ATOM 2851  H HD21 . ASN A 1 58  ? 7.856   -3.562  -14.280 1.00 0.00 ? 109 ASN A HD21 2  
ATOM 2852  H HD22 . ASN A 1 58  ? 7.680   -4.447  -12.842 1.00 0.00 ? 109 ASN A HD22 2  
ATOM 2853  N N    . ASP A 1 59  ? 7.260   1.884   -13.489 1.00 0.00 ? 110 ASP A N    2  
ATOM 2854  C CA   . ASP A 1 59  ? 7.318   3.141   -14.284 1.00 0.00 ? 110 ASP A CA   2  
ATOM 2855  C C    . ASP A 1 59  ? 7.237   2.824   -15.797 1.00 0.00 ? 110 ASP A C    2  
ATOM 2856  O O    . ASP A 1 59  ? 6.611   3.540   -16.549 1.00 0.00 ? 110 ASP A O    2  
ATOM 2857  C CB   . ASP A 1 59  ? 8.621   3.874   -13.957 1.00 0.00 ? 110 ASP A CB   2  
ATOM 2858  C CG   . ASP A 1 59  ? 8.611   5.246   -14.619 1.00 0.00 ? 110 ASP A CG   2  
ATOM 2859  O OD1  . ASP A 1 59  ? 7.705   5.498   -15.394 1.00 0.00 ? 110 ASP A OD1  2  
ATOM 2860  O OD2  . ASP A 1 59  ? 9.508   6.022   -14.344 1.00 0.00 ? 110 ASP A OD2  2  
ATOM 2861  H H    . ASP A 1 59  ? 8.007   1.645   -12.904 1.00 0.00 ? 110 ASP A H    2  
ATOM 2862  H HA   . ASP A 1 59  ? 6.482   3.770   -14.014 1.00 0.00 ? 110 ASP A HA   2  
ATOM 2863  H HB2  . ASP A 1 59  ? 8.704   3.999   -12.887 1.00 0.00 ? 110 ASP A HB2  2  
ATOM 2864  H HB3  . ASP A 1 59  ? 9.465   3.305   -14.315 1.00 0.00 ? 110 ASP A HB3  2  
ATOM 2865  N N    . GLU A 1 60  ? 7.880   1.774   -16.248 1.00 0.00 ? 111 GLU A N    2  
ATOM 2866  C CA   . GLU A 1 60  ? 7.849   1.427   -17.714 1.00 0.00 ? 111 GLU A CA   2  
ATOM 2867  C C    . GLU A 1 60  ? 6.691   0.473   -18.070 1.00 0.00 ? 111 GLU A C    2  
ATOM 2868  O O    . GLU A 1 60  ? 6.553   0.066   -19.210 1.00 0.00 ? 111 GLU A O    2  
ATOM 2869  C CB   . GLU A 1 60  ? 9.167   0.756   -18.062 1.00 0.00 ? 111 GLU A CB   2  
ATOM 2870  C CG   . GLU A 1 60  ? 9.269   -0.558  -17.290 1.00 0.00 ? 111 GLU A CG   2  
ATOM 2871  C CD   . GLU A 1 60  ? 10.683  -1.113  -17.424 1.00 0.00 ? 111 GLU A CD   2  
ATOM 2872  O OE1  . GLU A 1 60  ? 10.968  -1.703  -18.454 1.00 0.00 ? 111 GLU A OE1  2  
ATOM 2873  O OE2  . GLU A 1 60  ? 11.457  -0.933  -16.500 1.00 0.00 ? 111 GLU A OE2  2  
ATOM 2874  H H    . GLU A 1 60  ? 8.393   1.211   -15.632 1.00 0.00 ? 111 GLU A H    2  
ATOM 2875  H HA   . GLU A 1 60  ? 7.754   2.334   -18.297 1.00 0.00 ? 111 GLU A HA   2  
ATOM 2876  H HB2  . GLU A 1 60  ? 9.205   0.558   -19.124 1.00 0.00 ? 111 GLU A HB2  2  
ATOM 2877  H HB3  . GLU A 1 60  ? 9.983   1.400   -17.787 1.00 0.00 ? 111 GLU A HB3  2  
ATOM 2878  H HG2  . GLU A 1 60  ? 9.046   -0.384  -16.245 1.00 0.00 ? 111 GLU A HG2  2  
ATOM 2879  H HG3  . GLU A 1 60  ? 8.571   -1.272  -17.694 1.00 0.00 ? 111 GLU A HG3  2  
ATOM 2880  N N    . ASN A 1 61  ? 5.872   0.098   -17.116 1.00 0.00 ? 112 ASN A N    2  
ATOM 2881  C CA   . ASN A 1 61  ? 4.738   -0.842  -17.401 1.00 0.00 ? 112 ASN A CA   2  
ATOM 2882  C C    . ASN A 1 61  ? 3.409   -0.140  -17.147 1.00 0.00 ? 112 ASN A C    2  
ATOM 2883  O O    . ASN A 1 61  ? 3.356   1.013   -16.763 1.00 0.00 ? 112 ASN A O    2  
ATOM 2884  C CB   . ASN A 1 61  ? 4.835   -2.065  -16.489 1.00 0.00 ? 112 ASN A CB   2  
ATOM 2885  C CG   . ASN A 1 61  ? 6.159   -2.788  -16.747 1.00 0.00 ? 112 ASN A CG   2  
ATOM 2886  O OD1  . ASN A 1 61  ? 6.741   -2.646  -17.803 1.00 0.00 ? 112 ASN A OD1  2  
ATOM 2887  N ND2  . ASN A 1 61  ? 6.658   -3.564  -15.822 1.00 0.00 ? 112 ASN A ND2  2  
ATOM 2888  H H    . ASN A 1 61  ? 6.000   0.431   -16.210 1.00 0.00 ? 112 ASN A H    2  
ATOM 2889  H HA   . ASN A 1 61  ? 4.767   -1.169  -18.430 1.00 0.00 ? 112 ASN A HA   2  
ATOM 2890  H HB2  . ASN A 1 61  ? 4.779   -1.754  -15.457 1.00 0.00 ? 112 ASN A HB2  2  
ATOM 2891  H HB3  . ASN A 1 61  ? 4.017   -2.735  -16.709 1.00 0.00 ? 112 ASN A HB3  2  
ATOM 2892  H HD21 . ASN A 1 61  ? 6.191   -3.681  -14.972 1.00 0.00 ? 112 ASN A HD21 2  
ATOM 2893  H HD22 . ASN A 1 61  ? 7.503   -4.035  -15.983 1.00 0.00 ? 112 ASN A HD22 2  
ATOM 2894  N N    . TYR A 1 62  ? 2.336   -0.836  -17.355 1.00 0.00 ? 113 TYR A N    2  
ATOM 2895  C CA   . TYR A 1 62  ? 1.003   -0.229  -17.127 1.00 0.00 ? 113 TYR A CA   2  
ATOM 2896  C C    . TYR A 1 62  ? 0.806   -0.036  -15.633 1.00 0.00 ? 113 TYR A C    2  
ATOM 2897  O O    . TYR A 1 62  ? 1.584   -0.504  -14.831 1.00 0.00 ? 113 TYR A O    2  
ATOM 2898  C CB   . TYR A 1 62  ? -0.090  -1.164  -17.657 1.00 0.00 ? 113 TYR A CB   2  
ATOM 2899  C CG   . TYR A 1 62  ? 0.209   -2.585  -17.226 1.00 0.00 ? 113 TYR A CG   2  
ATOM 2900  C CD1  . TYR A 1 62  ? 0.002   -2.981  -15.891 1.00 0.00 ? 113 TYR A CD1  2  
ATOM 2901  C CD2  . TYR A 1 62  ? 0.699   -3.507  -18.158 1.00 0.00 ? 113 TYR A CD2  2  
ATOM 2902  C CE1  . TYR A 1 62  ? 0.281   -4.296  -15.500 1.00 0.00 ? 113 TYR A CE1  2  
ATOM 2903  C CE2  . TYR A 1 62  ? 0.974   -4.817  -17.764 1.00 0.00 ? 113 TYR A CE2  2  
ATOM 2904  C CZ   . TYR A 1 62  ? 0.768   -5.212  -16.442 1.00 0.00 ? 113 TYR A CZ   2  
ATOM 2905  O OH   . TYR A 1 62  ? 1.049   -6.507  -16.076 1.00 0.00 ? 113 TYR A OH   2  
ATOM 2906  H H    . TYR A 1 62  ? 2.406   -1.766  -17.659 1.00 0.00 ? 113 TYR A H    2  
ATOM 2907  H HA   . TYR A 1 62  ? 0.956   0.723   -17.629 1.00 0.00 ? 113 TYR A HA   2  
ATOM 2908  H HB2  . TYR A 1 62  ? -1.052  -0.864  -17.259 1.00 0.00 ? 113 TYR A HB2  2  
ATOM 2909  H HB3  . TYR A 1 62  ? -0.118  -1.111  -18.734 1.00 0.00 ? 113 TYR A HB3  2  
ATOM 2910  H HD1  . TYR A 1 62  ? -0.377  -2.276  -15.168 1.00 0.00 ? 113 TYR A HD1  2  
ATOM 2911  H HD2  . TYR A 1 62  ? 0.861   -3.204  -19.181 1.00 0.00 ? 113 TYR A HD2  2  
ATOM 2912  H HE1  . TYR A 1 62  ? 0.125   -4.605  -14.470 1.00 0.00 ? 113 TYR A HE1  2  
ATOM 2913  H HE2  . TYR A 1 62  ? 1.346   -5.529  -18.486 1.00 0.00 ? 113 TYR A HE2  2  
ATOM 2914  H HH   . TYR A 1 62  ? 1.324   -6.978  -16.866 1.00 0.00 ? 113 TYR A HH   2  
ATOM 2915  N N    . SER A 1 63  ? -0.236  0.635   -15.242 1.00 0.00 ? 114 SER A N    2  
ATOM 2916  C CA   . SER A 1 63  ? -0.468  0.822   -13.792 1.00 0.00 ? 114 SER A CA   2  
ATOM 2917  C C    . SER A 1 63  ? -1.017  -0.499  -13.236 1.00 0.00 ? 114 SER A C    2  
ATOM 2918  O O    . SER A 1 63  ? -1.867  -1.123  -13.835 1.00 0.00 ? 114 SER A O    2  
ATOM 2919  C CB   . SER A 1 63  ? -1.479  1.954   -13.609 1.00 0.00 ? 114 SER A CB   2  
ATOM 2920  O OG   . SER A 1 63  ? -2.795  1.432   -13.725 1.00 0.00 ? 114 SER A OG   2  
ATOM 2921  H H    . SER A 1 63  ? -0.868  1.001   -15.897 1.00 0.00 ? 114 SER A H    2  
ATOM 2922  H HA   . SER A 1 63  ? 0.463   1.074   -13.301 1.00 0.00 ? 114 SER A HA   2  
ATOM 2923  H HB2  . SER A 1 63  ? -1.355  2.400   -12.642 1.00 0.00 ? 114 SER A HB2  2  
ATOM 2924  H HB3  . SER A 1 63  ? -1.311  2.705   -14.372 1.00 0.00 ? 114 SER A HB3  2  
ATOM 2925  H HG   . SER A 1 63  ? -3.097  1.584   -14.625 1.00 0.00 ? 114 SER A HG   2  
ATOM 2926  N N    . ALA A 1 64  ? -0.525  -0.951  -12.113 1.00 0.00 ? 115 ALA A N    2  
ATOM 2927  C CA   . ALA A 1 64  ? -1.004  -2.256  -11.562 1.00 0.00 ? 115 ALA A CA   2  
ATOM 2928  C C    . ALA A 1 64  ? -2.500  -2.196  -11.283 1.00 0.00 ? 115 ALA A C    2  
ATOM 2929  O O    . ALA A 1 64  ? -3.098  -1.138  -11.302 1.00 0.00 ? 115 ALA A O    2  
ATOM 2930  C CB   . ALA A 1 64  ? -0.250  -2.574  -10.274 1.00 0.00 ? 115 ALA A CB   2  
ATOM 2931  H H    . ALA A 1 64  ? 0.178   -0.451  -11.646 1.00 0.00 ? 115 ALA A H    2  
ATOM 2932  H HA   . ALA A 1 64  ? -0.819  -3.034  -12.283 1.00 0.00 ? 115 ALA A HA   2  
ATOM 2933  H HB1  . ALA A 1 64  ? -0.398  -1.774  -9.562  1.00 0.00 ? 115 ALA A HB1  2  
ATOM 2934  H HB2  . ALA A 1 64  ? -0.618  -3.501  -9.860  1.00 0.00 ? 115 ALA A HB2  2  
ATOM 2935  H HB3  . ALA A 1 64  ? 0.799   -2.672  -10.492 1.00 0.00 ? 115 ALA A HB3  2  
ATOM 2936  N N    . GLU A 1 65  ? -3.121  -3.332  -11.034 1.00 0.00 ? 116 GLU A N    2  
ATOM 2937  C CA   . GLU A 1 65  ? -4.596  -3.322  -10.768 1.00 0.00 ? 116 GLU A CA   2  
ATOM 2938  C C    . GLU A 1 65  ? -4.859  -3.796  -9.344  1.00 0.00 ? 116 GLU A C    2  
ATOM 2939  O O    . GLU A 1 65  ? -4.553  -4.915  -8.985  1.00 0.00 ? 116 GLU A O    2  
ATOM 2940  C CB   . GLU A 1 65  ? -5.302  -4.288  -11.727 1.00 0.00 ? 116 GLU A CB   2  
ATOM 2941  C CG   . GLU A 1 65  ? -6.812  -4.060  -11.639 1.00 0.00 ? 116 GLU A CG   2  
ATOM 2942  C CD   . GLU A 1 65  ? -7.158  -2.713  -12.267 1.00 0.00 ? 116 GLU A CD   2  
ATOM 2943  O OE1  . GLU A 1 65  ? -6.543  -2.373  -13.263 1.00 0.00 ? 116 GLU A OE1  2  
ATOM 2944  O OE2  . GLU A 1 65  ? -8.027  -2.044  -11.738 1.00 0.00 ? 116 GLU A OE2  2  
ATOM 2945  H H    . GLU A 1 65  ? -2.617  -4.182  -11.032 1.00 0.00 ? 116 GLU A H    2  
ATOM 2946  H HA   . GLU A 1 65  ? -5.003  -2.331  -10.896 1.00 0.00 ? 116 GLU A HA   2  
ATOM 2947  H HB2  . GLU A 1 65  ? -4.963  -4.117  -12.738 1.00 0.00 ? 116 GLU A HB2  2  
ATOM 2948  H HB3  . GLU A 1 65  ? -5.085  -5.304  -11.443 1.00 0.00 ? 116 GLU A HB3  2  
ATOM 2949  H HG2  . GLU A 1 65  ? -7.333  -4.850  -12.165 1.00 0.00 ? 116 GLU A HG2  2  
ATOM 2950  H HG3  . GLU A 1 65  ? -7.116  -4.054  -10.605 1.00 0.00 ? 116 GLU A HG3  2  
ATOM 2951  N N    . LEU A 1 66  ? -5.438  -2.947  -8.536  1.00 0.00 ? 117 LEU A N    2  
ATOM 2952  C CA   . LEU A 1 66  ? -5.761  -3.337  -7.129  1.00 0.00 ? 117 LEU A CA   2  
ATOM 2953  C C    . LEU A 1 66  ? -7.273  -3.531  -7.002  1.00 0.00 ? 117 LEU A C    2  
ATOM 2954  O O    . LEU A 1 66  ? -8.030  -3.022  -7.800  1.00 0.00 ? 117 LEU A O    2  
ATOM 2955  C CB   . LEU A 1 66  ? -5.317  -2.240  -6.160  1.00 0.00 ? 117 LEU A CB   2  
ATOM 2956  C CG   . LEU A 1 66  ? -3.778  -2.137  -6.139  1.00 0.00 ? 117 LEU A CG   2  
ATOM 2957  C CD1  . LEU A 1 66  ? -3.290  -1.228  -7.265  1.00 0.00 ? 117 LEU A CD1  2  
ATOM 2958  C CD2  . LEU A 1 66  ? -3.315  -1.567  -4.794  1.00 0.00 ? 117 LEU A CD2  2  
ATOM 2959  H H    . LEU A 1 66  ? -5.674  -2.050  -8.860  1.00 0.00 ? 117 LEU A H    2  
ATOM 2960  H HA   . LEU A 1 66  ? -5.267  -4.259  -6.882  1.00 0.00 ? 117 LEU A HA   2  
ATOM 2961  H HB2  . LEU A 1 66  ? -5.751  -1.299  -6.465  1.00 0.00 ? 117 LEU A HB2  2  
ATOM 2962  H HB3  . LEU A 1 66  ? -5.675  -2.488  -5.172  1.00 0.00 ? 117 LEU A HB3  2  
ATOM 2963  H HG   . LEU A 1 66  ? -3.351  -3.119  -6.273  1.00 0.00 ? 117 LEU A HG   2  
ATOM 2964  H HD11 . LEU A 1 66  ? -3.872  -0.321  -7.275  1.00 0.00 ? 117 LEU A HD11 2  
ATOM 2965  H HD12 . LEU A 1 66  ? -2.250  -0.986  -7.106  1.00 0.00 ? 117 LEU A HD12 2  
ATOM 2966  H HD13 . LEU A 1 66  ? -3.399  -1.732  -8.210  1.00 0.00 ? 117 LEU A HD13 2  
ATOM 2967  H HD21 . LEU A 1 66  ? -3.896  -0.687  -4.554  1.00 0.00 ? 117 LEU A HD21 2  
ATOM 2968  H HD22 . LEU A 1 66  ? -3.450  -2.312  -4.022  1.00 0.00 ? 117 LEU A HD22 2  
ATOM 2969  H HD23 . LEU A 1 66  ? -2.270  -1.298  -4.858  1.00 0.00 ? 117 LEU A HD23 2  
ATOM 2970  N N    . ARG A 1 67  ? -7.726  -4.240  -5.992  1.00 0.00 ? 118 ARG A N    2  
ATOM 2971  C CA   . ARG A 1 67  ? -9.203  -4.424  -5.814  1.00 0.00 ? 118 ARG A CA   2  
ATOM 2972  C C    . ARG A 1 67  ? -9.676  -3.513  -4.682  1.00 0.00 ? 118 ARG A C    2  
ATOM 2973  O O    . ARG A 1 67  ? -9.026  -3.404  -3.665  1.00 0.00 ? 118 ARG A O    2  
ATOM 2974  C CB   . ARG A 1 67  ? -9.523  -5.887  -5.469  1.00 0.00 ? 118 ARG A CB   2  
ATOM 2975  C CG   . ARG A 1 67  ? -11.048 -6.123  -5.485  1.00 0.00 ? 118 ARG A CG   2  
ATOM 2976  C CD   . ARG A 1 67  ? -11.520 -6.464  -6.911  1.00 0.00 ? 118 ARG A CD   2  
ATOM 2977  N NE   . ARG A 1 67  ? -12.995 -6.211  -7.029  1.00 0.00 ? 118 ARG A NE   2  
ATOM 2978  C CZ   . ARG A 1 67  ? -13.844 -6.743  -6.191  1.00 0.00 ? 118 ARG A CZ   2  
ATOM 2979  N NH1  . ARG A 1 67  ? -13.455 -7.672  -5.361  1.00 0.00 ? 118 ARG A NH1  2  
ATOM 2980  N NH2  . ARG A 1 67  ? -15.102 -6.385  -6.227  1.00 0.00 ? 118 ARG A NH2  2  
ATOM 2981  H H    . ARG A 1 67  ? -7.100  -4.628  -5.335  1.00 0.00 ? 118 ARG A H    2  
ATOM 2982  H HA   . ARG A 1 67  ? -9.725  -4.144  -6.717  1.00 0.00 ? 118 ARG A HA   2  
ATOM 2983  H HB2  . ARG A 1 67  ? -9.058  -6.533  -6.199  1.00 0.00 ? 118 ARG A HB2  2  
ATOM 2984  H HB3  . ARG A 1 67  ? -9.136  -6.119  -4.484  1.00 0.00 ? 118 ARG A HB3  2  
ATOM 2985  H HG2  . ARG A 1 67  ? -11.281 -6.937  -4.819  1.00 0.00 ? 118 ARG A HG2  2  
ATOM 2986  H HG3  . ARG A 1 67  ? -11.560 -5.233  -5.144  1.00 0.00 ? 118 ARG A HG3  2  
ATOM 2987  H HD2  . ARG A 1 67  ? -11.021 -5.830  -7.620  1.00 0.00 ? 118 ARG A HD2  2  
ATOM 2988  H HD3  . ARG A 1 67  ? -11.274 -7.499  -7.133  1.00 0.00 ? 118 ARG A HD3  2  
ATOM 2989  H HE   . ARG A 1 67  ? -13.323 -5.591  -7.713  1.00 0.00 ? 118 ARG A HE   2  
ATOM 2990  H HH11 . ARG A 1 67  ? -12.506 -7.987  -5.376  1.00 0.00 ? 118 ARG A HH11 2  
ATOM 2991  H HH12 . ARG A 1 67  ? -14.100 -8.062  -4.705  1.00 0.00 ? 118 ARG A HH12 2  
ATOM 2992  H HH21 . ARG A 1 67  ? -15.410 -5.708  -6.897  1.00 0.00 ? 118 ARG A HH21 2  
ATOM 2993  H HH22 . ARG A 1 67  ? -15.757 -6.789  -5.585  1.00 0.00 ? 118 ARG A HH22 2  
ATOM 2994  N N    . ASN A 1 68  ? -10.796 -2.856  -4.875  1.00 0.00 ? 119 ASN A N    2  
ATOM 2995  C CA   . ASN A 1 68  ? -11.357 -1.924  -3.843  1.00 0.00 ? 119 ASN A CA   2  
ATOM 2996  C C    . ASN A 1 68  ? -10.280 -0.941  -3.372  1.00 0.00 ? 119 ASN A C    2  
ATOM 2997  O O    . ASN A 1 68  ? -10.241 -0.539  -2.226  1.00 0.00 ? 119 ASN A O    2  
ATOM 2998  C CB   . ASN A 1 68  ? -11.917 -2.727  -2.657  1.00 0.00 ? 119 ASN A CB   2  
ATOM 2999  C CG   . ASN A 1 68  ? -10.793 -3.237  -1.765  1.00 0.00 ? 119 ASN A CG   2  
ATOM 3000  O OD1  . ASN A 1 68  ? -10.371 -4.365  -1.895  1.00 0.00 ? 119 ASN A OD1  2  
ATOM 3001  N ND2  . ASN A 1 68  ? -10.297 -2.453  -0.855  1.00 0.00 ? 119 ASN A ND2  2  
ATOM 3002  H H    . ASN A 1 68  ? -11.275 -2.970  -5.720  1.00 0.00 ? 119 ASN A H    2  
ATOM 3003  H HA   . ASN A 1 68  ? -12.162 -1.359  -4.289  1.00 0.00 ? 119 ASN A HA   2  
ATOM 3004  H HB2  . ASN A 1 68  ? -12.567 -2.092  -2.072  1.00 0.00 ? 119 ASN A HB2  2  
ATOM 3005  H HB3  . ASN A 1 68  ? -12.482 -3.566  -3.029  1.00 0.00 ? 119 ASN A HB3  2  
ATOM 3006  H HD21 . ASN A 1 68  ? -10.644 -1.539  -0.754  1.00 0.00 ? 119 ASN A HD21 2  
ATOM 3007  H HD22 . ASN A 1 68  ? -9.580  -2.770  -0.269  1.00 0.00 ? 119 ASN A HD22 2  
ATOM 3008  N N    . ALA A 1 69  ? -9.422  -0.526  -4.255  1.00 0.00 ? 120 ALA A N    2  
ATOM 3009  C CA   . ALA A 1 69  ? -8.367  0.446   -3.852  1.00 0.00 ? 120 ALA A CA   2  
ATOM 3010  C C    . ALA A 1 69  ? -8.979  1.844   -3.807  1.00 0.00 ? 120 ALA A C    2  
ATOM 3011  O O    . ALA A 1 69  ? -8.352  2.796   -3.382  1.00 0.00 ? 120 ALA A O    2  
ATOM 3012  C CB   . ALA A 1 69  ? -7.211  0.407   -4.863  1.00 0.00 ? 120 ALA A CB   2  
ATOM 3013  H H    . ALA A 1 69  ? -9.478  -0.844  -5.183  1.00 0.00 ? 120 ALA A H    2  
ATOM 3014  H HA   . ALA A 1 69  ? -8.001  0.186   -2.865  1.00 0.00 ? 120 ALA A HA   2  
ATOM 3015  H HB1  . ALA A 1 69  ? -7.576  0.041   -5.810  1.00 0.00 ? 120 ALA A HB1  2  
ATOM 3016  H HB2  . ALA A 1 69  ? -6.805  1.402   -4.997  1.00 0.00 ? 120 ALA A HB2  2  
ATOM 3017  H HB3  . ALA A 1 69  ? -6.435  -0.249  -4.497  1.00 0.00 ? 120 ALA A HB3  2  
ATOM 3018  N N    . THR A 1 70  ? -10.203 1.969   -4.235  1.00 0.00 ? 121 THR A N    2  
ATOM 3019  C CA   . THR A 1 70  ? -10.880 3.282   -4.215  1.00 0.00 ? 121 THR A CA   2  
ATOM 3020  C C    . THR A 1 70  ? -11.700 3.351   -2.926  1.00 0.00 ? 121 THR A C    2  
ATOM 3021  O O    . THR A 1 70  ? -12.907 3.211   -2.932  1.00 0.00 ? 121 THR A O    2  
ATOM 3022  C CB   . THR A 1 70  ? -11.803 3.370   -5.435  1.00 0.00 ? 121 THR A CB   2  
ATOM 3023  O OG1  . THR A 1 70  ? -12.631 2.217   -5.479  1.00 0.00 ? 121 THR A OG1  2  
ATOM 3024  C CG2  . THR A 1 70  ? -10.959 3.446   -6.712  1.00 0.00 ? 121 THR A CG2  2  
ATOM 3025  H H    . THR A 1 70  ? -10.686 1.186   -4.562  1.00 0.00 ? 121 THR A H    2  
ATOM 3026  H HA   . THR A 1 70  ? -10.151 4.084   -4.241  1.00 0.00 ? 121 THR A HA   2  
ATOM 3027  H HB   . THR A 1 70  ? -12.414 4.248   -5.358  1.00 0.00 ? 121 THR A HB   2  
ATOM 3028  H HG1  . THR A 1 70  ? -13.538 2.510   -5.592  1.00 0.00 ? 121 THR A HG1  2  
ATOM 3029  H HG21 . THR A 1 70  ? -10.165 4.167   -6.579  1.00 0.00 ? 121 THR A HG21 2  
ATOM 3030  H HG22 . THR A 1 70  ? -10.531 2.477   -6.923  1.00 0.00 ? 121 THR A HG22 2  
ATOM 3031  H HG23 . THR A 1 70  ? -11.583 3.749   -7.538  1.00 0.00 ? 121 THR A HG23 2  
ATOM 3032  N N    . ALA A 1 71  ? -11.039 3.525   -1.813  1.00 0.00 ? 122 ALA A N    2  
ATOM 3033  C CA   . ALA A 1 71  ? -11.755 3.568   -0.507  1.00 0.00 ? 122 ALA A CA   2  
ATOM 3034  C C    . ALA A 1 71  ? -12.156 5.009   -0.195  1.00 0.00 ? 122 ALA A C    2  
ATOM 3035  O O    . ALA A 1 71  ? -11.490 5.943   -0.602  1.00 0.00 ? 122 ALA A O    2  
ATOM 3036  C CB   . ALA A 1 71  ? -10.823 3.061   0.594   1.00 0.00 ? 122 ALA A CB   2  
ATOM 3037  H H    . ALA A 1 71  ? -10.064 3.607   -1.834  1.00 0.00 ? 122 ALA A H    2  
ATOM 3038  H HA   . ALA A 1 71  ? -12.638 2.944   -0.549  1.00 0.00 ? 122 ALA A HA   2  
ATOM 3039  H HB1  . ALA A 1 71  ? -10.316 2.171   0.256   1.00 0.00 ? 122 ALA A HB1  2  
ATOM 3040  H HB2  . ALA A 1 71  ? -10.093 3.823   0.827   1.00 0.00 ? 122 ALA A HB2  2  
ATOM 3041  H HB3  . ALA A 1 71  ? -11.401 2.834   1.475   1.00 0.00 ? 122 ALA A HB3  2  
ATOM 3042  N N    . ALA A 1 72  ? -13.232 5.195   0.520   1.00 0.00 ? 123 ALA A N    2  
ATOM 3043  C CA   . ALA A 1 72  ? -13.681 6.579   0.867   1.00 0.00 ? 123 ALA A CA   2  
ATOM 3044  C C    . ALA A 1 72  ? -13.140 6.959   2.249   1.00 0.00 ? 123 ALA A C    2  
ATOM 3045  O O    . ALA A 1 72  ? -13.459 6.334   3.240   1.00 0.00 ? 123 ALA A O    2  
ATOM 3046  C CB   . ALA A 1 72  ? -15.210 6.634   0.884   1.00 0.00 ? 123 ALA A CB   2  
ATOM 3047  H H    . ALA A 1 72  ? -13.745 4.424   0.837   1.00 0.00 ? 123 ALA A H    2  
ATOM 3048  H HA   . ALA A 1 72  ? -13.311 7.272   0.143   1.00 0.00 ? 123 ALA A HA   2  
ATOM 3049  H HB1  . ALA A 1 72  ? -15.597 5.756   1.377   1.00 0.00 ? 123 ALA A HB1  2  
ATOM 3050  H HB2  . ALA A 1 72  ? -15.536 7.520   1.415   1.00 0.00 ? 123 ALA A HB2  2  
ATOM 3051  H HB3  . ALA A 1 72  ? -15.580 6.666   -0.130  1.00 0.00 ? 123 ALA A HB3  2  
ATOM 3052  N N    . MET A 1 73  ? -12.333 7.982   2.319   1.00 0.00 ? 124 MET A N    2  
ATOM 3053  C CA   . MET A 1 73  ? -11.780 8.405   3.636   1.00 0.00 ? 124 MET A CA   2  
ATOM 3054  C C    . MET A 1 73  ? -12.916 8.795   4.566   1.00 0.00 ? 124 MET A C    2  
ATOM 3055  O O    . MET A 1 73  ? -13.786 9.553   4.203   1.00 0.00 ? 124 MET A O    2  
ATOM 3056  C CB   . MET A 1 73  ? -10.864 9.609   3.444   1.00 0.00 ? 124 MET A CB   2  
ATOM 3057  C CG   . MET A 1 73  ? -10.120 9.901   4.746   1.00 0.00 ? 124 MET A CG   2  
ATOM 3058  S SD   . MET A 1 73  ? -9.129  11.404  4.542   1.00 0.00 ? 124 MET A SD   2  
ATOM 3059  C CE   . MET A 1 73  ? -7.975  10.768  3.299   1.00 0.00 ? 124 MET A CE   2  
ATOM 3060  H H    . MET A 1 73  ? -12.095 8.479   1.508   1.00 0.00 ? 124 MET A H    2  
ATOM 3061  H HA   . MET A 1 73  ? -11.224 7.592   4.071   1.00 0.00 ? 124 MET A HA   2  
ATOM 3062  H HB2  . MET A 1 73  ? -10.152 9.405   2.662   1.00 0.00 ? 124 MET A HB2  2  
ATOM 3063  H HB3  . MET A 1 73  ? -11.458 10.464  3.182   1.00 0.00 ? 124 MET A HB3  2  
ATOM 3064  H HG2  . MET A 1 73  ? -10.838 10.045  5.539   1.00 0.00 ? 124 MET A HG2  2  
ATOM 3065  H HG3  . MET A 1 73  ? -9.481  9.073   4.990   1.00 0.00 ? 124 MET A HG3  2  
ATOM 3066  H HE1  . MET A 1 73  ? -7.907  9.694   3.386   1.00 0.00 ? 124 MET A HE1  2  
ATOM 3067  H HE2  . MET A 1 73  ? -8.324  11.027  2.312   1.00 0.00 ? 124 MET A HE2  2  
ATOM 3068  H HE3  . MET A 1 73  ? -6.999  11.210  3.458   1.00 0.00 ? 124 MET A HE3  2  
ATOM 3069  N N    . LYS A 1 74  ? -12.897 8.297   5.768   1.00 0.00 ? 125 LYS A N    2  
ATOM 3070  C CA   . LYS A 1 74  ? -13.971 8.658   6.733   1.00 0.00 ? 125 LYS A CA   2  
ATOM 3071  C C    . LYS A 1 74  ? -13.682 10.064  7.267   1.00 0.00 ? 125 LYS A C    2  
ATOM 3072  O O    . LYS A 1 74  ? -14.449 10.989  7.078   1.00 0.00 ? 125 LYS A O    2  
ATOM 3073  C CB   . LYS A 1 74  ? -13.967 7.646   7.885   1.00 0.00 ? 125 LYS A CB   2  
ATOM 3074  C CG   . LYS A 1 74  ? -15.211 7.855   8.751   1.00 0.00 ? 125 LYS A CG   2  
ATOM 3075  C CD   . LYS A 1 74  ? -15.229 6.843   9.906   1.00 0.00 ? 125 LYS A CD   2  
ATOM 3076  C CE   . LYS A 1 74  ? -14.229 7.254   10.990  1.00 0.00 ? 125 LYS A CE   2  
ATOM 3077  N NZ   . LYS A 1 74  ? -14.550 6.530   12.248  1.00 0.00 ? 125 LYS A NZ   2  
ATOM 3078  H H    . LYS A 1 74  ? -12.168 7.692   6.040   1.00 0.00 ? 125 LYS A H    2  
ATOM 3079  H HA   . LYS A 1 74  ? -14.930 8.642   6.236   1.00 0.00 ? 125 LYS A HA   2  
ATOM 3080  H HB2  . LYS A 1 74  ? -13.968 6.645   7.480   1.00 0.00 ? 125 LYS A HB2  2  
ATOM 3081  H HB3  . LYS A 1 74  ? -13.079 7.792   8.482   1.00 0.00 ? 125 LYS A HB3  2  
ATOM 3082  H HG2  . LYS A 1 74  ? -15.206 8.859   9.147   1.00 0.00 ? 125 LYS A HG2  2  
ATOM 3083  H HG3  . LYS A 1 74  ? -16.094 7.717   8.145   1.00 0.00 ? 125 LYS A HG3  2  
ATOM 3084  H HD2  . LYS A 1 74  ? -16.220 6.804   10.333  1.00 0.00 ? 125 LYS A HD2  2  
ATOM 3085  H HD3  . LYS A 1 74  ? -14.965 5.863   9.530   1.00 0.00 ? 125 LYS A HD3  2  
ATOM 3086  H HE2  . LYS A 1 74  ? -13.227 7.005   10.676  1.00 0.00 ? 125 LYS A HE2  2  
ATOM 3087  H HE3  . LYS A 1 74  ? -14.301 8.311   11.165  1.00 0.00 ? 125 LYS A HE3  2  
ATOM 3088  H HZ1  . LYS A 1 74  ? -15.563 6.643   12.459  1.00 0.00 ? 125 LYS A HZ1  2  
ATOM 3089  H HZ2  . LYS A 1 74  ? -14.333 5.522   12.134  1.00 0.00 ? 125 LYS A HZ2  2  
ATOM 3090  H HZ3  . LYS A 1 74  ? -13.984 6.923   13.026  1.00 0.00 ? 125 LYS A HZ3  2  
ATOM 3091  N N    . ASN A 1 75  ? -12.547 10.227  7.900   1.00 0.00 ? 126 ASN A N    2  
ATOM 3092  C CA   . ASN A 1 75  ? -12.114 11.553  8.438   1.00 0.00 ? 126 ASN A CA   2  
ATOM 3093  C C    . ASN A 1 75  ? -10.762 11.879  7.808   1.00 0.00 ? 126 ASN A C    2  
ATOM 3094  O O    . ASN A 1 75  ? -10.653 12.081  6.620   1.00 0.00 ? 126 ASN A O    2  
ATOM 3095  C CB   . ASN A 1 75  ? -11.932 11.474  9.958   1.00 0.00 ? 126 ASN A CB   2  
ATOM 3096  C CG   . ASN A 1 75  ? -13.270 11.226  10.650  1.00 0.00 ? 126 ASN A CG   2  
ATOM 3097  O OD1  . ASN A 1 75  ? -13.360 10.372  11.503  1.00 0.00 ? 126 ASN A OD1  2  
ATOM 3098  N ND2  . ASN A 1 75  ? -14.309 11.946  10.340  1.00 0.00 ? 126 ASN A ND2  2  
ATOM 3099  H H    . ASN A 1 75  ? -11.948 9.460   7.999   1.00 0.00 ? 126 ASN A H    2  
ATOM 3100  H HA   . ASN A 1 75  ? -12.835 12.320  8.185   1.00 0.00 ? 126 ASN A HA   2  
ATOM 3101  H HB2  . ASN A 1 75  ? -11.259 10.660  10.191  1.00 0.00 ? 126 ASN A HB2  2  
ATOM 3102  H HB3  . ASN A 1 75  ? -11.506 12.399  10.318  1.00 0.00 ? 126 ASN A HB3  2  
ATOM 3103  H HD21 . ASN A 1 75  ? -14.238 12.649  9.661   1.00 0.00 ? 126 ASN A HD21 2  
ATOM 3104  H HD22 . ASN A 1 75  ? -15.167 11.781  10.790  1.00 0.00 ? 126 ASN A HD22 2  
ATOM 3105  N N    . GLN A 1 76  ? -9.724  11.896  8.609   1.00 0.00 ? 127 GLN A N    2  
ATOM 3106  C CA   . GLN A 1 76  ? -8.358  12.161  8.080   1.00 0.00 ? 127 GLN A CA   2  
ATOM 3107  C C    . GLN A 1 76  ? -7.662  10.814  7.860   1.00 0.00 ? 127 GLN A C    2  
ATOM 3108  O O    . GLN A 1 76  ? -6.478  10.761  7.603   1.00 0.00 ? 127 GLN A O    2  
ATOM 3109  C CB   . GLN A 1 76  ? -7.559  12.987  9.099   1.00 0.00 ? 127 GLN A CB   2  
ATOM 3110  C CG   . GLN A 1 76  ? -8.284  14.315  9.343   1.00 0.00 ? 127 GLN A CG   2  
ATOM 3111  C CD   . GLN A 1 76  ? -7.481  15.180  10.314  1.00 0.00 ? 127 GLN A CD   2  
ATOM 3112  O OE1  . GLN A 1 76  ? -6.943  14.688  11.287  1.00 0.00 ? 127 GLN A OE1  2  
ATOM 3113  N NE2  . GLN A 1 76  ? -7.388  16.463  10.097  1.00 0.00 ? 127 GLN A NE2  2  
ATOM 3114  H H    . GLN A 1 76  ? -9.845  11.705  9.560   1.00 0.00 ? 127 GLN A H    2  
ATOM 3115  H HA   . GLN A 1 76  ? -8.415  12.690  7.146   1.00 0.00 ? 127 GLN A HA   2  
ATOM 3116  H HB2  . GLN A 1 76  ? -7.482  12.440  10.027  1.00 0.00 ? 127 GLN A HB2  2  
ATOM 3117  H HB3  . GLN A 1 76  ? -6.568  13.182  8.711   1.00 0.00 ? 127 GLN A HB3  2  
ATOM 3118  H HG2  . GLN A 1 76  ? -8.401  14.841  8.407   1.00 0.00 ? 127 GLN A HG2  2  
ATOM 3119  H HG3  . GLN A 1 76  ? -9.254  14.117  9.765   1.00 0.00 ? 127 GLN A HG3  2  
ATOM 3120  H HE21 . GLN A 1 76  ? -7.835  16.859  9.319   1.00 0.00 ? 127 GLN A HE21 2  
ATOM 3121  H HE22 . GLN A 1 76  ? -6.868  17.026  10.702  1.00 0.00 ? 127 GLN A HE22 2  
ATOM 3122  N N    . VAL A 1 77  ? -8.395  9.722   7.981   1.00 0.00 ? 128 VAL A N    2  
ATOM 3123  C CA   . VAL A 1 77  ? -7.770  8.368   7.793   1.00 0.00 ? 128 VAL A CA   2  
ATOM 3124  C C    . VAL A 1 77  ? -8.624  7.498   6.852   1.00 0.00 ? 128 VAL A C    2  
ATOM 3125  O O    . VAL A 1 77  ? -9.835  7.504   6.911   1.00 0.00 ? 128 VAL A O    2  
ATOM 3126  C CB   . VAL A 1 77  ? -7.622  7.657   9.155   1.00 0.00 ? 128 VAL A CB   2  
ATOM 3127  C CG1  . VAL A 1 77  ? -6.884  6.313   8.967   1.00 0.00 ? 128 VAL A CG1  2  
ATOM 3128  C CG2  . VAL A 1 77  ? -6.820  8.552   10.121  1.00 0.00 ? 128 VAL A CG2  2  
ATOM 3129  H H    . VAL A 1 77  ? -9.346  9.792   8.203   1.00 0.00 ? 128 VAL A H    2  
ATOM 3130  H HA   . VAL A 1 77  ? -6.800  8.485   7.358   1.00 0.00 ? 128 VAL A HA   2  
ATOM 3131  H HB   . VAL A 1 77  ? -8.603  7.474   9.571   1.00 0.00 ? 128 VAL A HB   2  
ATOM 3132  H HG11 . VAL A 1 77  ? -6.157  6.400   8.169   1.00 0.00 ? 128 VAL A HG11 2  
ATOM 3133  H HG12 . VAL A 1 77  ? -6.378  6.042   9.881   1.00 0.00 ? 128 VAL A HG12 2  
ATOM 3134  H HG13 . VAL A 1 77  ? -7.599  5.546   8.713   1.00 0.00 ? 128 VAL A HG13 2  
ATOM 3135  H HG21 . VAL A 1 77  ? -7.336  9.493   10.260  1.00 0.00 ? 128 VAL A HG21 2  
ATOM 3136  H HG22 . VAL A 1 77  ? -6.719  8.053   11.075  1.00 0.00 ? 128 VAL A HG22 2  
ATOM 3137  H HG23 . VAL A 1 77  ? -5.837  8.737   9.709   1.00 0.00 ? 128 VAL A HG23 2  
ATOM 3138  N N    . ALA A 1 78  ? -7.985  6.735   5.990   1.00 0.00 ? 129 ALA A N    2  
ATOM 3139  C CA   . ALA A 1 78  ? -8.718  5.833   5.037   1.00 0.00 ? 129 ALA A CA   2  
ATOM 3140  C C    . ALA A 1 78  ? -8.175  4.408   5.194   1.00 0.00 ? 129 ALA A C    2  
ATOM 3141  O O    . ALA A 1 78  ? -7.135  4.190   5.785   1.00 0.00 ? 129 ALA A O    2  
ATOM 3142  C CB   . ALA A 1 78  ? -8.515  6.299   3.585   1.00 0.00 ? 129 ALA A CB   2  
ATOM 3143  H H    . ALA A 1 78  ? -7.013  6.746   5.977   1.00 0.00 ? 129 ALA A H    2  
ATOM 3144  H HA   . ALA A 1 78  ? -9.778  5.835   5.267   1.00 0.00 ? 129 ALA A HA   2  
ATOM 3145  H HB1  . ALA A 1 78  ? -7.459  6.392   3.374   1.00 0.00 ? 129 ALA A HB1  2  
ATOM 3146  H HB2  . ALA A 1 78  ? -8.954  5.575   2.910   1.00 0.00 ? 129 ALA A HB2  2  
ATOM 3147  H HB3  . ALA A 1 78  ? -8.994  7.256   3.438   1.00 0.00 ? 129 ALA A HB3  2  
ATOM 3148  N N    . ARG A 1 79  ? -8.874  3.435   4.680   1.00 0.00 ? 130 ARG A N    2  
ATOM 3149  C CA   . ARG A 1 79  ? -8.410  2.020   4.807   1.00 0.00 ? 130 ARG A CA   2  
ATOM 3150  C C    . ARG A 1 79  ? -8.948  1.203   3.638   1.00 0.00 ? 130 ARG A C    2  
ATOM 3151  O O    . ARG A 1 79  ? -9.898  1.586   2.984   1.00 0.00 ? 130 ARG A O    2  
ATOM 3152  C CB   . ARG A 1 79  ? -8.937  1.441   6.124   1.00 0.00 ? 130 ARG A CB   2  
ATOM 3153  C CG   . ARG A 1 79  ? -10.457 1.300   6.046   1.00 0.00 ? 130 ARG A CG   2  
ATOM 3154  C CD   . ARG A 1 79  ? -10.994 0.971   7.438   1.00 0.00 ? 130 ARG A CD   2  
ATOM 3155  N NE   . ARG A 1 79  ? -12.464 0.659   7.383   1.00 0.00 ? 130 ARG A NE   2  
ATOM 3156  C CZ   . ARG A 1 79  ? -13.333 1.498   6.879   1.00 0.00 ? 130 ARG A CZ   2  
ATOM 3157  N NH1  . ARG A 1 79  ? -12.975 2.710   6.561   1.00 0.00 ? 130 ARG A NH1  2  
ATOM 3158  N NH2  . ARG A 1 79  ? -14.578 1.135   6.744   1.00 0.00 ? 130 ARG A NH2  2  
ATOM 3159  H H    . ARG A 1 79  ? -9.713  3.631   4.214   1.00 0.00 ? 130 ARG A H    2  
ATOM 3160  H HA   . ARG A 1 79  ? -7.329  1.985   4.805   1.00 0.00 ? 130 ARG A HA   2  
ATOM 3161  H HB2  . ARG A 1 79  ? -8.493  0.472   6.294   1.00 0.00 ? 130 ARG A HB2  2  
ATOM 3162  H HB3  . ARG A 1 79  ? -8.681  2.101   6.937   1.00 0.00 ? 130 ARG A HB3  2  
ATOM 3163  H HG2  . ARG A 1 79  ? -10.874 2.227   5.686   1.00 0.00 ? 130 ARG A HG2  2  
ATOM 3164  H HG3  . ARG A 1 79  ? -10.716 0.498   5.367   1.00 0.00 ? 130 ARG A HG3  2  
ATOM 3165  H HD2  . ARG A 1 79  ? -10.493 0.092   7.804   1.00 0.00 ? 130 ARG A HD2  2  
ATOM 3166  H HD3  . ARG A 1 79  ? -10.782 1.804   8.105   1.00 0.00 ? 130 ARG A HD3  2  
ATOM 3167  H HE   . ARG A 1 79  ? -12.775 -0.216  7.700   1.00 0.00 ? 130 ARG A HE   2  
ATOM 3168  H HH11 . ARG A 1 79  ? -12.034 3.008   6.702   1.00 0.00 ? 130 ARG A HH11 2  
ATOM 3169  H HH12 . ARG A 1 79  ? -13.647 3.343   6.180   1.00 0.00 ? 130 ARG A HH12 2  
ATOM 3170  H HH21 . ARG A 1 79  ? -14.865 0.219   7.027   1.00 0.00 ? 130 ARG A HH21 2  
ATOM 3171  H HH22 . ARG A 1 79  ? -15.245 1.771   6.359   1.00 0.00 ? 130 ARG A HH22 2  
ATOM 3172  N N    . PHE A 1 80  ? -8.345  0.074   3.375   1.00 0.00 ? 131 PHE A N    2  
ATOM 3173  C CA   . PHE A 1 80  ? -8.795  -0.792  2.250   1.00 0.00 ? 131 PHE A CA   2  
ATOM 3174  C C    . PHE A 1 80  ? -9.216  -2.149  2.821   1.00 0.00 ? 131 PHE A C    2  
ATOM 3175  O O    . PHE A 1 80  ? -8.581  -2.670  3.714   1.00 0.00 ? 131 PHE A O    2  
ATOM 3176  C CB   . PHE A 1 80  ? -7.613  -0.994  1.303   1.00 0.00 ? 131 PHE A CB   2  
ATOM 3177  C CG   . PHE A 1 80  ? -6.841  0.299   1.160   1.00 0.00 ? 131 PHE A CG   2  
ATOM 3178  C CD1  . PHE A 1 80  ? -5.784  0.586   2.035   1.00 0.00 ? 131 PHE A CD1  2  
ATOM 3179  C CD2  . PHE A 1 80  ? -7.174  1.196   0.145   1.00 0.00 ? 131 PHE A CD2  2  
ATOM 3180  C CE1  . PHE A 1 80  ? -5.062  1.780   1.892   1.00 0.00 ? 131 PHE A CE1  2  
ATOM 3181  C CE2  . PHE A 1 80  ? -6.455  2.388   0.000   1.00 0.00 ? 131 PHE A CE2  2  
ATOM 3182  C CZ   . PHE A 1 80  ? -5.396  2.680   0.874   1.00 0.00 ? 131 PHE A CZ   2  
ATOM 3183  H H    . PHE A 1 80  ? -7.585  -0.205  3.923   1.00 0.00 ? 131 PHE A H    2  
ATOM 3184  H HA   . PHE A 1 80  ? -9.622  -0.340  1.718   1.00 0.00 ? 131 PHE A HA   2  
ATOM 3185  H HB2  . PHE A 1 80  ? -6.956  -1.758  1.694   1.00 0.00 ? 131 PHE A HB2  2  
ATOM 3186  H HB3  . PHE A 1 80  ? -7.982  -1.290  0.333   1.00 0.00 ? 131 PHE A HB3  2  
ATOM 3187  H HD1  . PHE A 1 80  ? -5.525  -0.112  2.815   1.00 0.00 ? 131 PHE A HD1  2  
ATOM 3188  H HD2  . PHE A 1 80  ? -7.989  0.969   -0.524  1.00 0.00 ? 131 PHE A HD2  2  
ATOM 3189  H HE1  . PHE A 1 80  ? -4.251  2.007   2.573   1.00 0.00 ? 131 PHE A HE1  2  
ATOM 3190  H HE2  . PHE A 1 80  ? -6.713  3.080   -0.791  1.00 0.00 ? 131 PHE A HE2  2  
ATOM 3191  H HZ   . PHE A 1 80  ? -4.837  3.596   0.761   1.00 0.00 ? 131 PHE A HZ   2  
ATOM 3192  N N    . ASN A 1 81  ? -10.275 -2.729  2.324   1.00 0.00 ? 132 ASN A N    2  
ATOM 3193  C CA   . ASN A 1 81  ? -10.718 -4.060  2.856   1.00 0.00 ? 132 ASN A CA   2  
ATOM 3194  C C    . ASN A 1 81  ? -10.139 -5.206  2.026   1.00 0.00 ? 132 ASN A C    2  
ATOM 3195  O O    . ASN A 1 81  ? -8.970  -5.526  2.126   1.00 0.00 ? 132 ASN A O    2  
ATOM 3196  C CB   . ASN A 1 81  ? -12.240 -4.139  2.844   1.00 0.00 ? 132 ASN A CB   2  
ATOM 3197  C CG   . ASN A 1 81  ? -12.821 -3.074  3.777   1.00 0.00 ? 132 ASN A CG   2  
ATOM 3198  O OD1  . ASN A 1 81  ? -13.733 -2.360  3.407   1.00 0.00 ? 132 ASN A OD1  2  
ATOM 3199  N ND2  . ASN A 1 81  ? -12.335 -2.941  4.983   1.00 0.00 ? 132 ASN A ND2  2  
ATOM 3200  H H    . ASN A 1 81  ? -10.783 -2.295  1.605   1.00 0.00 ? 132 ASN A H    2  
ATOM 3201  H HA   . ASN A 1 81  ? -10.370 -4.170  3.869   1.00 0.00 ? 132 ASN A HA   2  
ATOM 3202  H HB2  . ASN A 1 81  ? -12.598 -3.974  1.839   1.00 0.00 ? 132 ASN A HB2  2  
ATOM 3203  H HB3  . ASN A 1 81  ? -12.546 -5.115  3.180   1.00 0.00 ? 132 ASN A HB3  2  
ATOM 3204  H HD21 . ASN A 1 81  ? -11.598 -3.516  5.283   1.00 0.00 ? 132 ASN A HD21 2  
ATOM 3205  H HD22 . ASN A 1 81  ? -12.709 -2.271  5.594   1.00 0.00 ? 132 ASN A HD22 2  
ATOM 3206  N N    . ASP A 1 82  ? -10.955 -5.846  1.223   1.00 0.00 ? 133 ASP A N    2  
ATOM 3207  C CA   . ASP A 1 82  ? -10.453 -6.989  0.401   1.00 0.00 ? 133 ASP A CA   2  
ATOM 3208  C C    . ASP A 1 82  ? -9.465  -6.468  -0.643  1.00 0.00 ? 133 ASP A C    2  
ATOM 3209  O O    . ASP A 1 82  ? -9.536  -6.815  -1.806  1.00 0.00 ? 133 ASP A O    2  
ATOM 3210  C CB   . ASP A 1 82  ? -11.619 -7.670  -0.321  1.00 0.00 ? 133 ASP A CB   2  
ATOM 3211  C CG   . ASP A 1 82  ? -11.134 -8.984  -0.927  1.00 0.00 ? 133 ASP A CG   2  
ATOM 3212  O OD1  . ASP A 1 82  ? -9.955  -9.265  -0.804  1.00 0.00 ? 133 ASP A OD1  2  
ATOM 3213  O OD2  . ASP A 1 82  ? -11.948 -9.688  -1.499  1.00 0.00 ? 133 ASP A OD2  2  
ATOM 3214  H H    . ASP A 1 82  ? -11.896 -5.582  1.173   1.00 0.00 ? 133 ASP A H    2  
ATOM 3215  H HA   . ASP A 1 82  ? -9.959  -7.702  1.044   1.00 0.00 ? 133 ASP A HA   2  
ATOM 3216  H HB2  . ASP A 1 82  ? -12.420 -7.868  0.375   1.00 0.00 ? 133 ASP A HB2  2  
ATOM 3217  H HB3  . ASP A 1 82  ? -11.980 -7.029  -1.109  1.00 0.00 ? 133 ASP A HB3  2  
ATOM 3218  N N    . LEU A 1 83  ? -8.557  -5.623  -0.237  1.00 0.00 ? 134 LEU A N    2  
ATOM 3219  C CA   . LEU A 1 83  ? -7.568  -5.054  -1.194  1.00 0.00 ? 134 LEU A CA   2  
ATOM 3220  C C    . LEU A 1 83  ? -6.789  -6.177  -1.874  1.00 0.00 ? 134 LEU A C    2  
ATOM 3221  O O    . LEU A 1 83  ? -6.244  -7.038  -1.215  1.00 0.00 ? 134 LEU A O    2  
ATOM 3222  C CB   . LEU A 1 83  ? -6.591  -4.171  -0.410  1.00 0.00 ? 134 LEU A CB   2  
ATOM 3223  C CG   . LEU A 1 83  ? -5.552  -3.542  -1.357  1.00 0.00 ? 134 LEU A CG   2  
ATOM 3224  C CD1  . LEU A 1 83  ? -6.246  -2.618  -2.372  1.00 0.00 ? 134 LEU A CD1  2  
ATOM 3225  C CD2  . LEU A 1 83  ? -4.545  -2.727  -0.533  1.00 0.00 ? 134 LEU A CD2  2  
ATOM 3226  H H    . LEU A 1 83  ? -8.541  -5.346  0.699   1.00 0.00 ? 134 LEU A H    2  
ATOM 3227  H HA   . LEU A 1 83  ? -8.073  -4.467  -1.927  1.00 0.00 ? 134 LEU A HA   2  
ATOM 3228  H HB2  . LEU A 1 83  ? -7.141  -3.395  0.090   1.00 0.00 ? 134 LEU A HB2  2  
ATOM 3229  H HB3  . LEU A 1 83  ? -6.078  -4.776  0.325   1.00 0.00 ? 134 LEU A HB3  2  
ATOM 3230  H HG   . LEU A 1 83  ? -5.028  -4.321  -1.887  1.00 0.00 ? 134 LEU A HG   2  
ATOM 3231  H HD11 . LEU A 1 83  ? -7.062  -2.093  -1.893  1.00 0.00 ? 134 LEU A HD11 2  
ATOM 3232  H HD12 . LEU A 1 83  ? -5.535  -1.899  -2.760  1.00 0.00 ? 134 LEU A HD12 2  
ATOM 3233  H HD13 . LEU A 1 83  ? -6.630  -3.210  -3.190  1.00 0.00 ? 134 LEU A HD13 2  
ATOM 3234  H HD21 . LEU A 1 83  ? -5.073  -2.089  0.160   1.00 0.00 ? 134 LEU A HD21 2  
ATOM 3235  H HD22 . LEU A 1 83  ? -3.901  -3.397  0.014   1.00 0.00 ? 134 LEU A HD22 2  
ATOM 3236  H HD23 . LEU A 1 83  ? -3.948  -2.117  -1.198  1.00 0.00 ? 134 LEU A HD23 2  
ATOM 3237  N N    . ARG A 1 84  ? -6.708  -6.159  -3.187  1.00 0.00 ? 135 ARG A N    2  
ATOM 3238  C CA   . ARG A 1 84  ? -5.923  -7.224  -3.913  1.00 0.00 ? 135 ARG A CA   2  
ATOM 3239  C C    . ARG A 1 84  ? -4.680  -6.593  -4.538  1.00 0.00 ? 135 ARG A C    2  
ATOM 3240  O O    . ARG A 1 84  ? -4.732  -5.498  -5.053  1.00 0.00 ? 135 ARG A O    2  
ATOM 3241  C CB   . ARG A 1 84  ? -6.767  -7.886  -5.012  1.00 0.00 ? 135 ARG A CB   2  
ATOM 3242  C CG   . ARG A 1 84  ? -6.051  -9.163  -5.540  1.00 0.00 ? 135 ARG A CG   2  
ATOM 3243  C CD   . ARG A 1 84  ? -6.553  -10.427 -4.802  1.00 0.00 ? 135 ARG A CD   2  
ATOM 3244  N NE   . ARG A 1 84  ? -6.999  -10.070 -3.426  1.00 0.00 ? 135 ARG A NE   2  
ATOM 3245  C CZ   . ARG A 1 84  ? -7.722  -10.906 -2.731  1.00 0.00 ? 135 ARG A CZ   2  
ATOM 3246  N NH1  . ARG A 1 84  ? -8.059  -12.058 -3.243  1.00 0.00 ? 135 ARG A NH1  2  
ATOM 3247  N NH2  . ARG A 1 84  ? -8.104  -10.590 -1.521  1.00 0.00 ? 135 ARG A NH2  2  
ATOM 3248  H H    . ARG A 1 84  ? -7.144  -5.433  -3.697  1.00 0.00 ? 135 ARG A H    2  
ATOM 3249  H HA   . ARG A 1 84  ? -5.600  -7.976  -3.217  1.00 0.00 ? 135 ARG A HA   2  
ATOM 3250  H HB2  . ARG A 1 84  ? -7.740  -8.143  -4.618  1.00 0.00 ? 135 ARG A HB2  2  
ATOM 3251  H HB3  . ARG A 1 84  ? -6.887  -7.188  -5.828  1.00 0.00 ? 135 ARG A HB3  2  
ATOM 3252  H HG2  . ARG A 1 84  ? -6.247  -9.269  -6.598  1.00 0.00 ? 135 ARG A HG2  2  
ATOM 3253  H HG3  . ARG A 1 84  ? -4.984  -9.068  -5.392  1.00 0.00 ? 135 ARG A HG3  2  
ATOM 3254  H HD2  . ARG A 1 84  ? -7.383  -10.859 -5.343  1.00 0.00 ? 135 ARG A HD2  2  
ATOM 3255  H HD3  . ARG A 1 84  ? -5.752  -11.157 -4.741  1.00 0.00 ? 135 ARG A HD3  2  
ATOM 3256  H HE   . ARG A 1 84  ? -6.750  -9.210  -3.041  1.00 0.00 ? 135 ARG A HE   2  
ATOM 3257  H HH11 . ARG A 1 84  ? -7.762  -12.300 -4.166  1.00 0.00 ? 135 ARG A HH11 2  
ATOM 3258  H HH12 . ARG A 1 84  ? -8.615  -12.699 -2.713  1.00 0.00 ? 135 ARG A HH12 2  
ATOM 3259  H HH21 . ARG A 1 84  ? -7.842  -9.706  -1.127  1.00 0.00 ? 135 ARG A HH21 2  
ATOM 3260  H HH22 . ARG A 1 84  ? -8.659  -11.231 -0.987  1.00 0.00 ? 135 ARG A HH22 2  
ATOM 3261  N N    . PHE A 1 85  ? -3.565  -7.279  -4.500  1.00 0.00 ? 136 PHE A N    2  
ATOM 3262  C CA   . PHE A 1 85  ? -2.306  -6.735  -5.105  1.00 0.00 ? 136 PHE A CA   2  
ATOM 3263  C C    . PHE A 1 85  ? -1.953  -7.579  -6.334  1.00 0.00 ? 136 PHE A C    2  
ATOM 3264  O O    . PHE A 1 85  ? -1.474  -8.690  -6.204  1.00 0.00 ? 136 PHE A O    2  
ATOM 3265  C CB   . PHE A 1 85  ? -1.168  -6.837  -4.067  1.00 0.00 ? 136 PHE A CB   2  
ATOM 3266  C CG   . PHE A 1 85  ? -1.166  -5.615  -3.169  1.00 0.00 ? 136 PHE A CG   2  
ATOM 3267  C CD1  . PHE A 1 85  ? -0.899  -4.349  -3.706  1.00 0.00 ? 136 PHE A CD1  2  
ATOM 3268  C CD2  . PHE A 1 85  ? -1.420  -5.752  -1.800  1.00 0.00 ? 136 PHE A CD2  2  
ATOM 3269  C CE1  . PHE A 1 85  ? -0.893  -3.220  -2.875  1.00 0.00 ? 136 PHE A CE1  2  
ATOM 3270  C CE2  . PHE A 1 85  ? -1.417  -4.629  -0.967  1.00 0.00 ? 136 PHE A CE2  2  
ATOM 3271  C CZ   . PHE A 1 85  ? -1.151  -3.362  -1.503  1.00 0.00 ? 136 PHE A CZ   2  
ATOM 3272  H H    . PHE A 1 85  ? -3.556  -8.165  -4.082  1.00 0.00 ? 136 PHE A H    2  
ATOM 3273  H HA   . PHE A 1 85  ? -2.442  -5.704  -5.404  1.00 0.00 ? 136 PHE A HA   2  
ATOM 3274  H HB2  . PHE A 1 85  ? -1.315  -7.724  -3.467  1.00 0.00 ? 136 PHE A HB2  2  
ATOM 3275  H HB3  . PHE A 1 85  ? -0.213  -6.908  -4.573  1.00 0.00 ? 136 PHE A HB3  2  
ATOM 3276  H HD1  . PHE A 1 85  ? -0.699  -4.242  -4.762  1.00 0.00 ? 136 PHE A HD1  2  
ATOM 3277  H HD2  . PHE A 1 85  ? -1.624  -6.726  -1.386  1.00 0.00 ? 136 PHE A HD2  2  
ATOM 3278  H HE1  . PHE A 1 85  ? -0.689  -2.242  -3.288  1.00 0.00 ? 136 PHE A HE1  2  
ATOM 3279  H HE2  . PHE A 1 85  ? -1.613  -4.742  0.090   1.00 0.00 ? 136 PHE A HE2  2  
ATOM 3280  H HZ   . PHE A 1 85  ? -1.146  -2.493  -0.861  1.00 0.00 ? 136 PHE A HZ   2  
ATOM 3281  N N    . VAL A 1 86  ? -2.164  -7.066  -7.530  1.00 0.00 ? 137 VAL A N    2  
ATOM 3282  C CA   . VAL A 1 86  ? -1.808  -7.864  -8.747  1.00 0.00 ? 137 VAL A CA   2  
ATOM 3283  C C    . VAL A 1 86  ? -1.156  -6.966  -9.819  1.00 0.00 ? 137 VAL A C    2  
ATOM 3284  O O    . VAL A 1 86  ? -1.729  -6.670  -10.854 1.00 0.00 ? 137 VAL A O    2  
ATOM 3285  C CB   . VAL A 1 86  ? -3.063  -8.597  -9.282  1.00 0.00 ? 137 VAL A CB   2  
ATOM 3286  C CG1  . VAL A 1 86  ? -4.257  -7.637  -9.381  1.00 0.00 ? 137 VAL A CG1  2  
ATOM 3287  C CG2  . VAL A 1 86  ? -2.765  -9.222  -10.664 1.00 0.00 ? 137 VAL A CG2  2  
ATOM 3288  H H    . VAL A 1 86  ? -2.547  -6.162  -7.623  1.00 0.00 ? 137 VAL A H    2  
ATOM 3289  H HA   . VAL A 1 86  ? -1.077  -8.615  -8.473  1.00 0.00 ? 137 VAL A HA   2  
ATOM 3290  H HB   . VAL A 1 86  ? -3.320  -9.383  -8.588  1.00 0.00 ? 137 VAL A HB   2  
ATOM 3291  H HG11 . VAL A 1 86  ? -4.406  -7.148  -8.429  1.00 0.00 ? 137 VAL A HG11 2  
ATOM 3292  H HG12 . VAL A 1 86  ? -4.068  -6.903  -10.144 1.00 0.00 ? 137 VAL A HG12 2  
ATOM 3293  H HG13 . VAL A 1 86  ? -5.149  -8.198  -9.635  1.00 0.00 ? 137 VAL A HG13 2  
ATOM 3294  H HG21 . VAL A 1 86  ? -1.704  -9.417  -10.757 1.00 0.00 ? 137 VAL A HG21 2  
ATOM 3295  H HG22 . VAL A 1 86  ? -3.307  -10.158 -10.761 1.00 0.00 ? 137 VAL A HG22 2  
ATOM 3296  H HG23 . VAL A 1 86  ? -3.072  -8.550  -11.453 1.00 0.00 ? 137 VAL A HG23 2  
ATOM 3297  N N    . GLY A 1 87  ? 0.079   -6.568  -9.575  1.00 0.00 ? 138 GLY A N    2  
ATOM 3298  C CA   . GLY A 1 87  ? 0.857   -5.747  -10.564 1.00 0.00 ? 138 GLY A CA   2  
ATOM 3299  C C    . GLY A 1 87  ? 1.884   -6.694  -11.224 1.00 0.00 ? 138 GLY A C    2  
ATOM 3300  O O    . GLY A 1 87  ? 1.544   -7.785  -11.630 1.00 0.00 ? 138 GLY A O    2  
ATOM 3301  H H    . GLY A 1 87  ? 0.516   -6.853  -8.744  1.00 0.00 ? 138 GLY A H    2  
ATOM 3302  H HA2  . GLY A 1 87  ? 0.185   -5.342  -11.310 1.00 0.00 ? 138 GLY A HA2  2  
ATOM 3303  H HA3  . GLY A 1 87  ? 1.373   -4.940  -10.059 1.00 0.00 ? 138 GLY A HA3  2  
ATOM 3304  N N    . ARG A 1 88  ? 3.145   -6.312  -11.289 1.00 0.00 ? 139 ARG A N    2  
ATOM 3305  C CA   . ARG A 1 88  ? 4.201   -7.224  -11.875 1.00 0.00 ? 139 ARG A CA   2  
ATOM 3306  C C    . ARG A 1 88  ? 5.045   -7.804  -10.715 1.00 0.00 ? 139 ARG A C    2  
ATOM 3307  O O    . ARG A 1 88  ? 5.207   -7.183  -9.683  1.00 0.00 ? 139 ARG A O    2  
ATOM 3308  C CB   . ARG A 1 88  ? 5.119   -6.428  -12.841 1.00 0.00 ? 139 ARG A CB   2  
ATOM 3309  C CG   . ARG A 1 88  ? 4.625   -6.499  -14.321 1.00 0.00 ? 139 ARG A CG   2  
ATOM 3310  C CD   . ARG A 1 88  ? 3.933   -5.194  -14.707 1.00 0.00 ? 139 ARG A CD   2  
ATOM 3311  N NE   . ARG A 1 88  ? 2.918   -4.888  -13.671 1.00 0.00 ? 139 ARG A NE   2  
ATOM 3312  C CZ   . ARG A 1 88  ? 2.376   -3.712  -13.610 1.00 0.00 ? 139 ARG A CZ   2  
ATOM 3313  N NH1  . ARG A 1 88  ? 2.763   -2.768  -14.417 1.00 0.00 ? 139 ARG A NH1  2  
ATOM 3314  N NH2  . ARG A 1 88  ? 1.455   -3.473  -12.727 1.00 0.00 ? 139 ARG A NH2  2  
ATOM 3315  H H    . ARG A 1 88  ? 3.406   -5.441  -10.925 1.00 0.00 ? 139 ARG A H    2  
ATOM 3316  H HA   . ARG A 1 88  ? 3.730   -8.044  -12.399 1.00 0.00 ? 139 ARG A HA   2  
ATOM 3317  H HB2  . ARG A 1 88  ? 5.143   -5.397  -12.515 1.00 0.00 ? 139 ARG A HB2  2  
ATOM 3318  H HB3  . ARG A 1 88  ? 6.124   -6.828  -12.787 1.00 0.00 ? 139 ARG A HB3  2  
ATOM 3319  H HG2  . ARG A 1 88  ? 5.472   -6.649  -14.978 1.00 0.00 ? 139 ARG A HG2  2  
ATOM 3320  H HG3  . ARG A 1 88  ? 3.931   -7.315  -14.455 1.00 0.00 ? 139 ARG A HG3  2  
ATOM 3321  H HD2  . ARG A 1 88  ? 4.654   -4.397  -14.754 1.00 0.00 ? 139 ARG A HD2  2  
ATOM 3322  H HD3  . ARG A 1 88  ? 3.452   -5.304  -15.670 1.00 0.00 ? 139 ARG A HD3  2  
ATOM 3323  H HE   . ARG A 1 88  ? 2.642   -5.584  -13.041 1.00 0.00 ? 139 ARG A HE   2  
ATOM 3324  H HH11 . ARG A 1 88  ? 3.482   -2.952  -15.083 1.00 0.00 ? 139 ARG A HH11 2  
ATOM 3325  H HH12 . ARG A 1 88  ? 2.339   -1.866  -14.372 1.00 0.00 ? 139 ARG A HH12 2  
ATOM 3326  H HH21 . ARG A 1 88  ? 1.176   -4.193  -12.097 1.00 0.00 ? 139 ARG A HH21 2  
ATOM 3327  H HH22 . ARG A 1 88  ? 1.022   -2.573  -12.685 1.00 0.00 ? 139 ARG A HH22 2  
ATOM 3328  N N    . SER A 1 89  ? 5.570   -8.997  -10.879 1.00 0.00 ? 140 SER A N    2  
ATOM 3329  C CA   . SER A 1 89  ? 6.394   -9.641  -9.798  1.00 0.00 ? 140 SER A CA   2  
ATOM 3330  C C    . SER A 1 89  ? 7.883   -9.533  -10.138 1.00 0.00 ? 140 SER A C    2  
ATOM 3331  O O    . SER A 1 89  ? 8.735   -10.025 -9.421  1.00 0.00 ? 140 SER A O    2  
ATOM 3332  C CB   . SER A 1 89  ? 6.003   -11.112 -9.687  1.00 0.00 ? 140 SER A CB   2  
ATOM 3333  O OG   . SER A 1 89  ? 4.658   -11.202 -9.234  1.00 0.00 ? 140 SER A OG   2  
ATOM 3334  H H    . SER A 1 89  ? 5.420   -9.475  -11.717 1.00 0.00 ? 140 SER A H    2  
ATOM 3335  H HA   . SER A 1 89  ? 6.208   -9.149  -8.851  1.00 0.00 ? 140 SER A HA   2  
ATOM 3336  H HB2  . SER A 1 89  ? 6.090   -11.581 -10.654 1.00 0.00 ? 140 SER A HB2  2  
ATOM 3337  H HB3  . SER A 1 89  ? 6.664   -11.605 -8.985  1.00 0.00 ? 140 SER A HB3  2  
ATOM 3338  H HG   . SER A 1 89  ? 4.082   -10.945 -9.959  1.00 0.00 ? 140 SER A HG   2  
ATOM 3339  N N    . GLY A 1 90  ? 8.196   -8.892  -11.226 1.00 0.00 ? 141 GLY A N    2  
ATOM 3340  C CA   . GLY A 1 90  ? 9.627   -8.739  -11.630 1.00 0.00 ? 141 GLY A CA   2  
ATOM 3341  C C    . GLY A 1 90  ? 10.314  -7.692  -10.739 1.00 0.00 ? 141 GLY A C    2  
ATOM 3342  O O    . GLY A 1 90  ? 10.247  -6.508  -11.001 1.00 0.00 ? 141 GLY A O    2  
ATOM 3343  H H    . GLY A 1 90  ? 7.490   -8.509  -11.783 1.00 0.00 ? 141 GLY A H    2  
ATOM 3344  H HA2  . GLY A 1 90  ? 10.133  -9.689  -11.533 1.00 0.00 ? 141 GLY A HA2  2  
ATOM 3345  H HA3  . GLY A 1 90  ? 9.668   -8.413  -12.656 1.00 0.00 ? 141 GLY A HA3  2  
ATOM 3346  N N    . ARG A 1 91  ? 10.978  -8.121  -9.690  1.00 0.00 ? 142 ARG A N    2  
ATOM 3347  C CA   . ARG A 1 91  ? 11.679  -7.155  -8.785  1.00 0.00 ? 142 ARG A CA   2  
ATOM 3348  C C    . ARG A 1 91  ? 12.757  -6.393  -9.546  1.00 0.00 ? 142 ARG A C    2  
ATOM 3349  O O    . ARG A 1 91  ? 13.055  -5.257  -9.240  1.00 0.00 ? 142 ARG A O    2  
ATOM 3350  C CB   . ARG A 1 91  ? 12.333  -7.918  -7.627  1.00 0.00 ? 142 ARG A CB   2  
ATOM 3351  C CG   . ARG A 1 91  ? 13.346  -8.932  -8.191  1.00 0.00 ? 142 ARG A CG   2  
ATOM 3352  C CD   . ARG A 1 91  ? 13.750  -9.934  -7.103  1.00 0.00 ? 142 ARG A CD   2  
ATOM 3353  N NE   . ARG A 1 91  ? 12.657  -10.942 -6.969  1.00 0.00 ? 142 ARG A NE   2  
ATOM 3354  C CZ   . ARG A 1 91  ? 12.818  -12.026 -6.250  1.00 0.00 ? 142 ARG A CZ   2  
ATOM 3355  N NH1  . ARG A 1 91  ? 13.923  -12.227 -5.587  1.00 0.00 ? 142 ARG A NH1  2  
ATOM 3356  N NH2  . ARG A 1 91  ? 11.855  -12.905 -6.190  1.00 0.00 ? 142 ARG A NH2  2  
ATOM 3357  H H    . ARG A 1 91  ? 11.021  -9.081  -9.502  1.00 0.00 ? 142 ARG A H    2  
ATOM 3358  H HA   . ARG A 1 91  ? 10.969  -6.446  -8.395  1.00 0.00 ? 142 ARG A HA   2  
ATOM 3359  H HB2  . ARG A 1 91  ? 12.844  -7.216  -6.981  1.00 0.00 ? 142 ARG A HB2  2  
ATOM 3360  H HB3  . ARG A 1 91  ? 11.575  -8.439  -7.065  1.00 0.00 ? 142 ARG A HB3  2  
ATOM 3361  H HG2  . ARG A 1 91  ? 12.894  -9.467  -9.013  1.00 0.00 ? 142 ARG A HG2  2  
ATOM 3362  H HG3  . ARG A 1 91  ? 14.224  -8.413  -8.545  1.00 0.00 ? 142 ARG A HG3  2  
ATOM 3363  H HD2  . ARG A 1 91  ? 14.663  -10.435 -7.389  1.00 0.00 ? 142 ARG A HD2  2  
ATOM 3364  H HD3  . ARG A 1 91  ? 13.904  -9.413  -6.167  1.00 0.00 ? 142 ARG A HD3  2  
ATOM 3365  H HE   . ARG A 1 91  ? 11.813  -10.800 -7.443  1.00 0.00 ? 142 ARG A HE   2  
ATOM 3366  H HH11 . ARG A 1 91  ? 14.662  -11.557 -5.625  1.00 0.00 ? 142 ARG A HH11 2  
ATOM 3367  H HH12 . ARG A 1 91  ? 14.026  -13.053 -5.028  1.00 0.00 ? 142 ARG A HH12 2  
ATOM 3368  H HH21 . ARG A 1 91  ? 10.999  -12.745 -6.685  1.00 0.00 ? 142 ARG A HH21 2  
ATOM 3369  H HH22 . ARG A 1 91  ? 11.974  -13.745 -5.661  1.00 0.00 ? 142 ARG A HH22 2  
ATOM 3370  N N    . GLY A 1 92  ? 13.338  -7.001  -10.535 1.00 0.00 ? 143 GLY A N    2  
ATOM 3371  C CA   . GLY A 1 92  ? 14.394  -6.292  -11.308 1.00 0.00 ? 143 GLY A CA   2  
ATOM 3372  C C    . GLY A 1 92  ? 13.785  -5.040  -11.941 1.00 0.00 ? 143 GLY A C    2  
ATOM 3373  O O    . GLY A 1 92  ? 14.479  -4.115  -12.314 1.00 0.00 ? 143 GLY A O    2  
ATOM 3374  H H    . GLY A 1 92  ? 13.083  -7.918  -10.770 1.00 0.00 ? 143 GLY A H    2  
ATOM 3375  H HA2  . GLY A 1 92  ? 15.196  -6.008  -10.640 1.00 0.00 ? 143 GLY A HA2  2  
ATOM 3376  H HA3  . GLY A 1 92  ? 14.774  -6.941  -12.083 1.00 0.00 ? 143 GLY A HA3  2  
ATOM 3377  N N    . LYS A 1 93  ? 12.491  -5.006  -12.057 1.00 0.00 ? 144 LYS A N    2  
ATOM 3378  C CA   . LYS A 1 93  ? 11.815  -3.829  -12.654 1.00 0.00 ? 144 LYS A CA   2  
ATOM 3379  C C    . LYS A 1 93  ? 11.582  -2.802  -11.556 1.00 0.00 ? 144 LYS A C    2  
ATOM 3380  O O    . LYS A 1 93  ? 11.501  -3.140  -10.391 1.00 0.00 ? 144 LYS A O    2  
ATOM 3381  C CB   . LYS A 1 93  ? 10.473  -4.274  -13.221 1.00 0.00 ? 144 LYS A CB   2  
ATOM 3382  C CG   . LYS A 1 93  ? 10.714  -5.339  -14.291 1.00 0.00 ? 144 LYS A CG   2  
ATOM 3383  C CD   . LYS A 1 93  ? 9.380   -5.799  -14.874 1.00 0.00 ? 144 LYS A CD   2  
ATOM 3384  C CE   . LYS A 1 93  ? 9.634   -6.980  -15.813 1.00 0.00 ? 144 LYS A CE   2  
ATOM 3385  N NZ   . LYS A 1 93  ? 8.391   -7.297  -16.564 1.00 0.00 ? 144 LYS A NZ   2  
ATOM 3386  H H    . LYS A 1 93  ? 11.955  -5.758  -11.738 1.00 0.00 ? 144 LYS A H    2  
ATOM 3387  H HA   . LYS A 1 93  ? 12.424  -3.405  -13.437 1.00 0.00 ? 144 LYS A HA   2  
ATOM 3388  H HB2  . LYS A 1 93  ? 9.864   -4.682  -12.430 1.00 0.00 ? 144 LYS A HB2  2  
ATOM 3389  H HB3  . LYS A 1 93  ? 9.973   -3.426  -13.663 1.00 0.00 ? 144 LYS A HB3  2  
ATOM 3390  H HG2  . LYS A 1 93  ? 11.322  -4.918  -15.081 1.00 0.00 ? 144 LYS A HG2  2  
ATOM 3391  H HG3  . LYS A 1 93  ? 11.225  -6.180  -13.857 1.00 0.00 ? 144 LYS A HG3  2  
ATOM 3392  H HD2  . LYS A 1 93  ? 8.721   -6.112  -14.070 1.00 0.00 ? 144 LYS A HD2  2  
ATOM 3393  H HD3  . LYS A 1 93  ? 8.926   -4.993  -15.423 1.00 0.00 ? 144 LYS A HD3  2  
ATOM 3394  H HE2  . LYS A 1 93  ? 10.419  -6.722  -16.508 1.00 0.00 ? 144 LYS A HE2  2  
ATOM 3395  H HE3  . LYS A 1 93  ? 9.936   -7.840  -15.233 1.00 0.00 ? 144 LYS A HE3  2  
ATOM 3396  H HZ1  . LYS A 1 93  ? 7.579   -7.285  -15.918 1.00 0.00 ? 144 LYS A HZ1  2  
ATOM 3397  H HZ2  . LYS A 1 93  ? 8.247   -6.590  -17.312 1.00 0.00 ? 144 LYS A HZ2  2  
ATOM 3398  H HZ3  . LYS A 1 93  ? 8.483   -8.241  -16.994 1.00 0.00 ? 144 LYS A HZ3  2  
ATOM 3399  N N    . SER A 1 94  ? 11.463  -1.556  -11.892 1.00 0.00 ? 145 SER A N    2  
ATOM 3400  C CA   . SER A 1 94  ? 11.225  -0.549  -10.832 1.00 0.00 ? 145 SER A CA   2  
ATOM 3401  C C    . SER A 1 94  ? 9.721   -0.522  -10.545 1.00 0.00 ? 145 SER A C    2  
ATOM 3402  O O    . SER A 1 94  ? 8.918   -0.315  -11.428 1.00 0.00 ? 145 SER A O    2  
ATOM 3403  C CB   . SER A 1 94  ? 11.705  0.822   -11.315 1.00 0.00 ? 145 SER A CB   2  
ATOM 3404  O OG   . SER A 1 94  ? 13.065  0.720   -11.716 1.00 0.00 ? 145 SER A OG   2  
ATOM 3405  H H    . SER A 1 94  ? 11.520  -1.283  -12.832 1.00 0.00 ? 145 SER A H    2  
ATOM 3406  H HA   . SER A 1 94  ? 11.760  -0.833  -9.931  1.00 0.00 ? 145 SER A HA   2  
ATOM 3407  H HB2  . SER A 1 94  ? 11.112  1.141   -12.158 1.00 0.00 ? 145 SER A HB2  2  
ATOM 3408  H HB3  . SER A 1 94  ? 11.609  1.546   -10.518 1.00 0.00 ? 145 SER A HB3  2  
ATOM 3409  H HG   . SER A 1 94  ? 13.615  0.892   -10.948 1.00 0.00 ? 145 SER A HG   2  
ATOM 3410  N N    . PHE A 1 95  ? 9.344   -0.751  -9.315  1.00 0.00 ? 146 PHE A N    2  
ATOM 3411  C CA   . PHE A 1 95  ? 7.904   -0.762  -8.936  1.00 0.00 ? 146 PHE A CA   2  
ATOM 3412  C C    . PHE A 1 95  ? 7.498   0.672   -8.613  1.00 0.00 ? 146 PHE A C    2  
ATOM 3413  O O    . PHE A 1 95  ? 8.148   1.344   -7.836  1.00 0.00 ? 146 PHE A O    2  
ATOM 3414  C CB   . PHE A 1 95  ? 7.750   -1.673  -7.707  1.00 0.00 ? 146 PHE A CB   2  
ATOM 3415  C CG   . PHE A 1 95  ? 6.330   -2.173  -7.558  1.00 0.00 ? 146 PHE A CG   2  
ATOM 3416  C CD1  . PHE A 1 95  ? 5.749   -2.948  -8.571  1.00 0.00 ? 146 PHE A CD1  2  
ATOM 3417  C CD2  . PHE A 1 95  ? 5.603   -1.890  -6.396  1.00 0.00 ? 146 PHE A CD2  2  
ATOM 3418  C CE1  . PHE A 1 95  ? 4.451   -3.443  -8.428  1.00 0.00 ? 146 PHE A CE1  2  
ATOM 3419  C CE2  . PHE A 1 95  ? 4.304   -2.374  -6.246  1.00 0.00 ? 146 PHE A CE2  2  
ATOM 3420  C CZ   . PHE A 1 95  ? 3.726   -3.156  -7.261  1.00 0.00 ? 146 PHE A CZ   2  
ATOM 3421  H H    . PHE A 1 95  ? 10.016  -0.932  -8.627  1.00 0.00 ? 146 PHE A H    2  
ATOM 3422  H HA   . PHE A 1 95  ? 7.303   -1.128  -9.753  1.00 0.00 ? 146 PHE A HA   2  
ATOM 3423  H HB2  . PHE A 1 95  ? 8.405   -2.524  -7.819  1.00 0.00 ? 146 PHE A HB2  2  
ATOM 3424  H HB3  . PHE A 1 95  ? 8.037   -1.127  -6.822  1.00 0.00 ? 146 PHE A HB3  2  
ATOM 3425  H HD1  . PHE A 1 95  ? 6.310   -3.178  -9.456  1.00 0.00 ? 146 PHE A HD1  2  
ATOM 3426  H HD2  . PHE A 1 95  ? 6.044   -1.285  -5.615  1.00 0.00 ? 146 PHE A HD2  2  
ATOM 3427  H HE1  . PHE A 1 95  ? 4.005   -4.035  -9.227  1.00 0.00 ? 146 PHE A HE1  2  
ATOM 3428  H HE2  . PHE A 1 95  ? 3.754   -2.153  -5.345  1.00 0.00 ? 146 PHE A HE2  2  
ATOM 3429  H HZ   . PHE A 1 95  ? 2.725   -3.542  -7.141  1.00 0.00 ? 146 PHE A HZ   2  
ATOM 3430  N N    . THR A 1 96  ? 6.445   1.158   -9.228  1.00 0.00 ? 147 THR A N    2  
ATOM 3431  C CA   . THR A 1 96  ? 6.009   2.573   -8.994  1.00 0.00 ? 147 THR A CA   2  
ATOM 3432  C C    . THR A 1 96  ? 4.614   2.613   -8.369  1.00 0.00 ? 147 THR A C    2  
ATOM 3433  O O    . THR A 1 96  ? 3.672   1.988   -8.838  1.00 0.00 ? 147 THR A O    2  
ATOM 3434  C CB   . THR A 1 96  ? 6.008   3.327   -10.340 1.00 0.00 ? 147 THR A CB   2  
ATOM 3435  O OG1  . THR A 1 96  ? 7.345   3.475   -10.802 1.00 0.00 ? 147 THR A OG1  2  
ATOM 3436  C CG2  . THR A 1 96  ? 5.369   4.711   -10.177 1.00 0.00 ? 147 THR A CG2  2  
ATOM 3437  H H    . THR A 1 96  ? 5.955   0.598   -9.864  1.00 0.00 ? 147 THR A H    2  
ATOM 3438  H HA   . THR A 1 96  ? 6.700   3.067   -8.323  1.00 0.00 ? 147 THR A HA   2  
ATOM 3439  H HB   . THR A 1 96  ? 5.449   2.767   -11.070 1.00 0.00 ? 147 THR A HB   2  
ATOM 3440  H HG1  . THR A 1 96  ? 7.450   4.373   -11.133 1.00 0.00 ? 147 THR A HG1  2  
ATOM 3441  H HG21 . THR A 1 96  ? 5.561   5.089   -9.184  1.00 0.00 ? 147 THR A HG21 2  
ATOM 3442  H HG22 . THR A 1 96  ? 5.793   5.385   -10.906 1.00 0.00 ? 147 THR A HG22 2  
ATOM 3443  H HG23 . THR A 1 96  ? 4.300   4.639   -10.333 1.00 0.00 ? 147 THR A HG23 2  
ATOM 3444  N N    . LEU A 1 97  ? 4.502   3.366   -7.298  1.00 0.00 ? 148 LEU A N    2  
ATOM 3445  C CA   . LEU A 1 97  ? 3.207   3.521   -6.560  1.00 0.00 ? 148 LEU A CA   2  
ATOM 3446  C C    . LEU A 1 97  ? 2.801   5.009   -6.572  1.00 0.00 ? 148 LEU A C    2  
ATOM 3447  O O    . LEU A 1 97  ? 3.599   5.884   -6.292  1.00 0.00 ? 148 LEU A O    2  
ATOM 3448  C CB   . LEU A 1 97  ? 3.431   3.030   -5.106  1.00 0.00 ? 148 LEU A CB   2  
ATOM 3449  C CG   . LEU A 1 97  ? 2.989   1.548   -4.937  1.00 0.00 ? 148 LEU A CG   2  
ATOM 3450  C CD1  . LEU A 1 97  ? 3.892   0.828   -3.924  1.00 0.00 ? 148 LEU A CD1  2  
ATOM 3451  C CD2  . LEU A 1 97  ? 1.539   1.486   -4.432  1.00 0.00 ? 148 LEU A CD2  2  
ATOM 3452  H H    . LEU A 1 97  ? 5.297   3.844   -6.971  1.00 0.00 ? 148 LEU A H    2  
ATOM 3453  H HA   . LEU A 1 97  ? 2.436   2.936   -7.037  1.00 0.00 ? 148 LEU A HA   2  
ATOM 3454  H HB2  . LEU A 1 97  ? 4.484   3.111   -4.879  1.00 0.00 ? 148 LEU A HB2  2  
ATOM 3455  H HB3  . LEU A 1 97  ? 2.876   3.657   -4.417  1.00 0.00 ? 148 LEU A HB3  2  
ATOM 3456  H HG   . LEU A 1 97  ? 3.064   1.037   -5.881  1.00 0.00 ? 148 LEU A HG   2  
ATOM 3457  H HD11 . LEU A 1 97  ? 4.029   1.452   -3.056  1.00 0.00 ? 148 LEU A HD11 2  
ATOM 3458  H HD12 . LEU A 1 97  ? 3.425   -0.104  -3.627  1.00 0.00 ? 148 LEU A HD12 2  
ATOM 3459  H HD13 . LEU A 1 97  ? 4.845   0.620   -4.381  1.00 0.00 ? 148 LEU A HD13 2  
ATOM 3460  H HD21 . LEU A 1 97  ? 0.947   2.234   -4.936  1.00 0.00 ? 148 LEU A HD21 2  
ATOM 3461  H HD22 . LEU A 1 97  ? 1.130   0.507   -4.630  1.00 0.00 ? 148 LEU A HD22 2  
ATOM 3462  H HD23 . LEU A 1 97  ? 1.516   1.674   -3.366  1.00 0.00 ? 148 LEU A HD23 2  
ATOM 3463  N N    . THR A 1 98  ? 1.560   5.303   -6.895  1.00 0.00 ? 149 THR A N    2  
ATOM 3464  C CA   . THR A 1 98  ? 1.100   6.730   -6.930  1.00 0.00 ? 149 THR A CA   2  
ATOM 3465  C C    . THR A 1 98  ? -0.294  6.851   -6.307  1.00 0.00 ? 149 THR A C    2  
ATOM 3466  O O    . THR A 1 98  ? -1.229  6.196   -6.720  1.00 0.00 ? 149 THR A O    2  
ATOM 3467  C CB   . THR A 1 98  ? 1.051   7.199   -8.387  1.00 0.00 ? 149 THR A CB   2  
ATOM 3468  O OG1  . THR A 1 98  ? 0.214   6.326   -9.140  1.00 0.00 ? 149 THR A OG1  2  
ATOM 3469  C CG2  . THR A 1 98  ? 2.468   7.190   -8.972  1.00 0.00 ? 149 THR A CG2  2  
ATOM 3470  H H    . THR A 1 98  ? 0.933   4.584   -7.119  1.00 0.00 ? 149 THR A H    2  
ATOM 3471  H HA   . THR A 1 98  ? 1.783   7.356   -6.381  1.00 0.00 ? 149 THR A HA   2  
ATOM 3472  H HB   . THR A 1 98  ? 0.655   8.202   -8.430  1.00 0.00 ? 149 THR A HB   2  
ATOM 3473  H HG1  . THR A 1 98  ? 0.678   5.497   -9.267  1.00 0.00 ? 149 THR A HG1  2  
ATOM 3474  H HG21 . THR A 1 98  ? 2.879   6.194   -8.908  1.00 0.00 ? 149 THR A HG21 2  
ATOM 3475  H HG22 . THR A 1 98  ? 2.434   7.498   -10.006 1.00 0.00 ? 149 THR A HG22 2  
ATOM 3476  H HG23 . THR A 1 98  ? 3.092   7.873   -8.415  1.00 0.00 ? 149 THR A HG23 2  
ATOM 3477  N N    . ILE A 1 99  ? -0.428  7.702   -5.316  1.00 0.00 ? 150 ILE A N    2  
ATOM 3478  C CA   . ILE A 1 99  ? -1.751  7.904   -4.644  1.00 0.00 ? 150 ILE A CA   2  
ATOM 3479  C C    . ILE A 1 99  ? -2.172  9.364   -4.806  1.00 0.00 ? 150 ILE A C    2  
ATOM 3480  O O    . ILE A 1 99  ? -1.385  10.264  -4.586  1.00 0.00 ? 150 ILE A O    2  
ATOM 3481  C CB   . ILE A 1 99  ? -1.631  7.613   -3.147  1.00 0.00 ? 150 ILE A CB   2  
ATOM 3482  C CG1  . ILE A 1 99  ? -0.987  6.246   -2.937  1.00 0.00 ? 150 ILE A CG1  2  
ATOM 3483  C CG2  . ILE A 1 99  ? -3.031  7.611   -2.524  1.00 0.00 ? 150 ILE A CG2  2  
ATOM 3484  C CD1  . ILE A 1 99  ? -0.713  6.041   -1.449  1.00 0.00 ? 150 ILE A CD1  2  
ATOM 3485  H H    . ILE A 1 99  ? 0.348   8.216   -5.014  1.00 0.00 ? 150 ILE A H    2  
ATOM 3486  H HA   . ILE A 1 99  ? -2.499  7.257   -5.078  1.00 0.00 ? 150 ILE A HA   2  
ATOM 3487  H HB   . ILE A 1 99  ? -1.031  8.377   -2.678  1.00 0.00 ? 150 ILE A HB   2  
ATOM 3488  H HG12 . ILE A 1 99  ? -1.656  5.477   -3.290  1.00 0.00 ? 150 ILE A HG12 2  
ATOM 3489  H HG13 . ILE A 1 99  ? -0.059  6.191   -3.483  1.00 0.00 ? 150 ILE A HG13 2  
ATOM 3490  H HG21 . ILE A 1 99  ? -3.552  8.516   -2.790  1.00 0.00 ? 150 ILE A HG21 2  
ATOM 3491  H HG22 . ILE A 1 99  ? -3.583  6.759   -2.892  1.00 0.00 ? 150 ILE A HG22 2  
ATOM 3492  H HG23 . ILE A 1 99  ? -2.949  7.545   -1.447  1.00 0.00 ? 150 ILE A HG23 2  
ATOM 3493  H HD11 . ILE A 1 99  ? -0.181  6.897   -1.062  1.00 0.00 ? 150 ILE A HD11 2  
ATOM 3494  H HD12 . ILE A 1 99  ? -1.649  5.928   -0.923  1.00 0.00 ? 150 ILE A HD12 2  
ATOM 3495  H HD13 . ILE A 1 99  ? -0.113  5.153   -1.314  1.00 0.00 ? 150 ILE A HD13 2  
ATOM 3496  N N    . THR A 1 100 ? -3.404  9.615   -5.170  1.00 0.00 ? 151 THR A N    2  
ATOM 3497  C CA   . THR A 1 100 ? -3.872  11.032  -5.312  1.00 0.00 ? 151 THR A CA   2  
ATOM 3498  C C    . THR A 1 100 ? -5.275  11.157  -4.712  1.00 0.00 ? 151 THR A C    2  
ATOM 3499  O O    . THR A 1 100 ? -6.107  10.280  -4.857  1.00 0.00 ? 151 THR A O    2  
ATOM 3500  C CB   . THR A 1 100 ? -3.899  11.438  -6.794  1.00 0.00 ? 151 THR A CB   2  
ATOM 3501  O OG1  . THR A 1 100 ? -3.978  12.855  -6.890  1.00 0.00 ? 151 THR A OG1  2  
ATOM 3502  C CG2  . THR A 1 100 ? -5.118  10.820  -7.488  1.00 0.00 ? 151 THR A CG2  2  
ATOM 3503  H H    . THR A 1 100 ? -4.029  8.872   -5.326  1.00 0.00 ? 151 THR A H    2  
ATOM 3504  H HA   . THR A 1 100 ? -3.206  11.695  -4.774  1.00 0.00 ? 151 THR A HA   2  
ATOM 3505  H HB   . THR A 1 100 ? -3.002  11.093  -7.281  1.00 0.00 ? 151 THR A HB   2  
ATOM 3506  H HG1  . THR A 1 100 ? -3.086  13.197  -6.994  1.00 0.00 ? 151 THR A HG1  2  
ATOM 3507  H HG21 . THR A 1 100 ? -5.252  9.805   -7.143  1.00 0.00 ? 151 THR A HG21 2  
ATOM 3508  H HG22 . THR A 1 100 ? -5.998  11.401  -7.249  1.00 0.00 ? 151 THR A HG22 2  
ATOM 3509  H HG23 . THR A 1 100 ? -4.967  10.819  -8.556  1.00 0.00 ? 151 THR A HG23 2  
ATOM 3510  N N    . VAL A 1 101 ? -5.528  12.242  -4.036  1.00 0.00 ? 152 VAL A N    2  
ATOM 3511  C CA   . VAL A 1 101 ? -6.867  12.464  -3.408  1.00 0.00 ? 152 VAL A CA   2  
ATOM 3512  C C    . VAL A 1 101 ? -7.390  13.844  -3.785  1.00 0.00 ? 152 VAL A C    2  
ATOM 3513  O O    . VAL A 1 101 ? -6.697  14.838  -3.670  1.00 0.00 ? 152 VAL A O    2  
ATOM 3514  C CB   . VAL A 1 101 ? -6.703  12.360  -1.898  1.00 0.00 ? 152 VAL A CB   2  
ATOM 3515  C CG1  . VAL A 1 101 ? -8.082  12.351  -1.225  1.00 0.00 ? 152 VAL A CG1  2  
ATOM 3516  C CG2  . VAL A 1 101 ? -5.947  11.055  -1.574  1.00 0.00 ? 152 VAL A CG2  2  
ATOM 3517  H H    . VAL A 1 101 ? -4.830  12.922  -3.936  1.00 0.00 ? 152 VAL A H    2  
ATOM 3518  H HA   . VAL A 1 101 ? -7.569  11.711  -3.740  1.00 0.00 ? 152 VAL A HA   2  
ATOM 3519  H HB   . VAL A 1 101 ? -6.136  13.215  -1.547  1.00 0.00 ? 152 VAL A HB   2  
ATOM 3520  H HG11 . VAL A 1 101 ? -8.742  13.047  -1.723  1.00 0.00 ? 152 VAL A HG11 2  
ATOM 3521  H HG12 . VAL A 1 101 ? -8.504  11.360  -1.280  1.00 0.00 ? 152 VAL A HG12 2  
ATOM 3522  H HG13 . VAL A 1 101 ? -7.974  12.636  -0.189  1.00 0.00 ? 152 VAL A HG13 2  
ATOM 3523  H HG21 . VAL A 1 101 ? -6.183  10.300  -2.310  1.00 0.00 ? 152 VAL A HG21 2  
ATOM 3524  H HG22 . VAL A 1 101 ? -4.885  11.242  -1.584  1.00 0.00 ? 152 VAL A HG22 2  
ATOM 3525  H HG23 . VAL A 1 101 ? -6.241  10.694  -0.603  1.00 0.00 ? 152 VAL A HG23 2  
ATOM 3526  N N    . PHE A 1 102 ? -8.613  13.909  -4.237  1.00 0.00 ? 153 PHE A N    2  
ATOM 3527  C CA   . PHE A 1 102 ? -9.207  15.215  -4.643  1.00 0.00 ? 153 PHE A CA   2  
ATOM 3528  C C    . PHE A 1 102 ? -10.068 15.789  -3.517  1.00 0.00 ? 153 PHE A C    2  
ATOM 3529  O O    . PHE A 1 102 ? -11.233 16.070  -3.713  1.00 0.00 ? 153 PHE A O    2  
ATOM 3530  C CB   . PHE A 1 102 ? -10.088 14.991  -5.869  1.00 0.00 ? 153 PHE A CB   2  
ATOM 3531  C CG   . PHE A 1 102 ? -9.405  14.023  -6.792  1.00 0.00 ? 153 PHE A CG   2  
ATOM 3532  C CD1  . PHE A 1 102 ? -8.371  14.461  -7.622  1.00 0.00 ? 153 PHE A CD1  2  
ATOM 3533  C CD2  . PHE A 1 102 ? -9.812  12.683  -6.818  1.00 0.00 ? 153 PHE A CD2  2  
ATOM 3534  C CE1  . PHE A 1 102 ? -7.738  13.560  -8.482  1.00 0.00 ? 153 PHE A CE1  2  
ATOM 3535  C CE2  . PHE A 1 102 ? -9.183  11.781  -7.679  1.00 0.00 ? 153 PHE A CE2  2  
ATOM 3536  C CZ   . PHE A 1 102 ? -8.146  12.216  -8.510  1.00 0.00 ? 153 PHE A CZ   2  
ATOM 3537  H H    . PHE A 1 102 ? -9.143  13.089  -4.320  1.00 0.00 ? 153 PHE A H    2  
ATOM 3538  H HA   . PHE A 1 102 ? -8.420  15.917  -4.893  1.00 0.00 ? 153 PHE A HA   2  
ATOM 3539  H HB2  . PHE A 1 102 ? -11.042 14.584  -5.562  1.00 0.00 ? 153 PHE A HB2  2  
ATOM 3540  H HB3  . PHE A 1 102 ? -10.245 15.928  -6.380  1.00 0.00 ? 153 PHE A HB3  2  
ATOM 3541  H HD1  . PHE A 1 102 ? -8.058  15.497  -7.597  1.00 0.00 ? 153 PHE A HD1  2  
ATOM 3542  H HD2  . PHE A 1 102 ? -10.612 12.352  -6.173  1.00 0.00 ? 153 PHE A HD2  2  
ATOM 3543  H HE1  . PHE A 1 102 ? -6.938  13.897  -9.124  1.00 0.00 ? 153 PHE A HE1  2  
ATOM 3544  H HE2  . PHE A 1 102 ? -9.497  10.743  -7.698  1.00 0.00 ? 153 PHE A HE2  2  
ATOM 3545  H HZ   . PHE A 1 102 ? -7.662  11.519  -9.175  1.00 0.00 ? 153 PHE A HZ   2  
ATOM 3546  N N    . THR A 1 103 ? -9.520  15.980  -2.351  1.00 0.00 ? 154 THR A N    2  
ATOM 3547  C CA   . THR A 1 103 ? -10.334 16.548  -1.242  1.00 0.00 ? 154 THR A CA   2  
ATOM 3548  C C    . THR A 1 103 ? -10.348 18.086  -1.407  1.00 0.00 ? 154 THR A C    2  
ATOM 3549  O O    . THR A 1 103 ? -10.368 18.575  -2.519  1.00 0.00 ? 154 THR A O    2  
ATOM 3550  C CB   . THR A 1 103 ? -9.695  16.111  0.093   1.00 0.00 ? 154 THR A CB   2  
ATOM 3551  O OG1  . THR A 1 103 ? -9.983  17.061  1.103   1.00 0.00 ? 154 THR A OG1  2  
ATOM 3552  C CG2  . THR A 1 103 ? -8.168  15.966  -0.067  1.00 0.00 ? 154 THR A CG2  2  
ATOM 3553  H H    . THR A 1 103 ? -8.576  15.748  -2.201  1.00 0.00 ? 154 THR A H    2  
ATOM 3554  H HA   . THR A 1 103 ? -11.347 16.167  -1.305  1.00 0.00 ? 154 THR A HA   2  
ATOM 3555  H HB   . THR A 1 103 ? -10.107 15.156  0.380   1.00 0.00 ? 154 THR A HB   2  
ATOM 3556  H HG1  . THR A 1 103 ? -10.928 17.027  1.278   1.00 0.00 ? 154 THR A HG1  2  
ATOM 3557  H HG21 . THR A 1 103 ? -7.797  16.704  -0.765  1.00 0.00 ? 154 THR A HG21 2  
ATOM 3558  H HG22 . THR A 1 103 ? -7.691  16.108  0.890   1.00 0.00 ? 154 THR A HG22 2  
ATOM 3559  H HG23 . THR A 1 103 ? -7.936  14.976  -0.439  1.00 0.00 ? 154 THR A HG23 2  
ATOM 3560  N N    . ASN A 1 104 ? -10.348 18.870  -0.357  1.00 0.00 ? 155 ASN A N    2  
ATOM 3561  C CA   . ASN A 1 104 ? -10.369 20.356  -0.565  1.00 0.00 ? 155 ASN A CA   2  
ATOM 3562  C C    . ASN A 1 104 ? -8.933  20.802  -0.914  1.00 0.00 ? 155 ASN A C    2  
ATOM 3563  O O    . ASN A 1 104 ? -8.732  21.526  -1.868  1.00 0.00 ? 155 ASN A O    2  
ATOM 3564  C CB   . ASN A 1 104 ? -10.888 21.072  0.712   1.00 0.00 ? 155 ASN A CB   2  
ATOM 3565  C CG   . ASN A 1 104 ? -12.148 21.899  0.395   1.00 0.00 ? 155 ASN A CG   2  
ATOM 3566  O OD1  . ASN A 1 104 ? -12.077 23.102  0.279   1.00 0.00 ? 155 ASN A OD1  2  
ATOM 3567  N ND2  . ASN A 1 104 ? -13.304 21.301  0.253   1.00 0.00 ? 155 ASN A ND2  2  
ATOM 3568  H H    . ASN A 1 104 ? -10.342 18.495  0.547   1.00 0.00 ? 155 ASN A H    2  
ATOM 3569  H HA   . ASN A 1 104 ? -11.018 20.585  -1.406  1.00 0.00 ? 155 ASN A HA   2  
ATOM 3570  H HB2  . ASN A 1 104 ? -11.131 20.334  1.459   1.00 0.00 ? 155 ASN A HB2  2  
ATOM 3571  H HB3  . ASN A 1 104 ? -10.125 21.731  1.100   1.00 0.00 ? 155 ASN A HB3  2  
ATOM 3572  H HD21 . ASN A 1 104 ? -13.370 20.329  0.351   1.00 0.00 ? 155 ASN A HD21 2  
ATOM 3573  H HD22 . ASN A 1 104 ? -14.106 21.829  0.052   1.00 0.00 ? 155 ASN A HD22 2  
ATOM 3574  N N    . PRO A 1 105 ? -7.944  20.327  -0.190  1.00 0.00 ? 156 PRO A N    2  
ATOM 3575  C CA   . PRO A 1 105 ? -6.516  20.618  -0.460  1.00 0.00 ? 156 PRO A CA   2  
ATOM 3576  C C    . PRO A 1 105 ? -5.824  19.399  -1.101  1.00 0.00 ? 156 PRO A C    2  
ATOM 3577  O O    . PRO A 1 105 ? -5.042  18.747  -0.453  1.00 0.00 ? 156 PRO A O    2  
ATOM 3578  C CB   . PRO A 1 105 ? -5.982  20.802  0.960   1.00 0.00 ? 156 PRO A CB   2  
ATOM 3579  C CG   . PRO A 1 105 ? -6.711  19.750  1.753   1.00 0.00 ? 156 PRO A CG   2  
ATOM 3580  C CD   . PRO A 1 105 ? -8.041  19.473  1.005   1.00 0.00 ? 156 PRO A CD   2  
ATOM 3581  H HA   . PRO A 1 105 ? -6.382  21.515  -1.038  1.00 0.00 ? 156 PRO A HA   2  
ATOM 3582  H HB2  . PRO A 1 105 ? -4.908  20.642  0.989   1.00 0.00 ? 156 PRO A HB2  2  
ATOM 3583  H HB3  . PRO A 1 105 ? -6.228  21.786  1.339   1.00 0.00 ? 156 PRO A HB3  2  
ATOM 3584  H HG2  . PRO A 1 105 ? -6.112  18.847  1.798   1.00 0.00 ? 156 PRO A HG2  2  
ATOM 3585  H HG3  . PRO A 1 105 ? -6.916  20.104  2.751   1.00 0.00 ? 156 PRO A HG3  2  
ATOM 3586  H HD2  . PRO A 1 105 ? -8.109  18.435  0.727   1.00 0.00 ? 156 PRO A HD2  2  
ATOM 3587  H HD3  . PRO A 1 105 ? -8.883  19.760  1.606   1.00 0.00 ? 156 PRO A HD3  2  
ATOM 3588  N N    . PRO A 1 106 ? -6.124  19.067  -2.339  1.00 0.00 ? 157 PRO A N    2  
ATOM 3589  C CA   . PRO A 1 106 ? -5.535  17.888  -3.029  1.00 0.00 ? 157 PRO A CA   2  
ATOM 3590  C C    . PRO A 1 106 ? -4.126  17.537  -2.547  1.00 0.00 ? 157 PRO A C    2  
ATOM 3591  O O    . PRO A 1 106 ? -3.246  18.372  -2.495  1.00 0.00 ? 157 PRO A O    2  
ATOM 3592  C CB   . PRO A 1 106 ? -5.527  18.324  -4.491  1.00 0.00 ? 157 PRO A CB   2  
ATOM 3593  C CG   . PRO A 1 106 ? -6.738  19.197  -4.636  1.00 0.00 ? 157 PRO A CG   2  
ATOM 3594  C CD   . PRO A 1 106 ? -7.054  19.774  -3.235  1.00 0.00 ? 157 PRO A CD   2  
ATOM 3595  H HA   . PRO A 1 106 ? -6.187  17.039  -2.917  1.00 0.00 ? 157 PRO A HA   2  
ATOM 3596  H HB2  . PRO A 1 106 ? -4.624  18.878  -4.713  1.00 0.00 ? 157 PRO A HB2  2  
ATOM 3597  H HB3  . PRO A 1 106 ? -5.606  17.460  -5.141  1.00 0.00 ? 157 PRO A HB3  2  
ATOM 3598  H HG2  . PRO A 1 106 ? -6.536  20.001  -5.337  1.00 0.00 ? 157 PRO A HG2  2  
ATOM 3599  H HG3  . PRO A 1 106 ? -7.580  18.609  -4.981  1.00 0.00 ? 157 PRO A HG3  2  
ATOM 3600  H HD2  . PRO A 1 106 ? -6.873  20.841  -3.210  1.00 0.00 ? 157 PRO A HD2  2  
ATOM 3601  H HD3  . PRO A 1 106 ? -8.072  19.552  -2.957  1.00 0.00 ? 157 PRO A HD3  2  
ATOM 3602  N N    . GLN A 1 107 ? -3.920  16.295  -2.191  1.00 0.00 ? 158 GLN A N    2  
ATOM 3603  C CA   . GLN A 1 107 ? -2.581  15.836  -1.702  1.00 0.00 ? 158 GLN A CA   2  
ATOM 3604  C C    . GLN A 1 107 ? -2.133  14.634  -2.524  1.00 0.00 ? 158 GLN A C    2  
ATOM 3605  O O    . GLN A 1 107 ? -2.827  13.645  -2.621  1.00 0.00 ? 158 GLN A O    2  
ATOM 3606  C CB   . GLN A 1 107 ? -2.723  15.440  -0.234  1.00 0.00 ? 158 GLN A CB   2  
ATOM 3607  C CG   . GLN A 1 107 ? -2.726  16.703  0.630   1.00 0.00 ? 158 GLN A CG   2  
ATOM 3608  C CD   . GLN A 1 107 ? -3.235  16.386  2.037   1.00 0.00 ? 158 GLN A CD   2  
ATOM 3609  O OE1  . GLN A 1 107 ? -4.107  15.558  2.211   1.00 0.00 ? 158 GLN A OE1  2  
ATOM 3610  N NE2  . GLN A 1 107 ? -2.728  17.027  3.053   1.00 0.00 ? 158 GLN A NE2  2  
ATOM 3611  H H    . GLN A 1 107 ? -4.660  15.649  -2.250  1.00 0.00 ? 158 GLN A H    2  
ATOM 3612  H HA   . GLN A 1 107 ? -1.846  16.628  -1.794  1.00 0.00 ? 158 GLN A HA   2  
ATOM 3613  H HB2  . GLN A 1 107 ? -3.654  14.909  -0.102  1.00 0.00 ? 158 GLN A HB2  2  
ATOM 3614  H HB3  . GLN A 1 107 ? -1.897  14.804  0.054   1.00 0.00 ? 158 GLN A HB3  2  
ATOM 3615  H HG2  . GLN A 1 107 ? -1.722  17.094  0.693   1.00 0.00 ? 158 GLN A HG2  2  
ATOM 3616  H HG3  . GLN A 1 107 ? -3.359  17.438  0.182   1.00 0.00 ? 158 GLN A HG3  2  
ATOM 3617  H HE21 . GLN A 1 107 ? -2.026  17.694  2.910   1.00 0.00 ? 158 GLN A HE21 2  
ATOM 3618  H HE22 . GLN A 1 107 ? -3.057  16.850  3.957   1.00 0.00 ? 158 GLN A HE22 2  
ATOM 3619  N N    . VAL A 1 108 ? -0.972  14.717  -3.117  1.00 0.00 ? 159 VAL A N    2  
ATOM 3620  C CA   . VAL A 1 108 ? -0.460  13.594  -3.954  1.00 0.00 ? 159 VAL A CA   2  
ATOM 3621  C C    . VAL A 1 108 ? 0.709   12.907  -3.237  1.00 0.00 ? 159 VAL A C    2  
ATOM 3622  O O    . VAL A 1 108 ? 1.638   13.549  -2.787  1.00 0.00 ? 159 VAL A O    2  
ATOM 3623  C CB   . VAL A 1 108 ? 0.020   14.170  -5.285  1.00 0.00 ? 159 VAL A CB   2  
ATOM 3624  C CG1  . VAL A 1 108 ? 0.354   13.039  -6.257  1.00 0.00 ? 159 VAL A CG1  2  
ATOM 3625  C CG2  . VAL A 1 108 ? -1.091  15.035  -5.886  1.00 0.00 ? 159 VAL A CG2  2  
ATOM 3626  H H    . VAL A 1 108 ? -0.436  15.536  -3.020  1.00 0.00 ? 159 VAL A H    2  
ATOM 3627  H HA   . VAL A 1 108 ? -1.244  12.871  -4.136  1.00 0.00 ? 159 VAL A HA   2  
ATOM 3628  H HB   . VAL A 1 108 ? 0.896   14.776  -5.117  1.00 0.00 ? 159 VAL A HB   2  
ATOM 3629  H HG11 . VAL A 1 108 ? -0.487  12.367  -6.333  1.00 0.00 ? 159 VAL A HG11 2  
ATOM 3630  H HG12 . VAL A 1 108 ? 0.567   13.459  -7.230  1.00 0.00 ? 159 VAL A HG12 2  
ATOM 3631  H HG13 . VAL A 1 108 ? 1.219   12.498  -5.903  1.00 0.00 ? 159 VAL A HG13 2  
ATOM 3632  H HG21 . VAL A 1 108 ? -1.341  15.833  -5.204  1.00 0.00 ? 159 VAL A HG21 2  
ATOM 3633  H HG22 . VAL A 1 108 ? -0.749  15.457  -6.816  1.00 0.00 ? 159 VAL A HG22 2  
ATOM 3634  H HG23 . VAL A 1 108 ? -1.962  14.424  -6.069  1.00 0.00 ? 159 VAL A HG23 2  
ATOM 3635  N N    . ALA A 1 109 ? 0.664   11.600  -3.129  1.00 0.00 ? 160 ALA A N    2  
ATOM 3636  C CA   . ALA A 1 109 ? 1.767   10.849  -2.443  1.00 0.00 ? 160 ALA A CA   2  
ATOM 3637  C C    . ALA A 1 109 ? 2.175   9.656   -3.314  1.00 0.00 ? 160 ALA A C    2  
ATOM 3638  O O    . ALA A 1 109 ? 1.342   8.894   -3.767  1.00 0.00 ? 160 ALA A O    2  
ATOM 3639  C CB   . ALA A 1 109 ? 1.269   10.354  -1.076  1.00 0.00 ? 160 ALA A CB   2  
ATOM 3640  H H    . ALA A 1 109 ? -0.100  11.110  -3.502  1.00 0.00 ? 160 ALA A H    2  
ATOM 3641  H HA   . ALA A 1 109 ? 2.624   11.494  -2.302  1.00 0.00 ? 160 ALA A HA   2  
ATOM 3642  H HB1  . ALA A 1 109 ? 0.213   10.131  -1.133  1.00 0.00 ? 160 ALA A HB1  2  
ATOM 3643  H HB2  . ALA A 1 109 ? 1.809   9.461   -0.788  1.00 0.00 ? 160 ALA A HB2  2  
ATOM 3644  H HB3  . ALA A 1 109 ? 1.432   11.121  -0.335  1.00 0.00 ? 160 ALA A HB3  2  
ATOM 3645  N N    . THR A 1 110 ? 3.455   9.490   -3.552  1.00 0.00 ? 161 THR A N    2  
ATOM 3646  C CA   . THR A 1 110 ? 3.935   8.345   -4.393  1.00 0.00 ? 161 THR A CA   2  
ATOM 3647  C C    . THR A 1 110 ? 5.068   7.619   -3.662  1.00 0.00 ? 161 THR A C    2  
ATOM 3648  O O    . THR A 1 110 ? 5.803   8.206   -2.895  1.00 0.00 ? 161 THR A O    2  
ATOM 3649  C CB   . THR A 1 110 ? 4.450   8.880   -5.740  1.00 0.00 ? 161 THR A CB   2  
ATOM 3650  O OG1  . THR A 1 110 ? 5.750   9.424   -5.570  1.00 0.00 ? 161 THR A OG1  2  
ATOM 3651  C CG2  . THR A 1 110 ? 3.504   9.975   -6.251  1.00 0.00 ? 161 THR A CG2  2  
ATOM 3652  H H    . THR A 1 110 ? 4.102   10.123  -3.177  1.00 0.00 ? 161 THR A H    2  
ATOM 3653  H HA   . THR A 1 110 ? 3.132   7.649   -4.567  1.00 0.00 ? 161 THR A HA   2  
ATOM 3654  H HB   . THR A 1 110 ? 4.484   8.075   -6.461  1.00 0.00 ? 161 THR A HB   2  
ATOM 3655  H HG1  . THR A 1 110 ? 6.213   9.362   -6.410  1.00 0.00 ? 161 THR A HG1  2  
ATOM 3656  H HG21 . THR A 1 110 ? 2.482   9.716   -6.013  1.00 0.00 ? 161 THR A HG21 2  
ATOM 3657  H HG22 . THR A 1 110 ? 3.758   10.914  -5.780  1.00 0.00 ? 161 THR A HG22 2  
ATOM 3658  H HG23 . THR A 1 110 ? 3.607   10.071  -7.322  1.00 0.00 ? 161 THR A HG23 2  
ATOM 3659  N N    . TYR A 1 111 ? 5.206   6.336   -3.904  1.00 0.00 ? 162 TYR A N    2  
ATOM 3660  C CA   . TYR A 1 111 ? 6.285   5.525   -3.244  1.00 0.00 ? 162 TYR A CA   2  
ATOM 3661  C C    . TYR A 1 111 ? 7.075   4.769   -4.330  1.00 0.00 ? 162 TYR A C    2  
ATOM 3662  O O    . TYR A 1 111 ? 6.499   4.213   -5.242  1.00 0.00 ? 162 TYR A O    2  
ATOM 3663  C CB   . TYR A 1 111 ? 5.625   4.542   -2.268  1.00 0.00 ? 162 TYR A CB   2  
ATOM 3664  C CG   . TYR A 1 111 ? 6.630   3.535   -1.762  1.00 0.00 ? 162 TYR A CG   2  
ATOM 3665  C CD1  . TYR A 1 111 ? 7.374   3.804   -0.608  1.00 0.00 ? 162 TYR A CD1  2  
ATOM 3666  C CD2  . TYR A 1 111 ? 6.810   2.322   -2.441  1.00 0.00 ? 162 TYR A CD2  2  
ATOM 3667  C CE1  . TYR A 1 111 ? 8.294   2.861   -0.129  1.00 0.00 ? 162 TYR A CE1  2  
ATOM 3668  C CE2  . TYR A 1 111 ? 7.730   1.381   -1.965  1.00 0.00 ? 162 TYR A CE2  2  
ATOM 3669  C CZ   . TYR A 1 111 ? 8.472   1.649   -0.810  1.00 0.00 ? 162 TYR A CZ   2  
ATOM 3670  O OH   . TYR A 1 111 ? 9.379   0.718   -0.343  1.00 0.00 ? 162 TYR A OH   2  
ATOM 3671  H H    . TYR A 1 111 ? 4.592   5.898   -4.529  1.00 0.00 ? 162 TYR A H    2  
ATOM 3672  H HA   . TYR A 1 111 ? 6.957   6.177   -2.701  1.00 0.00 ? 162 TYR A HA   2  
ATOM 3673  H HB2  . TYR A 1 111 ? 5.225   5.092   -1.426  1.00 0.00 ? 162 TYR A HB2  2  
ATOM 3674  H HB3  . TYR A 1 111 ? 4.818   4.027   -2.765  1.00 0.00 ? 162 TYR A HB3  2  
ATOM 3675  H HD1  . TYR A 1 111 ? 7.236   4.741   -0.083  1.00 0.00 ? 162 TYR A HD1  2  
ATOM 3676  H HD2  . TYR A 1 111 ? 6.240   2.111   -3.333  1.00 0.00 ? 162 TYR A HD2  2  
ATOM 3677  H HE1  . TYR A 1 111 ? 8.867   3.068   0.762   1.00 0.00 ? 162 TYR A HE1  2  
ATOM 3678  H HE2  . TYR A 1 111 ? 7.866   0.448   -2.490  1.00 0.00 ? 162 TYR A HE2  2  
ATOM 3679  H HH   . TYR A 1 111 ? 9.222   0.594   0.593   1.00 0.00 ? 162 TYR A HH   2  
ATOM 3680  N N    . HIS A 1 112 ? 8.393   4.763   -4.253  1.00 0.00 ? 163 HIS A N    2  
ATOM 3681  C CA   . HIS A 1 112 ? 9.223   4.058   -5.304  1.00 0.00 ? 163 HIS A CA   2  
ATOM 3682  C C    . HIS A 1 112 ? 10.220  3.090   -4.647  1.00 0.00 ? 163 HIS A C    2  
ATOM 3683  O O    . HIS A 1 112 ? 10.992  3.460   -3.782  1.00 0.00 ? 163 HIS A O    2  
ATOM 3684  C CB   . HIS A 1 112 ? 10.000  5.111   -6.097  1.00 0.00 ? 163 HIS A CB   2  
ATOM 3685  C CG   . HIS A 1 112 ? 10.807  5.936   -5.140  1.00 0.00 ? 163 HIS A CG   2  
ATOM 3686  N ND1  . HIS A 1 112 ? 12.195  5.899   -5.104  1.00 0.00 ? 163 HIS A ND1  2  
ATOM 3687  C CD2  . HIS A 1 112 ? 10.430  6.809   -4.152  1.00 0.00 ? 163 HIS A CD2  2  
ATOM 3688  C CE1  . HIS A 1 112 ? 12.595  6.726   -4.122  1.00 0.00 ? 163 HIS A CE1  2  
ATOM 3689  N NE2  . HIS A 1 112 ? 11.561  7.309   -3.511  1.00 0.00 ? 163 HIS A NE2  2  
ATOM 3690  H H    . HIS A 1 112 ? 8.836   5.232   -3.517  1.00 0.00 ? 163 HIS A H    2  
ATOM 3691  H HA   . HIS A 1 112 ? 8.585   3.506   -5.975  1.00 0.00 ? 163 HIS A HA   2  
ATOM 3692  H HB2  . HIS A 1 112 ? 10.655  4.625   -6.806  1.00 0.00 ? 163 HIS A HB2  2  
ATOM 3693  H HB3  . HIS A 1 112 ? 9.306   5.746   -6.625  1.00 0.00 ? 163 HIS A HB3  2  
ATOM 3694  H HD1  . HIS A 1 112 ? 12.777  5.364   -5.687  1.00 0.00 ? 163 HIS A HD1  2  
ATOM 3695  H HD2  . HIS A 1 112 ? 9.409   7.059   -3.903  1.00 0.00 ? 163 HIS A HD2  2  
ATOM 3696  H HE1  . HIS A 1 112 ? 13.629  6.892   -3.853  1.00 0.00 ? 163 HIS A HE1  2  
ATOM 3697  N N    . ARG A 1 113 ? 10.204  1.850   -5.076  1.00 0.00 ? 164 ARG A N    2  
ATOM 3698  C CA   . ARG A 1 113 ? 11.129  0.815   -4.517  1.00 0.00 ? 164 ARG A CA   2  
ATOM 3699  C C    . ARG A 1 113 ? 10.855  -0.501  -5.276  1.00 0.00 ? 164 ARG A C    2  
ATOM 3700  O O    . ARG A 1 113 ? 10.242  -0.495  -6.321  1.00 0.00 ? 164 ARG A O    2  
ATOM 3701  C CB   . ARG A 1 113 ? 10.851  0.617   -3.010  1.00 0.00 ? 164 ARG A CB   2  
ATOM 3702  C CG   . ARG A 1 113 ? 12.132  0.169   -2.287  1.00 0.00 ? 164 ARG A CG   2  
ATOM 3703  C CD   . ARG A 1 113 ? 13.007  1.388   -1.947  1.00 0.00 ? 164 ARG A CD   2  
ATOM 3704  N NE   . ARG A 1 113 ? 14.447  0.978   -1.935  1.00 0.00 ? 164 ARG A NE   2  
ATOM 3705  C CZ   . ARG A 1 113 ? 14.846  -0.057  -1.245  1.00 0.00 ? 164 ARG A CZ   2  
ATOM 3706  N NH1  . ARG A 1 113 ? 14.024  -0.672  -0.440  1.00 0.00 ? 164 ARG A NH1  2  
ATOM 3707  N NH2  . ARG A 1 113 ? 16.087  -0.444  -1.328  1.00 0.00 ? 164 ARG A NH2  2  
ATOM 3708  H H    . ARG A 1 113 ? 9.573   1.596   -5.780  1.00 0.00 ? 164 ARG A H    2  
ATOM 3709  H HA   . ARG A 1 113 ? 12.157  1.121   -4.673  1.00 0.00 ? 164 ARG A HA   2  
ATOM 3710  H HB2  . ARG A 1 113 ? 10.501  1.543   -2.579  1.00 0.00 ? 164 ARG A HB2  2  
ATOM 3711  H HB3  . ARG A 1 113 ? 10.089  -0.139  -2.877  1.00 0.00 ? 164 ARG A HB3  2  
ATOM 3712  H HG2  . ARG A 1 113 ? 11.855  -0.346  -1.383  1.00 0.00 ? 164 ARG A HG2  2  
ATOM 3713  H HG3  . ARG A 1 113 ? 12.692  -0.502  -2.922  1.00 0.00 ? 164 ARG A HG3  2  
ATOM 3714  H HD2  . ARG A 1 113 ? 12.888  2.148   -2.700  1.00 0.00 ? 164 ARG A HD2  2  
ATOM 3715  H HD3  . ARG A 1 113 ? 12.704  1.792   -0.985  1.00 0.00 ? 164 ARG A HD3  2  
ATOM 3716  H HE   . ARG A 1 113 ? 15.095  1.470   -2.483  1.00 0.00 ? 164 ARG A HE   2  
ATOM 3717  H HH11 . ARG A 1 113 ? 13.089  -0.349  -0.341  1.00 0.00 ? 164 ARG A HH11 2  
ATOM 3718  H HH12 . ARG A 1 113 ? 14.330  -1.470  0.073   1.00 0.00 ? 164 ARG A HH12 2  
ATOM 3719  H HH21 . ARG A 1 113 ? 16.726  0.050   -1.916  1.00 0.00 ? 164 ARG A HH21 2  
ATOM 3720  H HH22 . ARG A 1 113 ? 16.399  -1.232  -0.799  1.00 0.00 ? 164 ARG A HH22 2  
ATOM 3721  N N    . ALA A 1 114 ? 11.290  -1.626  -4.763  1.00 0.00 ? 165 ALA A N    2  
ATOM 3722  C CA   . ALA A 1 114 ? 11.027  -2.922  -5.473  1.00 0.00 ? 165 ALA A CA   2  
ATOM 3723  C C    . ALA A 1 114 ? 9.620   -3.433  -5.129  1.00 0.00 ? 165 ALA A C    2  
ATOM 3724  O O    . ALA A 1 114 ? 8.932   -2.879  -4.292  1.00 0.00 ? 165 ALA A O    2  
ATOM 3725  C CB   . ALA A 1 114 ? 12.060  -3.967  -5.039  1.00 0.00 ? 165 ALA A CB   2  
ATOM 3726  H H    . ALA A 1 114 ? 11.779  -1.624  -3.918  1.00 0.00 ? 165 ALA A H    2  
ATOM 3727  H HA   . ALA A 1 114 ? 11.100  -2.768  -6.540  1.00 0.00 ? 165 ALA A HA   2  
ATOM 3728  H HB1  . ALA A 1 114 ? 12.094  -4.012  -3.959  1.00 0.00 ? 165 ALA A HB1  2  
ATOM 3729  H HB2  . ALA A 1 114 ? 11.777  -4.933  -5.433  1.00 0.00 ? 165 ALA A HB2  2  
ATOM 3730  H HB3  . ALA A 1 114 ? 13.031  -3.697  -5.420  1.00 0.00 ? 165 ALA A HB3  2  
ATOM 3731  N N    . ILE A 1 115 ? 9.187   -4.496  -5.764  1.00 0.00 ? 166 ILE A N    2  
ATOM 3732  C CA   . ILE A 1 115 ? 7.831   -5.052  -5.463  1.00 0.00 ? 166 ILE A CA   2  
ATOM 3733  C C    . ILE A 1 115 ? 7.782   -5.446  -3.991  1.00 0.00 ? 166 ILE A C    2  
ATOM 3734  O O    . ILE A 1 115 ? 8.804   -5.602  -3.361  1.00 0.00 ? 166 ILE A O    2  
ATOM 3735  C CB   . ILE A 1 115 ? 7.542   -6.297  -6.318  1.00 0.00 ? 166 ILE A CB   2  
ATOM 3736  C CG1  . ILE A 1 115 ? 8.756   -7.245  -6.355  1.00 0.00 ? 166 ILE A CG1  2  
ATOM 3737  C CG2  . ILE A 1 115 ? 7.219   -5.861  -7.745  1.00 0.00 ? 166 ILE A CG2  2  
ATOM 3738  C CD1  . ILE A 1 115 ? 8.980   -7.946  -5.003  1.00 0.00 ? 166 ILE A CD1  2  
ATOM 3739  H H    . ILE A 1 115 ? 9.759   -4.929  -6.430  1.00 0.00 ? 166 ILE A H    2  
ATOM 3740  H HA   . ILE A 1 115 ? 7.083   -4.296  -5.661  1.00 0.00 ? 166 ILE A HA   2  
ATOM 3741  H HB   . ILE A 1 115 ? 6.688   -6.820  -5.911  1.00 0.00 ? 166 ILE A HB   2  
ATOM 3742  H HG12 . ILE A 1 115 ? 8.589   -7.996  -7.111  1.00 0.00 ? 166 ILE A HG12 2  
ATOM 3743  H HG13 . ILE A 1 115 ? 9.637   -6.683  -6.605  1.00 0.00 ? 166 ILE A HG13 2  
ATOM 3744  H HG21 . ILE A 1 115 ? 8.009   -5.223  -8.116  1.00 0.00 ? 166 ILE A HG21 2  
ATOM 3745  H HG22 . ILE A 1 115 ? 7.133   -6.733  -8.377  1.00 0.00 ? 166 ILE A HG22 2  
ATOM 3746  H HG23 . ILE A 1 115 ? 6.288   -5.322  -7.749  1.00 0.00 ? 166 ILE A HG23 2  
ATOM 3747  H HD11 . ILE A 1 115 ? 8.063   -7.972  -4.435  1.00 0.00 ? 166 ILE A HD11 2  
ATOM 3748  H HD12 . ILE A 1 115 ? 9.315   -8.956  -5.178  1.00 0.00 ? 166 ILE A HD12 2  
ATOM 3749  H HD13 . ILE A 1 115 ? 9.738   -7.419  -4.444  1.00 0.00 ? 166 ILE A HD13 2  
ATOM 3750  N N    . LYS A 1 116 ? 6.605   -5.608  -3.429  1.00 0.00 ? 167 LYS A N    2  
ATOM 3751  C CA   . LYS A 1 116 ? 6.504   -6.002  -2.006  1.00 0.00 ? 167 LYS A CA   2  
ATOM 3752  C C    . LYS A 1 116 ? 6.072   -7.470  -1.897  1.00 0.00 ? 167 LYS A C    2  
ATOM 3753  O O    . LYS A 1 116 ? 5.859   -7.965  -0.807  1.00 0.00 ? 167 LYS A O    2  
ATOM 3754  C CB   . LYS A 1 116 ? 5.456   -5.128  -1.317  1.00 0.00 ? 167 LYS A CB   2  
ATOM 3755  C CG   . LYS A 1 116 ? 5.874   -3.659  -1.399  1.00 0.00 ? 167 LYS A CG   2  
ATOM 3756  C CD   . LYS A 1 116 ? 4.724   -2.766  -0.931  1.00 0.00 ? 167 LYS A CD   2  
ATOM 3757  C CE   . LYS A 1 116 ? 4.549   -2.874  0.588   1.00 0.00 ? 167 LYS A CE   2  
ATOM 3758  N NZ   . LYS A 1 116 ? 3.616   -1.808  1.041   1.00 0.00 ? 167 LYS A NZ   2  
ATOM 3759  H H    . LYS A 1 116 ? 5.790   -5.484  -3.941  1.00 0.00 ? 167 LYS A H    2  
ATOM 3760  H HA   . LYS A 1 116 ? 7.454   -5.866  -1.524  1.00 0.00 ? 167 LYS A HA   2  
ATOM 3761  H HB2  . LYS A 1 116 ? 4.503   -5.260  -1.808  1.00 0.00 ? 167 LYS A HB2  2  
ATOM 3762  H HB3  . LYS A 1 116 ? 5.373   -5.422  -0.283  1.00 0.00 ? 167 LYS A HB3  2  
ATOM 3763  H HG2  . LYS A 1 116 ? 6.732   -3.495  -0.769  1.00 0.00 ? 167 LYS A HG2  2  
ATOM 3764  H HG3  . LYS A 1 116 ? 6.125   -3.412  -2.418  1.00 0.00 ? 167 LYS A HG3  2  
ATOM 3765  H HD2  . LYS A 1 116 ? 4.943   -1.741  -1.193  1.00 0.00 ? 167 LYS A HD2  2  
ATOM 3766  H HD3  . LYS A 1 116 ? 3.811   -3.073  -1.418  1.00 0.00 ? 167 LYS A HD3  2  
ATOM 3767  H HE2  . LYS A 1 116 ? 4.136   -3.840  0.839   1.00 0.00 ? 167 LYS A HE2  2  
ATOM 3768  H HE3  . LYS A 1 116 ? 5.506   -2.750  1.075   1.00 0.00 ? 167 LYS A HE3  2  
ATOM 3769  H HZ1  . LYS A 1 116 ? 3.098   -1.432  0.222   1.00 0.00 ? 167 LYS A HZ1  2  
ATOM 3770  H HZ2  . LYS A 1 116 ? 2.940   -2.206  1.723   1.00 0.00 ? 167 LYS A HZ2  2  
ATOM 3771  H HZ3  . LYS A 1 116 ? 4.158   -1.044  1.493   1.00 0.00 ? 167 LYS A HZ3  2  
ATOM 3772  N N    . ILE A 1 117 ? 5.908   -8.166  -3.008  1.00 0.00 ? 168 ILE A N    2  
ATOM 3773  C CA   . ILE A 1 117 ? 5.454   -9.600  -2.932  1.00 0.00 ? 168 ILE A CA   2  
ATOM 3774  C C    . ILE A 1 117 ? 6.243   -10.519 -3.875  1.00 0.00 ? 168 ILE A C    2  
ATOM 3775  O O    . ILE A 1 117 ? 6.676   -10.146 -4.947  1.00 0.00 ? 168 ILE A O    2  
ATOM 3776  C CB   . ILE A 1 117 ? 3.948   -9.684  -3.254  1.00 0.00 ? 168 ILE A CB   2  
ATOM 3777  C CG1  . ILE A 1 117 ? 3.543   -11.143 -3.569  1.00 0.00 ? 168 ILE A CG1  2  
ATOM 3778  C CG2  . ILE A 1 117 ? 3.626   -8.804  -4.457  1.00 0.00 ? 168 ILE A CG2  2  
ATOM 3779  C CD1  . ILE A 1 117 ? 2.035   -11.329 -3.372  1.00 0.00 ? 168 ILE A CD1  2  
ATOM 3780  H H    . ILE A 1 117 ? 6.061   -7.747  -3.879  1.00 0.00 ? 168 ILE A H    2  
ATOM 3781  H HA   . ILE A 1 117 ? 5.603   -9.954  -1.930  1.00 0.00 ? 168 ILE A HA   2  
ATOM 3782  H HB   . ILE A 1 117 ? 3.388   -9.333  -2.401  1.00 0.00 ? 168 ILE A HB   2  
ATOM 3783  H HG12 . ILE A 1 117 ? 3.804   -11.375 -4.593  1.00 0.00 ? 168 ILE A HG12 2  
ATOM 3784  H HG13 . ILE A 1 117 ? 4.073   -11.809 -2.919  1.00 0.00 ? 168 ILE A HG13 2  
ATOM 3785  H HG21 . ILE A 1 117 ? 4.328   -9.007  -5.253  1.00 0.00 ? 168 ILE A HG21 2  
ATOM 3786  H HG22 . ILE A 1 117 ? 2.622   -9.021  -4.792  1.00 0.00 ? 168 ILE A HG22 2  
ATOM 3787  H HG23 . ILE A 1 117 ? 3.693   -7.766  -4.167  1.00 0.00 ? 168 ILE A HG23 2  
ATOM 3788  H HD11 . ILE A 1 117 ? 1.755   -11.002 -2.384  1.00 0.00 ? 168 ILE A HD11 2  
ATOM 3789  H HD12 . ILE A 1 117 ? 1.499   -10.750 -4.110  1.00 0.00 ? 168 ILE A HD12 2  
ATOM 3790  H HD13 . ILE A 1 117 ? 1.786   -12.376 -3.487  1.00 0.00 ? 168 ILE A HD13 2  
ATOM 3791  N N    . THR A 1 118 ? 6.376   -11.748 -3.456  1.00 0.00 ? 169 THR A N    2  
ATOM 3792  C CA   . THR A 1 118 ? 7.067   -12.788 -4.248  1.00 0.00 ? 169 THR A CA   2  
ATOM 3793  C C    . THR A 1 118 ? 6.363   -14.100 -3.929  1.00 0.00 ? 169 THR A C    2  
ATOM 3794  O O    . THR A 1 118 ? 5.217   -14.106 -3.527  1.00 0.00 ? 169 THR A O    2  
ATOM 3795  C CB   . THR A 1 118 ? 8.525   -12.893 -3.828  1.00 0.00 ? 169 THR A CB   2  
ATOM 3796  O OG1  . THR A 1 118 ? 8.591   -13.067 -2.423  1.00 0.00 ? 169 THR A OG1  2  
ATOM 3797  C CG2  . THR A 1 118 ? 9.275   -11.626 -4.218  1.00 0.00 ? 169 THR A CG2  2  
ATOM 3798  H H    . THR A 1 118 ? 5.984   -12.004 -2.598  1.00 0.00 ? 169 THR A H    2  
ATOM 3799  H HA   . THR A 1 118 ? 6.991   -12.567 -5.302  1.00 0.00 ? 169 THR A HA   2  
ATOM 3800  H HB   . THR A 1 118 ? 8.978   -13.740 -4.320  1.00 0.00 ? 169 THR A HB   2  
ATOM 3801  H HG1  . THR A 1 118 ? 9.371   -12.606 -2.108  1.00 0.00 ? 169 THR A HG1  2  
ATOM 3802  H HG21 . THR A 1 118 ? 9.092   -11.401 -5.259  1.00 0.00 ? 169 THR A HG21 2  
ATOM 3803  H HG22 . THR A 1 118 ? 8.935   -10.807 -3.605  1.00 0.00 ? 169 THR A HG22 2  
ATOM 3804  H HG23 . THR A 1 118 ? 10.331  -11.777 -4.059  1.00 0.00 ? 169 THR A HG23 2  
ATOM 3805  N N    . VAL A 1 119 ? 7.028   -15.213 -4.077  1.00 0.00 ? 170 VAL A N    2  
ATOM 3806  C CA   . VAL A 1 119 ? 6.380   -16.515 -3.752  1.00 0.00 ? 170 VAL A CA   2  
ATOM 3807  C C    . VAL A 1 119 ? 6.936   -17.032 -2.423  1.00 0.00 ? 170 VAL A C    2  
ATOM 3808  O O    . VAL A 1 119 ? 8.121   -17.272 -2.286  1.00 0.00 ? 170 VAL A O    2  
ATOM 3809  C CB   . VAL A 1 119 ? 6.721   -17.492 -4.863  1.00 0.00 ? 170 VAL A CB   2  
ATOM 3810  C CG1  . VAL A 1 119 ? 6.093   -18.857 -4.574  1.00 0.00 ? 170 VAL A CG1  2  
ATOM 3811  C CG2  . VAL A 1 119 ? 6.182   -16.953 -6.193  1.00 0.00 ? 170 VAL A CG2  2  
ATOM 3812  H H    . VAL A 1 119 ? 7.958   -15.192 -4.387  1.00 0.00 ? 170 VAL A H    2  
ATOM 3813  H HA   . VAL A 1 119 ? 5.307   -16.409 -3.681  1.00 0.00 ? 170 VAL A HA   2  
ATOM 3814  H HB   . VAL A 1 119 ? 7.792   -17.585 -4.920  1.00 0.00 ? 170 VAL A HB   2  
ATOM 3815  H HG11 . VAL A 1 119 ? 5.029   -18.745 -4.438  1.00 0.00 ? 170 VAL A HG11 2  
ATOM 3816  H HG12 . VAL A 1 119 ? 6.281   -19.519 -5.406  1.00 0.00 ? 170 VAL A HG12 2  
ATOM 3817  H HG13 . VAL A 1 119 ? 6.529   -19.276 -3.680  1.00 0.00 ? 170 VAL A HG13 2  
ATOM 3818  H HG21 . VAL A 1 119 ? 5.120   -16.775 -6.106  1.00 0.00 ? 170 VAL A HG21 2  
ATOM 3819  H HG22 . VAL A 1 119 ? 6.682   -16.027 -6.438  1.00 0.00 ? 170 VAL A HG22 2  
ATOM 3820  H HG23 . VAL A 1 119 ? 6.364   -17.675 -6.974  1.00 0.00 ? 170 VAL A HG23 2  
ATOM 3821  N N    . ASP A 1 120 ? 6.089   -17.215 -1.445  1.00 0.00 ? 171 ASP A N    2  
ATOM 3822  C CA   . ASP A 1 120 ? 6.572   -17.720 -0.129  1.00 0.00 ? 171 ASP A CA   2  
ATOM 3823  C C    . ASP A 1 120 ? 6.966   -19.190 -0.273  1.00 0.00 ? 171 ASP A C    2  
ATOM 3824  O O    . ASP A 1 120 ? 7.941   -19.646 0.292   1.00 0.00 ? 171 ASP A O    2  
ATOM 3825  C CB   . ASP A 1 120 ? 5.457   -17.586 0.913   1.00 0.00 ? 171 ASP A CB   2  
ATOM 3826  C CG   . ASP A 1 120 ? 6.033   -17.824 2.311   1.00 0.00 ? 171 ASP A CG   2  
ATOM 3827  O OD1  . ASP A 1 120 ? 7.202   -18.156 2.399   1.00 0.00 ? 171 ASP A OD1  2  
ATOM 3828  O OD2  . ASP A 1 120 ? 5.292   -17.679 3.270   1.00 0.00 ? 171 ASP A OD2  2  
ATOM 3829  H H    . ASP A 1 120 ? 5.134   -17.021 -1.576  1.00 0.00 ? 171 ASP A H    2  
ATOM 3830  H HA   . ASP A 1 120 ? 7.430   -17.144 0.182   1.00 0.00 ? 171 ASP A HA   2  
ATOM 3831  H HB2  . ASP A 1 120 ? 5.031   -16.593 0.861   1.00 0.00 ? 171 ASP A HB2  2  
ATOM 3832  H HB3  . ASP A 1 120 ? 4.689   -18.321 0.714   1.00 0.00 ? 171 ASP A HB3  2  
ATOM 3833  N N    . GLY A 1 121 ? 6.210   -19.927 -1.037  1.00 0.00 ? 172 GLY A N    2  
ATOM 3834  C CA   . GLY A 1 121 ? 6.520   -21.371 -1.242  1.00 0.00 ? 172 GLY A CA   2  
ATOM 3835  C C    . GLY A 1 121 ? 7.801   -21.512 -2.076  1.00 0.00 ? 172 GLY A C    2  
ATOM 3836  O O    . GLY A 1 121 ? 8.253   -20.566 -2.691  1.00 0.00 ? 172 GLY A O    2  
ATOM 3837  H H    . GLY A 1 121 ? 5.435   -19.527 -1.482  1.00 0.00 ? 172 GLY A H    2  
ATOM 3838  H HA2  . GLY A 1 121 ? 6.652   -21.852 -0.285  1.00 0.00 ? 172 GLY A HA2  2  
ATOM 3839  H HA3  . GLY A 1 121 ? 5.702   -21.835 -1.770  1.00 0.00 ? 172 GLY A HA3  2  
ATOM 3840  N N    . PRO A 1 122 ? 8.372   -22.687 -2.097  1.00 0.00 ? 173 PRO A N    2  
ATOM 3841  C CA   . PRO A 1 122 ? 9.612   -22.977 -2.868  1.00 0.00 ? 173 PRO A CA   2  
ATOM 3842  C C    . PRO A 1 122 ? 9.645   -22.235 -4.200  1.00 0.00 ? 173 PRO A C    2  
ATOM 3843  O O    . PRO A 1 122 ? 8.620   -21.831 -4.711  1.00 0.00 ? 173 PRO A O    2  
ATOM 3844  C CB   . PRO A 1 122 ? 9.518   -24.486 -3.114  1.00 0.00 ? 173 PRO A CB   2  
ATOM 3845  C CG   . PRO A 1 122 ? 8.780   -25.023 -1.924  1.00 0.00 ? 173 PRO A CG   2  
ATOM 3846  C CD   . PRO A 1 122 ? 7.898   -23.878 -1.383  1.00 0.00 ? 173 PRO A CD   2  
ATOM 3847  H HA   . PRO A 1 122 ? 10.487  -22.759 -2.283  1.00 0.00 ? 173 PRO A HA   2  
ATOM 3848  H HB2  . PRO A 1 122 ? 8.964   -24.687 -4.027  1.00 0.00 ? 173 PRO A HB2  2  
ATOM 3849  H HB3  . PRO A 1 122 ? 10.503  -24.918 -3.174  1.00 0.00 ? 173 PRO A HB3  2  
ATOM 3850  H HG2  . PRO A 1 122 ? 8.165   -25.867 -2.219  1.00 0.00 ? 173 PRO A HG2  2  
ATOM 3851  H HG3  . PRO A 1 122 ? 9.482   -25.332 -1.161  1.00 0.00 ? 173 PRO A HG3  2  
ATOM 3852  H HD2  . PRO A 1 122 ? 6.855   -24.061 -1.608  1.00 0.00 ? 173 PRO A HD2  2  
ATOM 3853  H HD3  . PRO A 1 122 ? 8.041   -23.755 -0.319  1.00 0.00 ? 173 PRO A HD3  2  
ATOM 3854  N N    . ARG A 1 123 ? 10.807  -22.073 -4.784  1.00 0.00 ? 174 ARG A N    2  
ATOM 3855  C CA   . ARG A 1 123 ? 10.892  -21.379 -6.105  1.00 0.00 ? 174 ARG A CA   2  
ATOM 3856  C C    . ARG A 1 123 ? 11.401  -22.378 -7.135  1.00 0.00 ? 174 ARG A C    2  
ATOM 3857  O O    . ARG A 1 123 ? 12.575  -22.449 -7.428  1.00 0.00 ? 174 ARG A O    2  
ATOM 3858  C CB   . ARG A 1 123 ? 11.852  -20.190 -6.005  1.00 0.00 ? 174 ARG A CB   2  
ATOM 3859  C CG   . ARG A 1 123 ? 11.752  -19.330 -7.272  1.00 0.00 ? 174 ARG A CG   2  
ATOM 3860  C CD   . ARG A 1 123 ? 12.525  -18.030 -7.055  1.00 0.00 ? 174 ARG A CD   2  
ATOM 3861  N NE   . ARG A 1 123 ? 13.972  -18.347 -6.896  1.00 0.00 ? 174 ARG A NE   2  
ATOM 3862  C CZ   . ARG A 1 123 ? 14.851  -17.384 -6.949  1.00 0.00 ? 174 ARG A CZ   2  
ATOM 3863  N NH1  . ARG A 1 123 ? 14.449  -16.156 -7.087  1.00 0.00 ? 174 ARG A NH1  2  
ATOM 3864  N NH2  . ARG A 1 123 ? 16.128  -17.640 -6.840  1.00 0.00 ? 174 ARG A NH2  2  
ATOM 3865  H H    . ARG A 1 123 ? 11.620  -22.430 -4.364  1.00 0.00 ? 174 ARG A H    2  
ATOM 3866  H HA   . ARG A 1 123 ? 9.916   -21.026 -6.409  1.00 0.00 ? 174 ARG A HA   2  
ATOM 3867  H HB2  . ARG A 1 123 ? 11.593  -19.592 -5.145  1.00 0.00 ? 174 ARG A HB2  2  
ATOM 3868  H HB3  . ARG A 1 123 ? 12.865  -20.554 -5.899  1.00 0.00 ? 174 ARG A HB3  2  
ATOM 3869  H HG2  . ARG A 1 123 ? 12.174  -19.865 -8.110  1.00 0.00 ? 174 ARG A HG2  2  
ATOM 3870  H HG3  . ARG A 1 123 ? 10.716  -19.100 -7.474  1.00 0.00 ? 174 ARG A HG3  2  
ATOM 3871  H HD2  . ARG A 1 123 ? 12.393  -17.380 -7.909  1.00 0.00 ? 174 ARG A HD2  2  
ATOM 3872  H HD3  . ARG A 1 123 ? 12.158  -17.535 -6.168  1.00 0.00 ? 174 ARG A HD3  2  
ATOM 3873  H HE   . ARG A 1 123 ? 14.259  -19.273 -6.760  1.00 0.00 ? 174 ARG A HE   2  
ATOM 3874  H HH11 . ARG A 1 123 ? 13.471  -15.957 -7.147  1.00 0.00 ? 174 ARG A HH11 2  
ATOM 3875  H HH12 . ARG A 1 123 ? 15.114  -15.414 -7.133  1.00 0.00 ? 174 ARG A HH12 2  
ATOM 3876  H HH21 . ARG A 1 123 ? 16.445  -18.577 -6.717  1.00 0.00 ? 174 ARG A HH21 2  
ATOM 3877  H HH22 . ARG A 1 123 ? 16.787  -16.887 -6.870  1.00 0.00 ? 174 ARG A HH22 2  
ATOM 3878  N N    . GLU A 1 124 ? 10.507  -23.142 -7.697  1.00 0.00 ? 175 GLU A N    2  
ATOM 3879  C CA   . GLU A 1 124 ? 10.914  -24.132 -8.725  1.00 0.00 ? 175 GLU A CA   2  
ATOM 3880  C C    . GLU A 1 124 ? 11.391  -23.413 -9.997  1.00 0.00 ? 175 GLU A C    2  
ATOM 3881  O O    . GLU A 1 124 ? 12.273  -23.892 -10.679 1.00 0.00 ? 175 GLU A O    2  
ATOM 3882  C CB   . GLU A 1 124 ? 9.748   -25.072 -9.057  1.00 0.00 ? 175 GLU A CB   2  
ATOM 3883  C CG   . GLU A 1 124 ? 9.563   -26.093 -7.933  1.00 0.00 ? 175 GLU A CG   2  
ATOM 3884  C CD   . GLU A 1 124 ? 9.328   -25.355 -6.615  1.00 0.00 ? 175 GLU A CD   2  
ATOM 3885  O OE1  . GLU A 1 124 ? 10.302  -24.934 -6.012  1.00 0.00 ? 175 GLU A OE1  2  
ATOM 3886  O OE2  . GLU A 1 124 ? 8.179   -25.217 -6.233  1.00 0.00 ? 175 GLU A OE2  2  
ATOM 3887  H H    . GLU A 1 124 ? 9.565   -23.058 -7.451  1.00 0.00 ? 175 GLU A H    2  
ATOM 3888  H HA   . GLU A 1 124 ? 11.733  -24.715 -8.331  1.00 0.00 ? 175 GLU A HA   2  
ATOM 3889  H HB2  . GLU A 1 124 ? 8.841   -24.502 -9.166  1.00 0.00 ? 175 GLU A HB2  2  
ATOM 3890  H HB3  . GLU A 1 124 ? 9.961   -25.592 -9.979  1.00 0.00 ? 175 GLU A HB3  2  
ATOM 3891  H HG2  . GLU A 1 124 ? 8.713   -26.720 -8.157  1.00 0.00 ? 175 GLU A HG2  2  
ATOM 3892  H HG3  . GLU A 1 124 ? 10.449  -26.702 -7.849  1.00 0.00 ? 175 GLU A HG3  2  
ATOM 3893  N N    . PRO A 1 125 ? 10.818  -22.285 -10.348 1.00 0.00 ? 176 PRO A N    2  
ATOM 3894  C CA   . PRO A 1 125 ? 11.231  -21.551 -11.577 1.00 0.00 ? 176 PRO A CA   2  
ATOM 3895  C C    . PRO A 1 125 ? 12.755  -21.344 -11.698 1.00 0.00 ? 176 PRO A C    2  
ATOM 3896  O O    . PRO A 1 125 ? 13.284  -21.267 -12.789 1.00 0.00 ? 176 PRO A O    2  
ATOM 3897  C CB   . PRO A 1 125 ? 10.525  -20.202 -11.417 1.00 0.00 ? 176 PRO A CB   2  
ATOM 3898  C CG   . PRO A 1 125 ? 9.278   -20.544 -10.689 1.00 0.00 ? 176 PRO A CG   2  
ATOM 3899  C CD   . PRO A 1 125 ? 9.717   -21.573 -9.653  1.00 0.00 ? 176 PRO A CD   2  
ATOM 3900  H HA   . PRO A 1 125 ? 10.847  -22.050 -12.443 1.00 0.00 ? 176 PRO A HA   2  
ATOM 3901  H HB2  . PRO A 1 125 ? 11.134  -19.529 -10.829 1.00 0.00 ? 176 PRO A HB2  2  
ATOM 3902  H HB3  . PRO A 1 125 ? 10.295  -19.772 -12.378 1.00 0.00 ? 176 PRO A HB3  2  
ATOM 3903  H HG2  . PRO A 1 125 ? 8.871   -19.663 -10.208 1.00 0.00 ? 176 PRO A HG2  2  
ATOM 3904  H HG3  . PRO A 1 125 ? 8.557   -20.981 -11.357 1.00 0.00 ? 176 PRO A HG3  2  
ATOM 3905  H HD2  . PRO A 1 125 ? 10.069  -21.063 -8.774  1.00 0.00 ? 176 PRO A HD2  2  
ATOM 3906  H HD3  . PRO A 1 125 ? 8.911   -22.243 -9.419  1.00 0.00 ? 176 PRO A HD3  2  
ATOM 3907  N N    . ARG A 1 126 ? 13.455  -21.212 -10.599 1.00 0.00 ? 177 ARG A N    2  
ATOM 3908  C CA   . ARG A 1 126 ? 14.934  -20.961 -10.693 1.00 0.00 ? 177 ARG A CA   2  
ATOM 3909  C C    . ARG A 1 126 ? 15.690  -22.197 -11.202 1.00 0.00 ? 177 ARG A C    2  
ATOM 3910  O O    . ARG A 1 126 ? 16.802  -22.088 -11.680 1.00 0.00 ? 177 ARG A O    2  
ATOM 3911  C CB   . ARG A 1 126 ? 15.509  -20.525 -9.328  1.00 0.00 ? 177 ARG A CB   2  
ATOM 3912  C CG   . ARG A 1 126 ? 15.675  -21.736 -8.395  1.00 0.00 ? 177 ARG A CG   2  
ATOM 3913  C CD   . ARG A 1 126 ? 16.012  -21.263 -6.974  1.00 0.00 ? 177 ARG A CD   2  
ATOM 3914  N NE   . ARG A 1 126 ? 16.487  -22.428 -6.181  1.00 0.00 ? 177 ARG A NE   2  
ATOM 3915  C CZ   . ARG A 1 126 ? 17.124  -22.236 -5.058  1.00 0.00 ? 177 ARG A CZ   2  
ATOM 3916  N NH1  . ARG A 1 126 ? 17.330  -21.024 -4.625  1.00 0.00 ? 177 ARG A NH1  2  
ATOM 3917  N NH2  . ARG A 1 126 ? 17.573  -23.254 -4.376  1.00 0.00 ? 177 ARG A NH2  2  
ATOM 3918  H H    . ARG A 1 126 ? 13.014  -21.246 -9.726  1.00 0.00 ? 177 ARG A H    2  
ATOM 3919  H HA   . ARG A 1 126 ? 15.090  -20.158 -11.399 1.00 0.00 ? 177 ARG A HA   2  
ATOM 3920  H HB2  . ARG A 1 126 ? 16.474  -20.065 -9.484  1.00 0.00 ? 177 ARG A HB2  2  
ATOM 3921  H HB3  . ARG A 1 126 ? 14.841  -19.809 -8.871  1.00 0.00 ? 177 ARG A HB3  2  
ATOM 3922  H HG2  . ARG A 1 126 ? 14.759  -22.303 -8.375  1.00 0.00 ? 177 ARG A HG2  2  
ATOM 3923  H HG3  . ARG A 1 126 ? 16.479  -22.358 -8.755  1.00 0.00 ? 177 ARG A HG3  2  
ATOM 3924  H HD2  . ARG A 1 126 ? 16.784  -20.511 -7.016  1.00 0.00 ? 177 ARG A HD2  2  
ATOM 3925  H HD3  . ARG A 1 126 ? 15.130  -20.848 -6.507  1.00 0.00 ? 177 ARG A HD3  2  
ATOM 3926  H HE   . ARG A 1 126 ? 16.334  -23.339 -6.506  1.00 0.00 ? 177 ARG A HE   2  
ATOM 3927  H HH11 . ARG A 1 126 ? 17.004  -20.243 -5.156  1.00 0.00 ? 177 ARG A HH11 2  
ATOM 3928  H HH12 . ARG A 1 126 ? 17.806  -20.878 -3.757  1.00 0.00 ? 177 ARG A HH12 2  
ATOM 3929  H HH21 . ARG A 1 126 ? 17.431  -24.183 -4.714  1.00 0.00 ? 177 ARG A HH21 2  
ATOM 3930  H HH22 . ARG A 1 126 ? 18.058  -23.104 -3.514  1.00 0.00 ? 177 ARG A HH22 2  
ATOM 3931  N N    . ARG A 1 127 ? 15.128  -23.369 -11.105 1.00 0.00 ? 178 ARG A N    2  
ATOM 3932  C CA   . ARG A 1 127 ? 15.866  -24.573 -11.590 1.00 0.00 ? 178 ARG A CA   2  
ATOM 3933  C C    . ARG A 1 127 ? 15.676  -24.710 -13.103 1.00 0.00 ? 178 ARG A C    2  
ATOM 3934  O O    . ARG A 1 127 ? 16.615  -24.944 -13.839 1.00 0.00 ? 178 ARG A O    2  
ATOM 3935  C CB   . ARG A 1 127 ? 15.326  -25.825 -10.891 1.00 0.00 ? 178 ARG A CB   2  
ATOM 3936  C CG   . ARG A 1 127 ? 15.602  -25.755 -9.363  1.00 0.00 ? 178 ARG A CG   2  
ATOM 3937  C CD   . ARG A 1 127 ? 14.370  -25.206 -8.633  1.00 0.00 ? 178 ARG A CD   2  
ATOM 3938  N NE   . ARG A 1 127 ? 14.774  -24.596 -7.330  1.00 0.00 ? 178 ARG A NE   2  
ATOM 3939  C CZ   . ARG A 1 127 ? 15.409  -25.283 -6.420  1.00 0.00 ? 178 ARG A CZ   2  
ATOM 3940  N NH1  . ARG A 1 127 ? 15.635  -26.557 -6.588  1.00 0.00 ? 178 ARG A NH1  2  
ATOM 3941  N NH2  . ARG A 1 127 ? 15.787  -24.703 -5.316  1.00 0.00 ? 178 ARG A NH2  2  
ATOM 3942  H H    . ARG A 1 127 ? 14.234  -23.459 -10.714 1.00 0.00 ? 178 ARG A H    2  
ATOM 3943  H HA   . ARG A 1 127 ? 16.919  -24.465 -11.369 1.00 0.00 ? 178 ARG A HA   2  
ATOM 3944  H HB2  . ARG A 1 127 ? 14.263  -25.902 -11.072 1.00 0.00 ? 178 ARG A HB2  2  
ATOM 3945  H HB3  . ARG A 1 127 ? 15.821  -26.696 -11.300 1.00 0.00 ? 178 ARG A HB3  2  
ATOM 3946  H HG2  . ARG A 1 127 ? 15.822  -26.745 -8.999  1.00 0.00 ? 178 ARG A HG2  2  
ATOM 3947  H HG3  . ARG A 1 127 ? 16.446  -25.107 -9.169  1.00 0.00 ? 178 ARG A HG3  2  
ATOM 3948  H HD2  . ARG A 1 127 ? 13.927  -24.430 -9.214  1.00 0.00 ? 178 ARG A HD2  2  
ATOM 3949  H HD3  . ARG A 1 127 ? 13.648  -26.010 -8.500  1.00 0.00 ? 178 ARG A HD3  2  
ATOM 3950  H HE   . ARG A 1 127 ? 14.568  -23.647 -7.166  1.00 0.00 ? 178 ARG A HE   2  
ATOM 3951  H HH11 . ARG A 1 127 ? 15.316  -27.019 -7.409  1.00 0.00 ? 178 ARG A HH11 2  
ATOM 3952  H HH12 . ARG A 1 127 ? 16.134  -27.070 -5.889  1.00 0.00 ? 178 ARG A HH12 2  
ATOM 3953  H HH21 . ARG A 1 127 ? 15.595  -23.736 -5.167  1.00 0.00 ? 178 ARG A HH21 2  
ATOM 3954  H HH22 . ARG A 1 127 ? 16.258  -25.233 -4.611  1.00 0.00 ? 178 ARG A HH22 2  
ATOM 3955  N N    . VAL A 1 1   ? -2.527  9.514   29.570  1.00 0.00 ? 52  VAL A N    3  
ATOM 3956  C CA   . VAL A 1 1   ? -1.192  10.073  29.219  1.00 0.00 ? 52  VAL A CA   3  
ATOM 3957  C C    . VAL A 1 1   ? -1.312  10.951  27.971  1.00 0.00 ? 52  VAL A C    3  
ATOM 3958  O O    . VAL A 1 1   ? -0.930  10.551  26.889  1.00 0.00 ? 52  VAL A O    3  
ATOM 3959  C CB   . VAL A 1 1   ? -0.216  8.933   28.929  1.00 0.00 ? 52  VAL A CB   3  
ATOM 3960  C CG1  . VAL A 1 1   ? 1.201   9.489   28.898  1.00 0.00 ? 52  VAL A CG1  3  
ATOM 3961  C CG2  . VAL A 1 1   ? -0.304  7.884   30.037  1.00 0.00 ? 52  VAL A CG2  3  
ATOM 3962  H H    . VAL A 1 1   ? -2.841  8.688   29.149  1.00 0.00 ? 52  VAL A H    3  
ATOM 3963  H HA   . VAL A 1 1   ? -0.822  10.662  30.044  1.00 0.00 ? 52  VAL A HA   3  
ATOM 3964  H HB   . VAL A 1 1   ? -0.450  8.479   27.971  1.00 0.00 ? 52  VAL A HB   3  
ATOM 3965  H HG11 . VAL A 1 1   ? 1.241   10.330  28.228  1.00 0.00 ? 52  VAL A HG11 3  
ATOM 3966  H HG12 . VAL A 1 1   ? 1.474   9.808   29.895  1.00 0.00 ? 52  VAL A HG12 3  
ATOM 3967  H HG13 . VAL A 1 1   ? 1.883   8.722   28.562  1.00 0.00 ? 52  VAL A HG13 3  
ATOM 3968  H HG21 . VAL A 1 1   ? -0.065  8.344   30.984  1.00 0.00 ? 52  VAL A HG21 3  
ATOM 3969  H HG22 . VAL A 1 1   ? -1.306  7.474   30.074  1.00 0.00 ? 52  VAL A HG22 3  
ATOM 3970  H HG23 . VAL A 1 1   ? 0.408   7.092   29.839  1.00 0.00 ? 52  VAL A HG23 3  
ATOM 3971  N N    . GLU A 1 2   ? -1.831  12.141  28.103  1.00 0.00 ? 53  GLU A N    3  
ATOM 3972  C CA   . GLU A 1 2   ? -1.958  13.019  26.906  1.00 0.00 ? 53  GLU A CA   3  
ATOM 3973  C C    . GLU A 1 2   ? -0.604  13.632  26.605  1.00 0.00 ? 53  GLU A C    3  
ATOM 3974  O O    . GLU A 1 2   ? -0.327  14.770  26.929  1.00 0.00 ? 53  GLU A O    3  
ATOM 3975  C CB   . GLU A 1 2   ? -2.963  14.135  27.182  1.00 0.00 ? 53  GLU A CB   3  
ATOM 3976  C CG   . GLU A 1 2   ? -4.347  13.540  27.481  1.00 0.00 ? 53  GLU A CG   3  
ATOM 3977  C CD   . GLU A 1 2   ? -4.839  12.725  26.277  1.00 0.00 ? 53  GLU A CD   3  
ATOM 3978  O OE1  . GLU A 1 2   ? -4.399  11.597  26.125  1.00 0.00 ? 53  GLU A OE1  3  
ATOM 3979  O OE2  . GLU A 1 2   ? -5.653  13.244  25.530  1.00 0.00 ? 53  GLU A OE2  3  
ATOM 3980  H H    . GLU A 1 2   ? -2.131  12.453  28.983  1.00 0.00 ? 53  GLU A H    3  
ATOM 3981  H HA   . GLU A 1 2   ? -2.273  12.440  26.058  1.00 0.00 ? 53  GLU A HA   3  
ATOM 3982  H HB2  . GLU A 1 2   ? -2.626  14.711  28.034  1.00 0.00 ? 53  GLU A HB2  3  
ATOM 3983  H HB3  . GLU A 1 2   ? -3.023  14.774  26.317  1.00 0.00 ? 53  GLU A HB3  3  
ATOM 3984  H HG2  . GLU A 1 2   ? -4.285  12.900  28.346  1.00 0.00 ? 53  GLU A HG2  3  
ATOM 3985  H HG3  . GLU A 1 2   ? -5.043  14.342  27.676  1.00 0.00 ? 53  GLU A HG3  3  
ATOM 3986  N N    . VAL A 1 3   ? 0.252   12.871  25.996  1.00 0.00 ? 54  VAL A N    3  
ATOM 3987  C CA   . VAL A 1 3   ? 1.617   13.375  25.676  1.00 0.00 ? 54  VAL A CA   3  
ATOM 3988  C C    . VAL A 1 3   ? 2.148   12.667  24.426  1.00 0.00 ? 54  VAL A C    3  
ATOM 3989  O O    . VAL A 1 3   ? 2.772   13.273  23.575  1.00 0.00 ? 54  VAL A O    3  
ATOM 3990  C CB   . VAL A 1 3   ? 2.544   13.077  26.861  1.00 0.00 ? 54  VAL A CB   3  
ATOM 3991  C CG1  . VAL A 1 3   ? 3.932   13.643  26.581  1.00 0.00 ? 54  VAL A CG1  3  
ATOM 3992  C CG2  . VAL A 1 3   ? 1.998   13.728  28.139  1.00 0.00 ? 54  VAL A CG2  3  
ATOM 3993  H H    . VAL A 1 3   ? 0.001   11.959  25.758  1.00 0.00 ? 54  VAL A H    3  
ATOM 3994  H HA   . VAL A 1 3   ? 1.583   14.437  25.499  1.00 0.00 ? 54  VAL A HA   3  
ATOM 3995  H HB   . VAL A 1 3   ? 2.611   12.007  27.002  1.00 0.00 ? 54  VAL A HB   3  
ATOM 3996  H HG11 . VAL A 1 3   ? 4.323   13.219  25.671  1.00 0.00 ? 54  VAL A HG11 3  
ATOM 3997  H HG12 . VAL A 1 3   ? 3.867   14.714  26.483  1.00 0.00 ? 54  VAL A HG12 3  
ATOM 3998  H HG13 . VAL A 1 3   ? 4.588   13.389  27.400  1.00 0.00 ? 54  VAL A HG13 3  
ATOM 3999  H HG21 . VAL A 1 3   ? 1.776   14.767  27.950  1.00 0.00 ? 54  VAL A HG21 3  
ATOM 4000  H HG22 . VAL A 1 3   ? 1.101   13.216  28.457  1.00 0.00 ? 54  VAL A HG22 3  
ATOM 4001  H HG23 . VAL A 1 3   ? 2.743   13.663  28.920  1.00 0.00 ? 54  VAL A HG23 3  
ATOM 4002  N N    . LEU A 1 4   ? 1.913   11.389  24.314  1.00 0.00 ? 55  LEU A N    3  
ATOM 4003  C CA   . LEU A 1 4   ? 2.412   10.640  23.122  1.00 0.00 ? 55  LEU A CA   3  
ATOM 4004  C C    . LEU A 1 4   ? 1.454   10.885  21.952  1.00 0.00 ? 55  LEU A C    3  
ATOM 4005  O O    . LEU A 1 4   ? 0.339   11.331  22.133  1.00 0.00 ? 55  LEU A O    3  
ATOM 4006  C CB   . LEU A 1 4   ? 2.507   9.123   23.425  1.00 0.00 ? 55  LEU A CB   3  
ATOM 4007  C CG   . LEU A 1 4   ? 1.553   8.722   24.560  1.00 0.00 ? 55  LEU A CG   3  
ATOM 4008  C CD1  . LEU A 1 4   ? 0.105   9.000   24.158  1.00 0.00 ? 55  LEU A CD1  3  
ATOM 4009  C CD2  . LEU A 1 4   ? 1.716   7.228   24.838  1.00 0.00 ? 55  LEU A CD2  3  
ATOM 4010  H H    . LEU A 1 4   ? 1.414   10.925  25.013  1.00 0.00 ? 55  LEU A H    3  
ATOM 4011  H HA   . LEU A 1 4   ? 3.391   11.016  22.855  1.00 0.00 ? 55  LEU A HA   3  
ATOM 4012  H HB2  . LEU A 1 4   ? 2.265   8.554   22.539  1.00 0.00 ? 55  LEU A HB2  3  
ATOM 4013  H HB3  . LEU A 1 4   ? 3.520   8.884   23.727  1.00 0.00 ? 55  LEU A HB3  3  
ATOM 4014  H HG   . LEU A 1 4   ? 1.789   9.278   25.456  1.00 0.00 ? 55  LEU A HG   3  
ATOM 4015  H HD11 . LEU A 1 4   ? -0.073  8.623   23.161  1.00 0.00 ? 55  LEU A HD11 3  
ATOM 4016  H HD12 . LEU A 1 4   ? -0.561  8.505   24.855  1.00 0.00 ? 55  LEU A HD12 3  
ATOM 4017  H HD13 . LEU A 1 4   ? -0.076  10.062  24.183  1.00 0.00 ? 55  LEU A HD13 3  
ATOM 4018  H HD21 . LEU A 1 4   ? 1.556   6.669   23.927  1.00 0.00 ? 55  LEU A HD21 3  
ATOM 4019  H HD22 . LEU A 1 4   ? 2.713   7.037   25.200  1.00 0.00 ? 55  LEU A HD22 3  
ATOM 4020  H HD23 . LEU A 1 4   ? 0.996   6.921   25.584  1.00 0.00 ? 55  LEU A HD23 3  
ATOM 4021  N N    . ALA A 1 5   ? 1.882   10.596  20.757  1.00 0.00 ? 56  ALA A N    3  
ATOM 4022  C CA   . ALA A 1 5   ? 0.998   10.810  19.575  1.00 0.00 ? 56  ALA A CA   3  
ATOM 4023  C C    . ALA A 1 5   ? 1.367   9.796   18.501  1.00 0.00 ? 56  ALA A C    3  
ATOM 4024  O O    . ALA A 1 5   ? 1.172   8.608   18.668  1.00 0.00 ? 56  ALA A O    3  
ATOM 4025  C CB   . ALA A 1 5   ? 1.186   12.235  19.047  1.00 0.00 ? 56  ALA A CB   3  
ATOM 4026  H H    . ALA A 1 5   ? 2.789   10.238  20.635  1.00 0.00 ? 56  ALA A H    3  
ATOM 4027  H HA   . ALA A 1 5   ? -0.032  10.662  19.858  1.00 0.00 ? 56  ALA A HA   3  
ATOM 4028  H HB1  . ALA A 1 5   ? 2.243   12.460  18.979  1.00 0.00 ? 56  ALA A HB1  3  
ATOM 4029  H HB2  . ALA A 1 5   ? 0.735   12.318  18.069  1.00 0.00 ? 56  ALA A HB2  3  
ATOM 4030  H HB3  . ALA A 1 5   ? 0.711   12.932  19.720  1.00 0.00 ? 56  ALA A HB3  3  
ATOM 4031  N N    . ASP A 1 6   ? 1.898   10.237  17.397  1.00 0.00 ? 57  ASP A N    3  
ATOM 4032  C CA   . ASP A 1 6   ? 2.280   9.272   16.339  1.00 0.00 ? 57  ASP A CA   3  
ATOM 4033  C C    . ASP A 1 6   ? 3.638   8.668   16.686  1.00 0.00 ? 57  ASP A C    3  
ATOM 4034  O O    . ASP A 1 6   ? 4.113   7.771   16.023  1.00 0.00 ? 57  ASP A O    3  
ATOM 4035  C CB   . ASP A 1 6   ? 2.374   9.994   14.998  1.00 0.00 ? 57  ASP A CB   3  
ATOM 4036  C CG   . ASP A 1 6   ? 3.500   11.033  15.048  1.00 0.00 ? 57  ASP A CG   3  
ATOM 4037  O OD1  . ASP A 1 6   ? 3.843   11.460  16.140  1.00 0.00 ? 57  ASP A OD1  3  
ATOM 4038  O OD2  . ASP A 1 6   ? 3.993   11.389  13.986  1.00 0.00 ? 57  ASP A OD2  3  
ATOM 4039  H H    . ASP A 1 6   ? 2.053   11.196  17.270  1.00 0.00 ? 57  ASP A H    3  
ATOM 4040  H HA   . ASP A 1 6   ? 1.543   8.485   16.275  1.00 0.00 ? 57  ASP A HA   3  
ATOM 4041  H HB2  . ASP A 1 6   ? 2.583   9.276   14.220  1.00 0.00 ? 57  ASP A HB2  3  
ATOM 4042  H HB3  . ASP A 1 6   ? 1.438   10.487  14.792  1.00 0.00 ? 57  ASP A HB3  3  
ATOM 4043  N N    . HIS A 1 7   ? 4.269   9.148   17.725  1.00 0.00 ? 58  HIS A N    3  
ATOM 4044  C CA   . HIS A 1 7   ? 5.595   8.582   18.104  1.00 0.00 ? 58  HIS A CA   3  
ATOM 4045  C C    . HIS A 1 7   ? 5.493   7.057   18.268  1.00 0.00 ? 58  HIS A C    3  
ATOM 4046  O O    . HIS A 1 7   ? 6.229   6.340   17.622  1.00 0.00 ? 58  HIS A O    3  
ATOM 4047  C CB   . HIS A 1 7   ? 6.109   9.236   19.395  1.00 0.00 ? 58  HIS A CB   3  
ATOM 4048  C CG   . HIS A 1 7   ? 6.589   10.626  19.101  1.00 0.00 ? 58  HIS A CG   3  
ATOM 4049  N ND1  . HIS A 1 7   ? 5.704   11.669  18.910  1.00 0.00 ? 58  HIS A ND1  3  
ATOM 4050  C CD2  . HIS A 1 7   ? 7.846   11.172  18.968  1.00 0.00 ? 58  HIS A CD2  3  
ATOM 4051  C CE1  . HIS A 1 7   ? 6.422   12.781  18.677  1.00 0.00 ? 58  HIS A CE1  3  
ATOM 4052  N NE2  . HIS A 1 7   ? 7.732   12.537  18.701  1.00 0.00 ? 58  HIS A NE2  3  
ATOM 4053  H H    . HIS A 1 7   ? 3.871   9.873   18.255  1.00 0.00 ? 58  HIS A H    3  
ATOM 4054  H HA   . HIS A 1 7   ? 6.291   8.790   17.302  1.00 0.00 ? 58  HIS A HA   3  
ATOM 4055  H HB2  . HIS A 1 7   ? 5.312   9.297   20.110  1.00 0.00 ? 58  HIS A HB2  3  
ATOM 4056  H HB3  . HIS A 1 7   ? 6.916   8.655   19.804  1.00 0.00 ? 58  HIS A HB3  3  
ATOM 4057  H HD1  . HIS A 1 7   ? 4.728   11.607  18.939  1.00 0.00 ? 58  HIS A HD1  3  
ATOM 4058  H HD2  . HIS A 1 7   ? 8.780   10.629  19.057  1.00 0.00 ? 58  HIS A HD2  3  
ATOM 4059  H HE1  . HIS A 1 7   ? 5.991   13.753  18.503  1.00 0.00 ? 58  HIS A HE1  3  
ATOM 4060  N N    . PRO A 1 8   ? 4.589   6.547   19.093  1.00 0.00 ? 59  PRO A N    3  
ATOM 4061  C CA   . PRO A 1 8   ? 4.407   5.081   19.277  1.00 0.00 ? 59  PRO A CA   3  
ATOM 4062  C C    . PRO A 1 8   ? 4.785   4.260   18.031  1.00 0.00 ? 59  PRO A C    3  
ATOM 4063  O O    . PRO A 1 8   ? 5.585   3.349   18.101  1.00 0.00 ? 59  PRO A O    3  
ATOM 4064  C CB   . PRO A 1 8   ? 2.913   4.975   19.563  1.00 0.00 ? 59  PRO A CB   3  
ATOM 4065  C CG   . PRO A 1 8   ? 2.555   6.243   20.297  1.00 0.00 ? 59  PRO A CG   3  
ATOM 4066  C CD   . PRO A 1 8   ? 3.649   7.282   19.968  1.00 0.00 ? 59  PRO A CD   3  
ATOM 4067  H HA   . PRO A 1 8   ? 4.963   4.744   20.132  1.00 0.00 ? 59  PRO A HA   3  
ATOM 4068  H HB2  . PRO A 1 8   ? 2.359   4.905   18.634  1.00 0.00 ? 59  PRO A HB2  3  
ATOM 4069  H HB3  . PRO A 1 8   ? 2.711   4.115   20.180  1.00 0.00 ? 59  PRO A HB3  3  
ATOM 4070  H HG2  . PRO A 1 8   ? 1.584   6.601   19.972  1.00 0.00 ? 59  PRO A HG2  3  
ATOM 4071  H HG3  . PRO A 1 8   ? 2.540   6.061   21.364  1.00 0.00 ? 59  PRO A HG3  3  
ATOM 4072  H HD2  . PRO A 1 8   ? 3.227   8.133   19.471  1.00 0.00 ? 59  PRO A HD2  3  
ATOM 4073  H HD3  . PRO A 1 8   ? 4.151   7.590   20.870  1.00 0.00 ? 59  PRO A HD3  3  
ATOM 4074  N N    . GLY A 1 9   ? 4.219   4.589   16.895  1.00 0.00 ? 60  GLY A N    3  
ATOM 4075  C CA   . GLY A 1 9   ? 4.540   3.850   15.626  1.00 0.00 ? 60  GLY A CA   3  
ATOM 4076  C C    . GLY A 1 9   ? 5.117   4.856   14.618  1.00 0.00 ? 60  GLY A C    3  
ATOM 4077  O O    . GLY A 1 9   ? 5.177   6.037   14.889  1.00 0.00 ? 60  GLY A O    3  
ATOM 4078  H H    . GLY A 1 9   ? 3.583   5.333   16.871  1.00 0.00 ? 60  GLY A H    3  
ATOM 4079  H HA2  . GLY A 1 9   ? 5.259   3.062   15.817  1.00 0.00 ? 60  GLY A HA2  3  
ATOM 4080  H HA3  . GLY A 1 9   ? 3.636   3.422   15.220  1.00 0.00 ? 60  GLY A HA3  3  
ATOM 4081  N N    . GLU A 1 10  ? 5.542   4.406   13.459  1.00 0.00 ? 61  GLU A N    3  
ATOM 4082  C CA   . GLU A 1 10  ? 6.115   5.347   12.427  1.00 0.00 ? 61  GLU A CA   3  
ATOM 4083  C C    . GLU A 1 10  ? 5.411   5.124   11.087  1.00 0.00 ? 61  GLU A C    3  
ATOM 4084  O O    . GLU A 1 10  ? 4.962   4.039   10.784  1.00 0.00 ? 61  GLU A O    3  
ATOM 4085  C CB   . GLU A 1 10  ? 7.612   5.075   12.219  1.00 0.00 ? 61  GLU A CB   3  
ATOM 4086  C CG   . GLU A 1 10  ? 8.394   5.334   13.509  1.00 0.00 ? 61  GLU A CG   3  
ATOM 4087  C CD   . GLU A 1 10  ? 8.226   4.155   14.470  1.00 0.00 ? 61  GLU A CD   3  
ATOM 4088  O OE1  . GLU A 1 10  ? 7.981   3.059   13.999  1.00 0.00 ? 61  GLU A OE1  3  
ATOM 4089  O OE2  . GLU A 1 10  ? 8.350   4.371   15.662  1.00 0.00 ? 61  GLU A OE2  3  
ATOM 4090  H H    . GLU A 1 10  ? 5.484   3.453   13.260  1.00 0.00 ? 61  GLU A H    3  
ATOM 4091  H HA   . GLU A 1 10  ? 5.979   6.375   12.738  1.00 0.00 ? 61  GLU A HA   3  
ATOM 4092  H HB2  . GLU A 1 10  ? 7.748   4.051   11.912  1.00 0.00 ? 61  GLU A HB2  3  
ATOM 4093  H HB3  . GLU A 1 10  ? 7.986   5.724   11.440  1.00 0.00 ? 61  GLU A HB3  3  
ATOM 4094  H HG2  . GLU A 1 10  ? 9.443   5.452   13.269  1.00 0.00 ? 61  GLU A HG2  3  
ATOM 4095  H HG3  . GLU A 1 10  ? 8.029   6.238   13.976  1.00 0.00 ? 61  GLU A HG3  3  
ATOM 4096  N N    . LEU A 1 11  ? 5.332   6.149   10.279  1.00 0.00 ? 62  LEU A N    3  
ATOM 4097  C CA   . LEU A 1 11  ? 4.687   6.040   8.939   1.00 0.00 ? 62  LEU A CA   3  
ATOM 4098  C C    . LEU A 1 11  ? 5.757   6.371   7.883   1.00 0.00 ? 62  LEU A C    3  
ATOM 4099  O O    . LEU A 1 11  ? 6.869   6.723   8.225   1.00 0.00 ? 62  LEU A O    3  
ATOM 4100  C CB   . LEU A 1 11  ? 3.523   7.037   8.853   1.00 0.00 ? 62  LEU A CB   3  
ATOM 4101  C CG   . LEU A 1 11  ? 2.503   6.780   10.000  1.00 0.00 ? 62  LEU A CG   3  
ATOM 4102  C CD1  . LEU A 1 11  ? 2.875   7.577   11.265  1.00 0.00 ? 62  LEU A CD1  3  
ATOM 4103  C CD2  . LEU A 1 11  ? 1.104   7.220   9.554   1.00 0.00 ? 62  LEU A CD2  3  
ATOM 4104  H H    . LEU A 1 11  ? 5.707   7.005   10.555  1.00 0.00 ? 62  LEU A H    3  
ATOM 4105  H HA   . LEU A 1 11  ? 4.319   5.037   8.779   1.00 0.00 ? 62  LEU A HA   3  
ATOM 4106  H HB2  . LEU A 1 11  ? 3.909   8.044   8.921   1.00 0.00 ? 62  LEU A HB2  3  
ATOM 4107  H HB3  . LEU A 1 11  ? 3.033   6.907   7.899   1.00 0.00 ? 62  LEU A HB3  3  
ATOM 4108  H HG   . LEU A 1 11  ? 2.485   5.726   10.240  1.00 0.00 ? 62  LEU A HG   3  
ATOM 4109  H HD11 . LEU A 1 11  ? 3.112   8.597   10.999  1.00 0.00 ? 62  LEU A HD11 3  
ATOM 4110  H HD12 . LEU A 1 11  ? 2.036   7.571   11.948  1.00 0.00 ? 62  LEU A HD12 3  
ATOM 4111  H HD13 . LEU A 1 11  ? 3.726   7.125   11.746  1.00 0.00 ? 62  LEU A HD13 3  
ATOM 4112  H HD21 . LEU A 1 11  ? 0.858   6.750   8.614   1.00 0.00 ? 62  LEU A HD21 3  
ATOM 4113  H HD22 . LEU A 1 11  ? 0.383   6.932   10.305  1.00 0.00 ? 62  LEU A HD22 3  
ATOM 4114  H HD23 . LEU A 1 11  ? 1.090   8.292   9.437   1.00 0.00 ? 62  LEU A HD23 3  
ATOM 4115  N N    . VAL A 1 12  ? 5.455   6.249   6.611   1.00 0.00 ? 63  VAL A N    3  
ATOM 4116  C CA   . VAL A 1 12  ? 6.483   6.544   5.557   1.00 0.00 ? 63  VAL A CA   3  
ATOM 4117  C C    . VAL A 1 12  ? 6.233   7.939   4.996   1.00 0.00 ? 63  VAL A C    3  
ATOM 4118  O O    . VAL A 1 12  ? 5.128   8.283   4.643   1.00 0.00 ? 63  VAL A O    3  
ATOM 4119  C CB   . VAL A 1 12  ? 6.352   5.513   4.431   1.00 0.00 ? 63  VAL A CB   3  
ATOM 4120  C CG1  . VAL A 1 12  ? 7.411   5.758   3.353   1.00 0.00 ? 63  VAL A CG1  3  
ATOM 4121  C CG2  . VAL A 1 12  ? 6.544   4.114   5.016   1.00 0.00 ? 63  VAL A CG2  3  
ATOM 4122  H H    . VAL A 1 12  ? 4.561   5.952   6.349   1.00 0.00 ? 63  VAL A H    3  
ATOM 4123  H HA   . VAL A 1 12  ? 7.480   6.494   5.980   1.00 0.00 ? 63  VAL A HA   3  
ATOM 4124  H HB   . VAL A 1 12  ? 5.368   5.587   3.991   1.00 0.00 ? 63  VAL A HB   3  
ATOM 4125  H HG11 . VAL A 1 12  ? 8.392   5.741   3.797   1.00 0.00 ? 63  VAL A HG11 3  
ATOM 4126  H HG12 . VAL A 1 12  ? 7.343   4.982   2.605   1.00 0.00 ? 63  VAL A HG12 3  
ATOM 4127  H HG13 . VAL A 1 12  ? 7.243   6.717   2.894   1.00 0.00 ? 63  VAL A HG13 3  
ATOM 4128  H HG21 . VAL A 1 12  ? 5.850   3.968   5.826   1.00 0.00 ? 63  VAL A HG21 3  
ATOM 4129  H HG22 . VAL A 1 12  ? 6.365   3.373   4.249   1.00 0.00 ? 63  VAL A HG22 3  
ATOM 4130  H HG23 . VAL A 1 12  ? 7.551   4.013   5.388   1.00 0.00 ? 63  VAL A HG23 3  
ATOM 4131  N N    . ARG A 1 13  ? 7.238   8.757   4.928   1.00 0.00 ? 64  ARG A N    3  
ATOM 4132  C CA   . ARG A 1 13  ? 7.017   10.119  4.396   1.00 0.00 ? 64  ARG A CA   3  
ATOM 4133  C C    . ARG A 1 13  ? 6.545   10.037  2.948   1.00 0.00 ? 64  ARG A C    3  
ATOM 4134  O O    . ARG A 1 13  ? 6.919   9.144   2.214   1.00 0.00 ? 64  ARG A O    3  
ATOM 4135  C CB   . ARG A 1 13  ? 8.316   10.908  4.485   1.00 0.00 ? 64  ARG A CB   3  
ATOM 4136  C CG   . ARG A 1 13  ? 8.631   11.196  5.951   1.00 0.00 ? 64  ARG A CG   3  
ATOM 4137  C CD   . ARG A 1 13  ? 9.783   12.188  6.017   1.00 0.00 ? 64  ARG A CD   3  
ATOM 4138  N NE   . ARG A 1 13  ? 9.371   13.442  5.320   1.00 0.00 ? 64  ARG A NE   3  
ATOM 4139  C CZ   . ARG A 1 13  ? 10.023  14.551  5.527   1.00 0.00 ? 64  ARG A CZ   3  
ATOM 4140  N NH1  . ARG A 1 13  ? 11.069  14.560  6.305   1.00 0.00 ? 64  ARG A NH1  3  
ATOM 4141  N NH2  . ARG A 1 13  ? 9.640   15.650  4.942   1.00 0.00 ? 64  ARG A NH2  3  
ATOM 4142  H H    . ARG A 1 13  ? 8.133   8.477   5.222   1.00 0.00 ? 64  ARG A H    3  
ATOM 4143  H HA   . ARG A 1 13  ? 6.263   10.607  4.987   1.00 0.00 ? 64  ARG A HA   3  
ATOM 4144  H HB2  . ARG A 1 13  ? 9.118   10.321  4.059   1.00 0.00 ? 64  ARG A HB2  3  
ATOM 4145  H HB3  . ARG A 1 13  ? 8.219   11.835  3.944   1.00 0.00 ? 64  ARG A HB3  3  
ATOM 4146  H HG2  . ARG A 1 13  ? 7.762   11.622  6.431   1.00 0.00 ? 64  ARG A HG2  3  
ATOM 4147  H HG3  . ARG A 1 13  ? 8.907   10.283  6.454   1.00 0.00 ? 64  ARG A HG3  3  
ATOM 4148  H HD2  . ARG A 1 13  ? 10.013  12.401  7.055   1.00 0.00 ? 64  ARG A HD2  3  
ATOM 4149  H HD3  . ARG A 1 13  ? 10.647  11.776  5.526   1.00 0.00 ? 64  ARG A HD3  3  
ATOM 4150  H HE   . ARG A 1 13  ? 8.601   13.432  4.714   1.00 0.00 ? 64  ARG A HE   3  
ATOM 4151  H HH11 . ARG A 1 13  ? 11.373  13.716  6.744   1.00 0.00 ? 64  ARG A HH11 3  
ATOM 4152  H HH12 . ARG A 1 13  ? 11.565  15.413  6.465   1.00 0.00 ? 64  ARG A HH12 3  
ATOM 4153  H HH21 . ARG A 1 13  ? 8.845   15.642  4.334   1.00 0.00 ? 64  ARG A HH21 3  
ATOM 4154  H HH22 . ARG A 1 13  ? 10.137  16.503  5.102   1.00 0.00 ? 64  ARG A HH22 3  
ATOM 4155  N N    . THR A 1 14  ? 5.728   10.977  2.531   1.00 0.00 ? 65  THR A N    3  
ATOM 4156  C CA   . THR A 1 14  ? 5.214   10.995  1.131   1.00 0.00 ? 65  THR A CA   3  
ATOM 4157  C C    . THR A 1 14  ? 5.695   12.273  0.457   1.00 0.00 ? 65  THR A C    3  
ATOM 4158  O O    . THR A 1 14  ? 6.270   13.129  1.093   1.00 0.00 ? 65  THR A O    3  
ATOM 4159  C CB   . THR A 1 14  ? 3.689   10.998  1.142   1.00 0.00 ? 65  THR A CB   3  
ATOM 4160  O OG1  . THR A 1 14  ? 3.220   12.171  1.787   1.00 0.00 ? 65  THR A OG1  3  
ATOM 4161  C CG2  . THR A 1 14  ? 3.159   9.754   1.857   1.00 0.00 ? 65  THR A CG2  3  
ATOM 4162  H H    . THR A 1 14  ? 5.453   11.685  3.142   1.00 0.00 ? 65  THR A H    3  
ATOM 4163  H HA   . THR A 1 14  ? 5.576   10.133  0.585   1.00 0.00 ? 65  THR A HA   3  
ATOM 4164  H HB   . THR A 1 14  ? 3.341   10.993  0.135   1.00 0.00 ? 65  THR A HB   3  
ATOM 4165  H HG1  . THR A 1 14  ? 3.654   12.927  1.387   1.00 0.00 ? 65  THR A HG1  3  
ATOM 4166  H HG21 . THR A 1 14  ? 3.713   9.600   2.770   1.00 0.00 ? 65  THR A HG21 3  
ATOM 4167  H HG22 . THR A 1 14  ? 2.115   9.892   2.090   1.00 0.00 ? 65  THR A HG22 3  
ATOM 4168  H HG23 . THR A 1 14  ? 3.274   8.894   1.212   1.00 0.00 ? 65  THR A HG23 3  
ATOM 4169  N N    . ASP A 1 15  ? 5.469   12.418  -0.820  1.00 0.00 ? 66  ASP A N    3  
ATOM 4170  C CA   . ASP A 1 15  ? 5.927   13.659  -1.500  1.00 0.00 ? 66  ASP A CA   3  
ATOM 4171  C C    . ASP A 1 15  ? 5.162   14.844  -0.923  1.00 0.00 ? 66  ASP A C    3  
ATOM 4172  O O    . ASP A 1 15  ? 5.679   15.935  -0.797  1.00 0.00 ? 66  ASP A O    3  
ATOM 4173  C CB   . ASP A 1 15  ? 5.673   13.563  -3.008  1.00 0.00 ? 66  ASP A CB   3  
ATOM 4174  C CG   . ASP A 1 15  ? 6.534   12.446  -3.603  1.00 0.00 ? 66  ASP A CG   3  
ATOM 4175  O OD1  . ASP A 1 15  ? 7.524   12.098  -2.984  1.00 0.00 ? 66  ASP A OD1  3  
ATOM 4176  O OD2  . ASP A 1 15  ? 6.180   11.952  -4.660  1.00 0.00 ? 66  ASP A OD2  3  
ATOM 4177  H H    . ASP A 1 15  ? 4.998   11.719  -1.325  1.00 0.00 ? 66  ASP A H    3  
ATOM 4178  H HA   . ASP A 1 15  ? 6.977   13.790  -1.311  1.00 0.00 ? 66  ASP A HA   3  
ATOM 4179  H HB2  . ASP A 1 15  ? 4.627   13.352  -3.190  1.00 0.00 ? 66  ASP A HB2  3  
ATOM 4180  H HB3  . ASP A 1 15  ? 5.940   14.500  -3.477  1.00 0.00 ? 66  ASP A HB3  3  
ATOM 4181  N N    . SER A 1 16  ? 3.932   14.636  -0.541  1.00 0.00 ? 67  SER A N    3  
ATOM 4182  C CA   . SER A 1 16  ? 3.153   15.751  0.057   1.00 0.00 ? 67  SER A CA   3  
ATOM 4183  C C    . SER A 1 16  ? 3.492   15.826  1.555   1.00 0.00 ? 67  SER A C    3  
ATOM 4184  O O    . SER A 1 16  ? 3.594   14.806  2.207   1.00 0.00 ? 67  SER A O    3  
ATOM 4185  C CB   . SER A 1 16  ? 1.660   15.484  -0.123  1.00 0.00 ? 67  SER A CB   3  
ATOM 4186  O OG   . SER A 1 16  ? 1.329   15.595  -1.500  1.00 0.00 ? 67  SER A OG   3  
ATOM 4187  H H    . SER A 1 16  ? 3.530   13.744  -0.624  1.00 0.00 ? 67  SER A H    3  
ATOM 4188  H HA   . SER A 1 16  ? 3.417   16.672  -0.441  1.00 0.00 ? 67  SER A HA   3  
ATOM 4189  H HB2  . SER A 1 16  ? 1.425   14.487  0.223   1.00 0.00 ? 67  SER A HB2  3  
ATOM 4190  H HB3  . SER A 1 16  ? 1.096   16.207  0.453   1.00 0.00 ? 67  SER A HB3  3  
ATOM 4191  H HG   . SER A 1 16  ? 1.076   16.506  -1.672  1.00 0.00 ? 67  SER A HG   3  
ATOM 4192  N N    . PRO A 1 17  ? 3.685   17.005  2.101   1.00 0.00 ? 68  PRO A N    3  
ATOM 4193  C CA   . PRO A 1 17  ? 4.029   17.172  3.546   1.00 0.00 ? 68  PRO A CA   3  
ATOM 4194  C C    . PRO A 1 17  ? 2.810   17.022  4.465   1.00 0.00 ? 68  PRO A C    3  
ATOM 4195  O O    . PRO A 1 17  ? 2.761   17.614  5.525   1.00 0.00 ? 68  PRO A O    3  
ATOM 4196  C CB   . PRO A 1 17  ? 4.560   18.607  3.608   1.00 0.00 ? 68  PRO A CB   3  
ATOM 4197  C CG   . PRO A 1 17  ? 3.772   19.318  2.567   1.00 0.00 ? 68  PRO A CG   3  
ATOM 4198  C CD   . PRO A 1 17  ? 3.611   18.315  1.424   1.00 0.00 ? 68  PRO A CD   3  
ATOM 4199  H HA   . PRO A 1 17  ? 4.807   16.488  3.830   1.00 0.00 ? 68  PRO A HA   3  
ATOM 4200  H HB2  . PRO A 1 17  ? 4.385   19.045  4.587   1.00 0.00 ? 68  PRO A HB2  3  
ATOM 4201  H HB3  . PRO A 1 17  ? 5.612   18.635  3.360   1.00 0.00 ? 68  PRO A HB3  3  
ATOM 4202  H HG2  . PRO A 1 17  ? 2.808   19.596  2.964   1.00 0.00 ? 68  PRO A HG2  3  
ATOM 4203  H HG3  . PRO A 1 17  ? 4.301   20.188  2.218   1.00 0.00 ? 68  PRO A HG3  3  
ATOM 4204  H HD2  . PRO A 1 17  ? 2.654   18.440  0.935   1.00 0.00 ? 68  PRO A HD2  3  
ATOM 4205  H HD3  . PRO A 1 17  ? 4.420   18.413  0.717   1.00 0.00 ? 68  PRO A HD3  3  
ATOM 4206  N N    . ASN A 1 18  ? 1.817   16.259  4.076   1.00 0.00 ? 69  ASN A N    3  
ATOM 4207  C CA   . ASN A 1 18  ? 0.606   16.115  4.944   1.00 0.00 ? 69  ASN A CA   3  
ATOM 4208  C C    . ASN A 1 18  ? 0.071   14.677  4.873   1.00 0.00 ? 69  ASN A C    3  
ATOM 4209  O O    . ASN A 1 18  ? -0.515  14.175  5.810   1.00 0.00 ? 69  ASN A O    3  
ATOM 4210  C CB   . ASN A 1 18  ? -0.472  17.074  4.437   1.00 0.00 ? 69  ASN A CB   3  
ATOM 4211  C CG   . ASN A 1 18  ? -0.036  18.524  4.671   1.00 0.00 ? 69  ASN A CG   3  
ATOM 4212  O OD1  . ASN A 1 18  ? 0.731   18.807  5.572   1.00 0.00 ? 69  ASN A OD1  3  
ATOM 4213  N ND2  . ASN A 1 18  ? -0.478  19.454  3.869   1.00 0.00 ? 69  ASN A ND2  3  
ATOM 4214  H H    . ASN A 1 18  ? 1.854   15.796  3.209   1.00 0.00 ? 69  ASN A H    3  
ATOM 4215  H HA   . ASN A 1 18  ? 0.848   16.352  5.968   1.00 0.00 ? 69  ASN A HA   3  
ATOM 4216  H HB2  . ASN A 1 18  ? -0.625  16.908  3.382   1.00 0.00 ? 69  ASN A HB2  3  
ATOM 4217  H HB3  . ASN A 1 18  ? -1.390  16.897  4.965   1.00 0.00 ? 69  ASN A HB3  3  
ATOM 4218  H HD21 . ASN A 1 18  ? -1.076  19.220  3.127   1.00 0.00 ? 69  ASN A HD21 3  
ATOM 4219  H HD22 . ASN A 1 18  ? -0.212  20.386  4.006   1.00 0.00 ? 69  ASN A HD22 3  
ATOM 4220  N N    . PHE A 1 19  ? 0.264   14.017  3.761   1.00 0.00 ? 70  PHE A N    3  
ATOM 4221  C CA   . PHE A 1 19  ? -0.241  12.617  3.601   1.00 0.00 ? 70  PHE A CA   3  
ATOM 4222  C C    . PHE A 1 19  ? 0.821   11.613  4.039   1.00 0.00 ? 70  PHE A C    3  
ATOM 4223  O O    . PHE A 1 19  ? 1.963   11.689  3.646   1.00 0.00 ? 70  PHE A O    3  
ATOM 4224  C CB   . PHE A 1 19  ? -0.582  12.379  2.112   1.00 0.00 ? 70  PHE A CB   3  
ATOM 4225  C CG   . PHE A 1 19  ? -2.079  12.274  1.924   1.00 0.00 ? 70  PHE A CG   3  
ATOM 4226  C CD1  . PHE A 1 19  ? -2.901  13.326  2.331   1.00 0.00 ? 70  PHE A CD1  3  
ATOM 4227  C CD2  . PHE A 1 19  ? -2.638  11.130  1.338   1.00 0.00 ? 70  PHE A CD2  3  
ATOM 4228  C CE1  . PHE A 1 19  ? -4.289  13.241  2.154   1.00 0.00 ? 70  PHE A CE1  3  
ATOM 4229  C CE2  . PHE A 1 19  ? -4.024  11.043  1.161   1.00 0.00 ? 70  PHE A CE2  3  
ATOM 4230  C CZ   . PHE A 1 19  ? -4.850  12.100  1.573   1.00 0.00 ? 70  PHE A CZ   3  
ATOM 4231  H H    . PHE A 1 19  ? 0.736   14.447  3.017   1.00 0.00 ? 70  PHE A H    3  
ATOM 4232  H HA   . PHE A 1 19  ? -1.124  12.477  4.211   1.00 0.00 ? 70  PHE A HA   3  
ATOM 4233  H HB2  . PHE A 1 19  ? -0.207  13.206  1.528   1.00 0.00 ? 70  PHE A HB2  3  
ATOM 4234  H HB3  . PHE A 1 19  ? -0.114  11.461  1.765   1.00 0.00 ? 70  PHE A HB3  3  
ATOM 4235  H HD1  . PHE A 1 19  ? -2.462  14.198  2.786   1.00 0.00 ? 70  PHE A HD1  3  
ATOM 4236  H HD2  . PHE A 1 19  ? -1.995  10.316  1.018   1.00 0.00 ? 70  PHE A HD2  3  
ATOM 4237  H HE1  . PHE A 1 19  ? -4.930  14.052  2.471   1.00 0.00 ? 70  PHE A HE1  3  
ATOM 4238  H HE2  . PHE A 1 19  ? -4.453  10.159  0.716   1.00 0.00 ? 70  PHE A HE2  3  
ATOM 4239  H HZ   . PHE A 1 19  ? -5.920  12.039  1.441   1.00 0.00 ? 70  PHE A HZ   3  
ATOM 4240  N N    . LEU A 1 20  ? 0.430   10.655  4.833   1.00 0.00 ? 71  LEU A N    3  
ATOM 4241  C CA   . LEU A 1 20  ? 1.396   9.606   5.286   1.00 0.00 ? 71  LEU A CA   3  
ATOM 4242  C C    . LEU A 1 20  ? 0.732   8.220   5.218   1.00 0.00 ? 71  LEU A C    3  
ATOM 4243  O O    . LEU A 1 20  ? -0.419  8.057   5.577   1.00 0.00 ? 71  LEU A O    3  
ATOM 4244  C CB   . LEU A 1 20  ? 1.825   9.879   6.737   1.00 0.00 ? 71  LEU A CB   3  
ATOM 4245  C CG   . LEU A 1 20  ? 2.741   11.125  6.823   1.00 0.00 ? 71  LEU A CG   3  
ATOM 4246  C CD1  . LEU A 1 20  ? 1.908   12.406  7.030   1.00 0.00 ? 71  LEU A CD1  3  
ATOM 4247  C CD2  . LEU A 1 20  ? 3.711   10.959  7.998   1.00 0.00 ? 71  LEU A CD2  3  
ATOM 4248  H H    . LEU A 1 20  ? -0.510  10.616  5.119   1.00 0.00 ? 71  LEU A H    3  
ATOM 4249  H HA   . LEU A 1 20  ? 2.268   9.606   4.648   1.00 0.00 ? 71  LEU A HA   3  
ATOM 4250  H HB2  . LEU A 1 20  ? 0.942   10.036  7.345   1.00 0.00 ? 71  LEU A HB2  3  
ATOM 4251  H HB3  . LEU A 1 20  ? 2.355   9.010   7.104   1.00 0.00 ? 71  LEU A HB3  3  
ATOM 4252  H HG   . LEU A 1 20  ? 3.311   11.222  5.911   1.00 0.00 ? 71  LEU A HG   3  
ATOM 4253  H HD11 . LEU A 1 20  ? 0.964   12.318  6.518   1.00 0.00 ? 71  LEU A HD11 3  
ATOM 4254  H HD12 . LEU A 1 20  ? 1.728   12.561  8.085   1.00 0.00 ? 71  LEU A HD12 3  
ATOM 4255  H HD13 . LEU A 1 20  ? 2.455   13.253  6.633   1.00 0.00 ? 71  LEU A HD13 3  
ATOM 4256  H HD21 . LEU A 1 20  ? 3.165   10.612  8.862   1.00 0.00 ? 71  LEU A HD21 3  
ATOM 4257  H HD22 . LEU A 1 20  ? 4.468   10.236  7.737   1.00 0.00 ? 71  LEU A HD22 3  
ATOM 4258  H HD23 . LEU A 1 20  ? 4.176   11.906  8.220   1.00 0.00 ? 71  LEU A HD23 3  
ATOM 4259  N N    . CYS A 1 21  ? 1.464   7.220   4.781   1.00 0.00 ? 72  CYS A N    3  
ATOM 4260  C CA   . CYS A 1 21  ? 0.904   5.831   4.707   1.00 0.00 ? 72  CYS A CA   3  
ATOM 4261  C C    . CYS A 1 21  ? 1.398   5.061   5.936   1.00 0.00 ? 72  CYS A C    3  
ATOM 4262  O O    . CYS A 1 21  ? 2.583   4.983   6.183   1.00 0.00 ? 72  CYS A O    3  
ATOM 4263  C CB   . CYS A 1 21  ? 1.417   5.145   3.441   1.00 0.00 ? 72  CYS A CB   3  
ATOM 4264  S SG   . CYS A 1 21  ? 0.921   6.114   1.997   1.00 0.00 ? 72  CYS A SG   3  
ATOM 4265  H H    . CYS A 1 21  ? 2.394   7.384   4.512   1.00 0.00 ? 72  CYS A H    3  
ATOM 4266  H HA   . CYS A 1 21  ? -0.183  5.858   4.695   1.00 0.00 ? 72  CYS A HA   3  
ATOM 4267  H HB2  . CYS A 1 21  ? 2.496   5.079   3.478   1.00 0.00 ? 72  CYS A HB2  3  
ATOM 4268  H HB3  . CYS A 1 21  ? 0.993   4.151   3.373   1.00 0.00 ? 72  CYS A HB3  3  
ATOM 4269  H HG   . CYS A 1 21  ? 1.089   5.584   1.214   1.00 0.00 ? 72  CYS A HG   3  
ATOM 4270  N N    . SER A 1 22  ? 0.508   4.515   6.717   1.00 0.00 ? 73  SER A N    3  
ATOM 4271  C CA   . SER A 1 22  ? 0.949   3.778   7.947   1.00 0.00 ? 73  SER A CA   3  
ATOM 4272  C C    . SER A 1 22  ? 1.767   2.514   7.590   1.00 0.00 ? 73  SER A C    3  
ATOM 4273  O O    . SER A 1 22  ? 2.358   1.896   8.453   1.00 0.00 ? 73  SER A O    3  
ATOM 4274  C CB   . SER A 1 22  ? -0.286  3.365   8.758   1.00 0.00 ? 73  SER A CB   3  
ATOM 4275  O OG   . SER A 1 22  ? -0.707  2.078   8.338   1.00 0.00 ? 73  SER A OG   3  
ATOM 4276  H H    . SER A 1 22  ? -0.457  4.602   6.503   1.00 0.00 ? 73  SER A H    3  
ATOM 4277  H HA   . SER A 1 22  ? 1.568   4.441   8.548   1.00 0.00 ? 73  SER A HA   3  
ATOM 4278  H HB2  . SER A 1 22  ? -0.045  3.339   9.809   1.00 0.00 ? 73  SER A HB2  3  
ATOM 4279  H HB3  . SER A 1 22  ? -1.083  4.080   8.589   1.00 0.00 ? 73  SER A HB3  3  
ATOM 4280  H HG   . SER A 1 22  ? -0.648  1.491   9.091   1.00 0.00 ? 73  SER A HG   3  
ATOM 4281  N N    . VAL A 1 23  ? 1.782   2.097   6.347   1.00 0.00 ? 74  VAL A N    3  
ATOM 4282  C CA   . VAL A 1 23  ? 2.530   0.846   5.983   1.00 0.00 ? 74  VAL A CA   3  
ATOM 4283  C C    . VAL A 1 23  ? 4.029   0.996   6.293   1.00 0.00 ? 74  VAL A C    3  
ATOM 4284  O O    . VAL A 1 23  ? 4.647   1.980   5.947   1.00 0.00 ? 74  VAL A O    3  
ATOM 4285  C CB   . VAL A 1 23  ? 2.355   0.568   4.490   1.00 0.00 ? 74  VAL A CB   3  
ATOM 4286  C CG1  . VAL A 1 23  ? 3.115   -0.713  4.122   1.00 0.00 ? 74  VAL A CG1  3  
ATOM 4287  C CG2  . VAL A 1 23  ? 0.867   0.393   4.175   1.00 0.00 ? 74  VAL A CG2  3  
ATOM 4288  H H    . VAL A 1 23  ? 1.277   2.582   5.659   1.00 0.00 ? 74  VAL A H    3  
ATOM 4289  H HA   . VAL A 1 23  ? 2.133   0.016   6.546   1.00 0.00 ? 74  VAL A HA   3  
ATOM 4290  H HB   . VAL A 1 23  ? 2.754   1.397   3.922   1.00 0.00 ? 74  VAL A HB   3  
ATOM 4291  H HG11 . VAL A 1 23  ? 2.996   -1.445  4.905   1.00 0.00 ? 74  VAL A HG11 3  
ATOM 4292  H HG12 . VAL A 1 23  ? 2.726   -1.112  3.197   1.00 0.00 ? 74  VAL A HG12 3  
ATOM 4293  H HG13 . VAL A 1 23  ? 4.161   -0.487  4.002   1.00 0.00 ? 74  VAL A HG13 3  
ATOM 4294  H HG21 . VAL A 1 23  ? 0.330   1.285   4.472   1.00 0.00 ? 74  VAL A HG21 3  
ATOM 4295  H HG22 . VAL A 1 23  ? 0.738   0.232   3.116   1.00 0.00 ? 74  VAL A HG22 3  
ATOM 4296  H HG23 . VAL A 1 23  ? 0.482   -0.455  4.717   1.00 0.00 ? 74  VAL A HG23 3  
ATOM 4297  N N    . LEU A 1 24  ? 4.611   0.009   6.949   1.00 0.00 ? 75  LEU A N    3  
ATOM 4298  C CA   . LEU A 1 24  ? 6.073   0.056   7.304   1.00 0.00 ? 75  LEU A CA   3  
ATOM 4299  C C    . LEU A 1 24  ? 6.834   -1.070  6.572   1.00 0.00 ? 75  LEU A C    3  
ATOM 4300  O O    . LEU A 1 24  ? 7.653   -0.795  5.716   1.00 0.00 ? 75  LEU A O    3  
ATOM 4301  C CB   . LEU A 1 24  ? 6.224   -0.093  8.842   1.00 0.00 ? 75  LEU A CB   3  
ATOM 4302  C CG   . LEU A 1 24  ? 6.422   1.285   9.494   1.00 0.00 ? 75  LEU A CG   3  
ATOM 4303  C CD1  . LEU A 1 24  ? 6.037   1.214   10.976  1.00 0.00 ? 75  LEU A CD1  3  
ATOM 4304  C CD2  . LEU A 1 24  ? 7.894   1.712   9.364   1.00 0.00 ? 75  LEU A CD2  3  
ATOM 4305  H H    . LEU A 1 24  ? 4.081   -0.766  7.214   1.00 0.00 ? 75  LEU A H    3  
ATOM 4306  H HA   . LEU A 1 24  ? 6.491   1.005   6.991   1.00 0.00 ? 75  LEU A HA   3  
ATOM 4307  H HB2  . LEU A 1 24  ? 5.328   -0.545  9.240   1.00 0.00 ? 75  LEU A HB2  3  
ATOM 4308  H HB3  . LEU A 1 24  ? 7.076   -0.719  9.075   1.00 0.00 ? 75  LEU A HB3  3  
ATOM 4309  H HG   . LEU A 1 24  ? 5.791   2.008   8.997   1.00 0.00 ? 75  LEU A HG   3  
ATOM 4310  H HD11 . LEU A 1 24  ? 6.634   0.455   11.466  1.00 0.00 ? 75  LEU A HD11 3  
ATOM 4311  H HD12 . LEU A 1 24  ? 6.220   2.171   11.438  1.00 0.00 ? 75  LEU A HD12 3  
ATOM 4312  H HD13 . LEU A 1 24  ? 4.989   0.969   11.066  1.00 0.00 ? 75  LEU A HD13 3  
ATOM 4313  H HD21 . LEU A 1 24  ? 8.295   1.370   8.420   1.00 0.00 ? 75  LEU A HD21 3  
ATOM 4314  H HD22 . LEU A 1 24  ? 7.958   2.785   9.411   1.00 0.00 ? 75  LEU A HD22 3  
ATOM 4315  H HD23 . LEU A 1 24  ? 8.472   1.282   10.172  1.00 0.00 ? 75  LEU A HD23 3  
ATOM 4316  N N    . PRO A 1 25  ? 6.585   -2.323  6.905   1.00 0.00 ? 76  PRO A N    3  
ATOM 4317  C CA   . PRO A 1 25  ? 7.266   -3.488  6.279   1.00 0.00 ? 76  PRO A CA   3  
ATOM 4318  C C    . PRO A 1 25  ? 7.729   -3.232  4.852   1.00 0.00 ? 76  PRO A C    3  
ATOM 4319  O O    . PRO A 1 25  ? 6.940   -3.072  3.941   1.00 0.00 ? 76  PRO A O    3  
ATOM 4320  C CB   . PRO A 1 25  ? 6.174   -4.552  6.302   1.00 0.00 ? 76  PRO A CB   3  
ATOM 4321  C CG   . PRO A 1 25  ? 5.420   -4.291  7.573   1.00 0.00 ? 76  PRO A CG   3  
ATOM 4322  C CD   . PRO A 1 25  ? 5.626   -2.797  7.922   1.00 0.00 ? 76  PRO A CD   3  
ATOM 4323  H HA   . PRO A 1 25  ? 8.094   -3.816  6.887   1.00 0.00 ? 76  PRO A HA   3  
ATOM 4324  H HB2  . PRO A 1 25  ? 5.527   -4.440  5.440   1.00 0.00 ? 76  PRO A HB2  3  
ATOM 4325  H HB3  . PRO A 1 25  ? 6.607   -5.540  6.319   1.00 0.00 ? 76  PRO A HB3  3  
ATOM 4326  H HG2  . PRO A 1 25  ? 4.364   -4.499  7.427   1.00 0.00 ? 76  PRO A HG2  3  
ATOM 4327  H HG3  . PRO A 1 25  ? 5.814   -4.911  8.374   1.00 0.00 ? 76  PRO A HG3  3  
ATOM 4328  H HD2  . PRO A 1 25  ? 4.696   -2.261  7.850   1.00 0.00 ? 76  PRO A HD2  3  
ATOM 4329  H HD3  . PRO A 1 25  ? 6.044   -2.704  8.910   1.00 0.00 ? 76  PRO A HD3  3  
ATOM 4330  N N    . THR A 1 26  ? 9.012   -3.206  4.657   1.00 0.00 ? 77  THR A N    3  
ATOM 4331  C CA   . THR A 1 26  ? 9.547   -2.970  3.298   1.00 0.00 ? 77  THR A CA   3  
ATOM 4332  C C    . THR A 1 26  ? 9.200   -4.162  2.408   1.00 0.00 ? 77  THR A C    3  
ATOM 4333  O O    . THR A 1 26  ? 9.388   -4.119  1.211   1.00 0.00 ? 77  THR A O    3  
ATOM 4334  C CB   . THR A 1 26  ? 11.063  -2.804  3.367   1.00 0.00 ? 77  THR A CB   3  
ATOM 4335  O OG1  . THR A 1 26  ? 11.657  -4.031  3.748   1.00 0.00 ? 77  THR A OG1  3  
ATOM 4336  C CG2  . THR A 1 26  ? 11.409  -1.728  4.391   1.00 0.00 ? 77  THR A CG2  3  
ATOM 4337  H H    . THR A 1 26  ? 9.624   -3.346  5.411   1.00 0.00 ? 77  THR A H    3  
ATOM 4338  H HA   . THR A 1 26  ? 9.105   -2.074  2.889   1.00 0.00 ? 77  THR A HA   3  
ATOM 4339  H HB   . THR A 1 26  ? 11.438  -2.509  2.401   1.00 0.00 ? 77  THR A HB   3  
ATOM 4340  H HG1  . THR A 1 26  ? 11.167  -4.747  3.328   1.00 0.00 ? 77  THR A HG1  3  
ATOM 4341  H HG21 . THR A 1 26  ? 10.886  -0.817  4.138   1.00 0.00 ? 77  THR A HG21 3  
ATOM 4342  H HG22 . THR A 1 26  ? 11.106  -2.058  5.374   1.00 0.00 ? 77  THR A HG22 3  
ATOM 4343  H HG23 . THR A 1 26  ? 12.475  -1.547  4.380   1.00 0.00 ? 77  THR A HG23 3  
ATOM 4344  N N    . HIS A 1 27  ? 8.704   -5.233  2.985   1.00 0.00 ? 78  HIS A N    3  
ATOM 4345  C CA   . HIS A 1 27  ? 8.352   -6.442  2.168   1.00 0.00 ? 78  HIS A CA   3  
ATOM 4346  C C    . HIS A 1 27  ? 6.952   -6.933  2.554   1.00 0.00 ? 78  HIS A C    3  
ATOM 4347  O O    . HIS A 1 27  ? 6.403   -6.514  3.554   1.00 0.00 ? 78  HIS A O    3  
ATOM 4348  C CB   . HIS A 1 27  ? 9.376   -7.543  2.456   1.00 0.00 ? 78  HIS A CB   3  
ATOM 4349  C CG   . HIS A 1 27  ? 9.235   -8.005  3.883   1.00 0.00 ? 78  HIS A CG   3  
ATOM 4350  N ND1  . HIS A 1 27  ? 9.935   -7.405  4.917   1.00 0.00 ? 78  HIS A ND1  3  
ATOM 4351  C CD2  . HIS A 1 27  ? 8.480   -8.995  4.464   1.00 0.00 ? 78  HIS A CD2  3  
ATOM 4352  C CE1  . HIS A 1 27  ? 9.592   -8.030  6.055   1.00 0.00 ? 78  HIS A CE1  3  
ATOM 4353  N NE2  . HIS A 1 27  ? 8.709   -9.011  5.838   1.00 0.00 ? 78  HIS A NE2  3  
ATOM 4354  H H    . HIS A 1 27  ? 8.563   -5.246  3.956   1.00 0.00 ? 78  HIS A H    3  
ATOM 4355  H HA   . HIS A 1 27  ? 8.371   -6.202  1.116   1.00 0.00 ? 78  HIS A HA   3  
ATOM 4356  H HB2  . HIS A 1 27  ? 9.214   -8.375  1.785   1.00 0.00 ? 78  HIS A HB2  3  
ATOM 4357  H HB3  . HIS A 1 27  ? 10.375  -7.146  2.308   1.00 0.00 ? 78  HIS A HB3  3  
ATOM 4358  H HD1  . HIS A 1 27  ? 10.559  -6.655  4.831   1.00 0.00 ? 78  HIS A HD1  3  
ATOM 4359  H HD2  . HIS A 1 27  ? 7.803   -9.653  3.940   1.00 0.00 ? 78  HIS A HD2  3  
ATOM 4360  H HE1  . HIS A 1 27  ? 9.985   -7.769  7.027   1.00 0.00 ? 78  HIS A HE1  3  
ATOM 4361  N N    . TRP A 1 28  ? 6.364   -7.814  1.765   1.00 0.00 ? 79  TRP A N    3  
ATOM 4362  C CA   . TRP A 1 28  ? 4.978   -8.323  2.082   1.00 0.00 ? 79  TRP A CA   3  
ATOM 4363  C C    . TRP A 1 28  ? 5.053   -9.832  2.428   1.00 0.00 ? 79  TRP A C    3  
ATOM 4364  O O    . TRP A 1 28  ? 6.101   -10.443 2.350   1.00 0.00 ? 79  TRP A O    3  
ATOM 4365  C CB   . TRP A 1 28  ? 4.085   -8.027  0.844   1.00 0.00 ? 79  TRP A CB   3  
ATOM 4366  C CG   . TRP A 1 28  ? 3.446   -9.251  0.261   1.00 0.00 ? 79  TRP A CG   3  
ATOM 4367  C CD1  . TRP A 1 28  ? 2.124   -9.378  0.029   1.00 0.00 ? 79  TRP A CD1  3  
ATOM 4368  C CD2  . TRP A 1 28  ? 4.070   -10.490 -0.199  1.00 0.00 ? 79  TRP A CD2  3  
ATOM 4369  N NE1  . TRP A 1 28  ? 1.886   -10.608 -0.537  1.00 0.00 ? 79  TRP A NE1  3  
ATOM 4370  C CE2  . TRP A 1 28  ? 3.057   -11.336 -0.700  1.00 0.00 ? 79  TRP A CE2  3  
ATOM 4371  C CE3  . TRP A 1 28  ? 5.399   -10.958 -0.227  1.00 0.00 ? 79  TRP A CE3  3  
ATOM 4372  C CZ2  . TRP A 1 28  ? 3.350   -12.599 -1.212  1.00 0.00 ? 79  TRP A CZ2  3  
ATOM 4373  C CZ3  . TRP A 1 28  ? 5.695   -12.229 -0.740  1.00 0.00 ? 79  TRP A CZ3  3  
ATOM 4374  C CH2  . TRP A 1 28  ? 4.674   -13.046 -1.233  1.00 0.00 ? 79  TRP A CH2  3  
ATOM 4375  H H    . TRP A 1 28  ? 6.823   -8.118  0.935   1.00 0.00 ? 79  TRP A H    3  
ATOM 4376  H HA   . TRP A 1 28  ? 4.585   -7.790  2.942   1.00 0.00 ? 79  TRP A HA   3  
ATOM 4377  H HB2  . TRP A 1 28  ? 3.309   -7.335  1.120   1.00 0.00 ? 79  TRP A HB2  3  
ATOM 4378  H HB3  . TRP A 1 28  ? 4.698   -7.568  0.082   1.00 0.00 ? 79  TRP A HB3  3  
ATOM 4379  H HD1  . TRP A 1 28  ? 1.377   -8.636  0.250   1.00 0.00 ? 79  TRP A HD1  3  
ATOM 4380  H HE1  . TRP A 1 28  ? 0.997   -10.949 -0.794  1.00 0.00 ? 79  TRP A HE1  3  
ATOM 4381  H HE3  . TRP A 1 28  ? 6.197   -10.331 0.137   1.00 0.00 ? 79  TRP A HE3  3  
ATOM 4382  H HZ2  . TRP A 1 28  ? 2.569   -13.215 -1.617  1.00 0.00 ? 79  TRP A HZ2  3  
ATOM 4383  H HZ3  . TRP A 1 28  ? 6.714   -12.576 -0.759  1.00 0.00 ? 79  TRP A HZ3  3  
ATOM 4384  H HH2  . TRP A 1 28  ? 4.904   -14.016 -1.630  1.00 0.00 ? 79  TRP A HH2  3  
ATOM 4385  N N    . ARG A 1 29  ? 3.967   -10.427 2.874   1.00 0.00 ? 80  ARG A N    3  
ATOM 4386  C CA   . ARG A 1 29  ? 4.004   -11.879 3.263   1.00 0.00 ? 80  ARG A CA   3  
ATOM 4387  C C    . ARG A 1 29  ? 2.672   -12.588 2.955   1.00 0.00 ? 80  ARG A C    3  
ATOM 4388  O O    . ARG A 1 29  ? 1.900   -12.874 3.848   1.00 0.00 ? 80  ARG A O    3  
ATOM 4389  C CB   . ARG A 1 29  ? 4.307   -11.985 4.762   1.00 0.00 ? 80  ARG A CB   3  
ATOM 4390  C CG   . ARG A 1 29  ? 3.420   -11.014 5.541   1.00 0.00 ? 80  ARG A CG   3  
ATOM 4391  C CD   . ARG A 1 29  ? 3.787   -11.073 7.017   1.00 0.00 ? 80  ARG A CD   3  
ATOM 4392  N NE   . ARG A 1 29  ? 2.835   -10.224 7.782   1.00 0.00 ? 80  ARG A NE   3  
ATOM 4393  C CZ   . ARG A 1 29  ? 2.754   -10.340 9.078   1.00 0.00 ? 80  ARG A CZ   3  
ATOM 4394  N NH1  . ARG A 1 29  ? 3.500   -11.211 9.702   1.00 0.00 ? 80  ARG A NH1  3  
ATOM 4395  N NH2  . ARG A 1 29  ? 1.925   -9.589  9.752   1.00 0.00 ? 80  ARG A NH2  3  
ATOM 4396  H H    . ARG A 1 29  ? 3.138   -9.913  2.976   1.00 0.00 ? 80  ARG A H    3  
ATOM 4397  H HA   . ARG A 1 29  ? 4.791   -12.376 2.712   1.00 0.00 ? 80  ARG A HA   3  
ATOM 4398  H HB2  . ARG A 1 29  ? 4.115   -12.998 5.099   1.00 0.00 ? 80  ARG A HB2  3  
ATOM 4399  H HB3  . ARG A 1 29  ? 5.342   -11.737 4.939   1.00 0.00 ? 80  ARG A HB3  3  
ATOM 4400  H HG2  . ARG A 1 29  ? 3.578   -10.010 5.176   1.00 0.00 ? 80  ARG A HG2  3  
ATOM 4401  H HG3  . ARG A 1 29  ? 2.383   -11.285 5.422   1.00 0.00 ? 80  ARG A HG3  3  
ATOM 4402  H HD2  . ARG A 1 29  ? 3.725   -12.095 7.365   1.00 0.00 ? 80  ARG A HD2  3  
ATOM 4403  H HD3  . ARG A 1 29  ? 4.792   -10.705 7.155   1.00 0.00 ? 80  ARG A HD3  3  
ATOM 4404  H HE   . ARG A 1 29  ? 2.274   -9.573  7.312   1.00 0.00 ? 80  ARG A HE   3  
ATOM 4405  H HH11 . ARG A 1 29  ? 4.132   -11.787 9.186   1.00 0.00 ? 80  ARG A HH11 3  
ATOM 4406  H HH12 . ARG A 1 29  ? 3.439   -11.301 10.696  1.00 0.00 ? 80  ARG A HH12 3  
ATOM 4407  H HH21 . ARG A 1 29  ? 1.350   -8.921  9.273   1.00 0.00 ? 80  ARG A HH21 3  
ATOM 4408  H HH22 . ARG A 1 29  ? 1.862   -9.679  10.747  1.00 0.00 ? 80  ARG A HH22 3  
ATOM 4409  N N    . SER A 1 30  ? 2.401   -12.896 1.704   1.00 0.00 ? 81  SER A N    3  
ATOM 4410  C CA   . SER A 1 30  ? 1.122   -13.609 1.354   1.00 0.00 ? 81  SER A CA   3  
ATOM 4411  C C    . SER A 1 30  ? 1.437   -14.943 0.677   1.00 0.00 ? 81  SER A C    3  
ATOM 4412  O O    . SER A 1 30  ? 2.007   -14.989 -0.389  1.00 0.00 ? 81  SER A O    3  
ATOM 4413  C CB   . SER A 1 30  ? 0.309   -12.730 0.401   1.00 0.00 ? 81  SER A CB   3  
ATOM 4414  O OG   . SER A 1 30  ? 0.273   -11.424 0.933   1.00 0.00 ? 81  SER A OG   3  
ATOM 4415  H H    . SER A 1 30  ? 3.039   -12.673 0.997   1.00 0.00 ? 81  SER A H    3  
ATOM 4416  H HA   . SER A 1 30  ? 0.537   -13.793 2.243   1.00 0.00 ? 81  SER A HA   3  
ATOM 4417  H HB2  . SER A 1 30  ? 0.762   -12.697 -0.574  1.00 0.00 ? 81  SER A HB2  3  
ATOM 4418  H HB3  . SER A 1 30  ? -0.693  -13.123 0.310   1.00 0.00 ? 81  SER A HB3  3  
ATOM 4419  H HG   . SER A 1 30  ? 0.744   -11.434 1.767   1.00 0.00 ? 81  SER A HG   3  
ATOM 4420  N N    . ASN A 1 31  ? 1.056   -16.038 1.269   1.00 0.00 ? 82  ASN A N    3  
ATOM 4421  C CA   . ASN A 1 31  ? 1.328   -17.337 0.604   1.00 0.00 ? 82  ASN A CA   3  
ATOM 4422  C C    . ASN A 1 31  ? 0.552   -17.338 -0.707  1.00 0.00 ? 82  ASN A C    3  
ATOM 4423  O O    . ASN A 1 31  ? 1.002   -17.831 -1.726  1.00 0.00 ? 82  ASN A O    3  
ATOM 4424  C CB   . ASN A 1 31  ? 0.872   -18.504 1.493   1.00 0.00 ? 82  ASN A CB   3  
ATOM 4425  C CG   . ASN A 1 31  ? 1.755   -18.566 2.745   1.00 0.00 ? 82  ASN A CG   3  
ATOM 4426  O OD1  . ASN A 1 31  ? 2.833   -18.006 2.764   1.00 0.00 ? 82  ASN A OD1  3  
ATOM 4427  N ND2  . ASN A 1 31  ? 1.351   -19.229 3.799   1.00 0.00 ? 82  ASN A ND2  3  
ATOM 4428  H H    . ASN A 1 31  ? 0.575   -16.003 2.122   1.00 0.00 ? 82  ASN A H    3  
ATOM 4429  H HA   . ASN A 1 31  ? 2.388   -17.419 0.393   1.00 0.00 ? 82  ASN A HA   3  
ATOM 4430  H HB2  . ASN A 1 31  ? -0.160  -18.356 1.782   1.00 0.00 ? 82  ASN A HB2  3  
ATOM 4431  H HB3  . ASN A 1 31  ? 0.961   -19.432 0.950   1.00 0.00 ? 82  ASN A HB3  3  
ATOM 4432  H HD21 . ASN A 1 31  ? 0.485   -19.691 3.792   1.00 0.00 ? 82  ASN A HD21 3  
ATOM 4433  H HD22 . ASN A 1 31  ? 1.911   -19.258 4.601   1.00 0.00 ? 82  ASN A HD22 3  
ATOM 4434  N N    . LYS A 1 32  ? -0.626  -16.770 -0.674  1.00 0.00 ? 83  LYS A N    3  
ATOM 4435  C CA   . LYS A 1 32  ? -1.483  -16.703 -1.890  1.00 0.00 ? 83  LYS A CA   3  
ATOM 4436  C C    . LYS A 1 32  ? -2.327  -15.425 -1.835  1.00 0.00 ? 83  LYS A C    3  
ATOM 4437  O O    . LYS A 1 32  ? -1.809  -14.337 -1.660  1.00 0.00 ? 83  LYS A O    3  
ATOM 4438  C CB   . LYS A 1 32  ? -2.396  -17.932 -1.932  1.00 0.00 ? 83  LYS A CB   3  
ATOM 4439  C CG   . LYS A 1 32  ? -3.069  -18.124 -0.553  1.00 0.00 ? 83  LYS A CG   3  
ATOM 4440  C CD   . LYS A 1 32  ? -4.060  -19.308 -0.576  1.00 0.00 ? 83  LYS A CD   3  
ATOM 4441  C CE   . LYS A 1 32  ? -3.332  -20.632 -0.328  1.00 0.00 ? 83  LYS A CE   3  
ATOM 4442  N NZ   . LYS A 1 32  ? -2.457  -20.933 -1.489  1.00 0.00 ? 83  LYS A NZ   3  
ATOM 4443  H H    . LYS A 1 32  ? -0.951  -16.378 0.168   1.00 0.00 ? 83  LYS A H    3  
ATOM 4444  H HA   . LYS A 1 32  ? -0.860  -16.682 -2.774  1.00 0.00 ? 83  LYS A HA   3  
ATOM 4445  H HB2  . LYS A 1 32  ? -3.148  -17.793 -2.694  1.00 0.00 ? 83  LYS A HB2  3  
ATOM 4446  H HB3  . LYS A 1 32  ? -1.804  -18.799 -2.174  1.00 0.00 ? 83  LYS A HB3  3  
ATOM 4447  H HG2  . LYS A 1 32  ? -2.308  -18.305 0.191   1.00 0.00 ? 83  LYS A HG2  3  
ATOM 4448  H HG3  . LYS A 1 32  ? -3.604  -17.224 -0.295  1.00 0.00 ? 83  LYS A HG3  3  
ATOM 4449  H HD2  . LYS A 1 32  ? -4.802  -19.165 0.195   1.00 0.00 ? 83  LYS A HD2  3  
ATOM 4450  H HD3  . LYS A 1 32  ? -4.553  -19.345 -1.535  1.00 0.00 ? 83  LYS A HD3  3  
ATOM 4451  H HE2  . LYS A 1 32  ? -2.730  -20.556 0.571   1.00 0.00 ? 83  LYS A HE2  3  
ATOM 4452  H HE3  . LYS A 1 32  ? -4.059  -21.425 -0.210  1.00 0.00 ? 83  LYS A HE3  3  
ATOM 4453  H HZ1  . LYS A 1 32  ? -2.777  -20.384 -2.311  1.00 0.00 ? 83  LYS A HZ1  3  
ATOM 4454  H HZ2  . LYS A 1 32  ? -1.474  -20.667 -1.261  1.00 0.00 ? 83  LYS A HZ2  3  
ATOM 4455  H HZ3  . LYS A 1 32  ? -2.506  -21.946 -1.709  1.00 0.00 ? 83  LYS A HZ3  3  
ATOM 4456  N N    . THR A 1 33  ? -3.620  -15.538 -1.969  1.00 0.00 ? 84  THR A N    3  
ATOM 4457  C CA   . THR A 1 33  ? -4.476  -14.331 -1.914  1.00 0.00 ? 84  THR A CA   3  
ATOM 4458  C C    . THR A 1 33  ? -4.552  -13.855 -0.472  1.00 0.00 ? 84  THR A C    3  
ATOM 4459  O O    . THR A 1 33  ? -5.618  -13.567 0.045   1.00 0.00 ? 84  THR A O    3  
ATOM 4460  C CB   . THR A 1 33  ? -5.887  -14.659 -2.422  1.00 0.00 ? 84  THR A CB   3  
ATOM 4461  O OG1  . THR A 1 33  ? -5.803  -15.484 -3.574  1.00 0.00 ? 84  THR A OG1  3  
ATOM 4462  C CG2  . THR A 1 33  ? -6.624  -13.356 -2.762  1.00 0.00 ? 84  THR A CG2  3  
ATOM 4463  H H    . THR A 1 33  ? -4.032  -16.409 -2.092  1.00 0.00 ? 84  THR A H    3  
ATOM 4464  H HA   . THR A 1 33  ? -4.039  -13.552 -2.527  1.00 0.00 ? 84  THR A HA   3  
ATOM 4465  H HB   . THR A 1 33  ? -6.436  -15.181 -1.654  1.00 0.00 ? 84  THR A HB   3  
ATOM 4466  H HG1  . THR A 1 33  ? -6.153  -16.347 -3.342  1.00 0.00 ? 84  THR A HG1  3  
ATOM 4467  H HG21 . THR A 1 33  ? -6.068  -12.801 -3.502  1.00 0.00 ? 84  THR A HG21 3  
ATOM 4468  H HG22 . THR A 1 33  ? -7.607  -13.589 -3.144  1.00 0.00 ? 84  THR A HG22 3  
ATOM 4469  H HG23 . THR A 1 33  ? -6.721  -12.756 -1.869  1.00 0.00 ? 84  THR A HG23 3  
ATOM 4470  N N    . LEU A 1 34  ? -3.416  -13.736 0.176   1.00 0.00 ? 85  LEU A N    3  
ATOM 4471  C CA   . LEU A 1 34  ? -3.389  -13.240 1.583   1.00 0.00 ? 85  LEU A CA   3  
ATOM 4472  C C    . LEU A 1 34  ? -2.539  -11.969 1.642   1.00 0.00 ? 85  LEU A C    3  
ATOM 4473  O O    . LEU A 1 34  ? -1.491  -11.959 2.252   1.00 0.00 ? 85  LEU A O    3  
ATOM 4474  C CB   . LEU A 1 34  ? -2.767  -14.308 2.499   1.00 0.00 ? 85  LEU A CB   3  
ATOM 4475  C CG   . LEU A 1 34  ? -2.949  -13.907 3.979   1.00 0.00 ? 85  LEU A CG   3  
ATOM 4476  C CD1  . LEU A 1 34  ? -4.333  -14.338 4.475   1.00 0.00 ? 85  LEU A CD1  3  
ATOM 4477  C CD2  . LEU A 1 34  ? -1.881  -14.595 4.835   1.00 0.00 ? 85  LEU A CD2  3  
ATOM 4478  H H    . LEU A 1 34  ? -2.573  -13.957 -0.277  1.00 0.00 ? 85  LEU A H    3  
ATOM 4479  H HA   . LEU A 1 34  ? -4.374  -13.023 1.912   1.00 0.00 ? 85  LEU A HA   3  
ATOM 4480  H HB2  . LEU A 1 34  ? -3.248  -15.260 2.319   1.00 0.00 ? 85  LEU A HB2  3  
ATOM 4481  H HB3  . LEU A 1 34  ? -1.715  -14.396 2.275   1.00 0.00 ? 85  LEU A HB3  3  
ATOM 4482  H HG   . LEU A 1 34  ? -2.852  -12.834 4.078   1.00 0.00 ? 85  LEU A HG   3  
ATOM 4483  H HD11 . LEU A 1 34  ? -4.455  -15.399 4.326   1.00 0.00 ? 85  LEU A HD11 3  
ATOM 4484  H HD12 . LEU A 1 34  ? -4.422  -14.116 5.526   1.00 0.00 ? 85  LEU A HD12 3  
ATOM 4485  H HD13 . LEU A 1 34  ? -5.098  -13.804 3.930   1.00 0.00 ? 85  LEU A HD13 3  
ATOM 4486  H HD21 . LEU A 1 34  ? -1.837  -15.643 4.583   1.00 0.00 ? 85  LEU A HD21 3  
ATOM 4487  H HD22 . LEU A 1 34  ? -0.921  -14.136 4.650   1.00 0.00 ? 85  LEU A HD22 3  
ATOM 4488  H HD23 . LEU A 1 34  ? -2.131  -14.487 5.878   1.00 0.00 ? 85  LEU A HD23 3  
ATOM 4489  N N    . PRO A 1 35  ? -2.989  -10.909 1.007   1.00 0.00 ? 86  PRO A N    3  
ATOM 4490  C CA   . PRO A 1 35  ? -2.254  -9.608  0.961   1.00 0.00 ? 86  PRO A CA   3  
ATOM 4491  C C    . PRO A 1 35  ? -2.359  -8.807  2.258   1.00 0.00 ? 86  PRO A C    3  
ATOM 4492  O O    . PRO A 1 35  ? -2.708  -9.318  3.305   1.00 0.00 ? 86  PRO A O    3  
ATOM 4493  C CB   . PRO A 1 35  ? -2.952  -8.872  -0.188  1.00 0.00 ? 86  PRO A CB   3  
ATOM 4494  C CG   . PRO A 1 35  ? -4.356  -9.352  -0.113  1.00 0.00 ? 86  PRO A CG   3  
ATOM 4495  C CD   . PRO A 1 35  ? -4.249  -10.829 0.245   1.00 0.00 ? 86  PRO A CD   3  
ATOM 4496  H HA   . PRO A 1 35  ? -1.227  -9.766  0.703   1.00 0.00 ? 86  PRO A HA   3  
ATOM 4497  H HB2  . PRO A 1 35  ? -2.902  -7.801  -0.051  1.00 0.00 ? 86  PRO A HB2  3  
ATOM 4498  H HB3  . PRO A 1 35  ? -2.516  -9.156  -1.138  1.00 0.00 ? 86  PRO A HB3  3  
ATOM 4499  H HG2  . PRO A 1 35  ? -4.896  -8.811  0.656   1.00 0.00 ? 86  PRO A HG2  3  
ATOM 4500  H HG3  . PRO A 1 35  ? -4.847  -9.243  -1.067  1.00 0.00 ? 86  PRO A HG3  3  
ATOM 4501  H HD2  . PRO A 1 35  ? -5.094  -11.139 0.848   1.00 0.00 ? 86  PRO A HD2  3  
ATOM 4502  H HD3  . PRO A 1 35  ? -4.175  -11.419 -0.651  1.00 0.00 ? 86  PRO A HD3  3  
ATOM 4503  N N    . ILE A 1 36  ? -2.050  -7.545  2.171   1.00 0.00 ? 87  ILE A N    3  
ATOM 4504  C CA   . ILE A 1 36  ? -2.109  -6.635  3.354   1.00 0.00 ? 87  ILE A CA   3  
ATOM 4505  C C    . ILE A 1 36  ? -3.018  -5.451  3.016   1.00 0.00 ? 87  ILE A C    3  
ATOM 4506  O O    . ILE A 1 36  ? -3.400  -5.272  1.876   1.00 0.00 ? 87  ILE A O    3  
ATOM 4507  C CB   . ILE A 1 36  ? -0.698  -6.134  3.659   1.00 0.00 ? 87  ILE A CB   3  
ATOM 4508  C CG1  . ILE A 1 36  ? -0.092  -5.547  2.384   1.00 0.00 ? 87  ILE A CG1  3  
ATOM 4509  C CG2  . ILE A 1 36  ? 0.171   -7.291  4.149   1.00 0.00 ? 87  ILE A CG2  3  
ATOM 4510  C CD1  . ILE A 1 36  ? 1.299   -4.991  2.680   1.00 0.00 ? 87  ILE A CD1  3  
ATOM 4511  H H    . ILE A 1 36  ? -1.776  -7.180  1.303   1.00 0.00 ? 87  ILE A H    3  
ATOM 4512  H HA   . ILE A 1 36  ? -2.504  -7.164  4.214   1.00 0.00 ? 87  ILE A HA   3  
ATOM 4513  H HB   . ILE A 1 36  ? -0.745  -5.370  4.421   1.00 0.00 ? 87  ILE A HB   3  
ATOM 4514  H HG12 . ILE A 1 36  ? -0.016  -6.328  1.638   1.00 0.00 ? 87  ILE A HG12 3  
ATOM 4515  H HG13 . ILE A 1 36  ? -0.726  -4.754  2.012   1.00 0.00 ? 87  ILE A HG13 3  
ATOM 4516  H HG21 . ILE A 1 36  ? -0.301  -7.761  5.002   1.00 0.00 ? 87  ILE A HG21 3  
ATOM 4517  H HG22 . ILE A 1 36  ? 0.293   -8.012  3.355   1.00 0.00 ? 87  ILE A HG22 3  
ATOM 4518  H HG23 . ILE A 1 36  ? 1.138   -6.915  4.440   1.00 0.00 ? 87  ILE A HG23 3  
ATOM 4519  H HD11 . ILE A 1 36  ? 1.269   -4.414  3.596   1.00 0.00 ? 87  ILE A HD11 3  
ATOM 4520  H HD12 . ILE A 1 36  ? 1.996   -5.812  2.791   1.00 0.00 ? 87  ILE A HD12 3  
ATOM 4521  H HD13 . ILE A 1 36  ? 1.615   -4.360  1.864   1.00 0.00 ? 87  ILE A HD13 3  
ATOM 4522  N N    . ALA A 1 37  ? -3.372  -4.648  3.994   1.00 0.00 ? 88  ALA A N    3  
ATOM 4523  C CA   . ALA A 1 37  ? -4.275  -3.473  3.735   1.00 0.00 ? 88  ALA A CA   3  
ATOM 4524  C C    . ALA A 1 37  ? -3.541  -2.156  4.062   1.00 0.00 ? 88  ALA A C    3  
ATOM 4525  O O    . ALA A 1 37  ? -2.696  -2.098  4.938   1.00 0.00 ? 88  ALA A O    3  
ATOM 4526  C CB   . ALA A 1 37  ? -5.531  -3.612  4.606   1.00 0.00 ? 88  ALA A CB   3  
ATOM 4527  H H    . ALA A 1 37  ? -3.052  -4.825  4.902   1.00 0.00 ? 88  ALA A H    3  
ATOM 4528  H HA   . ALA A 1 37  ? -4.570  -3.457  2.693   1.00 0.00 ? 88  ALA A HA   3  
ATOM 4529  H HB1  . ALA A 1 37  ? -5.256  -3.983  5.582   1.00 0.00 ? 88  ALA A HB1  3  
ATOM 4530  H HB2  . ALA A 1 37  ? -6.012  -2.650  4.710   1.00 0.00 ? 88  ALA A HB2  3  
ATOM 4531  H HB3  . ALA A 1 37  ? -6.218  -4.305  4.140   1.00 0.00 ? 88  ALA A HB3  3  
ATOM 4532  N N    . PHE A 1 38  ? -3.849  -1.108  3.334   1.00 0.00 ? 89  PHE A N    3  
ATOM 4533  C CA   . PHE A 1 38  ? -3.179  0.221   3.536   1.00 0.00 ? 89  PHE A CA   3  
ATOM 4534  C C    . PHE A 1 38  ? -4.011  1.122   4.477   1.00 0.00 ? 89  PHE A C    3  
ATOM 4535  O O    . PHE A 1 38  ? -5.205  0.969   4.638   1.00 0.00 ? 89  PHE A O    3  
ATOM 4536  C CB   . PHE A 1 38  ? -3.037  0.915   2.152   1.00 0.00 ? 89  PHE A CB   3  
ATOM 4537  C CG   . PHE A 1 38  ? -1.667  0.672   1.537   1.00 0.00 ? 89  PHE A CG   3  
ATOM 4538  C CD1  . PHE A 1 38  ? -1.204  -0.632  1.319   1.00 0.00 ? 89  PHE A CD1  3  
ATOM 4539  C CD2  . PHE A 1 38  ? -0.857  1.768   1.174   1.00 0.00 ? 89  PHE A CD2  3  
ATOM 4540  C CE1  . PHE A 1 38  ? 0.062   -0.841  0.747   1.00 0.00 ? 89  PHE A CE1  3  
ATOM 4541  C CE2  . PHE A 1 38  ? 0.400   1.556   0.603   1.00 0.00 ? 89  PHE A CE2  3  
ATOM 4542  C CZ   . PHE A 1 38  ? 0.862   0.252   0.393   1.00 0.00 ? 89  PHE A CZ   3  
ATOM 4543  H H    . PHE A 1 38  ? -4.520  -1.196  2.627   1.00 0.00 ? 89  PHE A H    3  
ATOM 4544  H HA   . PHE A 1 38  ? -2.201  0.074   3.969   1.00 0.00 ? 89  PHE A HA   3  
ATOM 4545  H HB2  . PHE A 1 38  ? -3.791  0.532   1.490   1.00 0.00 ? 89  PHE A HB2  3  
ATOM 4546  H HB3  . PHE A 1 38  ? -3.184  1.978   2.266   1.00 0.00 ? 89  PHE A HB3  3  
ATOM 4547  H HD1  . PHE A 1 38  ? -1.818  -1.481  1.592   1.00 0.00 ? 89  PHE A HD1  3  
ATOM 4548  H HD2  . PHE A 1 38  ? -1.210  2.776   1.335   1.00 0.00 ? 89  PHE A HD2  3  
ATOM 4549  H HE1  . PHE A 1 38  ? 0.420   -1.850  0.581   1.00 0.00 ? 89  PHE A HE1  3  
ATOM 4550  H HE2  . PHE A 1 38  ? 1.015   2.402   0.328   1.00 0.00 ? 89  PHE A HE2  3  
ATOM 4551  H HZ   . PHE A 1 38  ? 1.841   0.089   -0.041  1.00 0.00 ? 89  PHE A HZ   3  
ATOM 4552  N N    . LYS A 1 39  ? -3.365  2.078   5.081   1.00 0.00 ? 90  LYS A N    3  
ATOM 4553  C CA   . LYS A 1 39  ? -4.055  3.041   5.983   1.00 0.00 ? 90  LYS A CA   3  
ATOM 4554  C C    . LYS A 1 39  ? -3.338  4.379   5.820   1.00 0.00 ? 90  LYS A C    3  
ATOM 4555  O O    . LYS A 1 39  ? -2.139  4.463   5.991   1.00 0.00 ? 90  LYS A O    3  
ATOM 4556  C CB   . LYS A 1 39  ? -3.954  2.541   7.414   1.00 0.00 ? 90  LYS A CB   3  
ATOM 4557  C CG   . LYS A 1 39  ? -4.657  3.484   8.386   1.00 0.00 ? 90  LYS A CG   3  
ATOM 4558  C CD   . LYS A 1 39  ? -4.373  2.981   9.798   1.00 0.00 ? 90  LYS A CD   3  
ATOM 4559  C CE   . LYS A 1 39  ? -5.137  3.813   10.823  1.00 0.00 ? 90  LYS A CE   3  
ATOM 4560  N NZ   . LYS A 1 39  ? -4.789  3.352   12.201  1.00 0.00 ? 90  LYS A NZ   3  
ATOM 4561  H H    . LYS A 1 39  ? -2.408  2.180   4.926   1.00 0.00 ? 90  LYS A H    3  
ATOM 4562  H HA   . LYS A 1 39  ? -5.088  3.139   5.691   1.00 0.00 ? 90  LYS A HA   3  
ATOM 4563  H HB2  . LYS A 1 39  ? -4.419  1.572   7.477   1.00 0.00 ? 90  LYS A HB2  3  
ATOM 4564  H HB3  . LYS A 1 39  ? -2.915  2.461   7.685   1.00 0.00 ? 90  LYS A HB3  3  
ATOM 4565  H HG2  . LYS A 1 39  ? -4.272  4.489   8.263   1.00 0.00 ? 90  LYS A HG2  3  
ATOM 4566  H HG3  . LYS A 1 39  ? -5.724  3.473   8.205   1.00 0.00 ? 90  LYS A HG3  3  
ATOM 4567  H HD2  . LYS A 1 39  ? -4.681  1.947   9.872   1.00 0.00 ? 90  LYS A HD2  3  
ATOM 4568  H HD3  . LYS A 1 39  ? -3.314  3.057   9.994   1.00 0.00 ? 90  LYS A HD3  3  
ATOM 4569  H HE2  . LYS A 1 39  ? -4.862  4.850   10.709  1.00 0.00 ? 90  LYS A HE2  3  
ATOM 4570  H HE3  . LYS A 1 39  ? -6.200  3.698   10.657  1.00 0.00 ? 90  LYS A HE3  3  
ATOM 4571  H HZ1  . LYS A 1 39  ? -4.107  2.570   12.143  1.00 0.00 ? 90  LYS A HZ1  3  
ATOM 4572  H HZ2  . LYS A 1 39  ? -4.366  4.137   12.734  1.00 0.00 ? 90  LYS A HZ2  3  
ATOM 4573  H HZ3  . LYS A 1 39  ? -5.650  3.027   12.688  1.00 0.00 ? 90  LYS A HZ3  3  
ATOM 4574  N N    . VAL A 1 40  ? -4.043  5.408   5.440   1.00 0.00 ? 91  VAL A N    3  
ATOM 4575  C CA   . VAL A 1 40  ? -3.386  6.728   5.201   1.00 0.00 ? 91  VAL A CA   3  
ATOM 4576  C C    . VAL A 1 40  ? -3.785  7.752   6.258   1.00 0.00 ? 91  VAL A C    3  
ATOM 4577  O O    . VAL A 1 40  ? -4.943  7.968   6.512   1.00 0.00 ? 91  VAL A O    3  
ATOM 4578  C CB   . VAL A 1 40  ? -3.852  7.224   3.839   1.00 0.00 ? 91  VAL A CB   3  
ATOM 4579  C CG1  . VAL A 1 40  ? -3.036  8.443   3.412   1.00 0.00 ? 91  VAL A CG1  3  
ATOM 4580  C CG2  . VAL A 1 40  ? -3.685  6.094   2.827   1.00 0.00 ? 91  VAL A CG2  3  
ATOM 4581  H H    . VAL A 1 40  ? -4.999  5.306   5.267   1.00 0.00 ? 91  VAL A H    3  
ATOM 4582  H HA   . VAL A 1 40  ? -2.310  6.624   5.189   1.00 0.00 ? 91  VAL A HA   3  
ATOM 4583  H HB   . VAL A 1 40  ? -4.897  7.499   3.899   1.00 0.00 ? 91  VAL A HB   3  
ATOM 4584  H HG11 . VAL A 1 40  ? -1.984  8.206   3.451   1.00 0.00 ? 91  VAL A HG11 3  
ATOM 4585  H HG12 . VAL A 1 40  ? -3.303  8.715   2.402   1.00 0.00 ? 91  VAL A HG12 3  
ATOM 4586  H HG13 . VAL A 1 40  ? -3.248  9.270   4.080   1.00 0.00 ? 91  VAL A HG13 3  
ATOM 4587  H HG21 . VAL A 1 40  ? -2.677  5.703   2.887   1.00 0.00 ? 91  VAL A HG21 3  
ATOM 4588  H HG22 . VAL A 1 40  ? -4.391  5.305   3.057   1.00 0.00 ? 91  VAL A HG22 3  
ATOM 4589  H HG23 . VAL A 1 40  ? -3.875  6.471   1.832   1.00 0.00 ? 91  VAL A HG23 3  
ATOM 4590  N N    . VAL A 1 41  ? -2.819  8.409   6.837   1.00 0.00 ? 92  VAL A N    3  
ATOM 4591  C CA   . VAL A 1 41  ? -3.099  9.473   7.847   1.00 0.00 ? 92  VAL A CA   3  
ATOM 4592  C C    . VAL A 1 41  ? -2.789  10.819  7.189   1.00 0.00 ? 92  VAL A C    3  
ATOM 4593  O O    . VAL A 1 41  ? -1.735  11.000  6.614   1.00 0.00 ? 92  VAL A O    3  
ATOM 4594  C CB   . VAL A 1 41  ? -2.188  9.256   9.063   1.00 0.00 ? 92  VAL A CB   3  
ATOM 4595  C CG1  . VAL A 1 41  ? -2.361  10.410  10.063  1.00 0.00 ? 92  VAL A CG1  3  
ATOM 4596  C CG2  . VAL A 1 41  ? -2.568  7.929   9.739   1.00 0.00 ? 92  VAL A CG2  3  
ATOM 4597  H H    . VAL A 1 41  ? -1.897  8.225   6.577   1.00 0.00 ? 92  VAL A H    3  
ATOM 4598  H HA   . VAL A 1 41  ? -4.139  9.440   8.154   1.00 0.00 ? 92  VAL A HA   3  
ATOM 4599  H HB   . VAL A 1 41  ? -1.159  9.211   8.740   1.00 0.00 ? 92  VAL A HB   3  
ATOM 4600  H HG11 . VAL A 1 41  ? -3.411  10.561  10.263  1.00 0.00 ? 92  VAL A HG11 3  
ATOM 4601  H HG12 . VAL A 1 41  ? -1.846  10.168  10.984  1.00 0.00 ? 92  VAL A HG12 3  
ATOM 4602  H HG13 . VAL A 1 41  ? -1.942  11.317  9.644   1.00 0.00 ? 92  VAL A HG13 3  
ATOM 4603  H HG21 . VAL A 1 41  ? -2.600  7.143   9.001   1.00 0.00 ? 92  VAL A HG21 3  
ATOM 4604  H HG22 . VAL A 1 41  ? -1.834  7.681   10.491  1.00 0.00 ? 92  VAL A HG22 3  
ATOM 4605  H HG23 . VAL A 1 41  ? -3.538  8.024   10.202  1.00 0.00 ? 92  VAL A HG23 3  
ATOM 4606  N N    . ALA A 1 42  ? -3.714  11.750  7.235   1.00 0.00 ? 93  ALA A N    3  
ATOM 4607  C CA   . ALA A 1 42  ? -3.491  13.078  6.578   1.00 0.00 ? 93  ALA A CA   3  
ATOM 4608  C C    . ALA A 1 42  ? -3.491  14.187  7.626   1.00 0.00 ? 93  ALA A C    3  
ATOM 4609  O O    . ALA A 1 42  ? -4.452  14.377  8.347   1.00 0.00 ? 93  ALA A O    3  
ATOM 4610  C CB   . ALA A 1 42  ? -4.607  13.320  5.560   1.00 0.00 ? 93  ALA A CB   3  
ATOM 4611  H H    . ALA A 1 42  ? -4.566  11.567  7.684   1.00 0.00 ? 93  ALA A H    3  
ATOM 4612  H HA   . ALA A 1 42  ? -2.544  13.083  6.063   1.00 0.00 ? 93  ALA A HA   3  
ATOM 4613  H HB1  . ALA A 1 42  ? -5.567  13.252  6.054   1.00 0.00 ? 93  ALA A HB1  3  
ATOM 4614  H HB2  . ALA A 1 42  ? -4.489  14.304  5.125   1.00 0.00 ? 93  ALA A HB2  3  
ATOM 4615  H HB3  . ALA A 1 42  ? -4.548  12.570  4.783   1.00 0.00 ? 93  ALA A HB3  3  
ATOM 4616  N N    . LEU A 1 43  ? -2.416  14.927  7.697   1.00 0.00 ? 94  LEU A N    3  
ATOM 4617  C CA   . LEU A 1 43  ? -2.320  16.050  8.675   1.00 0.00 ? 94  LEU A CA   3  
ATOM 4618  C C    . LEU A 1 43  ? -2.834  17.317  7.998   1.00 0.00 ? 94  LEU A C    3  
ATOM 4619  O O    . LEU A 1 43  ? -2.777  18.405  8.539   1.00 0.00 ? 94  LEU A O    3  
ATOM 4620  C CB   . LEU A 1 43  ? -0.859  16.240  9.082   1.00 0.00 ? 94  LEU A CB   3  
ATOM 4621  C CG   . LEU A 1 43  ? -0.271  14.885  9.498   1.00 0.00 ? 94  LEU A CG   3  
ATOM 4622  C CD1  . LEU A 1 43  ? 1.174   15.067  9.983   1.00 0.00 ? 94  LEU A CD1  3  
ATOM 4623  C CD2  . LEU A 1 43  ? -1.128  14.253  10.609  1.00 0.00 ? 94  LEU A CD2  3  
ATOM 4624  H H    . LEU A 1 43  ? -1.669  14.748  7.090   1.00 0.00 ? 94  LEU A H    3  
ATOM 4625  H HA   . LEU A 1 43  ? -2.920  15.833  9.548   1.00 0.00 ? 94  LEU A HA   3  
ATOM 4626  H HB2  . LEU A 1 43  ? -0.299  16.628  8.241   1.00 0.00 ? 94  LEU A HB2  3  
ATOM 4627  H HB3  . LEU A 1 43  ? -0.794  16.932  9.908   1.00 0.00 ? 94  LEU A HB3  3  
ATOM 4628  H HG   . LEU A 1 43  ? -0.273  14.226  8.642   1.00 0.00 ? 94  LEU A HG   3  
ATOM 4629  H HD11 . LEU A 1 43  ? 1.676   15.805  9.370   1.00 0.00 ? 94  LEU A HD11 3  
ATOM 4630  H HD12 . LEU A 1 43  ? 1.177   15.401  11.011  1.00 0.00 ? 94  LEU A HD12 3  
ATOM 4631  H HD13 . LEU A 1 43  ? 1.697   14.120  9.903   1.00 0.00 ? 94  LEU A HD13 3  
ATOM 4632  H HD21 . LEU A 1 43  ? -1.460  15.016  11.297  1.00 0.00 ? 94  LEU A HD21 3  
ATOM 4633  H HD22 . LEU A 1 43  ? -1.989  13.777  10.165  1.00 0.00 ? 94  LEU A HD22 3  
ATOM 4634  H HD23 . LEU A 1 43  ? -0.545  13.515  11.141  1.00 0.00 ? 94  LEU A HD23 3  
ATOM 4635  N N    . GLY A 1 44  ? -3.339  17.173  6.804   1.00 0.00 ? 95  GLY A N    3  
ATOM 4636  C CA   . GLY A 1 44  ? -3.869  18.346  6.055   1.00 0.00 ? 95  GLY A CA   3  
ATOM 4637  C C    . GLY A 1 44  ? -5.343  18.516  6.375   1.00 0.00 ? 95  GLY A C    3  
ATOM 4638  O O    . GLY A 1 44  ? -5.907  17.776  7.153   1.00 0.00 ? 95  GLY A O    3  
ATOM 4639  H H    . GLY A 1 44  ? -3.369  16.286  6.399   1.00 0.00 ? 95  GLY A H    3  
ATOM 4640  H HA2  . GLY A 1 44  ? -3.329  19.237  6.335   1.00 0.00 ? 95  GLY A HA2  3  
ATOM 4641  H HA3  . GLY A 1 44  ? -3.761  18.173  4.996   1.00 0.00 ? 95  GLY A HA3  3  
ATOM 4642  N N    . ASP A 1 45  ? -5.977  19.482  5.781   1.00 0.00 ? 96  ASP A N    3  
ATOM 4643  C CA   . ASP A 1 45  ? -7.422  19.691  6.049   1.00 0.00 ? 96  ASP A CA   3  
ATOM 4644  C C    . ASP A 1 45  ? -8.215  18.750  5.150   1.00 0.00 ? 96  ASP A C    3  
ATOM 4645  O O    . ASP A 1 45  ? -8.275  18.933  3.956   1.00 0.00 ? 96  ASP A O    3  
ATOM 4646  C CB   . ASP A 1 45  ? -7.787  21.145  5.732   1.00 0.00 ? 96  ASP A CB   3  
ATOM 4647  C CG   . ASP A 1 45  ? -9.273  21.388  6.010   1.00 0.00 ? 96  ASP A CG   3  
ATOM 4648  O OD1  . ASP A 1 45  ? -9.953  20.447  6.380   1.00 0.00 ? 96  ASP A OD1  3  
ATOM 4649  O OD2  . ASP A 1 45  ? -9.705  22.517  5.847   1.00 0.00 ? 96  ASP A OD2  3  
ATOM 4650  H H    . ASP A 1 45  ? -5.502  20.066  5.151   1.00 0.00 ? 96  ASP A H    3  
ATOM 4651  H HA   . ASP A 1 45  ? -7.637  19.477  7.086   1.00 0.00 ? 96  ASP A HA   3  
ATOM 4652  H HB2  . ASP A 1 45  ? -7.195  21.807  6.346   1.00 0.00 ? 96  ASP A HB2  3  
ATOM 4653  H HB3  . ASP A 1 45  ? -7.580  21.347  4.693   1.00 0.00 ? 96  ASP A HB3  3  
ATOM 4654  N N    . VAL A 1 46  ? -8.826  17.743  5.703   1.00 0.00 ? 97  VAL A N    3  
ATOM 4655  C CA   . VAL A 1 46  ? -9.604  16.805  4.845   1.00 0.00 ? 97  VAL A CA   3  
ATOM 4656  C C    . VAL A 1 46  ? -10.514 15.914  5.713   1.00 0.00 ? 97  VAL A C    3  
ATOM 4657  O O    . VAL A 1 46  ? -10.606 14.727  5.502   1.00 0.00 ? 97  VAL A O    3  
ATOM 4658  C CB   . VAL A 1 46  ? -8.623  15.928  4.036   1.00 0.00 ? 97  VAL A CB   3  
ATOM 4659  C CG1  . VAL A 1 46  ? -7.752  15.109  4.997   1.00 0.00 ? 97  VAL A CG1  3  
ATOM 4660  C CG2  . VAL A 1 46  ? -9.393  14.979  3.083   1.00 0.00 ? 97  VAL A CG2  3  
ATOM 4661  H H    . VAL A 1 46  ? -8.769  17.599  6.671   1.00 0.00 ? 97  VAL A H    3  
ATOM 4662  H HA   . VAL A 1 46  ? -10.208 17.381  4.164   1.00 0.00 ? 97  VAL A HA   3  
ATOM 4663  H HB   . VAL A 1 46  ? -7.980  16.575  3.452   1.00 0.00 ? 97  VAL A HB   3  
ATOM 4664  H HG11 . VAL A 1 46  ? -7.364  15.757  5.768   1.00 0.00 ? 97  VAL A HG11 3  
ATOM 4665  H HG12 . VAL A 1 46  ? -8.339  14.325  5.444   1.00 0.00 ? 97  VAL A HG12 3  
ATOM 4666  H HG13 . VAL A 1 46  ? -6.934  14.666  4.448   1.00 0.00 ? 97  VAL A HG13 3  
ATOM 4667  H HG21 . VAL A 1 46  ? -10.329 15.432  2.791   1.00 0.00 ? 97  VAL A HG21 3  
ATOM 4668  H HG22 . VAL A 1 46  ? -8.795  14.798  2.199   1.00 0.00 ? 97  VAL A HG22 3  
ATOM 4669  H HG23 . VAL A 1 46  ? -9.591  14.038  3.572   1.00 0.00 ? 97  VAL A HG23 3  
ATOM 4670  N N    . PRO A 1 47  ? -11.194 16.469  6.682   1.00 0.00 ? 98  PRO A N    3  
ATOM 4671  C CA   . PRO A 1 47  ? -12.098 15.668  7.560   1.00 0.00 ? 98  PRO A CA   3  
ATOM 4672  C C    . PRO A 1 47  ? -13.364 15.204  6.823   1.00 0.00 ? 98  PRO A C    3  
ATOM 4673  O O    . PRO A 1 47  ? -14.070 14.324  7.272   1.00 0.00 ? 98  PRO A O    3  
ATOM 4674  C CB   . PRO A 1 47  ? -12.449 16.642  8.693   1.00 0.00 ? 98  PRO A CB   3  
ATOM 4675  C CG   . PRO A 1 47  ? -12.359 17.987  8.050   1.00 0.00 ? 98  PRO A CG   3  
ATOM 4676  C CD   . PRO A 1 47  ? -11.200 17.896  7.054   1.00 0.00 ? 98  PRO A CD   3  
ATOM 4677  H HA   . PRO A 1 47  ? -11.567 14.817  7.955   1.00 0.00 ? 98  PRO A HA   3  
ATOM 4678  H HB2  . PRO A 1 47  ? -13.446 16.458  9.062   1.00 0.00 ? 98  PRO A HB2  3  
ATOM 4679  H HB3  . PRO A 1 47  ? -11.735 16.564  9.497   1.00 0.00 ? 98  PRO A HB3  3  
ATOM 4680  H HG2  . PRO A 1 47  ? -13.283 18.209  7.529   1.00 0.00 ? 98  PRO A HG2  3  
ATOM 4681  H HG3  . PRO A 1 47  ? -12.151 18.747  8.788   1.00 0.00 ? 98  PRO A HG3  3  
ATOM 4682  H HD2  . PRO A 1 47  ? -11.386 18.522  6.193   1.00 0.00 ? 98  PRO A HD2  3  
ATOM 4683  H HD3  . PRO A 1 47  ? -10.272 18.166  7.531   1.00 0.00 ? 98  PRO A HD3  3  
ATOM 4684  N N    . ASP A 1 48  ? -13.663 15.788  5.700   1.00 0.00 ? 99  ASP A N    3  
ATOM 4685  C CA   . ASP A 1 48  ? -14.886 15.376  4.958   1.00 0.00 ? 99  ASP A CA   3  
ATOM 4686  C C    . ASP A 1 48  ? -14.677 14.010  4.312   1.00 0.00 ? 99  ASP A C    3  
ATOM 4687  O O    . ASP A 1 48  ? -13.592 13.470  4.309   1.00 0.00 ? 99  ASP A O    3  
ATOM 4688  C CB   . ASP A 1 48  ? -15.182 16.399  3.865   1.00 0.00 ? 99  ASP A CB   3  
ATOM 4689  C CG   . ASP A 1 48  ? -13.991 16.478  2.906   1.00 0.00 ? 99  ASP A CG   3  
ATOM 4690  O OD1  . ASP A 1 48  ? -13.028 15.758  3.130   1.00 0.00 ? 99  ASP A OD1  3  
ATOM 4691  O OD2  . ASP A 1 48  ? -14.059 17.264  1.975   1.00 0.00 ? 99  ASP A OD2  3  
ATOM 4692  H H    . ASP A 1 48  ? -13.088 16.501  5.345   1.00 0.00 ? 99  ASP A H    3  
ATOM 4693  H HA   . ASP A 1 48  ? -15.721 15.331  5.639   1.00 0.00 ? 99  ASP A HA   3  
ATOM 4694  H HB2  . ASP A 1 48  ? -16.064 16.087  3.312   1.00 0.00 ? 99  ASP A HB2  3  
ATOM 4695  H HB3  . ASP A 1 48  ? -15.355 17.368  4.310   1.00 0.00 ? 99  ASP A HB3  3  
ATOM 4696  N N    . GLY A 1 49  ? -15.715 13.458  3.748   1.00 0.00 ? 100 GLY A N    3  
ATOM 4697  C CA   . GLY A 1 49  ? -15.589 12.142  3.077   1.00 0.00 ? 100 GLY A CA   3  
ATOM 4698  C C    . GLY A 1 49  ? -15.103 12.379  1.644   1.00 0.00 ? 100 GLY A C    3  
ATOM 4699  O O    . GLY A 1 49  ? -15.793 12.975  0.844   1.00 0.00 ? 100 GLY A O    3  
ATOM 4700  H H    . GLY A 1 49  ? -16.576 13.921  3.758   1.00 0.00 ? 100 GLY A H    3  
ATOM 4701  H HA2  . GLY A 1 49  ? -14.886 11.529  3.609   1.00 0.00 ? 100 GLY A HA2  3  
ATOM 4702  H HA3  . GLY A 1 49  ? -16.551 11.651  3.053   1.00 0.00 ? 100 GLY A HA3  3  
ATOM 4703  N N    . THR A 1 50  ? -13.915 11.925  1.325   1.00 0.00 ? 101 THR A N    3  
ATOM 4704  C CA   . THR A 1 50  ? -13.354 12.117  -0.059  1.00 0.00 ? 101 THR A CA   3  
ATOM 4705  C C    . THR A 1 50  ? -13.038 10.739  -0.651  1.00 0.00 ? 101 THR A C    3  
ATOM 4706  O O    . THR A 1 50  ? -13.367 9.727   -0.067  1.00 0.00 ? 101 THR A O    3  
ATOM 4707  C CB   . THR A 1 50  ? -12.079 12.967  0.002   1.00 0.00 ? 101 THR A CB   3  
ATOM 4708  O OG1  . THR A 1 50  ? -11.359 12.841  -1.217  1.00 0.00 ? 101 THR A OG1  3  
ATOM 4709  C CG2  . THR A 1 50  ? -11.210 12.497  1.164   1.00 0.00 ? 101 THR A CG2  3  
ATOM 4710  H H    . THR A 1 50  ? -13.381 11.448  2.005   1.00 0.00 ? 101 THR A H    3  
ATOM 4711  H HA   . THR A 1 50  ? -14.083 12.614  -0.690  1.00 0.00 ? 101 THR A HA   3  
ATOM 4712  H HB   . THR A 1 50  ? -12.342 14.002  0.155   1.00 0.00 ? 101 THR A HB   3  
ATOM 4713  H HG1  . THR A 1 50  ? -10.480 12.510  -1.010  1.00 0.00 ? 101 THR A HG1  3  
ATOM 4714  H HG21 . THR A 1 50  ? -10.990 11.450  1.046   1.00 0.00 ? 101 THR A HG21 3  
ATOM 4715  H HG22 . THR A 1 50  ? -10.287 13.061  1.175   1.00 0.00 ? 101 THR A HG22 3  
ATOM 4716  H HG23 . THR A 1 50  ? -11.740 12.648  2.091   1.00 0.00 ? 101 THR A HG23 3  
ATOM 4717  N N    . LEU A 1 51  ? -12.421 10.691  -1.811  1.00 0.00 ? 102 LEU A N    3  
ATOM 4718  C CA   . LEU A 1 51  ? -12.094 9.378   -2.468  1.00 0.00 ? 102 LEU A CA   3  
ATOM 4719  C C    . LEU A 1 51  ? -10.568 9.211   -2.533  1.00 0.00 ? 102 LEU A C    3  
ATOM 4720  O O    . LEU A 1 51  ? -9.841  10.133  -2.847  1.00 0.00 ? 102 LEU A O    3  
ATOM 4721  C CB   . LEU A 1 51  ? -12.655 9.380   -3.910  1.00 0.00 ? 102 LEU A CB   3  
ATOM 4722  C CG   . LEU A 1 51  ? -14.138 8.958   -3.953  1.00 0.00 ? 102 LEU A CG   3  
ATOM 4723  C CD1  . LEU A 1 51  ? -14.267 7.433   -3.817  1.00 0.00 ? 102 LEU A CD1  3  
ATOM 4724  C CD2  . LEU A 1 51  ? -14.921 9.647   -2.830  1.00 0.00 ? 102 LEU A CD2  3  
ATOM 4725  H H    . LEU A 1 51  ? -12.181 11.525  -2.265  1.00 0.00 ? 102 LEU A H    3  
ATOM 4726  H HA   . LEU A 1 51  ? -12.517 8.557   -1.916  1.00 0.00 ? 102 LEU A HA   3  
ATOM 4727  H HB2  . LEU A 1 51  ? -12.568 10.378  -4.312  1.00 0.00 ? 102 LEU A HB2  3  
ATOM 4728  H HB3  . LEU A 1 51  ? -12.074 8.705   -4.527  1.00 0.00 ? 102 LEU A HB3  3  
ATOM 4729  H HG   . LEU A 1 51  ? -14.553 9.256   -4.908  1.00 0.00 ? 102 LEU A HG   3  
ATOM 4730  H HD11 . LEU A 1 51  ? -13.522 6.945   -4.429  1.00 0.00 ? 102 LEU A HD11 3  
ATOM 4731  H HD12 . LEU A 1 51  ? -14.125 7.145   -2.789  1.00 0.00 ? 102 LEU A HD12 3  
ATOM 4732  H HD13 . LEU A 1 51  ? -15.251 7.125   -4.142  1.00 0.00 ? 102 LEU A HD13 3  
ATOM 4733  H HD21 . LEU A 1 51  ? -14.607 10.675  -2.747  1.00 0.00 ? 102 LEU A HD21 3  
ATOM 4734  H HD22 . LEU A 1 51  ? -15.972 9.617   -3.060  1.00 0.00 ? 102 LEU A HD22 3  
ATOM 4735  H HD23 . LEU A 1 51  ? -14.747 9.135   -1.895  1.00 0.00 ? 102 LEU A HD23 3  
ATOM 4736  N N    . VAL A 1 52  ? -10.084 8.025   -2.258  1.00 0.00 ? 103 VAL A N    3  
ATOM 4737  C CA   . VAL A 1 52  ? -8.612  7.759   -2.307  1.00 0.00 ? 103 VAL A CA   3  
ATOM 4738  C C    . VAL A 1 52  ? -8.351  6.694   -3.365  1.00 0.00 ? 103 VAL A C    3  
ATOM 4739  O O    . VAL A 1 52  ? -9.042  5.704   -3.423  1.00 0.00 ? 103 VAL A O    3  
ATOM 4740  C CB   . VAL A 1 52  ? -8.165  7.229   -0.947  1.00 0.00 ? 103 VAL A CB   3  
ATOM 4741  C CG1  . VAL A 1 52  ? -6.639  7.124   -0.905  1.00 0.00 ? 103 VAL A CG1  3  
ATOM 4742  C CG2  . VAL A 1 52  ? -8.656  8.184   0.143   1.00 0.00 ? 103 VAL A CG2  3  
ATOM 4743  H H    . VAL A 1 52  ? -10.695 7.291   -2.020  1.00 0.00 ? 103 VAL A H    3  
ATOM 4744  H HA   . VAL A 1 52  ? -8.064  8.660   -2.549  1.00 0.00 ? 103 VAL A HA   3  
ATOM 4745  H HB   . VAL A 1 52  ? -8.597  6.249   -0.789  1.00 0.00 ? 103 VAL A HB   3  
ATOM 4746  H HG11 . VAL A 1 52  ? -6.204  8.084   -1.119  1.00 0.00 ? 103 VAL A HG11 3  
ATOM 4747  H HG12 . VAL A 1 52  ? -6.328  6.806   0.074   1.00 0.00 ? 103 VAL A HG12 3  
ATOM 4748  H HG13 . VAL A 1 52  ? -6.306  6.407   -1.643  1.00 0.00 ? 103 VAL A HG13 3  
ATOM 4749  H HG21 . VAL A 1 52  ? -8.460  9.203   -0.155  1.00 0.00 ? 103 VAL A HG21 3  
ATOM 4750  H HG22 . VAL A 1 52  ? -9.720  8.047   0.287   1.00 0.00 ? 103 VAL A HG22 3  
ATOM 4751  H HG23 . VAL A 1 52  ? -8.136  7.975   1.063   1.00 0.00 ? 103 VAL A HG23 3  
ATOM 4752  N N    . THR A 1 53  ? -7.371  6.887   -4.217  1.00 0.00 ? 104 THR A N    3  
ATOM 4753  C CA   . THR A 1 53  ? -7.089  5.865   -5.282  1.00 0.00 ? 104 THR A CA   3  
ATOM 4754  C C    . THR A 1 53  ? -5.614  5.476   -5.217  1.00 0.00 ? 104 THR A C    3  
ATOM 4755  O O    . THR A 1 53  ? -4.777  6.265   -4.845  1.00 0.00 ? 104 THR A O    3  
ATOM 4756  C CB   . THR A 1 53  ? -7.392  6.454   -6.671  1.00 0.00 ? 104 THR A CB   3  
ATOM 4757  O OG1  . THR A 1 53  ? -6.416  7.434   -6.996  1.00 0.00 ? 104 THR A OG1  3  
ATOM 4758  C CG2  . THR A 1 53  ? -8.782  7.103   -6.687  1.00 0.00 ? 104 THR A CG2  3  
ATOM 4759  H H    . THR A 1 53  ? -6.821  7.699   -4.158  1.00 0.00 ? 104 THR A H    3  
ATOM 4760  H HA   . THR A 1 53  ? -7.696  4.982   -5.124  1.00 0.00 ? 104 THR A HA   3  
ATOM 4761  H HB   . THR A 1 53  ? -7.361  5.666   -7.405  1.00 0.00 ? 104 THR A HB   3  
ATOM 4762  H HG1  . THR A 1 53  ? -5.842  7.072   -7.675  1.00 0.00 ? 104 THR A HG1  3  
ATOM 4763  H HG21 . THR A 1 53  ? -8.909  7.723   -5.810  1.00 0.00 ? 104 THR A HG21 3  
ATOM 4764  H HG22 . THR A 1 53  ? -8.884  7.714   -7.570  1.00 0.00 ? 104 THR A HG22 3  
ATOM 4765  H HG23 . THR A 1 53  ? -9.539  6.333   -6.698  1.00 0.00 ? 104 THR A HG23 3  
ATOM 4766  N N    . VAL A 1 54  ? -5.286  4.260   -5.576  1.00 0.00 ? 105 VAL A N    3  
ATOM 4767  C CA   . VAL A 1 54  ? -3.857  3.823   -5.538  1.00 0.00 ? 105 VAL A CA   3  
ATOM 4768  C C    . VAL A 1 54  ? -3.572  2.806   -6.644  1.00 0.00 ? 105 VAL A C    3  
ATOM 4769  O O    . VAL A 1 54  ? -4.443  2.091   -7.097  1.00 0.00 ? 105 VAL A O    3  
ATOM 4770  C CB   . VAL A 1 54  ? -3.530  3.217   -4.167  1.00 0.00 ? 105 VAL A CB   3  
ATOM 4771  C CG1  . VAL A 1 54  ? -4.542  2.125   -3.826  1.00 0.00 ? 105 VAL A CG1  3  
ATOM 4772  C CG2  . VAL A 1 54  ? -2.121  2.612   -4.200  1.00 0.00 ? 105 VAL A CG2  3  
ATOM 4773  H H    . VAL A 1 54  ? -5.978  3.639   -5.871  1.00 0.00 ? 105 VAL A H    3  
ATOM 4774  H HA   . VAL A 1 54  ? -3.225  4.680   -5.695  1.00 0.00 ? 105 VAL A HA   3  
ATOM 4775  H HB   . VAL A 1 54  ? -3.573  3.989   -3.416  1.00 0.00 ? 105 VAL A HB   3  
ATOM 4776  H HG11 . VAL A 1 54  ? -4.689  1.498   -4.686  1.00 0.00 ? 105 VAL A HG11 3  
ATOM 4777  H HG12 . VAL A 1 54  ? -4.167  1.529   -3.007  1.00 0.00 ? 105 VAL A HG12 3  
ATOM 4778  H HG13 . VAL A 1 54  ? -5.479  2.578   -3.539  1.00 0.00 ? 105 VAL A HG13 3  
ATOM 4779  H HG21 . VAL A 1 54  ? -1.437  3.321   -4.647  1.00 0.00 ? 105 VAL A HG21 3  
ATOM 4780  H HG22 . VAL A 1 54  ? -1.800  2.385   -3.194  1.00 0.00 ? 105 VAL A HG22 3  
ATOM 4781  H HG23 . VAL A 1 54  ? -2.133  1.704   -4.783  1.00 0.00 ? 105 VAL A HG23 3  
ATOM 4782  N N    . MET A 1 55  ? -2.331  2.749   -7.062  1.00 0.00 ? 106 MET A N    3  
ATOM 4783  C CA   . MET A 1 55  ? -1.904  1.791   -8.127  1.00 0.00 ? 106 MET A CA   3  
ATOM 4784  C C    . MET A 1 55  ? -0.516  1.255   -7.767  1.00 0.00 ? 106 MET A C    3  
ATOM 4785  O O    . MET A 1 55  ? 0.116   1.752   -6.855  1.00 0.00 ? 106 MET A O    3  
ATOM 4786  C CB   . MET A 1 55  ? -1.862  2.510   -9.478  1.00 0.00 ? 106 MET A CB   3  
ATOM 4787  C CG   . MET A 1 55  ? -0.808  3.618   -9.465  1.00 0.00 ? 106 MET A CG   3  
ATOM 4788  S SD   . MET A 1 55  ? -1.055  4.680   -10.915 1.00 0.00 ? 106 MET A SD   3  
ATOM 4789  C CE   . MET A 1 55  ? -2.563  5.535   -10.376 1.00 0.00 ? 106 MET A CE   3  
ATOM 4790  H H    . MET A 1 55  ? -1.666  3.345   -6.656  1.00 0.00 ? 106 MET A H    3  
ATOM 4791  H HA   . MET A 1 55  ? -2.600  0.968   -8.179  1.00 0.00 ? 106 MET A HA   3  
ATOM 4792  H HB2  . MET A 1 55  ? -1.613  1.796   -10.250 1.00 0.00 ? 106 MET A HB2  3  
ATOM 4793  H HB3  . MET A 1 55  ? -2.834  2.944   -9.682  1.00 0.00 ? 106 MET A HB3  3  
ATOM 4794  H HG2  . MET A 1 55  ? -0.898  4.200   -8.562  1.00 0.00 ? 106 MET A HG2  3  
ATOM 4795  H HG3  . MET A 1 55  ? 0.178   3.180   -9.508  1.00 0.00 ? 106 MET A HG3  3  
ATOM 4796  H HE1  . MET A 1 55  ? -2.679  5.434   -9.307  1.00 0.00 ? 106 MET A HE1  3  
ATOM 4797  H HE2  . MET A 1 55  ? -2.489  6.585   -10.636 1.00 0.00 ? 106 MET A HE2  3  
ATOM 4798  H HE3  . MET A 1 55  ? -3.422  5.104   -10.866 1.00 0.00 ? 106 MET A HE3  3  
ATOM 4799  N N    . ALA A 1 56  ? -0.034  0.236   -8.440  1.00 0.00 ? 107 ALA A N    3  
ATOM 4800  C CA   . ALA A 1 56  ? 1.308   -0.318  -8.069  1.00 0.00 ? 107 ALA A CA   3  
ATOM 4801  C C    . ALA A 1 56  ? 2.017   -0.966  -9.271  1.00 0.00 ? 107 ALA A C    3  
ATOM 4802  O O    . ALA A 1 56  ? 2.623   -2.009  -9.147  1.00 0.00 ? 107 ALA A O    3  
ATOM 4803  C CB   . ALA A 1 56  ? 1.098   -1.371  -6.975  1.00 0.00 ? 107 ALA A CB   3  
ATOM 4804  H H    . ALA A 1 56  ? -0.557  -0.169  -9.163  1.00 0.00 ? 107 ALA A H    3  
ATOM 4805  H HA   . ALA A 1 56  ? 1.925   0.471   -7.683  1.00 0.00 ? 107 ALA A HA   3  
ATOM 4806  H HB1  . ALA A 1 56  ? 0.229   -1.107  -6.394  1.00 0.00 ? 107 ALA A HB1  3  
ATOM 4807  H HB2  . ALA A 1 56  ? 0.945   -2.345  -7.424  1.00 0.00 ? 107 ALA A HB2  3  
ATOM 4808  H HB3  . ALA A 1 56  ? 1.963   -1.403  -6.333  1.00 0.00 ? 107 ALA A HB3  3  
ATOM 4809  N N    . GLY A 1 57  ? 1.954   -0.371  -10.423 1.00 0.00 ? 108 GLY A N    3  
ATOM 4810  C CA   . GLY A 1 57  ? 2.634   -0.961  -11.617 1.00 0.00 ? 108 GLY A CA   3  
ATOM 4811  C C    . GLY A 1 57  ? 4.081   -0.466  -11.716 1.00 0.00 ? 108 GLY A C    3  
ATOM 4812  O O    . GLY A 1 57  ? 4.454   0.509   -11.100 1.00 0.00 ? 108 GLY A O    3  
ATOM 4813  H H    . GLY A 1 57  ? 1.478   0.471   -10.502 1.00 0.00 ? 108 GLY A H    3  
ATOM 4814  H HA2  . GLY A 1 57  ? 2.630   -2.036  -11.543 1.00 0.00 ? 108 GLY A HA2  3  
ATOM 4815  H HA3  . GLY A 1 57  ? 2.102   -0.671  -12.504 1.00 0.00 ? 108 GLY A HA3  3  
ATOM 4816  N N    . ASN A 1 58  ? 4.887   -1.103  -12.529 1.00 0.00 ? 109 ASN A N    3  
ATOM 4817  C CA   . ASN A 1 58  ? 6.293   -0.637  -12.727 1.00 0.00 ? 109 ASN A CA   3  
ATOM 4818  C C    . ASN A 1 58  ? 6.287   0.558   -13.698 1.00 0.00 ? 109 ASN A C    3  
ATOM 4819  O O    . ASN A 1 58  ? 5.313   0.804   -14.382 1.00 0.00 ? 109 ASN A O    3  
ATOM 4820  C CB   . ASN A 1 58  ? 7.143   -1.769  -13.311 1.00 0.00 ? 109 ASN A CB   3  
ATOM 4821  C CG   . ASN A 1 58  ? 7.259   -2.915  -12.307 1.00 0.00 ? 109 ASN A CG   3  
ATOM 4822  O OD1  . ASN A 1 58  ? 7.838   -2.758  -11.256 1.00 0.00 ? 109 ASN A OD1  3  
ATOM 4823  N ND2  . ASN A 1 58  ? 6.724   -4.067  -12.578 1.00 0.00 ? 109 ASN A ND2  3  
ATOM 4824  H H    . ASN A 1 58  ? 4.553   -1.863  -13.043 1.00 0.00 ? 109 ASN A H    3  
ATOM 4825  H HA   . ASN A 1 58  ? 6.706   -0.322  -11.778 1.00 0.00 ? 109 ASN A HA   3  
ATOM 4826  H HB2  . ASN A 1 58  ? 6.686   -2.127  -14.217 1.00 0.00 ? 109 ASN A HB2  3  
ATOM 4827  H HB3  . ASN A 1 58  ? 8.130   -1.396  -13.532 1.00 0.00 ? 109 ASN A HB3  3  
ATOM 4828  H HD21 . ASN A 1 58  ? 6.244   -4.200  -13.423 1.00 0.00 ? 109 ASN A HD21 3  
ATOM 4829  H HD22 . ASN A 1 58  ? 6.812   -4.809  -11.939 1.00 0.00 ? 109 ASN A HD22 3  
ATOM 4830  N N    . ASP A 1 59  ? 7.361   1.308   -13.757 1.00 0.00 ? 110 ASP A N    3  
ATOM 4831  C CA   . ASP A 1 59  ? 7.421   2.491   -14.677 1.00 0.00 ? 110 ASP A CA   3  
ATOM 4832  C C    . ASP A 1 59  ? 7.259   2.067   -16.144 1.00 0.00 ? 110 ASP A C    3  
ATOM 4833  O O    . ASP A 1 59  ? 6.612   2.741   -16.920 1.00 0.00 ? 110 ASP A O    3  
ATOM 4834  C CB   . ASP A 1 59  ? 8.783   3.183   -14.519 1.00 0.00 ? 110 ASP A CB   3  
ATOM 4835  C CG   . ASP A 1 59  ? 8.858   3.864   -13.152 1.00 0.00 ? 110 ASP A CG   3  
ATOM 4836  O OD1  . ASP A 1 59  ? 8.844   3.161   -12.163 1.00 0.00 ? 110 ASP A OD1  3  
ATOM 4837  O OD2  . ASP A 1 59  ? 8.938   5.081   -13.122 1.00 0.00 ? 110 ASP A OD2  3  
ATOM 4838  H H    . ASP A 1 59  ? 8.132   1.095   -13.193 1.00 0.00 ? 110 ASP A H    3  
ATOM 4839  H HA   . ASP A 1 59  ? 6.640   3.191   -14.421 1.00 0.00 ? 110 ASP A HA   3  
ATOM 4840  H HB2  . ASP A 1 59  ? 9.571   2.445   -14.597 1.00 0.00 ? 110 ASP A HB2  3  
ATOM 4841  H HB3  . ASP A 1 59  ? 8.904   3.925   -15.295 1.00 0.00 ? 110 ASP A HB3  3  
ATOM 4842  N N    . GLU A 1 60  ? 7.862   0.974   -16.545 1.00 0.00 ? 111 GLU A N    3  
ATOM 4843  C CA   . GLU A 1 60  ? 7.758   0.543   -17.980 1.00 0.00 ? 111 GLU A CA   3  
ATOM 4844  C C    . GLU A 1 60  ? 6.562   -0.384  -18.199 1.00 0.00 ? 111 GLU A C    3  
ATOM 4845  O O    . GLU A 1 60  ? 6.350   -0.863  -19.297 1.00 0.00 ? 111 GLU A O    3  
ATOM 4846  C CB   . GLU A 1 60  ? 9.033   -0.191  -18.385 1.00 0.00 ? 111 GLU A CB   3  
ATOM 4847  C CG   . GLU A 1 60  ? 9.180   -1.455  -17.537 1.00 0.00 ? 111 GLU A CG   3  
ATOM 4848  C CD   . GLU A 1 60  ? 10.568  -2.061  -17.758 1.00 0.00 ? 111 GLU A CD   3  
ATOM 4849  O OE1  . GLU A 1 60  ? 10.825  -2.525  -18.857 1.00 0.00 ? 111 GLU A OE1  3  
ATOM 4850  O OE2  . GLU A 1 60  ? 11.353  -2.041  -16.829 1.00 0.00 ? 111 GLU A OE2  3  
ATOM 4851  H H    . GLU A 1 60  ? 8.399   0.452   -15.916 1.00 0.00 ? 111 GLU A H    3  
ATOM 4852  H HA   . GLU A 1 60  ? 7.644   1.416   -18.608 1.00 0.00 ? 111 GLU A HA   3  
ATOM 4853  H HB2  . GLU A 1 60  ? 8.971   -0.465  -19.432 1.00 0.00 ? 111 GLU A HB2  3  
ATOM 4854  H HB3  . GLU A 1 60  ? 9.884   0.453   -18.218 1.00 0.00 ? 111 GLU A HB3  3  
ATOM 4855  H HG2  . GLU A 1 60  ? 9.065   -1.197  -16.495 1.00 0.00 ? 111 GLU A HG2  3  
ATOM 4856  H HG3  . GLU A 1 60  ? 8.424   -2.172  -17.818 1.00 0.00 ? 111 GLU A HG3  3  
ATOM 4857  N N    . ASN A 1 61  ? 5.774   -0.630  -17.189 1.00 0.00 ? 112 ASN A N    3  
ATOM 4858  C CA   . ASN A 1 61  ? 4.586   -1.514  -17.351 1.00 0.00 ? 112 ASN A CA   3  
ATOM 4859  C C    . ASN A 1 61  ? 3.330   -0.702  -17.102 1.00 0.00 ? 112 ASN A C    3  
ATOM 4860  O O    . ASN A 1 61  ? 3.376   0.456   -16.748 1.00 0.00 ? 112 ASN A O    3  
ATOM 4861  C CB   . ASN A 1 61  ? 4.626   -2.658  -16.338 1.00 0.00 ? 112 ASN A CB   3  
ATOM 4862  C CG   . ASN A 1 61  ? 5.882   -3.500  -16.540 1.00 0.00 ? 112 ASN A CG   3  
ATOM 4863  O OD1  . ASN A 1 61  ? 6.466   -3.504  -17.609 1.00 0.00 ? 112 ASN A OD1  3  
ATOM 4864  N ND2  . ASN A 1 61  ? 6.327   -4.214  -15.546 1.00 0.00 ? 112 ASN A ND2  3  
ATOM 4865  H H    . ASN A 1 61  ? 5.949   -0.221  -16.321 1.00 0.00 ? 112 ASN A H    3  
ATOM 4866  H HA   . ASN A 1 61  ? 4.550   -1.922  -18.350 1.00 0.00 ? 112 ASN A HA   3  
ATOM 4867  H HB2  . ASN A 1 61  ? 4.621   -2.252  -15.336 1.00 0.00 ? 112 ASN A HB2  3  
ATOM 4868  H HB3  . ASN A 1 61  ? 3.757   -3.285  -16.474 1.00 0.00 ? 112 ASN A HB3  3  
ATOM 4869  H HD21 . ASN A 1 61  ? 5.858   -4.200  -14.687 1.00 0.00 ? 112 ASN A HD21 3  
ATOM 4870  H HD22 . ASN A 1 61  ? 7.131   -4.759  -15.652 1.00 0.00 ? 112 ASN A HD22 3  
ATOM 4871  N N    . TYR A 1 62  ? 2.213   -1.328  -17.272 1.00 0.00 ? 113 TYR A N    3  
ATOM 4872  C CA   . TYR A 1 62  ? 0.916   -0.643  -17.046 1.00 0.00 ? 113 TYR A CA   3  
ATOM 4873  C C    . TYR A 1 62  ? 0.771   -0.323  -15.565 1.00 0.00 ? 113 TYR A C    3  
ATOM 4874  O O    . TYR A 1 62  ? 1.525   -0.804  -14.749 1.00 0.00 ? 113 TYR A O    3  
ATOM 4875  C CB   . TYR A 1 62  ? -0.224  -1.593  -17.433 1.00 0.00 ? 113 TYR A CB   3  
ATOM 4876  C CG   . TYR A 1 62  ? 0.047   -2.968  -16.854 1.00 0.00 ? 113 TYR A CG   3  
ATOM 4877  C CD1  . TYR A 1 62  ? -0.122  -3.208  -15.480 1.00 0.00 ? 113 TYR A CD1  3  
ATOM 4878  C CD2  . TYR A 1 62  ? 0.470   -4.005  -17.690 1.00 0.00 ? 113 TYR A CD2  3  
ATOM 4879  C CE1  . TYR A 1 62  ? 0.131   -4.479  -14.952 1.00 0.00 ? 113 TYR A CE1  3  
ATOM 4880  C CE2  . TYR A 1 62  ? 0.719   -5.277  -17.160 1.00 0.00 ? 113 TYR A CE2  3  
ATOM 4881  C CZ   . TYR A 1 62  ? 0.551   -5.514  -15.790 1.00 0.00 ? 113 TYR A CZ   3  
ATOM 4882  O OH   . TYR A 1 62  ? 0.801   -6.768  -15.272 1.00 0.00 ? 113 TYR A OH   3  
ATOM 4883  H H    . TYR A 1 62  ? 2.229   -2.268  -17.550 1.00 0.00 ? 113 TYR A H    3  
ATOM 4884  H HA   . TYR A 1 62  ? 0.877   0.255   -17.633 1.00 0.00 ? 113 TYR A HA   3  
ATOM 4885  H HB2  . TYR A 1 62  ? -1.160  -1.225  -17.036 1.00 0.00 ? 113 TYR A HB2  3  
ATOM 4886  H HB3  . TYR A 1 62  ? -0.288  -1.665  -18.506 1.00 0.00 ? 113 TYR A HB3  3  
ATOM 4887  H HD1  . TYR A 1 62  ? -0.454  -2.421  -14.831 1.00 0.00 ? 113 TYR A HD1  3  
ATOM 4888  H HD2  . TYR A 1 62  ? 0.600   -3.829  -18.749 1.00 0.00 ? 113 TYR A HD2  3  
ATOM 4889  H HE1  . TYR A 1 62  ? 0.002   -4.660  -13.893 1.00 0.00 ? 113 TYR A HE1  3  
ATOM 4890  H HE2  . TYR A 1 62  ? 1.039   -6.074  -17.810 1.00 0.00 ? 113 TYR A HE2  3  
ATOM 4891  H HH   . TYR A 1 62  ? 0.728   -7.400  -15.991 1.00 0.00 ? 113 TYR A HH   3  
ATOM 4892  N N    . SER A 1 63  ? -0.220  0.441   -15.190 1.00 0.00 ? 114 SER A N    3  
ATOM 4893  C CA   . SER A 1 63  ? -0.398  0.705   -13.739 1.00 0.00 ? 114 SER A CA   3  
ATOM 4894  C C    . SER A 1 63  ? -1.025  -0.553  -13.151 1.00 0.00 ? 114 SER A C    3  
ATOM 4895  O O    . SER A 1 63  ? -2.034  -1.031  -13.635 1.00 0.00 ? 114 SER A O    3  
ATOM 4896  C CB   . SER A 1 63  ? -1.329  1.904   -13.506 1.00 0.00 ? 114 SER A CB   3  
ATOM 4897  O OG   . SER A 1 63  ? -2.681  1.458   -13.428 1.00 0.00 ? 114 SER A OG   3  
ATOM 4898  H H    . SER A 1 63  ? -0.855  0.800   -15.850 1.00 0.00 ? 114 SER A H    3  
ATOM 4899  H HA   . SER A 1 63  ? 0.561   0.886   -13.281 1.00 0.00 ? 114 SER A HA   3  
ATOM 4900  H HB2  . SER A 1 63  ? -1.068  2.387   -12.576 1.00 0.00 ? 114 SER A HB2  3  
ATOM 4901  H HB3  . SER A 1 63  ? -1.219  2.610   -14.320 1.00 0.00 ? 114 SER A HB3  3  
ATOM 4902  H HG   . SER A 1 63  ? -2.744  0.597   -13.847 1.00 0.00 ? 114 SER A HG   3  
ATOM 4903  N N    . ALA A 1 64  ? -0.439  -1.121  -12.136 1.00 0.00 ? 115 ALA A N    3  
ATOM 4904  C CA   . ALA A 1 64  ? -1.017  -2.370  -11.568 1.00 0.00 ? 115 ALA A CA   3  
ATOM 4905  C C    . ALA A 1 64  ? -2.501  -2.171  -11.320 1.00 0.00 ? 115 ALA A C    3  
ATOM 4906  O O    . ALA A 1 64  ? -2.994  -1.062  -11.318 1.00 0.00 ? 115 ALA A O    3  
ATOM 4907  C CB   . ALA A 1 64  ? -0.327  -2.731  -10.254 1.00 0.00 ? 115 ALA A CB   3  
ATOM 4908  H H    . ALA A 1 64  ? 0.384   -0.742  -11.764 1.00 0.00 ? 115 ALA A H    3  
ATOM 4909  H HA   . ALA A 1 64  ? -0.881  -3.179  -12.274 1.00 0.00 ? 115 ALA A HA   3  
ATOM 4910  H HB1  . ALA A 1 64  ? -0.385  -1.899  -9.575  1.00 0.00 ? 115 ALA A HB1  3  
ATOM 4911  H HB2  . ALA A 1 64  ? -0.816  -3.587  -9.814  1.00 0.00 ? 115 ALA A HB2  3  
ATOM 4912  H HB3  . ALA A 1 64  ? 0.705   -2.966  -10.450 1.00 0.00 ? 115 ALA A HB3  3  
ATOM 4913  N N    . GLU A 1 65  ? -3.217  -3.241  -11.114 1.00 0.00 ? 116 GLU A N    3  
ATOM 4914  C CA   . GLU A 1 65  ? -4.683  -3.132  -10.872 1.00 0.00 ? 116 GLU A CA   3  
ATOM 4915  C C    . GLU A 1 65  ? -4.969  -3.641  -9.457  1.00 0.00 ? 116 GLU A C    3  
ATOM 4916  O O    . GLU A 1 65  ? -4.698  -4.770  -9.121  1.00 0.00 ? 116 GLU A O    3  
ATOM 4917  C CB   . GLU A 1 65  ? -5.407  -3.985  -11.921 1.00 0.00 ? 116 GLU A CB   3  
ATOM 4918  C CG   . GLU A 1 65  ? -5.256  -3.333  -13.303 1.00 0.00 ? 116 GLU A CG   3  
ATOM 4919  C CD   . GLU A 1 65  ? -6.003  -4.156  -14.361 1.00 0.00 ? 116 GLU A CD   3  
ATOM 4920  O OE1  . GLU A 1 65  ? -6.694  -5.088  -13.986 1.00 0.00 ? 116 GLU A OE1  3  
ATOM 4921  O OE2  . GLU A 1 65  ? -5.884  -3.827  -15.529 1.00 0.00 ? 116 GLU A OE2  3  
ATOM 4922  H H    . GLU A 1 65  ? -2.786  -4.129  -11.127 1.00 0.00 ? 116 GLU A H    3  
ATOM 4923  H HA   . GLU A 1 65  ? -5.010  -2.101  -10.956 1.00 0.00 ? 116 GLU A HA   3  
ATOM 4924  H HB2  . GLU A 1 65  ? -4.958  -4.966  -11.952 1.00 0.00 ? 116 GLU A HB2  3  
ATOM 4925  H HB3  . GLU A 1 65  ? -6.448  -4.068  -11.669 1.00 0.00 ? 116 GLU A HB3  3  
ATOM 4926  H HG2  . GLU A 1 65  ? -5.661  -2.330  -13.273 1.00 0.00 ? 116 GLU A HG2  3  
ATOM 4927  H HG3  . GLU A 1 65  ? -4.211  -3.289  -13.567 1.00 0.00 ? 116 GLU A HG3  3  
ATOM 4928  N N    . LEU A 1 66  ? -5.472  -2.784  -8.614  1.00 0.00 ? 117 LEU A N    3  
ATOM 4929  C CA   . LEU A 1 66  ? -5.755  -3.162  -7.197  1.00 0.00 ? 117 LEU A CA   3  
ATOM 4930  C C    . LEU A 1 66  ? -7.263  -3.327  -6.995  1.00 0.00 ? 117 LEU A C    3  
ATOM 4931  O O    . LEU A 1 66  ? -8.059  -2.722  -7.682  1.00 0.00 ? 117 LEU A O    3  
ATOM 4932  C CB   . LEU A 1 66  ? -5.230  -2.047  -6.305  1.00 0.00 ? 117 LEU A CB   3  
ATOM 4933  C CG   . LEU A 1 66  ? -3.720  -1.875  -6.511  1.00 0.00 ? 117 LEU A CG   3  
ATOM 4934  C CD1  . LEU A 1 66  ? -3.227  -0.707  -5.644  1.00 0.00 ? 117 LEU A CD1  3  
ATOM 4935  C CD2  . LEU A 1 66  ? -2.980  -3.166  -6.111  1.00 0.00 ? 117 LEU A CD2  3  
ATOM 4936  H H    . LEU A 1 66  ? -5.645  -1.865  -8.904  1.00 0.00 ? 117 LEU A H    3  
ATOM 4937  H HA   . LEU A 1 66  ? -5.253  -4.090  -6.949  1.00 0.00 ? 117 LEU A HA   3  
ATOM 4938  H HB2  . LEU A 1 66  ? -5.727  -1.130  -6.580  1.00 0.00 ? 117 LEU A HB2  3  
ATOM 4939  H HB3  . LEU A 1 66  ? -5.424  -2.278  -5.270  1.00 0.00 ? 117 LEU A HB3  3  
ATOM 4940  H HG   . LEU A 1 66  ? -3.524  -1.658  -7.547  1.00 0.00 ? 117 LEU A HG   3  
ATOM 4941  H HD11 . LEU A 1 66  ? -3.713  -0.740  -4.676  1.00 0.00 ? 117 LEU A HD11 3  
ATOM 4942  H HD12 . LEU A 1 66  ? -2.156  -0.780  -5.508  1.00 0.00 ? 117 LEU A HD12 3  
ATOM 4943  H HD13 . LEU A 1 66  ? -3.464  0.224   -6.135  1.00 0.00 ? 117 LEU A HD13 3  
ATOM 4944  H HD21 . LEU A 1 66  ? -3.541  -3.691  -5.348  1.00 0.00 ? 117 LEU A HD21 3  
ATOM 4945  H HD22 . LEU A 1 66  ? -2.874  -3.804  -6.981  1.00 0.00 ? 117 LEU A HD22 3  
ATOM 4946  H HD23 . LEU A 1 66  ? -2.001  -2.918  -5.731  1.00 0.00 ? 117 LEU A HD23 3  
ATOM 4947  N N    . ARG A 1 67  ? -7.660  -4.154  -6.056  1.00 0.00 ? 118 ARG A N    3  
ATOM 4948  C CA   . ARG A 1 67  ? -9.121  -4.387  -5.800  1.00 0.00 ? 118 ARG A CA   3  
ATOM 4949  C C    . ARG A 1 67  ? -9.571  -3.562  -4.591  1.00 0.00 ? 118 ARG A C    3  
ATOM 4950  O O    . ARG A 1 67  ? -8.985  -3.632  -3.528  1.00 0.00 ? 118 ARG A O    3  
ATOM 4951  C CB   . ARG A 1 67  ? -9.308  -5.883  -5.509  1.00 0.00 ? 118 ARG A CB   3  
ATOM 4952  C CG   . ARG A 1 67  ? -10.792 -6.263  -5.338  1.00 0.00 ? 118 ARG A CG   3  
ATOM 4953  C CD   . ARG A 1 67  ? -11.463 -6.473  -6.705  1.00 0.00 ? 118 ARG A CD   3  
ATOM 4954  N NE   . ARG A 1 67  ? -12.956 -6.332  -6.568  1.00 0.00 ? 118 ARG A NE   3  
ATOM 4955  C CZ   . ARG A 1 67  ? -13.630 -7.031  -5.683  1.00 0.00 ? 118 ARG A CZ   3  
ATOM 4956  N NH1  . ARG A 1 67  ? -13.064 -8.021  -5.056  1.00 0.00 ? 118 ARG A NH1  3  
ATOM 4957  N NH2  . ARG A 1 67  ? -14.896 -6.795  -5.477  1.00 0.00 ? 118 ARG A NH2  3  
ATOM 4958  H H    . ARG A 1 67  ? -6.992  -4.629  -5.513  1.00 0.00 ? 118 ARG A H    3  
ATOM 4959  H HA   . ARG A 1 67  ? -9.697  -4.106  -6.667  1.00 0.00 ? 118 ARG A HA   3  
ATOM 4960  H HB2  . ARG A 1 67  ? -8.886  -6.451  -6.327  1.00 0.00 ? 118 ARG A HB2  3  
ATOM 4961  H HB3  . ARG A 1 67  ? -8.773  -6.123  -4.598  1.00 0.00 ? 118 ARG A HB3  3  
ATOM 4962  H HG2  . ARG A 1 67  ? -10.843 -7.180  -4.773  1.00 0.00 ? 118 ARG A HG2  3  
ATOM 4963  H HG3  . ARG A 1 67  ? -11.309 -5.483  -4.797  1.00 0.00 ? 118 ARG A HG3  3  
ATOM 4964  H HD2  . ARG A 1 67  ? -11.122 -5.727  -7.395  1.00 0.00 ? 118 ARG A HD2  3  
ATOM 4965  H HD3  . ARG A 1 67  ? -11.190 -7.454  -7.086  1.00 0.00 ? 118 ARG A HD3  3  
ATOM 4966  H HE   . ARG A 1 67  ? -13.425 -5.672  -7.118  1.00 0.00 ? 118 ARG A HE   3  
ATOM 4967  H HH11 . ARG A 1 67  ? -12.118 -8.269  -5.256  1.00 0.00 ? 118 ARG A HH11 3  
ATOM 4968  H HH12 . ARG A 1 67  ? -13.578 -8.527  -4.364  1.00 0.00 ? 118 ARG A HH12 3  
ATOM 4969  H HH21 . ARG A 1 67  ? -15.365 -6.083  -5.994  1.00 0.00 ? 118 ARG A HH21 3  
ATOM 4970  H HH22 . ARG A 1 67  ? -15.396 -7.335  -4.800  1.00 0.00 ? 118 ARG A HH22 3  
ATOM 4971  N N    . ASN A 1 68  ? -10.621 -2.795  -4.762  1.00 0.00 ? 119 ASN A N    3  
ATOM 4972  C CA   . ASN A 1 68  ? -11.169 -1.940  -3.658  1.00 0.00 ? 119 ASN A CA   3  
ATOM 4973  C C    . ASN A 1 68  ? -10.153 -0.842  -3.318  1.00 0.00 ? 119 ASN A C    3  
ATOM 4974  O O    . ASN A 1 68  ? -10.140 -0.288  -2.237  1.00 0.00 ? 119 ASN A O    3  
ATOM 4975  C CB   . ASN A 1 68  ? -11.510 -2.829  -2.423  1.00 0.00 ? 119 ASN A CB   3  
ATOM 4976  C CG   . ASN A 1 68  ? -10.558 -2.576  -1.237  1.00 0.00 ? 119 ASN A CG   3  
ATOM 4977  O OD1  . ASN A 1 68  ? -9.460  -3.094  -1.205  1.00 0.00 ? 119 ASN A OD1  3  
ATOM 4978  N ND2  . ASN A 1 68  ? -10.932 -1.779  -0.266  1.00 0.00 ? 119 ASN A ND2  3  
ATOM 4979  H H    . ASN A 1 68  ? -11.059 -2.781  -5.638  1.00 0.00 ? 119 ASN A H    3  
ATOM 4980  H HA   . ASN A 1 68  ? -12.075 -1.467  -4.019  1.00 0.00 ? 119 ASN A HA   3  
ATOM 4981  H HB2  . ASN A 1 68  ? -12.524 -2.625  -2.104  1.00 0.00 ? 119 ASN A HB2  3  
ATOM 4982  H HB3  . ASN A 1 68  ? -11.436 -3.865  -2.711  1.00 0.00 ? 119 ASN A HB3  3  
ATOM 4983  H HD21 . ASN A 1 68  ? -11.814 -1.350  -0.291  1.00 0.00 ? 119 ASN A HD21 3  
ATOM 4984  H HD22 . ASN A 1 68  ? -10.326 -1.609  0.487   1.00 0.00 ? 119 ASN A HD22 3  
ATOM 4985  N N    . ALA A 1 69  ? -9.315  -0.508  -4.241  1.00 0.00 ? 120 ALA A N    3  
ATOM 4986  C CA   . ALA A 1 69  ? -8.309  0.543   -3.967  1.00 0.00 ? 120 ALA A CA   3  
ATOM 4987  C C    . ALA A 1 69  ? -9.010  1.897   -3.934  1.00 0.00 ? 120 ALA A C    3  
ATOM 4988  O O    . ALA A 1 69  ? -8.411  2.910   -3.631  1.00 0.00 ? 120 ALA A O    3  
ATOM 4989  C CB   . ALA A 1 69  ? -7.247  0.503   -5.068  1.00 0.00 ? 120 ALA A CB   3  
ATOM 4990  H H    . ALA A 1 69  ? -9.344  -0.953  -5.113  1.00 0.00 ? 120 ALA A H    3  
ATOM 4991  H HA   . ALA A 1 69  ? -7.847  0.359   -3.008  1.00 0.00 ? 120 ALA A HA   3  
ATOM 4992  H HB1  . ALA A 1 69  ? -7.670  0.038   -5.948  1.00 0.00 ? 120 ALA A HB1  3  
ATOM 4993  H HB2  . ALA A 1 69  ? -6.919  1.507   -5.309  1.00 0.00 ? 120 ALA A HB2  3  
ATOM 4994  H HB3  . ALA A 1 69  ? -6.407  -0.077  -4.726  1.00 0.00 ? 120 ALA A HB3  3  
ATOM 4995  N N    . THR A 1 70  ? -10.274 1.915   -4.231  1.00 0.00 ? 121 THR A N    3  
ATOM 4996  C CA   . THR A 1 70  ? -11.033 3.187   -4.207  1.00 0.00 ? 121 THR A CA   3  
ATOM 4997  C C    . THR A 1 70  ? -11.740 3.299   -2.850  1.00 0.00 ? 121 THR A C    3  
ATOM 4998  O O    . THR A 1 70  ? -12.935 3.113   -2.739  1.00 0.00 ? 121 THR A O    3  
ATOM 4999  C CB   . THR A 1 70  ? -12.064 3.173   -5.336  1.00 0.00 ? 121 THR A CB   3  
ATOM 5000  O OG1  . THR A 1 70  ? -12.728 1.920   -5.366  1.00 0.00 ? 121 THR A OG1  3  
ATOM 5001  C CG2  . THR A 1 70  ? -11.359 3.402   -6.673  1.00 0.00 ? 121 THR A CG2  3  
ATOM 5002  H H    . THR A 1 70  ? -10.731 1.086   -4.465  1.00 0.00 ? 121 THR A H    3  
ATOM 5003  H HA   . THR A 1 70  ? -10.352 4.025   -4.343  1.00 0.00 ? 121 THR A HA   3  
ATOM 5004  H HB   . THR A 1 70  ? -12.780 3.952   -5.174  1.00 0.00 ? 121 THR A HB   3  
ATOM 5005  H HG1  . THR A 1 70  ? -13.252 1.881   -6.173  1.00 0.00 ? 121 THR A HG1  3  
ATOM 5006  H HG21 . THR A 1 70  ? -10.572 2.674   -6.797  1.00 0.00 ? 121 THR A HG21 3  
ATOM 5007  H HG22 . THR A 1 70  ? -12.069 3.300   -7.478  1.00 0.00 ? 121 THR A HG22 3  
ATOM 5008  H HG23 . THR A 1 70  ? -10.934 4.391   -6.691  1.00 0.00 ? 121 THR A HG23 3  
ATOM 5009  N N    . ALA A 1 71  ? -10.995 3.587   -1.813  1.00 0.00 ? 122 ALA A N    3  
ATOM 5010  C CA   . ALA A 1 71  ? -11.583 3.703   -0.447  1.00 0.00 ? 122 ALA A CA   3  
ATOM 5011  C C    . ALA A 1 71  ? -11.852 5.171   -0.134  1.00 0.00 ? 122 ALA A C    3  
ATOM 5012  O O    . ALA A 1 71  ? -11.100 6.045   -0.513  1.00 0.00 ? 122 ALA A O    3  
ATOM 5013  C CB   . ALA A 1 71  ? -10.589 3.142   0.560   1.00 0.00 ? 122 ALA A CB   3  
ATOM 5014  H H    . ALA A 1 71  ? -10.031 3.721   -1.932  1.00 0.00 ? 122 ALA A H    3  
ATOM 5015  H HA   . ALA A 1 71  ? -12.508 3.146   -0.389  1.00 0.00 ? 122 ALA A HA   3  
ATOM 5016  H HB1  . ALA A 1 71  ? -10.385 2.112   0.322   1.00 0.00 ? 122 ALA A HB1  3  
ATOM 5017  H HB2  . ALA A 1 71  ? -9.672  3.710   0.506   1.00 0.00 ? 122 ALA A HB2  3  
ATOM 5018  H HB3  . ALA A 1 71  ? -11.002 3.206   1.555   1.00 0.00 ? 122 ALA A HB3  3  
ATOM 5019  N N    . ALA A 1 72  ? -12.930 5.451   0.542   1.00 0.00 ? 123 ALA A N    3  
ATOM 5020  C CA   . ALA A 1 72  ? -13.272 6.866   0.861   1.00 0.00 ? 123 ALA A CA   3  
ATOM 5021  C C    . ALA A 1 72  ? -12.780 7.239   2.266   1.00 0.00 ? 123 ALA A C    3  
ATOM 5022  O O    . ALA A 1 72  ? -13.143 6.619   3.245   1.00 0.00 ? 123 ALA A O    3  
ATOM 5023  C CB   . ALA A 1 72  ? -14.789 7.024   0.772   1.00 0.00 ? 123 ALA A CB   3  
ATOM 5024  H H    . ALA A 1 72  ? -13.528 4.729   0.826   1.00 0.00 ? 123 ALA A H    3  
ATOM 5025  H HA   . ALA A 1 72  ? -12.807 7.514   0.144   1.00 0.00 ? 123 ALA A HA   3  
ATOM 5026  H HB1  . ALA A 1 72  ? -15.123 6.730   -0.214  1.00 0.00 ? 123 ALA A HB1  3  
ATOM 5027  H HB2  . ALA A 1 72  ? -15.260 6.395   1.513   1.00 0.00 ? 123 ALA A HB2  3  
ATOM 5028  H HB3  . ALA A 1 72  ? -15.059 8.054   0.951   1.00 0.00 ? 123 ALA A HB3  3  
ATOM 5029  N N    . MET A 1 73  ? -11.958 8.253   2.366   1.00 0.00 ? 124 MET A N    3  
ATOM 5030  C CA   . MET A 1 73  ? -11.444 8.667   3.701   1.00 0.00 ? 124 MET A CA   3  
ATOM 5031  C C    . MET A 1 73  ? -12.626 9.051   4.585   1.00 0.00 ? 124 MET A C    3  
ATOM 5032  O O    . MET A 1 73  ? -13.459 9.843   4.196   1.00 0.00 ? 124 MET A O    3  
ATOM 5033  C CB   . MET A 1 73  ? -10.526 9.884   3.538   1.00 0.00 ? 124 MET A CB   3  
ATOM 5034  C CG   . MET A 1 73  ? -9.771  10.121  4.843   1.00 0.00 ? 124 MET A CG   3  
ATOM 5035  S SD   . MET A 1 73  ? -8.822  11.657  4.720   1.00 0.00 ? 124 MET A SD   3  
ATOM 5036  C CE   . MET A 1 73  ? -7.591  11.087  3.514   1.00 0.00 ? 124 MET A CE   3  
ATOM 5037  H H    . MET A 1 73  ? -11.677 8.737   1.562   1.00 0.00 ? 124 MET A H    3  
ATOM 5038  H HA   . MET A 1 73  ? -10.903 7.853   4.158   1.00 0.00 ? 124 MET A HA   3  
ATOM 5039  H HB2  . MET A 1 73  ? -9.820  9.704   2.736   1.00 0.00 ? 124 MET A HB2  3  
ATOM 5040  H HB3  . MET A 1 73  ? -11.123 10.758  3.309   1.00 0.00 ? 124 MET A HB3  3  
ATOM 5041  H HG2  . MET A 1 73  ? -10.476 10.201  5.649   1.00 0.00 ? 124 MET A HG2  3  
ATOM 5042  H HG3  . MET A 1 73  ? -9.104  9.296   5.033   1.00 0.00 ? 124 MET A HG3  3  
ATOM 5043  H HE1  . MET A 1 73  ? -7.384  10.037  3.673   1.00 0.00 ? 124 MET A HE1  3  
ATOM 5044  H HE2  . MET A 1 73  ? -7.967  11.229  2.515   1.00 0.00 ? 124 MET A HE2  3  
ATOM 5045  H HE3  . MET A 1 73  ? -6.686  11.657  3.631   1.00 0.00 ? 124 MET A HE3  3  
ATOM 5046  N N    . LYS A 1 74  ? -12.689 8.515   5.773   1.00 0.00 ? 125 LYS A N    3  
ATOM 5047  C CA   . LYS A 1 74  ? -13.813 8.869   6.688   1.00 0.00 ? 125 LYS A CA   3  
ATOM 5048  C C    . LYS A 1 74  ? -13.568 10.265  7.253   1.00 0.00 ? 125 LYS A C    3  
ATOM 5049  O O    . LYS A 1 74  ? -14.344 11.182  7.066   1.00 0.00 ? 125 LYS A O    3  
ATOM 5050  C CB   . LYS A 1 74  ? -13.866 7.856   7.838   1.00 0.00 ? 125 LYS A CB   3  
ATOM 5051  C CG   . LYS A 1 74  ? -14.164 6.456   7.294   1.00 0.00 ? 125 LYS A CG   3  
ATOM 5052  C CD   . LYS A 1 74  ? -14.420 5.496   8.462   1.00 0.00 ? 125 LYS A CD   3  
ATOM 5053  C CE   . LYS A 1 74  ? -14.473 4.069   7.928   1.00 0.00 ? 125 LYS A CE   3  
ATOM 5054  N NZ   . LYS A 1 74  ? -15.673 3.916   7.062   1.00 0.00 ? 125 LYS A NZ   3  
ATOM 5055  H H    . LYS A 1 74  ? -11.989 7.892   6.070   1.00 0.00 ? 125 LYS A H    3  
ATOM 5056  H HA   . LYS A 1 74  ? -14.746 8.855   6.143   1.00 0.00 ? 125 LYS A HA   3  
ATOM 5057  H HB2  . LYS A 1 74  ? -12.905 7.845   8.339   1.00 0.00 ? 125 LYS A HB2  3  
ATOM 5058  H HB3  . LYS A 1 74  ? -14.635 8.146   8.535   1.00 0.00 ? 125 LYS A HB3  3  
ATOM 5059  H HG2  . LYS A 1 74  ? -15.040 6.497   6.660   1.00 0.00 ? 125 LYS A HG2  3  
ATOM 5060  H HG3  . LYS A 1 74  ? -13.316 6.105   6.724   1.00 0.00 ? 125 LYS A HG3  3  
ATOM 5061  H HD2  . LYS A 1 74  ? -13.617 5.584   9.186   1.00 0.00 ? 125 LYS A HD2  3  
ATOM 5062  H HD3  . LYS A 1 74  ? -15.365 5.738   8.930   1.00 0.00 ? 125 LYS A HD3  3  
ATOM 5063  H HE2  . LYS A 1 74  ? -13.587 3.871   7.345   1.00 0.00 ? 125 LYS A HE2  3  
ATOM 5064  H HE3  . LYS A 1 74  ? -14.528 3.372   8.751   1.00 0.00 ? 125 LYS A HE3  3  
ATOM 5065  H HZ1  . LYS A 1 74  ? -16.064 4.854   6.842   1.00 0.00 ? 125 LYS A HZ1  3  
ATOM 5066  H HZ2  . LYS A 1 74  ? -15.405 3.441   6.179   1.00 0.00 ? 125 LYS A HZ2  3  
ATOM 5067  H HZ3  . LYS A 1 74  ? -16.388 3.346   7.555   1.00 0.00 ? 125 LYS A HZ3  3  
ATOM 5068  N N    . ASN A 1 75  ? -12.470 10.423  7.927   1.00 0.00 ? 126 ASN A N    3  
ATOM 5069  C CA   . ASN A 1 75  ? -12.086 11.735  8.517   1.00 0.00 ? 126 ASN A CA   3  
ATOM 5070  C C    . ASN A 1 75  ? -10.685 12.036  7.988   1.00 0.00 ? 126 ASN A C    3  
ATOM 5071  O O    . ASN A 1 75  ? -10.496 12.217  6.802   1.00 0.00 ? 126 ASN A O    3  
ATOM 5072  C CB   . ASN A 1 75  ? -12.072 11.599  10.044  1.00 0.00 ? 126 ASN A CB   3  
ATOM 5073  C CG   . ASN A 1 75  ? -11.888 12.963  10.712  1.00 0.00 ? 126 ASN A CG   3  
ATOM 5074  O OD1  . ASN A 1 75  ? -11.650 13.954  10.055  1.00 0.00 ? 126 ASN A OD1  3  
ATOM 5075  N ND2  . ASN A 1 75  ? -11.982 13.053  12.006  1.00 0.00 ? 126 ASN A ND2  3  
ATOM 5076  H H    . ASN A 1 75  ? -11.867 9.663   8.039   1.00 0.00 ? 126 ASN A H    3  
ATOM 5077  H HA   . ASN A 1 75  ? -12.775 12.511  8.212   1.00 0.00 ? 126 ASN A HA   3  
ATOM 5078  H HB2  . ASN A 1 75  ? -13.009 11.173  10.371  1.00 0.00 ? 126 ASN A HB2  3  
ATOM 5079  H HB3  . ASN A 1 75  ? -11.266 10.945  10.337  1.00 0.00 ? 126 ASN A HB3  3  
ATOM 5080  H HD21 . ASN A 1 75  ? -12.173 12.253  12.538  1.00 0.00 ? 126 ASN A HD21 3  
ATOM 5081  H HD22 . ASN A 1 75  ? -11.856 13.918  12.449  1.00 0.00 ? 126 ASN A HD22 3  
ATOM 5082  N N    . GLN A 1 76  ? -9.696  12.048  8.839   1.00 0.00 ? 127 GLN A N    3  
ATOM 5083  C CA   . GLN A 1 76  ? -8.299  12.284  8.357   1.00 0.00 ? 127 GLN A CA   3  
ATOM 5084  C C    . GLN A 1 76  ? -7.609  10.930  8.131   1.00 0.00 ? 127 GLN A C    3  
ATOM 5085  O O    . GLN A 1 76  ? -6.411  10.864  7.928   1.00 0.00 ? 127 GLN A O    3  
ATOM 5086  C CB   . GLN A 1 76  ? -7.509  13.085  9.398   1.00 0.00 ? 127 GLN A CB   3  
ATOM 5087  C CG   . GLN A 1 76  ? -8.189  14.437  9.628   1.00 0.00 ? 127 GLN A CG   3  
ATOM 5088  C CD   . GLN A 1 76  ? -7.394  15.252  10.654  1.00 0.00 ? 127 GLN A CD   3  
ATOM 5089  O OE1  . GLN A 1 76  ? -6.767  14.703  11.538  1.00 0.00 ? 127 GLN A OE1  3  
ATOM 5090  N NE2  . GLN A 1 76  ? -7.396  16.556  10.570  1.00 0.00 ? 127 GLN A NE2  3  
ATOM 5091  H H    . GLN A 1 76  ? -9.862  11.867  9.786   1.00 0.00 ? 127 GLN A H    3  
ATOM 5092  H HA   . GLN A 1 76  ? -8.319  12.832  7.422   1.00 0.00 ? 127 GLN A HA   3  
ATOM 5093  H HB2  . GLN A 1 76  ? -7.475  12.531  10.329  1.00 0.00 ? 127 GLN A HB2  3  
ATOM 5094  H HB3  . GLN A 1 76  ? -6.500  13.250  9.040   1.00 0.00 ? 127 GLN A HB3  3  
ATOM 5095  H HG2  . GLN A 1 76  ? -8.238  14.977  8.692   1.00 0.00 ? 127 GLN A HG2  3  
ATOM 5096  H HG3  . GLN A 1 76  ? -9.189  14.275  10.000  1.00 0.00 ? 127 GLN A HG3  3  
ATOM 5097  H HE21 . GLN A 1 76  ? -7.906  17.001  9.860   1.00 0.00 ? 127 GLN A HE21 3  
ATOM 5098  H HE22 . GLN A 1 76  ? -6.879  17.088  11.208  1.00 0.00 ? 127 GLN A HE22 3  
ATOM 5099  N N    . VAL A 1 77  ? -8.352  9.848   8.181   1.00 0.00 ? 128 VAL A N    3  
ATOM 5100  C CA   . VAL A 1 77  ? -7.747  8.492   7.985   1.00 0.00 ? 128 VAL A CA   3  
ATOM 5101  C C    . VAL A 1 77  ? -8.582  7.660   6.984   1.00 0.00 ? 128 VAL A C    3  
ATOM 5102  O O    . VAL A 1 77  ? -9.792  7.796   6.905   1.00 0.00 ? 128 VAL A O    3  
ATOM 5103  C CB   . VAL A 1 77  ? -7.669  7.785   9.339   1.00 0.00 ? 128 VAL A CB   3  
ATOM 5104  C CG1  . VAL A 1 77  ? -6.943  6.456   9.167   1.00 0.00 ? 128 VAL A CG1  3  
ATOM 5105  C CG2  . VAL A 1 77  ? -6.883  8.660   10.328  1.00 0.00 ? 128 VAL A CG2  3  
ATOM 5106  H H    . VAL A 1 77  ? -9.313  9.927   8.355   1.00 0.00 ? 128 VAL A H    3  
ATOM 5107  H HA   . VAL A 1 77  ? -6.754  8.597   7.593   1.00 0.00 ? 128 VAL A HA   3  
ATOM 5108  H HB   . VAL A 1 77  ? -8.666  7.611   9.717   1.00 0.00 ? 128 VAL A HB   3  
ATOM 5109  H HG11 . VAL A 1 77  ? -5.989  6.629   8.688   1.00 0.00 ? 128 VAL A HG11 3  
ATOM 5110  H HG12 . VAL A 1 77  ? -6.785  6.008   10.130  1.00 0.00 ? 128 VAL A HG12 3  
ATOM 5111  H HG13 . VAL A 1 77  ? -7.540  5.797   8.555   1.00 0.00 ? 128 VAL A HG13 3  
ATOM 5112  H HG21 . VAL A 1 77  ? -5.927  8.925   9.897   1.00 0.00 ? 128 VAL A HG21 3  
ATOM 5113  H HG22 . VAL A 1 77  ? -7.436  9.561   10.543  1.00 0.00 ? 128 VAL A HG22 3  
ATOM 5114  H HG23 . VAL A 1 77  ? -6.722  8.111   11.247  1.00 0.00 ? 128 VAL A HG23 3  
ATOM 5115  N N    . ALA A 1 78  ? -7.933  6.797   6.216   1.00 0.00 ? 129 ALA A N    3  
ATOM 5116  C CA   . ALA A 1 78  ? -8.651  5.933   5.208   1.00 0.00 ? 129 ALA A CA   3  
ATOM 5117  C C    . ALA A 1 78  ? -8.129  4.490   5.345   1.00 0.00 ? 129 ALA A C    3  
ATOM 5118  O O    . ALA A 1 78  ? -7.070  4.268   5.889   1.00 0.00 ? 129 ALA A O    3  
ATOM 5119  C CB   . ALA A 1 78  ? -8.342  6.438   3.786   1.00 0.00 ? 129 ALA A CB   3  
ATOM 5120  H H    . ALA A 1 78  ? -6.960  6.711   6.306   1.00 0.00 ? 129 ALA A H    3  
ATOM 5121  H HA   . ALA A 1 78  ? -9.720  5.957   5.383   1.00 0.00 ? 129 ALA A HA   3  
ATOM 5122  H HB1  . ALA A 1 78  ? -7.274  6.419   3.620   1.00 0.00 ? 129 ALA A HB1  3  
ATOM 5123  H HB2  . ALA A 1 78  ? -8.825  5.798   3.065   1.00 0.00 ? 129 ALA A HB2  3  
ATOM 5124  H HB3  . ALA A 1 78  ? -8.701  7.445   3.664   1.00 0.00 ? 129 ALA A HB3  3  
ATOM 5125  N N    . ARG A 1 79  ? -8.854  3.508   4.853   1.00 0.00 ? 130 ARG A N    3  
ATOM 5126  C CA   . ARG A 1 79  ? -8.383  2.086   4.954   1.00 0.00 ? 130 ARG A CA   3  
ATOM 5127  C C    . ARG A 1 79  ? -8.950  1.268   3.784   1.00 0.00 ? 130 ARG A C    3  
ATOM 5128  O O    . ARG A 1 79  ? -10.025 1.540   3.288   1.00 0.00 ? 130 ARG A O    3  
ATOM 5129  C CB   . ARG A 1 79  ? -8.860  1.470   6.270   1.00 0.00 ? 130 ARG A CB   3  
ATOM 5130  C CG   . ARG A 1 79  ? -8.179  0.112   6.462   1.00 0.00 ? 130 ARG A CG   3  
ATOM 5131  C CD   . ARG A 1 79  ? -8.746  -0.585  7.695   1.00 0.00 ? 130 ARG A CD   3  
ATOM 5132  N NE   . ARG A 1 79  ? -7.825  -1.693  8.119   1.00 0.00 ? 130 ARG A NE   3  
ATOM 5133  C CZ   . ARG A 1 79  ? -7.470  -2.650  7.304   1.00 0.00 ? 130 ARG A CZ   3  
ATOM 5134  N NH1  . ARG A 1 79  ? -8.041  -2.778  6.137   1.00 0.00 ? 130 ARG A NH1  3  
ATOM 5135  N NH2  . ARG A 1 79  ? -6.594  -3.538  7.696   1.00 0.00 ? 130 ARG A NH2  3  
ATOM 5136  H H    . ARG A 1 79  ? -9.701  3.702   4.415   1.00 0.00 ? 130 ARG A H    3  
ATOM 5137  H HA   . ARG A 1 79  ? -7.301  2.055   4.919   1.00 0.00 ? 130 ARG A HA   3  
ATOM 5138  H HB2  . ARG A 1 79  ? -8.602  2.121   7.087   1.00 0.00 ? 130 ARG A HB2  3  
ATOM 5139  H HB3  . ARG A 1 79  ? -9.930  1.333   6.239   1.00 0.00 ? 130 ARG A HB3  3  
ATOM 5140  H HG2  . ARG A 1 79  ? -8.355  -0.497  5.594   1.00 0.00 ? 130 ARG A HG2  3  
ATOM 5141  H HG3  . ARG A 1 79  ? -7.117  0.258   6.591   1.00 0.00 ? 130 ARG A HG3  3  
ATOM 5142  H HD2  . ARG A 1 79  ? -8.810  0.115   8.499   1.00 0.00 ? 130 ARG A HD2  3  
ATOM 5143  H HD3  . ARG A 1 79  ? -9.744  -0.954  7.468   1.00 0.00 ? 130 ARG A HD3  3  
ATOM 5144  H HE   . ARG A 1 79  ? -7.443  -1.673  9.020   1.00 0.00 ? 130 ARG A HE   3  
ATOM 5145  H HH11 . ARG A 1 79  ? -8.765  -2.151  5.866   1.00 0.00 ? 130 ARG A HH11 3  
ATOM 5146  H HH12 . ARG A 1 79  ? -7.740  -3.491  5.507   1.00 0.00 ? 130 ARG A HH12 3  
ATOM 5147  H HH21 . ARG A 1 79  ? -6.206  -3.482  8.615   1.00 0.00 ? 130 ARG A HH21 3  
ATOM 5148  H HH22 . ARG A 1 79  ? -6.314  -4.274  7.079   1.00 0.00 ? 130 ARG A HH22 3  
ATOM 5149  N N    . PHE A 1 80  ? -8.230  0.257   3.347   1.00 0.00 ? 131 PHE A N    3  
ATOM 5150  C CA   . PHE A 1 80  ? -8.703  -0.603  2.215   1.00 0.00 ? 131 PHE A CA   3  
ATOM 5151  C C    . PHE A 1 80  ? -8.829  -2.049  2.725   1.00 0.00 ? 131 PHE A C    3  
ATOM 5152  O O    . PHE A 1 80  ? -7.920  -2.580  3.330   1.00 0.00 ? 131 PHE A O    3  
ATOM 5153  C CB   . PHE A 1 80  ? -7.657  -0.537  1.091   1.00 0.00 ? 131 PHE A CB   3  
ATOM 5154  C CG   . PHE A 1 80  ? -7.231  0.903   0.877   1.00 0.00 ? 131 PHE A CG   3  
ATOM 5155  C CD1  . PHE A 1 80  ? -6.289  1.452   1.744   1.00 0.00 ? 131 PHE A CD1  3  
ATOM 5156  C CD2  . PHE A 1 80  ? -7.758  1.680   -0.166  1.00 0.00 ? 131 PHE A CD2  3  
ATOM 5157  C CE1  . PHE A 1 80  ? -5.855  2.773   1.588   1.00 0.00 ? 131 PHE A CE1  3  
ATOM 5158  C CE2  . PHE A 1 80  ? -7.326  3.009   -0.330  1.00 0.00 ? 131 PHE A CE2  3  
ATOM 5159  C CZ   . PHE A 1 80  ? -6.375  3.552   0.550   1.00 0.00 ? 131 PHE A CZ   3  
ATOM 5160  H H    . PHE A 1 80  ? -7.371  0.055   3.769   1.00 0.00 ? 131 PHE A H    3  
ATOM 5161  H HA   . PHE A 1 80  ? -9.660  -0.265  1.849   1.00 0.00 ? 131 PHE A HA   3  
ATOM 5162  H HB2  . PHE A 1 80  ? -6.794  -1.118  1.383   1.00 0.00 ? 131 PHE A HB2  3  
ATOM 5163  H HB3  . PHE A 1 80  ? -8.069  -0.938  0.177   1.00 0.00 ? 131 PHE A HB3  3  
ATOM 5164  H HD1  . PHE A 1 80  ? -5.891  0.847   2.532   1.00 0.00 ? 131 PHE A HD1  3  
ATOM 5165  H HD2  . PHE A 1 80  ? -8.490  1.262   -0.843  1.00 0.00 ? 131 PHE A HD2  3  
ATOM 5166  H HE1  . PHE A 1 80  ? -5.119  3.196   2.275   1.00 0.00 ? 131 PHE A HE1  3  
ATOM 5167  H HE2  . PHE A 1 80  ? -7.724  3.614   -1.134  1.00 0.00 ? 131 PHE A HE2  3  
ATOM 5168  H HZ   . PHE A 1 80  ? -6.040  4.565   0.423   1.00 0.00 ? 131 PHE A HZ   3  
ATOM 5169  N N    . ASN A 1 81  ? -9.942  -2.694  2.489   1.00 0.00 ? 132 ASN A N    3  
ATOM 5170  C CA   . ASN A 1 81  ? -10.104 -4.098  2.973   1.00 0.00 ? 132 ASN A CA   3  
ATOM 5171  C C    . ASN A 1 81  ? -9.634  -5.077  1.904   1.00 0.00 ? 132 ASN A C    3  
ATOM 5172  O O    . ASN A 1 81  ? -8.520  -5.558  1.948   1.00 0.00 ? 132 ASN A O    3  
ATOM 5173  C CB   . ASN A 1 81  ? -11.573 -4.362  3.296   1.00 0.00 ? 132 ASN A CB   3  
ATOM 5174  C CG   . ASN A 1 81  ? -11.693 -5.731  3.965   1.00 0.00 ? 132 ASN A CG   3  
ATOM 5175  O OD1  . ASN A 1 81  ? -12.268 -6.642  3.406   1.00 0.00 ? 132 ASN A OD1  3  
ATOM 5176  N ND2  . ASN A 1 81  ? -11.154 -5.918  5.140   1.00 0.00 ? 132 ASN A ND2  3  
ATOM 5177  H H    . ASN A 1 81  ? -10.668 -2.256  2.005   1.00 0.00 ? 132 ASN A H    3  
ATOM 5178  H HA   . ASN A 1 81  ? -9.512  -4.249  3.860   1.00 0.00 ? 132 ASN A HA   3  
ATOM 5179  H HB2  . ASN A 1 81  ? -11.937 -3.595  3.964   1.00 0.00 ? 132 ASN A HB2  3  
ATOM 5180  H HB3  . ASN A 1 81  ? -12.149 -4.354  2.386   1.00 0.00 ? 132 ASN A HB3  3  
ATOM 5181  H HD21 . ASN A 1 81  ? -10.681 -5.184  5.584   1.00 0.00 ? 132 ASN A HD21 3  
ATOM 5182  H HD22 . ASN A 1 81  ? -11.219 -6.792  5.574   1.00 0.00 ? 132 ASN A HD22 3  
ATOM 5183  N N    . ASP A 1 82  ? -10.462 -5.374  0.940   1.00 0.00 ? 133 ASP A N    3  
ATOM 5184  C CA   . ASP A 1 82  ? -10.032 -6.325  -0.117  1.00 0.00 ? 133 ASP A CA   3  
ATOM 5185  C C    . ASP A 1 82  ? -8.972  -5.665  -0.999  1.00 0.00 ? 133 ASP A C    3  
ATOM 5186  O O    . ASP A 1 82  ? -9.088  -5.635  -2.206  1.00 0.00 ? 133 ASP A O    3  
ATOM 5187  C CB   . ASP A 1 82  ? -11.231 -6.743  -0.977  1.00 0.00 ? 133 ASP A CB   3  
ATOM 5188  C CG   . ASP A 1 82  ? -10.830 -7.941  -1.845  1.00 0.00 ? 133 ASP A CG   3  
ATOM 5189  O OD1  . ASP A 1 82  ? -9.666  -8.307  -1.808  1.00 0.00 ? 133 ASP A OD1  3  
ATOM 5190  O OD2  . ASP A 1 82  ? -11.693 -8.469  -2.534  1.00 0.00 ? 133 ASP A OD2  3  
ATOM 5191  H H    . ASP A 1 82  ? -11.358 -4.979  0.914   1.00 0.00 ? 133 ASP A H    3  
ATOM 5192  H HA   . ASP A 1 82  ? -9.610  -7.202  0.346   1.00 0.00 ? 133 ASP A HA   3  
ATOM 5193  H HB2  . ASP A 1 82  ? -12.058 -7.021  -0.340  1.00 0.00 ? 133 ASP A HB2  3  
ATOM 5194  H HB3  . ASP A 1 82  ? -11.525 -5.924  -1.614  1.00 0.00 ? 133 ASP A HB3  3  
ATOM 5195  N N    . LEU A 1 83  ? -7.930  -5.155  -0.405  1.00 0.00 ? 134 LEU A N    3  
ATOM 5196  C CA   . LEU A 1 83  ? -6.852  -4.522  -1.215  1.00 0.00 ? 134 LEU A CA   3  
ATOM 5197  C C    . LEU A 1 83  ? -6.056  -5.651  -1.879  1.00 0.00 ? 134 LEU A C    3  
ATOM 5198  O O    . LEU A 1 83  ? -5.023  -6.060  -1.387  1.00 0.00 ? 134 LEU A O    3  
ATOM 5199  C CB   . LEU A 1 83  ? -5.925  -3.695  -0.296  1.00 0.00 ? 134 LEU A CB   3  
ATOM 5200  C CG   . LEU A 1 83  ? -5.217  -2.594  -1.105  1.00 0.00 ? 134 LEU A CG   3  
ATOM 5201  C CD1  . LEU A 1 83  ? -4.155  -1.908  -0.239  1.00 0.00 ? 134 LEU A CD1  3  
ATOM 5202  C CD2  . LEU A 1 83  ? -4.538  -3.197  -2.336  1.00 0.00 ? 134 LEU A CD2  3  
ATOM 5203  H H    . LEU A 1 83  ? -7.856  -5.201  0.569   1.00 0.00 ? 134 LEU A H    3  
ATOM 5204  H HA   . LEU A 1 83  ? -7.293  -3.885  -1.966  1.00 0.00 ? 134 LEU A HA   3  
ATOM 5205  H HB2  . LEU A 1 83  ? -6.519  -3.241  0.481   1.00 0.00 ? 134 LEU A HB2  3  
ATOM 5206  H HB3  . LEU A 1 83  ? -5.185  -4.338  0.158   1.00 0.00 ? 134 LEU A HB3  3  
ATOM 5207  H HG   . LEU A 1 83  ? -5.947  -1.862  -1.423  1.00 0.00 ? 134 LEU A HG   3  
ATOM 5208  H HD11 . LEU A 1 83  ? -4.600  -1.562  0.678   1.00 0.00 ? 134 LEU A HD11 3  
ATOM 5209  H HD12 . LEU A 1 83  ? -3.366  -2.606  -0.010  1.00 0.00 ? 134 LEU A HD12 3  
ATOM 5210  H HD13 . LEU A 1 83  ? -3.742  -1.067  -0.776  1.00 0.00 ? 134 LEU A HD13 3  
ATOM 5211  H HD21 . LEU A 1 83  ? -3.971  -4.061  -2.047  1.00 0.00 ? 134 LEU A HD21 3  
ATOM 5212  H HD22 . LEU A 1 83  ? -5.284  -3.482  -3.058  1.00 0.00 ? 134 LEU A HD22 3  
ATOM 5213  H HD23 . LEU A 1 83  ? -3.876  -2.463  -2.774  1.00 0.00 ? 134 LEU A HD23 3  
ATOM 5214  N N    . ARG A 1 84  ? -6.524  -6.186  -2.980  1.00 0.00 ? 135 ARG A N    3  
ATOM 5215  C CA   . ARG A 1 84  ? -5.763  -7.309  -3.617  1.00 0.00 ? 135 ARG A CA   3  
ATOM 5216  C C    . ARG A 1 84  ? -4.717  -6.747  -4.577  1.00 0.00 ? 135 ARG A C    3  
ATOM 5217  O O    . ARG A 1 84  ? -4.965  -5.807  -5.307  1.00 0.00 ? 135 ARG A O    3  
ATOM 5218  C CB   . ARG A 1 84  ? -6.719  -8.249  -4.349  1.00 0.00 ? 135 ARG A CB   3  
ATOM 5219  C CG   . ARG A 1 84  ? -5.960  -9.516  -4.763  1.00 0.00 ? 135 ARG A CG   3  
ATOM 5220  C CD   . ARG A 1 84  ? -6.923  -10.488 -5.457  1.00 0.00 ? 135 ARG A CD   3  
ATOM 5221  N NE   . ARG A 1 84  ? -7.311  -9.916  -6.777  1.00 0.00 ? 135 ARG A NE   3  
ATOM 5222  C CZ   . ARG A 1 84  ? -7.893  -10.655 -7.689  1.00 0.00 ? 135 ARG A CZ   3  
ATOM 5223  N NH1  . ARG A 1 84  ? -8.197  -11.904 -7.447  1.00 0.00 ? 135 ARG A NH1  3  
ATOM 5224  N NH2  . ARG A 1 84  ? -8.179  -10.128 -8.854  1.00 0.00 ? 135 ARG A NH2  3  
ATOM 5225  H H    . ARG A 1 84  ? -7.372  -5.867  -3.373  1.00 0.00 ? 135 ARG A H    3  
ATOM 5226  H HA   . ARG A 1 84  ? -5.251  -7.869  -2.850  1.00 0.00 ? 135 ARG A HA   3  
ATOM 5227  H HB2  . ARG A 1 84  ? -7.534  -8.511  -3.693  1.00 0.00 ? 135 ARG A HB2  3  
ATOM 5228  H HB3  . ARG A 1 84  ? -7.102  -7.759  -5.231  1.00 0.00 ? 135 ARG A HB3  3  
ATOM 5229  H HG2  . ARG A 1 84  ? -5.157  -9.255  -5.438  1.00 0.00 ? 135 ARG A HG2  3  
ATOM 5230  H HG3  . ARG A 1 84  ? -5.548  -9.986  -3.887  1.00 0.00 ? 135 ARG A HG3  3  
ATOM 5231  H HD2  . ARG A 1 84  ? -6.431  -11.444 -5.598  1.00 0.00 ? 135 ARG A HD2  3  
ATOM 5232  H HD3  . ARG A 1 84  ? -7.802  -10.626 -4.846  1.00 0.00 ? 135 ARG A HD3  3  
ATOM 5233  H HE   . ARG A 1 84  ? -7.116  -8.975  -6.972  1.00 0.00 ? 135 ARG A HE   3  
ATOM 5234  H HH11 . ARG A 1 84  ? -7.983  -12.306 -6.559  1.00 0.00 ? 135 ARG A HH11 3  
ATOM 5235  H HH12 . ARG A 1 84  ? -8.642  -12.457 -8.150  1.00 0.00 ? 135 ARG A HH12 3  
ATOM 5236  H HH21 . ARG A 1 84  ? -7.956  -9.168  -9.039  1.00 0.00 ? 135 ARG A HH21 3  
ATOM 5237  H HH22 . ARG A 1 84  ? -8.619  -10.683 -9.564  1.00 0.00 ? 135 ARG A HH22 3  
ATOM 5238  N N    . PHE A 1 85  ? -3.536  -7.303  -4.556  1.00 0.00 ? 136 PHE A N    3  
ATOM 5239  C CA   . PHE A 1 85  ? -2.445  -6.800  -5.440  1.00 0.00 ? 136 PHE A CA   3  
ATOM 5240  C C    . PHE A 1 85  ? -2.279  -7.717  -6.656  1.00 0.00 ? 136 PHE A C    3  
ATOM 5241  O O    . PHE A 1 85  ? -1.837  -8.842  -6.536  1.00 0.00 ? 136 PHE A O    3  
ATOM 5242  C CB   . PHE A 1 85  ? -1.137  -6.799  -4.634  1.00 0.00 ? 136 PHE A CB   3  
ATOM 5243  C CG   . PHE A 1 85  ? -1.098  -5.609  -3.697  1.00 0.00 ? 136 PHE A CG   3  
ATOM 5244  C CD1  . PHE A 1 85  ? -0.588  -4.389  -4.148  1.00 0.00 ? 136 PHE A CD1  3  
ATOM 5245  C CD2  . PHE A 1 85  ? -1.555  -5.729  -2.376  1.00 0.00 ? 136 PHE A CD2  3  
ATOM 5246  C CE1  . PHE A 1 85  ? -0.536  -3.284  -3.286  1.00 0.00 ? 136 PHE A CE1  3  
ATOM 5247  C CE2  . PHE A 1 85  ? -1.502  -4.622  -1.509  1.00 0.00 ? 136 PHE A CE2  3  
ATOM 5248  C CZ   . PHE A 1 85  ? -0.992  -3.400  -1.967  1.00 0.00 ? 136 PHE A CZ   3  
ATOM 5249  H H    . PHE A 1 85  ? -3.357  -8.045  -3.941  1.00 0.00 ? 136 PHE A H    3  
ATOM 5250  H HA   . PHE A 1 85  ? -2.660  -5.795  -5.772  1.00 0.00 ? 136 PHE A HA   3  
ATOM 5251  H HB2  . PHE A 1 85  ? -1.077  -7.710  -4.060  1.00 0.00 ? 136 PHE A HB2  3  
ATOM 5252  H HB3  . PHE A 1 85  ? -0.294  -6.744  -5.309  1.00 0.00 ? 136 PHE A HB3  3  
ATOM 5253  H HD1  . PHE A 1 85  ? -0.230  -4.299  -5.162  1.00 0.00 ? 136 PHE A HD1  3  
ATOM 5254  H HD2  . PHE A 1 85  ? -1.946  -6.674  -2.026  1.00 0.00 ? 136 PHE A HD2  3  
ATOM 5255  H HE1  . PHE A 1 85  ? -0.144  -2.343  -3.642  1.00 0.00 ? 136 PHE A HE1  3  
ATOM 5256  H HE2  . PHE A 1 85  ? -1.852  -4.716  -0.490  1.00 0.00 ? 136 PHE A HE2  3  
ATOM 5257  H HZ   . PHE A 1 85  ? -0.949  -2.548  -1.304  1.00 0.00 ? 136 PHE A HZ   3  
ATOM 5258  N N    . VAL A 1 86  ? -2.574  -7.218  -7.835  1.00 0.00 ? 137 VAL A N    3  
ATOM 5259  C CA   . VAL A 1 86  ? -2.371  -8.025  -9.080  1.00 0.00 ? 137 VAL A CA   3  
ATOM 5260  C C    . VAL A 1 86  ? -1.649  -7.121  -10.090 1.00 0.00 ? 137 VAL A C    3  
ATOM 5261  O O    . VAL A 1 86  ? -2.163  -6.732  -11.127 1.00 0.00 ? 137 VAL A O    3  
ATOM 5262  C CB   . VAL A 1 86  ? -3.717  -8.545  -9.613  1.00 0.00 ? 137 VAL A CB   3  
ATOM 5263  C CG1  . VAL A 1 86  ? -4.706  -7.395  -9.723  1.00 0.00 ? 137 VAL A CG1  3  
ATOM 5264  C CG2  . VAL A 1 86  ? -3.533  -9.220  -10.984 1.00 0.00 ? 137 VAL A CG2  3  
ATOM 5265  H H    . VAL A 1 86  ? -2.891  -6.288  -7.907  1.00 0.00 ? 137 VAL A H    3  
ATOM 5266  H HA   . VAL A 1 86  ? -1.724  -8.868  -8.862  1.00 0.00 ? 137 VAL A HA   3  
ATOM 5267  H HB   . VAL A 1 86  ? -4.110  -9.266  -8.915  1.00 0.00 ? 137 VAL A HB   3  
ATOM 5268  H HG11 . VAL A 1 86  ? -4.284  -6.621  -10.333 1.00 0.00 ? 137 VAL A HG11 3  
ATOM 5269  H HG12 . VAL A 1 86  ? -5.621  -7.747  -10.173 1.00 0.00 ? 137 VAL A HG12 3  
ATOM 5270  H HG13 . VAL A 1 86  ? -4.913  -7.014  -8.731  1.00 0.00 ? 137 VAL A HG13 3  
ATOM 5271  H HG21 . VAL A 1 86  ? -2.579  -9.726  -11.015 1.00 0.00 ? 137 VAL A HG21 3  
ATOM 5272  H HG22 . VAL A 1 86  ? -4.322  -9.943  -11.136 1.00 0.00 ? 137 VAL A HG22 3  
ATOM 5273  H HG23 . VAL A 1 86  ? -3.573  -8.477  -11.769 1.00 0.00 ? 137 VAL A HG23 3  
ATOM 5274  N N    . GLY A 1 87  ? -0.438  -6.771  -9.752  1.00 0.00 ? 138 GLY A N    3  
ATOM 5275  C CA   . GLY A 1 87  ? 0.402   -5.894  -10.618 1.00 0.00 ? 138 GLY A CA   3  
ATOM 5276  C C    . GLY A 1 87  ? 1.422   -6.770  -11.350 1.00 0.00 ? 138 GLY A C    3  
ATOM 5277  O O    . GLY A 1 87  ? 1.123   -7.876  -11.761 1.00 0.00 ? 138 GLY A O    3  
ATOM 5278  H H    . GLY A 1 87  ? -0.071  -7.092  -8.904  1.00 0.00 ? 138 GLY A H    3  
ATOM 5279  H HA2  . GLY A 1 87  ? -0.217  -5.371  -11.336 1.00 0.00 ? 138 GLY A HA2  3  
ATOM 5280  H HA3  . GLY A 1 87  ? 0.923   -5.177  -10.006 1.00 0.00 ? 138 GLY A HA3  3  
ATOM 5281  N N    . ARG A 1 88  ? 2.629   -6.292  -11.498 1.00 0.00 ? 139 ARG A N    3  
ATOM 5282  C CA   . ARG A 1 88  ? 3.692   -7.094  -12.187 1.00 0.00 ? 139 ARG A CA   3  
ATOM 5283  C C    . ARG A 1 88  ? 4.670   -7.652  -11.148 1.00 0.00 ? 139 ARG A C    3  
ATOM 5284  O O    . ARG A 1 88  ? 4.749   -7.181  -10.034 1.00 0.00 ? 139 ARG A O    3  
ATOM 5285  C CB   . ARG A 1 88  ? 4.453   -6.181  -13.149 1.00 0.00 ? 139 ARG A CB   3  
ATOM 5286  C CG   . ARG A 1 88  ? 3.602   -5.884  -14.396 1.00 0.00 ? 139 ARG A CG   3  
ATOM 5287  C CD   . ARG A 1 88  ? 3.691   -7.044  -15.403 1.00 0.00 ? 139 ARG A CD   3  
ATOM 5288  N NE   . ARG A 1 88  ? 3.198   -6.576  -16.735 1.00 0.00 ? 139 ARG A NE   3  
ATOM 5289  C CZ   . ARG A 1 88  ? 3.415   -7.297  -17.802 1.00 0.00 ? 139 ARG A CZ   3  
ATOM 5290  N NH1  . ARG A 1 88  ? 4.113   -8.391  -17.705 1.00 0.00 ? 139 ARG A NH1  3  
ATOM 5291  N NH2  . ARG A 1 88  ? 2.945   -6.920  -18.963 1.00 0.00 ? 139 ARG A NH2  3  
ATOM 5292  H H    . ARG A 1 88  ? 2.845   -5.405  -11.145 1.00 0.00 ? 139 ARG A H    3  
ATOM 5293  H HA   . ARG A 1 88  ? 3.244   -7.911  -12.740 1.00 0.00 ? 139 ARG A HA   3  
ATOM 5294  H HB2  . ARG A 1 88  ? 4.674   -5.256  -12.643 1.00 0.00 ? 139 ARG A HB2  3  
ATOM 5295  H HB3  . ARG A 1 88  ? 5.377   -6.655  -13.442 1.00 0.00 ? 139 ARG A HB3  3  
ATOM 5296  H HG2  . ARG A 1 88  ? 2.570   -5.750  -14.099 1.00 0.00 ? 139 ARG A HG2  3  
ATOM 5297  H HG3  . ARG A 1 88  ? 3.957   -4.979  -14.862 1.00 0.00 ? 139 ARG A HG3  3  
ATOM 5298  H HD2  . ARG A 1 88  ? 4.716   -7.368  -15.504 1.00 0.00 ? 139 ARG A HD2  3  
ATOM 5299  H HD3  . ARG A 1 88  ? 3.081   -7.870  -15.057 1.00 0.00 ? 139 ARG A HD3  3  
ATOM 5300  H HE   . ARG A 1 88  ? 2.706   -5.731  -16.804 1.00 0.00 ? 139 ARG A HE   3  
ATOM 5301  H HH11 . ARG A 1 88  ? 4.489   -8.669  -16.815 1.00 0.00 ? 139 ARG A HH11 3  
ATOM 5302  H HH12 . ARG A 1 88  ? 4.269   -8.959  -18.513 1.00 0.00 ? 139 ARG A HH12 3  
ATOM 5303  H HH21 . ARG A 1 88  ? 2.420   -6.074  -19.036 1.00 0.00 ? 139 ARG A HH21 3  
ATOM 5304  H HH22 . ARG A 1 88  ? 3.117   -7.477  -19.774 1.00 0.00 ? 139 ARG A HH22 3  
ATOM 5305  N N    . SER A 1 89  ? 5.431   -8.651  -11.513 1.00 0.00 ? 140 SER A N    3  
ATOM 5306  C CA   . SER A 1 89  ? 6.424   -9.238  -10.557 1.00 0.00 ? 140 SER A CA   3  
ATOM 5307  C C    . SER A 1 89  ? 7.770   -8.573  -10.829 1.00 0.00 ? 140 SER A C    3  
ATOM 5308  O O    . SER A 1 89  ? 8.812   -9.067  -10.448 1.00 0.00 ? 140 SER A O    3  
ATOM 5309  C CB   . SER A 1 89  ? 6.545   -10.748 -10.787 1.00 0.00 ? 140 SER A CB   3  
ATOM 5310  O OG   . SER A 1 89  ? 7.412   -11.310 -9.808  1.00 0.00 ? 140 SER A OG   3  
ATOM 5311  H H    . SER A 1 89  ? 5.362   -9.008  -12.428 1.00 0.00 ? 140 SER A H    3  
ATOM 5312  H HA   . SER A 1 89  ? 6.117   -9.044  -9.534  1.00 0.00 ? 140 SER A HA   3  
ATOM 5313  H HB2  . SER A 1 89  ? 5.576   -11.203 -10.704 1.00 0.00 ? 140 SER A HB2  3  
ATOM 5314  H HB3  . SER A 1 89  ? 6.940   -10.929 -11.778 1.00 0.00 ? 140 SER A HB3  3  
ATOM 5315  H HG   . SER A 1 89  ? 7.407   -12.265 -9.918  1.00 0.00 ? 140 SER A HG   3  
ATOM 5316  N N    . GLY A 1 90  ? 7.725   -7.452  -11.503 1.00 0.00 ? 141 GLY A N    3  
ATOM 5317  C CA   . GLY A 1 90  ? 8.956   -6.686  -11.859 1.00 0.00 ? 141 GLY A CA   3  
ATOM 5318  C C    . GLY A 1 90  ? 10.100  -6.901  -10.862 1.00 0.00 ? 141 GLY A C    3  
ATOM 5319  O O    . GLY A 1 90  ? 10.312  -6.106  -9.967  1.00 0.00 ? 141 GLY A O    3  
ATOM 5320  H H    . GLY A 1 90  ? 6.852   -7.106  -11.792 1.00 0.00 ? 141 GLY A H    3  
ATOM 5321  H HA2  . GLY A 1 90  ? 9.285   -6.980  -12.843 1.00 0.00 ? 141 GLY A HA2  3  
ATOM 5322  H HA3  . GLY A 1 90  ? 8.709   -5.636  -11.874 1.00 0.00 ? 141 GLY A HA3  3  
ATOM 5323  N N    . ARG A 1 91  ? 10.862  -7.948  -11.029 1.00 0.00 ? 142 ARG A N    3  
ATOM 5324  C CA   . ARG A 1 91  ? 12.016  -8.181  -10.115 1.00 0.00 ? 142 ARG A CA   3  
ATOM 5325  C C    . ARG A 1 91  ? 13.264  -7.497  -10.705 1.00 0.00 ? 142 ARG A C    3  
ATOM 5326  O O    . ARG A 1 91  ? 14.217  -7.214  -10.006 1.00 0.00 ? 142 ARG A O    3  
ATOM 5327  C CB   . ARG A 1 91  ? 12.255  -9.688  -9.976  1.00 0.00 ? 142 ARG A CB   3  
ATOM 5328  C CG   . ARG A 1 91  ? 12.597  -10.264 -11.352 1.00 0.00 ? 142 ARG A CG   3  
ATOM 5329  C CD   . ARG A 1 91  ? 12.654  -11.781 -11.282 1.00 0.00 ? 142 ARG A CD   3  
ATOM 5330  N NE   . ARG A 1 91  ? 13.766  -12.190 -10.368 1.00 0.00 ? 142 ARG A NE   3  
ATOM 5331  C CZ   . ARG A 1 91  ? 15.015  -11.930 -10.642 1.00 0.00 ? 142 ARG A CZ   3  
ATOM 5332  N NH1  . ARG A 1 91  ? 15.359  -11.388 -11.782 1.00 0.00 ? 142 ARG A NH1  3  
ATOM 5333  N NH2  . ARG A 1 91  ? 15.932  -12.248 -9.781  1.00 0.00 ? 142 ARG A NH2  3  
ATOM 5334  H H    . ARG A 1 91  ? 10.693  -8.565  -11.772 1.00 0.00 ? 142 ARG A H    3  
ATOM 5335  H HA   . ARG A 1 91  ? 11.802  -7.761  -9.140  1.00 0.00 ? 142 ARG A HA   3  
ATOM 5336  H HB2  . ARG A 1 91  ? 13.075  -9.864  -9.289  1.00 0.00 ? 142 ARG A HB2  3  
ATOM 5337  H HB3  . ARG A 1 91  ? 11.355  -10.163 -9.602  1.00 0.00 ? 142 ARG A HB3  3  
ATOM 5338  H HG2  . ARG A 1 91  ? 11.833  -9.970  -12.058 1.00 0.00 ? 142 ARG A HG2  3  
ATOM 5339  H HG3  . ARG A 1 91  ? 13.554  -9.883  -11.674 1.00 0.00 ? 142 ARG A HG3  3  
ATOM 5340  H HD2  . ARG A 1 91  ? 11.747  -12.156 -10.868 1.00 0.00 ? 142 ARG A HD2  3  
ATOM 5341  H HD3  . ARG A 1 91  ? 12.768  -12.179 -12.288 1.00 0.00 ? 142 ARG A HD3  3  
ATOM 5342  H HE   . ARG A 1 91  ? 13.544  -12.639 -9.525  1.00 0.00 ? 142 ARG A HE   3  
ATOM 5343  H HH11 . ARG A 1 91  ? 14.659  -11.166 -12.466 1.00 0.00 ? 142 ARG A HH11 3  
ATOM 5344  H HH12 . ARG A 1 91  ? 16.323  -11.199 -11.973 1.00 0.00 ? 142 ARG A HH12 3  
ATOM 5345  H HH21 . ARG A 1 91  ? 15.676  -12.686 -8.917  1.00 0.00 ? 142 ARG A HH21 3  
ATOM 5346  H HH22 . ARG A 1 91  ? 16.893  -12.062 -9.983  1.00 0.00 ? 142 ARG A HH22 3  
ATOM 5347  N N    . GLY A 1 92  ? 13.258  -7.233  -11.997 1.00 0.00 ? 143 GLY A N    3  
ATOM 5348  C CA   . GLY A 1 92  ? 14.430  -6.569  -12.664 1.00 0.00 ? 143 GLY A CA   3  
ATOM 5349  C C    . GLY A 1 92  ? 14.039  -5.154  -13.106 1.00 0.00 ? 143 GLY A C    3  
ATOM 5350  O O    . GLY A 1 92  ? 14.634  -4.591  -14.002 1.00 0.00 ? 143 GLY A O    3  
ATOM 5351  H H    . GLY A 1 92  ? 12.475  -7.475  -12.533 1.00 0.00 ? 143 GLY A H    3  
ATOM 5352  H HA2  . GLY A 1 92  ? 15.271  -6.525  -11.981 1.00 0.00 ? 143 GLY A HA2  3  
ATOM 5353  H HA3  . GLY A 1 92  ? 14.711  -7.137  -13.537 1.00 0.00 ? 143 GLY A HA3  3  
ATOM 5354  N N    . LYS A 1 93  ? 13.037  -4.584  -12.495 1.00 0.00 ? 144 LYS A N    3  
ATOM 5355  C CA   . LYS A 1 93  ? 12.583  -3.222  -12.883 1.00 0.00 ? 144 LYS A CA   3  
ATOM 5356  C C    . LYS A 1 93  ? 12.056  -2.500  -11.643 1.00 0.00 ? 144 LYS A C    3  
ATOM 5357  O O    . LYS A 1 93  ? 11.957  -3.079  -10.578 1.00 0.00 ? 144 LYS A O    3  
ATOM 5358  C CB   . LYS A 1 93  ? 11.486  -3.356  -13.938 1.00 0.00 ? 144 LYS A CB   3  
ATOM 5359  C CG   . LYS A 1 93  ? 10.317  -4.150  -13.360 1.00 0.00 ? 144 LYS A CG   3  
ATOM 5360  C CD   . LYS A 1 93  ? 9.320   -4.504  -14.477 1.00 0.00 ? 144 LYS A CD   3  
ATOM 5361  C CE   . LYS A 1 93  ? 9.928   -5.552  -15.426 1.00 0.00 ? 144 LYS A CE   3  
ATOM 5362  N NZ   . LYS A 1 93  ? 8.841   -6.329  -16.079 1.00 0.00 ? 144 LYS A NZ   3  
ATOM 5363  H H    . LYS A 1 93  ? 12.570  -5.063  -11.786 1.00 0.00 ? 144 LYS A H    3  
ATOM 5364  H HA   . LYS A 1 93  ? 13.414  -2.663  -13.293 1.00 0.00 ? 144 LYS A HA   3  
ATOM 5365  H HB2  . LYS A 1 93  ? 11.150  -2.376  -14.237 1.00 0.00 ? 144 LYS A HB2  3  
ATOM 5366  H HB3  . LYS A 1 93  ? 11.886  -3.878  -14.793 1.00 0.00 ? 144 LYS A HB3  3  
ATOM 5367  H HG2  . LYS A 1 93  ? 10.696  -5.052  -12.904 1.00 0.00 ? 144 LYS A HG2  3  
ATOM 5368  H HG3  . LYS A 1 93  ? 9.820   -3.558  -12.612 1.00 0.00 ? 144 LYS A HG3  3  
ATOM 5369  H HD2  . LYS A 1 93  ? 8.415   -4.902  -14.039 1.00 0.00 ? 144 LYS A HD2  3  
ATOM 5370  H HD3  . LYS A 1 93  ? 9.078   -3.615  -15.037 1.00 0.00 ? 144 LYS A HD3  3  
ATOM 5371  H HE2  . LYS A 1 93  ? 10.510  -5.057  -16.188 1.00 0.00 ? 144 LYS A HE2  3  
ATOM 5372  H HE3  . LYS A 1 93  ? 10.562  -6.230  -14.875 1.00 0.00 ? 144 LYS A HE3  3  
ATOM 5373  H HZ1  . LYS A 1 93  ? 8.068   -6.490  -15.398 1.00 0.00 ? 144 LYS A HZ1  3  
ATOM 5374  H HZ2  . LYS A 1 93  ? 8.480   -5.799  -16.896 1.00 0.00 ? 144 LYS A HZ2  3  
ATOM 5375  H HZ3  . LYS A 1 93  ? 9.220   -7.244  -16.397 1.00 0.00 ? 144 LYS A HZ3  3  
ATOM 5376  N N    . SER A 1 94  ? 11.762  -1.230  -11.754 1.00 0.00 ? 145 SER A N    3  
ATOM 5377  C CA   . SER A 1 94  ? 11.289  -0.459  -10.561 1.00 0.00 ? 145 SER A CA   3  
ATOM 5378  C C    . SER A 1 94  ? 9.765   -0.554  -10.400 1.00 0.00 ? 145 SER A C    3  
ATOM 5379  O O    . SER A 1 94  ? 9.013   -0.461  -11.348 1.00 0.00 ? 145 SER A O    3  
ATOM 5380  C CB   . SER A 1 94  ? 11.704  1.011   -10.716 1.00 0.00 ? 145 SER A CB   3  
ATOM 5381  O OG   . SER A 1 94  ? 11.161  1.530   -11.924 1.00 0.00 ? 145 SER A OG   3  
ATOM 5382  H H    . SER A 1 94  ? 11.880  -0.777  -12.612 1.00 0.00 ? 145 SER A H    3  
ATOM 5383  H HA   . SER A 1 94  ? 11.753  -0.859  -9.676  1.00 0.00 ? 145 SER A HA   3  
ATOM 5384  H HB2  . SER A 1 94  ? 11.329  1.589   -9.887  1.00 0.00 ? 145 SER A HB2  3  
ATOM 5385  H HB3  . SER A 1 94  ? 12.784  1.081   -10.736 1.00 0.00 ? 145 SER A HB3  3  
ATOM 5386  H HG   . SER A 1 94  ? 10.656  2.318   -11.707 1.00 0.00 ? 145 SER A HG   3  
ATOM 5387  N N    . PHE A 1 95  ? 9.334   -0.730  -9.174  1.00 0.00 ? 146 PHE A N    3  
ATOM 5388  C CA   . PHE A 1 95  ? 7.885   -0.825  -8.843  1.00 0.00 ? 146 PHE A CA   3  
ATOM 5389  C C    . PHE A 1 95  ? 7.395   0.582   -8.507  1.00 0.00 ? 146 PHE A C    3  
ATOM 5390  O O    . PHE A 1 95  ? 8.045   1.301   -7.771  1.00 0.00 ? 146 PHE A O    3  
ATOM 5391  C CB   . PHE A 1 95  ? 7.770   -1.753  -7.630  1.00 0.00 ? 146 PHE A CB   3  
ATOM 5392  C CG   . PHE A 1 95  ? 6.371   -2.291  -7.490  1.00 0.00 ? 146 PHE A CG   3  
ATOM 5393  C CD1  . PHE A 1 95  ? 5.813   -3.070  -8.510  1.00 0.00 ? 146 PHE A CD1  3  
ATOM 5394  C CD2  . PHE A 1 95  ? 5.638   -2.033  -6.327  1.00 0.00 ? 146 PHE A CD2  3  
ATOM 5395  C CE1  . PHE A 1 95  ? 4.527   -3.591  -8.366  1.00 0.00 ? 146 PHE A CE1  3  
ATOM 5396  C CE2  . PHE A 1 95  ? 4.353   -2.550  -6.184  1.00 0.00 ? 146 PHE A CE2  3  
ATOM 5397  C CZ   . PHE A 1 95  ? 3.791   -3.330  -7.204  1.00 0.00 ? 146 PHE A CZ   3  
ATOM 5398  H H    . PHE A 1 95  ? 9.984   -0.787  -8.446  1.00 0.00 ? 146 PHE A H    3  
ATOM 5399  H HA   . PHE A 1 95  ? 7.325   -1.213  -9.674  1.00 0.00 ? 146 PHE A HA   3  
ATOM 5400  H HB2  . PHE A 1 95  ? 8.451   -2.576  -7.751  1.00 0.00 ? 146 PHE A HB2  3  
ATOM 5401  H HB3  . PHE A 1 95  ? 8.042   -1.210  -6.742  1.00 0.00 ? 146 PHE A HB3  3  
ATOM 5402  H HD1  . PHE A 1 95  ? 6.376   -3.276  -9.409  1.00 0.00 ? 146 PHE A HD1  3  
ATOM 5403  H HD2  . PHE A 1 95  ? 6.064   -1.433  -5.539  1.00 0.00 ? 146 PHE A HD2  3  
ATOM 5404  H HE1  . PHE A 1 95  ? 4.097   -4.183  -9.157  1.00 0.00 ? 146 PHE A HE1  3  
ATOM 5405  H HE2  . PHE A 1 95  ? 3.796   -2.348  -5.285  1.00 0.00 ? 146 PHE A HE2  3  
ATOM 5406  H HZ   . PHE A 1 95  ? 2.799   -3.729  -7.093  1.00 0.00 ? 146 PHE A HZ   3  
ATOM 5407  N N    . THR A 1 96  ? 6.281   1.006   -9.070  1.00 0.00 ? 147 THR A N    3  
ATOM 5408  C CA   . THR A 1 96  ? 5.794   2.401   -8.809  1.00 0.00 ? 147 THR A CA   3  
ATOM 5409  C C    . THR A 1 96  ? 4.412   2.395   -8.167  1.00 0.00 ? 147 THR A C    3  
ATOM 5410  O O    . THR A 1 96  ? 3.478   1.781   -8.651  1.00 0.00 ? 147 THR A O    3  
ATOM 5411  C CB   . THR A 1 96  ? 5.738   3.143   -10.147 1.00 0.00 ? 147 THR A CB   3  
ATOM 5412  O OG1  . THR A 1 96  ? 6.999   3.036   -10.777 1.00 0.00 ? 147 THR A OG1  3  
ATOM 5413  C CG2  . THR A 1 96  ? 5.417   4.619   -9.935  1.00 0.00 ? 147 THR A CG2  3  
ATOM 5414  H H    . THR A 1 96  ? 5.790   0.424   -9.683  1.00 0.00 ? 147 THR A H    3  
ATOM 5415  H HA   . THR A 1 96  ? 6.478   2.921   -8.156  1.00 0.00 ? 147 THR A HA   3  
ATOM 5416  H HB   . THR A 1 96  ? 4.983   2.707   -10.776 1.00 0.00 ? 147 THR A HB   3  
ATOM 5417  H HG1  . THR A 1 96  ? 7.616   3.604   -10.305 1.00 0.00 ? 147 THR A HG1  3  
ATOM 5418  H HG21 . THR A 1 96  ? 4.576   4.715   -9.262  1.00 0.00 ? 147 THR A HG21 3  
ATOM 5419  H HG22 . THR A 1 96  ? 6.278   5.117   -9.516  1.00 0.00 ? 147 THR A HG22 3  
ATOM 5420  H HG23 . THR A 1 96  ? 5.167   5.067   -10.885 1.00 0.00 ? 147 THR A HG23 3  
ATOM 5421  N N    . LEU A 1 97  ? 4.296   3.126   -7.088  1.00 0.00 ? 148 LEU A N    3  
ATOM 5422  C CA   . LEU A 1 97  ? 3.011   3.257   -6.342  1.00 0.00 ? 148 LEU A CA   3  
ATOM 5423  C C    . LEU A 1 97  ? 2.605   4.743   -6.368  1.00 0.00 ? 148 LEU A C    3  
ATOM 5424  O O    . LEU A 1 97  ? 3.422   5.612   -6.137  1.00 0.00 ? 148 LEU A O    3  
ATOM 5425  C CB   . LEU A 1 97  ? 3.258   2.774   -4.881  1.00 0.00 ? 148 LEU A CB   3  
ATOM 5426  C CG   . LEU A 1 97  ? 2.598   1.393   -4.623  1.00 0.00 ? 148 LEU A CG   3  
ATOM 5427  C CD1  . LEU A 1 97  ? 3.338   0.650   -3.498  1.00 0.00 ? 148 LEU A CD1  3  
ATOM 5428  C CD2  . LEU A 1 97  ? 1.119   1.580   -4.226  1.00 0.00 ? 148 LEU A CD2  3  
ATOM 5429  H H    . LEU A 1 97  ? 5.084   3.617   -6.765  1.00 0.00 ? 148 LEU A H    3  
ATOM 5430  H HA   . LEU A 1 97  ? 2.246   2.666   -6.814  1.00 0.00 ? 148 LEU A HA   3  
ATOM 5431  H HB2  . LEU A 1 97  ? 4.328   2.687   -4.727  1.00 0.00 ? 148 LEU A HB2  3  
ATOM 5432  H HB3  . LEU A 1 97  ? 2.860   3.494   -4.179  1.00 0.00 ? 148 LEU A HB3  3  
ATOM 5433  H HG   . LEU A 1 97  ? 2.656   0.802   -5.518  1.00 0.00 ? 148 LEU A HG   3  
ATOM 5434  H HD11 . LEU A 1 97  ? 3.568   1.341   -2.701  1.00 0.00 ? 148 LEU A HD11 3  
ATOM 5435  H HD12 . LEU A 1 97  ? 2.706   -0.143  -3.114  1.00 0.00 ? 148 LEU A HD12 3  
ATOM 5436  H HD13 . LEU A 1 97  ? 4.257   0.226   -3.886  1.00 0.00 ? 148 LEU A HD13 3  
ATOM 5437  H HD21 . LEU A 1 97  ? 0.720   2.461   -4.701  1.00 0.00 ? 148 LEU A HD21 3  
ATOM 5438  H HD22 . LEU A 1 97  ? 0.555   0.715   -4.544  1.00 0.00 ? 148 LEU A HD22 3  
ATOM 5439  H HD23 . LEU A 1 97  ? 1.036   1.682   -3.155  1.00 0.00 ? 148 LEU A HD23 3  
ATOM 5440  N N    . THR A 1 98  ? 1.357   5.042   -6.650  1.00 0.00 ? 149 THR A N    3  
ATOM 5441  C CA   . THR A 1 98  ? 0.908   6.476   -6.687  1.00 0.00 ? 149 THR A CA   3  
ATOM 5442  C C    . THR A 1 98  ? -0.464  6.591   -6.030  1.00 0.00 ? 149 THR A C    3  
ATOM 5443  O O    . THR A 1 98  ? -1.395  5.908   -6.399  1.00 0.00 ? 149 THR A O    3  
ATOM 5444  C CB   . THR A 1 98  ? 0.801   6.952   -8.142  1.00 0.00 ? 149 THR A CB   3  
ATOM 5445  O OG1  . THR A 1 98  ? -0.421  6.492   -8.700  1.00 0.00 ? 149 THR A OG1  3  
ATOM 5446  C CG2  . THR A 1 98  ? 1.981   6.403   -8.952  1.00 0.00 ? 149 THR A CG2  3  
ATOM 5447  H H    . THR A 1 98  ? 0.717   4.326   -6.835  1.00 0.00 ? 149 THR A H    3  
ATOM 5448  H HA   . THR A 1 98  ? 1.612   7.101   -6.154  1.00 0.00 ? 149 THR A HA   3  
ATOM 5449  H HB   . THR A 1 98  ? 0.824   8.029   -8.171  1.00 0.00 ? 149 THR A HB   3  
ATOM 5450  H HG1  . THR A 1 98  ? -1.068  6.431   -7.992  1.00 0.00 ? 149 THR A HG1  3  
ATOM 5451  H HG21 . THR A 1 98  ? 2.908   6.649   -8.454  1.00 0.00 ? 149 THR A HG21 3  
ATOM 5452  H HG22 . THR A 1 98  ? 1.893   5.330   -9.035  1.00 0.00 ? 149 THR A HG22 3  
ATOM 5453  H HG23 . THR A 1 98  ? 1.974   6.843   -9.943  1.00 0.00 ? 149 THR A HG23 3  
ATOM 5454  N N    . ILE A 1 99  ? -0.589  7.467   -5.069  1.00 0.00 ? 150 ILE A N    3  
ATOM 5455  C CA   . ILE A 1 99  ? -1.890  7.673   -4.359  1.00 0.00 ? 150 ILE A CA   3  
ATOM 5456  C C    . ILE A 1 99  ? -2.343  9.121   -4.569  1.00 0.00 ? 150 ILE A C    3  
ATOM 5457  O O    . ILE A 1 99  ? -1.577  10.040  -4.363  1.00 0.00 ? 150 ILE A O    3  
ATOM 5458  C CB   . ILE A 1 99  ? -1.696  7.429   -2.855  1.00 0.00 ? 150 ILE A CB   3  
ATOM 5459  C CG1  . ILE A 1 99  ? -1.031  6.067   -2.620  1.00 0.00 ? 150 ILE A CG1  3  
ATOM 5460  C CG2  . ILE A 1 99  ? -3.057  7.441   -2.149  1.00 0.00 ? 150 ILE A CG2  3  
ATOM 5461  C CD1  . ILE A 1 99  ? -0.614  5.938   -1.150  1.00 0.00 ? 150 ILE A CD1  3  
ATOM 5462  H H    . ILE A 1 99  ? 0.187   8.002   -4.813  1.00 0.00 ? 150 ILE A H    3  
ATOM 5463  H HA   . ILE A 1 99  ? -2.633  6.997   -4.745  1.00 0.00 ? 150 ILE A HA   3  
ATOM 5464  H HB   . ILE A 1 99  ? -1.073  8.208   -2.447  1.00 0.00 ? 150 ILE A HB   3  
ATOM 5465  H HG12 . ILE A 1 99  ? -1.731  5.281   -2.863  1.00 0.00 ? 150 ILE A HG12 3  
ATOM 5466  H HG13 . ILE A 1 99  ? -0.154  5.978   -3.250  1.00 0.00 ? 150 ILE A HG13 3  
ATOM 5467  H HG21 . ILE A 1 99  ? -3.695  6.684   -2.587  1.00 0.00 ? 150 ILE A HG21 3  
ATOM 5468  H HG22 . ILE A 1 99  ? -2.917  7.232   -1.097  1.00 0.00 ? 150 ILE A HG22 3  
ATOM 5469  H HG23 . ILE A 1 99  ? -3.521  8.407   -2.264  1.00 0.00 ? 150 ILE A HG23 3  
ATOM 5470  H HD11 . ILE A 1 99  ? -1.359  6.398   -0.512  1.00 0.00 ? 150 ILE A HD11 3  
ATOM 5471  H HD12 . ILE A 1 99  ? -0.516  4.895   -0.892  1.00 0.00 ? 150 ILE A HD12 3  
ATOM 5472  H HD13 . ILE A 1 99  ? 0.335   6.432   -1.005  1.00 0.00 ? 150 ILE A HD13 3  
ATOM 5473  N N    . THR A 1 100 ? -3.575  9.345   -4.972  1.00 0.00 ? 151 THR A N    3  
ATOM 5474  C CA   . THR A 1 100 ? -4.059  10.754  -5.178  1.00 0.00 ? 151 THR A CA   3  
ATOM 5475  C C    . THR A 1 100 ? -5.449  10.924  -4.572  1.00 0.00 ? 151 THR A C    3  
ATOM 5476  O O    . THR A 1 100 ? -6.311  10.078  -4.717  1.00 0.00 ? 151 THR A O    3  
ATOM 5477  C CB   . THR A 1 100 ? -4.142  11.080  -6.667  1.00 0.00 ? 151 THR A CB   3  
ATOM 5478  O OG1  . THR A 1 100 ? -4.942  10.106  -7.330  1.00 0.00 ? 151 THR A OG1  3  
ATOM 5479  C CG2  . THR A 1 100 ? -2.738  11.105  -7.266  1.00 0.00 ? 151 THR A CG2  3  
ATOM 5480  H H    . THR A 1 100 ? -4.183  8.591   -5.133  1.00 0.00 ? 151 THR A H    3  
ATOM 5481  H HA   . THR A 1 100 ? -3.382  11.452  -4.700  1.00 0.00 ? 151 THR A HA   3  
ATOM 5482  H HB   . THR A 1 100 ? -4.591  12.055  -6.784  1.00 0.00 ? 151 THR A HB   3  
ATOM 5483  H HG1  . THR A 1 100 ? -5.469  10.561  -7.993  1.00 0.00 ? 151 THR A HG1  3  
ATOM 5484  H HG21 . THR A 1 100 ? -2.215  10.197  -7.006  1.00 0.00 ? 151 THR A HG21 3  
ATOM 5485  H HG22 . THR A 1 100 ? -2.810  11.186  -8.343  1.00 0.00 ? 151 THR A HG22 3  
ATOM 5486  H HG23 . THR A 1 100 ? -2.201  11.955  -6.873  1.00 0.00 ? 151 THR A HG23 3  
ATOM 5487  N N    . VAL A 1 101 ? -5.673  12.027  -3.901  1.00 0.00 ? 152 VAL A N    3  
ATOM 5488  C CA   . VAL A 1 101 ? -7.009  12.293  -3.277  1.00 0.00 ? 152 VAL A CA   3  
ATOM 5489  C C    . VAL A 1 101 ? -7.550  13.643  -3.735  1.00 0.00 ? 152 VAL A C    3  
ATOM 5490  O O    . VAL A 1 101 ? -6.873  14.656  -3.670  1.00 0.00 ? 152 VAL A O    3  
ATOM 5491  C CB   . VAL A 1 101 ? -6.852  12.302  -1.760  1.00 0.00 ? 152 VAL A CB   3  
ATOM 5492  C CG1  . VAL A 1 101 ? -8.236  12.376  -1.094  1.00 0.00 ? 152 VAL A CG1  3  
ATOM 5493  C CG2  . VAL A 1 101 ? -6.112  11.016  -1.327  1.00 0.00 ? 152 VAL A CG2  3  
ATOM 5494  H H    . VAL A 1 101 ? -4.955  12.688  -3.811  1.00 0.00 ? 152 VAL A H    3  
ATOM 5495  H HA   . VAL A 1 101 ? -7.711  11.519  -3.553  1.00 0.00 ? 152 VAL A HA   3  
ATOM 5496  H HB   . VAL A 1 101 ? -6.274  13.168  -1.473  1.00 0.00 ? 152 VAL A HB   3  
ATOM 5497  H HG11 . VAL A 1 101 ? -8.860  13.082  -1.619  1.00 0.00 ? 152 VAL A HG11 3  
ATOM 5498  H HG12 . VAL A 1 101 ? -8.702  11.404  -1.122  1.00 0.00 ? 152 VAL A HG12 3  
ATOM 5499  H HG13 . VAL A 1 101 ? -8.124  12.689  -0.069  1.00 0.00 ? 152 VAL A HG13 3  
ATOM 5500  H HG21 . VAL A 1 101 ? -6.323  10.217  -2.026  1.00 0.00 ? 152 VAL A HG21 3  
ATOM 5501  H HG22 . VAL A 1 101 ? -5.044  11.206  -1.310  1.00 0.00 ? 152 VAL A HG22 3  
ATOM 5502  H HG23 . VAL A 1 101 ? -6.439  10.718  -0.347  1.00 0.00 ? 152 VAL A HG23 3  
ATOM 5503  N N    . PHE A 1 102 ? -8.785  13.653  -4.176  1.00 0.00 ? 153 PHE A N    3  
ATOM 5504  C CA   . PHE A 1 102 ? -9.436  14.909  -4.637  1.00 0.00 ? 153 PHE A CA   3  
ATOM 5505  C C    . PHE A 1 102 ? -10.291 15.495  -3.503  1.00 0.00 ? 153 PHE A C    3  
ATOM 5506  O O    . PHE A 1 102 ? -11.502 15.560  -3.587  1.00 0.00 ? 153 PHE A O    3  
ATOM 5507  C CB   . PHE A 1 102 ? -10.315 14.586  -5.852  1.00 0.00 ? 153 PHE A CB   3  
ATOM 5508  C CG   . PHE A 1 102 ? -9.609  13.566  -6.722  1.00 0.00 ? 153 PHE A CG   3  
ATOM 5509  C CD1  . PHE A 1 102 ? -8.579  13.969  -7.582  1.00 0.00 ? 153 PHE A CD1  3  
ATOM 5510  C CD2  . PHE A 1 102 ? -9.972  12.214  -6.656  1.00 0.00 ? 153 PHE A CD2  3  
ATOM 5511  C CE1  . PHE A 1 102 ? -7.920  13.023  -8.379  1.00 0.00 ? 153 PHE A CE1  3  
ATOM 5512  C CE2  . PHE A 1 102 ? -9.311  11.268  -7.453  1.00 0.00 ? 153 PHE A CE2  3  
ATOM 5513  C CZ   . PHE A 1 102 ? -8.285  11.675  -8.314  1.00 0.00 ? 153 PHE A CZ   3  
ATOM 5514  H H    . PHE A 1 102 ? -9.293  12.815  -4.192  1.00 0.00 ? 153 PHE A H    3  
ATOM 5515  H HA   . PHE A 1 102 ? -8.684  15.628  -4.921  1.00 0.00 ? 153 PHE A HA   3  
ATOM 5516  H HB2  . PHE A 1 102 ? -11.262 14.183  -5.516  1.00 0.00 ? 153 PHE A HB2  3  
ATOM 5517  H HB3  . PHE A 1 102 ? -10.489 15.486  -6.421  1.00 0.00 ? 153 PHE A HB3  3  
ATOM 5518  H HD1  . PHE A 1 102 ? -8.289  15.008  -7.630  1.00 0.00 ? 153 PHE A HD1  3  
ATOM 5519  H HD2  . PHE A 1 102 ? -10.766 11.899  -5.991  1.00 0.00 ? 153 PHE A HD2  3  
ATOM 5520  H HE1  . PHE A 1 102 ? -7.128  13.335  -9.042  1.00 0.00 ? 153 PHE A HE1  3  
ATOM 5521  H HE2  . PHE A 1 102 ? -9.590  10.228  -7.401  1.00 0.00 ? 153 PHE A HE2  3  
ATOM 5522  H HZ   . PHE A 1 102 ? -7.772  10.947  -8.925  1.00 0.00 ? 153 PHE A HZ   3  
ATOM 5523  N N    . THR A 1 103 ? -9.662  15.937  -2.445  1.00 0.00 ? 154 THR A N    3  
ATOM 5524  C CA   . THR A 1 103 ? -10.417 16.543  -1.313  1.00 0.00 ? 154 THR A CA   3  
ATOM 5525  C C    . THR A 1 103 ? -10.425 18.064  -1.550  1.00 0.00 ? 154 THR A C    3  
ATOM 5526  O O    . THR A 1 103 ? -10.384 18.500  -2.683  1.00 0.00 ? 154 THR A O    3  
ATOM 5527  C CB   . THR A 1 103 ? -9.714  16.171  0.004   1.00 0.00 ? 154 THR A CB   3  
ATOM 5528  O OG1  . THR A 1 103 ? -9.995  17.147  0.995   1.00 0.00 ? 154 THR A OG1  3  
ATOM 5529  C CG2  . THR A 1 103 ? -8.194  16.054  -0.216  1.00 0.00 ? 154 THR A CG2  3  
ATOM 5530  H H    . THR A 1 103 ? -8.683  15.880  -2.392  1.00 0.00 ? 154 THR A H    3  
ATOM 5531  H HA   . THR A 1 103 ? -11.437 16.173  -1.304  1.00 0.00 ? 154 THR A HA   3  
ATOM 5532  H HB   . THR A 1 103 ? -10.090 15.221  0.338   1.00 0.00 ? 154 THR A HB   3  
ATOM 5533  H HG1  . THR A 1 103 ? -9.373  17.029  1.713   1.00 0.00 ? 154 THR A HG1  3  
ATOM 5534  H HG21 . THR A 1 103 ? -7.868  16.801  -0.925  1.00 0.00 ? 154 THR A HG21 3  
ATOM 5535  H HG22 . THR A 1 103 ? -7.680  16.200  0.723   1.00 0.00 ? 154 THR A HG22 3  
ATOM 5536  H HG23 . THR A 1 103 ? -7.958  15.076  -0.601  1.00 0.00 ? 154 THR A HG23 3  
ATOM 5537  N N    . ASN A 1 104 ? -10.474 18.892  -0.536  1.00 0.00 ? 155 ASN A N    3  
ATOM 5538  C CA   . ASN A 1 104 ? -10.484 20.367  -0.809  1.00 0.00 ? 155 ASN A CA   3  
ATOM 5539  C C    . ASN A 1 104 ? -9.040  20.783  -1.108  1.00 0.00 ? 155 ASN A C    3  
ATOM 5540  O O    . ASN A 1 104 ? -8.785  21.483  -2.071  1.00 0.00 ? 155 ASN A O    3  
ATOM 5541  C CB   . ASN A 1 104 ? -11.054 21.136  0.413   1.00 0.00 ? 155 ASN A CB   3  
ATOM 5542  C CG   . ASN A 1 104 ? -12.280 21.964  0.008   1.00 0.00 ? 155 ASN A CG   3  
ATOM 5543  O OD1  . ASN A 1 104 ? -13.401 21.518  0.143   1.00 0.00 ? 155 ASN A OD1  3  
ATOM 5544  N ND2  . ASN A 1 104 ? -12.110 23.157  -0.491  1.00 0.00 ? 155 ASN A ND2  3  
ATOM 5545  H H    . ASN A 1 104 ? -10.507 18.556  0.382   1.00 0.00 ? 155 ASN A H    3  
ATOM 5546  H HA   . ASN A 1 104 ? -11.088 20.561  -1.688  1.00 0.00 ? 155 ASN A HA   3  
ATOM 5547  H HB2  . ASN A 1 104 ? -11.346 20.424  1.171   1.00 0.00 ? 155 ASN A HB2  3  
ATOM 5548  H HB3  . ASN A 1 104 ? -10.303 21.799  0.820   1.00 0.00 ? 155 ASN A HB3  3  
ATOM 5549  H HD21 . ASN A 1 104 ? -11.204 23.511  -0.607  1.00 0.00 ? 155 ASN A HD21 3  
ATOM 5550  H HD22 . ASN A 1 104 ? -12.884 23.703  -0.740  1.00 0.00 ? 155 ASN A HD22 3  
ATOM 5551  N N    . PRO A 1 105 ? -8.094  20.309  -0.343  1.00 0.00 ? 156 PRO A N    3  
ATOM 5552  C CA   . PRO A 1 105 ? -6.661  20.565  -0.578  1.00 0.00 ? 156 PRO A CA   3  
ATOM 5553  C C    . PRO A 1 105 ? -5.974  19.304  -1.156  1.00 0.00 ? 156 PRO A C    3  
ATOM 5554  O O    . PRO A 1 105 ? -5.196  18.670  -0.474  1.00 0.00 ? 156 PRO A O    3  
ATOM 5555  C CB   . PRO A 1 105 ? -6.166  20.826  0.851   1.00 0.00 ? 156 PRO A CB   3  
ATOM 5556  C CG   . PRO A 1 105 ? -7.059  19.981  1.736   1.00 0.00 ? 156 PRO A CG   3  
ATOM 5557  C CD   . PRO A 1 105 ? -8.241  19.503  0.867   1.00 0.00 ? 156 PRO A CD   3  
ATOM 5558  H HA   . PRO A 1 105 ? -6.503  21.431  -1.199  1.00 0.00 ? 156 PRO A HA   3  
ATOM 5559  H HB2  . PRO A 1 105 ? -5.128  20.525  0.953   1.00 0.00 ? 156 PRO A HB2  3  
ATOM 5560  H HB3  . PRO A 1 105 ? -6.280  21.873  1.103   1.00 0.00 ? 156 PRO A HB3  3  
ATOM 5561  H HG2  . PRO A 1 105 ? -6.509  19.128  2.124   1.00 0.00 ? 156 PRO A HG2  3  
ATOM 5562  H HG3  . PRO A 1 105 ? -7.431  20.574  2.553   1.00 0.00 ? 156 PRO A HG3  3  
ATOM 5563  H HD2  . PRO A 1 105 ? -8.137  18.460  0.642   1.00 0.00 ? 156 PRO A HD2  3  
ATOM 5564  H HD3  . PRO A 1 105 ? -9.178  19.703  1.349   1.00 0.00 ? 156 PRO A HD3  3  
ATOM 5565  N N    . PRO A 1 106 ? -6.268  18.916  -2.390  1.00 0.00 ? 157 PRO A N    3  
ATOM 5566  C CA   . PRO A 1 106 ? -5.673  17.695  -3.017  1.00 0.00 ? 157 PRO A CA   3  
ATOM 5567  C C    . PRO A 1 106 ? -4.269  17.354  -2.501  1.00 0.00 ? 157 PRO A C    3  
ATOM 5568  O O    . PRO A 1 106 ? -3.387  18.189  -2.468  1.00 0.00 ? 157 PRO A O    3  
ATOM 5569  C CB   . PRO A 1 106 ? -5.625  18.076  -4.491  1.00 0.00 ? 157 PRO A CB   3  
ATOM 5570  C CG   . PRO A 1 106 ? -6.845  18.926  -4.705  1.00 0.00 ? 157 PRO A CG   3  
ATOM 5571  C CD   . PRO A 1 106 ? -7.187  19.578  -3.342  1.00 0.00 ? 157 PRO A CD   3  
ATOM 5572  H HA   . PRO A 1 106 ? -6.333  16.853  -2.888  1.00 0.00 ? 157 PRO A HA   3  
ATOM 5573  H HB2  . PRO A 1 106 ? -4.723  18.640  -4.697  1.00 0.00 ? 157 PRO A HB2  3  
ATOM 5574  H HB3  . PRO A 1 106 ? -5.668  17.190  -5.111  1.00 0.00 ? 157 PRO A HB3  3  
ATOM 5575  H HG2  . PRO A 1 106 ? -6.638  19.687  -5.449  1.00 0.00 ? 157 PRO A HG2  3  
ATOM 5576  H HG3  . PRO A 1 106 ? -7.672  18.309  -5.033  1.00 0.00 ? 157 PRO A HG3  3  
ATOM 5577  H HD2  . PRO A 1 106 ? -7.010  20.643  -3.374  1.00 0.00 ? 157 PRO A HD2  3  
ATOM 5578  H HD3  . PRO A 1 106 ? -8.213  19.371  -3.077  1.00 0.00 ? 157 PRO A HD3  3  
ATOM 5579  N N    . GLN A 1 107 ? -4.065  16.121  -2.100  1.00 0.00 ? 158 GLN A N    3  
ATOM 5580  C CA   . GLN A 1 107 ? -2.727  15.682  -1.584  1.00 0.00 ? 158 GLN A CA   3  
ATOM 5581  C C    . GLN A 1 107 ? -2.155  14.630  -2.527  1.00 0.00 ? 158 GLN A C    3  
ATOM 5582  O O    . GLN A 1 107 ? -2.852  13.737  -2.959  1.00 0.00 ? 158 GLN A O    3  
ATOM 5583  C CB   . GLN A 1 107 ? -2.917  15.092  -0.184  1.00 0.00 ? 158 GLN A CB   3  
ATOM 5584  C CG   . GLN A 1 107 ? -3.427  16.196  0.743   1.00 0.00 ? 158 GLN A CG   3  
ATOM 5585  C CD   . GLN A 1 107 ? -2.378  17.303  0.850   1.00 0.00 ? 158 GLN A CD   3  
ATOM 5586  O OE1  . GLN A 1 107 ? -1.201  17.061  0.669   1.00 0.00 ? 158 GLN A OE1  3  
ATOM 5587  N NE2  . GLN A 1 107 ? -2.758  18.513  1.136   1.00 0.00 ? 158 GLN A NE2  3  
ATOM 5588  H H    . GLN A 1 107 ? -4.802  15.471  -2.147  1.00 0.00 ? 158 GLN A H    3  
ATOM 5589  H HA   . GLN A 1 107 ? -2.038  16.513  -1.532  1.00 0.00 ? 158 GLN A HA   3  
ATOM 5590  H HB2  . GLN A 1 107 ? -3.642  14.293  -0.228  1.00 0.00 ? 158 GLN A HB2  3  
ATOM 5591  H HB3  . GLN A 1 107 ? -1.976  14.710  0.189   1.00 0.00 ? 158 GLN A HB3  3  
ATOM 5592  H HG2  . GLN A 1 107 ? -4.337  16.604  0.335   1.00 0.00 ? 158 GLN A HG2  3  
ATOM 5593  H HG3  . GLN A 1 107 ? -3.622  15.797  1.720   1.00 0.00 ? 158 GLN A HG3  3  
ATOM 5594  H HE21 . GLN A 1 107 ? -3.705  18.704  1.281   1.00 0.00 ? 158 GLN A HE21 3  
ATOM 5595  H HE22 . GLN A 1 107 ? -2.097  19.233  1.208   1.00 0.00 ? 158 GLN A HE22 3  
ATOM 5596  N N    . VAL A 1 108 ? -0.885  14.723  -2.840  1.00 0.00 ? 159 VAL A N    3  
ATOM 5597  C CA   . VAL A 1 108 ? -0.250  13.720  -3.753  1.00 0.00 ? 159 VAL A CA   3  
ATOM 5598  C C    . VAL A 1 108 ? 0.706   12.861  -2.931  1.00 0.00 ? 159 VAL A C    3  
ATOM 5599  O O    . VAL A 1 108 ? 1.531   13.362  -2.195  1.00 0.00 ? 159 VAL A O    3  
ATOM 5600  C CB   . VAL A 1 108 ? 0.539   14.446  -4.858  1.00 0.00 ? 159 VAL A CB   3  
ATOM 5601  C CG1  . VAL A 1 108 ? 1.101   13.422  -5.856  1.00 0.00 ? 159 VAL A CG1  3  
ATOM 5602  C CG2  . VAL A 1 108 ? -0.382  15.420  -5.605  1.00 0.00 ? 159 VAL A CG2  3  
ATOM 5603  H H    . VAL A 1 108 ? -0.340  15.449  -2.468  1.00 0.00 ? 159 VAL A H    3  
ATOM 5604  H HA   . VAL A 1 108 ? -1.002  13.088  -4.201  1.00 0.00 ? 159 VAL A HA   3  
ATOM 5605  H HB   . VAL A 1 108 ? 1.358   14.992  -4.410  1.00 0.00 ? 159 VAL A HB   3  
ATOM 5606  H HG11 . VAL A 1 108 ? 0.349   12.674  -6.069  1.00 0.00 ? 159 VAL A HG11 3  
ATOM 5607  H HG12 . VAL A 1 108 ? 1.379   13.924  -6.774  1.00 0.00 ? 159 VAL A HG12 3  
ATOM 5608  H HG13 . VAL A 1 108 ? 1.974   12.946  -5.432  1.00 0.00 ? 159 VAL A HG13 3  
ATOM 5609  H HG21 . VAL A 1 108 ? -0.944  16.006  -4.896  1.00 0.00 ? 159 VAL A HG21 3  
ATOM 5610  H HG22 . VAL A 1 108 ? 0.219   16.078  -6.219  1.00 0.00 ? 159 VAL A HG22 3  
ATOM 5611  H HG23 . VAL A 1 108 ? -1.063  14.864  -6.234  1.00 0.00 ? 159 VAL A HG23 3  
ATOM 5612  N N    . ALA A 1 109 ? 0.603   11.566  -3.048  1.00 0.00 ? 160 ALA A N    3  
ATOM 5613  C CA   . ALA A 1 109 ? 1.504   10.663  -2.268  1.00 0.00 ? 160 ALA A CA   3  
ATOM 5614  C C    . ALA A 1 109 ? 1.960   9.513   -3.164  1.00 0.00 ? 160 ALA A C    3  
ATOM 5615  O O    . ALA A 1 109 ? 1.166   8.892   -3.842  1.00 0.00 ? 160 ALA A O    3  
ATOM 5616  C CB   . ALA A 1 109 ? 0.738   10.116  -1.058  1.00 0.00 ? 160 ALA A CB   3  
ATOM 5617  H H    . ALA A 1 109 ? -0.079  11.181  -3.641  1.00 0.00 ? 160 ALA A H    3  
ATOM 5618  H HA   . ALA A 1 109 ? 2.368   11.210  -1.931  1.00 0.00 ? 160 ALA A HA   3  
ATOM 5619  H HB1  . ALA A 1 109 ? -0.318  10.101  -1.283  1.00 0.00 ? 160 ALA A HB1  3  
ATOM 5620  H HB2  . ALA A 1 109 ? 1.073   9.115   -0.826  1.00 0.00 ? 160 ALA A HB2  3  
ATOM 5621  H HB3  . ALA A 1 109 ? 0.909   10.755  -0.205  1.00 0.00 ? 160 ALA A HB3  3  
ATOM 5622  N N    . THR A 1 110 ? 3.234   9.220   -3.169  1.00 0.00 ? 161 THR A N    3  
ATOM 5623  C CA   . THR A 1 110 ? 3.741   8.103   -4.024  1.00 0.00 ? 161 THR A CA   3  
ATOM 5624  C C    . THR A 1 110 ? 4.861   7.352   -3.301  1.00 0.00 ? 161 THR A C    3  
ATOM 5625  O O    . THR A 1 110 ? 5.461   7.842   -2.362  1.00 0.00 ? 161 THR A O    3  
ATOM 5626  C CB   . THR A 1 110 ? 4.266   8.658   -5.352  1.00 0.00 ? 161 THR A CB   3  
ATOM 5627  O OG1  . THR A 1 110 ? 5.573   9.181   -5.158  1.00 0.00 ? 161 THR A OG1  3  
ATOM 5628  C CG2  . THR A 1 110 ? 3.343   9.776   -5.850  1.00 0.00 ? 161 THR A CG2  3  
ATOM 5629  H H    . THR A 1 110 ? 3.855   9.730   -2.607  1.00 0.00 ? 161 THR A H    3  
ATOM 5630  H HA   . THR A 1 110 ? 2.935   7.406   -4.224  1.00 0.00 ? 161 THR A HA   3  
ATOM 5631  H HB   . THR A 1 110 ? 4.297   7.866   -6.088  1.00 0.00 ? 161 THR A HB   3  
ATOM 5632  H HG1  . THR A 1 110 ? 5.490   10.117  -4.956  1.00 0.00 ? 161 THR A HG1  3  
ATOM 5633  H HG21 . THR A 1 110 ? 2.340   9.394   -5.956  1.00 0.00 ? 161 THR A HG21 3  
ATOM 5634  H HG22 . THR A 1 110 ? 3.344   10.588  -5.143  1.00 0.00 ? 161 THR A HG22 3  
ATOM 5635  H HG23 . THR A 1 110 ? 3.695   10.137  -6.807  1.00 0.00 ? 161 THR A HG23 3  
ATOM 5636  N N    . TYR A 1 111 ? 5.131   6.158   -3.739  1.00 0.00 ? 162 TYR A N    3  
ATOM 5637  C CA   . TYR A 1 111 ? 6.197   5.331   -3.112  1.00 0.00 ? 162 TYR A CA   3  
ATOM 5638  C C    . TYR A 1 111 ? 6.953   4.589   -4.224  1.00 0.00 ? 162 TYR A C    3  
ATOM 5639  O O    . TYR A 1 111 ? 6.358   3.864   -5.000  1.00 0.00 ? 162 TYR A O    3  
ATOM 5640  C CB   . TYR A 1 111 ? 5.510   4.358   -2.159  1.00 0.00 ? 162 TYR A CB   3  
ATOM 5641  C CG   . TYR A 1 111 ? 6.482   3.319   -1.667  1.00 0.00 ? 162 TYR A CG   3  
ATOM 5642  C CD1  . TYR A 1 111 ? 7.374   3.627   -0.631  1.00 0.00 ? 162 TYR A CD1  3  
ATOM 5643  C CD2  . TYR A 1 111 ? 6.473   2.043   -2.231  1.00 0.00 ? 162 TYR A CD2  3  
ATOM 5644  C CE1  . TYR A 1 111 ? 8.253   2.650   -0.158  1.00 0.00 ? 162 TYR A CE1  3  
ATOM 5645  C CE2  . TYR A 1 111 ? 7.353   1.069   -1.763  1.00 0.00 ? 162 TYR A CE2  3  
ATOM 5646  C CZ   . TYR A 1 111 ? 8.242   1.370   -0.725  1.00 0.00 ? 162 TYR A CZ   3  
ATOM 5647  O OH   . TYR A 1 111 ? 9.104   0.398   -0.254  1.00 0.00 ? 162 TYR A OH   3  
ATOM 5648  H H    . TYR A 1 111 ? 4.616   5.796   -4.491  1.00 0.00 ? 162 TYR A H    3  
ATOM 5649  H HA   . TYR A 1 111 ? 6.883   5.961   -2.562  1.00 0.00 ? 162 TYR A HA   3  
ATOM 5650  H HB2  . TYR A 1 111 ? 5.119   4.914   -1.314  1.00 0.00 ? 162 TYR A HB2  3  
ATOM 5651  H HB3  . TYR A 1 111 ? 4.692   3.876   -2.674  1.00 0.00 ? 162 TYR A HB3  3  
ATOM 5652  H HD1  . TYR A 1 111 ? 7.379   4.618   -0.199  1.00 0.00 ? 162 TYR A HD1  3  
ATOM 5653  H HD2  . TYR A 1 111 ? 5.793   1.816   -3.033  1.00 0.00 ? 162 TYR A HD2  3  
ATOM 5654  H HE1  . TYR A 1 111 ? 8.941   2.881   0.641   1.00 0.00 ? 162 TYR A HE1  3  
ATOM 5655  H HE2  . TYR A 1 111 ? 7.346   0.080   -2.198  1.00 0.00 ? 162 TYR A HE2  3  
ATOM 5656  H HH   . TYR A 1 111 ? 8.609   -0.416  -0.135  1.00 0.00 ? 162 TYR A HH   3  
ATOM 5657  N N    . HIS A 1 112 ? 8.252   4.796   -4.330  1.00 0.00 ? 163 HIS A N    3  
ATOM 5658  C CA   . HIS A 1 112 ? 9.052   4.137   -5.427  1.00 0.00 ? 163 HIS A CA   3  
ATOM 5659  C C    . HIS A 1 112 ? 10.159  3.251   -4.845  1.00 0.00 ? 163 HIS A C    3  
ATOM 5660  O O    . HIS A 1 112 ? 11.148  3.733   -4.346  1.00 0.00 ? 163 HIS A O    3  
ATOM 5661  C CB   . HIS A 1 112 ? 9.694   5.241   -6.291  1.00 0.00 ? 163 HIS A CB   3  
ATOM 5662  C CG   . HIS A 1 112 ? 8.676   6.324   -6.527  1.00 0.00 ? 163 HIS A CG   3  
ATOM 5663  N ND1  . HIS A 1 112 ? 8.967   7.682   -6.419  1.00 0.00 ? 163 HIS A ND1  3  
ATOM 5664  C CD2  . HIS A 1 112 ? 7.351   6.249   -6.846  1.00 0.00 ? 163 HIS A CD2  3  
ATOM 5665  C CE1  . HIS A 1 112 ? 7.825   8.356   -6.669  1.00 0.00 ? 163 HIS A CE1  3  
ATOM 5666  N NE2  . HIS A 1 112 ? 6.812   7.531   -6.938  1.00 0.00 ? 163 HIS A NE2  3  
ATOM 5667  H H    . HIS A 1 112 ? 8.696   5.407   -3.706  1.00 0.00 ? 163 HIS A H    3  
ATOM 5668  H HA   . HIS A 1 112 ? 8.405   3.535   -6.049  1.00 0.00 ? 163 HIS A HA   3  
ATOM 5669  H HB2  . HIS A 1 112 ? 10.555  5.652   -5.780  1.00 0.00 ? 163 HIS A HB2  3  
ATOM 5670  H HB3  . HIS A 1 112 ? 10.001  4.820   -7.240  1.00 0.00 ? 163 HIS A HB3  3  
ATOM 5671  H HD1  . HIS A 1 112 ? 9.841   8.078   -6.206  1.00 0.00 ? 163 HIS A HD1  3  
ATOM 5672  H HD2  . HIS A 1 112 ? 6.805   5.329   -7.002  1.00 0.00 ? 163 HIS A HD2  3  
ATOM 5673  H HE1  . HIS A 1 112 ? 7.738   9.430   -6.640  1.00 0.00 ? 163 HIS A HE1  3  
ATOM 5674  N N    . ARG A 1 113 ? 10.004  1.953   -4.939  1.00 0.00 ? 164 ARG A N    3  
ATOM 5675  C CA   . ARG A 1 113 ? 11.055  1.015   -4.422  1.00 0.00 ? 164 ARG A CA   3  
ATOM 5676  C C    . ARG A 1 113 ? 10.979  -0.287  -5.221  1.00 0.00 ? 164 ARG A C    3  
ATOM 5677  O O    . ARG A 1 113 ? 10.183  -0.418  -6.130  1.00 0.00 ? 164 ARG A O    3  
ATOM 5678  C CB   . ARG A 1 113 ? 10.828  0.692   -2.938  1.00 0.00 ? 164 ARG A CB   3  
ATOM 5679  C CG   . ARG A 1 113 ? 11.111  1.903   -2.033  1.00 0.00 ? 164 ARG A CG   3  
ATOM 5680  C CD   . ARG A 1 113 ? 12.597  2.290   -2.094  1.00 0.00 ? 164 ARG A CD   3  
ATOM 5681  N NE   . ARG A 1 113 ? 12.976  3.064   -0.865  1.00 0.00 ? 164 ARG A NE   3  
ATOM 5682  C CZ   . ARG A 1 113 ? 12.273  4.086   -0.435  1.00 0.00 ? 164 ARG A CZ   3  
ATOM 5683  N NH1  . ARG A 1 113 ? 11.336  4.623   -1.170  1.00 0.00 ? 164 ARG A NH1  3  
ATOM 5684  N NH2  . ARG A 1 113 ? 12.555  4.616   0.721   1.00 0.00 ? 164 ARG A NH2  3  
ATOM 5685  H H    . ARG A 1 113 ? 9.200   1.586   -5.375  1.00 0.00 ? 164 ARG A H    3  
ATOM 5686  H HA   . ARG A 1 113 ? 12.030  1.456   -4.561  1.00 0.00 ? 164 ARG A HA   3  
ATOM 5687  H HB2  . ARG A 1 113 ? 9.803   0.384   -2.800  1.00 0.00 ? 164 ARG A HB2  3  
ATOM 5688  H HB3  . ARG A 1 113 ? 11.476  -0.122  -2.651  1.00 0.00 ? 164 ARG A HB3  3  
ATOM 5689  H HG2  . ARG A 1 113 ? 10.496  2.729   -2.345  1.00 0.00 ? 164 ARG A HG2  3  
ATOM 5690  H HG3  . ARG A 1 113 ? 10.862  1.650   -1.017  1.00 0.00 ? 164 ARG A HG3  3  
ATOM 5691  H HD2  . ARG A 1 113 ? 13.196  1.399   -2.117  1.00 0.00 ? 164 ARG A HD2  3  
ATOM 5692  H HD3  . ARG A 1 113 ? 12.794  2.870   -2.984  1.00 0.00 ? 164 ARG A HD3  3  
ATOM 5693  H HE   . ARG A 1 113 ? 13.745  2.763   -0.335  1.00 0.00 ? 164 ARG A HE   3  
ATOM 5694  H HH11 . ARG A 1 113 ? 11.142  4.264   -2.080  1.00 0.00 ? 164 ARG A HH11 3  
ATOM 5695  H HH12 . ARG A 1 113 ? 10.819  5.404   -0.823  1.00 0.00 ? 164 ARG A HH12 3  
ATOM 5696  H HH21 . ARG A 1 113 ? 13.306  4.251   1.269   1.00 0.00 ? 164 ARG A HH21 3  
ATOM 5697  H HH22 . ARG A 1 113 ? 12.010  5.382   1.063   1.00 0.00 ? 164 ARG A HH22 3  
ATOM 5698  N N    . ALA A 1 114 ? 11.785  -1.258  -4.888  1.00 0.00 ? 165 ALA A N    3  
ATOM 5699  C CA   . ALA A 1 114 ? 11.720  -2.549  -5.629  1.00 0.00 ? 165 ALA A CA   3  
ATOM 5700  C C    . ALA A 1 114 ? 10.326  -3.147  -5.414  1.00 0.00 ? 165 ALA A C    3  
ATOM 5701  O O    . ALA A 1 114 ? 9.365   -2.428  -5.231  1.00 0.00 ? 165 ALA A O    3  
ATOM 5702  C CB   . ALA A 1 114 ? 12.790  -3.509  -5.093  1.00 0.00 ? 165 ALA A CB   3  
ATOM 5703  H H    . ALA A 1 114 ? 12.414  -1.146  -4.146  1.00 0.00 ? 165 ALA A H    3  
ATOM 5704  H HA   . ALA A 1 114 ? 11.883  -2.374  -6.685  1.00 0.00 ? 165 ALA A HA   3  
ATOM 5705  H HB1  . ALA A 1 114 ? 13.744  -3.009  -5.076  1.00 0.00 ? 165 ALA A HB1  3  
ATOM 5706  H HB2  . ALA A 1 114 ? 12.527  -3.820  -4.093  1.00 0.00 ? 165 ALA A HB2  3  
ATOM 5707  H HB3  . ALA A 1 114 ? 12.851  -4.377  -5.736  1.00 0.00 ? 165 ALA A HB3  3  
ATOM 5708  N N    . ILE A 1 115 ? 10.198  -4.452  -5.439  1.00 0.00 ? 166 ILE A N    3  
ATOM 5709  C CA   . ILE A 1 115 ? 8.855   -5.086  -5.246  1.00 0.00 ? 166 ILE A CA   3  
ATOM 5710  C C    . ILE A 1 115 ? 8.790   -5.764  -3.861  1.00 0.00 ? 166 ILE A C    3  
ATOM 5711  O O    . ILE A 1 115 ? 9.663   -6.521  -3.479  1.00 0.00 ? 166 ILE A O    3  
ATOM 5712  C CB   . ILE A 1 115 ? 8.634   -6.104  -6.376  1.00 0.00 ? 166 ILE A CB   3  
ATOM 5713  C CG1  . ILE A 1 115 ? 7.162   -6.526  -6.406  1.00 0.00 ? 166 ILE A CG1  3  
ATOM 5714  C CG2  . ILE A 1 115 ? 9.518   -7.336  -6.165  1.00 0.00 ? 166 ILE A CG2  3  
ATOM 5715  C CD1  . ILE A 1 115 ? 6.874   -7.338  -7.671  1.00 0.00 ? 166 ILE A CD1  3  
ATOM 5716  H H    . ILE A 1 115 ? 10.985  -5.015  -5.598  1.00 0.00 ? 166 ILE A H    3  
ATOM 5717  H HA   . ILE A 1 115 ? 8.080   -4.333  -5.299  1.00 0.00 ? 166 ILE A HA   3  
ATOM 5718  H HB   . ILE A 1 115 ? 8.894   -5.643  -7.318  1.00 0.00 ? 166 ILE A HB   3  
ATOM 5719  H HG12 . ILE A 1 115 ? 6.946   -7.127  -5.540  1.00 0.00 ? 166 ILE A HG12 3  
ATOM 5720  H HG13 . ILE A 1 115 ? 6.534   -5.650  -6.401  1.00 0.00 ? 166 ILE A HG13 3  
ATOM 5721  H HG21 . ILE A 1 115 ? 10.533  -7.025  -5.972  1.00 0.00 ? 166 ILE A HG21 3  
ATOM 5722  H HG22 . ILE A 1 115 ? 9.146   -7.905  -5.325  1.00 0.00 ? 166 ILE A HG22 3  
ATOM 5723  H HG23 . ILE A 1 115 ? 9.495   -7.948  -7.055  1.00 0.00 ? 166 ILE A HG23 3  
ATOM 5724  H HD11 . ILE A 1 115 ? 7.524   -8.200  -7.704  1.00 0.00 ? 166 ILE A HD11 3  
ATOM 5725  H HD12 . ILE A 1 115 ? 5.843   -7.662  -7.659  1.00 0.00 ? 166 ILE A HD12 3  
ATOM 5726  H HD13 . ILE A 1 115 ? 7.046   -6.723  -8.542  1.00 0.00 ? 166 ILE A HD13 3  
ATOM 5727  N N    . LYS A 1 116 ? 7.752   -5.466  -3.109  1.00 0.00 ? 167 LYS A N    3  
ATOM 5728  C CA   . LYS A 1 116 ? 7.577   -6.034  -1.745  1.00 0.00 ? 167 LYS A CA   3  
ATOM 5729  C C    . LYS A 1 116 ? 7.017   -7.443  -1.831  1.00 0.00 ? 167 LYS A C    3  
ATOM 5730  O O    . LYS A 1 116 ? 6.916   -8.135  -0.835  1.00 0.00 ? 167 LYS A O    3  
ATOM 5731  C CB   . LYS A 1 116 ? 6.596   -5.140  -0.970  1.00 0.00 ? 167 LYS A CB   3  
ATOM 5732  C CG   . LYS A 1 116 ? 5.252   -5.083  -1.711  1.00 0.00 ? 167 LYS A CG   3  
ATOM 5733  C CD   . LYS A 1 116 ? 4.336   -4.047  -1.052  1.00 0.00 ? 167 LYS A CD   3  
ATOM 5734  C CE   . LYS A 1 116 ? 2.921   -4.162  -1.644  1.00 0.00 ? 167 LYS A CE   3  
ATOM 5735  N NZ   . LYS A 1 116 ? 2.919   -3.740  -3.081  1.00 0.00 ? 167 LYS A NZ   3  
ATOM 5736  H H    . LYS A 1 116 ? 7.076   -4.853  -3.443  1.00 0.00 ? 167 LYS A H    3  
ATOM 5737  H HA   . LYS A 1 116 ? 8.525   -6.052  -1.231  1.00 0.00 ? 167 LYS A HA   3  
ATOM 5738  H HB2  . LYS A 1 116 ? 6.442   -5.548  0.018   1.00 0.00 ? 167 LYS A HB2  3  
ATOM 5739  H HB3  . LYS A 1 116 ? 7.002   -4.144  -0.890  1.00 0.00 ? 167 LYS A HB3  3  
ATOM 5740  H HG2  . LYS A 1 116 ? 5.421   -4.806  -2.741  1.00 0.00 ? 167 LYS A HG2  3  
ATOM 5741  H HG3  . LYS A 1 116 ? 4.778   -6.051  -1.675  1.00 0.00 ? 167 LYS A HG3  3  
ATOM 5742  H HD2  . LYS A 1 116 ? 4.296   -4.236  0.015   1.00 0.00 ? 167 LYS A HD2  3  
ATOM 5743  H HD3  . LYS A 1 116 ? 4.726   -3.055  -1.227  1.00 0.00 ? 167 LYS A HD3  3  
ATOM 5744  H HE2  . LYS A 1 116 ? 2.591   -5.188  -1.576  1.00 0.00 ? 167 LYS A HE2  3  
ATOM 5745  H HE3  . LYS A 1 116 ? 2.247   -3.531  -1.085  1.00 0.00 ? 167 LYS A HE3  3  
ATOM 5746  H HZ1  . LYS A 1 116 ? 3.666   -4.250  -3.593  1.00 0.00 ? 167 LYS A HZ1  3  
ATOM 5747  H HZ2  . LYS A 1 116 ? 1.995   -3.964  -3.502  1.00 0.00 ? 167 LYS A HZ2  3  
ATOM 5748  H HZ3  . LYS A 1 116 ? 3.090   -2.716  -3.146  1.00 0.00 ? 167 LYS A HZ3  3  
ATOM 5749  N N    . ILE A 1 117 ? 6.628   -7.868  -3.008  1.00 0.00 ? 168 ILE A N    3  
ATOM 5750  C CA   . ILE A 1 117 ? 6.043   -9.233  -3.163  1.00 0.00 ? 168 ILE A CA   3  
ATOM 5751  C C    . ILE A 1 117 ? 6.746   -10.040 -4.252  1.00 0.00 ? 168 ILE A C    3  
ATOM 5752  O O    . ILE A 1 117 ? 7.094   -9.543  -5.307  1.00 0.00 ? 168 ILE A O    3  
ATOM 5753  C CB   . ILE A 1 117 ? 4.539   -9.152  -3.467  1.00 0.00 ? 168 ILE A CB   3  
ATOM 5754  C CG1  . ILE A 1 117 ? 4.012   -10.568 -3.701  1.00 0.00 ? 168 ILE A CG1  3  
ATOM 5755  C CG2  . ILE A 1 117 ? 4.281   -8.324  -4.717  1.00 0.00 ? 168 ILE A CG2  3  
ATOM 5756  C CD1  . ILE A 1 117 ? 2.483   -10.605 -3.623  1.00 0.00 ? 168 ILE A CD1  3  
ATOM 5757  H H    . ILE A 1 117 ? 6.703   -7.277  -3.786  1.00 0.00 ? 168 ILE A H    3  
ATOM 5758  H HA   . ILE A 1 117 ? 6.163   -9.767  -2.244  1.00 0.00 ? 168 ILE A HA   3  
ATOM 5759  H HB   . ILE A 1 117 ? 4.028   -8.705  -2.628  1.00 0.00 ? 168 ILE A HB   3  
ATOM 5760  H HG12 . ILE A 1 117 ? 4.322   -10.908 -4.678  1.00 0.00 ? 168 ILE A HG12 3  
ATOM 5761  H HG13 . ILE A 1 117 ? 4.426   -11.213 -2.965  1.00 0.00 ? 168 ILE A HG13 3  
ATOM 5762  H HG21 . ILE A 1 117 ? 4.920   -8.668  -5.520  1.00 0.00 ? 168 ILE A HG21 3  
ATOM 5763  H HG22 . ILE A 1 117 ? 3.249   -8.441  -5.005  1.00 0.00 ? 168 ILE A HG22 3  
ATOM 5764  H HG23 . ILE A 1 117 ? 4.479   -7.286  -4.504  1.00 0.00 ? 168 ILE A HG23 3  
ATOM 5765  H HD11 . ILE A 1 117 ? 2.144   -9.996  -2.803  1.00 0.00 ? 168 ILE A HD11 3  
ATOM 5766  H HD12 . ILE A 1 117 ? 2.063   -10.229 -4.544  1.00 0.00 ? 168 ILE A HD12 3  
ATOM 5767  H HD13 . ILE A 1 117 ? 2.162   -11.623 -3.469  1.00 0.00 ? 168 ILE A HD13 3  
ATOM 5768  N N    . THR A 1 118 ? 6.933   -11.298 -3.975  1.00 0.00 ? 169 THR A N    3  
ATOM 5769  C CA   . THR A 1 118 ? 7.581   -12.223 -4.935  1.00 0.00 ? 169 THR A CA   3  
ATOM 5770  C C    . THR A 1 118 ? 6.999   -13.620 -4.679  1.00 0.00 ? 169 THR A C    3  
ATOM 5771  O O    . THR A 1 118 ? 6.052   -14.036 -5.319  1.00 0.00 ? 169 THR A O    3  
ATOM 5772  C CB   . THR A 1 118 ? 9.096   -12.205 -4.706  1.00 0.00 ? 169 THR A CB   3  
ATOM 5773  O OG1  . THR A 1 118 ? 9.550   -10.857 -4.714  1.00 0.00 ? 169 THR A OG1  3  
ATOM 5774  C CG2  . THR A 1 118 ? 9.793   -12.981 -5.821  1.00 0.00 ? 169 THR A CG2  3  
ATOM 5775  H H    . THR A 1 118 ? 6.624   -11.648 -3.114  1.00 0.00 ? 169 THR A H    3  
ATOM 5776  H HA   . THR A 1 118 ? 7.358   -11.917 -5.946  1.00 0.00 ? 169 THR A HA   3  
ATOM 5777  H HB   . THR A 1 118 ? 9.327   -12.661 -3.752  1.00 0.00 ? 169 THR A HB   3  
ATOM 5778  H HG1  . THR A 1 118 ? 9.393   -10.491 -3.841  1.00 0.00 ? 169 THR A HG1  3  
ATOM 5779  H HG21 . THR A 1 118 ? 9.406   -13.990 -5.854  1.00 0.00 ? 169 THR A HG21 3  
ATOM 5780  H HG22 . THR A 1 118 ? 9.606   -12.487 -6.766  1.00 0.00 ? 169 THR A HG22 3  
ATOM 5781  H HG23 . THR A 1 118 ? 10.855  -13.008 -5.631  1.00 0.00 ? 169 THR A HG23 3  
ATOM 5782  N N    . VAL A 1 119 ? 7.532   -14.331 -3.718  1.00 0.00 ? 170 VAL A N    3  
ATOM 5783  C CA   . VAL A 1 119 ? 6.991   -15.684 -3.380  1.00 0.00 ? 170 VAL A CA   3  
ATOM 5784  C C    . VAL A 1 119 ? 7.238   -15.959 -1.893  1.00 0.00 ? 170 VAL A C    3  
ATOM 5785  O O    . VAL A 1 119 ? 8.363   -16.148 -1.472  1.00 0.00 ? 170 VAL A O    3  
ATOM 5786  C CB   . VAL A 1 119 ? 7.695   -16.748 -4.225  1.00 0.00 ? 170 VAL A CB   3  
ATOM 5787  C CG1  . VAL A 1 119 ? 7.286   -18.139 -3.737  1.00 0.00 ? 170 VAL A CG1  3  
ATOM 5788  C CG2  . VAL A 1 119 ? 7.290   -16.581 -5.693  1.00 0.00 ? 170 VAL A CG2  3  
ATOM 5789  H H    . VAL A 1 119 ? 8.274   -13.961 -3.197  1.00 0.00 ? 170 VAL A H    3  
ATOM 5790  H HA   . VAL A 1 119 ? 5.928   -15.709 -3.572  1.00 0.00 ? 170 VAL A HA   3  
ATOM 5791  H HB   . VAL A 1 119 ? 8.765   -16.631 -4.128  1.00 0.00 ? 170 VAL A HB   3  
ATOM 5792  H HG11 . VAL A 1 119 ? 6.213   -18.179 -3.619  1.00 0.00 ? 170 VAL A HG11 3  
ATOM 5793  H HG12 . VAL A 1 119 ? 7.598   -18.879 -4.457  1.00 0.00 ? 170 VAL A HG12 3  
ATOM 5794  H HG13 . VAL A 1 119 ? 7.760   -18.341 -2.787  1.00 0.00 ? 170 VAL A HG13 3  
ATOM 5795  H HG21 . VAL A 1 119 ? 6.216   -16.482 -5.764  1.00 0.00 ? 170 VAL A HG21 3  
ATOM 5796  H HG22 . VAL A 1 119 ? 7.762   -15.693 -6.096  1.00 0.00 ? 170 VAL A HG22 3  
ATOM 5797  H HG23 . VAL A 1 119 ? 7.610   -17.447 -6.254  1.00 0.00 ? 170 VAL A HG23 3  
ATOM 5798  N N    . ASP A 1 120 ? 6.205   -15.999 -1.090  1.00 0.00 ? 171 ASP A N    3  
ATOM 5799  C CA   . ASP A 1 120 ? 6.413   -16.280 0.355   1.00 0.00 ? 171 ASP A CA   3  
ATOM 5800  C C    . ASP A 1 120 ? 6.440   -17.797 0.560   1.00 0.00 ? 171 ASP A C    3  
ATOM 5801  O O    . ASP A 1 120 ? 5.537   -18.367 1.138   1.00 0.00 ? 171 ASP A O    3  
ATOM 5802  C CB   . ASP A 1 120 ? 5.263   -15.662 1.156   1.00 0.00 ? 171 ASP A CB   3  
ATOM 5803  C CG   . ASP A 1 120 ? 5.591   -15.738 2.646   1.00 0.00 ? 171 ASP A CG   3  
ATOM 5804  O OD1  . ASP A 1 120 ? 6.631   -16.288 2.973   1.00 0.00 ? 171 ASP A OD1  3  
ATOM 5805  O OD2  . ASP A 1 120 ? 4.802   -15.237 3.434   1.00 0.00 ? 171 ASP A OD2  3  
ATOM 5806  H H    . ASP A 1 120 ? 5.296   -15.859 -1.436  1.00 0.00 ? 171 ASP A H    3  
ATOM 5807  H HA   . ASP A 1 120 ? 7.352   -15.851 0.685   1.00 0.00 ? 171 ASP A HA   3  
ATOM 5808  H HB2  . ASP A 1 120 ? 5.137   -14.630 0.866   1.00 0.00 ? 171 ASP A HB2  3  
ATOM 5809  H HB3  . ASP A 1 120 ? 4.351   -16.205 0.961   1.00 0.00 ? 171 ASP A HB3  3  
ATOM 5810  N N    . GLY A 1 121 ? 7.468   -18.461 0.087   1.00 0.00 ? 172 GLY A N    3  
ATOM 5811  C CA   . GLY A 1 121 ? 7.529   -19.941 0.261   1.00 0.00 ? 172 GLY A CA   3  
ATOM 5812  C C    . GLY A 1 121 ? 8.795   -20.508 -0.401  1.00 0.00 ? 172 GLY A C    3  
ATOM 5813  O O    . GLY A 1 121 ? 9.618   -19.778 -0.916  1.00 0.00 ? 172 GLY A O    3  
ATOM 5814  H H    . GLY A 1 121 ? 8.189   -17.989 -0.382  1.00 0.00 ? 172 GLY A H    3  
ATOM 5815  H HA2  . GLY A 1 121 ? 7.537   -20.178 1.317   1.00 0.00 ? 172 GLY A HA2  3  
ATOM 5816  H HA3  . GLY A 1 121 ? 6.661   -20.388 -0.199  1.00 0.00 ? 172 GLY A HA3  3  
ATOM 5817  N N    . PRO A 1 122 ? 8.926   -21.812 -0.398  1.00 0.00 ? 173 PRO A N    3  
ATOM 5818  C CA   . PRO A 1 122 ? 10.087  -22.519 -1.026  1.00 0.00 ? 173 PRO A CA   3  
ATOM 5819  C C    . PRO A 1 122 ? 10.368  -22.027 -2.452  1.00 0.00 ? 173 PRO A C    3  
ATOM 5820  O O    . PRO A 1 122 ? 9.570   -22.217 -3.350  1.00 0.00 ? 173 PRO A O    3  
ATOM 5821  C CB   . PRO A 1 122 ? 9.636   -23.986 -1.050  1.00 0.00 ? 173 PRO A CB   3  
ATOM 5822  C CG   . PRO A 1 122 ? 8.682   -24.111 0.096   1.00 0.00 ? 173 PRO A CG   3  
ATOM 5823  C CD   . PRO A 1 122 ? 7.978   -22.757 0.210   1.00 0.00 ? 173 PRO A CD   3  
ATOM 5824  H HA   . PRO A 1 122 ? 10.967  -22.422 -0.411  1.00 0.00 ? 173 PRO A HA   3  
ATOM 5825  H HB2  . PRO A 1 122 ? 9.135   -24.213 -1.986  1.00 0.00 ? 173 PRO A HB2  3  
ATOM 5826  H HB3  . PRO A 1 122 ? 10.479  -24.645 -0.909  1.00 0.00 ? 173 PRO A HB3  3  
ATOM 5827  H HG2  . PRO A 1 122 ? 7.960   -24.894 -0.103  1.00 0.00 ? 173 PRO A HG2  3  
ATOM 5828  H HG3  . PRO A 1 122 ? 9.216   -24.320 1.009   1.00 0.00 ? 173 PRO A HG3  3  
ATOM 5829  H HD2  . PRO A 1 122 ? 7.044   -22.764 -0.335  1.00 0.00 ? 173 PRO A HD2  3  
ATOM 5830  H HD3  . PRO A 1 122 ? 7.811   -22.498 1.245   1.00 0.00 ? 173 PRO A HD3  3  
ATOM 5831  N N    . ARG A 1 123 ? 11.495  -21.407 -2.676  1.00 0.00 ? 174 ARG A N    3  
ATOM 5832  C CA   . ARG A 1 123 ? 11.818  -20.919 -4.052  1.00 0.00 ? 174 ARG A CA   3  
ATOM 5833  C C    . ARG A 1 123 ? 12.630  -21.994 -4.775  1.00 0.00 ? 174 ARG A C    3  
ATOM 5834  O O    . ARG A 1 123 ? 13.834  -21.895 -4.891  1.00 0.00 ? 174 ARG A O    3  
ATOM 5835  C CB   . ARG A 1 123 ? 12.650  -19.628 -3.933  1.00 0.00 ? 174 ARG A CB   3  
ATOM 5836  C CG   . ARG A 1 123 ? 13.002  -19.034 -5.316  1.00 0.00 ? 174 ARG A CG   3  
ATOM 5837  C CD   . ARG A 1 123 ? 11.755  -18.454 -5.995  1.00 0.00 ? 174 ARG A CD   3  
ATOM 5838  N NE   . ARG A 1 123 ? 12.154  -17.764 -7.268  1.00 0.00 ? 174 ARG A NE   3  
ATOM 5839  C CZ   . ARG A 1 123 ? 12.878  -16.681 -7.262  1.00 0.00 ? 174 ARG A CZ   3  
ATOM 5840  N NH1  . ARG A 1 123 ? 13.185  -16.104 -6.134  1.00 0.00 ? 174 ARG A NH1  3  
ATOM 5841  N NH2  . ARG A 1 123 ? 13.259  -16.148 -8.392  1.00 0.00 ? 174 ARG A NH2  3  
ATOM 5842  H H    . ARG A 1 123 ? 12.133  -21.270 -1.944  1.00 0.00 ? 174 ARG A H    3  
ATOM 5843  H HA   . ARG A 1 123 ? 10.908  -20.722 -4.591  1.00 0.00 ? 174 ARG A HA   3  
ATOM 5844  H HB2  . ARG A 1 123 ? 12.088  -18.895 -3.373  1.00 0.00 ? 174 ARG A HB2  3  
ATOM 5845  H HB3  . ARG A 1 123 ? 13.566  -19.847 -3.403  1.00 0.00 ? 174 ARG A HB3  3  
ATOM 5846  H HG2  . ARG A 1 123 ? 13.740  -18.255 -5.195  1.00 0.00 ? 174 ARG A HG2  3  
ATOM 5847  H HG3  . ARG A 1 123 ? 13.414  -19.811 -5.942  1.00 0.00 ? 174 ARG A HG3  3  
ATOM 5848  H HD2  . ARG A 1 123 ? 11.096  -19.239 -6.276  1.00 0.00 ? 174 ARG A HD2  3  
ATOM 5849  H HD3  . ARG A 1 123 ? 11.240  -17.793 -5.296  1.00 0.00 ? 174 ARG A HD3  3  
ATOM 5850  H HE   . ARG A 1 123 ? 11.882  -18.155 -8.127  1.00 0.00 ? 174 ARG A HE   3  
ATOM 5851  H HH11 . ARG A 1 123 ? 12.861  -16.488 -5.272  1.00 0.00 ? 174 ARG A HH11 3  
ATOM 5852  H HH12 . ARG A 1 123 ? 13.750  -15.283 -6.134  1.00 0.00 ? 174 ARG A HH12 3  
ATOM 5853  H HH21 . ARG A 1 123 ? 12.995  -16.567 -9.260  1.00 0.00 ? 174 ARG A HH21 3  
ATOM 5854  H HH22 . ARG A 1 123 ? 13.819  -15.321 -8.389  1.00 0.00 ? 174 ARG A HH22 3  
ATOM 5855  N N    . GLU A 1 124 ? 11.985  -23.018 -5.279  1.00 0.00 ? 175 GLU A N    3  
ATOM 5856  C CA   . GLU A 1 124 ? 12.750  -24.067 -6.010  1.00 0.00 ? 175 GLU A CA   3  
ATOM 5857  C C    . GLU A 1 124 ? 13.180  -23.515 -7.377  1.00 0.00 ? 175 GLU A C    3  
ATOM 5858  O O    . GLU A 1 124 ? 14.248  -23.836 -7.851  1.00 0.00 ? 175 GLU A O    3  
ATOM 5859  C CB   . GLU A 1 124 ? 11.919  -25.359 -6.164  1.00 0.00 ? 175 GLU A CB   3  
ATOM 5860  C CG   . GLU A 1 124 ? 11.979  -26.186 -4.864  1.00 0.00 ? 175 GLU A CG   3  
ATOM 5861  C CD   . GLU A 1 124 ? 13.296  -26.968 -4.796  1.00 0.00 ? 175 GLU A CD   3  
ATOM 5862  O OE1  . GLU A 1 124 ? 13.361  -28.026 -5.399  1.00 0.00 ? 175 GLU A OE1  3  
ATOM 5863  O OE2  . GLU A 1 124 ? 14.212  -26.500 -4.141  1.00 0.00 ? 175 GLU A OE2  3  
ATOM 5864  H H    . GLU A 1 124 ? 11.009  -23.084 -5.195  1.00 0.00 ? 175 GLU A H    3  
ATOM 5865  H HA   . GLU A 1 124 ? 13.652  -24.288 -5.446  1.00 0.00 ? 175 GLU A HA   3  
ATOM 5866  H HB2  . GLU A 1 124 ? 10.888  -25.110 -6.378  1.00 0.00 ? 175 GLU A HB2  3  
ATOM 5867  H HB3  . GLU A 1 124 ? 12.326  -25.950 -6.975  1.00 0.00 ? 175 GLU A HB3  3  
ATOM 5868  H HG2  . GLU A 1 124 ? 11.909  -25.527 -4.011  1.00 0.00 ? 175 GLU A HG2  3  
ATOM 5869  H HG3  . GLU A 1 124 ? 11.153  -26.886 -4.850  1.00 0.00 ? 175 GLU A HG3  3  
ATOM 5870  N N    . PRO A 1 125 ? 12.380  -22.676 -8.014  1.00 0.00 ? 176 PRO A N    3  
ATOM 5871  C CA   . PRO A 1 125 ? 12.759  -22.075 -9.330  1.00 0.00 ? 176 PRO A CA   3  
ATOM 5872  C C    . PRO A 1 125 ? 14.111  -21.369 -9.244  1.00 0.00 ? 176 PRO A C    3  
ATOM 5873  O O    . PRO A 1 125 ? 14.201  -20.161 -9.137  1.00 0.00 ? 176 PRO A O    3  
ATOM 5874  C CB   . PRO A 1 125 ? 11.636  -21.072 -9.617  1.00 0.00 ? 176 PRO A CB   3  
ATOM 5875  C CG   . PRO A 1 125 ? 10.462  -21.614 -8.872  1.00 0.00 ? 176 PRO A CG   3  
ATOM 5876  C CD   . PRO A 1 125 ? 11.046  -22.214 -7.593  1.00 0.00 ? 176 PRO A CD   3  
ATOM 5877  H HA   . PRO A 1 125 ? 12.776  -22.831 -10.092 1.00 0.00 ? 176 PRO A HA   3  
ATOM 5878  H HB2  . PRO A 1 125 ? 11.900  -20.090 -9.247  1.00 0.00 ? 176 PRO A HB2  3  
ATOM 5879  H HB3  . PRO A 1 125 ? 11.426  -21.034 -10.675 1.00 0.00 ? 176 PRO A HB3  3  
ATOM 5880  H HG2  . PRO A 1 125 ? 9.765   -20.818 -8.636  1.00 0.00 ? 176 PRO A HG2  3  
ATOM 5881  H HG3  . PRO A 1 125 ? 9.974   -22.384 -9.447  1.00 0.00 ? 176 PRO A HG3  3  
ATOM 5882  H HD2  . PRO A 1 125 ? 11.126  -21.456 -6.830  1.00 0.00 ? 176 PRO A HD2  3  
ATOM 5883  H HD3  . PRO A 1 125 ? 10.448  -23.040 -7.255  1.00 0.00 ? 176 PRO A HD3  3  
ATOM 5884  N N    . ARG A 1 126 ? 15.166  -22.112 -9.264  1.00 0.00 ? 177 ARG A N    3  
ATOM 5885  C CA   . ARG A 1 126 ? 16.502  -21.477 -9.148  1.00 0.00 ? 177 ARG A CA   3  
ATOM 5886  C C    . ARG A 1 126 ? 16.897  -20.752 -10.428 1.00 0.00 ? 177 ARG A C    3  
ATOM 5887  O O    . ARG A 1 126 ? 16.790  -21.246 -11.536 1.00 0.00 ? 177 ARG A O    3  
ATOM 5888  C CB   . ARG A 1 126 ? 17.557  -22.522 -8.783  1.00 0.00 ? 177 ARG A CB   3  
ATOM 5889  C CG   . ARG A 1 126 ? 17.342  -22.959 -7.327  1.00 0.00 ? 177 ARG A CG   3  
ATOM 5890  C CD   . ARG A 1 126 ? 18.528  -23.797 -6.836  1.00 0.00 ? 177 ARG A CD   3  
ATOM 5891  N NE   . ARG A 1 126 ? 19.540  -22.887 -6.235  1.00 0.00 ? 177 ARG A NE   3  
ATOM 5892  C CZ   . ARG A 1 126 ? 20.587  -23.389 -5.632  1.00 0.00 ? 177 ARG A CZ   3  
ATOM 5893  N NH1  . ARG A 1 126 ? 20.747  -24.682 -5.600  1.00 0.00 ? 177 ARG A NH1  3  
ATOM 5894  N NH2  . ARG A 1 126 ? 21.473  -22.614 -5.070  1.00 0.00 ? 177 ARG A NH2  3  
ATOM 5895  H H    . ARG A 1 126 ? 15.079  -23.082 -9.330  1.00 0.00 ? 177 ARG A H    3  
ATOM 5896  H HA   . ARG A 1 126 ? 16.460  -20.742 -8.354  1.00 0.00 ? 177 ARG A HA   3  
ATOM 5897  H HB2  . ARG A 1 126 ? 17.453  -23.379 -9.434  1.00 0.00 ? 177 ARG A HB2  3  
ATOM 5898  H HB3  . ARG A 1 126 ? 18.542  -22.099 -8.890  1.00 0.00 ? 177 ARG A HB3  3  
ATOM 5899  H HG2  . ARG A 1 126 ? 17.250  -22.073 -6.706  1.00 0.00 ? 177 ARG A HG2  3  
ATOM 5900  H HG3  . ARG A 1 126 ? 16.440  -23.545 -7.261  1.00 0.00 ? 177 ARG A HG3  3  
ATOM 5901  H HD2  . ARG A 1 126 ? 18.199  -24.491 -6.085  1.00 0.00 ? 177 ARG A HD2  3  
ATOM 5902  H HD3  . ARG A 1 126 ? 18.956  -24.353 -7.665  1.00 0.00 ? 177 ARG A HD3  3  
ATOM 5903  H HE   . ARG A 1 126 ? 19.407  -21.918 -6.274  1.00 0.00 ? 177 ARG A HE   3  
ATOM 5904  H HH11 . ARG A 1 126 ? 20.069  -25.281 -6.033  1.00 0.00 ? 177 ARG A HH11 3  
ATOM 5905  H HH12 . ARG A 1 126 ? 21.545  -25.074 -5.141  1.00 0.00 ? 177 ARG A HH12 3  
ATOM 5906  H HH21 . ARG A 1 126 ? 21.361  -21.622 -5.095  1.00 0.00 ? 177 ARG A HH21 3  
ATOM 5907  H HH22 . ARG A 1 126 ? 22.264  -23.017 -4.609  1.00 0.00 ? 177 ARG A HH22 3  
ATOM 5908  N N    . ARG A 1 127 ? 17.368  -19.565 -10.220 1.00 0.00 ? 178 ARG A N    3  
ATOM 5909  C CA   . ARG A 1 127 ? 17.827  -18.670 -11.308 1.00 0.00 ? 178 ARG A CA   3  
ATOM 5910  C C    . ARG A 1 127 ? 19.184  -19.151 -11.840 1.00 0.00 ? 178 ARG A C    3  
ATOM 5911  O O    . ARG A 1 127 ? 19.775  -18.537 -12.707 1.00 0.00 ? 178 ARG A O    3  
ATOM 5912  C CB   . ARG A 1 127 ? 17.964  -17.256 -10.708 1.00 0.00 ? 178 ARG A CB   3  
ATOM 5913  C CG   . ARG A 1 127 ? 19.087  -17.189 -9.631  1.00 0.00 ? 178 ARG A CG   3  
ATOM 5914  C CD   . ARG A 1 127 ? 18.788  -18.071 -8.393  1.00 0.00 ? 178 ARG A CD   3  
ATOM 5915  N NE   . ARG A 1 127 ? 17.344  -17.972 -8.000  1.00 0.00 ? 178 ARG A NE   3  
ATOM 5916  C CZ   . ARG A 1 127 ? 16.779  -16.832 -7.713  1.00 0.00 ? 178 ARG A CZ   3  
ATOM 5917  N NH1  . ARG A 1 127 ? 17.484  -15.733 -7.639  1.00 0.00 ? 178 ARG A NH1  3  
ATOM 5918  N NH2  . ARG A 1 127 ? 15.504  -16.800 -7.444  1.00 0.00 ? 178 ARG A NH2  3  
ATOM 5919  H H    . ARG A 1 127 ? 17.411  -19.252 -9.302  1.00 0.00 ? 178 ARG A H    3  
ATOM 5920  H HA   . ARG A 1 127 ? 17.099  -18.655 -12.108 1.00 0.00 ? 178 ARG A HA   3  
ATOM 5921  H HB2  . ARG A 1 127 ? 18.194  -16.557 -11.501 1.00 0.00 ? 178 ARG A HB2  3  
ATOM 5922  H HB3  . ARG A 1 127 ? 17.026  -16.976 -10.261 1.00 0.00 ? 178 ARG A HB3  3  
ATOM 5923  H HG2  . ARG A 1 127 ? 20.019  -17.514 -10.069 1.00 0.00 ? 178 ARG A HG2  3  
ATOM 5924  H HG3  . ARG A 1 127 ? 19.199  -16.162 -9.313  1.00 0.00 ? 178 ARG A HG3  3  
ATOM 5925  H HD2  . ARG A 1 127 ? 18.990  -19.102 -8.615  1.00 0.00 ? 178 ARG A HD2  3  
ATOM 5926  H HD3  . ARG A 1 127 ? 19.446  -17.765 -7.578  1.00 0.00 ? 178 ARG A HD3  3  
ATOM 5927  H HE   . ARG A 1 127 ? 16.799  -18.787 -7.986  1.00 0.00 ? 178 ARG A HE   3  
ATOM 5928  H HH11 . ARG A 1 127 ? 18.466  -15.760 -7.794  1.00 0.00 ? 178 ARG A HH11 3  
ATOM 5929  H HH12 . ARG A 1 127 ? 17.035  -14.866 -7.429  1.00 0.00 ? 178 ARG A HH12 3  
ATOM 5930  H HH21 . ARG A 1 127 ? 14.973  -17.646 -7.455  1.00 0.00 ? 178 ARG A HH21 3  
ATOM 5931  H HH22 . ARG A 1 127 ? 15.060  -15.936 -7.223  1.00 0.00 ? 178 ARG A HH22 3  
ATOM 5932  N N    . VAL A 1 1   ? -12.248 7.844   20.869  1.00 0.00 ? 52  VAL A N    4  
ATOM 5933  C CA   . VAL A 1 1   ? -11.271 7.335   21.874  1.00 0.00 ? 52  VAL A CA   4  
ATOM 5934  C C    . VAL A 1 1   ? -9.968  8.136   21.754  1.00 0.00 ? 52  VAL A C    4  
ATOM 5935  O O    . VAL A 1 1   ? -9.241  8.013   20.793  1.00 0.00 ? 52  VAL A O    4  
ATOM 5936  C CB   . VAL A 1 1   ? -10.995 5.839   21.610  1.00 0.00 ? 52  VAL A CB   4  
ATOM 5937  C CG1  . VAL A 1 1   ? -10.409 5.179   22.862  1.00 0.00 ? 52  VAL A CG1  4  
ATOM 5938  C CG2  . VAL A 1 1   ? -12.299 5.127   21.227  1.00 0.00 ? 52  VAL A CG2  4  
ATOM 5939  H H    . VAL A 1 1   ? -11.984 7.927   19.927  1.00 0.00 ? 52  VAL A H    4  
ATOM 5940  H HA   . VAL A 1 1   ? -11.676 7.460   22.868  1.00 0.00 ? 52  VAL A HA   4  
ATOM 5941  H HB   . VAL A 1 1   ? -10.285 5.744   20.800  1.00 0.00 ? 52  VAL A HB   4  
ATOM 5942  H HG11 . VAL A 1 1   ? -9.702  5.849   23.324  1.00 0.00 ? 52  VAL A HG11 4  
ATOM 5943  H HG12 . VAL A 1 1   ? -11.201 4.956   23.562  1.00 0.00 ? 52  VAL A HG12 4  
ATOM 5944  H HG13 . VAL A 1 1   ? -9.908  4.262   22.582  1.00 0.00 ? 52  VAL A HG13 4  
ATOM 5945  H HG21 . VAL A 1 1   ? -13.069 5.375   21.942  1.00 0.00 ? 52  VAL A HG21 4  
ATOM 5946  H HG22 . VAL A 1 1   ? -12.605 5.443   20.242  1.00 0.00 ? 52  VAL A HG22 4  
ATOM 5947  H HG23 . VAL A 1 1   ? -12.137 4.057   21.228  1.00 0.00 ? 52  VAL A HG23 4  
ATOM 5948  N N    . GLU A 1 2   ? -9.676  8.957   22.728  1.00 0.00 ? 53  GLU A N    4  
ATOM 5949  C CA   . GLU A 1 2   ? -8.422  9.769   22.687  1.00 0.00 ? 53  GLU A CA   4  
ATOM 5950  C C    . GLU A 1 2   ? -7.284  8.971   23.306  1.00 0.00 ? 53  GLU A C    4  
ATOM 5951  O O    . GLU A 1 2   ? -6.191  9.470   23.495  1.00 0.00 ? 53  GLU A O    4  
ATOM 5952  C CB   . GLU A 1 2   ? -8.632  11.058  23.480  1.00 0.00 ? 53  GLU A CB   4  
ATOM 5953  C CG   . GLU A 1 2   ? -9.764  11.865  22.839  1.00 0.00 ? 53  GLU A CG   4  
ATOM 5954  C CD   . GLU A 1 2   ? -11.122 11.268  23.219  1.00 0.00 ? 53  GLU A CD   4  
ATOM 5955  O OE1  . GLU A 1 2   ? -11.204 10.631  24.257  1.00 0.00 ? 53  GLU A OE1  4  
ATOM 5956  O OE2  . GLU A 1 2   ? -12.056 11.451  22.457  1.00 0.00 ? 53  GLU A OE2  4  
ATOM 5957  H H    . GLU A 1 2   ? -10.281 9.040   23.495  1.00 0.00 ? 53  GLU A H    4  
ATOM 5958  H HA   . GLU A 1 2   ? -8.177  10.013  21.664  1.00 0.00 ? 53  GLU A HA   4  
ATOM 5959  H HB2  . GLU A 1 2   ? -8.887  10.819  24.501  1.00 0.00 ? 53  GLU A HB2  4  
ATOM 5960  H HB3  . GLU A 1 2   ? -7.726  11.642  23.462  1.00 0.00 ? 53  GLU A HB3  4  
ATOM 5961  H HG2  . GLU A 1 2   ? -9.714  12.886  23.185  1.00 0.00 ? 53  GLU A HG2  4  
ATOM 5962  H HG3  . GLU A 1 2   ? -9.655  11.847  21.764  1.00 0.00 ? 53  GLU A HG3  4  
ATOM 5963  N N    . VAL A 1 3   ? -7.537  7.740   23.631  1.00 0.00 ? 54  VAL A N    4  
ATOM 5964  C CA   . VAL A 1 3   ? -6.479  6.897   24.253  1.00 0.00 ? 54  VAL A CA   4  
ATOM 5965  C C    . VAL A 1 3   ? -5.356  6.649   23.250  1.00 0.00 ? 54  VAL A C    4  
ATOM 5966  O O    . VAL A 1 3   ? -4.192  6.657   23.598  1.00 0.00 ? 54  VAL A O    4  
ATOM 5967  C CB   . VAL A 1 3   ? -7.081  5.558   24.671  1.00 0.00 ? 54  VAL A CB   4  
ATOM 5968  C CG1  . VAL A 1 3   ? -5.986  4.625   25.194  1.00 0.00 ? 54  VAL A CG1  4  
ATOM 5969  C CG2  . VAL A 1 3   ? -8.112  5.786   25.774  1.00 0.00 ? 54  VAL A CG2  4  
ATOM 5970  H H    . VAL A 1 3   ? -8.430  7.365   23.472  1.00 0.00 ? 54  VAL A H    4  
ATOM 5971  H HA   . VAL A 1 3   ? -6.083  7.404   25.117  1.00 0.00 ? 54  VAL A HA   4  
ATOM 5972  H HB   . VAL A 1 3   ? -7.560  5.101   23.819  1.00 0.00 ? 54  VAL A HB   4  
ATOM 5973  H HG11 . VAL A 1 3   ? -5.358  5.161   25.887  1.00 0.00 ? 54  VAL A HG11 4  
ATOM 5974  H HG12 . VAL A 1 3   ? -6.444  3.786   25.695  1.00 0.00 ? 54  VAL A HG12 4  
ATOM 5975  H HG13 . VAL A 1 3   ? -5.391  4.268   24.365  1.00 0.00 ? 54  VAL A HG13 4  
ATOM 5976  H HG21 . VAL A 1 3   ? -8.867  6.472   25.420  1.00 0.00 ? 54  VAL A HG21 4  
ATOM 5977  H HG22 . VAL A 1 3   ? -8.571  4.845   26.032  1.00 0.00 ? 54  VAL A HG22 4  
ATOM 5978  H HG23 . VAL A 1 3   ? -7.626  6.201   26.644  1.00 0.00 ? 54  VAL A HG23 4  
ATOM 5979  N N    . LEU A 1 4   ? -5.685  6.421   22.008  1.00 0.00 ? 55  LEU A N    4  
ATOM 5980  C CA   . LEU A 1 4   ? -4.610  6.179   21.004  1.00 0.00 ? 55  LEU A CA   4  
ATOM 5981  C C    . LEU A 1 4   ? -4.119  7.533   20.486  1.00 0.00 ? 55  LEU A C    4  
ATOM 5982  O O    . LEU A 1 4   ? -4.272  7.866   19.327  1.00 0.00 ? 55  LEU A O    4  
ATOM 5983  C CB   . LEU A 1 4   ? -5.135  5.299   19.841  1.00 0.00 ? 55  LEU A CB   4  
ATOM 5984  C CG   . LEU A 1 4   ? -6.651  5.417   19.706  1.00 0.00 ? 55  LEU A CG   4  
ATOM 5985  C CD1  . LEU A 1 4   ? -7.030  6.861   19.375  1.00 0.00 ? 55  LEU A CD1  4  
ATOM 5986  C CD2  . LEU A 1 4   ? -7.113  4.507   18.568  1.00 0.00 ? 55  LEU A CD2  4  
ATOM 5987  H H    . LEU A 1 4   ? -6.625  6.424   21.739  1.00 0.00 ? 55  LEU A H    4  
ATOM 5988  H HA   . LEU A 1 4   ? -3.783  5.672   21.486  1.00 0.00 ? 55  LEU A HA   4  
ATOM 5989  H HB2  . LEU A 1 4   ? -4.674  5.604   18.912  1.00 0.00 ? 55  LEU A HB2  4  
ATOM 5990  H HB3  . LEU A 1 4   ? -4.884  4.263   20.034  1.00 0.00 ? 55  LEU A HB3  4  
ATOM 5991  H HG   . LEU A 1 4   ? -7.129  5.115   20.627  1.00 0.00 ? 55  LEU A HG   4  
ATOM 5992  H HD11 . LEU A 1 4   ? -6.435  7.205   18.539  1.00 0.00 ? 55  LEU A HD11 4  
ATOM 5993  H HD12 . LEU A 1 4   ? -8.075  6.903   19.110  1.00 0.00 ? 55  LEU A HD12 4  
ATOM 5994  H HD13 . LEU A 1 4   ? -6.851  7.496   20.229  1.00 0.00 ? 55  LEU A HD13 4  
ATOM 5995  H HD21 . LEU A 1 4   ? -6.544  4.734   17.679  1.00 0.00 ? 55  LEU A HD21 4  
ATOM 5996  H HD22 . LEU A 1 4   ? -6.953  3.473   18.843  1.00 0.00 ? 55  LEU A HD22 4  
ATOM 5997  H HD23 . LEU A 1 4   ? -8.162  4.673   18.377  1.00 0.00 ? 55  LEU A HD23 4  
ATOM 5998  N N    . ALA A 1 5   ? -3.520  8.313   21.343  1.00 0.00 ? 56  ALA A N    4  
ATOM 5999  C CA   . ALA A 1 5   ? -3.006  9.639   20.906  1.00 0.00 ? 56  ALA A CA   4  
ATOM 6000  C C    . ALA A 1 5   ? -1.683  9.420   20.175  1.00 0.00 ? 56  ALA A C    4  
ATOM 6001  O O    . ALA A 1 5   ? -1.393  10.062  19.184  1.00 0.00 ? 56  ALA A O    4  
ATOM 6002  C CB   . ALA A 1 5   ? -2.789  10.544  22.126  1.00 0.00 ? 56  ALA A CB   4  
ATOM 6003  H H    . ALA A 1 5   ? -3.399  8.022   22.273  1.00 0.00 ? 56  ALA A H    4  
ATOM 6004  H HA   . ALA A 1 5   ? -3.717  10.097  20.234  1.00 0.00 ? 56  ALA A HA   4  
ATOM 6005  H HB1  . ALA A 1 5   ? -2.443  9.949   22.958  1.00 0.00 ? 56  ALA A HB1  4  
ATOM 6006  H HB2  . ALA A 1 5   ? -2.054  11.303  21.894  1.00 0.00 ? 56  ALA A HB2  4  
ATOM 6007  H HB3  . ALA A 1 5   ? -3.722  11.019  22.391  1.00 0.00 ? 56  ALA A HB3  4  
ATOM 6008  N N    . ASP A 1 6   ? -0.887  8.502   20.657  1.00 0.00 ? 57  ASP A N    4  
ATOM 6009  C CA   . ASP A 1 6   ? 0.415   8.220   19.993  1.00 0.00 ? 57  ASP A CA   4  
ATOM 6010  C C    . ASP A 1 6   ? 0.176   7.315   18.783  1.00 0.00 ? 57  ASP A C    4  
ATOM 6011  O O    . ASP A 1 6   ? -0.730  6.504   18.770  1.00 0.00 ? 57  ASP A O    4  
ATOM 6012  C CB   . ASP A 1 6   ? 1.354   7.500   20.963  1.00 0.00 ? 57  ASP A CB   4  
ATOM 6013  C CG   . ASP A 1 6   ? 1.523   8.331   22.235  1.00 0.00 ? 57  ASP A CG   4  
ATOM 6014  O OD1  . ASP A 1 6   ? 0.648   9.130   22.518  1.00 0.00 ? 57  ASP A OD1  4  
ATOM 6015  O OD2  . ASP A 1 6   ? 2.531   8.159   22.896  1.00 0.00 ? 57  ASP A OD2  4  
ATOM 6016  H H    . ASP A 1 6   ? -1.153  7.997   21.452  1.00 0.00 ? 57  ASP A H    4  
ATOM 6017  H HA   . ASP A 1 6   ? 0.869   9.146   19.671  1.00 0.00 ? 57  ASP A HA   4  
ATOM 6018  H HB2  . ASP A 1 6   ? 0.945   6.532   21.215  1.00 0.00 ? 57  ASP A HB2  4  
ATOM 6019  H HB3  . ASP A 1 6   ? 2.319   7.370   20.495  1.00 0.00 ? 57  ASP A HB3  4  
ATOM 6020  N N    . HIS A 1 7   ? 0.986   7.443   17.771  1.00 0.00 ? 58  HIS A N    4  
ATOM 6021  C CA   . HIS A 1 7   ? 0.825   6.594   16.556  1.00 0.00 ? 58  HIS A CA   4  
ATOM 6022  C C    . HIS A 1 7   ? 0.862   5.106   16.962  1.00 0.00 ? 58  HIS A C    4  
ATOM 6023  O O    . HIS A 1 7   ? 1.895   4.624   17.382  1.00 0.00 ? 58  HIS A O    4  
ATOM 6024  C CB   . HIS A 1 7   ? 1.997   6.896   15.617  1.00 0.00 ? 58  HIS A CB   4  
ATOM 6025  C CG   . HIS A 1 7   ? 1.956   8.355   15.232  1.00 0.00 ? 58  HIS A CG   4  
ATOM 6026  N ND1  . HIS A 1 7   ? 0.854   8.932   14.614  1.00 0.00 ? 58  HIS A ND1  4  
ATOM 6027  C CD2  . HIS A 1 7   ? 2.859   9.372   15.409  1.00 0.00 ? 58  HIS A CD2  4  
ATOM 6028  C CE1  . HIS A 1 7   ? 1.117   10.244  14.453  1.00 0.00 ? 58  HIS A CE1  4  
ATOM 6029  N NE2  . HIS A 1 7   ? 2.328   10.564  14.919  1.00 0.00 ? 58  HIS A NE2  4  
ATOM 6030  H H    . HIS A 1 7   ? 1.712   8.099   17.810  1.00 0.00 ? 58  HIS A H    4  
ATOM 6031  H HA   . HIS A 1 7   ? -0.098  6.836   16.060  1.00 0.00 ? 58  HIS A HA   4  
ATOM 6032  H HB2  . HIS A 1 7   ? 2.928   6.689   16.130  1.00 0.00 ? 58  HIS A HB2  4  
ATOM 6033  H HB3  . HIS A 1 7   ? 1.928   6.284   14.733  1.00 0.00 ? 58  HIS A HB3  4  
ATOM 6034  H HD1  . HIS A 1 7   ? 0.036   8.468   14.338  1.00 0.00 ? 58  HIS A HD1  4  
ATOM 6035  H HD2  . HIS A 1 7   ? 3.836   9.262   15.856  1.00 0.00 ? 58  HIS A HD2  4  
ATOM 6036  H HE1  . HIS A 1 7   ? 0.430   10.952  14.012  1.00 0.00 ? 58  HIS A HE1  4  
ATOM 6037  N N    . PRO A 1 8   ? -0.224  4.359   16.830  1.00 0.00 ? 59  PRO A N    4  
ATOM 6038  C CA   . PRO A 1 8   ? -0.215  2.907   17.188  1.00 0.00 ? 59  PRO A CA   4  
ATOM 6039  C C    . PRO A 1 8   ? 0.910   2.152   16.475  1.00 0.00 ? 59  PRO A C    4  
ATOM 6040  O O    . PRO A 1 8   ? 1.061   0.959   16.635  1.00 0.00 ? 59  PRO A O    4  
ATOM 6041  C CB   . PRO A 1 8   ? -1.588  2.394   16.716  1.00 0.00 ? 59  PRO A CB   4  
ATOM 6042  C CG   . PRO A 1 8   ? -2.466  3.599   16.722  1.00 0.00 ? 59  PRO A CG   4  
ATOM 6043  C CD   . PRO A 1 8   ? -1.560  4.785   16.358  1.00 0.00 ? 59  PRO A CD   4  
ATOM 6044  H HA   . PRO A 1 8   ? -0.132  2.788   18.255  1.00 0.00 ? 59  PRO A HA   4  
ATOM 6045  H HB2  . PRO A 1 8   ? -1.517  1.984   15.714  1.00 0.00 ? 59  PRO A HB2  4  
ATOM 6046  H HB3  . PRO A 1 8   ? -1.970  1.648   17.399  1.00 0.00 ? 59  PRO A HB3  4  
ATOM 6047  H HG2  . PRO A 1 8   ? -3.261  3.486   15.992  1.00 0.00 ? 59  PRO A HG2  4  
ATOM 6048  H HG3  . PRO A 1 8   ? -2.887  3.752   17.707  1.00 0.00 ? 59  PRO A HG3  4  
ATOM 6049  H HD2  . PRO A 1 8   ? -1.556  4.943   15.286  1.00 0.00 ? 59  PRO A HD2  4  
ATOM 6050  H HD3  . PRO A 1 8   ? -1.879  5.675   16.877  1.00 0.00 ? 59  PRO A HD3  4  
ATOM 6051  N N    . GLY A 1 9   ? 1.685   2.833   15.675  1.00 0.00 ? 60  GLY A N    4  
ATOM 6052  C CA   . GLY A 1 9   ? 2.782   2.133   14.942  1.00 0.00 ? 60  GLY A CA   4  
ATOM 6053  C C    . GLY A 1 9   ? 3.761   3.148   14.337  1.00 0.00 ? 60  GLY A C    4  
ATOM 6054  O O    . GLY A 1 9   ? 4.102   4.140   14.953  1.00 0.00 ? 60  GLY A O    4  
ATOM 6055  H H    . GLY A 1 9   ? 1.539   3.792   15.546  1.00 0.00 ? 60  GLY A H    4  
ATOM 6056  H HA2  . GLY A 1 9   ? 3.312   1.488   15.627  1.00 0.00 ? 60  GLY A HA2  4  
ATOM 6057  H HA3  . GLY A 1 9   ? 2.355   1.538   14.151  1.00 0.00 ? 60  GLY A HA3  4  
ATOM 6058  N N    . GLU A 1 10  ? 4.232   2.890   13.136  1.00 0.00 ? 61  GLU A N    4  
ATOM 6059  C CA   . GLU A 1 10  ? 5.210   3.810   12.473  1.00 0.00 ? 61  GLU A CA   4  
ATOM 6060  C C    . GLU A 1 10  ? 4.609   4.351   11.174  1.00 0.00 ? 61  GLU A C    4  
ATOM 6061  O O    . GLU A 1 10  ? 3.862   3.676   10.495  1.00 0.00 ? 61  GLU A O    4  
ATOM 6062  C CB   . GLU A 1 10  ? 6.499   3.029   12.181  1.00 0.00 ? 61  GLU A CB   4  
ATOM 6063  C CG   . GLU A 1 10  ? 7.012   2.360   13.480  1.00 0.00 ? 61  GLU A CG   4  
ATOM 6064  C CD   . GLU A 1 10  ? 6.476   0.924   13.594  1.00 0.00 ? 61  GLU A CD   4  
ATOM 6065  O OE1  . GLU A 1 10  ? 5.301   0.769   13.881  1.00 0.00 ? 61  GLU A OE1  4  
ATOM 6066  O OE2  . GLU A 1 10  ? 7.256   0.003   13.397  1.00 0.00 ? 61  GLU A OE2  4  
ATOM 6067  H H    . GLU A 1 10  ? 3.951   2.074   12.671  1.00 0.00 ? 61  GLU A H    4  
ATOM 6068  H HA   . GLU A 1 10  ? 5.441   4.644   13.125  1.00 0.00 ? 61  GLU A HA   4  
ATOM 6069  H HB2  . GLU A 1 10  ? 6.296   2.272   11.432  1.00 0.00 ? 61  GLU A HB2  4  
ATOM 6070  H HB3  . GLU A 1 10  ? 7.253   3.706   11.804  1.00 0.00 ? 61  GLU A HB3  4  
ATOM 6071  H HG2  . GLU A 1 10  ? 8.094   2.336   13.471  1.00 0.00 ? 61  GLU A HG2  4  
ATOM 6072  H HG3  . GLU A 1 10  ? 6.681   2.928   14.339  1.00 0.00 ? 61  GLU A HG3  4  
ATOM 6073  N N    . LEU A 1 11  ? 4.921   5.577   10.843  1.00 0.00 ? 62  LEU A N    4  
ATOM 6074  C CA   . LEU A 1 11  ? 4.373   6.224   9.611   1.00 0.00 ? 62  LEU A CA   4  
ATOM 6075  C C    . LEU A 1 11  ? 5.526   6.543   8.649   1.00 0.00 ? 62  LEU A C    4  
ATOM 6076  O O    . LEU A 1 11  ? 6.622   6.879   9.061   1.00 0.00 ? 62  LEU A O    4  
ATOM 6077  C CB   . LEU A 1 11  ? 3.672   7.541   10.009  1.00 0.00 ? 62  LEU A CB   4  
ATOM 6078  C CG   . LEU A 1 11  ? 2.233   7.284   10.508  1.00 0.00 ? 62  LEU A CG   4  
ATOM 6079  C CD1  . LEU A 1 11  ? 2.208   6.159   11.551  1.00 0.00 ? 62  LEU A CD1  4  
ATOM 6080  C CD2  . LEU A 1 11  ? 1.671   8.567   11.143  1.00 0.00 ? 62  LEU A CD2  4  
ATOM 6081  H H    . LEU A 1 11  ? 5.509   6.092   11.425  1.00 0.00 ? 62  LEU A H    4  
ATOM 6082  H HA   . LEU A 1 11  ? 3.664   5.568   9.125   1.00 0.00 ? 62  LEU A HA   4  
ATOM 6083  H HB2  . LEU A 1 11  ? 4.241   8.018   10.794  1.00 0.00 ? 62  LEU A HB2  4  
ATOM 6084  H HB3  . LEU A 1 11  ? 3.636   8.199   9.154   1.00 0.00 ? 62  LEU A HB3  4  
ATOM 6085  H HG   . LEU A 1 11  ? 1.615   7.003   9.668   1.00 0.00 ? 62  LEU A HG   4  
ATOM 6086  H HD11 . LEU A 1 11  ? 3.081   6.222   12.179  1.00 0.00 ? 62  LEU A HD11 4  
ATOM 6087  H HD12 . LEU A 1 11  ? 1.321   6.249   12.164  1.00 0.00 ? 62  LEU A HD12 4  
ATOM 6088  H HD13 . LEU A 1 11  ? 2.190   5.207   11.051  1.00 0.00 ? 62  LEU A HD13 4  
ATOM 6089  H HD21 . LEU A 1 11  ? 1.769   9.391   10.453  1.00 0.00 ? 62  LEU A HD21 4  
ATOM 6090  H HD22 . LEU A 1 11  ? 0.625   8.420   11.379  1.00 0.00 ? 62  LEU A HD22 4  
ATOM 6091  H HD23 . LEU A 1 11  ? 2.216   8.789   12.049  1.00 0.00 ? 62  LEU A HD23 4  
ATOM 6092  N N    . VAL A 1 12  ? 5.281   6.456   7.364   1.00 0.00 ? 63  VAL A N    4  
ATOM 6093  C CA   . VAL A 1 12  ? 6.340   6.769   6.359   1.00 0.00 ? 63  VAL A CA   4  
ATOM 6094  C C    . VAL A 1 12  ? 5.982   8.092   5.683   1.00 0.00 ? 63  VAL A C    4  
ATOM 6095  O O    . VAL A 1 12  ? 4.870   8.292   5.242   1.00 0.00 ? 63  VAL A O    4  
ATOM 6096  C CB   . VAL A 1 12  ? 6.397   5.658   5.298   1.00 0.00 ? 63  VAL A CB   4  
ATOM 6097  C CG1  . VAL A 1 12  ? 7.492   5.993   4.273   1.00 0.00 ? 63  VAL A CG1  4  
ATOM 6098  C CG2  . VAL A 1 12  ? 6.721   4.308   5.967   1.00 0.00 ? 63  VAL A CG2  4  
ATOM 6099  H H    . VAL A 1 12  ? 4.386   6.197   7.061   1.00 0.00 ? 63  VAL A H    4  
ATOM 6100  H HA   . VAL A 1 12  ? 7.304   6.861   6.839   1.00 0.00 ? 63  VAL A HA   4  
ATOM 6101  H HB   . VAL A 1 12  ? 5.441   5.593   4.797   1.00 0.00 ? 63  VAL A HB   4  
ATOM 6102  H HG11 . VAL A 1 12  ? 8.360   6.382   4.782   1.00 0.00 ? 63  VAL A HG11 4  
ATOM 6103  H HG12 . VAL A 1 12  ? 7.764   5.101   3.727   1.00 0.00 ? 63  VAL A HG12 4  
ATOM 6104  H HG13 . VAL A 1 12  ? 7.121   6.735   3.580   1.00 0.00 ? 63  VAL A HG13 4  
ATOM 6105  H HG21 . VAL A 1 12  ? 7.456   4.452   6.747   1.00 0.00 ? 63  VAL A HG21 4  
ATOM 6106  H HG22 . VAL A 1 12  ? 5.822   3.893   6.396   1.00 0.00 ? 63  VAL A HG22 4  
ATOM 6107  H HG23 . VAL A 1 12  ? 7.112   3.621   5.228   1.00 0.00 ? 63  VAL A HG23 4  
ATOM 6108  N N    . ARG A 1 13  ? 6.914   9.001   5.616   1.00 0.00 ? 64  ARG A N    4  
ATOM 6109  C CA   . ARG A 1 13  ? 6.642   10.325  4.983   1.00 0.00 ? 64  ARG A CA   4  
ATOM 6110  C C    . ARG A 1 13  ? 6.435   10.153  3.475   1.00 0.00 ? 64  ARG A C    4  
ATOM 6111  O O    . ARG A 1 13  ? 6.962   9.241   2.867   1.00 0.00 ? 64  ARG A O    4  
ATOM 6112  C CB   . ARG A 1 13  ? 7.834   11.250  5.237   1.00 0.00 ? 64  ARG A CB   4  
ATOM 6113  C CG   . ARG A 1 13  ? 7.530   12.660  4.734   1.00 0.00 ? 64  ARG A CG   4  
ATOM 6114  C CD   . ARG A 1 13  ? 8.732   13.569  5.000   1.00 0.00 ? 64  ARG A CD   4  
ATOM 6115  N NE   . ARG A 1 13  ? 8.446   14.924  4.450   1.00 0.00 ? 64  ARG A NE   4  
ATOM 6116  C CZ   . ARG A 1 13  ? 9.169   15.946  4.823   1.00 0.00 ? 64  ARG A CZ   4  
ATOM 6117  N NH1  . ARG A 1 13  ? 10.142  15.776  5.669   1.00 0.00 ? 64  ARG A NH1  4  
ATOM 6118  N NH2  . ARG A 1 13  ? 8.922   17.140  4.341   1.00 0.00 ? 64  ARG A NH2  4  
ATOM 6119  H H    . ARG A 1 13  ? 7.803   8.815   5.990   1.00 0.00 ? 64  ARG A H    4  
ATOM 6120  H HA   . ARG A 1 13  ? 5.751   10.756  5.417   1.00 0.00 ? 64  ARG A HA   4  
ATOM 6121  H HB2  . ARG A 1 13  ? 8.041   11.282  6.296   1.00 0.00 ? 64  ARG A HB2  4  
ATOM 6122  H HB3  . ARG A 1 13  ? 8.696   10.866  4.716   1.00 0.00 ? 64  ARG A HB3  4  
ATOM 6123  H HG2  . ARG A 1 13  ? 7.329   12.630  3.674   1.00 0.00 ? 64  ARG A HG2  4  
ATOM 6124  H HG3  . ARG A 1 13  ? 6.666   13.051  5.253   1.00 0.00 ? 64  ARG A HG3  4  
ATOM 6125  H HD2  . ARG A 1 13  ? 8.907   13.638  6.066   1.00 0.00 ? 64  ARG A HD2  4  
ATOM 6126  H HD3  . ARG A 1 13  ? 9.606   13.162  4.516   1.00 0.00 ? 64  ARG A HD3  4  
ATOM 6127  H HE   . ARG A 1 13  ? 7.717   15.045  3.809   1.00 0.00 ? 64  ARG A HE   4  
ATOM 6128  H HH11 . ARG A 1 13  ? 10.335  14.862  6.029   1.00 0.00 ? 64  ARG A HH11 4  
ATOM 6129  H HH12 . ARG A 1 13  ? 10.692  16.555  5.964   1.00 0.00 ? 64  ARG A HH12 4  
ATOM 6130  H HH21 . ARG A 1 13  ? 8.181   17.272  3.681   1.00 0.00 ? 64  ARG A HH21 4  
ATOM 6131  H HH22 . ARG A 1 13  ? 9.469   17.924  4.643   1.00 0.00 ? 64  ARG A HH22 4  
ATOM 6132  N N    . THR A 1 14  ? 5.656   11.021  2.874   1.00 0.00 ? 65  THR A N    4  
ATOM 6133  C CA   . THR A 1 14  ? 5.375   10.940  1.411   1.00 0.00 ? 65  THR A CA   4  
ATOM 6134  C C    . THR A 1 14  ? 5.876   12.205  0.728   1.00 0.00 ? 65  THR A C    4  
ATOM 6135  O O    . THR A 1 14  ? 6.430   13.083  1.359   1.00 0.00 ? 65  THR A O    4  
ATOM 6136  C CB   . THR A 1 14  ? 3.868   10.835  1.204   1.00 0.00 ? 65  THR A CB   4  
ATOM 6137  O OG1  . THR A 1 14  ? 3.243   11.994  1.736   1.00 0.00 ? 65  THR A OG1  4  
ATOM 6138  C CG2  . THR A 1 14  ? 3.331   9.581   1.899   1.00 0.00 ? 65  THR A CG2  4  
ATOM 6139  H H    . THR A 1 14  ? 5.242   11.736  3.391   1.00 0.00 ? 65  THR A H    4  
ATOM 6140  H HA   . THR A 1 14  ? 5.860   10.076  0.980   1.00 0.00 ? 65  THR A HA   4  
ATOM 6141  H HB   . THR A 1 14  ? 3.660   10.777  0.155   1.00 0.00 ? 65  THR A HB   4  
ATOM 6142  H HG1  . THR A 1 14  ? 3.933   12.588  2.040   1.00 0.00 ? 65  THR A HG1  4  
ATOM 6143  H HG21 . THR A 1 14  ? 3.892   9.394   2.805   1.00 0.00 ? 65  THR A HG21 4  
ATOM 6144  H HG22 . THR A 1 14  ? 2.289   9.724   2.148   1.00 0.00 ? 65  THR A HG22 4  
ATOM 6145  H HG23 . THR A 1 14  ? 3.429   8.731   1.238   1.00 0.00 ? 65  THR A HG23 4  
ATOM 6146  N N    . ASP A 1 15  ? 5.686   12.312  -0.556  1.00 0.00 ? 66  ASP A N    4  
ATOM 6147  C CA   . ASP A 1 15  ? 6.149   13.524  -1.270  1.00 0.00 ? 66  ASP A CA   4  
ATOM 6148  C C    . ASP A 1 15  ? 5.318   14.723  -0.801  1.00 0.00 ? 66  ASP A C    4  
ATOM 6149  O O    . ASP A 1 15  ? 5.768   15.852  -0.833  1.00 0.00 ? 66  ASP A O    4  
ATOM 6150  C CB   . ASP A 1 15  ? 5.987   13.321  -2.780  1.00 0.00 ? 66  ASP A CB   4  
ATOM 6151  C CG   . ASP A 1 15  ? 6.628   14.487  -3.538  1.00 0.00 ? 66  ASP A CG   4  
ATOM 6152  O OD1  . ASP A 1 15  ? 7.171   15.363  -2.888  1.00 0.00 ? 66  ASP A OD1  4  
ATOM 6153  O OD2  . ASP A 1 15  ? 6.557   14.485  -4.756  1.00 0.00 ? 66  ASP A OD2  4  
ATOM 6154  H H    . ASP A 1 15  ? 5.232   11.594  -1.049  1.00 0.00 ? 66  ASP A H    4  
ATOM 6155  H HA   . ASP A 1 15  ? 7.188   13.695  -1.033  1.00 0.00 ? 66  ASP A HA   4  
ATOM 6156  H HB2  . ASP A 1 15  ? 6.471   12.399  -3.068  1.00 0.00 ? 66  ASP A HB2  4  
ATOM 6157  H HB3  . ASP A 1 15  ? 4.937   13.267  -3.025  1.00 0.00 ? 66  ASP A HB3  4  
ATOM 6158  N N    . SER A 1 16  ? 4.107   14.486  -0.353  1.00 0.00 ? 67  SER A N    4  
ATOM 6159  C CA   . SER A 1 16  ? 3.259   15.620  0.127   1.00 0.00 ? 67  SER A CA   4  
ATOM 6160  C C    . SER A 1 16  ? 3.692   16.005  1.557   1.00 0.00 ? 67  SER A C    4  
ATOM 6161  O O    . SER A 1 16  ? 4.270   15.205  2.269   1.00 0.00 ? 67  SER A O    4  
ATOM 6162  C CB   . SER A 1 16  ? 1.774   15.206  0.106   1.00 0.00 ? 67  SER A CB   4  
ATOM 6163  O OG   . SER A 1 16  ? 1.220   15.515  -1.172  1.00 0.00 ? 67  SER A OG   4  
ATOM 6164  H H    . SER A 1 16  ? 3.764   13.568  -0.327  1.00 0.00 ? 67  SER A H    4  
ATOM 6165  H HA   . SER A 1 16  ? 3.402   16.457  -0.534  1.00 0.00 ? 67  SER A HA   4  
ATOM 6166  H HB2  . SER A 1 16  ? 1.696   14.149  0.274   1.00 0.00 ? 67  SER A HB2  4  
ATOM 6167  H HB3  . SER A 1 16  ? 1.230   15.731  0.883   1.00 0.00 ? 67  SER A HB3  4  
ATOM 6168  H HG   . SER A 1 16  ? 0.640   16.278  -1.075  1.00 0.00 ? 67  SER A HG   4  
ATOM 6169  N N    . PRO A 1 17  ? 3.442   17.232  1.962   1.00 0.00 ? 68  PRO A N    4  
ATOM 6170  C CA   . PRO A 1 17  ? 3.829   17.738  3.316   1.00 0.00 ? 68  PRO A CA   4  
ATOM 6171  C C    . PRO A 1 17  ? 2.890   17.290  4.446   1.00 0.00 ? 68  PRO A C    4  
ATOM 6172  O O    . PRO A 1 17  ? 3.109   17.635  5.592   1.00 0.00 ? 68  PRO A O    4  
ATOM 6173  C CB   . PRO A 1 17  ? 3.753   19.261  3.148   1.00 0.00 ? 68  PRO A CB   4  
ATOM 6174  C CG   . PRO A 1 17  ? 2.668   19.466  2.148   1.00 0.00 ? 68  PRO A CG   4  
ATOM 6175  C CD   . PRO A 1 17  ? 2.766   18.284  1.177   1.00 0.00 ? 68  PRO A CD   4  
ATOM 6176  H HA   . PRO A 1 17  ? 4.841   17.462  3.541   1.00 0.00 ? 68  PRO A HA   4  
ATOM 6177  H HB2  . PRO A 1 17  ? 3.504   19.742  4.088   1.00 0.00 ? 68  PRO A HB2  4  
ATOM 6178  H HB3  . PRO A 1 17  ? 4.685   19.649  2.765   1.00 0.00 ? 68  PRO A HB3  4  
ATOM 6179  H HG2  . PRO A 1 17  ? 1.704   19.470  2.644   1.00 0.00 ? 68  PRO A HG2  4  
ATOM 6180  H HG3  . PRO A 1 17  ? 2.817   20.392  1.614   1.00 0.00 ? 68  PRO A HG3  4  
ATOM 6181  H HD2  . PRO A 1 17  ? 1.783   17.964  0.866   1.00 0.00 ? 68  PRO A HD2  4  
ATOM 6182  H HD3  . PRO A 1 17  ? 3.367   18.551  0.325   1.00 0.00 ? 68  PRO A HD3  4  
ATOM 6183  N N    . ASN A 1 18  ? 1.835   16.561  4.160   1.00 0.00 ? 69  ASN A N    4  
ATOM 6184  C CA   . ASN A 1 18  ? 0.899   16.159  5.263   1.00 0.00 ? 69  ASN A CA   4  
ATOM 6185  C C    . ASN A 1 18  ? 0.284   14.768  5.036   1.00 0.00 ? 69  ASN A C    4  
ATOM 6186  O O    . ASN A 1 18  ? -0.502  14.313  5.843   1.00 0.00 ? 69  ASN A O    4  
ATOM 6187  C CB   . ASN A 1 18  ? -0.232  17.182  5.323   1.00 0.00 ? 69  ASN A CB   4  
ATOM 6188  C CG   . ASN A 1 18  ? -0.886  17.274  3.940   1.00 0.00 ? 69  ASN A CG   4  
ATOM 6189  O OD1  . ASN A 1 18  ? -0.219  17.542  2.960   1.00 0.00 ? 69  ASN A OD1  4  
ATOM 6190  N ND2  . ASN A 1 18  ? -2.165  17.056  3.812   1.00 0.00 ? 69  ASN A ND2  4  
ATOM 6191  H H    . ASN A 1 18  ? 1.643   16.305  3.232   1.00 0.00 ? 69  ASN A H    4  
ATOM 6192  H HA   . ASN A 1 18  ? 1.421   16.160  6.208   1.00 0.00 ? 69  ASN A HA   4  
ATOM 6193  H HB2  . ASN A 1 18  ? -0.965  16.871  6.055   1.00 0.00 ? 69  ASN A HB2  4  
ATOM 6194  H HB3  . ASN A 1 18  ? 0.167   18.146  5.598   1.00 0.00 ? 69  ASN A HB3  4  
ATOM 6195  H HD21 . ASN A 1 18  ? -2.705  16.838  4.601   1.00 0.00 ? 69  ASN A HD21 4  
ATOM 6196  H HD22 . ASN A 1 18  ? -2.584  17.105  2.925   1.00 0.00 ? 69  ASN A HD22 4  
ATOM 6197  N N    . PHE A 1 19  ? 0.616   14.087  3.964   1.00 0.00 ? 70  PHE A N    4  
ATOM 6198  C CA   . PHE A 1 19  ? 0.020   12.723  3.718   1.00 0.00 ? 70  PHE A CA   4  
ATOM 6199  C C    . PHE A 1 19  ? 1.013   11.646  4.166   1.00 0.00 ? 70  PHE A C    4  
ATOM 6200  O O    . PHE A 1 19  ? 2.159   11.655  3.773   1.00 0.00 ? 70  PHE A O    4  
ATOM 6201  C CB   . PHE A 1 19  ? -0.300  12.566  2.205   1.00 0.00 ? 70  PHE A CB   4  
ATOM 6202  C CG   . PHE A 1 19  ? -1.790  12.382  2.005   1.00 0.00 ? 70  PHE A CG   4  
ATOM 6203  C CD1  . PHE A 1 19  ? -2.668  13.360  2.474   1.00 0.00 ? 70  PHE A CD1  4  
ATOM 6204  C CD2  . PHE A 1 19  ? -2.288  11.241  1.360   1.00 0.00 ? 70  PHE A CD2  4  
ATOM 6205  C CE1  . PHE A 1 19  ? -4.046  13.205  2.313   1.00 0.00 ? 70  PHE A CE1  4  
ATOM 6206  C CE2  . PHE A 1 19  ? -3.672  11.087  1.195   1.00 0.00 ? 70  PHE A CE2  4  
ATOM 6207  C CZ   . PHE A 1 19  ? -4.550  12.071  1.673   1.00 0.00 ? 70  PHE A CZ   4  
ATOM 6208  H H    . PHE A 1 19  ? 1.252   14.465  3.322   1.00 0.00 ? 70  PHE A H    4  
ATOM 6209  H HA   . PHE A 1 19  ? -0.890  12.613  4.302   1.00 0.00 ? 70  PHE A HA   4  
ATOM 6210  H HB2  . PHE A 1 19  ? 0.015   13.454  1.688   1.00 0.00 ? 70  PHE A HB2  4  
ATOM 6211  H HB3  . PHE A 1 19  ? 0.223   11.710  1.794   1.00 0.00 ? 70  PHE A HB3  4  
ATOM 6212  H HD1  . PHE A 1 19  ? -2.279  14.239  2.966   1.00 0.00 ? 70  PHE A HD1  4  
ATOM 6213  H HD2  . PHE A 1 19  ? -1.610  10.485  0.989   1.00 0.00 ? 70  PHE A HD2  4  
ATOM 6214  H HE1  . PHE A 1 19  ? -4.723  13.962  2.681   1.00 0.00 ? 70  PHE A HE1  4  
ATOM 6215  H HE2  . PHE A 1 19  ? -4.059  10.210  0.700   1.00 0.00 ? 70  PHE A HE2  4  
ATOM 6216  H HZ   . PHE A 1 19  ? -5.618  11.956  1.552   1.00 0.00 ? 70  PHE A HZ   4  
ATOM 6217  N N    . LEU A 1 20  ? 0.578   10.714  4.985   1.00 0.00 ? 71  LEU A N    4  
ATOM 6218  C CA   . LEU A 1 20  ? 1.507   9.634   5.446   1.00 0.00 ? 71  LEU A CA   4  
ATOM 6219  C C    . LEU A 1 20  ? 0.766   8.296   5.450   1.00 0.00 ? 71  LEU A C    4  
ATOM 6220  O O    . LEU A 1 20  ? -0.428  8.232   5.665   1.00 0.00 ? 71  LEU A O    4  
ATOM 6221  C CB   . LEU A 1 20  ? 2.018   9.947   6.861   1.00 0.00 ? 71  LEU A CB   4  
ATOM 6222  C CG   . LEU A 1 20  ? 2.939   11.186  6.836   1.00 0.00 ? 71  LEU A CG   4  
ATOM 6223  C CD1  . LEU A 1 20  ? 2.105   12.482  6.985   1.00 0.00 ? 71  LEU A CD1  4  
ATOM 6224  C CD2  . LEU A 1 20  ? 3.947   11.087  7.988   1.00 0.00 ? 71  LEU A CD2  4  
ATOM 6225  H H    . LEU A 1 20  ? -0.361  10.726  5.293   1.00 0.00 ? 71  LEU A H    4  
ATOM 6226  H HA   . LEU A 1 20  ? 2.348   9.558   4.772   1.00 0.00 ? 71  LEU A HA   4  
ATOM 6227  H HB2  . LEU A 1 20  ? 1.184   10.139  7.514   1.00 0.00 ? 71  LEU A HB2  4  
ATOM 6228  H HB3  . LEU A 1 20  ? 2.570   9.094   7.232   1.00 0.00 ? 71  LEU A HB3  4  
ATOM 6229  H HG   . LEU A 1 20  ? 3.479   11.222  5.899   1.00 0.00 ? 71  LEU A HG   4  
ATOM 6230  H HD11 . LEU A 1 20  ? 1.096   12.317  6.645   1.00 0.00 ? 71  LEU A HD11 4  
ATOM 6231  H HD12 . LEU A 1 20  ? 2.083   12.791  8.021   1.00 0.00 ? 71  LEU A HD12 4  
ATOM 6232  H HD13 . LEU A 1 20  ? 2.555   13.261  6.390   1.00 0.00 ? 71  LEU A HD13 4  
ATOM 6233  H HD21 . LEU A 1 20  ? 3.418   10.919  8.915   1.00 0.00 ? 71  LEU A HD21 4  
ATOM 6234  H HD22 . LEU A 1 20  ? 4.624   10.264  7.804   1.00 0.00 ? 71  LEU A HD22 4  
ATOM 6235  H HD23 . LEU A 1 20  ? 4.507   12.005  8.053   1.00 0.00 ? 71  LEU A HD23 4  
ATOM 6236  N N    . CYS A 1 21  ? 1.475   7.222   5.217   1.00 0.00 ? 72  CYS A N    4  
ATOM 6237  C CA   . CYS A 1 21  ? 0.831   5.874   5.205   1.00 0.00 ? 72  CYS A CA   4  
ATOM 6238  C C    . CYS A 1 21  ? 1.123   5.182   6.533   1.00 0.00 ? 72  CYS A C    4  
ATOM 6239  O O    . CYS A 1 21  ? 2.264   5.006   6.908   1.00 0.00 ? 72  CYS A O    4  
ATOM 6240  C CB   . CYS A 1 21  ? 1.406   5.050   4.044   1.00 0.00 ? 72  CYS A CB   4  
ATOM 6241  S SG   . CYS A 1 21  ? 1.117   5.919   2.482   1.00 0.00 ? 72  CYS A SG   4  
ATOM 6242  H H    . CYS A 1 21  ? 2.437   7.303   5.056   1.00 0.00 ? 72  CYS A H    4  
ATOM 6243  H HA   . CYS A 1 21  ? -0.235  5.973   5.081   1.00 0.00 ? 72  CYS A HA   4  
ATOM 6244  H HB2  . CYS A 1 21  ? 2.467   4.911   4.186   1.00 0.00 ? 72  CYS A HB2  4  
ATOM 6245  H HB3  . CYS A 1 21  ? 0.917   4.086   4.009   1.00 0.00 ? 72  CYS A HB3  4  
ATOM 6246  H HG   . CYS A 1 21  ? 1.970   6.100   2.077   1.00 0.00 ? 72  CYS A HG   4  
ATOM 6247  N N    . SER A 1 22  ? 0.108   4.803   7.263   1.00 0.00 ? 73  SER A N    4  
ATOM 6248  C CA   . SER A 1 22  ? 0.359   4.139   8.573   1.00 0.00 ? 73  SER A CA   4  
ATOM 6249  C C    . SER A 1 22  ? 1.204   2.879   8.382   1.00 0.00 ? 73  SER A C    4  
ATOM 6250  O O    . SER A 1 22  ? 2.290   2.772   8.918   1.00 0.00 ? 73  SER A O    4  
ATOM 6251  C CB   . SER A 1 22  ? -0.982  3.754   9.196   1.00 0.00 ? 73  SER A CB   4  
ATOM 6252  O OG   . SER A 1 22  ? -1.476  2.598   8.539   1.00 0.00 ? 73  SER A OG   4  
ATOM 6253  H H    . SER A 1 22  ? -0.813  4.968   6.956   1.00 0.00 ? 73  SER A H    4  
ATOM 6254  H HA   . SER A 1 22  ? 0.879   4.816   9.230   1.00 0.00 ? 73  SER A HA   4  
ATOM 6255  H HB2  . SER A 1 22  ? -0.850  3.543   10.244  1.00 0.00 ? 73  SER A HB2  4  
ATOM 6256  H HB3  . SER A 1 22  ? -1.679  4.572   9.076   1.00 0.00 ? 73  SER A HB3  4  
ATOM 6257  H HG   . SER A 1 22  ? -1.749  2.858   7.656   1.00 0.00 ? 73  SER A HG   4  
ATOM 6258  N N    . VAL A 1 23  ? 0.732   1.928   7.614   1.00 0.00 ? 74  VAL A N    4  
ATOM 6259  C CA   . VAL A 1 23  ? 1.520   0.678   7.392   1.00 0.00 ? 74  VAL A CA   4  
ATOM 6260  C C    . VAL A 1 23  ? 2.062   0.654   5.961   1.00 0.00 ? 74  VAL A C    4  
ATOM 6261  O O    . VAL A 1 23  ? 1.329   0.553   4.993   1.00 0.00 ? 74  VAL A O    4  
ATOM 6262  C CB   . VAL A 1 23  ? 0.613   -0.535  7.648   1.00 0.00 ? 74  VAL A CB   4  
ATOM 6263  C CG1  . VAL A 1 23  ? 1.290   -1.807  7.128   1.00 0.00 ? 74  VAL A CG1  4  
ATOM 6264  C CG2  . VAL A 1 23  ? 0.349   -0.669  9.157   1.00 0.00 ? 74  VAL A CG2  4  
ATOM 6265  H H    . VAL A 1 23  ? -0.142  2.032   7.188   1.00 0.00 ? 74  VAL A H    4  
ATOM 6266  H HA   . VAL A 1 23  ? 2.356   0.638   8.078   1.00 0.00 ? 74  VAL A HA   4  
ATOM 6267  H HB   . VAL A 1 23  ? -0.321  -0.396  7.136   1.00 0.00 ? 74  VAL A HB   4  
ATOM 6268  H HG11 . VAL A 1 23  ? 2.345   -1.776  7.350   1.00 0.00 ? 74  VAL A HG11 4  
ATOM 6269  H HG12 . VAL A 1 23  ? 0.846   -2.672  7.595   1.00 0.00 ? 74  VAL A HG12 4  
ATOM 6270  H HG13 . VAL A 1 23  ? 1.150   -1.867  6.058   1.00 0.00 ? 74  VAL A HG13 4  
ATOM 6271  H HG21 . VAL A 1 23  ? -0.116  0.235   9.524   1.00 0.00 ? 74  VAL A HG21 4  
ATOM 6272  H HG22 . VAL A 1 23  ? -0.312  -1.507  9.331   1.00 0.00 ? 74  VAL A HG22 4  
ATOM 6273  H HG23 . VAL A 1 23  ? 1.281   -0.833  9.679   1.00 0.00 ? 74  VAL A HG23 4  
ATOM 6274  N N    . LEU A 1 24  ? 3.362   0.733   5.841   1.00 0.00 ? 75  LEU A N    4  
ATOM 6275  C CA   . LEU A 1 24  ? 4.027   0.695   4.510   1.00 0.00 ? 75  LEU A CA   4  
ATOM 6276  C C    . LEU A 1 24  ? 5.361   -0.047  4.677   1.00 0.00 ? 75  LEU A C    4  
ATOM 6277  O O    . LEU A 1 24  ? 6.396   0.574   4.832   1.00 0.00 ? 75  LEU A O    4  
ATOM 6278  C CB   . LEU A 1 24  ? 4.279   2.131   4.009   1.00 0.00 ? 75  LEU A CB   4  
ATOM 6279  C CG   . LEU A 1 24  ? 4.432   2.138   2.480   1.00 0.00 ? 75  LEU A CG   4  
ATOM 6280  C CD1  . LEU A 1 24  ? 4.425   3.581   1.979   1.00 0.00 ? 75  LEU A CD1  4  
ATOM 6281  C CD2  . LEU A 1 24  ? 5.739   1.438   2.078   1.00 0.00 ? 75  LEU A CD2  4  
ATOM 6282  H H    . LEU A 1 24  ? 3.908   0.799   6.650   1.00 0.00 ? 75  LEU A H    4  
ATOM 6283  H HA   . LEU A 1 24  ? 3.404   0.164   3.806   1.00 0.00 ? 75  LEU A HA   4  
ATOM 6284  H HB2  . LEU A 1 24  ? 3.441   2.753   4.285   1.00 0.00 ? 75  LEU A HB2  4  
ATOM 6285  H HB3  . LEU A 1 24  ? 5.176   2.527   4.463   1.00 0.00 ? 75  LEU A HB3  4  
ATOM 6286  H HG   . LEU A 1 24  ? 3.596   1.616   2.037   1.00 0.00 ? 75  LEU A HG   4  
ATOM 6287  H HD11 . LEU A 1 24  ? 5.184   4.149   2.496   1.00 0.00 ? 75  LEU A HD11 4  
ATOM 6288  H HD12 . LEU A 1 24  ? 4.619   3.596   0.917   1.00 0.00 ? 75  LEU A HD12 4  
ATOM 6289  H HD13 . LEU A 1 24  ? 3.458   4.016   2.174   1.00 0.00 ? 75  LEU A HD13 4  
ATOM 6290  H HD21 . LEU A 1 24  ? 6.532   1.725   2.753   1.00 0.00 ? 75  LEU A HD21 4  
ATOM 6291  H HD22 . LEU A 1 24  ? 5.597   0.369   2.125   1.00 0.00 ? 75  LEU A HD22 4  
ATOM 6292  H HD23 . LEU A 1 24  ? 6.009   1.718   1.069   1.00 0.00 ? 75  LEU A HD23 4  
ATOM 6293  N N    . PRO A 1 25  ? 5.349   -1.359  4.670   1.00 0.00 ? 76  PRO A N    4  
ATOM 6294  C CA   . PRO A 1 25  ? 6.593   -2.156  4.844   1.00 0.00 ? 76  PRO A CA   4  
ATOM 6295  C C    . PRO A 1 25  ? 7.406   -2.226  3.547   1.00 0.00 ? 76  PRO A C    4  
ATOM 6296  O O    . PRO A 1 25  ? 6.869   -2.428  2.477   1.00 0.00 ? 76  PRO A O    4  
ATOM 6297  C CB   . PRO A 1 25  ? 6.074   -3.537  5.263   1.00 0.00 ? 76  PRO A CB   4  
ATOM 6298  C CG   . PRO A 1 25  ? 4.730   -3.658  4.616   1.00 0.00 ? 76  PRO A CG   4  
ATOM 6299  C CD   . PRO A 1 25  ? 4.165   -2.230  4.496   1.00 0.00 ? 76  PRO A CD   4  
ATOM 6300  H HA   . PRO A 1 25  ? 7.194   -1.739  5.636   1.00 0.00 ? 76  PRO A HA   4  
ATOM 6301  H HB2  . PRO A 1 25  ? 6.740   -4.317  4.910   1.00 0.00 ? 76  PRO A HB2  4  
ATOM 6302  H HB3  . PRO A 1 25  ? 5.973   -3.589  6.339   1.00 0.00 ? 76  PRO A HB3  4  
ATOM 6303  H HG2  . PRO A 1 25  ? 4.834   -4.102  3.634   1.00 0.00 ? 76  PRO A HG2  4  
ATOM 6304  H HG3  . PRO A 1 25  ? 4.072   -4.263  5.223   1.00 0.00 ? 76  PRO A HG3  4  
ATOM 6305  H HD2  . PRO A 1 25  ? 3.723   -2.088  3.517   1.00 0.00 ? 76  PRO A HD2  4  
ATOM 6306  H HD3  . PRO A 1 25  ? 3.440   -2.036  5.271   1.00 0.00 ? 76  PRO A HD3  4  
ATOM 6307  N N    . THR A 1 26  ? 8.700   -2.053  3.631   1.00 0.00 ? 77  THR A N    4  
ATOM 6308  C CA   . THR A 1 26  ? 9.539   -2.097  2.401   1.00 0.00 ? 77  THR A CA   4  
ATOM 6309  C C    . THR A 1 26  ? 9.387   -3.458  1.731   1.00 0.00 ? 77  THR A C    4  
ATOM 6310  O O    . THR A 1 26  ? 9.612   -3.604  0.551   1.00 0.00 ? 77  THR A O    4  
ATOM 6311  C CB   . THR A 1 26  ? 11.017  -1.876  2.757   1.00 0.00 ? 77  THR A CB   4  
ATOM 6312  O OG1  . THR A 1 26  ? 11.505  -2.996  3.483   1.00 0.00 ? 77  THR A OG1  4  
ATOM 6313  C CG2  . THR A 1 26  ? 11.173  -0.616  3.609   1.00 0.00 ? 77  THR A CG2  4  
ATOM 6314  H H    . THR A 1 26  ? 9.113   -1.883  4.502   1.00 0.00 ? 77  THR A H    4  
ATOM 6315  H HA   . THR A 1 26  ? 9.215   -1.323  1.721   1.00 0.00 ? 77  THR A HA   4  
ATOM 6316  H HB   . THR A 1 26  ? 11.589  -1.763  1.849   1.00 0.00 ? 77  THR A HB   4  
ATOM 6317  H HG1  . THR A 1 26  ? 12.276  -2.714  3.984   1.00 0.00 ? 77  THR A HG1  4  
ATOM 6318  H HG21 . THR A 1 26  ? 10.525  0.163   3.230   1.00 0.00 ? 77  THR A HG21 4  
ATOM 6319  H HG22 . THR A 1 26  ? 10.908  -0.840  4.630   1.00 0.00 ? 77  THR A HG22 4  
ATOM 6320  H HG23 . THR A 1 26  ? 12.200  -0.280  3.573   1.00 0.00 ? 77  THR A HG23 4  
ATOM 6321  N N    . HIS A 1 27  ? 9.018   -4.462  2.478   1.00 0.00 ? 78  HIS A N    4  
ATOM 6322  C CA   . HIS A 1 27  ? 8.851   -5.823  1.884   1.00 0.00 ? 78  HIS A CA   4  
ATOM 6323  C C    . HIS A 1 27  ? 7.608   -6.494  2.475   1.00 0.00 ? 78  HIS A C    4  
ATOM 6324  O O    . HIS A 1 27  ? 7.514   -6.689  3.672   1.00 0.00 ? 78  HIS A O    4  
ATOM 6325  C CB   . HIS A 1 27  ? 10.090  -6.666  2.215   1.00 0.00 ? 78  HIS A CB   4  
ATOM 6326  C CG   . HIS A 1 27  ? 10.152  -7.874  1.312   1.00 0.00 ? 78  HIS A CG   4  
ATOM 6327  N ND1  . HIS A 1 27  ? 11.355  -8.386  0.849   1.00 0.00 ? 78  HIS A ND1  4  
ATOM 6328  C CD2  . HIS A 1 27  ? 9.173   -8.668  0.763   1.00 0.00 ? 78  HIS A CD2  4  
ATOM 6329  C CE1  . HIS A 1 27  ? 11.072  -9.437  0.058   1.00 0.00 ? 78  HIS A CE1  4  
ATOM 6330  N NE2  . HIS A 1 27  ? 9.757   -9.654  -0.027  1.00 0.00 ? 78  HIS A NE2  4  
ATOM 6331  H H    . HIS A 1 27  ? 8.853   -4.320  3.433   1.00 0.00 ? 78  HIS A H    4  
ATOM 6332  H HA   . HIS A 1 27  ? 8.739   -5.752  0.809   1.00 0.00 ? 78  HIS A HA   4  
ATOM 6333  H HB2  . HIS A 1 27  ? 10.976  -6.067  2.070   1.00 0.00 ? 78  HIS A HB2  4  
ATOM 6334  H HB3  . HIS A 1 27  ? 10.042  -6.986  3.248   1.00 0.00 ? 78  HIS A HB3  4  
ATOM 6335  H HD1  . HIS A 1 27  ? 12.248  -8.043  1.056   1.00 0.00 ? 78  HIS A HD1  4  
ATOM 6336  H HD2  . HIS A 1 27  ? 8.110   -8.544  0.914   1.00 0.00 ? 78  HIS A HD2  4  
ATOM 6337  H HE1  . HIS A 1 27  ? 11.818  -10.029 -0.452  1.00 0.00 ? 78  HIS A HE1  4  
ATOM 6338  N N    . TRP A 1 28  ? 6.669   -6.878  1.637   1.00 0.00 ? 79  TRP A N    4  
ATOM 6339  C CA   . TRP A 1 28  ? 5.437   -7.582  2.117   1.00 0.00 ? 79  TRP A CA   4  
ATOM 6340  C C    . TRP A 1 28  ? 5.383   -8.926  1.382   1.00 0.00 ? 79  TRP A C    4  
ATOM 6341  O O    . TRP A 1 28  ? 5.543   -8.979  0.181   1.00 0.00 ? 79  TRP A O    4  
ATOM 6342  C CB   . TRP A 1 28  ? 4.204   -6.697  1.798   1.00 0.00 ? 79  TRP A CB   4  
ATOM 6343  C CG   . TRP A 1 28  ? 3.123   -7.456  1.076   1.00 0.00 ? 79  TRP A CG   4  
ATOM 6344  C CD1  . TRP A 1 28  ? 2.291   -8.374  1.625   1.00 0.00 ? 79  TRP A CD1  4  
ATOM 6345  C CD2  . TRP A 1 28  ? 2.760   -7.361  -0.327  1.00 0.00 ? 79  TRP A CD2  4  
ATOM 6346  N NE1  . TRP A 1 28  ? 1.426   -8.840  0.641   1.00 0.00 ? 79  TRP A NE1  4  
ATOM 6347  C CE2  . TRP A 1 28  ? 1.680   -8.239  -0.576  1.00 0.00 ? 79  TRP A CE2  4  
ATOM 6348  C CE3  . TRP A 1 28  ? 3.261   -6.594  -1.390  1.00 0.00 ? 79  TRP A CE3  4  
ATOM 6349  C CZ2  . TRP A 1 28  ? 1.114   -8.354  -1.843  1.00 0.00 ? 79  TRP A CZ2  4  
ATOM 6350  C CZ3  . TRP A 1 28  ? 2.701   -6.708  -2.673  1.00 0.00 ? 79  TRP A CZ3  4  
ATOM 6351  C CH2  . TRP A 1 28  ? 1.624   -7.586  -2.898  1.00 0.00 ? 79  TRP A CH2  4  
ATOM 6352  H H    . TRP A 1 28  ? 6.791   -6.728  0.667   1.00 0.00 ? 79  TRP A H    4  
ATOM 6353  H HA   . TRP A 1 28  ? 5.501   -7.762  3.183   1.00 0.00 ? 79  TRP A HA   4  
ATOM 6354  H HB2  . TRP A 1 28  ? 3.799   -6.300  2.715   1.00 0.00 ? 79  TRP A HB2  4  
ATOM 6355  H HB3  . TRP A 1 28  ? 4.526   -5.874  1.177   1.00 0.00 ? 79  TRP A HB3  4  
ATOM 6356  H HD1  . TRP A 1 28  ? 2.296   -8.690  2.656   1.00 0.00 ? 79  TRP A HD1  4  
ATOM 6357  H HE1  . TRP A 1 28  ? 0.716   -9.515  0.772   1.00 0.00 ? 79  TRP A HE1  4  
ATOM 6358  H HE3  . TRP A 1 28  ? 4.095   -5.921  -1.220  1.00 0.00 ? 79  TRP A HE3  4  
ATOM 6359  H HZ2  . TRP A 1 28  ? 0.288   -9.031  -2.009  1.00 0.00 ? 79  TRP A HZ2  4  
ATOM 6360  H HZ3  . TRP A 1 28  ? 3.093   -6.114  -3.488  1.00 0.00 ? 79  TRP A HZ3  4  
ATOM 6361  H HH2  . TRP A 1 28  ? 1.204   -7.676  -3.888  1.00 0.00 ? 79  TRP A HH2  4  
ATOM 6362  N N    . ARG A 1 29  ? 5.181   -10.011 2.088   1.00 0.00 ? 80  ARG A N    4  
ATOM 6363  C CA   . ARG A 1 29  ? 5.146   -11.350 1.417   1.00 0.00 ? 80  ARG A CA   4  
ATOM 6364  C C    . ARG A 1 29  ? 3.743   -11.934 1.449   1.00 0.00 ? 80  ARG A C    4  
ATOM 6365  O O    . ARG A 1 29  ? 3.153   -12.137 2.489   1.00 0.00 ? 80  ARG A O    4  
ATOM 6366  C CB   . ARG A 1 29  ? 6.113   -12.291 2.138   1.00 0.00 ? 80  ARG A CB   4  
ATOM 6367  C CG   . ARG A 1 29  ? 5.615   -12.579 3.562   1.00 0.00 ? 80  ARG A CG   4  
ATOM 6368  C CD   . ARG A 1 29  ? 6.776   -13.139 4.388   1.00 0.00 ? 80  ARG A CD   4  
ATOM 6369  N NE   . ARG A 1 29  ? 6.275   -13.660 5.708   1.00 0.00 ? 80  ARG A NE   4  
ATOM 6370  C CZ   . ARG A 1 29  ? 5.661   -12.881 6.566   1.00 0.00 ? 80  ARG A CZ   4  
ATOM 6371  N NH1  . ARG A 1 29  ? 5.595   -11.600 6.349   1.00 0.00 ? 80  ARG A NH1  4  
ATOM 6372  N NH2  . ARG A 1 29  ? 5.144   -13.383 7.662   1.00 0.00 ? 80  ARG A NH2  4  
ATOM 6373  H H    . ARG A 1 29  ? 5.066   -9.950  3.058   1.00 0.00 ? 80  ARG A H    4  
ATOM 6374  H HA   . ARG A 1 29  ? 5.460   -11.260 0.385   1.00 0.00 ? 80  ARG A HA   4  
ATOM 6375  H HB2  . ARG A 1 29  ? 6.185   -13.217 1.588   1.00 0.00 ? 80  ARG A HB2  4  
ATOM 6376  H HB3  . ARG A 1 29  ? 7.086   -11.825 2.186   1.00 0.00 ? 80  ARG A HB3  4  
ATOM 6377  H HG2  . ARG A 1 29  ? 5.247   -11.669 4.004   1.00 0.00 ? 80  ARG A HG2  4  
ATOM 6378  H HG3  . ARG A 1 29  ? 4.823   -13.313 3.527   1.00 0.00 ? 80  ARG A HG3  4  
ATOM 6379  H HD2  . ARG A 1 29  ? 7.214   -13.965 3.865   1.00 0.00 ? 80  ARG A HD2  4  
ATOM 6380  H HD3  . ARG A 1 29  ? 7.529   -12.361 4.509   1.00 0.00 ? 80  ARG A HD3  4  
ATOM 6381  H HE   . ARG A 1 29  ? 6.380   -14.612 5.916   1.00 0.00 ? 80  ARG A HE   4  
ATOM 6382  H HH11 . ARG A 1 29  ? 6.012   -11.212 5.530   1.00 0.00 ? 80  ARG A HH11 4  
ATOM 6383  H HH12 . ARG A 1 29  ? 5.137   -11.002 7.006   1.00 0.00 ? 80  ARG A HH12 4  
ATOM 6384  H HH21 . ARG A 1 29  ? 5.215   -14.363 7.849   1.00 0.00 ? 80  ARG A HH21 4  
ATOM 6385  H HH22 . ARG A 1 29  ? 4.681   -12.783 8.318   1.00 0.00 ? 80  ARG A HH22 4  
ATOM 6386  N N    . SER A 1 30  ? 3.220   -12.230 0.294   1.00 0.00 ? 81  SER A N    4  
ATOM 6387  C CA   . SER A 1 30  ? 1.868   -12.839 0.190   1.00 0.00 ? 81  SER A CA   4  
ATOM 6388  C C    . SER A 1 30  ? 2.026   -14.196 -0.477  1.00 0.00 ? 81  SER A C    4  
ATOM 6389  O O    . SER A 1 30  ? 2.498   -14.291 -1.590  1.00 0.00 ? 81  SER A O    4  
ATOM 6390  C CB   . SER A 1 30  ? 0.984   -11.960 -0.684  1.00 0.00 ? 81  SER A CB   4  
ATOM 6391  O OG   . SER A 1 30  ? -0.266  -12.604 -0.885  1.00 0.00 ? 81  SER A OG   4  
ATOM 6392  H H    . SER A 1 30  ? 3.732   -12.064 -0.522  1.00 0.00 ? 81  SER A H    4  
ATOM 6393  H HA   . SER A 1 30  ? 1.422   -12.959 1.170   1.00 0.00 ? 81  SER A HA   4  
ATOM 6394  H HB2  . SER A 1 30  ? 0.823   -11.015 -0.197  1.00 0.00 ? 81  SER A HB2  4  
ATOM 6395  H HB3  . SER A 1 30  ? 1.475   -11.795 -1.634  1.00 0.00 ? 81  SER A HB3  4  
ATOM 6396  H HG   . SER A 1 30  ? -0.654  -12.773 -0.024  1.00 0.00 ? 81  SER A HG   4  
ATOM 6397  N N    . ASN A 1 31  ? 1.647   -15.247 0.176   1.00 0.00 ? 82  ASN A N    4  
ATOM 6398  C CA   . ASN A 1 31  ? 1.788   -16.575 -0.468  1.00 0.00 ? 82  ASN A CA   4  
ATOM 6399  C C    . ASN A 1 31  ? 0.968   -16.595 -1.753  1.00 0.00 ? 82  ASN A C    4  
ATOM 6400  O O    . ASN A 1 31  ? 1.363   -17.164 -2.749  1.00 0.00 ? 82  ASN A O    4  
ATOM 6401  C CB   . ASN A 1 31  ? 1.292   -17.676 0.470   1.00 0.00 ? 82  ASN A CB   4  
ATOM 6402  C CG   . ASN A 1 31  ? 2.224   -17.775 1.680   1.00 0.00 ? 82  ASN A CG   4  
ATOM 6403  O OD1  . ASN A 1 31  ? 1.786   -18.024 2.785   1.00 0.00 ? 82  ASN A OD1  4  
ATOM 6404  N ND2  . ASN A 1 31  ? 3.503   -17.582 1.516   1.00 0.00 ? 82  ASN A ND2  4  
ATOM 6405  H H    . ASN A 1 31  ? 1.264   -15.165 1.076   1.00 0.00 ? 82  ASN A H    4  
ATOM 6406  H HA   . ASN A 1 31  ? 2.831   -16.747 -0.712  1.00 0.00 ? 82  ASN A HA   4  
ATOM 6407  H HB2  . ASN A 1 31  ? 0.289   -17.443 0.800   1.00 0.00 ? 82  ASN A HB2  4  
ATOM 6408  H HB3  . ASN A 1 31  ? 1.288   -18.618 -0.058  1.00 0.00 ? 82  ASN A HB3  4  
ATOM 6409  H HD21 . ASN A 1 31  ? 3.856   -17.370 0.628   1.00 0.00 ? 82  ASN A HD21 4  
ATOM 6410  H HD22 . ASN A 1 31  ? 4.110   -17.655 2.280   1.00 0.00 ? 82  ASN A HD22 4  
ATOM 6411  N N    . LYS A 1 32  ? -0.183  -15.985 -1.735  1.00 0.00 ? 83  LYS A N    4  
ATOM 6412  C CA   . LYS A 1 32  ? -1.035  -15.985 -2.954  1.00 0.00 ? 83  LYS A CA   4  
ATOM 6413  C C    . LYS A 1 32  ? -2.038  -14.834 -2.849  1.00 0.00 ? 83  LYS A C    4  
ATOM 6414  O O    . LYS A 1 32  ? -1.668  -13.683 -2.739  1.00 0.00 ? 83  LYS A O    4  
ATOM 6415  C CB   . LYS A 1 32  ? -1.770  -17.331 -3.052  1.00 0.00 ? 83  LYS A CB   4  
ATOM 6416  C CG   . LYS A 1 32  ? -2.348  -17.509 -4.461  1.00 0.00 ? 83  LYS A CG   4  
ATOM 6417  C CD   . LYS A 1 32  ? -3.165  -18.808 -4.531  1.00 0.00 ? 83  LYS A CD   4  
ATOM 6418  C CE   . LYS A 1 32  ? -3.679  -19.027 -5.965  1.00 0.00 ? 83  LYS A CE   4  
ATOM 6419  N NZ   . LYS A 1 32  ? -2.539  -19.416 -6.840  1.00 0.00 ? 83  LYS A NZ   4  
ATOM 6420  H H    . LYS A 1 32  ? -0.487  -15.520 -0.919  1.00 0.00 ? 83  LYS A H    4  
ATOM 6421  H HA   . LYS A 1 32  ? -0.416  -15.843 -3.829  1.00 0.00 ? 83  LYS A HA   4  
ATOM 6422  H HB2  . LYS A 1 32  ? -1.076  -18.133 -2.844  1.00 0.00 ? 83  LYS A HB2  4  
ATOM 6423  H HB3  . LYS A 1 32  ? -2.570  -17.361 -2.329  1.00 0.00 ? 83  LYS A HB3  4  
ATOM 6424  H HG2  . LYS A 1 32  ? -2.986  -16.670 -4.691  1.00 0.00 ? 83  LYS A HG2  4  
ATOM 6425  H HG3  . LYS A 1 32  ? -1.541  -17.552 -5.178  1.00 0.00 ? 83  LYS A HG3  4  
ATOM 6426  H HD2  . LYS A 1 32  ? -2.533  -19.642 -4.246  1.00 0.00 ? 83  LYS A HD2  4  
ATOM 6427  H HD3  . LYS A 1 32  ? -4.001  -18.745 -3.854  1.00 0.00 ? 83  LYS A HD3  4  
ATOM 6428  H HE2  . LYS A 1 32  ? -4.426  -19.812 -5.972  1.00 0.00 ? 83  LYS A HE2  4  
ATOM 6429  H HE3  . LYS A 1 32  ? -4.120  -18.111 -6.337  1.00 0.00 ? 83  LYS A HE3  4  
ATOM 6430  H HZ1  . LYS A 1 32  ? -1.786  -19.829 -6.256  1.00 0.00 ? 83  LYS A HZ1  4  
ATOM 6431  H HZ2  . LYS A 1 32  ? -2.856  -20.119 -7.541  1.00 0.00 ? 83  LYS A HZ2  4  
ATOM 6432  H HZ3  . LYS A 1 32  ? -2.175  -18.578 -7.330  1.00 0.00 ? 83  LYS A HZ3  4  
ATOM 6433  N N    . THR A 1 33  ? -3.304  -15.140 -2.864  1.00 0.00 ? 84  THR A N    4  
ATOM 6434  C CA   . THR A 1 33  ? -4.329  -14.077 -2.745  1.00 0.00 ? 84  THR A CA   4  
ATOM 6435  C C    . THR A 1 33  ? -4.420  -13.672 -1.279  1.00 0.00 ? 84  THR A C    4  
ATOM 6436  O O    . THR A 1 33  ? -5.491  -13.457 -0.746  1.00 0.00 ? 84  THR A O    4  
ATOM 6437  C CB   . THR A 1 33  ? -5.687  -14.614 -3.227  1.00 0.00 ? 84  THR A CB   4  
ATOM 6438  O OG1  . THR A 1 33  ? -5.501  -15.426 -4.379  1.00 0.00 ? 84  THR A OG1  4  
ATOM 6439  C CG2  . THR A 1 33  ? -6.621  -13.452 -3.568  1.00 0.00 ? 84  THR A CG2  4  
ATOM 6440  H H    . THR A 1 33  ? -3.583  -16.070 -2.934  1.00 0.00 ? 84  THR A H    4  
ATOM 6441  H HA   . THR A 1 33  ? -4.034  -13.224 -3.339  1.00 0.00 ? 84  THR A HA   4  
ATOM 6442  H HB   . THR A 1 33  ? -6.137  -15.208 -2.445  1.00 0.00 ? 84  THR A HB   4  
ATOM 6443  H HG1  . THR A 1 33  ? -4.636  -15.232 -4.747  1.00 0.00 ? 84  THR A HG1  4  
ATOM 6444  H HG21 . THR A 1 33  ? -6.122  -12.769 -4.240  1.00 0.00 ? 84  THR A HG21 4  
ATOM 6445  H HG22 . THR A 1 33  ? -7.510  -13.837 -4.044  1.00 0.00 ? 84  THR A HG22 4  
ATOM 6446  H HG23 . THR A 1 33  ? -6.896  -12.932 -2.662  1.00 0.00 ? 84  THR A HG23 4  
ATOM 6447  N N    . LEU A 1 34  ? -3.289  -13.576 -0.622  1.00 0.00 ? 85  LEU A N    4  
ATOM 6448  C CA   . LEU A 1 34  ? -3.266  -13.188 0.825   1.00 0.00 ? 85  LEU A CA   4  
ATOM 6449  C C    . LEU A 1 34  ? -2.444  -11.894 0.984   1.00 0.00 ? 85  LEU A C    4  
ATOM 6450  O O    . LEU A 1 34  ? -1.277  -11.929 1.319   1.00 0.00 ? 85  LEU A O    4  
ATOM 6451  C CB   . LEU A 1 34  ? -2.628  -14.334 1.641   1.00 0.00 ? 85  LEU A CB   4  
ATOM 6452  C CG   . LEU A 1 34  ? -3.090  -14.287 3.108   1.00 0.00 ? 85  LEU A CG   4  
ATOM 6453  C CD1  . LEU A 1 34  ? -2.376  -15.382 3.900   1.00 0.00 ? 85  LEU A CD1  4  
ATOM 6454  C CD2  . LEU A 1 34  ? -2.757  -12.927 3.722   1.00 0.00 ? 85  LEU A CD2  4  
ATOM 6455  H H    . LEU A 1 34  ? -2.443  -13.760 -1.089  1.00 0.00 ? 85  LEU A H    4  
ATOM 6456  H HA   . LEU A 1 34  ? -4.271  -13.021 1.175   1.00 0.00 ? 85  LEU A HA   4  
ATOM 6457  H HB2  . LEU A 1 34  ? -2.923  -15.282 1.212   1.00 0.00 ? 85  LEU A HB2  4  
ATOM 6458  H HB3  . LEU A 1 34  ? -1.553  -14.250 1.602   1.00 0.00 ? 85  LEU A HB3  4  
ATOM 6459  H HG   . LEU A 1 34  ? -4.159  -14.452 3.158   1.00 0.00 ? 85  LEU A HG   4  
ATOM 6460  H HD11 . LEU A 1 34  ? -2.553  -16.337 3.431   1.00 0.00 ? 85  LEU A HD11 4  
ATOM 6461  H HD12 . LEU A 1 34  ? -1.315  -15.180 3.912   1.00 0.00 ? 85  LEU A HD12 4  
ATOM 6462  H HD13 . LEU A 1 34  ? -2.750  -15.402 4.913   1.00 0.00 ? 85  LEU A HD13 4  
ATOM 6463  H HD21 . LEU A 1 34  ? -1.748  -12.651 3.456   1.00 0.00 ? 85  LEU A HD21 4  
ATOM 6464  H HD22 . LEU A 1 34  ? -3.446  -12.187 3.350   1.00 0.00 ? 85  LEU A HD22 4  
ATOM 6465  H HD23 . LEU A 1 34  ? -2.840  -12.983 4.800   1.00 0.00 ? 85  LEU A HD23 4  
ATOM 6466  N N    . PRO A 1 35  ? -3.054  -10.759 0.724   1.00 0.00 ? 86  PRO A N    4  
ATOM 6467  C CA   . PRO A 1 35  ? -2.400  -9.425  0.830   1.00 0.00 ? 86  PRO A CA   4  
ATOM 6468  C C    . PRO A 1 35  ? -2.587  -8.780  2.205   1.00 0.00 ? 86  PRO A C    4  
ATOM 6469  O O    . PRO A 1 35  ? -3.111  -9.376  3.126   1.00 0.00 ? 86  PRO A O    4  
ATOM 6470  C CB   . PRO A 1 35  ? -3.157  -8.619  -0.210  1.00 0.00 ? 86  PRO A CB   4  
ATOM 6471  C CG   . PRO A 1 35  ? -4.561  -9.104  -0.050  1.00 0.00 ? 86  PRO A CG   4  
ATOM 6472  C CD   . PRO A 1 35  ? -4.456  -10.604 0.298   1.00 0.00 ? 86  PRO A CD   4  
ATOM 6473  H HA   . PRO A 1 35  ? -1.358  -9.480  0.562   1.00 0.00 ? 86  PRO A HA   4  
ATOM 6474  H HB2  . PRO A 1 35  ? -3.084  -7.555  0.000   1.00 0.00 ? 86  PRO A HB2  4  
ATOM 6475  H HB3  . PRO A 1 35  ? -2.796  -8.839  -1.202  1.00 0.00 ? 86  PRO A HB3  4  
ATOM 6476  H HG2  . PRO A 1 35  ? -5.043  -8.565  0.759   1.00 0.00 ? 86  PRO A HG2  4  
ATOM 6477  H HG3  . PRO A 1 35  ? -5.112  -8.977  -0.964  1.00 0.00 ? 86  PRO A HG3  4  
ATOM 6478  H HD2  . PRO A 1 35  ? -5.131  -10.857 1.104   1.00 0.00 ? 86  PRO A HD2  4  
ATOM 6479  H HD3  . PRO A 1 35  ? -4.649  -11.208 -0.570  1.00 0.00 ? 86  PRO A HD3  4  
ATOM 6480  N N    . ILE A 1 36  ? -2.170  -7.550  2.327   1.00 0.00 ? 87  ILE A N    4  
ATOM 6481  C CA   . ILE A 1 36  ? -2.300  -6.810  3.617   1.00 0.00 ? 87  ILE A CA   4  
ATOM 6482  C C    . ILE A 1 36  ? -2.975  -5.462  3.374   1.00 0.00 ? 87  ILE A C    4  
ATOM 6483  O O    . ILE A 1 36  ? -3.013  -4.973  2.265   1.00 0.00 ? 87  ILE A O    4  
ATOM 6484  C CB   . ILE A 1 36  ? -0.901  -6.607  4.180   1.00 0.00 ? 87  ILE A CB   4  
ATOM 6485  C CG1  . ILE A 1 36  ? -0.066  -5.768  3.199   1.00 0.00 ? 87  ILE A CG1  4  
ATOM 6486  C CG2  . ILE A 1 36  ? -0.249  -7.980  4.351   1.00 0.00 ? 87  ILE A CG2  4  
ATOM 6487  C CD1  . ILE A 1 36  ? 1.325   -5.537  3.790   1.00 0.00 ? 87  ILE A CD1  4  
ATOM 6488  H H    . ILE A 1 36  ? -1.762  -7.106  1.556   1.00 0.00 ? 87  ILE A H    4  
ATOM 6489  H HA   . ILE A 1 36  ? -2.891  -7.377  4.321   1.00 0.00 ? 87  ILE A HA   4  
ATOM 6490  H HB   . ILE A 1 36  ? -0.960  -6.105  5.135   1.00 0.00 ? 87  ILE A HB   4  
ATOM 6491  H HG12 . ILE A 1 36  ? 0.025   -6.301  2.263   1.00 0.00 ? 87  ILE A HG12 4  
ATOM 6492  H HG13 . ILE A 1 36  ? -0.540  -4.816  3.026   1.00 0.00 ? 87  ILE A HG13 4  
ATOM 6493  H HG21 . ILE A 1 36  ? -0.857  -8.590  5.002   1.00 0.00 ? 87  ILE A HG21 4  
ATOM 6494  H HG22 . ILE A 1 36  ? -0.165  -8.457  3.385   1.00 0.00 ? 87  ILE A HG22 4  
ATOM 6495  H HG23 . ILE A 1 36  ? 0.733   -7.865  4.780   1.00 0.00 ? 87  ILE A HG23 4  
ATOM 6496  H HD11 . ILE A 1 36  ? 1.228   -5.050  4.749   1.00 0.00 ? 87  ILE A HD11 4  
ATOM 6497  H HD12 . ILE A 1 36  ? 1.826   -6.485  3.915   1.00 0.00 ? 87  ILE A HD12 4  
ATOM 6498  H HD13 . ILE A 1 36  ? 1.900   -4.910  3.123   1.00 0.00 ? 87  ILE A HD13 4  
ATOM 6499  N N    . ALA A 1 37  ? -3.514  -4.865  4.410   1.00 0.00 ? 88  ALA A N    4  
ATOM 6500  C CA   . ALA A 1 37  ? -4.204  -3.542  4.264   1.00 0.00 ? 88  ALA A CA   4  
ATOM 6501  C C    . ALA A 1 37  ? -3.532  -2.501  5.162   1.00 0.00 ? 88  ALA A C    4  
ATOM 6502  O O    . ALA A 1 37  ? -3.145  -2.793  6.275   1.00 0.00 ? 88  ALA A O    4  
ATOM 6503  C CB   . ALA A 1 37  ? -5.671  -3.705  4.673   1.00 0.00 ? 88  ALA A CB   4  
ATOM 6504  H H    . ALA A 1 37  ? -3.467  -5.294  5.292   1.00 0.00 ? 88  ALA A H    4  
ATOM 6505  H HA   . ALA A 1 37  ? -4.158  -3.208  3.238   1.00 0.00 ? 88  ALA A HA   4  
ATOM 6506  H HB1  . ALA A 1 37  ? -5.731  -4.303  5.574   1.00 0.00 ? 88  ALA A HB1  4  
ATOM 6507  H HB2  . ALA A 1 37  ? -6.109  -2.733  4.855   1.00 0.00 ? 88  ALA A HB2  4  
ATOM 6508  H HB3  . ALA A 1 37  ? -6.208  -4.198  3.877   1.00 0.00 ? 88  ALA A HB3  4  
ATOM 6509  N N    . PHE A 1 38  ? -3.399  -1.281  4.684   1.00 0.00 ? 89  PHE A N    4  
ATOM 6510  C CA   . PHE A 1 38  ? -2.764  -0.197  5.504   1.00 0.00 ? 89  PHE A CA   4  
ATOM 6511  C C    . PHE A 1 38  ? -3.726  0.971   5.638   1.00 0.00 ? 89  PHE A C    4  
ATOM 6512  O O    . PHE A 1 38  ? -4.763  1.004   5.005   1.00 0.00 ? 89  PHE A O    4  
ATOM 6513  C CB   . PHE A 1 38  ? -1.463  0.281   4.870   1.00 0.00 ? 89  PHE A CB   4  
ATOM 6514  C CG   . PHE A 1 38  ? -1.704  0.869   3.502   1.00 0.00 ? 89  PHE A CG   4  
ATOM 6515  C CD1  . PHE A 1 38  ? -2.054  0.040   2.431   1.00 0.00 ? 89  PHE A CD1  4  
ATOM 6516  C CD2  . PHE A 1 38  ? -1.542  2.244   3.301   1.00 0.00 ? 89  PHE A CD2  4  
ATOM 6517  C CE1  . PHE A 1 38  ? -2.233  0.591   1.155   1.00 0.00 ? 89  PHE A CE1  4  
ATOM 6518  C CE2  . PHE A 1 38  ? -1.715  2.789   2.031   1.00 0.00 ? 89  PHE A CE2  4  
ATOM 6519  C CZ   . PHE A 1 38  ? -2.067  1.971   0.961   1.00 0.00 ? 89  PHE A CZ   4  
ATOM 6520  H H    . PHE A 1 38  ? -3.730  -1.073  3.783   1.00 0.00 ? 89  PHE A H    4  
ATOM 6521  H HA   . PHE A 1 38  ? -2.547  -0.574  6.493   1.00 0.00 ? 89  PHE A HA   4  
ATOM 6522  H HB2  . PHE A 1 38  ? -1.025  1.037   5.506   1.00 0.00 ? 89  PHE A HB2  4  
ATOM 6523  H HB3  . PHE A 1 38  ? -0.782  -0.550  4.787   1.00 0.00 ? 89  PHE A HB3  4  
ATOM 6524  H HD1  . PHE A 1 38  ? -2.184  -1.021  2.588   1.00 0.00 ? 89  PHE A HD1  4  
ATOM 6525  H HD2  . PHE A 1 38  ? -1.276  2.882   4.130   1.00 0.00 ? 89  PHE A HD2  4  
ATOM 6526  H HE1  . PHE A 1 38  ? -2.503  -0.044  0.326   1.00 0.00 ? 89  PHE A HE1  4  
ATOM 6527  H HE2  . PHE A 1 38  ? -1.588  3.846   1.880   1.00 0.00 ? 89  PHE A HE2  4  
ATOM 6528  H HZ   . PHE A 1 38  ? -2.194  2.401   -0.018  1.00 0.00 ? 89  PHE A HZ   4  
ATOM 6529  N N    . LYS A 1 39  ? -3.399  1.929   6.470   1.00 0.00 ? 90  LYS A N    4  
ATOM 6530  C CA   . LYS A 1 39  ? -4.299  3.103   6.665   1.00 0.00 ? 90  LYS A CA   4  
ATOM 6531  C C    . LYS A 1 39  ? -3.555  4.359   6.241   1.00 0.00 ? 90  LYS A C    4  
ATOM 6532  O O    . LYS A 1 39  ? -2.386  4.519   6.534   1.00 0.00 ? 90  LYS A O    4  
ATOM 6533  C CB   . LYS A 1 39  ? -4.629  3.247   8.153   1.00 0.00 ? 90  LYS A CB   4  
ATOM 6534  C CG   . LYS A 1 39  ? -5.273  1.977   8.682   1.00 0.00 ? 90  LYS A CG   4  
ATOM 6535  C CD   . LYS A 1 39  ? -5.674  2.208   10.142  1.00 0.00 ? 90  LYS A CD   4  
ATOM 6536  C CE   . LYS A 1 39  ? -6.093  0.882   10.765  1.00 0.00 ? 90  LYS A CE   4  
ATOM 6537  N NZ   . LYS A 1 39  ? -7.413  0.485   10.212  1.00 0.00 ? 90  LYS A NZ   4  
ATOM 6538  H H    . LYS A 1 39  ? -2.555  1.873   6.970   1.00 0.00 ? 90  LYS A H    4  
ATOM 6539  H HA   . LYS A 1 39  ? -5.211  2.997   6.094   1.00 0.00 ? 90  LYS A HA   4  
ATOM 6540  H HB2  . LYS A 1 39  ? -3.721  3.437   8.704   1.00 0.00 ? 90  LYS A HB2  4  
ATOM 6541  H HB3  . LYS A 1 39  ? -5.310  4.073   8.290   1.00 0.00 ? 90  LYS A HB3  4  
ATOM 6542  H HG2  . LYS A 1 39  ? -6.149  1.741   8.092   1.00 0.00 ? 90  LYS A HG2  4  
ATOM 6543  H HG3  . LYS A 1 39  ? -4.565  1.167   8.626   1.00 0.00 ? 90  LYS A HG3  4  
ATOM 6544  H HD2  . LYS A 1 39  ? -4.838  2.618   10.691  1.00 0.00 ? 90  LYS A HD2  4  
ATOM 6545  H HD3  . LYS A 1 39  ? -6.505  2.898   10.184  1.00 0.00 ? 90  LYS A HD3  4  
ATOM 6546  H HE2  . LYS A 1 39  ? -5.356  0.128   10.529  1.00 0.00 ? 90  LYS A HE2  4  
ATOM 6547  H HE3  . LYS A 1 39  ? -6.162  0.993   11.837  1.00 0.00 ? 90  LYS A HE3  4  
ATOM 6548  H HZ1  . LYS A 1 39  ? -7.812  1.278   9.668   1.00 0.00 ? 90  LYS A HZ1  4  
ATOM 6549  H HZ2  . LYS A 1 39  ? -7.292  -0.339  9.589   1.00 0.00 ? 90  LYS A HZ2  4  
ATOM 6550  H HZ3  . LYS A 1 39  ? -8.057  0.243   10.991  1.00 0.00 ? 90  LYS A HZ3  4  
ATOM 6551  N N    . VAL A 1 40  ? -4.222  5.265   5.580   1.00 0.00 ? 91  VAL A N    4  
ATOM 6552  C CA   . VAL A 1 40  ? -3.558  6.531   5.154   1.00 0.00 ? 91  VAL A CA   4  
ATOM 6553  C C    . VAL A 1 40  ? -4.015  7.670   6.056   1.00 0.00 ? 91  VAL A C    4  
ATOM 6554  O O    . VAL A 1 40  ? -5.183  7.966   6.131   1.00 0.00 ? 91  VAL A O    4  
ATOM 6555  C CB   . VAL A 1 40  ? -3.954  6.848   3.713   1.00 0.00 ? 91  VAL A CB   4  
ATOM 6556  C CG1  . VAL A 1 40  ? -3.372  8.201   3.312   1.00 0.00 ? 91  VAL A CG1  4  
ATOM 6557  C CG2  . VAL A 1 40  ? -3.385  5.774   2.797   1.00 0.00 ? 91  VAL A CG2  4  
ATOM 6558  H H    . VAL A 1 40  ? -5.166  5.118   5.374   1.00 0.00 ? 91  VAL A H    4  
ATOM 6559  H HA   . VAL A 1 40  ? -2.486  6.430   5.213   1.00 0.00 ? 91  VAL A HA   4  
ATOM 6560  H HB   . VAL A 1 40  ? -5.032  6.870   3.624   1.00 0.00 ? 91  VAL A HB   4  
ATOM 6561  H HG11 . VAL A 1 40  ? -2.329  8.239   3.590   1.00 0.00 ? 91  VAL A HG11 4  
ATOM 6562  H HG12 . VAL A 1 40  ? -3.466  8.331   2.245   1.00 0.00 ? 91  VAL A HG12 4  
ATOM 6563  H HG13 . VAL A 1 40  ? -3.912  8.986   3.820   1.00 0.00 ? 91  VAL A HG13 4  
ATOM 6564  H HG21 . VAL A 1 40  ? -3.783  4.813   3.085   1.00 0.00 ? 91  VAL A HG21 4  
ATOM 6565  H HG22 . VAL A 1 40  ? -3.658  5.990   1.776   1.00 0.00 ? 91  VAL A HG22 4  
ATOM 6566  H HG23 . VAL A 1 40  ? -2.311  5.766   2.891   1.00 0.00 ? 91  VAL A HG23 4  
ATOM 6567  N N    . VAL A 1 41  ? -3.100  8.321   6.728   1.00 0.00 ? 92  VAL A N    4  
ATOM 6568  C CA   . VAL A 1 41  ? -3.461  9.454   7.625   1.00 0.00 ? 92  VAL A CA   4  
ATOM 6569  C C    . VAL A 1 41  ? -3.095  10.757  6.914   1.00 0.00 ? 92  VAL A C    4  
ATOM 6570  O O    . VAL A 1 41  ? -2.199  10.785  6.095   1.00 0.00 ? 92  VAL A O    4  
ATOM 6571  C CB   . VAL A 1 41  ? -2.662  9.349   8.932   1.00 0.00 ? 92  VAL A CB   4  
ATOM 6572  C CG1  . VAL A 1 41  ? -2.752  7.925   9.500   1.00 0.00 ? 92  VAL A CG1  4  
ATOM 6573  C CG2  . VAL A 1 41  ? -1.192  9.706   8.675   1.00 0.00 ? 92  VAL A CG2  4  
ATOM 6574  H H    . VAL A 1 41  ? -2.162  8.065   6.645   1.00 0.00 ? 92  VAL A H    4  
ATOM 6575  H HA   . VAL A 1 41  ? -4.522  9.439   7.844   1.00 0.00 ? 92  VAL A HA   4  
ATOM 6576  H HB   . VAL A 1 41  ? -3.070  10.034  9.640   1.00 0.00 ? 92  VAL A HB   4  
ATOM 6577  H HG11 . VAL A 1 41  ? -2.523  7.207   8.728   1.00 0.00 ? 92  VAL A HG11 4  
ATOM 6578  H HG12 . VAL A 1 41  ? -2.044  7.815   10.308  1.00 0.00 ? 92  VAL A HG12 4  
ATOM 6579  H HG13 . VAL A 1 41  ? -3.750  7.747   9.873   1.00 0.00 ? 92  VAL A HG13 4  
ATOM 6580  H HG21 . VAL A 1 41  ? -0.866  9.220   7.770   1.00 0.00 ? 92  VAL A HG21 4  
ATOM 6581  H HG22 . VAL A 1 41  ? -1.093  10.783  8.566   1.00 0.00 ? 92  VAL A HG22 4  
ATOM 6582  H HG23 . VAL A 1 41  ? -0.588  9.372   9.505   1.00 0.00 ? 92  VAL A HG23 4  
ATOM 6583  N N    . ALA A 1 42  ? -3.768  11.833  7.217   1.00 0.00 ? 93  ALA A N    4  
ATOM 6584  C CA   . ALA A 1 42  ? -3.447  13.135  6.549   1.00 0.00 ? 93  ALA A CA   4  
ATOM 6585  C C    . ALA A 1 42  ? -3.426  14.251  7.590   1.00 0.00 ? 93  ALA A C    4  
ATOM 6586  O O    . ALA A 1 42  ? -4.363  14.436  8.336   1.00 0.00 ? 93  ALA A O    4  
ATOM 6587  C CB   . ALA A 1 42  ? -4.519  13.430  5.504   1.00 0.00 ? 93  ALA A CB   4  
ATOM 6588  H H    . ALA A 1 42  ? -4.485  11.789  7.884   1.00 0.00 ? 93  ALA A H    4  
ATOM 6589  H HA   . ALA A 1 42  ? -2.481  13.084  6.067   1.00 0.00 ? 93  ALA A HA   4  
ATOM 6590  H HB1  . ALA A 1 42  ? -4.611  12.582  4.840   1.00 0.00 ? 93  ALA A HB1  4  
ATOM 6591  H HB2  . ALA A 1 42  ? -5.463  13.605  5.998   1.00 0.00 ? 93  ALA A HB2  4  
ATOM 6592  H HB3  . ALA A 1 42  ? -4.239  14.303  4.936   1.00 0.00 ? 93  ALA A HB3  4  
ATOM 6593  N N    . LEU A 1 43  ? -2.352  14.997  7.651   1.00 0.00 ? 94  LEU A N    4  
ATOM 6594  C CA   . LEU A 1 43  ? -2.270  16.097  8.652   1.00 0.00 ? 94  LEU A CA   4  
ATOM 6595  C C    . LEU A 1 43  ? -2.788  17.393  8.022   1.00 0.00 ? 94  LEU A C    4  
ATOM 6596  O O    . LEU A 1 43  ? -2.736  18.450  8.618   1.00 0.00 ? 94  LEU A O    4  
ATOM 6597  C CB   . LEU A 1 43  ? -0.811  16.281  9.075   1.00 0.00 ? 94  LEU A CB   4  
ATOM 6598  C CG   . LEU A 1 43  ? -0.215  14.928  9.476   1.00 0.00 ? 94  LEU A CG   4  
ATOM 6599  C CD1  . LEU A 1 43  ? 1.252   15.124  9.870   1.00 0.00 ? 94  LEU A CD1  4  
ATOM 6600  C CD2  . LEU A 1 43  ? -0.989  14.346  10.666  1.00 0.00 ? 94  LEU A CD2  4  
ATOM 6601  H H    . LEU A 1 43  ? -1.602  14.829  7.042   1.00 0.00 ? 94  LEU A H    4  
ATOM 6602  H HA   . LEU A 1 43  ? -2.869  15.857  9.518   1.00 0.00 ? 94  LEU A HA   4  
ATOM 6603  H HB2  . LEU A 1 43  ? -0.244  16.699  8.257   1.00 0.00 ? 94  LEU A HB2  4  
ATOM 6604  H HB3  . LEU A 1 43  ? -0.768  16.953  9.920   1.00 0.00 ? 94  LEU A HB3  4  
ATOM 6605  H HG   . LEU A 1 43  ? -0.274  14.243  8.635   1.00 0.00 ? 94  LEU A HG   4  
ATOM 6606  H HD11 . LEU A 1 43  ? 1.345   16.004  10.490  1.00 0.00 ? 94  LEU A HD11 4  
ATOM 6607  H HD12 . LEU A 1 43  ? 1.599   14.261  10.415  1.00 0.00 ? 94  LEU A HD12 4  
ATOM 6608  H HD13 . LEU A 1 43  ? 1.847   15.252  8.975   1.00 0.00 ? 94  LEU A HD13 4  
ATOM 6609  H HD21 . LEU A 1 43  ? -1.210  15.130  11.376  1.00 0.00 ? 94  LEU A HD21 4  
ATOM 6610  H HD22 . LEU A 1 43  ? -1.912  13.909  10.314  1.00 0.00 ? 94  LEU A HD22 4  
ATOM 6611  H HD23 . LEU A 1 43  ? -0.393  13.583  11.148  1.00 0.00 ? 94  LEU A HD23 4  
ATOM 6612  N N    . GLY A 1 44  ? -3.284  17.310  6.814   1.00 0.00 ? 95  GLY A N    4  
ATOM 6613  C CA   . GLY A 1 44  ? -3.805  18.526  6.117   1.00 0.00 ? 95  GLY A CA   4  
ATOM 6614  C C    . GLY A 1 44  ? -5.294  18.712  6.413   1.00 0.00 ? 95  GLY A C    4  
ATOM 6615  O O    . GLY A 1 44  ? -5.837  18.117  7.322   1.00 0.00 ? 95  GLY A O    4  
ATOM 6616  H H    . GLY A 1 44  ? -3.305  16.445  6.358   1.00 0.00 ? 95  GLY A H    4  
ATOM 6617  H HA2  . GLY A 1 44  ? -3.261  19.397  6.448   1.00 0.00 ? 95  GLY A HA2  4  
ATOM 6618  H HA3  . GLY A 1 44  ? -3.676  18.404  5.053   1.00 0.00 ? 95  GLY A HA3  4  
ATOM 6619  N N    . ASP A 1 45  ? -5.965  19.531  5.640   1.00 0.00 ? 96  ASP A N    4  
ATOM 6620  C CA   . ASP A 1 45  ? -7.423  19.750  5.868   1.00 0.00 ? 96  ASP A CA   4  
ATOM 6621  C C    . ASP A 1 45  ? -8.201  18.718  5.040   1.00 0.00 ? 96  ASP A C    4  
ATOM 6622  O O    . ASP A 1 45  ? -8.267  18.822  3.834   1.00 0.00 ? 96  ASP A O    4  
ATOM 6623  C CB   . ASP A 1 45  ? -7.803  21.159  5.380   1.00 0.00 ? 96  ASP A CB   4  
ATOM 6624  C CG   . ASP A 1 45  ? -7.071  22.222  6.210   1.00 0.00 ? 96  ASP A CG   4  
ATOM 6625  O OD1  . ASP A 1 45  ? -6.311  21.844  7.085   1.00 0.00 ? 96  ASP A OD1  4  
ATOM 6626  O OD2  . ASP A 1 45  ? -7.294  23.399  5.965   1.00 0.00 ? 96  ASP A OD2  4  
ATOM 6627  H H    . ASP A 1 45  ? -5.510  19.997  4.907   1.00 0.00 ? 96  ASP A H    4  
ATOM 6628  H HA   . ASP A 1 45  ? -7.660  19.649  6.919   1.00 0.00 ? 96  ASP A HA   4  
ATOM 6629  H HB2  . ASP A 1 45  ? -7.526  21.263  4.340   1.00 0.00 ? 96  ASP A HB2  4  
ATOM 6630  H HB3  . ASP A 1 45  ? -8.869  21.300  5.480   1.00 0.00 ? 96  ASP A HB3  4  
ATOM 6631  N N    . VAL A 1 46  ? -8.798  17.725  5.658   1.00 0.00 ? 97  VAL A N    4  
ATOM 6632  C CA   . VAL A 1 46  ? -9.558  16.719  4.858   1.00 0.00 ? 97  VAL A CA   4  
ATOM 6633  C C    . VAL A 1 46  ? -10.405 15.807  5.769   1.00 0.00 ? 97  VAL A C    4  
ATOM 6634  O O    . VAL A 1 46  ? -10.394 14.604  5.617   1.00 0.00 ? 97  VAL A O    4  
ATOM 6635  C CB   . VAL A 1 46  ? -8.575  15.865  4.026   1.00 0.00 ? 97  VAL A CB   4  
ATOM 6636  C CG1  . VAL A 1 46  ? -7.674  15.025  4.958   1.00 0.00 ? 97  VAL A CG1  4  
ATOM 6637  C CG2  . VAL A 1 46  ? -9.357  14.934  3.063   1.00 0.00 ? 97  VAL A CG2  4  
ATOM 6638  H H    . VAL A 1 46  ? -8.746  17.645  6.635   1.00 0.00 ? 97  VAL A H    4  
ATOM 6639  H HA   . VAL A 1 46  ? -10.208 17.248  4.182   1.00 0.00 ? 97  VAL A HA   4  
ATOM 6640  H HB   . VAL A 1 46  ? -7.949  16.529  3.444   1.00 0.00 ? 97  VAL A HB   4  
ATOM 6641  H HG11 . VAL A 1 46  ? -7.485  15.569  5.874   1.00 0.00 ? 97  VAL A HG11 4  
ATOM 6642  H HG12 . VAL A 1 46  ? -8.156  14.089  5.191   1.00 0.00 ? 97  VAL A HG12 4  
ATOM 6643  H HG13 . VAL A 1 46  ? -6.733  14.826  4.462   1.00 0.00 ? 97  VAL A HG13 4  
ATOM 6644  H HG21 . VAL A 1 46  ? -10.267 15.421  2.735   1.00 0.00 ? 97  VAL A HG21 4  
ATOM 6645  H HG22 . VAL A 1 46  ? -8.746  14.710  2.204   1.00 0.00 ? 97  VAL A HG22 4  
ATOM 6646  H HG23 . VAL A 1 46  ? -9.608  14.011  3.558   1.00 0.00 ? 97  VAL A HG23 4  
ATOM 6647  N N    . PRO A 1 47  ? -11.151 16.360  6.702   1.00 0.00 ? 98  PRO A N    4  
ATOM 6648  C CA   . PRO A 1 47  ? -12.020 15.548  7.617   1.00 0.00 ? 98  PRO A CA   4  
ATOM 6649  C C    . PRO A 1 47  ? -13.333 15.130  6.938   1.00 0.00 ? 98  PRO A C    4  
ATOM 6650  O O    . PRO A 1 47  ? -14.094 14.341  7.465   1.00 0.00 ? 98  PRO A O    4  
ATOM 6651  C CB   . PRO A 1 47  ? -12.298 16.518  8.763   1.00 0.00 ? 98  PRO A CB   4  
ATOM 6652  C CG   . PRO A 1 47  ? -12.353 17.851  8.094   1.00 0.00 ? 98  PRO A CG   4  
ATOM 6653  C CD   . PRO A 1 47  ? -11.264 17.806  7.012   1.00 0.00 ? 98  PRO A CD   4  
ATOM 6654  H HA   . PRO A 1 47  ? -11.489 14.683  7.985   1.00 0.00 ? 98  PRO A HA   4  
ATOM 6655  H HB2  . PRO A 1 47  ? -13.239 16.285  9.247   1.00 0.00 ? 98  PRO A HB2  4  
ATOM 6656  H HB3  . PRO A 1 47  ? -11.490 16.498  9.478   1.00 0.00 ? 98  PRO A HB3  4  
ATOM 6657  H HG2  . PRO A 1 47  ? -13.329 18.003  7.645   1.00 0.00 ? 98  PRO A HG2  4  
ATOM 6658  H HG3  . PRO A 1 47  ? -12.141 18.639  8.800   1.00 0.00 ? 98  PRO A HG3  4  
ATOM 6659  H HD2  . PRO A 1 47  ? -11.568 18.369  6.138   1.00 0.00 ? 98  PRO A HD2  4  
ATOM 6660  H HD3  . PRO A 1 47  ? -10.331 18.178  7.405   1.00 0.00 ? 98  PRO A HD3  4  
ATOM 6661  N N    . ASP A 1 48  ? -13.603 15.655  5.773   1.00 0.00 ? 99  ASP A N    4  
ATOM 6662  C CA   . ASP A 1 48  ? -14.864 15.291  5.071   1.00 0.00 ? 99  ASP A CA   4  
ATOM 6663  C C    . ASP A 1 48  ? -14.705 13.913  4.440   1.00 0.00 ? 99  ASP A C    4  
ATOM 6664  O O    . ASP A 1 48  ? -13.670 13.290  4.551   1.00 0.00 ? 99  ASP A O    4  
ATOM 6665  C CB   . ASP A 1 48  ? -15.174 16.328  3.989   1.00 0.00 ? 99  ASP A CB   4  
ATOM 6666  C CG   . ASP A 1 48  ? -14.065 16.334  2.934   1.00 0.00 ? 99  ASP A CG   4  
ATOM 6667  O OD1  . ASP A 1 48  ? -12.920 16.137  3.305   1.00 0.00 ? 99  ASP A OD1  4  
ATOM 6668  O OD2  . ASP A 1 48  ? -14.376 16.545  1.774   1.00 0.00 ? 99  ASP A OD2  4  
ATOM 6669  H H    . ASP A 1 48  ? -12.979 16.288  5.362   1.00 0.00 ? 99  ASP A H    4  
ATOM 6670  H HA   . ASP A 1 48  ? -15.676 15.264  5.782   1.00 0.00 ? 99  ASP A HA   4  
ATOM 6671  H HB2  . ASP A 1 48  ? -16.118 16.083  3.521   1.00 0.00 ? 99  ASP A HB2  4  
ATOM 6672  H HB3  . ASP A 1 48  ? -15.241 17.302  4.445   1.00 0.00 ? 99  ASP A HB3  4  
ATOM 6673  N N    . GLY A 1 49  ? -15.720 13.424  3.779   1.00 0.00 ? 100 GLY A N    4  
ATOM 6674  C CA   . GLY A 1 49  ? -15.612 12.080  3.148   1.00 0.00 ? 100 GLY A CA   4  
ATOM 6675  C C    . GLY A 1 49  ? -15.117 12.248  1.718   1.00 0.00 ? 100 GLY A C    4  
ATOM 6676  O O    . GLY A 1 49  ? -15.817 12.763  0.868   1.00 0.00 ? 100 GLY A O    4  
ATOM 6677  H H    . GLY A 1 49  ? -16.549 13.941  3.699   1.00 0.00 ? 100 GLY A H    4  
ATOM 6678  H HA2  . GLY A 1 49  ? -14.920 11.471  3.703   1.00 0.00 ? 100 GLY A HA2  4  
ATOM 6679  H HA3  . GLY A 1 49  ? -16.581 11.603  3.136   1.00 0.00 ? 100 GLY A HA3  4  
ATOM 6680  N N    . THR A 1 50  ? -13.915 11.813  1.444   1.00 0.00 ? 101 THR A N    4  
ATOM 6681  C CA   . THR A 1 50  ? -13.353 11.939  0.061   1.00 0.00 ? 101 THR A CA   4  
ATOM 6682  C C    . THR A 1 50  ? -13.026 10.553  -0.451  1.00 0.00 ? 101 THR A C    4  
ATOM 6683  O O    . THR A 1 50  ? -13.488 9.565   0.082   1.00 0.00 ? 101 THR A O    4  
ATOM 6684  C CB   . THR A 1 50  ? -12.079 12.790  0.087   1.00 0.00 ? 101 THR A CB   4  
ATOM 6685  O OG1  . THR A 1 50  ? -11.432 12.724  -1.177  1.00 0.00 ? 101 THR A OG1  4  
ATOM 6686  C CG2  . THR A 1 50  ? -11.136 12.270  1.160   1.00 0.00 ? 101 THR A CG2  4  
ATOM 6687  H H    . THR A 1 50  ? -13.372 11.393  2.155   1.00 0.00 ? 101 THR A H    4  
ATOM 6688  H HA   . THR A 1 50  ? -14.076 12.397  -0.600  1.00 0.00 ? 101 THR A HA   4  
ATOM 6689  H HB   . THR A 1 50  ? -12.337 13.812  0.307   1.00 0.00 ? 101 THR A HB   4  
ATOM 6690  H HG1  . THR A 1 50  ? -10.622 12.215  -1.072  1.00 0.00 ? 101 THR A HG1  4  
ATOM 6691  H HG21 . THR A 1 50  ? -11.038 11.198  1.066   1.00 0.00 ? 101 THR A HG21 4  
ATOM 6692  H HG22 . THR A 1 50  ? -10.165 12.729  1.040   1.00 0.00 ? 101 THR A HG22 4  
ATOM 6693  H HG23 . THR A 1 50  ? -11.534 12.514  2.133   1.00 0.00 ? 101 THR A HG23 4  
ATOM 6694  N N    . LEU A 1 51  ? -12.240 10.471  -1.488  1.00 0.00 ? 102 LEU A N    4  
ATOM 6695  C CA   . LEU A 1 51  ? -11.878 9.141   -2.065  1.00 0.00 ? 102 LEU A CA   4  
ATOM 6696  C C    . LEU A 1 51  ? -10.356 9.039   -2.241  1.00 0.00 ? 102 LEU A C    4  
ATOM 6697  O O    . LEU A 1 51  ? -9.717  9.969   -2.693  1.00 0.00 ? 102 LEU A O    4  
ATOM 6698  C CB   . LEU A 1 51  ? -12.547 9.015   -3.441  1.00 0.00 ? 102 LEU A CB   4  
ATOM 6699  C CG   . LEU A 1 51  ? -12.406 7.580   -3.984  1.00 0.00 ? 102 LEU A CG   4  
ATOM 6700  C CD1  . LEU A 1 51  ? -13.496 6.669   -3.398  1.00 0.00 ? 102 LEU A CD1  4  
ATOM 6701  C CD2  . LEU A 1 51  ? -12.527 7.592   -5.510  1.00 0.00 ? 102 LEU A CD2  4  
ATOM 6702  H H    . LEU A 1 51  ? -11.895 11.293  -1.899  1.00 0.00 ? 102 LEU A H    4  
ATOM 6703  H HA   . LEU A 1 51  ? -12.213 8.353   -1.421  1.00 0.00 ? 102 LEU A HA   4  
ATOM 6704  H HB2  . LEU A 1 51  ? -13.595 9.265   -3.357  1.00 0.00 ? 102 LEU A HB2  4  
ATOM 6705  H HB3  . LEU A 1 51  ? -12.073 9.706   -4.126  1.00 0.00 ? 102 LEU A HB3  4  
ATOM 6706  H HG   . LEU A 1 51  ? -11.435 7.192   -3.710  1.00 0.00 ? 102 LEU A HG   4  
ATOM 6707  H HD11 . LEU A 1 51  ? -13.623 6.867   -2.347  1.00 0.00 ? 102 LEU A HD11 4  
ATOM 6708  H HD12 . LEU A 1 51  ? -14.432 6.847   -3.908  1.00 0.00 ? 102 LEU A HD12 4  
ATOM 6709  H HD13 . LEU A 1 51  ? -13.209 5.637   -3.536  1.00 0.00 ? 102 LEU A HD13 4  
ATOM 6710  H HD21 . LEU A 1 51  ? -13.455 8.062   -5.797  1.00 0.00 ? 102 LEU A HD21 4  
ATOM 6711  H HD22 . LEU A 1 51  ? -11.700 8.140   -5.935  1.00 0.00 ? 102 LEU A HD22 4  
ATOM 6712  H HD23 . LEU A 1 51  ? -12.511 6.576   -5.875  1.00 0.00 ? 102 LEU A HD23 4  
ATOM 6713  N N    . VAL A 1 52  ? -9.773  7.898   -1.909  1.00 0.00 ? 103 VAL A N    4  
ATOM 6714  C CA   . VAL A 1 52  ? -8.290  7.713   -2.086  1.00 0.00 ? 103 VAL A CA   4  
ATOM 6715  C C    . VAL A 1 52  ? -8.070  6.594   -3.093  1.00 0.00 ? 103 VAL A C    4  
ATOM 6716  O O    . VAL A 1 52  ? -8.620  5.519   -2.960  1.00 0.00 ? 103 VAL A O    4  
ATOM 6717  C CB   . VAL A 1 52  ? -7.647  7.295   -0.755  1.00 0.00 ? 103 VAL A CB   4  
ATOM 6718  C CG1  . VAL A 1 52  ? -6.119  7.260   -0.892  1.00 0.00 ? 103 VAL A CG1  4  
ATOM 6719  C CG2  . VAL A 1 52  ? -8.043  8.289   0.331   1.00 0.00 ? 103 VAL A CG2  4  
ATOM 6720  H H    . VAL A 1 52  ? -10.318 7.156   -1.563  1.00 0.00 ? 103 VAL A H    4  
ATOM 6721  H HA   . VAL A 1 52  ? -7.832  8.621   -2.446  1.00 0.00 ? 103 VAL A HA   4  
ATOM 6722  H HB   . VAL A 1 52  ? -7.997  6.310   -0.485  1.00 0.00 ? 103 VAL A HB   4  
ATOM 6723  H HG11 . VAL A 1 52  ? -5.847  6.674   -1.758  1.00 0.00 ? 103 VAL A HG11 4  
ATOM 6724  H HG12 . VAL A 1 52  ? -5.737  8.264   -0.999  1.00 0.00 ? 103 VAL A HG12 4  
ATOM 6725  H HG13 . VAL A 1 52  ? -5.692  6.806   -0.007  1.00 0.00 ? 103 VAL A HG13 4  
ATOM 6726  H HG21 . VAL A 1 52  ? -9.119  8.361   0.368   1.00 0.00 ? 103 VAL A HG21 4  
ATOM 6727  H HG22 . VAL A 1 52  ? -7.671  7.947   1.286   1.00 0.00 ? 103 VAL A HG22 4  
ATOM 6728  H HG23 . VAL A 1 52  ? -7.623  9.256   0.105   1.00 0.00 ? 103 VAL A HG23 4  
ATOM 6729  N N    . THR A 1 53  ? -7.253  6.828   -4.088  1.00 0.00 ? 104 THR A N    4  
ATOM 6730  C CA   . THR A 1 53  ? -6.981  5.768   -5.109  1.00 0.00 ? 104 THR A CA   4  
ATOM 6731  C C    . THR A 1 53  ? -5.481  5.475   -5.119  1.00 0.00 ? 104 THR A C    4  
ATOM 6732  O O    . THR A 1 53  ? -4.669  6.361   -4.931  1.00 0.00 ? 104 THR A O    4  
ATOM 6733  C CB   . THR A 1 53  ? -7.424  6.276   -6.491  1.00 0.00 ? 104 THR A CB   4  
ATOM 6734  O OG1  . THR A 1 53  ? -6.610  7.371   -6.879  1.00 0.00 ? 104 THR A OG1  4  
ATOM 6735  C CG2  . THR A 1 53  ? -8.885  6.730   -6.434  1.00 0.00 ? 104 THR A CG2  4  
ATOM 6736  H H    . THR A 1 53  ? -6.807  7.703   -4.162  1.00 0.00 ? 104 THR A H    4  
ATOM 6737  H HA   . THR A 1 53  ? -7.526  4.863   -4.868  1.00 0.00 ? 104 THR A HA   4  
ATOM 6738  H HB   . THR A 1 53  ? -7.330  5.486   -7.216  1.00 0.00 ? 104 THR A HB   4  
ATOM 6739  H HG1  . THR A 1 53  ? -5.855  7.405   -6.288  1.00 0.00 ? 104 THR A HG1  4  
ATOM 6740  H HG21 . THR A 1 53  ? -9.461  6.031   -5.844  1.00 0.00 ? 104 THR A HG21 4  
ATOM 6741  H HG22 . THR A 1 53  ? -8.940  7.712   -5.985  1.00 0.00 ? 104 THR A HG22 4  
ATOM 6742  H HG23 . THR A 1 53  ? -9.288  6.771   -7.436  1.00 0.00 ? 104 THR A HG23 4  
ATOM 6743  N N    . VAL A 1 54  ? -5.096  4.236   -5.321  1.00 0.00 ? 105 VAL A N    4  
ATOM 6744  C CA   . VAL A 1 54  ? -3.648  3.891   -5.326  1.00 0.00 ? 105 VAL A CA   4  
ATOM 6745  C C    . VAL A 1 54  ? -3.352  2.878   -6.453  1.00 0.00 ? 105 VAL A C    4  
ATOM 6746  O O    . VAL A 1 54  ? -4.211  2.136   -6.884  1.00 0.00 ? 105 VAL A O    4  
ATOM 6747  C CB   . VAL A 1 54  ? -3.276  3.297   -3.958  1.00 0.00 ? 105 VAL A CB   4  
ATOM 6748  C CG1  . VAL A 1 54  ? -4.023  4.044   -2.847  1.00 0.00 ? 105 VAL A CG1  4  
ATOM 6749  C CG2  . VAL A 1 54  ? -3.625  1.803   -3.893  1.00 0.00 ? 105 VAL A CG2  4  
ATOM 6750  H H    . VAL A 1 54  ? -5.757  3.535   -5.447  1.00 0.00 ? 105 VAL A H    4  
ATOM 6751  H HA   . VAL A 1 54  ? -3.059  4.783   -5.499  1.00 0.00 ? 105 VAL A HA   4  
ATOM 6752  H HB   . VAL A 1 54  ? -2.225  3.417   -3.810  1.00 0.00 ? 105 VAL A HB   4  
ATOM 6753  H HG11 . VAL A 1 54  ? -3.975  5.106   -3.026  1.00 0.00 ? 105 VAL A HG11 4  
ATOM 6754  H HG12 . VAL A 1 54  ? -5.056  3.728   -2.835  1.00 0.00 ? 105 VAL A HG12 4  
ATOM 6755  H HG13 . VAL A 1 54  ? -3.568  3.820   -1.893  1.00 0.00 ? 105 VAL A HG13 4  
ATOM 6756  H HG21 . VAL A 1 54  ? -4.584  1.632   -4.357  1.00 0.00 ? 105 VAL A HG21 4  
ATOM 6757  H HG22 . VAL A 1 54  ? -2.865  1.242   -4.419  1.00 0.00 ? 105 VAL A HG22 4  
ATOM 6758  H HG23 . VAL A 1 54  ? -3.656  1.481   -2.862  1.00 0.00 ? 105 VAL A HG23 4  
ATOM 6759  N N    . MET A 1 55  ? -2.132  2.843   -6.911  1.00 0.00 ? 106 MET A N    4  
ATOM 6760  C CA   . MET A 1 55  ? -1.732  1.882   -7.991  1.00 0.00 ? 106 MET A CA   4  
ATOM 6761  C C    . MET A 1 55  ? -0.331  1.375   -7.657  1.00 0.00 ? 106 MET A C    4  
ATOM 6762  O O    . MET A 1 55  ? 0.318   1.912   -6.782  1.00 0.00 ? 106 MET A O    4  
ATOM 6763  C CB   . MET A 1 55  ? -1.748  2.590   -9.360  1.00 0.00 ? 106 MET A CB   4  
ATOM 6764  C CG   . MET A 1 55  ? -0.854  3.832   -9.305  1.00 0.00 ? 106 MET A CG   4  
ATOM 6765  S SD   . MET A 1 55  ? 0.885   3.345   -9.449  1.00 0.00 ? 106 MET A SD   4  
ATOM 6766  C CE   . MET A 1 55  ? 0.978   3.331   -11.254 1.00 0.00 ? 106 MET A CE   4  
ATOM 6767  H H    . MET A 1 55  ? -1.459  3.447   -6.533  1.00 0.00 ? 106 MET A H    4  
ATOM 6768  H HA   . MET A 1 55  ? -2.413  1.048   -8.009  1.00 0.00 ? 106 MET A HA   4  
ATOM 6769  H HB2  . MET A 1 55  ? -1.383  1.912   -10.122 1.00 0.00 ? 106 MET A HB2  4  
ATOM 6770  H HB3  . MET A 1 55  ? -2.759  2.887   -9.601  1.00 0.00 ? 106 MET A HB3  4  
ATOM 6771  H HG2  . MET A 1 55  ? -1.110  4.496   -10.117 1.00 0.00 ? 106 MET A HG2  4  
ATOM 6772  H HG3  . MET A 1 55  ? -1.005  4.342   -8.367  1.00 0.00 ? 106 MET A HG3  4  
ATOM 6773  H HE1  . MET A 1 55  ? 0.657   4.285   -11.637 1.00 0.00 ? 106 MET A HE1  4  
ATOM 6774  H HE2  . MET A 1 55  ? 1.999   3.147   -11.559 1.00 0.00 ? 106 MET A HE2  4  
ATOM 6775  H HE3  . MET A 1 55  ? 0.334   2.553   -11.641 1.00 0.00 ? 106 MET A HE3  4  
ATOM 6776  N N    . ALA A 1 56  ? 0.144   0.339   -8.314  1.00 0.00 ? 107 ALA A N    4  
ATOM 6777  C CA   . ALA A 1 56  ? 1.509   -0.187  -7.982  1.00 0.00 ? 107 ALA A CA   4  
ATOM 6778  C C    . ALA A 1 56  ? 2.138   -0.865  -9.192  1.00 0.00 ? 107 ALA A C    4  
ATOM 6779  O O    . ALA A 1 56  ? 2.794   -1.881  -9.076  1.00 0.00 ? 107 ALA A O    4  
ATOM 6780  C CB   . ALA A 1 56  ? 1.389   -1.192  -6.835  1.00 0.00 ? 107 ALA A CB   4  
ATOM 6781  H H    . ALA A 1 56  ? -0.397  -0.096  -9.005  1.00 0.00 ? 107 ALA A H    4  
ATOM 6782  H HA   . ALA A 1 56  ? 2.137   0.623   -7.682  1.00 0.00 ? 107 ALA A HA   4  
ATOM 6783  H HB1  . ALA A 1 56  ? 0.595   -0.883  -6.173  1.00 0.00 ? 107 ALA A HB1  4  
ATOM 6784  H HB2  . ALA A 1 56  ? 1.164   -2.174  -7.229  1.00 0.00 ? 107 ALA A HB2  4  
ATOM 6785  H HB3  . ALA A 1 56  ? 2.319   -1.228  -6.286  1.00 0.00 ? 107 ALA A HB3  4  
ATOM 6786  N N    . GLY A 1 57  ? 1.953   -0.317  -10.347 1.00 0.00 ? 108 GLY A N    4  
ATOM 6787  C CA   . GLY A 1 57  ? 2.545   -0.920  -11.572 1.00 0.00 ? 108 GLY A CA   4  
ATOM 6788  C C    . GLY A 1 57  ? 3.963   -0.407  -11.763 1.00 0.00 ? 108 GLY A C    4  
ATOM 6789  O O    . GLY A 1 57  ? 4.339   0.615   -11.225 1.00 0.00 ? 108 GLY A O    4  
ATOM 6790  H H    . GLY A 1 57  ? 1.440   0.505   -10.408 1.00 0.00 ? 108 GLY A H    4  
ATOM 6791  H HA2  . GLY A 1 57  ? 2.568   -1.996  -11.473 1.00 0.00 ? 108 GLY A HA2  4  
ATOM 6792  H HA3  . GLY A 1 57  ? 1.955   -0.657  -12.426 1.00 0.00 ? 108 GLY A HA3  4  
ATOM 6793  N N    . ASN A 1 58  ? 4.745   -1.092  -12.549 1.00 0.00 ? 109 ASN A N    4  
ATOM 6794  C CA   . ASN A 1 58  ? 6.132   -0.626  -12.804 1.00 0.00 ? 109 ASN A CA   4  
ATOM 6795  C C    . ASN A 1 58  ? 6.081   0.569   -13.740 1.00 0.00 ? 109 ASN A C    4  
ATOM 6796  O O    . ASN A 1 58  ? 5.113   0.774   -14.444 1.00 0.00 ? 109 ASN A O    4  
ATOM 6797  C CB   . ASN A 1 58  ? 6.956   -1.727  -13.458 1.00 0.00 ? 109 ASN A CB   4  
ATOM 6798  C CG   . ASN A 1 58  ? 6.883   -2.989  -12.604 1.00 0.00 ? 109 ASN A CG   4  
ATOM 6799  O OD1  . ASN A 1 58  ? 7.717   -3.207  -11.748 1.00 0.00 ? 109 ASN A OD1  4  
ATOM 6800  N ND2  . ASN A 1 58  ? 5.901   -3.829  -12.786 1.00 0.00 ? 109 ASN A ND2  4  
ATOM 6801  H H    . ASN A 1 58  ? 4.412   -1.901  -12.988 1.00 0.00 ? 109 ASN A H    4  
ATOM 6802  H HA   . ASN A 1 58  ? 6.587   -0.334  -11.872 1.00 0.00 ? 109 ASN A HA   4  
ATOM 6803  H HB2  . ASN A 1 58  ? 6.571   -1.925  -14.444 1.00 0.00 ? 109 ASN A HB2  4  
ATOM 6804  H HB3  . ASN A 1 58  ? 7.981   -1.403  -13.535 1.00 0.00 ? 109 ASN A HB3  4  
ATOM 6805  H HD21 . ASN A 1 58  ? 5.221   -3.647  -13.467 1.00 0.00 ? 109 ASN A HD21 4  
ATOM 6806  H HD22 . ASN A 1 58  ? 5.839   -4.640  -12.243 1.00 0.00 ? 109 ASN A HD22 4  
ATOM 6807  N N    . ASP A 1 59  ? 7.110   1.358   -13.747 1.00 0.00 ? 110 ASP A N    4  
ATOM 6808  C CA   . ASP A 1 59  ? 7.132   2.557   -14.623 1.00 0.00 ? 110 ASP A CA   4  
ATOM 6809  C C    . ASP A 1 59  ? 6.958   2.177   -16.100 1.00 0.00 ? 110 ASP A C    4  
ATOM 6810  O O    . ASP A 1 59  ? 6.261   2.845   -16.838 1.00 0.00 ? 110 ASP A O    4  
ATOM 6811  C CB   . ASP A 1 59  ? 8.485   3.234   -14.437 1.00 0.00 ? 110 ASP A CB   4  
ATOM 6812  C CG   . ASP A 1 59  ? 8.558   4.478   -15.317 1.00 0.00 ? 110 ASP A CG   4  
ATOM 6813  O OD1  . ASP A 1 59  ? 7.745   5.364   -15.118 1.00 0.00 ? 110 ASP A OD1  4  
ATOM 6814  O OD2  . ASP A 1 59  ? 9.422   4.521   -16.178 1.00 0.00 ? 110 ASP A OD2  4  
ATOM 6815  H H    . ASP A 1 59  ? 7.875   1.168   -13.163 1.00 0.00 ? 110 ASP A H    4  
ATOM 6816  H HA   . ASP A 1 59  ? 6.349   3.236   -14.330 1.00 0.00 ? 110 ASP A HA   4  
ATOM 6817  H HB2  . ASP A 1 59  ? 8.603   3.517   -13.401 1.00 0.00 ? 110 ASP A HB2  4  
ATOM 6818  H HB3  . ASP A 1 59  ? 9.275   2.547   -14.714 1.00 0.00 ? 110 ASP A HB3  4  
ATOM 6819  N N    . GLU A 1 60  ? 7.584   1.118   -16.535 1.00 0.00 ? 111 GLU A N    4  
ATOM 6820  C CA   . GLU A 1 60  ? 7.475   0.700   -17.969 1.00 0.00 ? 111 GLU A CA   4  
ATOM 6821  C C    . GLU A 1 60  ? 6.301   -0.265  -18.180 1.00 0.00 ? 111 GLU A C    4  
ATOM 6822  O O    . GLU A 1 60  ? 6.093   -0.736  -19.281 1.00 0.00 ? 111 GLU A O    4  
ATOM 6823  C CB   . GLU A 1 60  ? 8.771   -0.007  -18.379 1.00 0.00 ? 111 GLU A CB   4  
ATOM 6824  C CG   . GLU A 1 60  ? 8.884   -1.332  -17.613 1.00 0.00 ? 111 GLU A CG   4  
ATOM 6825  C CD   . GLU A 1 60  ? 10.305  -1.885  -17.698 1.00 0.00 ? 111 GLU A CD   4  
ATOM 6826  O OE1  . GLU A 1 60  ? 11.063  -1.402  -18.519 1.00 0.00 ? 111 GLU A OE1  4  
ATOM 6827  O OE2  . GLU A 1 60  ? 10.606  -2.790  -16.938 1.00 0.00 ? 111 GLU A OE2  4  
ATOM 6828  H H    . GLU A 1 60  ? 8.149   0.605   -15.923 1.00 0.00 ? 111 GLU A H    4  
ATOM 6829  H HA   . GLU A 1 60  ? 7.333   1.572   -18.591 1.00 0.00 ? 111 GLU A HA   4  
ATOM 6830  H HB2  . GLU A 1 60  ? 8.749   -0.202  -19.443 1.00 0.00 ? 111 GLU A HB2  4  
ATOM 6831  H HB3  . GLU A 1 60  ? 9.615   0.620   -18.143 1.00 0.00 ? 111 GLU A HB3  4  
ATOM 6832  H HG2  . GLU A 1 60  ? 8.629   -1.172  -16.577 1.00 0.00 ? 111 GLU A HG2  4  
ATOM 6833  H HG3  . GLU A 1 60  ? 8.203   -2.049  -18.040 1.00 0.00 ? 111 GLU A HG3  4  
ATOM 6834  N N    . ASN A 1 61  ? 5.547   -0.586  -17.152 1.00 0.00 ? 112 ASN A N    4  
ATOM 6835  C CA   . ASN A 1 61  ? 4.405   -1.545  -17.315 1.00 0.00 ? 112 ASN A CA   4  
ATOM 6836  C C    . ASN A 1 61  ? 3.099   -0.815  -17.045 1.00 0.00 ? 112 ASN A C    4  
ATOM 6837  O O    . ASN A 1 61  ? 3.083   0.347   -16.687 1.00 0.00 ? 112 ASN A O    4  
ATOM 6838  C CB   . ASN A 1 61  ? 4.552   -2.706  -16.321 1.00 0.00 ? 112 ASN A CB   4  
ATOM 6839  C CG   . ASN A 1 61  ? 5.887   -3.415  -16.571 1.00 0.00 ? 112 ASN A CG   4  
ATOM 6840  O OD1  . ASN A 1 61  ? 6.382   -3.416  -17.677 1.00 0.00 ? 112 ASN A OD1  4  
ATOM 6841  N ND2  . ASN A 1 61  ? 6.493   -4.029  -15.588 1.00 0.00 ? 112 ASN A ND2  4  
ATOM 6842  H H    . ASN A 1 61  ? 5.732   -0.202  -16.272 1.00 0.00 ? 112 ASN A H    4  
ATOM 6843  H HA   . ASN A 1 61  ? 4.386   -1.940  -18.323 1.00 0.00 ? 112 ASN A HA   4  
ATOM 6844  H HB2  . ASN A 1 61  ? 4.509   -2.332  -15.309 1.00 0.00 ? 112 ASN A HB2  4  
ATOM 6845  H HB3  . ASN A 1 61  ? 3.747   -3.409  -16.473 1.00 0.00 ? 112 ASN A HB3  4  
ATOM 6846  H HD21 . ASN A 1 61  ? 6.095   -4.040  -14.695 1.00 0.00 ? 112 ASN A HD21 4  
ATOM 6847  H HD22 . ASN A 1 61  ? 7.349   -4.479  -15.748 1.00 0.00 ? 112 ASN A HD22 4  
ATOM 6848  N N    . TYR A 1 62  ? 2.000   -1.483  -17.208 1.00 0.00 ? 113 TYR A N    4  
ATOM 6849  C CA   . TYR A 1 62  ? 0.699   -0.820  -16.954 1.00 0.00 ? 113 TYR A CA   4  
ATOM 6850  C C    . TYR A 1 62  ? 0.622   -0.449  -15.474 1.00 0.00 ? 113 TYR A C    4  
ATOM 6851  O O    . TYR A 1 62  ? 1.466   -0.837  -14.694 1.00 0.00 ? 113 TYR A O    4  
ATOM 6852  C CB   . TYR A 1 62  ? -0.444  -1.793  -17.272 1.00 0.00 ? 113 TYR A CB   4  
ATOM 6853  C CG   . TYR A 1 62  ? -0.108  -3.154  -16.713 1.00 0.00 ? 113 TYR A CG   4  
ATOM 6854  C CD1  . TYR A 1 62  ? -0.243  -3.388  -15.341 1.00 0.00 ? 113 TYR A CD1  4  
ATOM 6855  C CD2  . TYR A 1 62  ? 0.350   -4.175  -17.556 1.00 0.00 ? 113 TYR A CD2  4  
ATOM 6856  C CE1  . TYR A 1 62  ? 0.070   -4.648  -14.809 1.00 0.00 ? 113 TYR A CE1  4  
ATOM 6857  C CE2  . TYR A 1 62  ? 0.664   -5.435  -17.026 1.00 0.00 ? 113 TYR A CE2  4  
ATOM 6858  C CZ   . TYR A 1 62  ? 0.525   -5.673  -15.653 1.00 0.00 ? 113 TYR A CZ   4  
ATOM 6859  O OH   . TYR A 1 62  ? 0.828   -6.918  -15.135 1.00 0.00 ? 113 TYR A OH   4  
ATOM 6860  H H    . TYR A 1 62  ? 2.031   -2.421  -17.496 1.00 0.00 ? 113 TYR A H    4  
ATOM 6861  H HA   . TYR A 1 62  ? 0.623   0.063   -17.564 1.00 0.00 ? 113 TYR A HA   4  
ATOM 6862  H HB2  . TYR A 1 62  ? -1.360  -1.439  -16.813 1.00 0.00 ? 113 TYR A HB2  4  
ATOM 6863  H HB3  . TYR A 1 62  ? -0.581  -1.862  -18.340 1.00 0.00 ? 113 TYR A HB3  4  
ATOM 6864  H HD1  . TYR A 1 62  ? -0.602  -2.600  -14.694 1.00 0.00 ? 113 TYR A HD1  4  
ATOM 6865  H HD2  . TYR A 1 62  ? 0.455   -3.997  -18.615 1.00 0.00 ? 113 TYR A HD2  4  
ATOM 6866  H HE1  . TYR A 1 62  ? -0.031  -4.822  -13.745 1.00 0.00 ? 113 TYR A HE1  4  
ATOM 6867  H HE2  . TYR A 1 62  ? 1.017   -6.222  -17.677 1.00 0.00 ? 113 TYR A HE2  4  
ATOM 6868  H HH   . TYR A 1 62  ? 0.018   -7.308  -14.801 1.00 0.00 ? 113 TYR A HH   4  
ATOM 6869  N N    . SER A 1 63  ? -0.398  0.259   -15.072 1.00 0.00 ? 114 SER A N    4  
ATOM 6870  C CA   . SER A 1 63  ? -0.523  0.584   -13.629 1.00 0.00 ? 114 SER A CA   4  
ATOM 6871  C C    . SER A 1 63  ? -1.065  -0.676  -12.961 1.00 0.00 ? 114 SER A C    4  
ATOM 6872  O O    . SER A 1 63  ? -2.071  -1.207  -13.387 1.00 0.00 ? 114 SER A O    4  
ATOM 6873  C CB   . SER A 1 63  ? -1.520  1.731   -13.427 1.00 0.00 ? 114 SER A CB   4  
ATOM 6874  O OG   . SER A 1 63  ? -2.624  1.555   -14.306 1.00 0.00 ? 114 SER A OG   4  
ATOM 6875  H H    . SER A 1 63  ? -1.091  0.541   -15.705 1.00 0.00 ? 114 SER A H    4  
ATOM 6876  H HA   . SER A 1 63  ? 0.438   0.849   -13.220 1.00 0.00 ? 114 SER A HA   4  
ATOM 6877  H HB2  . SER A 1 63  ? -1.875  1.727   -12.407 1.00 0.00 ? 114 SER A HB2  4  
ATOM 6878  H HB3  . SER A 1 63  ? -1.028  2.675   -13.626 1.00 0.00 ? 114 SER A HB3  4  
ATOM 6879  H HG   . SER A 1 63  ? -3.328  1.117   -13.819 1.00 0.00 ? 114 SER A HG   4  
ATOM 6880  N N    . ALA A 1 64  ? -0.424  -1.181  -11.937 1.00 0.00 ? 115 ALA A N    4  
ATOM 6881  C CA   . ALA A 1 64  ? -0.948  -2.426  -11.294 1.00 0.00 ? 115 ALA A CA   4  
ATOM 6882  C C    . ALA A 1 64  ? -2.428  -2.227  -11.020 1.00 0.00 ? 115 ALA A C    4  
ATOM 6883  O O    . ALA A 1 64  ? -2.898  -1.108  -11.004 1.00 0.00 ? 115 ALA A O    4  
ATOM 6884  C CB   . ALA A 1 64  ? -0.207  -2.706  -9.990  1.00 0.00 ? 115 ALA A CB   4  
ATOM 6885  H H    . ALA A 1 64  ? 0.392   -0.753  -11.602 1.00 0.00 ? 115 ALA A H    4  
ATOM 6886  H HA   . ALA A 1 64  ? -0.818  -3.259  -11.974 1.00 0.00 ? 115 ALA A HA   4  
ATOM 6887  H HB1  . ALA A 1 64  ? -0.335  -1.873  -9.315  1.00 0.00 ? 115 ALA A HB1  4  
ATOM 6888  H HB2  . ALA A 1 64  ? -0.600  -3.604  -9.535  1.00 0.00 ? 115 ALA A HB2  4  
ATOM 6889  H HB3  . ALA A 1 64  ? 0.840   -2.843  -10.198 1.00 0.00 ? 115 ALA A HB3  4  
ATOM 6890  N N    . GLU A 1 65  ? -3.183  -3.283  -10.841 1.00 0.00 ? 116 GLU A N    4  
ATOM 6891  C CA   . GLU A 1 65  ? -4.664  -3.104  -10.607 1.00 0.00 ? 116 GLU A CA   4  
ATOM 6892  C C    . GLU A 1 65  ? -5.070  -3.621  -9.231  1.00 0.00 ? 116 GLU A C    4  
ATOM 6893  O O    . GLU A 1 65  ? -4.943  -4.781  -8.916  1.00 0.00 ? 116 GLU A O    4  
ATOM 6894  C CB   . GLU A 1 65  ? -5.413  -3.857  -11.701 1.00 0.00 ? 116 GLU A CB   4  
ATOM 6895  C CG   . GLU A 1 65  ? -5.236  -3.120  -13.025 1.00 0.00 ? 116 GLU A CG   4  
ATOM 6896  C CD   . GLU A 1 65  ? -5.952  -3.892  -14.126 1.00 0.00 ? 116 GLU A CD   4  
ATOM 6897  O OE1  . GLU A 1 65  ? -5.539  -5.007  -14.397 1.00 0.00 ? 116 GLU A OE1  4  
ATOM 6898  O OE2  . GLU A 1 65  ? -6.900  -3.361  -14.677 1.00 0.00 ? 116 GLU A OE2  4  
ATOM 6899  H H    . GLU A 1 65  ? -2.786  -4.194  -10.886 1.00 0.00 ? 116 GLU A H    4  
ATOM 6900  H HA   . GLU A 1 65  ? -4.927  -2.056  -10.671 1.00 0.00 ? 116 GLU A HA   4  
ATOM 6901  H HB2  . GLU A 1 65  ? -5.002  -4.851  -11.793 1.00 0.00 ? 116 GLU A HB2  4  
ATOM 6902  H HB3  . GLU A 1 65  ? -6.461  -3.916  -11.456 1.00 0.00 ? 116 GLU A HB3  4  
ATOM 6903  H HG2  . GLU A 1 65  ? -5.661  -2.128  -12.946 1.00 0.00 ? 116 GLU A HG2  4  
ATOM 6904  H HG3  . GLU A 1 65  ? -4.187  -3.046  -13.262 1.00 0.00 ? 116 GLU A HG3  4  
ATOM 6905  N N    . LEU A 1 66  ? -5.546  -2.740  -8.390  1.00 0.00 ? 117 LEU A N    4  
ATOM 6906  C CA   . LEU A 1 66  ? -5.946  -3.155  -7.014  1.00 0.00 ? 117 LEU A CA   4  
ATOM 6907  C C    . LEU A 1 66  ? -7.465  -3.243  -6.868  1.00 0.00 ? 117 LEU A C    4  
ATOM 6908  O O    . LEU A 1 66  ? -8.214  -2.523  -7.499  1.00 0.00 ? 117 LEU A O    4  
ATOM 6909  C CB   . LEU A 1 66  ? -5.369  -2.151  -6.024  1.00 0.00 ? 117 LEU A CB   4  
ATOM 6910  C CG   . LEU A 1 66  ? -3.825  -2.239  -6.043  1.00 0.00 ? 117 LEU A CG   4  
ATOM 6911  C CD1  . LEU A 1 66  ? -3.258  -1.490  -7.266  1.00 0.00 ? 117 LEU A CD1  4  
ATOM 6912  C CD2  . LEU A 1 66  ? -3.256  -1.641  -4.741  1.00 0.00 ? 117 LEU A CD2  4  
ATOM 6913  H H    . LEU A 1 66  ? -5.622  -1.799  -8.657  1.00 0.00 ? 117 LEU A H    4  
ATOM 6914  H HA   . LEU A 1 66  ? -5.536  -4.122  -6.801  1.00 0.00 ? 117 LEU A HA   4  
ATOM 6915  H HB2  . LEU A 1 66  ? -5.688  -1.158  -6.295  1.00 0.00 ? 117 LEU A HB2  4  
ATOM 6916  H HB3  . LEU A 1 66  ? -5.727  -2.382  -5.040  1.00 0.00 ? 117 LEU A HB3  4  
ATOM 6917  H HG   . LEU A 1 66  ? -3.529  -3.276  -6.109  1.00 0.00 ? 117 LEU A HG   4  
ATOM 6918  H HD11 . LEU A 1 66  ? -3.858  -0.619  -7.475  1.00 0.00 ? 117 LEU A HD11 4  
ATOM 6919  H HD12 . LEU A 1 66  ? -2.242  -1.184  -7.064  1.00 0.00 ? 117 LEU A HD12 4  
ATOM 6920  H HD13 . LEU A 1 66  ? -3.264  -2.140  -8.128  1.00 0.00 ? 117 LEU A HD13 4  
ATOM 6921  H HD21 . LEU A 1 66  ? -3.891  -0.835  -4.399  1.00 0.00 ? 117 LEU A HD21 4  
ATOM 6922  H HD22 . LEU A 1 66  ? -3.218  -2.409  -3.983  1.00 0.00 ? 117 LEU A HD22 4  
ATOM 6923  H HD23 . LEU A 1 66  ? -2.258  -1.263  -4.915  1.00 0.00 ? 117 LEU A HD23 4  
ATOM 6924  N N    . ARG A 1 67  ? -7.919  -4.130  -6.012  1.00 0.00 ? 118 ARG A N    4  
ATOM 6925  C CA   . ARG A 1 67  ? -9.379  -4.293  -5.779  1.00 0.00 ? 118 ARG A CA   4  
ATOM 6926  C C    . ARG A 1 67  ? -9.747  -3.506  -4.529  1.00 0.00 ? 118 ARG A C    4  
ATOM 6927  O O    . ARG A 1 67  ? -9.044  -3.538  -3.538  1.00 0.00 ? 118 ARG A O    4  
ATOM 6928  C CB   . ARG A 1 67  ? -9.702  -5.781  -5.569  1.00 0.00 ? 118 ARG A CB   4  
ATOM 6929  C CG   . ARG A 1 67  ? -9.328  -6.616  -6.811  1.00 0.00 ? 118 ARG A CG   4  
ATOM 6930  C CD   . ARG A 1 67  ? -10.284 -6.291  -7.974  1.00 0.00 ? 118 ARG A CD   4  
ATOM 6931  N NE   . ARG A 1 67  ? -10.118 -7.286  -9.081  1.00 0.00 ? 118 ARG A NE   4  
ATOM 6932  C CZ   . ARG A 1 67  ? -11.042 -7.391  -10.000 1.00 0.00 ? 118 ARG A CZ   4  
ATOM 6933  N NH1  . ARG A 1 67  ? -12.060 -6.573  -9.996  1.00 0.00 ? 118 ARG A NH1  4  
ATOM 6934  N NH2  . ARG A 1 67  ? -10.937 -8.301  -10.935 1.00 0.00 ? 118 ARG A NH2  4  
ATOM 6935  H H    . ARG A 1 67  ? -7.285  -4.683  -5.505  1.00 0.00 ? 118 ARG A H    4  
ATOM 6936  H HA   . ARG A 1 67  ? -9.935  -3.905  -6.616  1.00 0.00 ? 118 ARG A HA   4  
ATOM 6937  H HB2  . ARG A 1 67  ? -9.143  -6.148  -4.718  1.00 0.00 ? 118 ARG A HB2  4  
ATOM 6938  H HB3  . ARG A 1 67  ? -10.758 -5.894  -5.373  1.00 0.00 ? 118 ARG A HB3  4  
ATOM 6939  H HG2  . ARG A 1 67  ? -8.312  -6.387  -7.101  1.00 0.00 ? 118 ARG A HG2  4  
ATOM 6940  H HG3  . ARG A 1 67  ? -9.404  -7.663  -6.567  1.00 0.00 ? 118 ARG A HG3  4  
ATOM 6941  H HD2  . ARG A 1 67  ? -11.298 -6.330  -7.614  1.00 0.00 ? 118 ARG A HD2  4  
ATOM 6942  H HD3  . ARG A 1 67  ? -10.078 -5.306  -8.357  1.00 0.00 ? 118 ARG A HD3  4  
ATOM 6943  H HE   . ARG A 1 67  ? -9.335  -7.875  -9.105  1.00 0.00 ? 118 ARG A HE   4  
ATOM 6944  H HH11 . ARG A 1 67  ? -12.130 -5.870  -9.289  1.00 0.00 ? 118 ARG A HH11 4  
ATOM 6945  H HH12 . ARG A 1 67  ? -12.768 -6.646  -10.700 1.00 0.00 ? 118 ARG A HH12 4  
ATOM 6946  H HH21 . ARG A 1 67  ? -10.145 -8.910  -10.950 1.00 0.00 ? 118 ARG A HH21 4  
ATOM 6947  H HH22 . ARG A 1 67  ? -11.659 -8.402  -11.620 1.00 0.00 ? 118 ARG A HH22 4  
ATOM 6948  N N    . ASN A 1 68  ? -10.835 -2.786  -4.586  1.00 0.00 ? 119 ASN A N    4  
ATOM 6949  C CA   . ASN A 1 68  ? -11.285 -1.959  -3.427  1.00 0.00 ? 119 ASN A CA   4  
ATOM 6950  C C    . ASN A 1 68  ? -10.188 -0.972  -3.030  1.00 0.00 ? 119 ASN A C    4  
ATOM 6951  O O    . ASN A 1 68  ? -10.046 -0.608  -1.878  1.00 0.00 ? 119 ASN A O    4  
ATOM 6952  C CB   . ASN A 1 68  ? -11.622 -2.851  -2.237  1.00 0.00 ? 119 ASN A CB   4  
ATOM 6953  C CG   . ASN A 1 68  ? -12.334 -2.015  -1.171  1.00 0.00 ? 119 ASN A CG   4  
ATOM 6954  O OD1  . ASN A 1 68  ? -13.452 -1.583  -1.372  1.00 0.00 ? 119 ASN A OD1  4  
ATOM 6955  N ND2  . ASN A 1 68  ? -11.736 -1.764  -0.038  1.00 0.00 ? 119 ASN A ND2  4  
ATOM 6956  H H    . ASN A 1 68  ? -11.364 -2.782  -5.411  1.00 0.00 ? 119 ASN A H    4  
ATOM 6957  H HA   . ASN A 1 68  ? -12.165 -1.406  -3.715  1.00 0.00 ? 119 ASN A HA   4  
ATOM 6958  H HB2  . ASN A 1 68  ? -12.277 -3.643  -2.568  1.00 0.00 ? 119 ASN A HB2  4  
ATOM 6959  H HB3  . ASN A 1 68  ? -10.719 -3.271  -1.826  1.00 0.00 ? 119 ASN A HB3  4  
ATOM 6960  H HD21 . ASN A 1 68  ? -10.836 -2.113  0.130   1.00 0.00 ? 119 ASN A HD21 4  
ATOM 6961  H HD22 . ASN A 1 68  ? -12.182 -1.213  0.638   1.00 0.00 ? 119 ASN A HD22 4  
ATOM 6962  N N    . ALA A 1 69  ? -9.427  -0.519  -3.980  1.00 0.00 ? 120 ALA A N    4  
ATOM 6963  C CA   . ALA A 1 69  ? -8.354  0.463   -3.668  1.00 0.00 ? 120 ALA A CA   4  
ATOM 6964  C C    . ALA A 1 69  ? -8.975  1.861   -3.638  1.00 0.00 ? 120 ALA A C    4  
ATOM 6965  O O    . ALA A 1 69  ? -8.354  2.822   -3.234  1.00 0.00 ? 120 ALA A O    4  
ATOM 6966  C CB   . ALA A 1 69  ? -7.255  0.370   -4.740  1.00 0.00 ? 120 ALA A CB   4  
ATOM 6967  H H    . ALA A 1 69  ? -9.569  -0.817  -4.902  1.00 0.00 ? 120 ALA A H    4  
ATOM 6968  H HA   . ALA A 1 69  ? -7.934  0.242   -2.694  1.00 0.00 ? 120 ALA A HA   4  
ATOM 6969  H HB1  . ALA A 1 69  ? -7.658  -0.104  -5.624  1.00 0.00 ? 120 ALA A HB1  4  
ATOM 6970  H HB2  . ALA A 1 69  ? -6.894  1.358   -4.995  1.00 0.00 ? 120 ALA A HB2  4  
ATOM 6971  H HB3  . ALA A 1 69  ? -6.434  -0.221  -4.359  1.00 0.00 ? 120 ALA A HB3  4  
ATOM 6972  N N    . THR A 1 70  ? -10.209 1.970   -4.049  1.00 0.00 ? 121 THR A N    4  
ATOM 6973  C CA   . THR A 1 70  ? -10.896 3.280   -4.036  1.00 0.00 ? 121 THR A CA   4  
ATOM 6974  C C    . THR A 1 70  ? -11.696 3.366   -2.739  1.00 0.00 ? 121 THR A C    4  
ATOM 6975  O O    . THR A 1 70  ? -12.909 3.295   -2.729  1.00 0.00 ? 121 THR A O    4  
ATOM 6976  C CB   . THR A 1 70  ? -11.840 3.354   -5.234  1.00 0.00 ? 121 THR A CB   4  
ATOM 6977  O OG1  . THR A 1 70  ? -12.832 2.343   -5.104  1.00 0.00 ? 121 THR A OG1  4  
ATOM 6978  C CG2  . THR A 1 70  ? -11.044 3.148   -6.531  1.00 0.00 ? 121 THR A CG2  4  
ATOM 6979  H H    . THR A 1 70  ? -10.693 1.181   -4.358  1.00 0.00 ? 121 THR A H    4  
ATOM 6980  H HA   . THR A 1 70  ? -10.171 4.089   -4.084  1.00 0.00 ? 121 THR A HA   4  
ATOM 6981  H HB   . THR A 1 70  ? -12.313 4.313   -5.257  1.00 0.00 ? 121 THR A HB   4  
ATOM 6982  H HG1  . THR A 1 70  ? -12.778 1.774   -5.871  1.00 0.00 ? 121 THR A HG1  4  
ATOM 6983  H HG21 . THR A 1 70  ? -10.137 3.733   -6.493  1.00 0.00 ? 121 THR A HG21 4  
ATOM 6984  H HG22 . THR A 1 70  ? -10.791 2.104   -6.642  1.00 0.00 ? 121 THR A HG22 4  
ATOM 6985  H HG23 . THR A 1 70  ? -11.638 3.467   -7.377  1.00 0.00 ? 121 THR A HG23 4  
ATOM 6986  N N    . ALA A 1 71  ? -11.017 3.485   -1.639  1.00 0.00 ? 122 ALA A N    4  
ATOM 6987  C CA   . ALA A 1 71  ? -11.715 3.543   -0.332  1.00 0.00 ? 122 ALA A CA   4  
ATOM 6988  C C    . ALA A 1 71  ? -12.087 4.986   -0.021  1.00 0.00 ? 122 ALA A C    4  
ATOM 6989  O O    . ALA A 1 71  ? -11.428 5.917   -0.438  1.00 0.00 ? 122 ALA A O    4  
ATOM 6990  C CB   . ALA A 1 71  ? -10.788 3.015   0.753   1.00 0.00 ? 122 ALA A CB   4  
ATOM 6991  H H    . ALA A 1 71  ? -10.041 3.516   -1.670  1.00 0.00 ? 122 ALA A H    4  
ATOM 6992  H HA   . ALA A 1 71  ? -12.610 2.938   -0.367  1.00 0.00 ? 122 ALA A HA   4  
ATOM 6993  H HB1  . ALA A 1 71  ? -9.852  3.552   0.719   1.00 0.00 ? 122 ALA A HB1  4  
ATOM 6994  H HB2  . ALA A 1 71  ? -11.251 3.154   1.717   1.00 0.00 ? 122 ALA A HB2  4  
ATOM 6995  H HB3  . ALA A 1 71  ? -10.607 1.963   0.587   1.00 0.00 ? 122 ALA A HB3  4  
ATOM 6996  N N    . ALA A 1 72  ? -13.152 5.175   0.701   1.00 0.00 ? 123 ALA A N    4  
ATOM 6997  C CA   . ALA A 1 72  ? -13.596 6.553   1.043   1.00 0.00 ? 123 ALA A CA   4  
ATOM 6998  C C    . ALA A 1 72  ? -13.046 6.955   2.409   1.00 0.00 ? 123 ALA A C    4  
ATOM 6999  O O    . ALA A 1 72  ? -13.353 6.348   3.415   1.00 0.00 ? 123 ALA A O    4  
ATOM 7000  C CB   . ALA A 1 72  ? -15.121 6.568   1.089   1.00 0.00 ? 123 ALA A CB   4  
ATOM 7001  H H    . ALA A 1 72  ? -13.669 4.405   1.016   1.00 0.00 ? 123 ALA A H    4  
ATOM 7002  H HA   . ALA A 1 72  ? -13.251 7.247   0.296   1.00 0.00 ? 123 ALA A HA   4  
ATOM 7003  H HB1  . ALA A 1 72  ? -15.509 6.148   0.172   1.00 0.00 ? 123 ALA A HB1  4  
ATOM 7004  H HB2  . ALA A 1 72  ? -15.455 5.975   1.927   1.00 0.00 ? 123 ALA A HB2  4  
ATOM 7005  H HB3  . ALA A 1 72  ? -15.472 7.584   1.199   1.00 0.00 ? 123 ALA A HB3  4  
ATOM 7006  N N    . MET A 1 73  ? -12.244 7.982   2.451   1.00 0.00 ? 124 MET A N    4  
ATOM 7007  C CA   . MET A 1 73  ? -11.677 8.445   3.747   1.00 0.00 ? 124 MET A CA   4  
ATOM 7008  C C    . MET A 1 73  ? -12.813 8.880   4.673   1.00 0.00 ? 124 MET A C    4  
ATOM 7009  O O    . MET A 1 73  ? -13.654 9.671   4.292   1.00 0.00 ? 124 MET A O    4  
ATOM 7010  C CB   . MET A 1 73  ? -10.773 9.648   3.485   1.00 0.00 ? 124 MET A CB   4  
ATOM 7011  C CG   . MET A 1 73  ? -9.981  9.991   4.748   1.00 0.00 ? 124 MET A CG   4  
ATOM 7012  S SD   . MET A 1 73  ? -9.078  11.546  4.509   1.00 0.00 ? 124 MET A SD   4  
ATOM 7013  C CE   . MET A 1 73  ? -7.886  10.969  3.271   1.00 0.00 ? 124 MET A CE   4  
ATOM 7014  H H    . MET A 1 73  ? -12.017 8.456   1.624   1.00 0.00 ? 124 MET A H    4  
ATOM 7015  H HA   . MET A 1 73  ? -11.109 7.652   4.208   1.00 0.00 ? 124 MET A HA   4  
ATOM 7016  H HB2  . MET A 1 73  ? -10.093 9.422   2.676   1.00 0.00 ? 124 MET A HB2  4  
ATOM 7017  H HB3  . MET A 1 73  ? -11.387 10.488  3.215   1.00 0.00 ? 124 MET A HB3  4  
ATOM 7018  H HG2  . MET A 1 73  ? -10.663 10.101  5.576   1.00 0.00 ? 124 MET A HG2  4  
ATOM 7019  H HG3  . MET A 1 73  ? -9.284  9.199   4.960   1.00 0.00 ? 124 MET A HG3  4  
ATOM 7020  H HE1  . MET A 1 73  ? -7.772  9.896   3.342   1.00 0.00 ? 124 MET A HE1  4  
ATOM 7021  H HE2  . MET A 1 73  ? -8.241  11.226  2.289   1.00 0.00 ? 124 MET A HE2  4  
ATOM 7022  H HE3  . MET A 1 73  ? -6.932  11.449  3.444   1.00 0.00 ? 124 MET A HE3  4  
ATOM 7023  N N    . LYS A 1 74  ? -12.828 8.395   5.888   1.00 0.00 ? 125 LYS A N    4  
ATOM 7024  C CA   . LYS A 1 74  ? -13.896 8.799   6.855   1.00 0.00 ? 125 LYS A CA   4  
ATOM 7025  C C    . LYS A 1 74  ? -13.625 10.221  7.345   1.00 0.00 ? 125 LYS A C    4  
ATOM 7026  O O    . LYS A 1 74  ? -14.416 11.126  7.169   1.00 0.00 ? 125 LYS A O    4  
ATOM 7027  C CB   . LYS A 1 74  ? -13.860 7.839   8.050   1.00 0.00 ? 125 LYS A CB   4  
ATOM 7028  C CG   . LYS A 1 74  ? -15.056 8.074   8.988   1.00 0.00 ? 125 LYS A CG   4  
ATOM 7029  C CD   . LYS A 1 74  ? -16.344 7.483   8.392   1.00 0.00 ? 125 LYS A CD   4  
ATOM 7030  C CE   . LYS A 1 74  ? -17.470 7.545   9.430   1.00 0.00 ? 125 LYS A CE   4  
ATOM 7031  N NZ   . LYS A 1 74  ? -17.131 6.665   10.584  1.00 0.00 ? 125 LYS A NZ   4  
ATOM 7032  H H    . LYS A 1 74  ? -12.122 7.773   6.174   1.00 0.00 ? 125 LYS A H    4  
ATOM 7033  H HA   . LYS A 1 74  ? -14.853 8.758   6.372   1.00 0.00 ? 125 LYS A HA   4  
ATOM 7034  H HB2  . LYS A 1 74  ? -13.887 6.824   7.686   1.00 0.00 ? 125 LYS A HB2  4  
ATOM 7035  H HB3  . LYS A 1 74  ? -12.942 7.996   8.596   1.00 0.00 ? 125 LYS A HB3  4  
ATOM 7036  H HG2  . LYS A 1 74  ? -14.852 7.597   9.938   1.00 0.00 ? 125 LYS A HG2  4  
ATOM 7037  H HG3  . LYS A 1 74  ? -15.185 9.135   9.144   1.00 0.00 ? 125 LYS A HG3  4  
ATOM 7038  H HD2  . LYS A 1 74  ? -16.638 8.046   7.520   1.00 0.00 ? 125 LYS A HD2  4  
ATOM 7039  H HD3  . LYS A 1 74  ? -16.173 6.454   8.116   1.00 0.00 ? 125 LYS A HD3  4  
ATOM 7040  H HE2  . LYS A 1 74  ? -17.589 8.563   9.776   1.00 0.00 ? 125 LYS A HE2  4  
ATOM 7041  H HE3  . LYS A 1 74  ? -18.395 7.209   8.981   1.00 0.00 ? 125 LYS A HE3  4  
ATOM 7042  H HZ1  . LYS A 1 74  ? -16.836 5.733   10.230  1.00 0.00 ? 125 LYS A HZ1  4  
ATOM 7043  H HZ2  . LYS A 1 74  ? -16.355 7.090   11.129  1.00 0.00 ? 125 LYS A HZ2  4  
ATOM 7044  H HZ3  . LYS A 1 74  ? -17.962 6.557   11.200  1.00 0.00 ? 125 LYS A HZ3  4  
ATOM 7045  N N    . ASN A 1 75  ? -12.489 10.408  7.951   1.00 0.00 ? 126 ASN A N    4  
ATOM 7046  C CA   . ASN A 1 75  ? -12.086 11.749  8.458   1.00 0.00 ? 126 ASN A CA   4  
ATOM 7047  C C    . ASN A 1 75  ? -10.719 12.038  7.867   1.00 0.00 ? 126 ASN A C    4  
ATOM 7048  O O    . ASN A 1 75  ? -10.574 12.153  6.671   1.00 0.00 ? 126 ASN A O    4  
ATOM 7049  C CB   . ASN A 1 75  ? -12.023 11.724  9.989   1.00 0.00 ? 126 ASN A CB   4  
ATOM 7050  C CG   . ASN A 1 75  ? -11.791 13.144  10.506  1.00 0.00 ? 126 ASN A CG   4  
ATOM 7051  O OD1  . ASN A 1 75  ? -10.790 13.415  11.137  1.00 0.00 ? 126 ASN A OD1  4  
ATOM 7052  N ND2  . ASN A 1 75  ? -12.683 14.069  10.271  1.00 0.00 ? 126 ASN A ND2  4  
ATOM 7053  H H    . ASN A 1 75  ? -11.876 9.653   8.059   1.00 0.00 ? 126 ASN A H    4  
ATOM 7054  H HA   . ASN A 1 75  ? -12.786 12.505  8.130   1.00 0.00 ? 126 ASN A HA   4  
ATOM 7055  H HB2  . ASN A 1 75  ? -12.955 11.346  10.380  1.00 0.00 ? 126 ASN A HB2  4  
ATOM 7056  H HB3  . ASN A 1 75  ? -11.214 11.089  10.311  1.00 0.00 ? 126 ASN A HB3  4  
ATOM 7057  H HD21 . ASN A 1 75  ? -13.496 13.850  9.770   1.00 0.00 ? 126 ASN A HD21 4  
ATOM 7058  H HD22 . ASN A 1 75  ? -12.535 14.982  10.591  1.00 0.00 ? 126 ASN A HD22 4  
ATOM 7059  N N    . GLN A 1 76  ? -9.704  12.126  8.673   1.00 0.00 ? 127 GLN A N    4  
ATOM 7060  C CA   . GLN A 1 76  ? -8.344  12.365  8.119   1.00 0.00 ? 127 GLN A CA   4  
ATOM 7061  C C    . GLN A 1 76  ? -7.649  11.016  7.914   1.00 0.00 ? 127 GLN A C    4  
ATOM 7062  O O    . GLN A 1 76  ? -6.456  10.948  7.683   1.00 0.00 ? 127 GLN A O    4  
ATOM 7063  C CB   . GLN A 1 76  ? -7.536  13.206  9.093   1.00 0.00 ? 127 GLN A CB   4  
ATOM 7064  C CG   . GLN A 1 76  ? -8.224  14.554  9.293   1.00 0.00 ? 127 GLN A CG   4  
ATOM 7065  C CD   . GLN A 1 76  ? -7.406  15.390  10.279  1.00 0.00 ? 127 GLN A CD   4  
ATOM 7066  O OE1  . GLN A 1 76  ? -6.698  14.848  11.108  1.00 0.00 ? 127 GLN A OE1  4  
ATOM 7067  N NE2  . GLN A 1 76  ? -7.457  16.692  10.220  1.00 0.00 ? 127 GLN A NE2  4  
ATOM 7068  H H    . GLN A 1 76  ? -9.828  12.008  9.641   1.00 0.00 ? 127 GLN A H    4  
ATOM 7069  H HA   . GLN A 1 76  ? -8.415  12.883  7.173   1.00 0.00 ? 127 GLN A HA   4  
ATOM 7070  H HB2  . GLN A 1 76  ? -7.472  12.689  10.041  1.00 0.00 ? 127 GLN A HB2  4  
ATOM 7071  H HB3  . GLN A 1 76  ? -6.549  13.361  8.697   1.00 0.00 ? 127 GLN A HB3  4  
ATOM 7072  H HG2  . GLN A 1 76  ? -8.290  15.065  8.341   1.00 0.00 ? 127 GLN A HG2  4  
ATOM 7073  H HG3  . GLN A 1 76  ? -9.218  14.400  9.688   1.00 0.00 ? 127 GLN A HG3  4  
ATOM 7074  H HE21 . GLN A 1 76  ? -8.017  17.132  9.547   1.00 0.00 ? 127 GLN A HE21 4  
ATOM 7075  H HE22 . GLN A 1 76  ? -6.935  17.234  10.851  1.00 0.00 ? 127 GLN A HE22 4  
ATOM 7076  N N    . VAL A 1 77  ? -8.393  9.936   8.038   1.00 0.00 ? 128 VAL A N    4  
ATOM 7077  C CA   . VAL A 1 77  ? -7.798  8.570   7.888   1.00 0.00 ? 128 VAL A CA   4  
ATOM 7078  C C    . VAL A 1 77  ? -8.645  7.702   6.930   1.00 0.00 ? 128 VAL A C    4  
ATOM 7079  O O    . VAL A 1 77  ? -9.861  7.733   6.962   1.00 0.00 ? 128 VAL A O    4  
ATOM 7080  C CB   . VAL A 1 77  ? -7.740  7.930   9.277   1.00 0.00 ? 128 VAL A CB   4  
ATOM 7081  C CG1  . VAL A 1 77  ? -6.982  6.603   9.216   1.00 0.00 ? 128 VAL A CG1  4  
ATOM 7082  C CG2  . VAL A 1 77  ? -7.010  8.884   10.228  1.00 0.00 ? 128 VAL A CG2  4  
ATOM 7083  H H    . VAL A 1 77  ? -9.343  10.026  8.246   1.00 0.00 ? 128 VAL A H    4  
ATOM 7084  H HA   . VAL A 1 77  ? -6.802  8.648   7.500   1.00 0.00 ? 128 VAL A HA   4  
ATOM 7085  H HB   . VAL A 1 77  ? -8.744  7.759   9.640   1.00 0.00 ? 128 VAL A HB   4  
ATOM 7086  H HG11 . VAL A 1 77  ? -7.430  5.968   8.466   1.00 0.00 ? 128 VAL A HG11 4  
ATOM 7087  H HG12 . VAL A 1 77  ? -5.948  6.788   8.959   1.00 0.00 ? 128 VAL A HG12 4  
ATOM 7088  H HG13 . VAL A 1 77  ? -7.034  6.116   10.177  1.00 0.00 ? 128 VAL A HG13 4  
ATOM 7089  H HG21 . VAL A 1 77  ? -6.018  9.080   9.847   1.00 0.00 ? 128 VAL A HG21 4  
ATOM 7090  H HG22 . VAL A 1 77  ? -7.556  9.814   10.296  1.00 0.00 ? 128 VAL A HG22 4  
ATOM 7091  H HG23 . VAL A 1 77  ? -6.939  8.435   11.207  1.00 0.00 ? 128 VAL A HG23 4  
ATOM 7092  N N    . ALA A 1 78  ? -7.993  6.918   6.084   1.00 0.00 ? 129 ALA A N    4  
ATOM 7093  C CA   . ALA A 1 78  ? -8.716  6.022   5.112   1.00 0.00 ? 129 ALA A CA   4  
ATOM 7094  C C    . ALA A 1 78  ? -8.243  4.570   5.308   1.00 0.00 ? 129 ALA A C    4  
ATOM 7095  O O    . ALA A 1 78  ? -7.283  4.313   6.008   1.00 0.00 ? 129 ALA A O    4  
ATOM 7096  C CB   . ALA A 1 78  ? -8.403  6.434   3.664   1.00 0.00 ? 129 ALA A CB   4  
ATOM 7097  H H    . ALA A 1 78  ? -7.016  6.919   6.089   1.00 0.00 ? 129 ALA A H    4  
ATOM 7098  H HA   . ALA A 1 78  ? -9.783  6.080   5.282   1.00 0.00 ? 129 ALA A HA   4  
ATOM 7099  H HB1  . ALA A 1 78  ? -8.581  7.490   3.533   1.00 0.00 ? 129 ALA A HB1  4  
ATOM 7100  H HB2  . ALA A 1 78  ? -7.369  6.211   3.440   1.00 0.00 ? 129 ALA A HB2  4  
ATOM 7101  H HB3  . ALA A 1 78  ? -9.039  5.876   2.990   1.00 0.00 ? 129 ALA A HB3  4  
ATOM 7102  N N    . ARG A 1 79  ? -8.912  3.620   4.701   1.00 0.00 ? 130 ARG A N    4  
ATOM 7103  C CA   . ARG A 1 79  ? -8.496  2.187   4.868   1.00 0.00 ? 130 ARG A CA   4  
ATOM 7104  C C    . ARG A 1 79  ? -8.946  1.343   3.660   1.00 0.00 ? 130 ARG A C    4  
ATOM 7105  O O    . ARG A 1 79  ? -9.856  1.706   2.943   1.00 0.00 ? 130 ARG A O    4  
ATOM 7106  C CB   . ARG A 1 79  ? -9.129  1.647   6.151   1.00 0.00 ? 130 ARG A CB   4  
ATOM 7107  C CG   . ARG A 1 79  ? -8.546  0.277   6.497   1.00 0.00 ? 130 ARG A CG   4  
ATOM 7108  C CD   . ARG A 1 79  ? -9.169  -0.221  7.807   1.00 0.00 ? 130 ARG A CD   4  
ATOM 7109  N NE   . ARG A 1 79  ? -10.601 -0.588  7.598   1.00 0.00 ? 130 ARG A NE   4  
ATOM 7110  C CZ   . ARG A 1 79  ? -11.209 -1.359  8.459   1.00 0.00 ? 130 ARG A CZ   4  
ATOM 7111  N NH1  . ARG A 1 79  ? -10.581 -1.803  9.510   1.00 0.00 ? 130 ARG A NH1  4  
ATOM 7112  N NH2  . ARG A 1 79  ? -12.457 -1.682  8.275   1.00 0.00 ? 130 ARG A NH2  4  
ATOM 7113  H H    . ARG A 1 79  ? -9.687  3.846   4.145   1.00 0.00 ? 130 ARG A H    4  
ATOM 7114  H HA   . ARG A 1 79  ? -7.421  2.134   4.954   1.00 0.00 ? 130 ARG A HA   4  
ATOM 7115  H HB2  . ARG A 1 79  ? -8.925  2.334   6.961   1.00 0.00 ? 130 ARG A HB2  4  
ATOM 7116  H HB3  . ARG A 1 79  ? -10.197 1.560   6.018   1.00 0.00 ? 130 ARG A HB3  4  
ATOM 7117  H HG2  . ARG A 1 79  ? -8.771  -0.421  5.701   1.00 0.00 ? 130 ARG A HG2  4  
ATOM 7118  H HG3  . ARG A 1 79  ? -7.477  0.357   6.615   1.00 0.00 ? 130 ARG A HG3  4  
ATOM 7119  H HD2  . ARG A 1 79  ? -8.619  -1.082  8.163   1.00 0.00 ? 130 ARG A HD2  4  
ATOM 7120  H HD3  . ARG A 1 79  ? -9.118  0.568   8.540   1.00 0.00 ? 130 ARG A HD3  4  
ATOM 7121  H HE   . ARG A 1 79  ? -11.086 -0.252  6.815   1.00 0.00 ? 130 ARG A HE   4  
ATOM 7122  H HH11 . ARG A 1 79  ? -9.627  -1.549  9.666   1.00 0.00 ? 130 ARG A HH11 4  
ATOM 7123  H HH12 . ARG A 1 79  ? -11.051 -2.407  10.156  1.00 0.00 ? 130 ARG A HH12 4  
ATOM 7124  H HH21 . ARG A 1 79  ? -12.946 -1.340  7.475   1.00 0.00 ? 130 ARG A HH21 4  
ATOM 7125  H HH22 . ARG A 1 79  ? -12.922 -2.273  8.935   1.00 0.00 ? 130 ARG A HH22 4  
ATOM 7126  N N    . PHE A 1 80  ? -8.293  0.217   3.432   1.00 0.00 ? 131 PHE A N    4  
ATOM 7127  C CA   . PHE A 1 80  ? -8.654  -0.673  2.267   1.00 0.00 ? 131 PHE A CA   4  
ATOM 7128  C C    . PHE A 1 80  ? -9.014  -2.081  2.784   1.00 0.00 ? 131 PHE A C    4  
ATOM 7129  O O    . PHE A 1 80  ? -8.249  -2.701  3.499   1.00 0.00 ? 131 PHE A O    4  
ATOM 7130  C CB   . PHE A 1 80  ? -7.437  -0.780  1.337   1.00 0.00 ? 131 PHE A CB   4  
ATOM 7131  C CG   . PHE A 1 80  ? -6.730  0.556   1.247   1.00 0.00 ? 131 PHE A CG   4  
ATOM 7132  C CD1  . PHE A 1 80  ? -7.160  1.529   0.333   1.00 0.00 ? 131 PHE A CD1  4  
ATOM 7133  C CD2  . PHE A 1 80  ? -5.641  0.817   2.087   1.00 0.00 ? 131 PHE A CD2  4  
ATOM 7134  C CE1  . PHE A 1 80  ? -6.499  2.761   0.265   1.00 0.00 ? 131 PHE A CE1  4  
ATOM 7135  C CE2  . PHE A 1 80  ? -4.988  2.052   2.020   1.00 0.00 ? 131 PHE A CE2  4  
ATOM 7136  C CZ   . PHE A 1 80  ? -5.415  3.021   1.110   1.00 0.00 ? 131 PHE A CZ   4  
ATOM 7137  H H    . PHE A 1 80  ? -7.561  -0.046  4.025   1.00 0.00 ? 131 PHE A H    4  
ATOM 7138  H HA   . PHE A 1 80  ? -9.491  -0.258  1.724   1.00 0.00 ? 131 PHE A HA   4  
ATOM 7139  H HB2  . PHE A 1 80  ? -6.751  -1.514  1.732   1.00 0.00 ? 131 PHE A HB2  4  
ATOM 7140  H HB3  . PHE A 1 80  ? -7.763  -1.081  0.351   1.00 0.00 ? 131 PHE A HB3  4  
ATOM 7141  H HD1  . PHE A 1 80  ? -7.996  1.331   -0.322  1.00 0.00 ? 131 PHE A HD1  4  
ATOM 7142  H HD2  . PHE A 1 80  ? -5.304  0.068   2.789   1.00 0.00 ? 131 PHE A HD2  4  
ATOM 7143  H HE1  . PHE A 1 80  ? -6.823  3.512   -0.438  1.00 0.00 ? 131 PHE A HE1  4  
ATOM 7144  H HE2  . PHE A 1 80  ? -4.154  2.254   2.671   1.00 0.00 ? 131 PHE A HE2  4  
ATOM 7145  H HZ   . PHE A 1 80  ? -4.910  3.971   1.061   1.00 0.00 ? 131 PHE A HZ   4  
ATOM 7146  N N    . ASN A 1 81  ? -10.163 -2.597  2.421   1.00 0.00 ? 132 ASN A N    4  
ATOM 7147  C CA   . ASN A 1 81  ? -10.563 -3.965  2.885   1.00 0.00 ? 132 ASN A CA   4  
ATOM 7148  C C    . ASN A 1 81  ? -10.155 -5.018  1.856   1.00 0.00 ? 132 ASN A C    4  
ATOM 7149  O O    . ASN A 1 81  ? -9.103  -5.612  1.958   1.00 0.00 ? 132 ASN A O    4  
ATOM 7150  C CB   . ASN A 1 81  ? -12.079 -3.997  3.102   1.00 0.00 ? 132 ASN A CB   4  
ATOM 7151  C CG   . ASN A 1 81  ? -12.454 -3.023  4.225   1.00 0.00 ? 132 ASN A CG   4  
ATOM 7152  O OD1  . ASN A 1 81  ? -11.770 -2.937  5.227   1.00 0.00 ? 132 ASN A OD1  4  
ATOM 7153  N ND2  . ASN A 1 81  ? -13.515 -2.273  4.094   1.00 0.00 ? 132 ASN A ND2  4  
ATOM 7154  H H    . ASN A 1 81  ? -10.762 -2.089  1.838   1.00 0.00 ? 132 ASN A H    4  
ATOM 7155  H HA   . ASN A 1 81  ? -10.064 -4.191  3.812   1.00 0.00 ? 132 ASN A HA   4  
ATOM 7156  H HB2  . ASN A 1 81  ? -12.575 -3.698  2.188   1.00 0.00 ? 132 ASN A HB2  4  
ATOM 7157  H HB3  . ASN A 1 81  ? -12.390 -4.996  3.370   1.00 0.00 ? 132 ASN A HB3  4  
ATOM 7158  H HD21 . ASN A 1 81  ? -14.062 -2.337  3.283   1.00 0.00 ? 132 ASN A HD21 4  
ATOM 7159  H HD22 . ASN A 1 81  ? -13.764 -1.645  4.807   1.00 0.00 ? 132 ASN A HD22 4  
ATOM 7160  N N    . ASP A 1 82  ? -10.974 -5.261  0.870   1.00 0.00 ? 133 ASP A N    4  
ATOM 7161  C CA   . ASP A 1 82  ? -10.608 -6.291  -0.146  1.00 0.00 ? 133 ASP A CA   4  
ATOM 7162  C C    . ASP A 1 82  ? -9.452  -5.770  -0.995  1.00 0.00 ? 133 ASP A C    4  
ATOM 7163  O O    . ASP A 1 82  ? -9.538  -5.708  -2.205  1.00 0.00 ? 133 ASP A O    4  
ATOM 7164  C CB   . ASP A 1 82  ? -11.805 -6.581  -1.046  1.00 0.00 ? 133 ASP A CB   4  
ATOM 7165  C CG   . ASP A 1 82  ? -11.533 -7.851  -1.852  1.00 0.00 ? 133 ASP A CG   4  
ATOM 7166  O OD1  . ASP A 1 82  ? -10.444 -8.389  -1.724  1.00 0.00 ? 133 ASP A OD1  4  
ATOM 7167  O OD2  . ASP A 1 82  ? -12.414 -8.263  -2.589  1.00 0.00 ? 133 ASP A OD2  4  
ATOM 7168  H H    . ASP A 1 82  ? -11.823 -4.775  0.801   1.00 0.00 ? 133 ASP A H    4  
ATOM 7169  H HA   . ASP A 1 82  ? -10.305 -7.196  0.357   1.00 0.00 ? 133 ASP A HA   4  
ATOM 7170  H HB2  . ASP A 1 82  ? -12.688 -6.719  -0.441  1.00 0.00 ? 133 ASP A HB2  4  
ATOM 7171  H HB3  . ASP A 1 82  ? -11.957 -5.758  -1.724  1.00 0.00 ? 133 ASP A HB3  4  
ATOM 7172  N N    . LEU A 1 83  ? -8.374  -5.382  -0.370  1.00 0.00 ? 134 LEU A N    4  
ATOM 7173  C CA   . LEU A 1 83  ? -7.218  -4.840  -1.142  1.00 0.00 ? 134 LEU A CA   4  
ATOM 7174  C C    . LEU A 1 83  ? -6.396  -5.966  -1.759  1.00 0.00 ? 134 LEU A C    4  
ATOM 7175  O O    . LEU A 1 83  ? -5.552  -6.567  -1.116  1.00 0.00 ? 134 LEU A O    4  
ATOM 7176  C CB   . LEU A 1 83  ? -6.342  -4.015  -0.203  1.00 0.00 ? 134 LEU A CB   4  
ATOM 7177  C CG   . LEU A 1 83  ? -5.152  -3.402  -0.963  1.00 0.00 ? 134 LEU A CG   4  
ATOM 7178  C CD1  . LEU A 1 83  ? -5.647  -2.380  -1.995  1.00 0.00 ? 134 LEU A CD1  4  
ATOM 7179  C CD2  . LEU A 1 83  ? -4.236  -2.702  0.037   1.00 0.00 ? 134 LEU A CD2  4  
ATOM 7180  H H    . LEU A 1 83  ? -8.338  -5.422  0.608   1.00 0.00 ? 134 LEU A H    4  
ATOM 7181  H HA   . LEU A 1 83  ? -7.584  -4.205  -1.922  1.00 0.00 ? 134 LEU A HA   4  
ATOM 7182  H HB2  . LEU A 1 83  ? -6.938  -3.232  0.225   1.00 0.00 ? 134 LEU A HB2  4  
ATOM 7183  H HB3  . LEU A 1 83  ? -5.970  -4.650  0.588   1.00 0.00 ? 134 LEU A HB3  4  
ATOM 7184  H HG   . LEU A 1 83  ? -4.599  -4.177  -1.468  1.00 0.00 ? 134 LEU A HG   4  
ATOM 7185  H HD11 . LEU A 1 83  ? -6.496  -1.838  -1.602  1.00 0.00 ? 134 LEU A HD11 4  
ATOM 7186  H HD12 . LEU A 1 83  ? -4.854  -1.684  -2.232  1.00 0.00 ? 134 LEU A HD12 4  
ATOM 7187  H HD13 . LEU A 1 83  ? -5.936  -2.902  -2.887  1.00 0.00 ? 134 LEU A HD13 4  
ATOM 7188  H HD21 . LEU A 1 83  ? -4.802  -1.977  0.596   1.00 0.00 ? 134 LEU A HD21 4  
ATOM 7189  H HD22 . LEU A 1 83  ? -3.820  -3.432  0.714   1.00 0.00 ? 134 LEU A HD22 4  
ATOM 7190  H HD23 . LEU A 1 83  ? -3.438  -2.207  -0.492  1.00 0.00 ? 134 LEU A HD23 4  
ATOM 7191  N N    . ARG A 1 84  ? -6.619  -6.236  -3.025  1.00 0.00 ? 135 ARG A N    4  
ATOM 7192  C CA   . ARG A 1 84  ? -5.836  -7.314  -3.726  1.00 0.00 ? 135 ARG A CA   4  
ATOM 7193  C C    . ARG A 1 84  ? -4.769  -6.666  -4.604  1.00 0.00 ? 135 ARG A C    4  
ATOM 7194  O O    . ARG A 1 84  ? -5.048  -5.775  -5.368  1.00 0.00 ? 135 ARG A O    4  
ATOM 7195  C CB   . ARG A 1 84  ? -6.767  -8.172  -4.597  1.00 0.00 ? 135 ARG A CB   4  
ATOM 7196  C CG   . ARG A 1 84  ? -6.019  -9.428  -5.073  1.00 0.00 ? 135 ARG A CG   4  
ATOM 7197  C CD   . ARG A 1 84  ? -6.950  -10.279 -5.934  1.00 0.00 ? 135 ARG A CD   4  
ATOM 7198  N NE   . ARG A 1 84  ? -7.211  -9.559  -7.215  1.00 0.00 ? 135 ARG A NE   4  
ATOM 7199  C CZ   . ARG A 1 84  ? -7.794  -10.173 -8.204  1.00 0.00 ? 135 ARG A CZ   4  
ATOM 7200  N NH1  . ARG A 1 84  ? -8.135  -11.425 -8.079  1.00 0.00 ? 135 ARG A NH1  4  
ATOM 7201  N NH2  . ARG A 1 84  ? -8.024  -9.532  -9.319  1.00 0.00 ? 135 ARG A NH2  4  
ATOM 7202  H H    . ARG A 1 84  ? -7.295  -5.711  -3.517  1.00 0.00 ? 135 ARG A H    4  
ATOM 7203  H HA   . ARG A 1 84  ? -5.347  -7.944  -3.007  1.00 0.00 ? 135 ARG A HA   4  
ATOM 7204  H HB2  . ARG A 1 84  ? -7.635  -8.462  -4.026  1.00 0.00 ? 135 ARG A HB2  4  
ATOM 7205  H HB3  . ARG A 1 84  ? -7.079  -7.601  -5.461  1.00 0.00 ? 135 ARG A HB3  4  
ATOM 7206  H HG2  . ARG A 1 84  ? -5.157  -9.137  -5.654  1.00 0.00 ? 135 ARG A HG2  4  
ATOM 7207  H HG3  . ARG A 1 84  ? -5.699  -10.003 -4.217  1.00 0.00 ? 135 ARG A HG3  4  
ATOM 7208  H HD2  . ARG A 1 84  ? -6.482  -11.231 -6.145  1.00 0.00 ? 135 ARG A HD2  4  
ATOM 7209  H HD3  . ARG A 1 84  ? -7.881  -10.447 -5.405  1.00 0.00 ? 135 ARG A HD3  4  
ATOM 7210  H HE   . ARG A 1 84  ? -6.946  -8.621  -7.310  1.00 0.00 ? 135 ARG A HE   4  
ATOM 7211  H HH11 . ARG A 1 84  ? -7.944  -11.909 -7.224  1.00 0.00 ? 135 ARG A HH11 4  
ATOM 7212  H HH12 . ARG A 1 84  ? -8.594  -11.898 -8.831  1.00 0.00 ? 135 ARG A HH12 4  
ATOM 7213  H HH21 . ARG A 1 84  ? -7.752  -8.576  -9.408  1.00 0.00 ? 135 ARG A HH21 4  
ATOM 7214  H HH22 . ARG A 1 84  ? -8.467  -10.000 -10.084 1.00 0.00 ? 135 ARG A HH22 4  
ATOM 7215  N N    . PHE A 1 85  ? -3.546  -7.113  -4.512  1.00 0.00 ? 136 PHE A N    4  
ATOM 7216  C CA   . PHE A 1 85  ? -2.469  -6.523  -5.362  1.00 0.00 ? 136 PHE A CA   4  
ATOM 7217  C C    . PHE A 1 85  ? -2.288  -7.404  -6.601  1.00 0.00 ? 136 PHE A C    4  
ATOM 7218  O O    . PHE A 1 85  ? -1.936  -8.560  -6.479  1.00 0.00 ? 136 PHE A O    4  
ATOM 7219  C CB   . PHE A 1 85  ? -1.143  -6.552  -4.589  1.00 0.00 ? 136 PHE A CB   4  
ATOM 7220  C CG   . PHE A 1 85  ? -1.053  -5.423  -3.584  1.00 0.00 ? 136 PHE A CG   4  
ATOM 7221  C CD1  . PHE A 1 85  ? -1.508  -5.601  -2.270  1.00 0.00 ? 136 PHE A CD1  4  
ATOM 7222  C CD2  . PHE A 1 85  ? -0.484  -4.205  -3.965  1.00 0.00 ? 136 PHE A CD2  4  
ATOM 7223  C CE1  . PHE A 1 85  ? -1.394  -4.558  -1.339  1.00 0.00 ? 136 PHE A CE1  4  
ATOM 7224  C CE2  . PHE A 1 85  ? -0.368  -3.162  -3.037  1.00 0.00 ? 136 PHE A CE2  4  
ATOM 7225  C CZ   . PHE A 1 85  ? -0.826  -3.336  -1.722  1.00 0.00 ? 136 PHE A CZ   4  
ATOM 7226  H H    . PHE A 1 85  ? -3.336  -7.844  -3.892  1.00 0.00 ? 136 PHE A H    4  
ATOM 7227  H HA   . PHE A 1 85  ? -2.714  -5.509  -5.647  1.00 0.00 ? 136 PHE A HA   4  
ATOM 7228  H HB2  . PHE A 1 85  ? -1.070  -7.489  -4.069  1.00 0.00 ? 136 PHE A HB2  4  
ATOM 7229  H HB3  . PHE A 1 85  ? -0.319  -6.466  -5.286  1.00 0.00 ? 136 PHE A HB3  4  
ATOM 7230  H HD1  . PHE A 1 85  ? -1.943  -6.541  -1.972  1.00 0.00 ? 136 PHE A HD1  4  
ATOM 7231  H HD2  . PHE A 1 85  ? -0.131  -4.068  -4.975  1.00 0.00 ? 136 PHE A HD2  4  
ATOM 7232  H HE1  . PHE A 1 85  ? -1.746  -4.698  -0.325  1.00 0.00 ? 136 PHE A HE1  4  
ATOM 7233  H HE2  . PHE A 1 85  ? 0.076   -2.224  -3.335  1.00 0.00 ? 136 PHE A HE2  4  
ATOM 7234  H HZ   . PHE A 1 85  ? -0.736  -2.530  -1.006  1.00 0.00 ? 136 PHE A HZ   4  
ATOM 7235  N N    . VAL A 1 86  ? -2.482  -6.877  -7.792  1.00 0.00 ? 137 VAL A N    4  
ATOM 7236  C CA   . VAL A 1 86  ? -2.270  -7.722  -9.022  1.00 0.00 ? 137 VAL A CA   4  
ATOM 7237  C C    . VAL A 1 86  ? -1.411  -6.959  -10.044 1.00 0.00 ? 137 VAL A C    4  
ATOM 7238  O O    . VAL A 1 86  ? -1.802  -6.706  -11.172 1.00 0.00 ? 137 VAL A O    4  
ATOM 7239  C CB   . VAL A 1 86  ? -3.633  -8.133  -9.615  1.00 0.00 ? 137 VAL A CB   4  
ATOM 7240  C CG1  . VAL A 1 86  ? -4.252  -6.992  -10.453 1.00 0.00 ? 137 VAL A CG1  4  
ATOM 7241  C CG2  . VAL A 1 86  ? -3.458  -9.382  -10.495 1.00 0.00 ? 137 VAL A CG2  4  
ATOM 7242  H H    . VAL A 1 86  ? -2.752  -5.932  -7.878  1.00 0.00 ? 137 VAL A H    4  
ATOM 7243  H HA   . VAL A 1 86  ? -1.727  -8.620  -8.749  1.00 0.00 ? 137 VAL A HA   4  
ATOM 7244  H HB   . VAL A 1 86  ? -4.298  -8.375  -8.796  1.00 0.00 ? 137 VAL A HB   4  
ATOM 7245  H HG11 . VAL A 1 86  ? -3.788  -6.057  -10.201 1.00 0.00 ? 137 VAL A HG11 4  
ATOM 7246  H HG12 . VAL A 1 86  ? -4.104  -7.186  -11.509 1.00 0.00 ? 137 VAL A HG12 4  
ATOM 7247  H HG13 . VAL A 1 86  ? -5.309  -6.929  -10.249 1.00 0.00 ? 137 VAL A HG13 4  
ATOM 7248  H HG21 . VAL A 1 86  ? -2.598  -9.251  -11.138 1.00 0.00 ? 137 VAL A HG21 4  
ATOM 7249  H HG22 . VAL A 1 86  ? -3.312  -10.249 -9.870  1.00 0.00 ? 137 VAL A HG22 4  
ATOM 7250  H HG23 . VAL A 1 86  ? -4.343  -9.518  -11.098 1.00 0.00 ? 137 VAL A HG23 4  
ATOM 7251  N N    . GLY A 1 87  ? -0.212  -6.621  -9.652  1.00 0.00 ? 138 GLY A N    4  
ATOM 7252  C CA   . GLY A 1 87  ? 0.730   -5.925  -10.577 1.00 0.00 ? 138 GLY A CA   4  
ATOM 7253  C C    . GLY A 1 87  ? 1.713   -6.993  -11.065 1.00 0.00 ? 138 GLY A C    4  
ATOM 7254  O O    . GLY A 1 87  ? 1.540   -8.161  -10.781 1.00 0.00 ? 138 GLY A O    4  
ATOM 7255  H H    . GLY A 1 87  ? 0.084   -6.860  -8.749  1.00 0.00 ? 138 GLY A H    4  
ATOM 7256  H HA2  . GLY A 1 87  ? 0.188   -5.487  -11.410 1.00 0.00 ? 138 GLY A HA2  4  
ATOM 7257  H HA3  . GLY A 1 87  ? 1.273   -5.156  -10.046 1.00 0.00 ? 138 GLY A HA3  4  
ATOM 7258  N N    . ARG A 1 88  ? 2.760   -6.623  -11.749 1.00 0.00 ? 139 ARG A N    4  
ATOM 7259  C CA   . ARG A 1 88  ? 3.751   -7.658  -12.181 1.00 0.00 ? 139 ARG A CA   4  
ATOM 7260  C C    . ARG A 1 88  ? 4.718   -7.873  -11.013 1.00 0.00 ? 139 ARG A C    4  
ATOM 7261  O O    . ARG A 1 88  ? 5.162   -6.930  -10.389 1.00 0.00 ? 139 ARG A O    4  
ATOM 7262  C CB   . ARG A 1 88  ? 4.496   -7.176  -13.427 1.00 0.00 ? 139 ARG A CB   4  
ATOM 7263  C CG   . ARG A 1 88  ? 3.488   -6.965  -14.555 1.00 0.00 ? 139 ARG A CG   4  
ATOM 7264  C CD   . ARG A 1 88  ? 4.226   -6.575  -15.837 1.00 0.00 ? 139 ARG A CD   4  
ATOM 7265  N NE   . ARG A 1 88  ? 5.185   -7.658  -16.193 1.00 0.00 ? 139 ARG A NE   4  
ATOM 7266  C CZ   . ARG A 1 88  ? 5.739   -7.678  -17.370 1.00 0.00 ? 139 ARG A CZ   4  
ATOM 7267  N NH1  . ARG A 1 88  ? 5.460   -6.737  -18.222 1.00 0.00 ? 139 ARG A NH1  4  
ATOM 7268  N NH2  . ARG A 1 88  ? 6.577   -8.628  -17.690 1.00 0.00 ? 139 ARG A NH2  4  
ATOM 7269  H H    . ARG A 1 88  ? 2.914   -5.678  -11.945 1.00 0.00 ? 139 ARG A H    4  
ATOM 7270  H HA   . ARG A 1 88  ? 3.240   -8.587  -12.398 1.00 0.00 ? 139 ARG A HA   4  
ATOM 7271  H HB2  . ARG A 1 88  ? 5.006   -6.248  -13.213 1.00 0.00 ? 139 ARG A HB2  4  
ATOM 7272  H HB3  . ARG A 1 88  ? 5.208   -7.925  -13.733 1.00 0.00 ? 139 ARG A HB3  4  
ATOM 7273  H HG2  . ARG A 1 88  ? 2.939   -7.881  -14.719 1.00 0.00 ? 139 ARG A HG2  4  
ATOM 7274  H HG3  . ARG A 1 88  ? 2.809   -6.177  -14.277 1.00 0.00 ? 139 ARG A HG3  4  
ATOM 7275  H HD2  . ARG A 1 88  ? 3.513   -6.449  -16.639 1.00 0.00 ? 139 ARG A HD2  4  
ATOM 7276  H HD3  . ARG A 1 88  ? 4.755   -5.649  -15.683 1.00 0.00 ? 139 ARG A HD3  4  
ATOM 7277  H HE   . ARG A 1 88  ? 5.403   -8.356  -15.539 1.00 0.00 ? 139 ARG A HE   4  
ATOM 7278  H HH11 . ARG A 1 88  ? 4.823   -6.011  -17.966 1.00 0.00 ? 139 ARG A HH11 4  
ATOM 7279  H HH12 . ARG A 1 88  ? 5.882   -6.735  -19.126 1.00 0.00 ? 139 ARG A HH12 4  
ATOM 7280  H HH21 . ARG A 1 88  ? 6.801   -9.342  -17.026 1.00 0.00 ? 139 ARG A HH21 4  
ATOM 7281  H HH22 . ARG A 1 88  ? 6.994   -8.644  -18.598 1.00 0.00 ? 139 ARG A HH22 4  
ATOM 7282  N N    . SER A 1 89  ? 5.003   -9.103  -10.670 1.00 0.00 ? 140 SER A N    4  
ATOM 7283  C CA   . SER A 1 89  ? 5.892   -9.371  -9.493  1.00 0.00 ? 140 SER A CA   4  
ATOM 7284  C C    . SER A 1 89  ? 7.334   -9.669  -9.919  1.00 0.00 ? 140 SER A C    4  
ATOM 7285  O O    . SER A 1 89  ? 8.160   -10.006 -9.092  1.00 0.00 ? 140 SER A O    4  
ATOM 7286  C CB   . SER A 1 89  ? 5.344   -10.574 -8.746  1.00 0.00 ? 140 SER A CB   4  
ATOM 7287  O OG   . SER A 1 89  ? 5.664   -11.750 -9.473  1.00 0.00 ? 140 SER A OG   4  
ATOM 7288  H H    . SER A 1 89  ? 4.603   -9.852  -11.157 1.00 0.00 ? 140 SER A H    4  
ATOM 7289  H HA   . SER A 1 89  ? 5.887   -8.520  -8.829  1.00 0.00 ? 140 SER A HA   4  
ATOM 7290  H HB2  . SER A 1 89  ? 5.788   -10.624 -7.769  1.00 0.00 ? 140 SER A HB2  4  
ATOM 7291  H HB3  . SER A 1 89  ? 4.272   -10.477 -8.652  1.00 0.00 ? 140 SER A HB3  4  
ATOM 7292  H HG   . SER A 1 89  ? 5.395   -11.611 -10.385 1.00 0.00 ? 140 SER A HG   4  
ATOM 7293  N N    . GLY A 1 90  ? 7.646   -9.564  -11.185 1.00 0.00 ? 141 GLY A N    4  
ATOM 7294  C CA   . GLY A 1 90  ? 9.041   -9.852  -11.652 1.00 0.00 ? 141 GLY A CA   4  
ATOM 7295  C C    . GLY A 1 90  ? 10.075  -9.307  -10.660 1.00 0.00 ? 141 GLY A C    4  
ATOM 7296  O O    . GLY A 1 90  ? 10.059  -8.159  -10.266 1.00 0.00 ? 141 GLY A O    4  
ATOM 7297  H H    . GLY A 1 90  ? 6.964   -9.302  -11.834 1.00 0.00 ? 141 GLY A H    4  
ATOM 7298  H HA2  . GLY A 1 90  ? 9.172   -10.920 -11.749 1.00 0.00 ? 141 GLY A HA2  4  
ATOM 7299  H HA3  . GLY A 1 90  ? 9.197   -9.388  -12.614 1.00 0.00 ? 141 GLY A HA3  4  
ATOM 7300  N N    . ARG A 1 91  ? 10.975  -10.138 -10.259 1.00 0.00 ? 142 ARG A N    4  
ATOM 7301  C CA   . ARG A 1 91  ? 12.030  -9.714  -9.299  1.00 0.00 ? 142 ARG A CA   4  
ATOM 7302  C C    . ARG A 1 91  ? 12.894  -8.599  -9.887  1.00 0.00 ? 142 ARG A C    4  
ATOM 7303  O O    . ARG A 1 91  ? 13.454  -7.797  -9.169  1.00 0.00 ? 142 ARG A O    4  
ATOM 7304  C CB   . ARG A 1 91  ? 12.921  -10.903 -8.988  1.00 0.00 ? 142 ARG A CB   4  
ATOM 7305  C CG   . ARG A 1 91  ? 12.102  -12.002 -8.330  1.00 0.00 ? 142 ARG A CG   4  
ATOM 7306  C CD   . ARG A 1 91  ? 13.048  -13.143 -7.969  1.00 0.00 ? 142 ARG A CD   4  
ATOM 7307  N NE   . ARG A 1 91  ? 12.283  -14.326 -7.449  1.00 0.00 ? 142 ARG A NE   4  
ATOM 7308  C CZ   . ARG A 1 91  ? 11.517  -14.249 -6.392  1.00 0.00 ? 142 ARG A CZ   4  
ATOM 7309  N NH1  . ARG A 1 91  ? 11.500  -13.161 -5.669  1.00 0.00 ? 142 ARG A NH1  4  
ATOM 7310  N NH2  . ARG A 1 91  ? 10.808  -15.287 -6.027  1.00 0.00 ? 142 ARG A NH2  4  
ATOM 7311  H H    . ARG A 1 91  ? 10.963  -11.060 -10.594 1.00 0.00 ? 142 ARG A H    4  
ATOM 7312  H HA   . ARG A 1 91  ? 11.573  -9.366  -8.388  1.00 0.00 ? 142 ARG A HA   4  
ATOM 7313  H HB2  . ARG A 1 91  ? 13.347  -11.276 -9.906  1.00 0.00 ? 142 ARG A HB2  4  
ATOM 7314  H HB3  . ARG A 1 91  ? 13.711  -10.596 -8.322  1.00 0.00 ? 142 ARG A HB3  4  
ATOM 7315  H HG2  . ARG A 1 91  ? 11.625  -11.609 -7.446  1.00 0.00 ? 142 ARG A HG2  4  
ATOM 7316  H HG3  . ARG A 1 91  ? 11.354  -12.356 -9.022  1.00 0.00 ? 142 ARG A HG3  4  
ATOM 7317  H HD2  . ARG A 1 91  ? 13.557  -13.460 -8.854  1.00 0.00 ? 142 ARG A HD2  4  
ATOM 7318  H HD3  . ARG A 1 91  ? 13.786  -12.780 -7.251  1.00 0.00 ? 142 ARG A HD3  4  
ATOM 7319  H HE   . ARG A 1 91  ? 12.337  -15.177 -7.931  1.00 0.00 ? 142 ARG A HE   4  
ATOM 7320  H HH11 . ARG A 1 91  ? 12.078  -12.385 -5.921  1.00 0.00 ? 142 ARG A HH11 4  
ATOM 7321  H HH12 . ARG A 1 91  ? 10.912  -13.104 -4.862  1.00 0.00 ? 142 ARG A HH12 4  
ATOM 7322  H HH21 . ARG A 1 91  ? 10.852  -16.135 -6.559  1.00 0.00 ? 142 ARG A HH21 4  
ATOM 7323  H HH22 . ARG A 1 91  ? 10.227  -15.238 -5.213  1.00 0.00 ? 142 ARG A HH22 4  
ATOM 7324  N N    . GLY A 1 92  ? 13.049  -8.576  -11.182 1.00 0.00 ? 143 GLY A N    4  
ATOM 7325  C CA   . GLY A 1 92  ? 13.923  -7.543  -11.825 1.00 0.00 ? 143 GLY A CA   4  
ATOM 7326  C C    . GLY A 1 92  ? 13.083  -6.447  -12.477 1.00 0.00 ? 143 GLY A C    4  
ATOM 7327  O O    . GLY A 1 92  ? 13.116  -6.269  -13.677 1.00 0.00 ? 143 GLY A O    4  
ATOM 7328  H H    . GLY A 1 92  ? 12.609  -9.257  -11.734 1.00 0.00 ? 143 GLY A H    4  
ATOM 7329  H HA2  . GLY A 1 92  ? 14.578  -7.101  -11.086 1.00 0.00 ? 143 GLY A HA2  4  
ATOM 7330  H HA3  . GLY A 1 92  ? 14.524  -8.021  -12.585 1.00 0.00 ? 143 GLY A HA3  4  
ATOM 7331  N N    . LYS A 1 93  ? 12.338  -5.697  -11.705 1.00 0.00 ? 144 LYS A N    4  
ATOM 7332  C CA   . LYS A 1 93  ? 11.513  -4.604  -12.306 1.00 0.00 ? 144 LYS A CA   4  
ATOM 7333  C C    . LYS A 1 93  ? 11.475  -3.411  -11.354 1.00 0.00 ? 144 LYS A C    4  
ATOM 7334  O O    . LYS A 1 93  ? 11.610  -3.562  -10.157 1.00 0.00 ? 144 LYS A O    4  
ATOM 7335  C CB   . LYS A 1 93  ? 10.077  -5.089  -12.481 1.00 0.00 ? 144 LYS A CB   4  
ATOM 7336  C CG   . LYS A 1 93  ? 10.052  -6.342  -13.357 1.00 0.00 ? 144 LYS A CG   4  
ATOM 7337  C CD   . LYS A 1 93  ? 8.596   -6.758  -13.626 1.00 0.00 ? 144 LYS A CD   4  
ATOM 7338  C CE   . LYS A 1 93  ? 7.829   -6.957  -12.313 1.00 0.00 ? 144 LYS A CE   4  
ATOM 7339  N NZ   . LYS A 1 93  ? 7.295   -5.646  -11.860 1.00 0.00 ? 144 LYS A NZ   4  
ATOM 7340  H H    . LYS A 1 93  ? 12.327  -5.848  -10.736 1.00 0.00 ? 144 LYS A H    4  
ATOM 7341  H HA   . LYS A 1 93  ? 11.917  -4.303  -13.262 1.00 0.00 ? 144 LYS A HA   4  
ATOM 7342  H HB2  . LYS A 1 93  ? 9.656   -5.312  -11.512 1.00 0.00 ? 144 LYS A HB2  4  
ATOM 7343  H HB3  . LYS A 1 93  ? 9.497   -4.308  -12.957 1.00 0.00 ? 144 LYS A HB3  4  
ATOM 7344  H HG2  . LYS A 1 93  ? 10.543  -6.127  -14.295 1.00 0.00 ? 144 LYS A HG2  4  
ATOM 7345  H HG3  . LYS A 1 93  ? 10.571  -7.144  -12.854 1.00 0.00 ? 144 LYS A HG3  4  
ATOM 7346  H HD2  . LYS A 1 93  ? 8.110   -5.987  -14.200 1.00 0.00 ? 144 LYS A HD2  4  
ATOM 7347  H HD3  . LYS A 1 93  ? 8.587   -7.683  -14.185 1.00 0.00 ? 144 LYS A HD3  4  
ATOM 7348  H HE2  . LYS A 1 93  ? 7.016   -7.642  -12.468 1.00 0.00 ? 144 LYS A HE2  4  
ATOM 7349  H HE3  . LYS A 1 93  ? 8.480   -7.347  -11.565 1.00 0.00 ? 144 LYS A HE3  4  
ATOM 7350  H HZ1  . LYS A 1 93  ? 7.385   -4.960  -12.633 1.00 0.00 ? 144 LYS A HZ1  4  
ATOM 7351  H HZ2  . LYS A 1 93  ? 6.293   -5.743  -11.600 1.00 0.00 ? 144 LYS A HZ2  4  
ATOM 7352  H HZ3  . LYS A 1 93  ? 7.839   -5.318  -11.037 1.00 0.00 ? 144 LYS A HZ3  4  
ATOM 7353  N N    . SER A 1 94  ? 11.237  -2.231  -11.862 1.00 0.00 ? 145 SER A N    4  
ATOM 7354  C CA   . SER A 1 94  ? 11.133  -1.049  -10.962 1.00 0.00 ? 145 SER A CA   4  
ATOM 7355  C C    . SER A 1 94  ? 9.672   -0.933  -10.544 1.00 0.00 ? 145 SER A C    4  
ATOM 7356  O O    . SER A 1 94  ? 8.800   -0.753  -11.364 1.00 0.00 ? 145 SER A O    4  
ATOM 7357  C CB   . SER A 1 94  ? 11.546  0.209   -11.716 1.00 0.00 ? 145 SER A CB   4  
ATOM 7358  O OG   . SER A 1 94  ? 12.961  0.228   -11.848 1.00 0.00 ? 145 SER A OG   4  
ATOM 7359  H H    . SER A 1 94  ? 11.092  -2.129  -12.825 1.00 0.00 ? 145 SER A H    4  
ATOM 7360  H HA   . SER A 1 94  ? 11.761  -1.182  -10.089 1.00 0.00 ? 145 SER A HA   4  
ATOM 7361  H HB2  . SER A 1 94  ? 11.097  0.202   -12.694 1.00 0.00 ? 145 SER A HB2  4  
ATOM 7362  H HB3  . SER A 1 94  ? 11.209  1.081   -11.170 1.00 0.00 ? 145 SER A HB3  4  
ATOM 7363  H HG   . SER A 1 94  ? 13.215  1.072   -12.229 1.00 0.00 ? 145 SER A HG   4  
ATOM 7364  N N    . PHE A 1 95  ? 9.387   -1.070  -9.286  1.00 0.00 ? 146 PHE A N    4  
ATOM 7365  C CA   . PHE A 1 95  ? 7.973   -1.011  -8.827  1.00 0.00 ? 146 PHE A CA   4  
ATOM 7366  C C    . PHE A 1 95  ? 7.603   0.442   -8.488  1.00 0.00 ? 146 PHE A C    4  
ATOM 7367  O O    . PHE A 1 95  ? 8.304   1.119   -7.761  1.00 0.00 ? 146 PHE A O    4  
ATOM 7368  C CB   . PHE A 1 95  ? 7.882   -1.928  -7.599  1.00 0.00 ? 146 PHE A CB   4  
ATOM 7369  C CG   . PHE A 1 95  ? 6.472   -2.431  -7.393  1.00 0.00 ? 146 PHE A CG   4  
ATOM 7370  C CD1  . PHE A 1 95  ? 5.840   -3.191  -8.394  1.00 0.00 ? 146 PHE A CD1  4  
ATOM 7371  C CD2  . PHE A 1 95  ? 5.804   -2.154  -6.196  1.00 0.00 ? 146 PHE A CD2  4  
ATOM 7372  C CE1  . PHE A 1 95  ? 4.540   -3.667  -8.192  1.00 0.00 ? 146 PHE A CE1  4  
ATOM 7373  C CE2  . PHE A 1 95  ? 4.506   -2.625  -5.996  1.00 0.00 ? 146 PHE A CE2  4  
ATOM 7374  C CZ   . PHE A 1 95  ? 3.871   -3.385  -6.993  1.00 0.00 ? 146 PHE A CZ   4  
ATOM 7375  H H    . PHE A 1 95  ? 10.102  -1.243  -8.639  1.00 0.00 ? 146 PHE A H    4  
ATOM 7376  H HA   . PHE A 1 95  ? 7.312   -1.369  -9.604  1.00 0.00 ? 146 PHE A HA   4  
ATOM 7377  H HB2  . PHE A 1 95  ? 8.536   -2.782  -7.751  1.00 0.00 ? 146 PHE A HB2  4  
ATOM 7378  H HB3  . PHE A 1 95  ? 8.211   -1.389  -6.723  1.00 0.00 ? 146 PHE A HB3  4  
ATOM 7379  H HD1  . PHE A 1 95  ? 6.354   -3.413  -9.316  1.00 0.00 ? 146 PHE A HD1  4  
ATOM 7380  H HD2  . PHE A 1 95  ? 6.292   -1.573  -5.425  1.00 0.00 ? 146 PHE A HD2  4  
ATOM 7381  H HE1  . PHE A 1 95  ? 4.051   -4.249  -8.967  1.00 0.00 ? 146 PHE A HE1  4  
ATOM 7382  H HE2  . PHE A 1 95  ? 3.994   -2.405  -5.073  1.00 0.00 ? 146 PHE A HE2  4  
ATOM 7383  H HZ   . PHE A 1 95  ? 2.868   -3.754  -6.834  1.00 0.00 ? 146 PHE A HZ   4  
ATOM 7384  N N    . THR A 1 96  ? 6.514   0.933   -9.049  1.00 0.00 ? 147 THR A N    4  
ATOM 7385  C CA   . THR A 1 96  ? 6.089   2.355   -8.809  1.00 0.00 ? 147 THR A CA   4  
ATOM 7386  C C    . THR A 1 96  ? 4.663   2.416   -8.247  1.00 0.00 ? 147 THR A C    4  
ATOM 7387  O O    . THR A 1 96  ? 3.742   1.807   -8.775  1.00 0.00 ? 147 THR A O    4  
ATOM 7388  C CB   . THR A 1 96  ? 6.129   3.124   -10.143 1.00 0.00 ? 147 THR A CB   4  
ATOM 7389  O OG1  . THR A 1 96  ? 7.478   3.232   -10.594 1.00 0.00 ? 147 THR A OG1  4  
ATOM 7390  C CG2  . THR A 1 96  ? 5.527   4.521   -9.969  1.00 0.00 ? 147 THR A CG2  4  
ATOM 7391  H H    . THR A 1 96  ? 5.985   0.367   -9.650  1.00 0.00 ? 147 THR A H    4  
ATOM 7392  H HA   . THR A 1 96  ? 6.759   2.828   -8.106  1.00 0.00 ? 147 THR A HA   4  
ATOM 7393  H HB   . THR A 1 96  ? 5.555   2.589   -10.880 1.00 0.00 ? 147 THR A HB   4  
ATOM 7394  H HG1  . THR A 1 96  ? 7.683   4.166   -10.710 1.00 0.00 ? 147 THR A HG1  4  
ATOM 7395  H HG21 . THR A 1 96  ? 5.957   4.994   -9.100  1.00 0.00 ? 147 THR A HG21 4  
ATOM 7396  H HG22 . THR A 1 96  ? 5.737   5.113   -10.845 1.00 0.00 ? 147 THR A HG22 4  
ATOM 7397  H HG23 . THR A 1 96  ? 4.455   4.439   -9.845  1.00 0.00 ? 147 THR A HG23 4  
ATOM 7398  N N    . LEU A 1 97  ? 4.478   3.201   -7.208  1.00 0.00 ? 148 LEU A N    4  
ATOM 7399  C CA   . LEU A 1 97  ? 3.123   3.395   -6.598  1.00 0.00 ? 148 LEU A CA   4  
ATOM 7400  C C    . LEU A 1 97  ? 2.761   4.882   -6.663  1.00 0.00 ? 148 LEU A C    4  
ATOM 7401  O O    . LEU A 1 97  ? 3.602   5.737   -6.462  1.00 0.00 ? 148 LEU A O    4  
ATOM 7402  C CB   . LEU A 1 97  ? 3.129   2.971   -5.117  1.00 0.00 ? 148 LEU A CB   4  
ATOM 7403  C CG   . LEU A 1 97  ? 3.055   1.441   -4.969  1.00 0.00 ? 148 LEU A CG   4  
ATOM 7404  C CD1  . LEU A 1 97  ? 4.350   0.766   -5.483  1.00 0.00 ? 148 LEU A CD1  4  
ATOM 7405  C CD2  . LEU A 1 97  ? 2.837   1.093   -3.489  1.00 0.00 ? 148 LEU A CD2  4  
ATOM 7406  H H    . LEU A 1 97  ? 5.243   3.700   -6.847  1.00 0.00 ? 148 LEU A H    4  
ATOM 7407  H HA   . LEU A 1 97  ? 2.387   2.831   -7.138  1.00 0.00 ? 148 LEU A HA   4  
ATOM 7408  H HB2  . LEU A 1 97  ? 4.029   3.331   -4.654  1.00 0.00 ? 148 LEU A HB2  4  
ATOM 7409  H HB3  . LEU A 1 97  ? 2.275   3.412   -4.621  1.00 0.00 ? 148 LEU A HB3  4  
ATOM 7410  H HG   . LEU A 1 97  ? 2.217   1.077   -5.532  1.00 0.00 ? 148 LEU A HG   4  
ATOM 7411  H HD11 . LEU A 1 97  ? 5.160   1.484   -5.512  1.00 0.00 ? 148 LEU A HD11 4  
ATOM 7412  H HD12 . LEU A 1 97  ? 4.627   -0.051  -4.831  1.00 0.00 ? 148 LEU A HD12 4  
ATOM 7413  H HD13 . LEU A 1 97  ? 4.182   0.380   -6.477  1.00 0.00 ? 148 LEU A HD13 4  
ATOM 7414  H HD21 . LEU A 1 97  ? 2.043   1.707   -3.084  1.00 0.00 ? 148 LEU A HD21 4  
ATOM 7415  H HD22 . LEU A 1 97  ? 2.560   0.053   -3.406  1.00 0.00 ? 148 LEU A HD22 4  
ATOM 7416  H HD23 . LEU A 1 97  ? 3.750   1.268   -2.939  1.00 0.00 ? 148 LEU A HD23 4  
ATOM 7417  N N    . THR A 1 98  ? 1.510   5.200   -6.910  1.00 0.00 ? 149 THR A N    4  
ATOM 7418  C CA   . THR A 1 98  ? 1.087   6.637   -6.953  1.00 0.00 ? 149 THR A CA   4  
ATOM 7419  C C    . THR A 1 98  ? -0.277  6.779   -6.259  1.00 0.00 ? 149 THR A C    4  
ATOM 7420  O O    . THR A 1 98  ? -1.220  6.087   -6.584  1.00 0.00 ? 149 THR A O    4  
ATOM 7421  C CB   . THR A 1 98  ? 0.975   7.092   -8.414  1.00 0.00 ? 149 THR A CB   4  
ATOM 7422  O OG1  . THR A 1 98  ? 0.041   6.273   -9.098  1.00 0.00 ? 149 THR A OG1  4  
ATOM 7423  C CG2  . THR A 1 98  ? 2.342   6.977   -9.092  1.00 0.00 ? 149 THR A CG2  4  
ATOM 7424  H H    . THR A 1 98  ? 0.846   4.490   -7.049  1.00 0.00 ? 149 THR A H    4  
ATOM 7425  H HA   . THR A 1 98  ? 1.812   7.255   -6.439  1.00 0.00 ? 149 THR A HA   4  
ATOM 7426  H HB   . THR A 1 98  ? 0.646   8.118   -8.448  1.00 0.00 ? 149 THR A HB   4  
ATOM 7427  H HG1  . THR A 1 98  ? -0.255  6.747   -9.879  1.00 0.00 ? 149 THR A HG1  4  
ATOM 7428  H HG21 . THR A 1 98  ? 3.074   7.536   -8.527  1.00 0.00 ? 149 THR A HG21 4  
ATOM 7429  H HG22 . THR A 1 98  ? 2.633   5.939   -9.135  1.00 0.00 ? 149 THR A HG22 4  
ATOM 7430  H HG23 . THR A 1 98  ? 2.279   7.376   -10.094 1.00 0.00 ? 149 THR A HG23 4  
ATOM 7431  N N    . ILE A 1 99  ? -0.385  7.675   -5.306  1.00 0.00 ? 150 ILE A N    4  
ATOM 7432  C CA   . ILE A 1 99  ? -1.689  7.874   -4.580  1.00 0.00 ? 150 ILE A CA   4  
ATOM 7433  C C    . ILE A 1 99  ? -2.155  9.296   -4.783  1.00 0.00 ? 150 ILE A C    4  
ATOM 7434  O O    . ILE A 1 99  ? -1.396  10.231  -4.628  1.00 0.00 ? 150 ILE A O    4  
ATOM 7435  C CB   . ILE A 1 99  ? -1.509  7.669   -3.077  1.00 0.00 ? 150 ILE A CB   4  
ATOM 7436  C CG1  . ILE A 1 99  ? -0.928  6.279   -2.823  1.00 0.00 ? 150 ILE A CG1  4  
ATOM 7437  C CG2  . ILE A 1 99  ? -2.878  7.807   -2.368  1.00 0.00 ? 150 ILE A CG2  4  
ATOM 7438  C CD1  . ILE A 1 99  ? -0.544  6.119   -1.343  1.00 0.00 ? 150 ILE A CD1  4  
ATOM 7439  H H    . ILE A 1 99  ? 0.391   8.220   -5.064  1.00 0.00 ? 150 ILE A H    4  
ATOM 7440  H HA   . ILE A 1 99  ? -2.437  7.191   -4.953  1.00 0.00 ? 150 ILE A HA   4  
ATOM 7441  H HB   . ILE A 1 99  ? -0.840  8.421   -2.698  1.00 0.00 ? 150 ILE A HB   4  
ATOM 7442  H HG12 . ILE A 1 99  ? -1.661  5.537   -3.086  1.00 0.00 ? 150 ILE A HG12 4  
ATOM 7443  H HG13 . ILE A 1 99  ? -0.047  6.147   -3.435  1.00 0.00 ? 150 ILE A HG13 4  
ATOM 7444  H HG21 . ILE A 1 99  ? -3.665  7.427   -3.003  1.00 0.00 ? 150 ILE A HG21 4  
ATOM 7445  H HG22 . ILE A 1 99  ? -2.866  7.249   -1.445  1.00 0.00 ? 150 ILE A HG22 4  
ATOM 7446  H HG23 . ILE A 1 99  ? -3.067  8.848   -2.153  1.00 0.00 ? 150 ILE A HG23 4  
ATOM 7447  H HD11 . ILE A 1 99  ? -1.182  6.735   -0.723  1.00 0.00 ? 150 ILE A HD11 4  
ATOM 7448  H HD12 . ILE A 1 99  ? -0.659  5.085   -1.057  1.00 0.00 ? 150 ILE A HD12 4  
ATOM 7449  H HD13 . ILE A 1 99  ? 0.483   6.417   -1.206  1.00 0.00 ? 150 ILE A HD13 4  
ATOM 7450  N N    . THR A 1 100 ? -3.400  9.480   -5.109  1.00 0.00 ? 151 THR A N    4  
ATOM 7451  C CA   . THR A 1 100 ? -3.923  10.860  -5.297  1.00 0.00 ? 151 THR A CA   4  
ATOM 7452  C C    . THR A 1 100 ? -5.271  10.978  -4.615  1.00 0.00 ? 151 THR A C    4  
ATOM 7453  O O    . THR A 1 100 ? -6.070  10.062  -4.630  1.00 0.00 ? 151 THR A O    4  
ATOM 7454  C CB   . THR A 1 100 ? -4.085  11.167  -6.781  1.00 0.00 ? 151 THR A CB   4  
ATOM 7455  O OG1  . THR A 1 100 ? -4.950  10.208  -7.377  1.00 0.00 ? 151 THR A OG1  4  
ATOM 7456  C CG2  . THR A 1 100 ? -2.724  11.146  -7.472  1.00 0.00 ? 151 THR A CG2  4  
ATOM 7457  H H    . THR A 1 100 ? -3.999  8.709   -5.213  1.00 0.00 ? 151 THR A H    4  
ATOM 7458  H HA   . THR A 1 100 ? -3.246  11.580  -4.857  1.00 0.00 ? 151 THR A HA   4  
ATOM 7459  H HB   . THR A 1 100 ? -4.517  12.149  -6.886  1.00 0.00 ? 151 THR A HB   4  
ATOM 7460  H HG1  . THR A 1 100 ? -5.821  10.310  -6.987  1.00 0.00 ? 151 THR A HG1  4  
ATOM 7461  H HG21 . THR A 1 100 ? -2.174  10.268  -7.170  1.00 0.00 ? 151 THR A HG21 4  
ATOM 7462  H HG22 . THR A 1 100 ? -2.865  11.128  -8.542  1.00 0.00 ? 151 THR A HG22 4  
ATOM 7463  H HG23 . THR A 1 100 ? -2.171  12.032  -7.195  1.00 0.00 ? 151 THR A HG23 4  
ATOM 7464  N N    . VAL A 1 101 ? -5.532  12.111  -4.024  1.00 0.00 ? 152 VAL A N    4  
ATOM 7465  C CA   . VAL A 1 101 ? -6.838  12.326  -3.335  1.00 0.00 ? 152 VAL A CA   4  
ATOM 7466  C C    . VAL A 1 101 ? -7.431  13.642  -3.805  1.00 0.00 ? 152 VAL A C    4  
ATOM 7467  O O    . VAL A 1 101 ? -6.749  14.652  -3.864  1.00 0.00 ? 152 VAL A O    4  
ATOM 7468  C CB   . VAL A 1 101 ? -6.604  12.382  -1.835  1.00 0.00 ? 152 VAL A CB   4  
ATOM 7469  C CG1  . VAL A 1 101 ? -7.954  12.352  -1.102  1.00 0.00 ? 152 VAL A CG1  4  
ATOM 7470  C CG2  . VAL A 1 101 ? -5.734  11.180  -1.421  1.00 0.00 ? 152 VAL A CG2  4  
ATOM 7471  H H    . VAL A 1 101 ? -4.861  12.826  -4.034  1.00 0.00 ? 152 VAL A H    4  
ATOM 7472  H HA   . VAL A 1 101 ? -7.524  11.523  -3.563  1.00 0.00 ? 152 VAL A HA   4  
ATOM 7473  H HB   . VAL A 1 101 ? -6.091  13.306  -1.596  1.00 0.00 ? 152 VAL A HB   4  
ATOM 7474  H HG11 . VAL A 1 101 ? -8.630  13.058  -1.559  1.00 0.00 ? 152 VAL A HG11 4  
ATOM 7475  H HG12 . VAL A 1 101 ? -8.376  11.359  -1.164  1.00 0.00 ? 152 VAL A HG12 4  
ATOM 7476  H HG13 . VAL A 1 101 ? -7.806  12.615  -0.064  1.00 0.00 ? 152 VAL A HG13 4  
ATOM 7477  H HG21 . VAL A 1 101 ? -5.906  10.345  -2.092  1.00 0.00 ? 152 VAL A HG21 4  
ATOM 7478  H HG22 . VAL A 1 101 ? -4.693  11.459  -1.465  1.00 0.00 ? 152 VAL A HG22 4  
ATOM 7479  H HG23 . VAL A 1 101 ? -5.982  10.879  -0.417  1.00 0.00 ? 152 VAL A HG23 4  
ATOM 7480  N N    . PHE A 1 102 ? -8.692  13.639  -4.150  1.00 0.00 ? 153 PHE A N    4  
ATOM 7481  C CA   . PHE A 1 102 ? -9.348  14.888  -4.640  1.00 0.00 ? 153 PHE A CA   4  
ATOM 7482  C C    . PHE A 1 102 ? -10.203 15.516  -3.532  1.00 0.00 ? 153 PHE A C    4  
ATOM 7483  O O    . PHE A 1 102 ? -11.383 15.745  -3.703  1.00 0.00 ? 153 PHE A O    4  
ATOM 7484  C CB   . PHE A 1 102 ? -10.212 14.543  -5.856  1.00 0.00 ? 153 PHE A CB   4  
ATOM 7485  C CG   . PHE A 1 102 ? -9.476  13.532  -6.695  1.00 0.00 ? 153 PHE A CG   4  
ATOM 7486  C CD1  . PHE A 1 102 ? -8.478  13.953  -7.582  1.00 0.00 ? 153 PHE A CD1  4  
ATOM 7487  C CD2  . PHE A 1 102 ? -9.794  12.174  -6.591  1.00 0.00 ? 153 PHE A CD2  4  
ATOM 7488  C CE1  . PHE A 1 102 ? -7.795  13.012  -8.364  1.00 0.00 ? 153 PHE A CE1  4  
ATOM 7489  C CE2  . PHE A 1 102 ? -9.112  11.236  -7.374  1.00 0.00 ? 153 PHE A CE2  4  
ATOM 7490  C CZ   . PHE A 1 102 ? -8.115  11.656  -8.259  1.00 0.00 ? 153 PHE A CZ   4  
ATOM 7491  H H    . PHE A 1 102 ? -9.210  12.806  -4.096  1.00 0.00 ? 153 PHE A H    4  
ATOM 7492  H HA   . PHE A 1 102 ? -8.590  15.597  -4.946  1.00 0.00 ? 153 PHE A HA   4  
ATOM 7493  H HB2  . PHE A 1 102 ? -11.160 14.132  -5.536  1.00 0.00 ? 153 PHE A HB2  4  
ATOM 7494  H HB3  . PHE A 1 102 ? -10.383 15.434  -6.440  1.00 0.00 ? 153 PHE A HB3  4  
ATOM 7495  H HD1  . PHE A 1 102 ? -8.233  15.003  -7.661  1.00 0.00 ? 153 PHE A HD1  4  
ATOM 7496  H HD2  . PHE A 1 102 ? -10.558 11.851  -5.902  1.00 0.00 ? 153 PHE A HD2  4  
ATOM 7497  H HE1  . PHE A 1 102 ? -7.023  13.334  -9.047  1.00 0.00 ? 153 PHE A HE1  4  
ATOM 7498  H HE2  . PHE A 1 102 ? -9.357  10.186  -7.296  1.00 0.00 ? 153 PHE A HE2  4  
ATOM 7499  H HZ   . PHE A 1 102 ? -7.591  10.932  -8.864  1.00 0.00 ? 153 PHE A HZ   4  
ATOM 7500  N N    . THR A 1 103 ? -9.614  15.818  -2.402  1.00 0.00 ? 154 THR A N    4  
ATOM 7501  C CA   . THR A 1 103 ? -10.391 16.452  -1.295  1.00 0.00 ? 154 THR A CA   4  
ATOM 7502  C C    . THR A 1 103 ? -10.360 17.971  -1.514  1.00 0.00 ? 154 THR A C    4  
ATOM 7503  O O    . THR A 1 103 ? -10.383 18.430  -2.640  1.00 0.00 ? 154 THR A O    4  
ATOM 7504  C CB   . THR A 1 103 ? -9.728  16.076  0.045   1.00 0.00 ? 154 THR A CB   4  
ATOM 7505  O OG1  . THR A 1 103 ? -10.056 17.031  1.050   1.00 0.00 ? 154 THR A OG1  4  
ATOM 7506  C CG2  . THR A 1 103 ? -8.201  16.016  -0.140  1.00 0.00 ? 154 THR A CG2  4  
ATOM 7507  H H    . THR A 1 103 ? -8.655  15.635  -2.280  1.00 0.00 ? 154 THR A H    4  
ATOM 7508  H HA   . THR A 1 103 ? -11.415 16.102  -1.313  1.00 0.00 ? 154 THR A HA   4  
ATOM 7509  H HB   . THR A 1 103 ? -10.084 15.105  0.352   1.00 0.00 ? 154 THR A HB   4  
ATOM 7510  H HG1  . THR A 1 103 ? -10.997 16.966  1.232   1.00 0.00 ? 154 THR A HG1  4  
ATOM 7511  H HG21 . THR A 1 103 ? -7.885  16.787  -0.827  1.00 0.00 ? 154 THR A HG21 4  
ATOM 7512  H HG22 . THR A 1 103 ? -7.709  16.166  0.809   1.00 0.00 ? 154 THR A HG22 4  
ATOM 7513  H HG23 . THR A 1 103 ? -7.924  15.051  -0.536  1.00 0.00 ? 154 THR A HG23 4  
ATOM 7514  N N    . ASN A 1 104 ? -10.307 18.768  -0.479  1.00 0.00 ? 155 ASN A N    4  
ATOM 7515  C CA   . ASN A 1 104 ? -10.276 20.247  -0.704  1.00 0.00 ? 155 ASN A CA   4  
ATOM 7516  C C    . ASN A 1 104 ? -8.839  20.641  -1.081  1.00 0.00 ? 155 ASN A C    4  
ATOM 7517  O O    . ASN A 1 104 ? -8.635  21.299  -2.074  1.00 0.00 ? 155 ASN A O    4  
ATOM 7518  C CB   . ASN A 1 104 ? -10.757 21.000  0.562   1.00 0.00 ? 155 ASN A CB   4  
ATOM 7519  C CG   . ASN A 1 104 ? -12.044 21.777  0.270   1.00 0.00 ? 155 ASN A CG   4  
ATOM 7520  O OD1  . ASN A 1 104 ? -13.127 21.336  0.597   1.00 0.00 ? 155 ASN A OD1  4  
ATOM 7521  N ND2  . ASN A 1 104 ? -11.960 22.925  -0.344  1.00 0.00 ? 155 ASN A ND2  4  
ATOM 7522  H H    . ASN A 1 104 ? -10.290 18.401  0.431   1.00 0.00 ? 155 ASN A H    4  
ATOM 7523  H HA   . ASN A 1 104 ? -10.922 20.483  -1.542  1.00 0.00 ? 155 ASN A HA   4  
ATOM 7524  H HB2  . ASN A 1 104 ? -10.952 20.285  1.349   1.00 0.00 ? 155 ASN A HB2  4  
ATOM 7525  H HB3  . ASN A 1 104 ? -9.998  21.694  0.890   1.00 0.00 ? 155 ASN A HB3  4  
ATOM 7526  H HD21 . ASN A 1 104 ? -11.085 23.277  -0.608  1.00 0.00 ? 155 ASN A HD21 4  
ATOM 7527  H HD22 . ASN A 1 104 ? -12.773 23.436  -0.540  1.00 0.00 ? 155 ASN A HD22 4  
ATOM 7528  N N    . PRO A 1 105 ? -7.852  20.206  -0.340  1.00 0.00 ? 156 PRO A N    4  
ATOM 7529  C CA   . PRO A 1 105 ? -6.423  20.459  -0.664  1.00 0.00 ? 156 PRO A CA   4  
ATOM 7530  C C    . PRO A 1 105 ? -5.772  19.221  -1.325  1.00 0.00 ? 156 PRO A C    4  
ATOM 7531  O O    . PRO A 1 105 ? -4.956  18.566  -0.712  1.00 0.00 ? 156 PRO A O    4  
ATOM 7532  C CB   . PRO A 1 105 ? -5.855  20.668  0.736   1.00 0.00 ? 156 PRO A CB   4  
ATOM 7533  C CG   . PRO A 1 105 ? -6.555  19.629  1.558   1.00 0.00 ? 156 PRO A CG   4  
ATOM 7534  C CD   . PRO A 1 105 ? -7.957  19.468  0.933   1.00 0.00 ? 156 PRO A CD   4  
ATOM 7535  H HA   . PRO A 1 105 ? -6.295  21.345  -1.256  1.00 0.00 ? 156 PRO A HA   4  
ATOM 7536  H HB2  . PRO A 1 105 ? -4.783  20.515  0.749   1.00 0.00 ? 156 PRO A HB2  4  
ATOM 7537  H HB3  . PRO A 1 105 ? -6.108  21.652  1.099   1.00 0.00 ? 156 PRO A HB3  4  
ATOM 7538  H HG2  . PRO A 1 105 ? -6.011  18.693  1.512   1.00 0.00 ? 156 PRO A HG2  4  
ATOM 7539  H HG3  . PRO A 1 105 ? -6.644  19.961  2.582   1.00 0.00 ? 156 PRO A HG3  4  
ATOM 7540  H HD2  . PRO A 1 105 ? -8.186  18.433  0.764   1.00 0.00 ? 156 PRO A HD2  4  
ATOM 7541  H HD3  . PRO A 1 105 ? -8.692  19.917  1.567   1.00 0.00 ? 156 PRO A HD3  4  
ATOM 7542  N N    . PRO A 1 106 ? -6.138  18.882  -2.556  1.00 0.00 ? 157 PRO A N    4  
ATOM 7543  C CA   . PRO A 1 106 ? -5.596  17.692  -3.262  1.00 0.00 ? 157 PRO A CA   4  
ATOM 7544  C C    . PRO A 1 106 ? -4.185  17.325  -2.823  1.00 0.00 ? 157 PRO A C    4  
ATOM 7545  O O    . PRO A 1 106 ? -3.249  18.074  -3.024  1.00 0.00 ? 157 PRO A O    4  
ATOM 7546  C CB   . PRO A 1 106 ? -5.601  18.133  -4.716  1.00 0.00 ? 157 PRO A CB   4  
ATOM 7547  C CG   . PRO A 1 106 ? -6.781  19.050  -4.842  1.00 0.00 ? 157 PRO A CG   4  
ATOM 7548  C CD   . PRO A 1 106 ? -7.096  19.582  -3.427  1.00 0.00 ? 157 PRO A CD   4  
ATOM 7549  H HA   . PRO A 1 106 ? -6.261  16.853  -3.138  1.00 0.00 ? 157 PRO A HA   4  
ATOM 7550  H HB2  . PRO A 1 106 ? -4.683  18.663  -4.945  1.00 0.00 ? 157 PRO A HB2  4  
ATOM 7551  H HB3  . PRO A 1 106 ? -5.714  17.279  -5.366  1.00 0.00 ? 157 PRO A HB3  4  
ATOM 7552  H HG2  . PRO A 1 106 ? -6.540  19.871  -5.509  1.00 0.00 ? 157 PRO A HG2  4  
ATOM 7553  H HG3  . PRO A 1 106 ? -7.632  18.504  -5.225  1.00 0.00 ? 157 PRO A HG3  4  
ATOM 7554  H HD2  . PRO A 1 106 ? -6.939  20.649  -3.386  1.00 0.00 ? 157 PRO A HD2  4  
ATOM 7555  H HD3  . PRO A 1 106 ? -8.107  19.323  -3.151  1.00 0.00 ? 157 PRO A HD3  4  
ATOM 7556  N N    . GLN A 1 107 ? -4.031  16.178  -2.225  1.00 0.00 ? 158 GLN A N    4  
ATOM 7557  C CA   . GLN A 1 107 ? -2.677  15.742  -1.755  1.00 0.00 ? 158 GLN A CA   4  
ATOM 7558  C C    . GLN A 1 107 ? -2.068  14.740  -2.730  1.00 0.00 ? 158 GLN A C    4  
ATOM 7559  O O    . GLN A 1 107 ? -2.737  13.851  -3.220  1.00 0.00 ? 158 GLN A O    4  
ATOM 7560  C CB   . GLN A 1 107 ? -2.814  15.083  -0.388  1.00 0.00 ? 158 GLN A CB   4  
ATOM 7561  C CG   . GLN A 1 107 ? -3.310  16.114  0.627   1.00 0.00 ? 158 GLN A CG   4  
ATOM 7562  C CD   . GLN A 1 107 ? -2.225  17.172  0.864   1.00 0.00 ? 158 GLN A CD   4  
ATOM 7563  O OE1  . GLN A 1 107 ? -1.047  16.890  0.739   1.00 0.00 ? 158 GLN A OE1  4  
ATOM 7564  N NE2  . GLN A 1 107 ? -2.571  18.377  1.230   1.00 0.00 ? 158 GLN A NE2  4  
ATOM 7565  H H    . GLN A 1 107 ? -4.814  15.595  -2.084  1.00 0.00 ? 158 GLN A H    4  
ATOM 7566  H HA   . GLN A 1 107 ? -2.019  16.597  -1.668  1.00 0.00 ? 158 GLN A HA   4  
ATOM 7567  H HB2  . GLN A 1 107 ? -3.522  14.268  -0.452  1.00 0.00 ? 158 GLN A HB2  4  
ATOM 7568  H HB3  . GLN A 1 107 ? -1.855  14.701  -0.075  1.00 0.00 ? 158 GLN A HB3  4  
ATOM 7569  H HG2  . GLN A 1 107 ? -4.198  16.591  0.245   1.00 0.00 ? 158 GLN A HG2  4  
ATOM 7570  H HG3  . GLN A 1 107 ? -3.539  15.627  1.556   1.00 0.00 ? 158 GLN A HG3  4  
ATOM 7571  H HE21 . GLN A 1 107 ? -3.517  18.598  1.353   1.00 0.00 ? 158 GLN A HE21 4  
ATOM 7572  H HE22 . GLN A 1 107 ? -1.884  19.063  1.380   1.00 0.00 ? 158 GLN A HE22 4  
ATOM 7573  N N    . VAL A 1 108 ? -0.789  14.857  -2.983  1.00 0.00 ? 159 VAL A N    4  
ATOM 7574  C CA   . VAL A 1 108 ? -0.110  13.894  -3.898  1.00 0.00 ? 159 VAL A CA   4  
ATOM 7575  C C    . VAL A 1 108 ? 0.800   13.003  -3.061  1.00 0.00 ? 159 VAL A C    4  
ATOM 7576  O O    . VAL A 1 108 ? 1.623   13.480  -2.306  1.00 0.00 ? 159 VAL A O    4  
ATOM 7577  C CB   . VAL A 1 108 ? 0.744   14.655  -4.920  1.00 0.00 ? 159 VAL A CB   4  
ATOM 7578  C CG1  . VAL A 1 108 ? 1.327   13.661  -5.922  1.00 0.00 ? 159 VAL A CG1  4  
ATOM 7579  C CG2  . VAL A 1 108 ? -0.123  15.668  -5.662  1.00 0.00 ? 159 VAL A CG2  4  
ATOM 7580  H H    . VAL A 1 108 ? -0.271  15.568  -2.552  1.00 0.00 ? 159 VAL A H    4  
ATOM 7581  H HA   . VAL A 1 108 ? -0.835  13.286  -4.418  1.00 0.00 ? 159 VAL A HA   4  
ATOM 7582  H HB   . VAL A 1 108 ? 1.549   15.168  -4.410  1.00 0.00 ? 159 VAL A HB   4  
ATOM 7583  H HG11 . VAL A 1 108 ? 1.930   12.933  -5.400  1.00 0.00 ? 159 VAL A HG11 4  
ATOM 7584  H HG12 . VAL A 1 108 ? 0.523   13.158  -6.438  1.00 0.00 ? 159 VAL A HG12 4  
ATOM 7585  H HG13 . VAL A 1 108 ? 1.940   14.189  -6.639  1.00 0.00 ? 159 VAL A HG13 4  
ATOM 7586  H HG21 . VAL A 1 108 ? -0.614  16.311  -4.949  1.00 0.00 ? 159 VAL A HG21 4  
ATOM 7587  H HG22 . VAL A 1 108 ? 0.498   16.262  -6.316  1.00 0.00 ? 159 VAL A HG22 4  
ATOM 7588  H HG23 . VAL A 1 108 ? -0.866  15.144  -6.247  1.00 0.00 ? 159 VAL A HG23 4  
ATOM 7589  N N    . ALA A 1 109 ? 0.665   11.708  -3.191  1.00 0.00 ? 160 ALA A N    4  
ATOM 7590  C CA   . ALA A 1 109 ? 1.531   10.780  -2.399  1.00 0.00 ? 160 ALA A CA   4  
ATOM 7591  C C    . ALA A 1 109 ? 1.976   9.609   -3.291  1.00 0.00 ? 160 ALA A C    4  
ATOM 7592  O O    . ALA A 1 109 ? 1.160   8.944   -3.898  1.00 0.00 ? 160 ALA A O    4  
ATOM 7593  C CB   . ALA A 1 109 ? 0.727   10.255  -1.197  1.00 0.00 ? 160 ALA A CB   4  
ATOM 7594  H H    . ALA A 1 109 ? -0.009  11.343  -3.811  1.00 0.00 ? 160 ALA A H    4  
ATOM 7595  H HA   . ALA A 1 109 ? 2.408   11.306  -2.044  1.00 0.00 ? 160 ALA A HA   4  
ATOM 7596  H HB1  . ALA A 1 109 ? -0.327  10.300  -1.426  1.00 0.00 ? 160 ALA A HB1  4  
ATOM 7597  H HB2  . ALA A 1 109 ? 1.004   9.234   -0.982  1.00 0.00 ? 160 ALA A HB2  4  
ATOM 7598  H HB3  . ALA A 1 109 ? 0.929   10.866  -0.327  1.00 0.00 ? 160 ALA A HB3  4  
ATOM 7599  N N    . THR A 1 110 ? 3.266   9.348   -3.366  1.00 0.00 ? 161 THR A N    4  
ATOM 7600  C CA   . THR A 1 110 ? 3.760   8.214   -4.216  1.00 0.00 ? 161 THR A CA   4  
ATOM 7601  C C    . THR A 1 110 ? 4.888   7.466   -3.497  1.00 0.00 ? 161 THR A C    4  
ATOM 7602  O O    . THR A 1 110 ? 5.563   8.006   -2.642  1.00 0.00 ? 161 THR A O    4  
ATOM 7603  C CB   . THR A 1 110 ? 4.290   8.772   -5.543  1.00 0.00 ? 161 THR A CB   4  
ATOM 7604  O OG1  . THR A 1 110 ? 5.579   9.341   -5.347  1.00 0.00 ? 161 THR A OG1  4  
ATOM 7605  C CG2  . THR A 1 110 ? 3.329   9.845   -6.055  1.00 0.00 ? 161 THR A CG2  4  
ATOM 7606  H H    . THR A 1 110 ? 3.905   9.894   -2.863  1.00 0.00 ? 161 THR A H    4  
ATOM 7607  H HA   . THR A 1 110 ? 2.951   7.526   -4.415  1.00 0.00 ? 161 THR A HA   4  
ATOM 7608  H HB   . THR A 1 110 ? 4.354   7.976   -6.267  1.00 0.00 ? 161 THR A HB   4  
ATOM 7609  H HG1  . THR A 1 110 ? 6.159   9.012   -6.043  1.00 0.00 ? 161 THR A HG1  4  
ATOM 7610  H HG21 . THR A 1 110 ? 2.318   9.473   -6.004  1.00 0.00 ? 161 THR A HG21 4  
ATOM 7611  H HG22 . THR A 1 110 ? 3.415   10.731  -5.443  1.00 0.00 ? 161 THR A HG22 4  
ATOM 7612  H HG23 . THR A 1 110 ? 3.570   10.090  -7.079  1.00 0.00 ? 161 THR A HG23 4  
ATOM 7613  N N    . TYR A 1 111 ? 5.105   6.220   -3.859  1.00 0.00 ? 162 TYR A N    4  
ATOM 7614  C CA   . TYR A 1 111 ? 6.196   5.404   -3.232  1.00 0.00 ? 162 TYR A CA   4  
ATOM 7615  C C    . TYR A 1 111 ? 6.888   4.574   -4.330  1.00 0.00 ? 162 TYR A C    4  
ATOM 7616  O O    . TYR A 1 111 ? 6.247   3.846   -5.060  1.00 0.00 ? 162 TYR A O    4  
ATOM 7617  C CB   . TYR A 1 111 ? 5.580   4.480   -2.163  1.00 0.00 ? 162 TYR A CB   4  
ATOM 7618  C CG   . TYR A 1 111 ? 6.562   3.398   -1.763  1.00 0.00 ? 162 TYR A CG   4  
ATOM 7619  C CD1  . TYR A 1 111 ? 6.679   2.242   -2.547  1.00 0.00 ? 162 TYR A CD1  4  
ATOM 7620  C CD2  . TYR A 1 111 ? 7.343   3.542   -0.609  1.00 0.00 ? 162 TYR A CD2  4  
ATOM 7621  C CE1  . TYR A 1 111 ? 7.579   1.238   -2.182  1.00 0.00 ? 162 TYR A CE1  4  
ATOM 7622  C CE2  . TYR A 1 111 ? 8.241   2.531   -0.241  1.00 0.00 ? 162 TYR A CE2  4  
ATOM 7623  C CZ   . TYR A 1 111 ? 8.360   1.379   -1.030  1.00 0.00 ? 162 TYR A CZ   4  
ATOM 7624  O OH   . TYR A 1 111 ? 9.233   0.376   -0.659  1.00 0.00 ? 162 TYR A OH   4  
ATOM 7625  H H    . TYR A 1 111 ? 4.546   5.819   -4.560  1.00 0.00 ? 162 TYR A H    4  
ATOM 7626  H HA   . TYR A 1 111 ? 6.922   6.059   -2.770  1.00 0.00 ? 162 TYR A HA   4  
ATOM 7627  H HB2  . TYR A 1 111 ? 5.323   5.064   -1.291  1.00 0.00 ? 162 TYR A HB2  4  
ATOM 7628  H HB3  . TYR A 1 111 ? 4.688   4.022   -2.557  1.00 0.00 ? 162 TYR A HB3  4  
ATOM 7629  H HD1  . TYR A 1 111 ? 6.074   2.124   -3.435  1.00 0.00 ? 162 TYR A HD1  4  
ATOM 7630  H HD2  . TYR A 1 111 ? 7.251   4.429   -0.003  1.00 0.00 ? 162 TYR A HD2  4  
ATOM 7631  H HE1  . TYR A 1 111 ? 7.674   0.353   -2.796  1.00 0.00 ? 162 TYR A HE1  4  
ATOM 7632  H HE2  . TYR A 1 111 ? 8.847   2.641   0.648   1.00 0.00 ? 162 TYR A HE2  4  
ATOM 7633  H HH   . TYR A 1 111 ? 8.730   -0.286  -0.177  1.00 0.00 ? 162 TYR A HH   4  
ATOM 7634  N N    . HIS A 1 112 ? 8.192   4.670   -4.454  1.00 0.00 ? 163 HIS A N    4  
ATOM 7635  C CA   . HIS A 1 112 ? 8.920   3.876   -5.504  1.00 0.00 ? 163 HIS A CA   4  
ATOM 7636  C C    . HIS A 1 112 ? 10.096  3.155   -4.865  1.00 0.00 ? 163 HIS A C    4  
ATOM 7637  O O    . HIS A 1 112 ? 10.748  3.674   -3.980  1.00 0.00 ? 163 HIS A O    4  
ATOM 7638  C CB   . HIS A 1 112 ? 9.428   4.803   -6.613  1.00 0.00 ? 163 HIS A CB   4  
ATOM 7639  C CG   . HIS A 1 112 ? 10.458  5.762   -6.065  1.00 0.00 ? 163 HIS A CG   4  
ATOM 7640  N ND1  . HIS A 1 112 ? 10.110  6.996   -5.540  1.00 0.00 ? 163 HIS A ND1  4  
ATOM 7641  C CD2  . HIS A 1 112 ? 11.828  5.683   -5.961  1.00 0.00 ? 163 HIS A CD2  4  
ATOM 7642  C CE1  . HIS A 1 112 ? 11.243  7.608   -5.144  1.00 0.00 ? 163 HIS A CE1  4  
ATOM 7643  N NE2  . HIS A 1 112 ? 12.320  6.852   -5.379  1.00 0.00 ? 163 HIS A NE2  4  
ATOM 7644  H H    . HIS A 1 112 ? 8.695   5.259   -3.851  1.00 0.00 ? 163 HIS A H    4  
ATOM 7645  H HA   . HIS A 1 112 ? 8.258   3.136   -5.938  1.00 0.00 ? 163 HIS A HA   4  
ATOM 7646  H HB2  . HIS A 1 112 ? 9.871   4.209   -7.399  1.00 0.00 ? 163 HIS A HB2  4  
ATOM 7647  H HB3  . HIS A 1 112 ? 8.596   5.362   -7.012  1.00 0.00 ? 163 HIS A HB3  4  
ATOM 7648  H HD1  . HIS A 1 112 ? 9.205   7.368   -5.485  1.00 0.00 ? 163 HIS A HD1  4  
ATOM 7649  H HD2  . HIS A 1 112 ? 12.433  4.851   -6.290  1.00 0.00 ? 163 HIS A HD2  4  
ATOM 7650  H HE1  . HIS A 1 112 ? 11.276  8.587   -4.687  1.00 0.00 ? 163 HIS A HE1  4  
ATOM 7651  N N    . ARG A 1 113 ? 10.358  1.952   -5.304  1.00 0.00 ? 164 ARG A N    4  
ATOM 7652  C CA   . ARG A 1 113 ? 11.482  1.162   -4.733  1.00 0.00 ? 164 ARG A CA   4  
ATOM 7653  C C    . ARG A 1 113 ? 11.489  -0.222  -5.388  1.00 0.00 ? 164 ARG A C    4  
ATOM 7654  O O    . ARG A 1 113 ? 10.698  -0.517  -6.263  1.00 0.00 ? 164 ARG A O    4  
ATOM 7655  C CB   . ARG A 1 113 ? 11.281  1.031   -3.201  1.00 0.00 ? 164 ARG A CB   4  
ATOM 7656  C CG   . ARG A 1 113 ? 12.410  1.737   -2.442  1.00 0.00 ? 164 ARG A CG   4  
ATOM 7657  C CD   . ARG A 1 113 ? 13.666  0.862   -2.482  1.00 0.00 ? 164 ARG A CD   4  
ATOM 7658  N NE   . ARG A 1 113 ? 14.744  1.519   -1.702  1.00 0.00 ? 164 ARG A NE   4  
ATOM 7659  C CZ   . ARG A 1 113 ? 15.811  0.847   -1.384  1.00 0.00 ? 164 ARG A CZ   4  
ATOM 7660  N NH1  . ARG A 1 113 ? 15.909  -0.407  -1.731  1.00 0.00 ? 164 ARG A NH1  4  
ATOM 7661  N NH2  . ARG A 1 113 ? 16.775  1.422   -0.720  1.00 0.00 ? 164 ARG A NH2  4  
ATOM 7662  H H    . ARG A 1 113 ? 9.808   1.564   -6.014  1.00 0.00 ? 164 ARG A H    4  
ATOM 7663  H HA   . ARG A 1 113 ? 12.415  1.660   -4.954  1.00 0.00 ? 164 ARG A HA   4  
ATOM 7664  H HB2  . ARG A 1 113 ? 10.341  1.481   -2.924  1.00 0.00 ? 164 ARG A HB2  4  
ATOM 7665  H HB3  . ARG A 1 113 ? 11.266  -0.012  -2.915  1.00 0.00 ? 164 ARG A HB3  4  
ATOM 7666  H HG2  . ARG A 1 113 ? 12.618  2.694   -2.901  1.00 0.00 ? 164 ARG A HG2  4  
ATOM 7667  H HG3  . ARG A 1 113 ? 12.113  1.887   -1.418  1.00 0.00 ? 164 ARG A HG3  4  
ATOM 7668  H HD2  . ARG A 1 113 ? 13.448  -0.101  -2.050  1.00 0.00 ? 164 ARG A HD2  4  
ATOM 7669  H HD3  . ARG A 1 113 ? 13.986  0.731   -3.507  1.00 0.00 ? 164 ARG A HD3  4  
ATOM 7670  H HE   . ARG A 1 113 ? 14.655  2.457   -1.433  1.00 0.00 ? 164 ARG A HE   4  
ATOM 7671  H HH11 . ARG A 1 113 ? 15.167  -0.841  -2.241  1.00 0.00 ? 164 ARG A HH11 4  
ATOM 7672  H HH12 . ARG A 1 113 ? 16.722  -0.931  -1.486  1.00 0.00 ? 164 ARG A HH12 4  
ATOM 7673  H HH21 . ARG A 1 113 ? 16.695  2.381   -0.453  1.00 0.00 ? 164 ARG A HH21 4  
ATOM 7674  H HH22 . ARG A 1 113 ? 17.599  0.904   -0.486  1.00 0.00 ? 164 ARG A HH22 4  
ATOM 7675  N N    . ALA A 1 114 ? 12.355  -1.082  -4.939  1.00 0.00 ? 165 ALA A N    4  
ATOM 7676  C CA   . ALA A 1 114 ? 12.395  -2.453  -5.500  1.00 0.00 ? 165 ALA A CA   4  
ATOM 7677  C C    . ALA A 1 114 ? 11.060  -3.141  -5.196  1.00 0.00 ? 165 ALA A C    4  
ATOM 7678  O O    . ALA A 1 114 ? 10.293  -2.687  -4.370  1.00 0.00 ? 165 ALA A O    4  
ATOM 7679  C CB   . ALA A 1 114 ? 13.533  -3.231  -4.843  1.00 0.00 ? 165 ALA A CB   4  
ATOM 7680  H H    . ALA A 1 114 ? 12.966  -0.830  -4.215  1.00 0.00 ? 165 ALA A H    4  
ATOM 7681  H HA   . ALA A 1 114 ? 12.552  -2.408  -6.567  1.00 0.00 ? 165 ALA A HA   4  
ATOM 7682  H HB1  . ALA A 1 114 ? 13.395  -3.229  -3.772  1.00 0.00 ? 165 ALA A HB1  4  
ATOM 7683  H HB2  . ALA A 1 114 ? 13.531  -4.247  -5.206  1.00 0.00 ? 165 ALA A HB2  4  
ATOM 7684  H HB3  . ALA A 1 114 ? 14.475  -2.761  -5.084  1.00 0.00 ? 165 ALA A HB3  4  
ATOM 7685  N N    . ILE A 1 115 ? 10.769  -4.226  -5.859  1.00 0.00 ? 166 ILE A N    4  
ATOM 7686  C CA   . ILE A 1 115 ? 9.475   -4.925  -5.609  1.00 0.00 ? 166 ILE A CA   4  
ATOM 7687  C C    . ILE A 1 115 ? 9.398   -5.337  -4.137  1.00 0.00 ? 166 ILE A C    4  
ATOM 7688  O O    . ILE A 1 115 ? 10.354  -5.811  -3.560  1.00 0.00 ? 166 ILE A O    4  
ATOM 7689  C CB   . ILE A 1 115 ? 9.403   -6.173  -6.501  1.00 0.00 ? 166 ILE A CB   4  
ATOM 7690  C CG1  . ILE A 1 115 ? 10.724  -6.996  -6.368  1.00 0.00 ? 166 ILE A CG1  4  
ATOM 7691  C CG2  . ILE A 1 115 ? 9.198   -5.716  -7.956  1.00 0.00 ? 166 ILE A CG2  4  
ATOM 7692  C CD1  . ILE A 1 115 ? 10.413  -8.443  -5.968  1.00 0.00 ? 166 ILE A CD1  4  
ATOM 7693  H H    . ILE A 1 115 ? 11.394  -4.575  -6.525  1.00 0.00 ? 166 ILE A H    4  
ATOM 7694  H HA   . ILE A 1 115 ? 8.654   -4.266  -5.842  1.00 0.00 ? 166 ILE A HA   4  
ATOM 7695  H HB   . ILE A 1 115 ? 8.554   -6.773  -6.199  1.00 0.00 ? 166 ILE A HB   4  
ATOM 7696  H HG12 . ILE A 1 115 ? 11.257  -7.002  -7.309  1.00 0.00 ? 166 ILE A HG12 4  
ATOM 7697  H HG13 . ILE A 1 115 ? 11.359  -6.559  -5.611  1.00 0.00 ? 166 ILE A HG13 4  
ATOM 7698  H HG21 . ILE A 1 115 ? 9.786   -4.828  -8.145  1.00 0.00 ? 166 ILE A HG21 4  
ATOM 7699  H HG22 . ILE A 1 115 ? 9.515   -6.499  -8.629  1.00 0.00 ? 166 ILE A HG22 4  
ATOM 7700  H HG23 . ILE A 1 115 ? 8.153   -5.498  -8.121  1.00 0.00 ? 166 ILE A HG23 4  
ATOM 7701  H HD11 . ILE A 1 115 ? 9.610   -8.826  -6.581  1.00 0.00 ? 166 ILE A HD11 4  
ATOM 7702  H HD12 . ILE A 1 115 ? 11.293  -9.052  -6.105  1.00 0.00 ? 166 ILE A HD12 4  
ATOM 7703  H HD13 . ILE A 1 115 ? 10.118  -8.465  -4.932  1.00 0.00 ? 166 ILE A HD13 4  
ATOM 7704  N N    . LYS A 1 116 ? 8.266   -5.122  -3.522  1.00 0.00 ? 167 LYS A N    4  
ATOM 7705  C CA   . LYS A 1 116 ? 8.116   -5.450  -2.080  1.00 0.00 ? 167 LYS A CA   4  
ATOM 7706  C C    . LYS A 1 116 ? 7.559   -6.863  -1.903  1.00 0.00 ? 167 LYS A C    4  
ATOM 7707  O O    . LYS A 1 116 ? 7.250   -7.264  -0.802  1.00 0.00 ? 167 LYS A O    4  
ATOM 7708  C CB   . LYS A 1 116 ? 7.126   -4.465  -1.475  1.00 0.00 ? 167 LYS A CB   4  
ATOM 7709  C CG   . LYS A 1 116 ? 7.631   -3.039  -1.700  1.00 0.00 ? 167 LYS A CG   4  
ATOM 7710  C CD   . LYS A 1 116 ? 6.787   -2.056  -0.885  1.00 0.00 ? 167 LYS A CD   4  
ATOM 7711  C CE   . LYS A 1 116 ? 5.326   -2.125  -1.340  1.00 0.00 ? 167 LYS A CE   4  
ATOM 7712  N NZ   . LYS A 1 116 ? 4.644   -3.207  -0.590  1.00 0.00 ? 167 LYS A NZ   4  
ATOM 7713  H H    . LYS A 1 116 ? 7.519   -4.715  -4.001  1.00 0.00 ? 167 LYS A H    4  
ATOM 7714  H HA   . LYS A 1 116 ? 9.064   -5.362  -1.576  1.00 0.00 ? 167 LYS A HA   4  
ATOM 7715  H HB2  . LYS A 1 116 ? 6.162   -4.588  -1.950  1.00 0.00 ? 167 LYS A HB2  4  
ATOM 7716  H HB3  . LYS A 1 116 ? 7.033   -4.656  -0.417  1.00 0.00 ? 167 LYS A HB3  4  
ATOM 7717  H HG2  . LYS A 1 116 ? 8.663   -2.964  -1.402  1.00 0.00 ? 167 LYS A HG2  4  
ATOM 7718  H HG3  . LYS A 1 116 ? 7.548   -2.792  -2.745  1.00 0.00 ? 167 LYS A HG3  4  
ATOM 7719  H HD2  . LYS A 1 116 ? 6.846   -2.315  0.161   1.00 0.00 ? 167 LYS A HD2  4  
ATOM 7720  H HD3  . LYS A 1 116 ? 7.161   -1.058  -1.026  1.00 0.00 ? 167 LYS A HD3  4  
ATOM 7721  H HE2  . LYS A 1 116 ? 4.838   -1.183  -1.136  1.00 0.00 ? 167 LYS A HE2  4  
ATOM 7722  H HE3  . LYS A 1 116 ? 5.277   -2.332  -2.398  1.00 0.00 ? 167 LYS A HE3  4  
ATOM 7723  H HZ1  . LYS A 1 116 ? 5.280   -3.573  0.146   1.00 0.00 ? 167 LYS A HZ1  4  
ATOM 7724  H HZ2  . LYS A 1 116 ? 3.780   -2.828  -0.148  1.00 0.00 ? 167 LYS A HZ2  4  
ATOM 7725  H HZ3  . LYS A 1 116 ? 4.395   -3.975  -1.242  1.00 0.00 ? 167 LYS A HZ3  4  
ATOM 7726  N N    . ILE A 1 117 ? 7.388   -7.605  -2.973  1.00 0.00 ? 168 ILE A N    4  
ATOM 7727  C CA   . ILE A 1 117 ? 6.799   -8.987  -2.859  1.00 0.00 ? 168 ILE A CA   4  
ATOM 7728  C C    . ILE A 1 117 ? 7.652   -10.061 -3.543  1.00 0.00 ? 168 ILE A C    4  
ATOM 7729  O O    . ILE A 1 117 ? 8.293   -9.835  -4.548  1.00 0.00 ? 168 ILE A O    4  
ATOM 7730  C CB   . ILE A 1 117 ? 5.402   -8.993  -3.486  1.00 0.00 ? 168 ILE A CB   4  
ATOM 7731  C CG1  . ILE A 1 117 ? 4.809   -10.407 -3.371  1.00 0.00 ? 168 ILE A CG1  4  
ATOM 7732  C CG2  . ILE A 1 117 ? 5.495   -8.581  -4.962  1.00 0.00 ? 168 ILE A CG2  4  
ATOM 7733  C CD1  . ILE A 1 117 ? 3.320   -10.390 -3.709  1.00 0.00 ? 168 ILE A CD1  4  
ATOM 7734  H H    . ILE A 1 117 ? 7.614   -7.244  -3.856  1.00 0.00 ? 168 ILE A H    4  
ATOM 7735  H HA   . ILE A 1 117 ? 6.702   -9.253  -1.817  1.00 0.00 ? 168 ILE A HA   4  
ATOM 7736  H HB   . ILE A 1 117 ? 4.772   -8.292  -2.959  1.00 0.00 ? 168 ILE A HB   4  
ATOM 7737  H HG12 . ILE A 1 117 ? 5.320   -11.065 -4.058  1.00 0.00 ? 168 ILE A HG12 4  
ATOM 7738  H HG13 . ILE A 1 117 ? 4.943   -10.768 -2.363  1.00 0.00 ? 168 ILE A HG13 4  
ATOM 7739  H HG21 . ILE A 1 117 ? 5.931   -7.594  -5.034  1.00 0.00 ? 168 ILE A HG21 4  
ATOM 7740  H HG22 . ILE A 1 117 ? 6.114   -9.285  -5.501  1.00 0.00 ? 168 ILE A HG22 4  
ATOM 7741  H HG23 . ILE A 1 117 ? 4.503   -8.568  -5.395  1.00 0.00 ? 168 ILE A HG23 4  
ATOM 7742  H HD11 . ILE A 1 117 ? 3.158   -9.823  -4.612  1.00 0.00 ? 168 ILE A HD11 4  
ATOM 7743  H HD12 . ILE A 1 117 ? 2.973   -11.402 -3.850  1.00 0.00 ? 168 ILE A HD12 4  
ATOM 7744  H HD13 . ILE A 1 117 ? 2.780   -9.938  -2.898  1.00 0.00 ? 168 ILE A HD13 4  
ATOM 7745  N N    . THR A 1 118 ? 7.615   -11.255 -2.998  1.00 0.00 ? 169 THR A N    4  
ATOM 7746  C CA   . THR A 1 118 ? 8.362   -12.412 -3.576  1.00 0.00 ? 169 THR A CA   4  
ATOM 7747  C C    . THR A 1 118 ? 7.431   -13.630 -3.523  1.00 0.00 ? 169 THR A C    4  
ATOM 7748  O O    . THR A 1 118 ? 6.538   -13.682 -2.701  1.00 0.00 ? 169 THR A O    4  
ATOM 7749  C CB   . THR A 1 118 ? 9.637   -12.687 -2.756  1.00 0.00 ? 169 THR A CB   4  
ATOM 7750  O OG1  . THR A 1 118 ? 10.431  -13.640 -3.441  1.00 0.00 ? 169 THR A OG1  4  
ATOM 7751  C CG2  . THR A 1 118 ? 9.286   -13.226 -1.365  1.00 0.00 ? 169 THR A CG2  4  
ATOM 7752  H H    . THR A 1 118 ? 7.057   -11.401 -2.206  1.00 0.00 ? 169 THR A H    4  
ATOM 7753  H HA   . THR A 1 118 ? 8.625   -12.204 -4.604  1.00 0.00 ? 169 THR A HA   4  
ATOM 7754  H HB   . THR A 1 118 ? 10.198  -11.772 -2.648  1.00 0.00 ? 169 THR A HB   4  
ATOM 7755  H HG1  . THR A 1 118 ? 9.840   -14.286 -3.841  1.00 0.00 ? 169 THR A HG1  4  
ATOM 7756  H HG21 . THR A 1 118 ? 8.438   -12.686 -0.970  1.00 0.00 ? 169 THR A HG21 4  
ATOM 7757  H HG22 . THR A 1 118 ? 9.048   -14.280 -1.431  1.00 0.00 ? 169 THR A HG22 4  
ATOM 7758  H HG23 . THR A 1 118 ? 10.132  -13.092 -0.705  1.00 0.00 ? 169 THR A HG23 4  
ATOM 7759  N N    . VAL A 1 119 ? 7.617   -14.607 -4.389  1.00 0.00 ? 170 VAL A N    4  
ATOM 7760  C CA   . VAL A 1 119 ? 6.717   -15.816 -4.369  1.00 0.00 ? 170 VAL A CA   4  
ATOM 7761  C C    . VAL A 1 119 ? 7.461   -16.990 -3.743  1.00 0.00 ? 170 VAL A C    4  
ATOM 7762  O O    . VAL A 1 119 ? 8.602   -17.270 -4.060  1.00 0.00 ? 170 VAL A O    4  
ATOM 7763  C CB   . VAL A 1 119 ? 6.268   -16.193 -5.795  1.00 0.00 ? 170 VAL A CB   4  
ATOM 7764  C CG1  . VAL A 1 119 ? 7.456   -16.733 -6.608  1.00 0.00 ? 170 VAL A CG1  4  
ATOM 7765  C CG2  . VAL A 1 119 ? 5.163   -17.266 -5.718  1.00 0.00 ? 170 VAL A CG2  4  
ATOM 7766  H H    . VAL A 1 119 ? 8.339   -14.545 -5.050  1.00 0.00 ? 170 VAL A H    4  
ATOM 7767  H HA   . VAL A 1 119 ? 5.838   -15.607 -3.771  1.00 0.00 ? 170 VAL A HA   4  
ATOM 7768  H HB   . VAL A 1 119 ? 5.875   -15.315 -6.286  1.00 0.00 ? 170 VAL A HB   4  
ATOM 7769  H HG11 . VAL A 1 119 ? 8.329   -16.126 -6.416  1.00 0.00 ? 170 VAL A HG11 4  
ATOM 7770  H HG12 . VAL A 1 119 ? 7.658   -17.755 -6.325  1.00 0.00 ? 170 VAL A HG12 4  
ATOM 7771  H HG13 . VAL A 1 119 ? 7.219   -16.692 -7.662  1.00 0.00 ? 170 VAL A HG13 4  
ATOM 7772  H HG21 . VAL A 1 119 ? 5.454   -18.046 -5.027  1.00 0.00 ? 170 VAL A HG21 4  
ATOM 7773  H HG22 . VAL A 1 119 ? 4.243   -16.811 -5.378  1.00 0.00 ? 170 VAL A HG22 4  
ATOM 7774  H HG23 . VAL A 1 119 ? 5.006   -17.696 -6.696  1.00 0.00 ? 170 VAL A HG23 4  
ATOM 7775  N N    . ASP A 1 120 ? 6.819   -17.675 -2.843  1.00 0.00 ? 171 ASP A N    4  
ATOM 7776  C CA   . ASP A 1 120 ? 7.474   -18.826 -2.181  1.00 0.00 ? 171 ASP A CA   4  
ATOM 7777  C C    . ASP A 1 120 ? 7.646   -19.966 -3.193  1.00 0.00 ? 171 ASP A C    4  
ATOM 7778  O O    . ASP A 1 120 ? 8.636   -20.667 -3.181  1.00 0.00 ? 171 ASP A O    4  
ATOM 7779  C CB   . ASP A 1 120 ? 6.598   -19.274 -1.017  1.00 0.00 ? 171 ASP A CB   4  
ATOM 7780  C CG   . ASP A 1 120 ? 6.636   -18.194 0.071   1.00 0.00 ? 171 ASP A CG   4  
ATOM 7781  O OD1  . ASP A 1 120 ? 7.283   -17.183 -0.153  1.00 0.00 ? 171 ASP A OD1  4  
ATOM 7782  O OD2  . ASP A 1 120 ? 6.007   -18.388 1.100   1.00 0.00 ? 171 ASP A OD2  4  
ATOM 7783  H H    . ASP A 1 120 ? 5.901   -17.422 -2.592  1.00 0.00 ? 171 ASP A H    4  
ATOM 7784  H HA   . ASP A 1 120 ? 8.442   -18.525 -1.805  1.00 0.00 ? 171 ASP A HA   4  
ATOM 7785  H HB2  . ASP A 1 120 ? 5.581   -19.404 -1.368  1.00 0.00 ? 171 ASP A HB2  4  
ATOM 7786  H HB3  . ASP A 1 120 ? 6.966   -20.206 -0.619  1.00 0.00 ? 171 ASP A HB3  4  
ATOM 7787  N N    . GLY A 1 121 ? 6.699   -20.155 -4.079  1.00 0.00 ? 172 GLY A N    4  
ATOM 7788  C CA   . GLY A 1 121 ? 6.840   -21.251 -5.088  1.00 0.00 ? 172 GLY A CA   4  
ATOM 7789  C C    . GLY A 1 121 ? 5.847   -21.039 -6.239  1.00 0.00 ? 172 GLY A C    4  
ATOM 7790  O O    . GLY A 1 121 ? 5.128   -20.061 -6.271  1.00 0.00 ? 172 GLY A O    4  
ATOM 7791  H H    . GLY A 1 121 ? 5.904   -19.578 -4.087  1.00 0.00 ? 172 GLY A H    4  
ATOM 7792  H HA2  . GLY A 1 121 ? 7.850   -21.247 -5.476  1.00 0.00 ? 172 GLY A HA2  4  
ATOM 7793  H HA3  . GLY A 1 121 ? 6.640   -22.198 -4.614  1.00 0.00 ? 172 GLY A HA3  4  
ATOM 7794  N N    . PRO A 1 122 ? 5.797   -21.961 -7.176  1.00 0.00 ? 173 PRO A N    4  
ATOM 7795  C CA   . PRO A 1 122 ? 4.863   -21.879 -8.338  1.00 0.00 ? 173 PRO A CA   4  
ATOM 7796  C C    . PRO A 1 122 ? 3.435   -22.234 -7.905  1.00 0.00 ? 173 PRO A C    4  
ATOM 7797  O O    . PRO A 1 122 ? 2.969   -21.769 -6.886  1.00 0.00 ? 173 PRO A O    4  
ATOM 7798  C CB   . PRO A 1 122 ? 5.447   -22.904 -9.321  1.00 0.00 ? 173 PRO A CB   4  
ATOM 7799  C CG   . PRO A 1 122 ? 6.054   -23.942 -8.443  1.00 0.00 ? 173 PRO A CG   4  
ATOM 7800  C CD   . PRO A 1 122 ? 6.623   -23.184 -7.237  1.00 0.00 ? 173 PRO A CD   4  
ATOM 7801  H HA   . PRO A 1 122 ? 4.890   -20.895 -8.778  1.00 0.00 ? 173 PRO A HA   4  
ATOM 7802  H HB2  . PRO A 1 122 ? 4.679   -23.330 -9.946  1.00 0.00 ? 173 PRO A HB2  4  
ATOM 7803  H HB3  . PRO A 1 122 ? 6.210   -22.446 -9.930  1.00 0.00 ? 173 PRO A HB3  4  
ATOM 7804  H HG2  . PRO A 1 122 ? 5.294   -24.647 -8.124  1.00 0.00 ? 173 PRO A HG2  4  
ATOM 7805  H HG3  . PRO A 1 122 ? 6.849   -24.456 -8.962  1.00 0.00 ? 173 PRO A HG3  4  
ATOM 7806  H HD2  . PRO A 1 122 ? 6.511   -23.768 -6.335  1.00 0.00 ? 173 PRO A HD2  4  
ATOM 7807  H HD3  . PRO A 1 122 ? 7.657   -22.926 -7.400  1.00 0.00 ? 173 PRO A HD3  4  
ATOM 7808  N N    . ARG A 1 123 ? 2.731   -23.044 -8.656  1.00 0.00 ? 174 ARG A N    4  
ATOM 7809  C CA   . ARG A 1 123 ? 1.342   -23.423 -8.267  1.00 0.00 ? 174 ARG A CA   4  
ATOM 7810  C C    . ARG A 1 123 ? 1.357   -24.780 -7.542  1.00 0.00 ? 174 ARG A C    4  
ATOM 7811  O O    . ARG A 1 123 ? 0.346   -25.240 -7.062  1.00 0.00 ? 174 ARG A O    4  
ATOM 7812  C CB   . ARG A 1 123 ? 0.467   -23.500 -9.533  1.00 0.00 ? 174 ARG A CB   4  
ATOM 7813  C CG   . ARG A 1 123 ? 1.091   -24.461 -10.585 1.00 0.00 ? 174 ARG A CG   4  
ATOM 7814  C CD   . ARG A 1 123 ? 0.447   -25.863 -10.521 1.00 0.00 ? 174 ARG A CD   4  
ATOM 7815  N NE   . ARG A 1 123 ? 1.505   -26.897 -10.743 1.00 0.00 ? 174 ARG A NE   4  
ATOM 7816  C CZ   . ARG A 1 123 ? 2.334   -26.823 -11.752 1.00 0.00 ? 174 ARG A CZ   4  
ATOM 7817  N NH1  . ARG A 1 123 ? 2.182   -25.921 -12.686 1.00 0.00 ? 174 ARG A NH1  4  
ATOM 7818  N NH2  . ARG A 1 123 ? 3.300   -27.691 -11.846 1.00 0.00 ? 174 ARG A NH2  4  
ATOM 7819  H H    . ARG A 1 123 ? 3.118   -23.406 -9.472  1.00 0.00 ? 174 ARG A H    4  
ATOM 7820  H HA   . ARG A 1 123 ? 0.930   -22.672 -7.603  1.00 0.00 ? 174 ARG A HA   4  
ATOM 7821  H HB2  . ARG A 1 123 ? -0.522  -23.838 -9.265  1.00 0.00 ? 174 ARG A HB2  4  
ATOM 7822  H HB3  . ARG A 1 123 ? 0.393   -22.509 -9.959  1.00 0.00 ? 174 ARG A HB3  4  
ATOM 7823  H HG2  . ARG A 1 123 ? 0.933   -24.044 -11.570 1.00 0.00 ? 174 ARG A HG2  4  
ATOM 7824  H HG3  . ARG A 1 123 ? 2.151   -24.555 -10.415 1.00 0.00 ? 174 ARG A HG3  4  
ATOM 7825  H HD2  . ARG A 1 123 ? 0.024   -26.034 -9.547  1.00 0.00 ? 174 ARG A HD2  4  
ATOM 7826  H HD3  . ARG A 1 123 ? -0.336  -25.940 -11.269 1.00 0.00 ? 174 ARG A HD3  4  
ATOM 7827  H HE   . ARG A 1 123 ? 1.604   -27.625 -10.096 1.00 0.00 ? 174 ARG A HE   4  
ATOM 7828  H HH11 . ARG A 1 123 ? 1.426   -25.273 -12.638 1.00 0.00 ? 174 ARG A HH11 4  
ATOM 7829  H HH12 . ARG A 1 123 ? 2.820   -25.889 -13.459 1.00 0.00 ? 174 ARG A HH12 4  
ATOM 7830  H HH21 . ARG A 1 123 ? 3.394   -28.406 -11.154 1.00 0.00 ? 174 ARG A HH21 4  
ATOM 7831  H HH22 . ARG A 1 123 ? 3.951   -27.636 -12.601 1.00 0.00 ? 174 ARG A HH22 4  
ATOM 7832  N N    . GLU A 1 124 ? 2.507   -25.409 -7.444  1.00 0.00 ? 175 GLU A N    4  
ATOM 7833  C CA   . GLU A 1 124 ? 2.597   -26.725 -6.741  1.00 0.00 ? 175 GLU A CA   4  
ATOM 7834  C C    . GLU A 1 124 ? 2.367   -26.578 -5.229  1.00 0.00 ? 175 GLU A C    4  
ATOM 7835  O O    . GLU A 1 124 ? 1.775   -27.443 -4.617  1.00 0.00 ? 175 GLU A O    4  
ATOM 7836  C CB   . GLU A 1 124 ? 3.963   -27.368 -7.006  1.00 0.00 ? 175 GLU A CB   4  
ATOM 7837  C CG   . GLU A 1 124 ? 4.064   -27.690 -8.491  1.00 0.00 ? 175 GLU A CG   4  
ATOM 7838  C CD   . GLU A 1 124 ? 5.469   -28.178 -8.813  1.00 0.00 ? 175 GLU A CD   4  
ATOM 7839  O OE1  . GLU A 1 124 ? 6.170   -28.557 -7.888  1.00 0.00 ? 175 GLU A OE1  4  
ATOM 7840  O OE2  . GLU A 1 124 ? 5.823   -28.169 -9.979  1.00 0.00 ? 175 GLU A OE2  4  
ATOM 7841  H H    . GLU A 1 124 ? 3.318   -25.006 -7.816  1.00 0.00 ? 175 GLU A H    4  
ATOM 7842  H HA   . GLU A 1 124 ? 1.833   -27.374 -7.138  1.00 0.00 ? 175 GLU A HA   4  
ATOM 7843  H HB2  . GLU A 1 124 ? 4.757   -26.693 -6.727  1.00 0.00 ? 175 GLU A HB2  4  
ATOM 7844  H HB3  . GLU A 1 124 ? 4.053   -28.285 -6.437  1.00 0.00 ? 175 GLU A HB3  4  
ATOM 7845  H HG2  . GLU A 1 124 ? 3.349   -28.459 -8.739  1.00 0.00 ? 175 GLU A HG2  4  
ATOM 7846  H HG3  . GLU A 1 124 ? 3.854   -26.799 -9.064  1.00 0.00 ? 175 GLU A HG3  4  
ATOM 7847  N N    . PRO A 1 125 ? 2.846   -25.519 -4.610  1.00 0.00 ? 176 PRO A N    4  
ATOM 7848  C CA   . PRO A 1 125 ? 2.699   -25.316 -3.141  1.00 0.00 ? 176 PRO A CA   4  
ATOM 7849  C C    . PRO A 1 125 ? 1.383   -25.830 -2.542  1.00 0.00 ? 176 PRO A C    4  
ATOM 7850  O O    . PRO A 1 125 ? 1.382   -26.730 -1.725  1.00 0.00 ? 176 PRO A O    4  
ATOM 7851  C CB   . PRO A 1 125 ? 2.828   -23.804 -3.026  1.00 0.00 ? 176 PRO A CB   4  
ATOM 7852  C CG   . PRO A 1 125 ? 3.925   -23.516 -3.979  1.00 0.00 ? 176 PRO A CG   4  
ATOM 7853  C CD   . PRO A 1 125 ? 3.584   -24.371 -5.202  1.00 0.00 ? 176 PRO A CD   4  
ATOM 7854  H HA   . PRO A 1 125 ? 3.526   -25.774 -2.643  1.00 0.00 ? 176 PRO A HA   4  
ATOM 7855  H HB2  . PRO A 1 125 ? 1.907   -23.323 -3.344  1.00 0.00 ? 176 PRO A HB2  4  
ATOM 7856  H HB3  . PRO A 1 125 ? 3.103   -23.506 -2.028  1.00 0.00 ? 176 PRO A HB3  4  
ATOM 7857  H HG2  . PRO A 1 125 ? 3.948   -22.463 -4.232  1.00 0.00 ? 176 PRO A HG2  4  
ATOM 7858  H HG3  . PRO A 1 125 ? 4.873   -23.831 -3.569  1.00 0.00 ? 176 PRO A HG3  4  
ATOM 7859  H HD2  . PRO A 1 125 ? 2.959   -23.803 -5.862  1.00 0.00 ? 176 PRO A HD2  4  
ATOM 7860  H HD3  . PRO A 1 125 ? 4.475   -24.701 -5.700  1.00 0.00 ? 176 PRO A HD3  4  
ATOM 7861  N N    . ARG A 1 126 ? 0.271   -25.272 -2.912  1.00 0.00 ? 177 ARG A N    4  
ATOM 7862  C CA   . ARG A 1 126 ? -1.018  -25.744 -2.321  1.00 0.00 ? 177 ARG A CA   4  
ATOM 7863  C C    . ARG A 1 126 ? -1.306  -27.184 -2.754  1.00 0.00 ? 177 ARG A C    4  
ATOM 7864  O O    . ARG A 1 126 ? -2.064  -27.889 -2.120  1.00 0.00 ? 177 ARG A O    4  
ATOM 7865  C CB   . ARG A 1 126 ? -2.157  -24.812 -2.758  1.00 0.00 ? 177 ARG A CB   4  
ATOM 7866  C CG   . ARG A 1 126 ? -2.401  -24.935 -4.273  1.00 0.00 ? 177 ARG A CG   4  
ATOM 7867  C CD   . ARG A 1 126 ? -3.260  -23.752 -4.752  1.00 0.00 ? 177 ARG A CD   4  
ATOM 7868  N NE   . ARG A 1 126 ? -3.503  -23.851 -6.228  1.00 0.00 ? 177 ARG A NE   4  
ATOM 7869  C CZ   . ARG A 1 126 ? -4.423  -23.103 -6.799  1.00 0.00 ? 177 ARG A CZ   4  
ATOM 7870  N NH1  . ARG A 1 126 ? -5.147  -22.298 -6.072  1.00 0.00 ? 177 ARG A NH1  4  
ATOM 7871  N NH2  . ARG A 1 126 ? -4.620  -23.164 -8.091  1.00 0.00 ? 177 ARG A NH2  4  
ATOM 7872  H H    . ARG A 1 126 ? 0.280   -24.536 -3.558  1.00 0.00 ? 177 ARG A H    4  
ATOM 7873  H HA   . ARG A 1 126 ? -0.937  -25.716 -1.242  1.00 0.00 ? 177 ARG A HA   4  
ATOM 7874  H HB2  . ARG A 1 126 ? -3.057  -25.078 -2.224  1.00 0.00 ? 177 ARG A HB2  4  
ATOM 7875  H HB3  . ARG A 1 126 ? -1.890  -23.796 -2.521  1.00 0.00 ? 177 ARG A HB3  4  
ATOM 7876  H HG2  . ARG A 1 126 ? -1.455  -24.931 -4.793  1.00 0.00 ? 177 ARG A HG2  4  
ATOM 7877  H HG3  . ARG A 1 126 ? -2.921  -25.859 -4.480  1.00 0.00 ? 177 ARG A HG3  4  
ATOM 7878  H HD2  . ARG A 1 126 ? -4.208  -23.768 -4.236  1.00 0.00 ? 177 ARG A HD2  4  
ATOM 7879  H HD3  . ARG A 1 126 ? -2.748  -22.826 -4.528  1.00 0.00 ? 177 ARG A HD3  4  
ATOM 7880  H HE   . ARG A 1 126 ? -2.967  -24.465 -6.775  1.00 0.00 ? 177 ARG A HE   4  
ATOM 7881  H HH11 . ARG A 1 126 ? -5.000  -22.246 -5.086  1.00 0.00 ? 177 ARG A HH11 4  
ATOM 7882  H HH12 . ARG A 1 126 ? -5.851  -21.734 -6.505  1.00 0.00 ? 177 ARG A HH12 4  
ATOM 7883  H HH21 . ARG A 1 126 ? -4.070  -23.782 -8.655  1.00 0.00 ? 177 ARG A HH21 4  
ATOM 7884  H HH22 . ARG A 1 126 ? -5.323  -22.594 -8.518  1.00 0.00 ? 177 ARG A HH22 4  
ATOM 7885  N N    . ARG A 1 127 ? -0.711  -27.639 -3.819  1.00 0.00 ? 178 ARG A N    4  
ATOM 7886  C CA   . ARG A 1 127 ? -0.967  -29.044 -4.262  1.00 0.00 ? 178 ARG A CA   4  
ATOM 7887  C C    . ARG A 1 127 ? 0.015   -29.992 -3.571  1.00 0.00 ? 178 ARG A C    4  
ATOM 7888  O O    . ARG A 1 127 ? 1.094   -29.603 -3.172  1.00 0.00 ? 178 ARG A O    4  
ATOM 7889  C CB   . ARG A 1 127 ? -0.802  -29.134 -5.777  1.00 0.00 ? 178 ARG A CB   4  
ATOM 7890  C CG   . ARG A 1 127 ? -2.003  -28.428 -6.464  1.00 0.00 ? 178 ARG A CG   4  
ATOM 7891  C CD   . ARG A 1 127 ? -1.559  -27.685 -7.721  1.00 0.00 ? 178 ARG A CD   4  
ATOM 7892  N NE   . ARG A 1 127 ? -2.529  -26.576 -7.955  1.00 0.00 ? 178 ARG A NE   4  
ATOM 7893  C CZ   . ARG A 1 127 ? -3.786  -26.840 -8.177  1.00 0.00 ? 178 ARG A CZ   4  
ATOM 7894  N NH1  . ARG A 1 127 ? -4.169  -28.077 -8.354  1.00 0.00 ? 178 ARG A NH1  4  
ATOM 7895  N NH2  . ARG A 1 127 ? -4.655  -25.875 -8.245  1.00 0.00 ? 178 ARG A NH2  4  
ATOM 7896  H H    . ARG A 1 127 ? -0.096  -27.064 -4.324  1.00 0.00 ? 178 ARG A H    4  
ATOM 7897  H HA   . ARG A 1 127 ? -1.979  -29.326 -4.000  1.00 0.00 ? 178 ARG A HA   4  
ATOM 7898  H HB2  . ARG A 1 127 ? 0.132   -28.675 -6.059  1.00 0.00 ? 178 ARG A HB2  4  
ATOM 7899  H HB3  . ARG A 1 127 ? -0.787  -30.175 -6.066  1.00 0.00 ? 178 ARG A HB3  4  
ATOM 7900  H HG2  . ARG A 1 127 ? -2.742  -29.169 -6.738  1.00 0.00 ? 178 ARG A HG2  4  
ATOM 7901  H HG3  . ARG A 1 127 ? -2.456  -27.721 -5.782  1.00 0.00 ? 178 ARG A HG3  4  
ATOM 7902  H HD2  . ARG A 1 127 ? -0.605  -27.239 -7.575  1.00 0.00 ? 178 ARG A HD2  4  
ATOM 7903  H HD3  . ARG A 1 127 ? -1.507  -28.381 -8.558  1.00 0.00 ? 178 ARG A HD3  4  
ATOM 7904  H HE   . ARG A 1 127 ? -2.228  -25.641 -7.872  1.00 0.00 ? 178 ARG A HE   4  
ATOM 7905  H HH11 . ARG A 1 127 ? -3.502  -28.820 -8.318  1.00 0.00 ? 178 ARG A HH11 4  
ATOM 7906  H HH12 . ARG A 1 127 ? -5.132  -28.280 -8.533  1.00 0.00 ? 178 ARG A HH12 4  
ATOM 7907  H HH21 . ARG A 1 127 ? -4.358  -24.932 -8.125  1.00 0.00 ? 178 ARG A HH21 4  
ATOM 7908  H HH22 . ARG A 1 127 ? -5.618  -26.081 -8.420  1.00 0.00 ? 178 ARG A HH22 4  
ATOM 7909  N N    . VAL A 1 1   ? -4.748  6.885   24.506  1.00 0.00 ? 52  VAL A N    5  
ATOM 7910  C CA   . VAL A 1 1   ? -3.483  7.008   25.273  1.00 0.00 ? 52  VAL A CA   5  
ATOM 7911  C C    . VAL A 1 1   ? -2.524  7.891   24.468  1.00 0.00 ? 52  VAL A C    5  
ATOM 7912  O O    . VAL A 1 1   ? -1.781  7.416   23.632  1.00 0.00 ? 52  VAL A O    5  
ATOM 7913  C CB   . VAL A 1 1   ? -2.863  5.617   25.466  1.00 0.00 ? 52  VAL A CB   5  
ATOM 7914  C CG1  . VAL A 1 1   ? -1.806  5.682   26.576  1.00 0.00 ? 52  VAL A CG1  5  
ATOM 7915  C CG2  . VAL A 1 1   ? -3.954  4.611   25.859  1.00 0.00 ? 52  VAL A CG2  5  
ATOM 7916  H H    . VAL A 1 1   ? -4.736  6.973   23.531  1.00 0.00 ? 52  VAL A H    5  
ATOM 7917  H HA   . VAL A 1 1   ? -3.683  7.458   26.234  1.00 0.00 ? 52  VAL A HA   5  
ATOM 7918  H HB   . VAL A 1 1   ? -2.394  5.301   24.543  1.00 0.00 ? 52  VAL A HB   5  
ATOM 7919  H HG11 . VAL A 1 1   ? -2.243  6.125   27.456  1.00 0.00 ? 52  VAL A HG11 5  
ATOM 7920  H HG12 . VAL A 1 1   ? -1.461  4.681   26.813  1.00 0.00 ? 52  VAL A HG12 5  
ATOM 7921  H HG13 . VAL A 1 1   ? -0.970  6.280   26.246  1.00 0.00 ? 52  VAL A HG13 5  
ATOM 7922  H HG21 . VAL A 1 1   ? -4.716  4.585   25.098  1.00 0.00 ? 52  VAL A HG21 5  
ATOM 7923  H HG22 . VAL A 1 1   ? -3.515  3.633   25.960  1.00 0.00 ? 52  VAL A HG22 5  
ATOM 7924  H HG23 . VAL A 1 1   ? -4.393  4.909   26.798  1.00 0.00 ? 52  VAL A HG23 5  
ATOM 7925  N N    . GLU A 1 2   ? -2.534  9.172   24.703  1.00 0.00 ? 53  GLU A N    5  
ATOM 7926  C CA   . GLU A 1 2   ? -1.626  10.073  23.938  1.00 0.00 ? 53  GLU A CA   5  
ATOM 7927  C C    . GLU A 1 2   ? -0.219  9.967   24.518  1.00 0.00 ? 53  GLU A C    5  
ATOM 7928  O O    . GLU A 1 2   ? 0.273   10.862  25.171  1.00 0.00 ? 53  GLU A O    5  
ATOM 7929  C CB   . GLU A 1 2   ? -2.116  11.506  24.054  1.00 0.00 ? 53  GLU A CB   5  
ATOM 7930  C CG   . GLU A 1 2   ? -1.284  12.404  23.142  1.00 0.00 ? 53  GLU A CG   5  
ATOM 7931  C CD   . GLU A 1 2   ? -1.791  13.843  23.250  1.00 0.00 ? 53  GLU A CD   5  
ATOM 7932  O OE1  . GLU A 1 2   ? -2.683  14.187  22.494  1.00 0.00 ? 53  GLU A OE1  5  
ATOM 7933  O OE2  . GLU A 1 2   ? -1.272  14.581  24.075  1.00 0.00 ? 53  GLU A OE2  5  
ATOM 7934  H H    . GLU A 1 2   ? -3.142  9.540   25.374  1.00 0.00 ? 53  GLU A H    5  
ATOM 7935  H HA   . GLU A 1 2   ? -1.614  9.782   22.895  1.00 0.00 ? 53  GLU A HA   5  
ATOM 7936  H HB2  . GLU A 1 2   ? -3.155  11.557  23.767  1.00 0.00 ? 53  GLU A HB2  5  
ATOM 7937  H HB3  . GLU A 1 2   ? -2.005  11.835  25.068  1.00 0.00 ? 53  GLU A HB3  5  
ATOM 7938  H HG2  . GLU A 1 2   ? -0.248  12.363  23.447  1.00 0.00 ? 53  GLU A HG2  5  
ATOM 7939  H HG3  . GLU A 1 2   ? -1.375  12.064  22.124  1.00 0.00 ? 53  GLU A HG3  5  
ATOM 7940  N N    . VAL A 1 3   ? 0.423   8.865   24.269  1.00 0.00 ? 54  VAL A N    5  
ATOM 7941  C CA   . VAL A 1 3   ? 1.808   8.649   24.789  1.00 0.00 ? 54  VAL A CA   5  
ATOM 7942  C C    . VAL A 1 3   ? 2.597   7.744   23.837  1.00 0.00 ? 54  VAL A C    5  
ATOM 7943  O O    . VAL A 1 3   ? 3.811   7.810   23.767  1.00 0.00 ? 54  VAL A O    5  
ATOM 7944  C CB   . VAL A 1 3   ? 1.744   7.981   26.164  1.00 0.00 ? 54  VAL A CB   5  
ATOM 7945  C CG1  . VAL A 1 3   ? 3.164   7.789   26.696  1.00 0.00 ? 54  VAL A CG1  5  
ATOM 7946  C CG2  . VAL A 1 3   ? 0.964   8.859   27.140  1.00 0.00 ? 54  VAL A CG2  5  
ATOM 7947  H H    . VAL A 1 3   ? -0.017  8.177   23.746  1.00 0.00 ? 54  VAL A H    5  
ATOM 7948  H HA   . VAL A 1 3   ? 2.312   9.597   24.874  1.00 0.00 ? 54  VAL A HA   5  
ATOM 7949  H HB   . VAL A 1 3   ? 1.263   7.018   26.073  1.00 0.00 ? 54  VAL A HB   5  
ATOM 7950  H HG11 . VAL A 1 3   ? 3.695   8.734   26.667  1.00 0.00 ? 54  VAL A HG11 5  
ATOM 7951  H HG12 . VAL A 1 3   ? 3.116   7.436   27.716  1.00 0.00 ? 54  VAL A HG12 5  
ATOM 7952  H HG13 . VAL A 1 3   ? 3.683   7.063   26.088  1.00 0.00 ? 54  VAL A HG13 5  
ATOM 7953  H HG21 . VAL A 1 3   ? 1.311   9.877   27.055  1.00 0.00 ? 54  VAL A HG21 5  
ATOM 7954  H HG22 . VAL A 1 3   ? -0.095  8.820   26.906  1.00 0.00 ? 54  VAL A HG22 5  
ATOM 7955  H HG23 . VAL A 1 3   ? 1.124   8.506   28.148  1.00 0.00 ? 54  VAL A HG23 5  
ATOM 7956  N N    . LEU A 1 4   ? 1.929   6.892   23.113  1.00 0.00 ? 55  LEU A N    5  
ATOM 7957  C CA   . LEU A 1 4   ? 2.652   5.984   22.177  1.00 0.00 ? 55  LEU A CA   5  
ATOM 7958  C C    . LEU A 1 4   ? 2.870   6.720   20.849  1.00 0.00 ? 55  LEU A C    5  
ATOM 7959  O O    . LEU A 1 4   ? 1.958   7.282   20.279  1.00 0.00 ? 55  LEU A O    5  
ATOM 7960  C CB   . LEU A 1 4   ? 1.808   4.729   21.942  1.00 0.00 ? 55  LEU A CB   5  
ATOM 7961  C CG   . LEU A 1 4   ? 1.430   4.109   23.292  1.00 0.00 ? 55  LEU A CG   5  
ATOM 7962  C CD1  . LEU A 1 4   ? 0.610   2.839   23.050  1.00 0.00 ? 55  LEU A CD1  5  
ATOM 7963  C CD2  . LEU A 1 4   ? 2.698   3.760   24.103  1.00 0.00 ? 55  LEU A CD2  5  
ATOM 7964  H H    . LEU A 1 4   ? 0.954   6.841   23.189  1.00 0.00 ? 55  LEU A H    5  
ATOM 7965  H HA   . LEU A 1 4   ? 3.609   5.701   22.601  1.00 0.00 ? 55  LEU A HA   5  
ATOM 7966  H HB2  . LEU A 1 4   ? 0.908   4.997   21.401  1.00 0.00 ? 55  LEU A HB2  5  
ATOM 7967  H HB3  . LEU A 1 4   ? 2.368   4.012   21.370  1.00 0.00 ? 55  LEU A HB3  5  
ATOM 7968  H HG   . LEU A 1 4   ? 0.828   4.814   23.838  1.00 0.00 ? 55  LEU A HG   5  
ATOM 7969  H HD11 . LEU A 1 4   ? 1.060   2.260   22.259  1.00 0.00 ? 55  LEU A HD11 5  
ATOM 7970  H HD12 . LEU A 1 4   ? 0.578   2.247   23.957  1.00 0.00 ? 55  LEU A HD12 5  
ATOM 7971  H HD13 . LEU A 1 4   ? -0.389  3.114   22.766  1.00 0.00 ? 55  LEU A HD13 5  
ATOM 7972  H HD21 . LEU A 1 4   ? 3.453   3.369   23.435  1.00 0.00 ? 55  LEU A HD21 5  
ATOM 7973  H HD22 . LEU A 1 4   ? 3.088   4.641   24.600  1.00 0.00 ? 55  LEU A HD22 5  
ATOM 7974  H HD23 . LEU A 1 4   ? 2.456   3.009   24.845  1.00 0.00 ? 55  LEU A HD23 5  
ATOM 7975  N N    . ALA A 1 5   ? 4.074   6.723   20.355  1.00 0.00 ? 56  ALA A N    5  
ATOM 7976  C CA   . ALA A 1 5   ? 4.355   7.424   19.068  1.00 0.00 ? 56  ALA A CA   5  
ATOM 7977  C C    . ALA A 1 5   ? 5.620   6.840   18.424  1.00 0.00 ? 56  ALA A C    5  
ATOM 7978  O O    . ALA A 1 5   ? 5.784   6.870   17.219  1.00 0.00 ? 56  ALA A O    5  
ATOM 7979  C CB   . ALA A 1 5   ? 4.567   8.923   19.337  1.00 0.00 ? 56  ALA A CB   5  
ATOM 7980  H H    . ALA A 1 5   ? 4.795   6.269   20.832  1.00 0.00 ? 56  ALA A H    5  
ATOM 7981  H HA   . ALA A 1 5   ? 3.518   7.295   18.397  1.00 0.00 ? 56  ALA A HA   5  
ATOM 7982  H HB1  . ALA A 1 5   ? 3.753   9.298   19.936  1.00 0.00 ? 56  ALA A HB1  5  
ATOM 7983  H HB2  . ALA A 1 5   ? 5.503   9.070   19.863  1.00 0.00 ? 56  ALA A HB2  5  
ATOM 7984  H HB3  . ALA A 1 5   ? 4.591   9.457   18.398  1.00 0.00 ? 56  ALA A HB3  5  
ATOM 7985  N N    . ASP A 1 6   ? 6.536   6.339   19.220  1.00 0.00 ? 57  ASP A N    5  
ATOM 7986  C CA   . ASP A 1 6   ? 7.806   5.793   18.654  1.00 0.00 ? 57  ASP A CA   5  
ATOM 7987  C C    . ASP A 1 6   ? 7.592   4.392   18.070  1.00 0.00 ? 57  ASP A C    5  
ATOM 7988  O O    . ASP A 1 6   ? 6.848   4.204   17.122  1.00 0.00 ? 57  ASP A O    5  
ATOM 7989  C CB   . ASP A 1 6   ? 8.852   5.730   19.770  1.00 0.00 ? 57  ASP A CB   5  
ATOM 7990  C CG   . ASP A 1 6   ? 9.279   7.155   20.132  1.00 0.00 ? 57  ASP A CG   5  
ATOM 7991  O OD1  . ASP A 1 6   ? 9.330   7.980   19.234  1.00 0.00 ? 57  ASP A OD1  5  
ATOM 7992  O OD2  . ASP A 1 6   ? 9.544   7.399   21.297  1.00 0.00 ? 57  ASP A OD2  5  
ATOM 7993  H H    . ASP A 1 6   ? 6.397   6.346   20.196  1.00 0.00 ? 57  ASP A H    5  
ATOM 7994  H HA   . ASP A 1 6   ? 8.161   6.451   17.876  1.00 0.00 ? 57  ASP A HA   5  
ATOM 7995  H HB2  . ASP A 1 6   ? 8.427   5.246   20.638  1.00 0.00 ? 57  ASP A HB2  5  
ATOM 7996  H HB3  . ASP A 1 6   ? 9.716   5.173   19.426  1.00 0.00 ? 57  ASP A HB3  5  
ATOM 7997  N N    . HIS A 1 7   ? 8.266   3.415   18.621  1.00 0.00 ? 58  HIS A N    5  
ATOM 7998  C CA   . HIS A 1 7   ? 8.135   2.025   18.098  1.00 0.00 ? 58  HIS A CA   5  
ATOM 7999  C C    . HIS A 1 7   ? 6.650   1.615   17.956  1.00 0.00 ? 58  HIS A C    5  
ATOM 8000  O O    . HIS A 1 7   ? 6.258   1.113   16.921  1.00 0.00 ? 58  HIS A O    5  
ATOM 8001  C CB   . HIS A 1 7   ? 8.893   1.039   19.006  1.00 0.00 ? 58  HIS A CB   5  
ATOM 8002  C CG   . HIS A 1 7   ? 10.361  1.091   18.687  1.00 0.00 ? 58  HIS A CG   5  
ATOM 8003  N ND1  . HIS A 1 7   ? 10.880  0.607   17.500  1.00 0.00 ? 58  HIS A ND1  5  
ATOM 8004  C CD2  . HIS A 1 7   ? 11.428  1.592   19.385  1.00 0.00 ? 58  HIS A CD2  5  
ATOM 8005  C CE1  . HIS A 1 7   ? 12.203  0.830   17.520  1.00 0.00 ? 58  HIS A CE1  5  
ATOM 8006  N NE2  . HIS A 1 7   ? 12.590  1.429   18.648  1.00 0.00 ? 58  HIS A NE2  5  
ATOM 8007  H H    . HIS A 1 7   ? 8.866   3.602   19.374  1.00 0.00 ? 58  HIS A H    5  
ATOM 8008  H HA   . HIS A 1 7   ? 8.586   2.002   17.110  1.00 0.00 ? 58  HIS A HA   5  
ATOM 8009  H HB2  . HIS A 1 7   ? 8.769   1.319   20.037  1.00 0.00 ? 58  HIS A HB2  5  
ATOM 8010  H HB3  . HIS A 1 7   ? 8.526   0.035   18.851  1.00 0.00 ? 58  HIS A HB3  5  
ATOM 8011  H HD1  . HIS A 1 7   ? 10.370  0.182   16.774  1.00 0.00 ? 58  HIS A HD1  5  
ATOM 8012  H HD2  . HIS A 1 7   ? 11.370  2.057   20.357  1.00 0.00 ? 58  HIS A HD2  5  
ATOM 8013  H HE1  . HIS A 1 7   ? 12.872  0.560   16.724  1.00 0.00 ? 58  HIS A HE1  5  
ATOM 8014  N N    . PRO A 1 8   ? 5.809   1.806   18.961  1.00 0.00 ? 59  PRO A N    5  
ATOM 8015  C CA   . PRO A 1 8   ? 4.365   1.431   18.852  1.00 0.00 ? 59  PRO A CA   5  
ATOM 8016  C C    . PRO A 1 8   ? 3.777   1.653   17.441  1.00 0.00 ? 59  PRO A C    5  
ATOM 8017  O O    . PRO A 1 8   ? 2.993   0.858   16.953  1.00 0.00 ? 59  PRO A O    5  
ATOM 8018  C CB   . PRO A 1 8   ? 3.692   2.351   19.876  1.00 0.00 ? 59  PRO A CB   5  
ATOM 8019  C CG   . PRO A 1 8   ? 4.721   2.556   20.956  1.00 0.00 ? 59  PRO A CG   5  
ATOM 8020  C CD   . PRO A 1 8   ? 6.107   2.387   20.298  1.00 0.00 ? 59  PRO A CD   5  
ATOM 8021  H HA   . PRO A 1 8   ? 4.232   0.405   19.147  1.00 0.00 ? 59  PRO A HA   5  
ATOM 8022  H HB2  . PRO A 1 8   ? 3.432   3.291   19.408  1.00 0.00 ? 59  PRO A HB2  5  
ATOM 8023  H HB3  . PRO A 1 8   ? 2.809   1.887   20.290  1.00 0.00 ? 59  PRO A HB3  5  
ATOM 8024  H HG2  . PRO A 1 8   ? 4.622   3.554   21.365  1.00 0.00 ? 59  PRO A HG2  5  
ATOM 8025  H HG3  . PRO A 1 8   ? 4.594   1.826   21.743  1.00 0.00 ? 59  PRO A HG3  5  
ATOM 8026  H HD2  . PRO A 1 8   ? 6.590   3.349   20.214  1.00 0.00 ? 59  PRO A HD2  5  
ATOM 8027  H HD3  . PRO A 1 8   ? 6.717   1.705   20.878  1.00 0.00 ? 59  PRO A HD3  5  
ATOM 8028  N N    . GLY A 1 9   ? 4.150   2.722   16.785  1.00 0.00 ? 60  GLY A N    5  
ATOM 8029  C CA   . GLY A 1 9   ? 3.606   2.988   15.421  1.00 0.00 ? 60  GLY A CA   5  
ATOM 8030  C C    . GLY A 1 9   ? 4.606   3.820   14.617  1.00 0.00 ? 60  GLY A C    5  
ATOM 8031  O O    . GLY A 1 9   ? 5.312   4.649   15.158  1.00 0.00 ? 60  GLY A O    5  
ATOM 8032  H H    . GLY A 1 9   ? 4.788   3.345   17.186  1.00 0.00 ? 60  GLY A H    5  
ATOM 8033  H HA2  . GLY A 1 9   ? 3.419   2.052   14.914  1.00 0.00 ? 60  GLY A HA2  5  
ATOM 8034  H HA3  . GLY A 1 9   ? 2.684   3.541   15.505  1.00 0.00 ? 60  GLY A HA3  5  
ATOM 8035  N N    . GLU A 1 10  ? 4.659   3.606   13.326  1.00 0.00 ? 61  GLU A N    5  
ATOM 8036  C CA   . GLU A 1 10  ? 5.603   4.375   12.446  1.00 0.00 ? 61  GLU A CA   5  
ATOM 8037  C C    . GLU A 1 10  ? 4.907   4.755   11.134  1.00 0.00 ? 61  GLU A C    5  
ATOM 8038  O O    . GLU A 1 10  ? 4.150   3.980   10.574  1.00 0.00 ? 61  GLU A O    5  
ATOM 8039  C CB   . GLU A 1 10  ? 6.825   3.503   12.147  1.00 0.00 ? 61  GLU A CB   5  
ATOM 8040  C CG   . GLU A 1 10  ? 7.912   4.334   11.447  1.00 0.00 ? 61  GLU A CG   5  
ATOM 8041  C CD   . GLU A 1 10  ? 9.047   3.398   11.008  1.00 0.00 ? 61  GLU A CD   5  
ATOM 8042  O OE1  . GLU A 1 10  ? 8.744   2.313   10.530  1.00 0.00 ? 61  GLU A OE1  5  
ATOM 8043  O OE2  . GLU A 1 10  ? 10.195  3.776   11.156  1.00 0.00 ? 61  GLU A OE2  5  
ATOM 8044  H H    . GLU A 1 10  ? 4.065   2.936   12.929  1.00 0.00 ? 61  GLU A H    5  
ATOM 8045  H HA   . GLU A 1 10  ? 5.923   5.277   12.951  1.00 0.00 ? 61  GLU A HA   5  
ATOM 8046  H HB2  . GLU A 1 10  ? 7.214   3.124   13.077  1.00 0.00 ? 61  GLU A HB2  5  
ATOM 8047  H HB3  . GLU A 1 10  ? 6.537   2.675   11.513  1.00 0.00 ? 61  GLU A HB3  5  
ATOM 8048  H HG2  . GLU A 1 10  ? 7.492   4.830   10.583  1.00 0.00 ? 61  GLU A HG2  5  
ATOM 8049  H HG3  . GLU A 1 10  ? 8.304   5.074   12.131  1.00 0.00 ? 61  GLU A HG3  5  
ATOM 8050  N N    . LEU A 1 11  ? 5.158   5.944   10.642  1.00 0.00 ? 62  LEU A N    5  
ATOM 8051  C CA   . LEU A 1 11  ? 4.526   6.392   9.372   1.00 0.00 ? 62  LEU A CA   5  
ATOM 8052  C C    . LEU A 1 11  ? 5.628   6.707   8.346   1.00 0.00 ? 62  LEU A C    5  
ATOM 8053  O O    . LEU A 1 11  ? 6.765   6.941   8.704   1.00 0.00 ? 62  LEU A O    5  
ATOM 8054  C CB   . LEU A 1 11  ? 3.680   7.642   9.642   1.00 0.00 ? 62  LEU A CB   5  
ATOM 8055  C CG   . LEU A 1 11  ? 2.592   7.346   10.713  1.00 0.00 ? 62  LEU A CG   5  
ATOM 8056  C CD1  . LEU A 1 11  ? 3.105   7.695   12.121  1.00 0.00 ? 62  LEU A CD1  5  
ATOM 8057  C CD2  . LEU A 1 11  ? 1.328   8.164   10.414  1.00 0.00 ? 62  LEU A CD2  5  
ATOM 8058  H H    . LEU A 1 11  ? 5.771   6.544   11.109  1.00 0.00 ? 62  LEU A H    5  
ATOM 8059  H HA   . LEU A 1 11  ? 3.889   5.615   8.977   1.00 0.00 ? 62  LEU A HA   5  
ATOM 8060  H HB2  . LEU A 1 11  ? 4.323   8.439   9.981   1.00 0.00 ? 62  LEU A HB2  5  
ATOM 8061  H HB3  . LEU A 1 11  ? 3.208   7.937   8.720   1.00 0.00 ? 62  LEU A HB3  5  
ATOM 8062  H HG   . LEU A 1 11  ? 2.338   6.295   10.697  1.00 0.00 ? 62  LEU A HG   5  
ATOM 8063  H HD11 . LEU A 1 11  ? 3.544   8.681   12.122  1.00 0.00 ? 62  LEU A HD11 5  
ATOM 8064  H HD12 . LEU A 1 11  ? 2.282   7.675   12.815  1.00 0.00 ? 62  LEU A HD12 5  
ATOM 8065  H HD13 . LEU A 1 11  ? 3.846   6.969   12.428  1.00 0.00 ? 62  LEU A HD13 5  
ATOM 8066  H HD21 . LEU A 1 11  ? 1.586   9.205   10.286  1.00 0.00 ? 62  LEU A HD21 5  
ATOM 8067  H HD22 . LEU A 1 11  ? 0.869   7.792   9.509   1.00 0.00 ? 62  LEU A HD22 5  
ATOM 8068  H HD23 . LEU A 1 11  ? 0.634   8.062   11.238  1.00 0.00 ? 62  LEU A HD23 5  
ATOM 8069  N N    . VAL A 1 12  ? 5.298   6.714   7.075   1.00 0.00 ? 63  VAL A N    5  
ATOM 8070  C CA   . VAL A 1 12  ? 6.322   7.019   6.011   1.00 0.00 ? 63  VAL A CA   5  
ATOM 8071  C C    . VAL A 1 12  ? 6.005   8.368   5.387   1.00 0.00 ? 63  VAL A C    5  
ATOM 8072  O O    . VAL A 1 12  ? 4.874   8.653   5.027   1.00 0.00 ? 63  VAL A O    5  
ATOM 8073  C CB   . VAL A 1 12  ? 6.282   5.959   4.908   1.00 0.00 ? 63  VAL A CB   5  
ATOM 8074  C CG1  . VAL A 1 12  ? 7.406   6.210   3.879   1.00 0.00 ? 63  VAL A CG1  5  
ATOM 8075  C CG2  . VAL A 1 12  ? 6.443   4.571   5.532   1.00 0.00 ? 63  VAL A CG2  5  
ATOM 8076  H H    . VAL A 1 12  ? 4.374   6.522   6.818   1.00 0.00 ? 63  VAL A H    5  
ATOM 8077  H HA   . VAL A 1 12  ? 7.312   7.048   6.443   1.00 0.00 ? 63  VAL A HA   5  
ATOM 8078  H HB   . VAL A 1 12  ? 5.328   6.016   4.406   1.00 0.00 ? 63  VAL A HB   5  
ATOM 8079  H HG11 . VAL A 1 12  ? 7.283   7.189   3.434   1.00 0.00 ? 63  VAL A HG11 5  
ATOM 8080  H HG12 . VAL A 1 12  ? 8.375   6.153   4.363   1.00 0.00 ? 63  VAL A HG12 5  
ATOM 8081  H HG13 . VAL A 1 12  ? 7.350   5.457   3.105   1.00 0.00 ? 63  VAL A HG13 5  
ATOM 8082  H HG21 . VAL A 1 12  ? 7.198   4.599   6.308   1.00 0.00 ? 63  VAL A HG21 5  
ATOM 8083  H HG22 . VAL A 1 12  ? 5.501   4.267   5.958   1.00 0.00 ? 63  VAL A HG22 5  
ATOM 8084  H HG23 . VAL A 1 12  ? 6.736   3.865   4.770   1.00 0.00 ? 63  VAL A HG23 5  
ATOM 8085  N N    . ARG A 1 13  ? 6.987   9.204   5.263   1.00 0.00 ? 64  ARG A N    5  
ATOM 8086  C CA   . ARG A 1 13  ? 6.748   10.532  4.666   1.00 0.00 ? 64  ARG A CA   5  
ATOM 8087  C C    . ARG A 1 13  ? 6.606   10.369  3.152   1.00 0.00 ? 64  ARG A C    5  
ATOM 8088  O O    . ARG A 1 13  ? 7.195   9.488   2.561   1.00 0.00 ? 64  ARG A O    5  
ATOM 8089  C CB   . ARG A 1 13  ? 7.920   11.456  4.987   1.00 0.00 ? 64  ARG A CB   5  
ATOM 8090  C CG   . ARG A 1 13  ? 7.482   12.911  4.777   1.00 0.00 ? 64  ARG A CG   5  
ATOM 8091  C CD   . ARG A 1 13  ? 8.699   13.818  4.884   1.00 0.00 ? 64  ARG A CD   5  
ATOM 8092  N NE   . ARG A 1 13  ? 9.509   13.683  3.639   1.00 0.00 ? 64  ARG A NE   5  
ATOM 8093  C CZ   . ARG A 1 13  ? 10.546  14.468  3.426   1.00 0.00 ? 64  ARG A CZ   5  
ATOM 8094  N NH1  . ARG A 1 13  ? 10.854  15.389  4.303   1.00 0.00 ? 64  ARG A NH1  5  
ATOM 8095  N NH2  . ARG A 1 13  ? 11.267  14.327  2.341   1.00 0.00 ? 64  ARG A NH2  5  
ATOM 8096  H H    . ARG A 1 13  ? 7.885   8.958   5.568   1.00 0.00 ? 64  ARG A H    5  
ATOM 8097  H HA   . ARG A 1 13  ? 5.845   10.946  5.071   1.00 0.00 ? 64  ARG A HA   5  
ATOM 8098  H HB2  . ARG A 1 13  ? 8.213   11.307  6.014   1.00 0.00 ? 64  ARG A HB2  5  
ATOM 8099  H HB3  . ARG A 1 13  ? 8.755   11.230  4.336   1.00 0.00 ? 64  ARG A HB3  5  
ATOM 8100  H HG2  . ARG A 1 13  ? 7.033   13.015  3.803   1.00 0.00 ? 64  ARG A HG2  5  
ATOM 8101  H HG3  . ARG A 1 13  ? 6.765   13.194  5.540   1.00 0.00 ? 64  ARG A HG3  5  
ATOM 8102  H HD2  . ARG A 1 13  ? 8.383   14.835  4.995   1.00 0.00 ? 64  ARG A HD2  5  
ATOM 8103  H HD3  . ARG A 1 13  ? 9.277   13.526  5.747   1.00 0.00 ? 64  ARG A HD3  5  
ATOM 8104  H HE   . ARG A 1 13  ? 9.255   13.001  2.978   1.00 0.00 ? 64  ARG A HE   5  
ATOM 8105  H HH11 . ARG A 1 13  ? 10.297  15.494  5.122   1.00 0.00 ? 64  ARG A HH11 5  
ATOM 8106  H HH12 . ARG A 1 13  ? 11.649  15.983  4.160   1.00 0.00 ? 64  ARG A HH12 5  
ATOM 8107  H HH21 . ARG A 1 13  ? 11.037  13.618  1.680   1.00 0.00 ? 64  ARG A HH21 5  
ATOM 8108  H HH22 . ARG A 1 13  ? 12.042  14.938  2.166   1.00 0.00 ? 64  ARG A HH22 5  
ATOM 8109  N N    . THR A 1 14  ? 5.816   11.202  2.525   1.00 0.00 ? 65  THR A N    5  
ATOM 8110  C CA   . THR A 1 14  ? 5.607   11.117  1.059   1.00 0.00 ? 65  THR A CA   5  
ATOM 8111  C C    . THR A 1 14  ? 6.029   12.440  0.432   1.00 0.00 ? 65  THR A C    5  
ATOM 8112  O O    . THR A 1 14  ? 6.414   13.367  1.116   1.00 0.00 ? 65  THR A O    5  
ATOM 8113  C CB   . THR A 1 14  ? 4.124   10.867  0.806   1.00 0.00 ? 65  THR A CB   5  
ATOM 8114  O OG1  . THR A 1 14  ? 3.384   11.977  1.270   1.00 0.00 ? 65  THR A OG1  5  
ATOM 8115  C CG2  . THR A 1 14  ? 3.670   9.603   1.543   1.00 0.00 ? 65  THR A CG2  5  
ATOM 8116  H H    . THR A 1 14  ? 5.352   11.894  3.024   1.00 0.00 ? 65  THR A H    5  
ATOM 8117  H HA   . THR A 1 14  ? 6.186   10.314  0.630   1.00 0.00 ? 65  THR A HA   5  
ATOM 8118  H HB   . THR A 1 14  ? 3.964   10.748  -0.244  1.00 0.00 ? 65  THR A HB   5  
ATOM 8119  H HG1  . THR A 1 14  ? 3.993   12.571  1.705   1.00 0.00 ? 65  THR A HG1  5  
ATOM 8120  H HG21 . THR A 1 14  ? 4.078   9.598   2.547   1.00 0.00 ? 65  THR A HG21 5  
ATOM 8121  H HG22 . THR A 1 14  ? 2.589   9.585   1.598   1.00 0.00 ? 65  THR A HG22 5  
ATOM 8122  H HG23 . THR A 1 14  ? 4.016   8.734   1.009   1.00 0.00 ? 65  THR A HG23 5  
ATOM 8123  N N    . ASP A 1 15  ? 5.970   12.541  -0.863  1.00 0.00 ? 66  ASP A N    5  
ATOM 8124  C CA   . ASP A 1 15  ? 6.394   13.813  -1.510  1.00 0.00 ? 66  ASP A CA   5  
ATOM 8125  C C    . ASP A 1 15  ? 5.515   14.950  -0.981  1.00 0.00 ? 66  ASP A C    5  
ATOM 8126  O O    . ASP A 1 15  ? 5.965   16.077  -0.857  1.00 0.00 ? 66  ASP A O    5  
ATOM 8127  C CB   . ASP A 1 15  ? 6.259   13.707  -3.032  1.00 0.00 ? 66  ASP A CB   5  
ATOM 8128  C CG   . ASP A 1 15  ? 7.313   12.743  -3.591  1.00 0.00 ? 66  ASP A CG   5  
ATOM 8129  O OD1  . ASP A 1 15  ? 8.093   12.227  -2.810  1.00 0.00 ? 66  ASP A OD1  5  
ATOM 8130  O OD2  . ASP A 1 15  ? 7.307   12.532  -4.793  1.00 0.00 ? 66  ASP A OD2  5  
ATOM 8131  H H    . ASP A 1 15  ? 5.672   11.782  -1.404  1.00 0.00 ? 66  ASP A H    5  
ATOM 8132  H HA   . ASP A 1 15  ? 7.422   14.008  -1.246  1.00 0.00 ? 66  ASP A HA   5  
ATOM 8133  H HB2  . ASP A 1 15  ? 5.272   13.340  -3.278  1.00 0.00 ? 66  ASP A HB2  5  
ATOM 8134  H HB3  . ASP A 1 15  ? 6.394   14.685  -3.476  1.00 0.00 ? 66  ASP A HB3  5  
ATOM 8135  N N    . SER A 1 16  ? 4.279   14.671  -0.624  1.00 0.00 ? 67  SER A N    5  
ATOM 8136  C CA   . SER A 1 16  ? 3.421   15.750  -0.046  1.00 0.00 ? 67  SER A CA   5  
ATOM 8137  C C    . SER A 1 16  ? 3.741   15.863  1.459   1.00 0.00 ? 67  SER A C    5  
ATOM 8138  O O    . SER A 1 16  ? 3.894   14.858  2.137   1.00 0.00 ? 67  SER A O    5  
ATOM 8139  C CB   . SER A 1 16  ? 1.939   15.421  -0.222  1.00 0.00 ? 67  SER A CB   5  
ATOM 8140  O OG   . SER A 1 16  ? 1.168   16.390  0.478   1.00 0.00 ? 67  SER A OG   5  
ATOM 8141  H H    . SER A 1 16  ? 3.934   13.758  -0.703  1.00 0.00 ? 67  SER A H    5  
ATOM 8142  H HA   . SER A 1 16  ? 3.644   16.678  -0.547  1.00 0.00 ? 67  SER A HA   5  
ATOM 8143  H HB2  . SER A 1 16  ? 1.677   15.453  -1.263  1.00 0.00 ? 67  SER A HB2  5  
ATOM 8144  H HB3  . SER A 1 16  ? 1.738   14.433  0.171   1.00 0.00 ? 67  SER A HB3  5  
ATOM 8145  H HG   . SER A 1 16  ? 1.722   16.771  1.164   1.00 0.00 ? 67  SER A HG   5  
ATOM 8146  N N    . PRO A 1 17  ? 3.857   17.053  1.993   1.00 0.00 ? 68  PRO A N    5  
ATOM 8147  C CA   . PRO A 1 17  ? 4.180   17.242  3.432   1.00 0.00 ? 68  PRO A CA   5  
ATOM 8148  C C    . PRO A 1 17  ? 2.987   16.987  4.341   1.00 0.00 ? 68  PRO A C    5  
ATOM 8149  O O    . PRO A 1 17  ? 2.962   17.453  5.457   1.00 0.00 ? 68  PRO A O    5  
ATOM 8150  C CB   . PRO A 1 17  ? 4.592   18.711  3.511   1.00 0.00 ? 68  PRO A CB   5  
ATOM 8151  C CG   . PRO A 1 17  ? 3.767   19.366  2.461   1.00 0.00 ? 68  PRO A CG   5  
ATOM 8152  C CD   . PRO A 1 17  ? 3.686   18.353  1.316   1.00 0.00 ? 68  PRO A CD   5  
ATOM 8153  H HA   . PRO A 1 17  ? 5.002   16.619  3.718   1.00 0.00 ? 68  PRO A HA   5  
ATOM 8154  H HB2  . PRO A 1 17  ? 4.376   19.128  4.490   1.00 0.00 ? 68  PRO A HB2  5  
ATOM 8155  H HB3  . PRO A 1 17  ? 5.637   18.822  3.277   1.00 0.00 ? 68  PRO A HB3  5  
ATOM 8156  H HG2  . PRO A 1 17  ? 2.779   19.582  2.845   1.00 0.00 ? 68  PRO A HG2  5  
ATOM 8157  H HG3  . PRO A 1 17  ? 4.242   20.267  2.116   1.00 0.00 ? 68  PRO A HG3  5  
ATOM 8158  H HD2  . PRO A 1 17  ? 2.724   18.404  0.824   1.00 0.00 ? 68  PRO A HD2  5  
ATOM 8159  H HD3  . PRO A 1 17  ? 4.487   18.517  0.610   1.00 0.00 ? 68  PRO A HD3  5  
ATOM 8160  N N    . ASN A 1 18  ? 1.990   16.274  3.887   1.00 0.00 ? 69  ASN A N    5  
ATOM 8161  C CA   . ASN A 1 18  ? 0.808   16.031  4.766   1.00 0.00 ? 69  ASN A CA   5  
ATOM 8162  C C    . ASN A 1 18  ? 0.302   14.595  4.644   1.00 0.00 ? 69  ASN A C    5  
ATOM 8163  O O    . ASN A 1 18  ? -0.390  14.109  5.515   1.00 0.00 ? 69  ASN A O    5  
ATOM 8164  C CB   . ASN A 1 18  ? -0.310  16.957  4.326   1.00 0.00 ? 69  ASN A CB   5  
ATOM 8165  C CG   . ASN A 1 18  ? 0.128   18.405  4.493   1.00 0.00 ? 69  ASN A CG   5  
ATOM 8166  O OD1  . ASN A 1 18  ? -0.110  19.224  3.627   1.00 0.00 ? 69  ASN A OD1  5  
ATOM 8167  N ND2  . ASN A 1 18  ? 0.772   18.759  5.572   1.00 0.00 ? 69  ASN A ND2  5  
ATOM 8168  H H    . ASN A 1 18  ? 2.007   15.920  2.973   1.00 0.00 ? 69  ASN A H    5  
ATOM 8169  H HA   . ASN A 1 18  ? 1.058   16.238  5.794   1.00 0.00 ? 69  ASN A HA   5  
ATOM 8170  H HB2  . ASN A 1 18  ? -0.526  16.768  3.282   1.00 0.00 ? 69  ASN A HB2  5  
ATOM 8171  H HB3  . ASN A 1 18  ? -1.190  16.768  4.920   1.00 0.00 ? 69  ASN A HB3  5  
ATOM 8172  H HD21 . ASN A 1 18  ? 0.969   18.096  6.273   1.00 0.00 ? 69  ASN A HD21 5  
ATOM 8173  H HD22 . ASN A 1 18  ? 1.071   19.686  5.676   1.00 0.00 ? 69  ASN A HD22 5  
ATOM 8174  N N    . PHE A 1 19  ? 0.613   13.928  3.563   1.00 0.00 ? 70  PHE A N    5  
ATOM 8175  C CA   . PHE A 1 19  ? 0.122   12.532  3.357   1.00 0.00 ? 70  PHE A CA   5  
ATOM 8176  C C    . PHE A 1 19  ? 1.181   11.509  3.776   1.00 0.00 ? 70  PHE A C    5  
ATOM 8177  O O    . PHE A 1 19  ? 2.313   11.552  3.335   1.00 0.00 ? 70  PHE A O    5  
ATOM 8178  C CB   . PHE A 1 19  ? -0.221  12.345  1.860   1.00 0.00 ? 70  PHE A CB   5  
ATOM 8179  C CG   . PHE A 1 19  ? -1.716  12.194  1.663   1.00 0.00 ? 70  PHE A CG   5  
ATOM 8180  C CD1  . PHE A 1 19  ? -2.583  13.202  2.097   1.00 0.00 ? 70  PHE A CD1  5  
ATOM 8181  C CD2  . PHE A 1 19  ? -2.227  11.056  1.018   1.00 0.00 ? 70  PHE A CD2  5  
ATOM 8182  C CE1  . PHE A 1 19  ? -3.956  13.071  1.895   1.00 0.00 ? 70  PHE A CE1  5  
ATOM 8183  C CE2  . PHE A 1 19  ? -3.597  10.921  0.818   1.00 0.00 ? 70  PHE A CE2  5  
ATOM 8184  C CZ   . PHE A 1 19  ? -4.465  11.940  1.258   1.00 0.00 ? 70  PHE A CZ   5  
ATOM 8185  H H    . PHE A 1 19  ? 1.157   14.355  2.878   1.00 0.00 ? 70  PHE A H    5  
ATOM 8186  H HA   . PHE A 1 19  ? -0.764  12.376  3.954   1.00 0.00 ? 70  PHE A HA   5  
ATOM 8187  H HB2  . PHE A 1 19  ? 0.118   13.204  1.309   1.00 0.00 ? 70  PHE A HB2  5  
ATOM 8188  H HB3  . PHE A 1 19  ? 0.274   11.470  1.476   1.00 0.00 ? 70  PHE A HB3  5  
ATOM 8189  H HD1  . PHE A 1 19  ? -2.194  14.076  2.598   1.00 0.00 ? 70  PHE A HD1  5  
ATOM 8190  H HD2  . PHE A 1 19  ? -1.556  10.281  0.686   1.00 0.00 ? 70  PHE A HD2  5  
ATOM 8191  H HE1  . PHE A 1 19  ? -4.625  13.849  2.224   1.00 0.00 ? 70  PHE A HE1  5  
ATOM 8192  H HE2  . PHE A 1 19  ? -3.985  10.037  0.319   1.00 0.00 ? 70  PHE A HE2  5  
ATOM 8193  H HZ   . PHE A 1 19  ? -5.524  11.855  1.108   1.00 0.00 ? 70  PHE A HZ   5  
ATOM 8194  N N    . LEU A 1 20  ? 0.797   10.576  4.609   1.00 0.00 ? 71  LEU A N    5  
ATOM 8195  C CA   . LEU A 1 20  ? 1.746   9.511   5.053   1.00 0.00 ? 71  LEU A CA   5  
ATOM 8196  C C    . LEU A 1 20  ? 0.990   8.179   5.176   1.00 0.00 ? 71  LEU A C    5  
ATOM 8197  O O    . LEU A 1 20  ? -0.190  8.164   5.453   1.00 0.00 ? 71  LEU A O    5  
ATOM 8198  C CB   . LEU A 1 20  ? 2.334   9.874   6.414   1.00 0.00 ? 71  LEU A CB   5  
ATOM 8199  C CG   . LEU A 1 20  ? 3.194   11.164  6.316   1.00 0.00 ? 71  LEU A CG   5  
ATOM 8200  C CD1  . LEU A 1 20  ? 2.328   12.398  6.662   1.00 0.00 ? 71  LEU A CD1  5  
ATOM 8201  C CD2  . LEU A 1 20  ? 4.379   11.087  7.304   1.00 0.00 ? 71  LEU A CD2  5  
ATOM 8202  H H    . LEU A 1 20  ? -0.133  10.563  4.927   1.00 0.00 ? 71  LEU A H    5  
ATOM 8203  H HA   . LEU A 1 20  ? 2.546   9.406   4.338   1.00 0.00 ? 71  LEU A HA   5  
ATOM 8204  H HB2  . LEU A 1 20  ? 1.525   10.020  7.117   1.00 0.00 ? 71  LEU A HB2  5  
ATOM 8205  H HB3  . LEU A 1 20  ? 2.948   9.053   6.744   1.00 0.00 ? 71  LEU A HB3  5  
ATOM 8206  H HG   . LEU A 1 20  ? 3.584   11.267  5.306   1.00 0.00 ? 71  LEU A HG   5  
ATOM 8207  H HD11 . LEU A 1 20  ? 1.360   12.305  6.203   1.00 0.00 ? 71  LEU A HD11 5  
ATOM 8208  H HD12 . LEU A 1 20  ? 2.203   12.460  7.731   1.00 0.00 ? 71  LEU A HD12 5  
ATOM 8209  H HD13 . LEU A 1 20  ? 2.810   13.299  6.305   1.00 0.00 ? 71  LEU A HD13 5  
ATOM 8210  H HD21 . LEU A 1 20  ? 4.970   10.206  7.096   1.00 0.00 ? 71  LEU A HD21 5  
ATOM 8211  H HD22 . LEU A 1 20  ? 4.998   11.969  7.190   1.00 0.00 ? 71  LEU A HD22 5  
ATOM 8212  H HD23 . LEU A 1 20  ? 4.009   11.040  8.321   1.00 0.00 ? 71  LEU A HD23 5  
ATOM 8213  N N    . CYS A 1 21  ? 1.665   7.062   5.001   1.00 0.00 ? 72  CYS A N    5  
ATOM 8214  C CA   . CYS A 1 21  ? 0.994   5.723   5.137   1.00 0.00 ? 72  CYS A CA   5  
ATOM 8215  C C    . CYS A 1 21  ? 1.408   5.134   6.491   1.00 0.00 ? 72  CYS A C    5  
ATOM 8216  O O    . CYS A 1 21  ? 2.582   5.066   6.814   1.00 0.00 ? 72  CYS A O    5  
ATOM 8217  C CB   . CYS A 1 21  ? 1.445   4.790   4.005   1.00 0.00 ? 72  CYS A CB   5  
ATOM 8218  S SG   . CYS A 1 21  ? 1.223   5.610   2.401   1.00 0.00 ? 72  CYS A SG   5  
ATOM 8219  H H    . CYS A 1 21  ? 2.625   7.103   4.805   1.00 0.00 ? 72  CYS A H    5  
ATOM 8220  H HA   . CYS A 1 21  ? -0.087  5.836   5.111   1.00 0.00 ? 72  CYS A HA   5  
ATOM 8221  H HB2  . CYS A 1 21  ? 2.481   4.537   4.142   1.00 0.00 ? 72  CYS A HB2  5  
ATOM 8222  H HB3  . CYS A 1 21  ? 0.854   3.886   4.027   1.00 0.00 ? 72  CYS A HB3  5  
ATOM 8223  H HG   . CYS A 1 21  ? 2.001   5.433   1.861   1.00 0.00 ? 72  CYS A HG   5  
ATOM 8224  N N    . SER A 1 22  ? 0.453   4.746   7.298   1.00 0.00 ? 73  SER A N    5  
ATOM 8225  C CA   . SER A 1 22  ? 0.771   4.196   8.650   1.00 0.00 ? 73  SER A CA   5  
ATOM 8226  C C    . SER A 1 22  ? 1.639   2.928   8.587   1.00 0.00 ? 73  SER A C    5  
ATOM 8227  O O    . SER A 1 22  ? 2.447   2.692   9.459   1.00 0.00 ? 73  SER A O    5  
ATOM 8228  C CB   . SER A 1 22  ? -0.518  3.869   9.406   1.00 0.00 ? 73  SER A CB   5  
ATOM 8229  O OG   . SER A 1 22  ? -1.302  5.043   9.569   1.00 0.00 ? 73  SER A OG   5  
ATOM 8230  H H    . SER A 1 22  ? -0.484  4.830   7.013   1.00 0.00 ? 73  SER A H    5  
ATOM 8231  H HA   . SER A 1 22  ? 1.306   4.947   9.198   1.00 0.00 ? 73  SER A HA   5  
ATOM 8232  H HB2  . SER A 1 22  ? -1.077  3.151   8.847   1.00 0.00 ? 73  SER A HB2  5  
ATOM 8233  H HB3  . SER A 1 22  ? -0.270  3.451   10.376  1.00 0.00 ? 73  SER A HB3  5  
ATOM 8234  H HG   . SER A 1 22  ? -2.096  4.799   10.058  1.00 0.00 ? 73  SER A HG   5  
ATOM 8235  N N    . VAL A 1 23  ? 1.436   2.078   7.613   1.00 0.00 ? 74  VAL A N    5  
ATOM 8236  C CA   . VAL A 1 23  ? 2.206   0.787   7.550   1.00 0.00 ? 74  VAL A CA   5  
ATOM 8237  C C    . VAL A 1 23  ? 3.399   0.890   6.611   1.00 0.00 ? 74  VAL A C    5  
ATOM 8238  O O    . VAL A 1 23  ? 3.541   1.826   5.843   1.00 0.00 ? 74  VAL A O    5  
ATOM 8239  C CB   . VAL A 1 23  ? 1.276   -0.326  7.060   1.00 0.00 ? 74  VAL A CB   5  
ATOM 8240  C CG1  . VAL A 1 23  ? 1.988   -1.689  7.145   1.00 0.00 ? 74  VAL A CG1  5  
ATOM 8241  C CG2  . VAL A 1 23  ? 0.020   -0.352  7.933   1.00 0.00 ? 74  VAL A CG2  5  
ATOM 8242  H H    . VAL A 1 23  ? 0.741   2.259   6.950   1.00 0.00 ? 74  VAL A H    5  
ATOM 8243  H HA   . VAL A 1 23  ? 2.567   0.533   8.539   1.00 0.00 ? 74  VAL A HA   5  
ATOM 8244  H HB   . VAL A 1 23  ? 0.994   -0.130  6.030   1.00 0.00 ? 74  VAL A HB   5  
ATOM 8245  H HG11 . VAL A 1 23  ? 2.588   -1.738  8.038   1.00 0.00 ? 74  VAL A HG11 5  
ATOM 8246  H HG12 . VAL A 1 23  ? 1.254   -2.480  7.169   1.00 0.00 ? 74  VAL A HG12 5  
ATOM 8247  H HG13 . VAL A 1 23  ? 2.624   -1.820  6.277   1.00 0.00 ? 74  VAL A HG13 5  
ATOM 8248  H HG21 . VAL A 1 23  ? 0.300   -0.246  8.972   1.00 0.00 ? 74  VAL A HG21 5  
ATOM 8249  H HG22 . VAL A 1 23  ? -0.633  0.459   7.652   1.00 0.00 ? 74  VAL A HG22 5  
ATOM 8250  H HG23 . VAL A 1 23  ? -0.498  -1.291  7.793   1.00 0.00 ? 74  VAL A HG23 5  
ATOM 8251  N N    . LEU A 1 24  ? 4.258   -0.097  6.667   1.00 0.00 ? 75  LEU A N    5  
ATOM 8252  C CA   . LEU A 1 24  ? 5.463   -0.113  5.798   1.00 0.00 ? 75  LEU A CA   5  
ATOM 8253  C C    . LEU A 1 24  ? 5.323   -1.280  4.815   1.00 0.00 ? 75  LEU A C    5  
ATOM 8254  O O    . LEU A 1 24  ? 5.883   -2.338  5.032   1.00 0.00 ? 75  LEU A O    5  
ATOM 8255  C CB   . LEU A 1 24  ? 6.724   -0.350  6.634   1.00 0.00 ? 75  LEU A CB   5  
ATOM 8256  C CG   . LEU A 1 24  ? 6.828   0.643   7.811   1.00 0.00 ? 75  LEU A CG   5  
ATOM 8257  C CD1  . LEU A 1 24  ? 6.595   2.074   7.307   1.00 0.00 ? 75  LEU A CD1  5  
ATOM 8258  C CD2  . LEU A 1 24  ? 5.807   0.299   8.913   1.00 0.00 ? 75  LEU A CD2  5  
ATOM 8259  H H    . LEU A 1 24  ? 4.103   -0.840  7.292   1.00 0.00 ? 75  LEU A H    5  
ATOM 8260  H HA   . LEU A 1 24  ? 5.555   0.812   5.269   1.00 0.00 ? 75  LEU A HA   5  
ATOM 8261  H HB2  . LEU A 1 24  ? 6.713   -1.356  7.013   1.00 0.00 ? 75  LEU A HB2  5  
ATOM 8262  H HB3  . LEU A 1 24  ? 7.583   -0.232  5.995   1.00 0.00 ? 75  LEU A HB3  5  
ATOM 8263  H HG   . LEU A 1 24  ? 7.829   0.578   8.229   1.00 0.00 ? 75  LEU A HG   5  
ATOM 8264  H HD11 . LEU A 1 24  ? 7.178   2.237   6.411   1.00 0.00 ? 75  LEU A HD11 5  
ATOM 8265  H HD12 . LEU A 1 24  ? 5.552   2.216   7.088   1.00 0.00 ? 75  LEU A HD12 5  
ATOM 8266  H HD13 . LEU A 1 24  ? 6.894   2.780   8.066   1.00 0.00 ? 75  LEU A HD13 5  
ATOM 8267  H HD21 . LEU A 1 24  ? 5.600   -0.761  8.904   1.00 0.00 ? 75  LEU A HD21 5  
ATOM 8268  H HD22 . LEU A 1 24  ? 6.218   0.570   9.872   1.00 0.00 ? 75  LEU A HD22 5  
ATOM 8269  H HD23 . LEU A 1 24  ? 4.889   0.842   8.753   1.00 0.00 ? 75  LEU A HD23 5  
ATOM 8270  N N    . PRO A 1 25  ? 4.575   -1.115  3.747   1.00 0.00 ? 76  PRO A N    5  
ATOM 8271  C CA   . PRO A 1 25  ? 4.384   -2.215  2.757   1.00 0.00 ? 76  PRO A CA   5  
ATOM 8272  C C    . PRO A 1 25  ? 5.646   -2.458  1.923   1.00 0.00 ? 76  PRO A C    5  
ATOM 8273  O O    . PRO A 1 25  ? 5.624   -3.117  0.899   1.00 0.00 ? 76  PRO A O    5  
ATOM 8274  C CB   . PRO A 1 25  ? 3.235   -1.719  1.879   1.00 0.00 ? 76  PRO A CB   5  
ATOM 8275  C CG   . PRO A 1 25  ? 3.310   -0.228  1.947   1.00 0.00 ? 76  PRO A CG   5  
ATOM 8276  C CD   . PRO A 1 25  ? 3.824   0.106   3.355   1.00 0.00 ? 76  PRO A CD   5  
ATOM 8277  H HA   . PRO A 1 25  ? 4.094   -3.122  3.264   1.00 0.00 ? 76  PRO A HA   5  
ATOM 8278  H HB2  . PRO A 1 25  ? 3.362   -2.065  0.862   1.00 0.00 ? 76  PRO A HB2  5  
ATOM 8279  H HB3  . PRO A 1 25  ? 2.291   -2.059  2.274   1.00 0.00 ? 76  PRO A HB3  5  
ATOM 8280  H HG2  . PRO A 1 25  ? 3.997   0.142   1.194   1.00 0.00 ? 76  PRO A HG2  5  
ATOM 8281  H HG3  . PRO A 1 25  ? 2.327   0.208   1.799   1.00 0.00 ? 76  PRO A HG3  5  
ATOM 8282  H HD2  . PRO A 1 25  ? 4.459   0.980   3.323   1.00 0.00 ? 76  PRO A HD2  5  
ATOM 8283  H HD3  . PRO A 1 25  ? 2.995   0.263   4.029   1.00 0.00 ? 76  PRO A HD3  5  
ATOM 8284  N N    . THR A 1 26  ? 6.746   -1.939  2.363   1.00 0.00 ? 77  THR A N    5  
ATOM 8285  C CA   . THR A 1 26  ? 8.008   -2.138  1.606   1.00 0.00 ? 77  THR A CA   5  
ATOM 8286  C C    . THR A 1 26  ? 8.329   -3.631  1.570   1.00 0.00 ? 77  THR A C    5  
ATOM 8287  O O    . THR A 1 26  ? 8.996   -4.115  0.668   1.00 0.00 ? 77  THR A O    5  
ATOM 8288  C CB   . THR A 1 26  ? 9.153   -1.370  2.273   1.00 0.00 ? 77  THR A CB   5  
ATOM 8289  O OG1  . THR A 1 26  ? 9.454   -1.958  3.529   1.00 0.00 ? 77  THR A OG1  5  
ATOM 8290  C CG2  . THR A 1 26  ? 8.751   0.100   2.471   1.00 0.00 ? 77  THR A CG2  5  
ATOM 8291  H H    . THR A 1 26  ? 6.740   -1.422  3.193   1.00 0.00 ? 77  THR A H    5  
ATOM 8292  H HA   . THR A 1 26  ? 7.879   -1.780  0.596   1.00 0.00 ? 77  THR A HA   5  
ATOM 8293  H HB   . THR A 1 26  ? 10.024  -1.413  1.636   1.00 0.00 ? 77  THR A HB   5  
ATOM 8294  H HG1  . THR A 1 26  ? 10.221  -2.527  3.417   1.00 0.00 ? 77  THR A HG1  5  
ATOM 8295  H HG21 . THR A 1 26  ? 8.211   0.451   1.600   1.00 0.00 ? 77  THR A HG21 5  
ATOM 8296  H HG22 . THR A 1 26  ? 8.120   0.193   3.346   1.00 0.00 ? 77  THR A HG22 5  
ATOM 8297  H HG23 . THR A 1 26  ? 9.642   0.695   2.603   1.00 0.00 ? 77  THR A HG23 5  
ATOM 8298  N N    . HIS A 1 27  ? 7.868   -4.372  2.553   1.00 0.00 ? 78  HIS A N    5  
ATOM 8299  C CA   . HIS A 1 27  ? 8.143   -5.841  2.574   1.00 0.00 ? 78  HIS A CA   5  
ATOM 8300  C C    . HIS A 1 27  ? 6.924   -6.628  3.063   1.00 0.00 ? 78  HIS A C    5  
ATOM 8301  O O    . HIS A 1 27  ? 6.481   -6.482  4.182   1.00 0.00 ? 78  HIS A O    5  
ATOM 8302  C CB   . HIS A 1 27  ? 9.330   -6.127  3.487   1.00 0.00 ? 78  HIS A CB   5  
ATOM 8303  C CG   . HIS A 1 27  ? 9.759   -7.558  3.301   1.00 0.00 ? 78  HIS A CG   5  
ATOM 8304  N ND1  . HIS A 1 27  ? 10.906  -7.880  2.595   1.00 0.00 ? 78  HIS A ND1  5  
ATOM 8305  C CD2  . HIS A 1 27  ? 9.218   -8.760  3.701   1.00 0.00 ? 78  HIS A CD2  5  
ATOM 8306  C CE1  . HIS A 1 27  ? 11.018  -9.216  2.585   1.00 0.00 ? 78  HIS A CE1  5  
ATOM 8307  N NE2  . HIS A 1 27  ? 10.017  -9.805  3.246   1.00 0.00 ? 78  HIS A NE2  5  
ATOM 8308  H H    . HIS A 1 27  ? 7.336   -3.960  3.270   1.00 0.00 ? 78  HIS A H    5  
ATOM 8309  H HA   . HIS A 1 27  ? 8.377   -6.173  1.582   1.00 0.00 ? 78  HIS A HA   5  
ATOM 8310  H HB2  . HIS A 1 27  ? 10.150  -5.470  3.224   1.00 0.00 ? 78  HIS A HB2  5  
ATOM 8311  H HB3  . HIS A 1 27  ? 9.044   -5.954  4.513   1.00 0.00 ? 78  HIS A HB3  5  
ATOM 8312  H HD1  . HIS A 1 27  ? 11.529  -7.246  2.182   1.00 0.00 ? 78  HIS A HD1  5  
ATOM 8313  H HD2  . HIS A 1 27  ? 8.311   -8.880  4.273   1.00 0.00 ? 78  HIS A HD2  5  
ATOM 8314  H HE1  . HIS A 1 27  ? 11.816  -9.747  2.094   1.00 0.00 ? 78  HIS A HE1  5  
ATOM 8315  N N    . TRP A 1 28  ? 6.413   -7.498  2.231   1.00 0.00 ? 79  TRP A N    5  
ATOM 8316  C CA   . TRP A 1 28  ? 5.250   -8.348  2.619   1.00 0.00 ? 79  TRP A CA   5  
ATOM 8317  C C    . TRP A 1 28  ? 5.357   -9.676  1.872   1.00 0.00 ? 79  TRP A C    5  
ATOM 8318  O O    . TRP A 1 28  ? 6.102   -9.801  0.929   1.00 0.00 ? 79  TRP A O    5  
ATOM 8319  C CB   . TRP A 1 28  ? 3.922   -7.660  2.269   1.00 0.00 ? 79  TRP A CB   5  
ATOM 8320  C CG   . TRP A 1 28  ? 2.813   -8.652  2.442   1.00 0.00 ? 79  TRP A CG   5  
ATOM 8321  C CD1  . TRP A 1 28  ? 2.122   -9.211  1.426   1.00 0.00 ? 79  TRP A CD1  5  
ATOM 8322  C CD2  . TRP A 1 28  ? 2.292   -9.252  3.672   1.00 0.00 ? 79  TRP A CD2  5  
ATOM 8323  N NE1  . TRP A 1 28  ? 1.201   -10.104 1.952   1.00 0.00 ? 79  TRP A NE1  5  
ATOM 8324  C CE2  . TRP A 1 28  ? 1.271   -10.166 3.328   1.00 0.00 ? 79  TRP A CE2  5  
ATOM 8325  C CE3  . TRP A 1 28  ? 2.605   -9.101  5.036   1.00 0.00 ? 79  TRP A CE3  5  
ATOM 8326  C CZ2  . TRP A 1 28  ? 0.576   -10.891 4.300   1.00 0.00 ? 79  TRP A CZ2  5  
ATOM 8327  C CZ3  . TRP A 1 28  ? 1.907   -9.829  6.014   1.00 0.00 ? 79  TRP A CZ3  5  
ATOM 8328  C CH2  . TRP A 1 28  ? 0.901   -10.727 5.642   1.00 0.00 ? 79  TRP A CH2  5  
ATOM 8329  H H    . TRP A 1 28  ? 6.811   -7.606  1.342   1.00 0.00 ? 79  TRP A H    5  
ATOM 8330  H HA   . TRP A 1 28  ? 5.284   -8.544  3.679   1.00 0.00 ? 79  TRP A HA   5  
ATOM 8331  H HB2  . TRP A 1 28  ? 3.767   -6.820  2.926   1.00 0.00 ? 79  TRP A HB2  5  
ATOM 8332  H HB3  . TRP A 1 28  ? 3.948   -7.319  1.245   1.00 0.00 ? 79  TRP A HB3  5  
ATOM 8333  H HD1  . TRP A 1 28  ? 2.266   -8.994  0.375   1.00 0.00 ? 79  TRP A HD1  5  
ATOM 8334  H HE1  . TRP A 1 28  ? 0.568   -10.636 1.431   1.00 0.00 ? 79  TRP A HE1  5  
ATOM 8335  H HE3  . TRP A 1 28  ? 3.383   -8.420  5.335   1.00 0.00 ? 79  TRP A HE3  5  
ATOM 8336  H HZ2  . TRP A 1 28  ? -0.192  -11.589 4.016   1.00 0.00 ? 79  TRP A HZ2  5  
ATOM 8337  H HZ3  . TRP A 1 28  ? 2.157   -9.706  7.060   1.00 0.00 ? 79  TRP A HZ3  5  
ATOM 8338  H HH2  . TRP A 1 28  ? 0.369   -11.286 6.390   1.00 0.00 ? 79  TRP A HH2  5  
ATOM 8339  N N    . ARG A 1 29  ? 4.608   -10.665 2.293   1.00 0.00 ? 80  ARG A N    5  
ATOM 8340  C CA   . ARG A 1 29  ? 4.641   -12.011 1.613   1.00 0.00 ? 80  ARG A CA   5  
ATOM 8341  C C    . ARG A 1 29  ? 3.223   -12.431 1.241   1.00 0.00 ? 80  ARG A C    5  
ATOM 8342  O O    . ARG A 1 29  ? 2.574   -13.164 1.966   1.00 0.00 ? 80  ARG A O    5  
ATOM 8343  C CB   . ARG A 1 29  ? 5.234   -13.070 2.549   1.00 0.00 ? 80  ARG A CB   5  
ATOM 8344  C CG   . ARG A 1 29  ? 6.652   -12.661 2.919   1.00 0.00 ? 80  ARG A CG   5  
ATOM 8345  C CD   . ARG A 1 29  ? 7.339   -13.785 3.692   1.00 0.00 ? 80  ARG A CD   5  
ATOM 8346  N NE   . ARG A 1 29  ? 8.625   -13.264 4.219   1.00 0.00 ? 80  ARG A NE   5  
ATOM 8347  C CZ   . ARG A 1 29  ? 9.232   -13.883 5.186   1.00 0.00 ? 80  ARG A CZ   5  
ATOM 8348  N NH1  . ARG A 1 29  ? 8.708   -14.966 5.710   1.00 0.00 ? 80  ARG A NH1  5  
ATOM 8349  N NH2  . ARG A 1 29  ? 10.361  -13.417 5.643   1.00 0.00 ? 80  ARG A NH2  5  
ATOM 8350  H H    . ARG A 1 29  ? 4.006   -10.516 3.054   1.00 0.00 ? 80  ARG A H    5  
ATOM 8351  H HA   . ARG A 1 29  ? 5.244   -11.959 0.715   1.00 0.00 ? 80  ARG A HA   5  
ATOM 8352  H HB2  . ARG A 1 29  ? 4.629   -13.150 3.448   1.00 0.00 ? 80  ARG A HB2  5  
ATOM 8353  H HB3  . ARG A 1 29  ? 5.256   -14.026 2.038   1.00 0.00 ? 80  ARG A HB3  5  
ATOM 8354  H HG2  . ARG A 1 29  ? 7.218   -12.446 2.021   1.00 0.00 ? 80  ARG A HG2  5  
ATOM 8355  H HG3  . ARG A 1 29  ? 6.609   -11.780 3.535   1.00 0.00 ? 80  ARG A HG3  5  
ATOM 8356  H HD2  . ARG A 1 29  ? 6.704   -14.113 4.509   1.00 0.00 ? 80  ARG A HD2  5  
ATOM 8357  H HD3  . ARG A 1 29  ? 7.538   -14.614 3.037   1.00 0.00 ? 80  ARG A HD3  5  
ATOM 8358  H HE   . ARG A 1 29  ? 9.019   -12.446 3.829   1.00 0.00 ? 80  ARG A HE   5  
ATOM 8359  H HH11 . ARG A 1 29  ? 7.834   -15.317 5.370   1.00 0.00 ? 80  ARG A HH11 5  
ATOM 8360  H HH12 . ARG A 1 29  ? 9.180   -15.439 6.456   1.00 0.00 ? 80  ARG A HH12 5  
ATOM 8361  H HH21 . ARG A 1 29  ? 10.753  -12.580 5.252   1.00 0.00 ? 80  ARG A HH21 5  
ATOM 8362  H HH22 . ARG A 1 29  ? 10.834  -13.895 6.385   1.00 0.00 ? 80  ARG A HH22 5  
ATOM 8363  N N    . SER A 1 30  ? 2.729   -11.982 0.116   1.00 0.00 ? 81  SER A N    5  
ATOM 8364  C CA   . SER A 1 30  ? 1.346   -12.375 -0.290  1.00 0.00 ? 81  SER A CA   5  
ATOM 8365  C C    . SER A 1 30  ? 1.426   -13.596 -1.219  1.00 0.00 ? 81  SER A C    5  
ATOM 8366  O O    . SER A 1 30  ? 1.801   -13.492 -2.371  1.00 0.00 ? 81  SER A O    5  
ATOM 8367  C CB   . SER A 1 30  ? 0.687   -11.202 -1.021  1.00 0.00 ? 81  SER A CB   5  
ATOM 8368  O OG   . SER A 1 30  ? -0.479  -11.659 -1.696  1.00 0.00 ? 81  SER A OG   5  
ATOM 8369  H H    . SER A 1 30  ? 3.264   -11.388 -0.457  1.00 0.00 ? 81  SER A H    5  
ATOM 8370  H HA   . SER A 1 30  ? 0.765   -12.625 0.588   1.00 0.00 ? 81  SER A HA   5  
ATOM 8371  H HB2  . SER A 1 30  ? 0.407   -10.440 -0.304  1.00 0.00 ? 81  SER A HB2  5  
ATOM 8372  H HB3  . SER A 1 30  ? 1.389   -10.784 -1.725  1.00 0.00 ? 81  SER A HB3  5  
ATOM 8373  H HG   . SER A 1 30  ? -0.472  -12.620 -1.684  1.00 0.00 ? 81  SER A HG   5  
ATOM 8374  N N    . ASN A 1 31  ? 1.099   -14.765 -0.733  1.00 0.00 ? 82  ASN A N    5  
ATOM 8375  C CA   . ASN A 1 31  ? 1.185   -15.961 -1.607  1.00 0.00 ? 82  ASN A CA   5  
ATOM 8376  C C    . ASN A 1 31  ? 0.236   -15.811 -2.809  1.00 0.00 ? 82  ASN A C    5  
ATOM 8377  O O    . ASN A 1 31  ? 0.636   -15.940 -3.949  1.00 0.00 ? 82  ASN A O    5  
ATOM 8378  C CB   . ASN A 1 31  ? 0.807   -17.208 -0.795  1.00 0.00 ? 82  ASN A CB   5  
ATOM 8379  C CG   . ASN A 1 31  ? 1.856   -17.440 0.301   1.00 0.00 ? 82  ASN A CG   5  
ATOM 8380  O OD1  . ASN A 1 31  ? 2.955   -16.939 0.221   1.00 0.00 ? 82  ASN A OD1  5  
ATOM 8381  N ND2  . ASN A 1 31  ? 1.554   -18.191 1.324   1.00 0.00 ? 82  ASN A ND2  5  
ATOM 8382  H H    . ASN A 1 31  ? 0.816   -14.857 0.199   1.00 0.00 ? 82  ASN A H    5  
ATOM 8383  H HA   . ASN A 1 31  ? 2.203   -16.062 -1.968  1.00 0.00 ? 82  ASN A HA   5  
ATOM 8384  H HB2  . ASN A 1 31  ? -0.163  -17.063 -0.332  1.00 0.00 ? 82  ASN A HB2  5  
ATOM 8385  H HB3  . ASN A 1 31  ? 0.770   -18.067 -1.446  1.00 0.00 ? 82  ASN A HB3  5  
ATOM 8386  H HD21 . ASN A 1 31  ? 0.667   -18.587 1.381   1.00 0.00 ? 82  ASN A HD21 5  
ATOM 8387  H HD22 . ASN A 1 31  ? 2.212   -18.356 2.034   1.00 0.00 ? 82  ASN A HD22 5  
ATOM 8388  N N    . LYS A 1 32  ? -1.012  -15.523 -2.567  1.00 0.00 ? 83  LYS A N    5  
ATOM 8389  C CA   . LYS A 1 32  ? -1.969  -15.354 -3.693  1.00 0.00 ? 83  LYS A CA   5  
ATOM 8390  C C    . LYS A 1 32  ? -3.171  -14.540 -3.216  1.00 0.00 ? 83  LYS A C    5  
ATOM 8391  O O    . LYS A 1 32  ? -3.358  -13.402 -3.590  1.00 0.00 ? 83  LYS A O    5  
ATOM 8392  C CB   . LYS A 1 32  ? -2.452  -16.723 -4.182  1.00 0.00 ? 83  LYS A CB   5  
ATOM 8393  C CG   . LYS A 1 32  ? -3.259  -16.554 -5.482  1.00 0.00 ? 83  LYS A CG   5  
ATOM 8394  C CD   . LYS A 1 32  ? -3.752  -17.906 -5.986  1.00 0.00 ? 83  LYS A CD   5  
ATOM 8395  C CE   . LYS A 1 32  ? -4.460  -17.712 -7.338  1.00 0.00 ? 83  LYS A CE   5  
ATOM 8396  N NZ   . LYS A 1 32  ? -3.499  -17.123 -8.318  1.00 0.00 ? 83  LYS A NZ   5  
ATOM 8397  H H    . LYS A 1 32  ? -1.322  -15.405 -1.643  1.00 0.00 ? 83  LYS A H    5  
ATOM 8398  H HA   . LYS A 1 32  ? -1.476  -14.836 -4.503  1.00 0.00 ? 83  LYS A HA   5  
ATOM 8399  H HB2  . LYS A 1 32  ? -1.594  -17.355 -4.368  1.00 0.00 ? 83  LYS A HB2  5  
ATOM 8400  H HB3  . LYS A 1 32  ? -3.074  -17.173 -3.426  1.00 0.00 ? 83  LYS A HB3  5  
ATOM 8401  H HG2  . LYS A 1 32  ? -4.115  -15.915 -5.303  1.00 0.00 ? 83  LYS A HG2  5  
ATOM 8402  H HG3  . LYS A 1 32  ? -2.630  -16.107 -6.237  1.00 0.00 ? 83  LYS A HG3  5  
ATOM 8403  H HD2  . LYS A 1 32  ? -2.910  -18.578 -6.112  1.00 0.00 ? 83  LYS A HD2  5  
ATOM 8404  H HD3  . LYS A 1 32  ? -4.444  -18.318 -5.270  1.00 0.00 ? 83  LYS A HD3  5  
ATOM 8405  H HE2  . LYS A 1 32  ? -4.793  -18.669 -7.706  1.00 0.00 ? 83  LYS A HE2  5  
ATOM 8406  H HE3  . LYS A 1 32  ? -5.312  -17.055 -7.222  1.00 0.00 ? 83  LYS A HE3  5  
ATOM 8407  H HZ1  . LYS A 1 32  ? -2.635  -17.687 -8.315  1.00 0.00 ? 83  LYS A HZ1  5  
ATOM 8408  H HZ2  . LYS A 1 32  ? -3.922  -17.140 -9.270  1.00 0.00 ? 83  LYS A HZ2  5  
ATOM 8409  H HZ3  . LYS A 1 32  ? -3.270  -16.137 -8.054  1.00 0.00 ? 83  LYS A HZ3  5  
ATOM 8410  N N    . THR A 1 33  ? -3.999  -15.141 -2.391  1.00 0.00 ? 84  THR A N    5  
ATOM 8411  C CA   . THR A 1 33  ? -5.212  -14.444 -1.872  1.00 0.00 ? 84  THR A CA   5  
ATOM 8412  C C    . THR A 1 33  ? -4.930  -13.864 -0.486  1.00 0.00 ? 84  THR A C    5  
ATOM 8413  O O    . THR A 1 33  ? -5.844  -13.584 0.257   1.00 0.00 ? 84  THR A O    5  
ATOM 8414  C CB   . THR A 1 33  ? -6.381  -15.439 -1.777  1.00 0.00 ? 84  THR A CB   5  
ATOM 8415  O OG1  . THR A 1 33  ? -6.364  -16.285 -2.907  1.00 0.00 ? 84  THR A OG1  5  
ATOM 8416  C CG2  . THR A 1 33  ? -7.713  -14.681 -1.718  1.00 0.00 ? 84  THR A CG2  5  
ATOM 8417  H H    . THR A 1 33  ? -3.825  -16.063 -2.125  1.00 0.00 ? 84  THR A H    5  
ATOM 8418  H HA   . THR A 1 33  ? -5.478  -13.643 -2.542  1.00 0.00 ? 84  THR A HA   5  
ATOM 8419  H HB   . THR A 1 33  ? -6.275  -16.044 -0.893  1.00 0.00 ? 84  THR A HB   5  
ATOM 8420  H HG1  . THR A 1 33  ? -6.022  -17.131 -2.619  1.00 0.00 ? 84  THR A HG1  5  
ATOM 8421  H HG21 . THR A 1 33  ? -7.747  -13.945 -2.507  1.00 0.00 ? 84  THR A HG21 5  
ATOM 8422  H HG22 . THR A 1 33  ? -8.529  -15.371 -1.847  1.00 0.00 ? 84  THR A HG22 5  
ATOM 8423  H HG23 . THR A 1 33  ? -7.808  -14.188 -0.767  1.00 0.00 ? 84  THR A HG23 5  
ATOM 8424  N N    . LEU A 1 34  ? -3.681  -13.675 -0.126  1.00 0.00 ? 85  LEU A N    5  
ATOM 8425  C CA   . LEU A 1 34  ? -3.352  -13.103 1.222   1.00 0.00 ? 85  LEU A CA   5  
ATOM 8426  C C    . LEU A 1 34  ? -2.583  -11.786 1.050   1.00 0.00 ? 85  LEU A C    5  
ATOM 8427  O O    . LEU A 1 34  ? -1.372  -11.740 1.169   1.00 0.00 ? 85  LEU A O    5  
ATOM 8428  C CB   . LEU A 1 34  ? -2.445  -14.066 1.988   1.00 0.00 ? 85  LEU A CB   5  
ATOM 8429  C CG   . LEU A 1 34  ? -3.058  -15.480 2.074   1.00 0.00 ? 85  LEU A CG   5  
ATOM 8430  C CD1  . LEU A 1 34  ? -4.500  -15.408 2.581   1.00 0.00 ? 85  LEU A CD1  5  
ATOM 8431  C CD2  . LEU A 1 34  ? -3.008  -16.201 0.705   1.00 0.00 ? 85  LEU A CD2  5  
ATOM 8432  H H    . LEU A 1 34  ? -2.959  -13.899 -0.743  1.00 0.00 ? 85  LEU A H    5  
ATOM 8433  H HA   . LEU A 1 34  ? -4.249  -12.930 1.788   1.00 0.00 ? 85  LEU A HA   5  
ATOM 8434  H HB2  . LEU A 1 34  ? -1.487  -14.111 1.494   1.00 0.00 ? 85  LEU A HB2  5  
ATOM 8435  H HB3  . LEU A 1 34  ? -2.306  -13.683 2.991   1.00 0.00 ? 85  LEU A HB3  5  
ATOM 8436  H HG   . LEU A 1 34  ? -2.489  -16.055 2.784   1.00 0.00 ? 85  LEU A HG   5  
ATOM 8437  H HD11 . LEU A 1 34  ? -4.562  -14.702 3.392   1.00 0.00 ? 85  LEU A HD11 5  
ATOM 8438  H HD12 . LEU A 1 34  ? -5.143  -15.089 1.787   1.00 0.00 ? 85  LEU A HD12 5  
ATOM 8439  H HD13 . LEU A 1 34  ? -4.815  -16.384 2.921   1.00 0.00 ? 85  LEU A HD13 5  
ATOM 8440  H HD21 . LEU A 1 34  ? -2.271  -15.742 0.066   1.00 0.00 ? 85  LEU A HD21 5  
ATOM 8441  H HD22 . LEU A 1 34  ? -2.740  -17.234 0.875   1.00 0.00 ? 85  LEU A HD22 5  
ATOM 8442  H HD23 . LEU A 1 34  ? -3.971  -16.163 0.218   1.00 0.00 ? 85  LEU A HD23 5  
ATOM 8443  N N    . PRO A 1 35  ? -3.280  -10.716 0.787   1.00 0.00 ? 86  PRO A N    5  
ATOM 8444  C CA   . PRO A 1 35  ? -2.659  -9.388  0.604   1.00 0.00 ? 86  PRO A CA   5  
ATOM 8445  C C    . PRO A 1 35  ? -2.514  -8.648  1.940   1.00 0.00 ? 86  PRO A C    5  
ATOM 8446  O O    . PRO A 1 35  ? -2.621  -9.230  3.005   1.00 0.00 ? 86  PRO A O    5  
ATOM 8447  C CB   . PRO A 1 35  ? -3.657  -8.680  -0.308  1.00 0.00 ? 86  PRO A CB   5  
ATOM 8448  C CG   . PRO A 1 35  ? -4.996  -9.210  0.117   1.00 0.00 ? 86  PRO A CG   5  
ATOM 8449  C CD   . PRO A 1 35  ? -4.746  -10.640 0.645   1.00 0.00 ? 86  PRO A CD   5  
ATOM 8450  H HA   . PRO A 1 35  ? -1.704  -9.472  0.104   1.00 0.00 ? 86  PRO A HA   5  
ATOM 8451  H HB2  . PRO A 1 35  ? -3.600  -7.609  -0.166  1.00 0.00 ? 86  PRO A HB2  5  
ATOM 8452  H HB3  . PRO A 1 35  ? -3.468  -8.938  -1.345  1.00 0.00 ? 86  PRO A HB3  5  
ATOM 8453  H HG2  . PRO A 1 35  ? -5.425  -8.580  0.892   1.00 0.00 ? 86  PRO A HG2  5  
ATOM 8454  H HG3  . PRO A 1 35  ? -5.659  -9.247  -0.727  1.00 0.00 ? 86  PRO A HG3  5  
ATOM 8455  H HD2  . PRO A 1 35  ? -5.220  -10.783 1.604   1.00 0.00 ? 86  PRO A HD2  5  
ATOM 8456  H HD3  . PRO A 1 35  ? -5.094  -11.366 -0.061  1.00 0.00 ? 86  PRO A HD3  5  
ATOM 8457  N N    . ILE A 1 36  ? -2.279  -7.371  1.884   1.00 0.00 ? 87  ILE A N    5  
ATOM 8458  C CA   . ILE A 1 36  ? -2.131  -6.558  3.127   1.00 0.00 ? 87  ILE A CA   5  
ATOM 8459  C C    . ILE A 1 36  ? -3.049  -5.342  3.060   1.00 0.00 ? 87  ILE A C    5  
ATOM 8460  O O    . ILE A 1 36  ? -3.413  -4.874  1.997   1.00 0.00 ? 87  ILE A O    5  
ATOM 8461  C CB   . ILE A 1 36  ? -0.685  -6.069  3.262   1.00 0.00 ? 87  ILE A CB   5  
ATOM 8462  C CG1  . ILE A 1 36  ? -0.239  -5.337  1.992   1.00 0.00 ? 87  ILE A CG1  5  
ATOM 8463  C CG2  . ILE A 1 36  ? 0.240   -7.249  3.496   1.00 0.00 ? 87  ILE A CG2  5  
ATOM 8464  C CD1  . ILE A 1 36  ? 1.152   -4.735  2.219   1.00 0.00 ? 87  ILE A CD1  5  
ATOM 8465  H H    . ILE A 1 36  ? -2.202  -6.936  1.014   1.00 0.00 ? 87  ILE A H    5  
ATOM 8466  H HA   . ILE A 1 36  ? -2.385  -7.153  4.002   1.00 0.00 ? 87  ILE A HA   5  
ATOM 8467  H HB   . ILE A 1 36  ? -0.615  -5.393  4.103   1.00 0.00 ? 87  ILE A HB   5  
ATOM 8468  H HG12 . ILE A 1 36  ? -0.188  -6.044  1.178   1.00 0.00 ? 87  ILE A HG12 5  
ATOM 8469  H HG13 . ILE A 1 36  ? -0.940  -4.553  1.753   1.00 0.00 ? 87  ILE A HG13 5  
ATOM 8470  H HG21 . ILE A 1 36  ? -0.104  -7.809  4.350   1.00 0.00 ? 87  ILE A HG21 5  
ATOM 8471  H HG22 . ILE A 1 36  ? 0.239   -7.882  2.620   1.00 0.00 ? 87  ILE A HG22 5  
ATOM 8472  H HG23 . ILE A 1 36  ? 1.239   -6.886  3.677   1.00 0.00 ? 87  ILE A HG23 5  
ATOM 8473  H HD11 . ILE A 1 36  ? 1.153   -4.175  3.146   1.00 0.00 ? 87  ILE A HD11 5  
ATOM 8474  H HD12 . ILE A 1 36  ? 1.886   -5.524  2.274   1.00 0.00 ? 87  ILE A HD12 5  
ATOM 8475  H HD13 . ILE A 1 36  ? 1.397   -4.073  1.400   1.00 0.00 ? 87  ILE A HD13 5  
ATOM 8476  N N    . ALA A 1 37  ? -3.393  -4.808  4.196   1.00 0.00 ? 88  ALA A N    5  
ATOM 8477  C CA   . ALA A 1 37  ? -4.261  -3.591  4.245   1.00 0.00 ? 88  ALA A CA   5  
ATOM 8478  C C    . ALA A 1 37  ? -3.564  -2.552  5.124   1.00 0.00 ? 88  ALA A C    5  
ATOM 8479  O O    . ALA A 1 37  ? -3.143  -2.854  6.221   1.00 0.00 ? 88  ALA A O    5  
ATOM 8480  C CB   . ALA A 1 37  ? -5.613  -3.968  4.853   1.00 0.00 ? 88  ALA A CB   5  
ATOM 8481  H H    . ALA A 1 37  ? -3.062  -5.204  5.032   1.00 0.00 ? 88  ALA A H    5  
ATOM 8482  H HA   . ALA A 1 37  ? -4.405  -3.184  3.251   1.00 0.00 ? 88  ALA A HA   5  
ATOM 8483  H HB1  . ALA A 1 37  ? -5.464  -4.669  5.668   1.00 0.00 ? 88  ALA A HB1  5  
ATOM 8484  H HB2  . ALA A 1 37  ? -6.103  -3.078  5.235   1.00 0.00 ? 88  ALA A HB2  5  
ATOM 8485  H HB3  . ALA A 1 37  ? -6.230  -4.428  4.092   1.00 0.00 ? 88  ALA A HB3  5  
ATOM 8486  N N    . PHE A 1 38  ? -3.424  -1.327  4.653   1.00 0.00 ? 89  PHE A N    5  
ATOM 8487  C CA   . PHE A 1 38  ? -2.729  -0.273  5.478   1.00 0.00 ? 89  PHE A CA   5  
ATOM 8488  C C    . PHE A 1 38  ? -3.656  0.908   5.764   1.00 0.00 ? 89  PHE A C    5  
ATOM 8489  O O    . PHE A 1 38  ? -4.743  1.011   5.233   1.00 0.00 ? 89  PHE A O    5  
ATOM 8490  C CB   . PHE A 1 38  ? -1.484  0.226   4.758   1.00 0.00 ? 89  PHE A CB   5  
ATOM 8491  C CG   . PHE A 1 38  ? -1.824  0.914   3.448   1.00 0.00 ? 89  PHE A CG   5  
ATOM 8492  C CD1  . PHE A 1 38  ? -2.329  0.178   2.365   1.00 0.00 ? 89  PHE A CD1  5  
ATOM 8493  C CD2  . PHE A 1 38  ? -1.599  2.292   3.310   1.00 0.00 ? 89  PHE A CD2  5  
ATOM 8494  C CE1  . PHE A 1 38  ? -2.612  0.825   1.153   1.00 0.00 ? 89  PHE A CE1  5  
ATOM 8495  C CE2  . PHE A 1 38  ? -1.878  2.932   2.097   1.00 0.00 ? 89  PHE A CE2  5  
ATOM 8496  C CZ   . PHE A 1 38  ? -2.387  2.203   1.025   1.00 0.00 ? 89  PHE A CZ   5  
ATOM 8497  H H    . PHE A 1 38  ? -3.756  -1.106  3.754   1.00 0.00 ? 89  PHE A H    5  
ATOM 8498  H HA   . PHE A 1 38  ? -2.419  -0.698  6.420   1.00 0.00 ? 89  PHE A HA   5  
ATOM 8499  H HB2  . PHE A 1 38  ? -0.979  0.926   5.403   1.00 0.00 ? 89  PHE A HB2  5  
ATOM 8500  H HB3  . PHE A 1 38  ? -0.834  -0.612  4.568   1.00 0.00 ? 89  PHE A HB3  5  
ATOM 8501  H HD1  . PHE A 1 38  ? -2.500  -0.883  2.463   1.00 0.00 ? 89  PHE A HD1  5  
ATOM 8502  H HD2  . PHE A 1 38  ? -1.217  2.863   4.142   1.00 0.00 ? 89  PHE A HD2  5  
ATOM 8503  H HE1  . PHE A 1 38  ? -3.005  0.263   0.316   1.00 0.00 ? 89  PHE A HE1  5  
ATOM 8504  H HE2  . PHE A 1 38  ? -1.694  3.991   1.987   1.00 0.00 ? 89  PHE A HE2  5  
ATOM 8505  H HZ   . PHE A 1 38  ? -2.606  2.702   0.099   1.00 0.00 ? 89  PHE A HZ   5  
ATOM 8506  N N    . LYS A 1 39  ? -3.225  1.802   6.623   1.00 0.00 ? 90  LYS A N    5  
ATOM 8507  C CA   . LYS A 1 39  ? -4.055  3.000   6.981   1.00 0.00 ? 90  LYS A CA   5  
ATOM 8508  C C    . LYS A 1 39  ? -3.310  4.273   6.591   1.00 0.00 ? 90  LYS A C    5  
ATOM 8509  O O    . LYS A 1 39  ? -2.117  4.400   6.795   1.00 0.00 ? 90  LYS A O    5  
ATOM 8510  C CB   . LYS A 1 39  ? -4.296  2.975   8.494   1.00 0.00 ? 90  LYS A CB   5  
ATOM 8511  C CG   . LYS A 1 39  ? -5.108  4.192   8.967   1.00 0.00 ? 90  LYS A CG   5  
ATOM 8512  C CD   . LYS A 1 39  ? -5.100  4.259   10.513  1.00 0.00 ? 90  LYS A CD   5  
ATOM 8513  C CE   . LYS A 1 39  ? -6.149  3.298   11.090  1.00 0.00 ? 90  LYS A CE   5  
ATOM 8514  N NZ   . LYS A 1 39  ? -6.095  3.323   12.573  1.00 0.00 ? 90  LYS A NZ   5  
ATOM 8515  H H    . LYS A 1 39  ? -2.335  1.690   7.039   1.00 0.00 ? 90  LYS A H    5  
ATOM 8516  H HA   . LYS A 1 39  ? -5.005  2.975   6.461   1.00 0.00 ? 90  LYS A HA   5  
ATOM 8517  H HB2  . LYS A 1 39  ? -4.844  2.075   8.729   1.00 0.00 ? 90  LYS A HB2  5  
ATOM 8518  H HB3  . LYS A 1 39  ? -3.345  2.956   8.995   1.00 0.00 ? 90  LYS A HB3  5  
ATOM 8519  H HG2  . LYS A 1 39  ? -4.671  5.094   8.573   1.00 0.00 ? 90  LYS A HG2  5  
ATOM 8520  H HG3  . LYS A 1 39  ? -6.130  4.106   8.615   1.00 0.00 ? 90  LYS A HG3  5  
ATOM 8521  H HD2  . LYS A 1 39  ? -4.118  3.997   10.888  1.00 0.00 ? 90  LYS A HD2  5  
ATOM 8522  H HD3  . LYS A 1 39  ? -5.337  5.261   10.825  1.00 0.00 ? 90  LYS A HD3  5  
ATOM 8523  H HE2  . LYS A 1 39  ? -7.130  3.616   10.773  1.00 0.00 ? 90  LYS A HE2  5  
ATOM 8524  H HE3  . LYS A 1 39  ? -5.962  2.288   10.745  1.00 0.00 ? 90  LYS A HE3  5  
ATOM 8525  H HZ1  . LYS A 1 39  ? -5.110  3.390   12.887  1.00 0.00 ? 90  LYS A HZ1  5  
ATOM 8526  H HZ2  . LYS A 1 39  ? -6.632  4.143   12.925  1.00 0.00 ? 90  LYS A HZ2  5  
ATOM 8527  H HZ3  . LYS A 1 39  ? -6.517  2.452   12.942  1.00 0.00 ? 90  LYS A HZ3  5  
ATOM 8528  N N    . VAL A 1 40  ? -4.021  5.215   6.018   1.00 0.00 ? 91  VAL A N    5  
ATOM 8529  C CA   . VAL A 1 40  ? -3.394  6.496   5.589   1.00 0.00 ? 91  VAL A CA   5  
ATOM 8530  C C    . VAL A 1 40  ? -3.719  7.609   6.596   1.00 0.00 ? 91  VAL A C    5  
ATOM 8531  O O    . VAL A 1 40  ? -4.870  7.862   6.885   1.00 0.00 ? 91  VAL A O    5  
ATOM 8532  C CB   . VAL A 1 40  ? -3.975  6.898   4.227   1.00 0.00 ? 91  VAL A CB   5  
ATOM 8533  C CG1  . VAL A 1 40  ? -3.119  8.020   3.622   1.00 0.00 ? 91  VAL A CG1  5  
ATOM 8534  C CG2  . VAL A 1 40  ? -3.989  5.687   3.294   1.00 0.00 ? 91  VAL A CG2  5  
ATOM 8535  H H    . VAL A 1 40  ? -4.978  5.070   5.867   1.00 0.00 ? 91  VAL A H    5  
ATOM 8536  H HA   . VAL A 1 40  ? -2.327  6.380   5.501   1.00 0.00 ? 91  VAL A HA   5  
ATOM 8537  H HB   . VAL A 1 40  ? -4.989  7.256   4.361   1.00 0.00 ? 91  VAL A HB   5  
ATOM 8538  H HG11 . VAL A 1 40  ? -3.096  8.864   4.303   1.00 0.00 ? 91  VAL A HG11 5  
ATOM 8539  H HG12 . VAL A 1 40  ? -2.116  7.664   3.464   1.00 0.00 ? 91  VAL A HG12 5  
ATOM 8540  H HG13 . VAL A 1 40  ? -3.541  8.328   2.679   1.00 0.00 ? 91  VAL A HG13 5  
ATOM 8541  H HG21 . VAL A 1 40  ? -3.021  5.224   3.310   1.00 0.00 ? 91  VAL A HG21 5  
ATOM 8542  H HG22 . VAL A 1 40  ? -4.734  4.980   3.627   1.00 0.00 ? 91  VAL A HG22 5  
ATOM 8543  H HG23 . VAL A 1 40  ? -4.220  6.004   2.288   1.00 0.00 ? 91  VAL A HG23 5  
ATOM 8544  N N    . VAL A 1 41  ? -2.713  8.303   7.098   1.00 0.00 ? 92  VAL A N    5  
ATOM 8545  C CA   . VAL A 1 41  ? -2.953  9.444   8.043   1.00 0.00 ? 92  VAL A CA   5  
ATOM 8546  C C    . VAL A 1 41  ? -2.597  10.734  7.297   1.00 0.00 ? 92  VAL A C    5  
ATOM 8547  O O    . VAL A 1 41  ? -1.502  10.868  6.777   1.00 0.00 ? 92  VAL A O    5  
ATOM 8548  C CB   . VAL A 1 41  ? -2.055  9.296   9.275   1.00 0.00 ? 92  VAL A CB   5  
ATOM 8549  C CG1  . VAL A 1 41  ? -2.281  10.467  10.233  1.00 0.00 ? 92  VAL A CG1  5  
ATOM 8550  C CG2  . VAL A 1 41  ? -2.392  7.989   9.993   1.00 0.00 ? 92  VAL A CG2  5  
ATOM 8551  H H    . VAL A 1 41  ? -1.799  8.095   6.826   1.00 0.00 ? 92  VAL A H    5  
ATOM 8552  H HA   . VAL A 1 41  ? -3.991  9.465   8.349   1.00 0.00 ? 92  VAL A HA   5  
ATOM 8553  H HB   . VAL A 1 41  ? -1.019  9.288   8.972   1.00 0.00 ? 92  VAL A HB   5  
ATOM 8554  H HG11 . VAL A 1 41  ? -3.330  10.523  10.511  1.00 0.00 ? 92  VAL A HG11 5  
ATOM 8555  H HG12 . VAL A 1 41  ? -1.683  10.317  11.119  1.00 0.00 ? 92  VAL A HG12 5  
ATOM 8556  H HG13 . VAL A 1 41  ? -1.982  11.388  9.750   1.00 0.00 ? 92  VAL A HG13 5  
ATOM 8557  H HG21 . VAL A 1 41  ? -2.465  7.193   9.271   1.00 0.00 ? 92  VAL A HG21 5  
ATOM 8558  H HG22 . VAL A 1 41  ? -1.617  7.759   10.704  1.00 0.00 ? 92  VAL A HG22 5  
ATOM 8559  H HG23 . VAL A 1 41  ? -3.333  8.097   10.509  1.00 0.00 ? 92  VAL A HG23 5  
ATOM 8560  N N    . ALA A 1 42  ? -3.508  11.681  7.221   1.00 0.00 ? 93  ALA A N    5  
ATOM 8561  C CA   . ALA A 1 42  ? -3.228  12.953  6.492   1.00 0.00 ? 93  ALA A CA   5  
ATOM 8562  C C    . ALA A 1 42  ? -3.195  14.113  7.474   1.00 0.00 ? 93  ALA A C    5  
ATOM 8563  O O    . ALA A 1 42  ? -4.096  14.293  8.264   1.00 0.00 ? 93  ALA A O    5  
ATOM 8564  C CB   . ALA A 1 42  ? -4.329  13.192  5.458   1.00 0.00 ? 93  ALA A CB   5  
ATOM 8565  H H    . ALA A 1 42  ? -4.385  11.550  7.636   1.00 0.00 ? 93  ALA A H    5  
ATOM 8566  H HA   . ALA A 1 42  ? -2.285  12.893  5.986   1.00 0.00 ? 93  ALA A HA   5  
ATOM 8567  H HB1  . ALA A 1 42  ? -5.282  12.966  5.891   1.00 0.00 ? 93  ALA A HB1  5  
ATOM 8568  H HB2  . ALA A 1 42  ? -4.315  14.218  5.136   1.00 0.00 ? 93  ALA A HB2  5  
ATOM 8569  H HB3  . ALA A 1 42  ? -4.156  12.548  4.613   1.00 0.00 ? 93  ALA A HB3  5  
ATOM 8570  N N    . LEU A 1 43  ? -2.159  14.905  7.424   1.00 0.00 ? 94  LEU A N    5  
ATOM 8571  C CA   . LEU A 1 43  ? -2.049  16.076  8.342   1.00 0.00 ? 94  LEU A CA   5  
ATOM 8572  C C    . LEU A 1 43  ? -2.568  17.302  7.601   1.00 0.00 ? 94  LEU A C    5  
ATOM 8573  O O    . LEU A 1 43  ? -2.424  18.426  8.041   1.00 0.00 ? 94  LEU A O    5  
ATOM 8574  C CB   . LEU A 1 43  ? -0.581  16.263  8.725   1.00 0.00 ? 94  LEU A CB   5  
ATOM 8575  C CG   . LEU A 1 43  ? -0.041  14.927  9.257   1.00 0.00 ? 94  LEU A CG   5  
ATOM 8576  C CD1  . LEU A 1 43  ? 1.440   15.069  9.646   1.00 0.00 ? 94  LEU A CD1  5  
ATOM 8577  C CD2  . LEU A 1 43  ? -0.868  14.492  10.479  1.00 0.00 ? 94  LEU A CD2  5  
ATOM 8578  H H    . LEU A 1 43  ? -1.445  14.732  6.768   1.00 0.00 ? 94  LEU A H    5  
ATOM 8579  H HA   . LEU A 1 43  ? -2.643  15.920  9.230   1.00 0.00 ? 94  LEU A HA   5  
ATOM 8580  H HB2  . LEU A 1 43  ? -0.015  16.577  7.860   1.00 0.00 ? 94  LEU A HB2  5  
ATOM 8581  H HB3  . LEU A 1 43  ? -0.506  17.014  9.497   1.00 0.00 ? 94  LEU A HB3  5  
ATOM 8582  H HG   . LEU A 1 43  ? -0.135  14.171  8.483   1.00 0.00 ? 94  LEU A HG   5  
ATOM 8583  H HD11 . LEU A 1 43  ? 2.007   15.382  8.782   1.00 0.00 ? 94  LEU A HD11 5  
ATOM 8584  H HD12 . LEU A 1 43  ? 1.542   15.806  10.429  1.00 0.00 ? 94  LEU A HD12 5  
ATOM 8585  H HD13 . LEU A 1 43  ? 1.813   14.117  9.994   1.00 0.00 ? 94  LEU A HD13 5  
ATOM 8586  H HD21 . LEU A 1 43  ? -1.196  15.359  11.034  1.00 0.00 ? 94  LEU A HD21 5  
ATOM 8587  H HD22 . LEU A 1 43  ? -1.729  13.942  10.130  1.00 0.00 ? 94  LEU A HD22 5  
ATOM 8588  H HD23 . LEU A 1 43  ? -0.274  13.856  11.126  1.00 0.00 ? 94  LEU A HD23 5  
ATOM 8589  N N    . GLY A 1 44  ? -3.184  17.076  6.468   1.00 0.00 ? 95  GLY A N    5  
ATOM 8590  C CA   . GLY A 1 44  ? -3.740  18.196  5.658   1.00 0.00 ? 95  GLY A CA   5  
ATOM 8591  C C    . GLY A 1 44  ? -5.181  18.458  6.073   1.00 0.00 ? 95  GLY A C    5  
ATOM 8592  O O    . GLY A 1 44  ? -5.690  17.855  6.997   1.00 0.00 ? 95  GLY A O    5  
ATOM 8593  H H    . GLY A 1 44  ? -3.282  16.155  6.148   1.00 0.00 ? 95  GLY A H    5  
ATOM 8594  H HA2  . GLY A 1 44  ? -3.153  19.087  5.808   1.00 0.00 ? 95  GLY A HA2  5  
ATOM 8595  H HA3  . GLY A 1 44  ? -3.726  17.919  4.616   1.00 0.00 ? 95  GLY A HA3  5  
ATOM 8596  N N    . ASP A 1 45  ? -5.846  19.346  5.382   1.00 0.00 ? 96  ASP A N    5  
ATOM 8597  C CA   . ASP A 1 45  ? -7.273  19.642  5.720   1.00 0.00 ? 96  ASP A CA   5  
ATOM 8598  C C    . ASP A 1 45  ? -8.162  18.723  4.878   1.00 0.00 ? 96  ASP A C    5  
ATOM 8599  O O    . ASP A 1 45  ? -8.276  18.894  3.683   1.00 0.00 ? 96  ASP A O    5  
ATOM 8600  C CB   . ASP A 1 45  ? -7.598  21.105  5.372   1.00 0.00 ? 96  ASP A CB   5  
ATOM 8601  C CG   . ASP A 1 45  ? -6.701  22.050  6.188   1.00 0.00 ? 96  ASP A CG   5  
ATOM 8602  O OD1  . ASP A 1 45  ? -5.836  21.564  6.898   1.00 0.00 ? 96  ASP A OD1  5  
ATOM 8603  O OD2  . ASP A 1 45  ? -6.891  23.248  6.079   1.00 0.00 ? 96  ASP A OD2  5  
ATOM 8604  H H    . ASP A 1 45  ? -5.410  19.811  4.635   1.00 0.00 ? 96  ASP A H    5  
ATOM 8605  H HA   . ASP A 1 45  ? -7.448  19.466  6.772   1.00 0.00 ? 96  ASP A HA   5  
ATOM 8606  H HB2  . ASP A 1 45  ? -7.417  21.259  4.316   1.00 0.00 ? 96  ASP A HB2  5  
ATOM 8607  H HB3  . ASP A 1 45  ? -8.637  21.314  5.583   1.00 0.00 ? 96  ASP A HB3  5  
ATOM 8608  N N    . VAL A 1 46  ? -8.786  17.746  5.472   1.00 0.00 ? 97  VAL A N    5  
ATOM 8609  C CA   . VAL A 1 46  ? -9.644  16.827  4.666   1.00 0.00 ? 97  VAL A CA   5  
ATOM 8610  C C    . VAL A 1 46  ? -10.490 15.940  5.612   1.00 0.00 ? 97  VAL A C    5  
ATOM 8611  O O    . VAL A 1 46  ? -10.501 14.733  5.517   1.00 0.00 ? 97  VAL A O    5  
ATOM 8612  C CB   . VAL A 1 46  ? -8.725  15.971  3.758   1.00 0.00 ? 97  VAL A CB   5  
ATOM 8613  C CG1  . VAL A 1 46  ? -7.757  15.154  4.622   1.00 0.00 ? 97  VAL A CG1  5  
ATOM 8614  C CG2  . VAL A 1 46  ? -9.557  15.020  2.877   1.00 0.00 ? 97  VAL A CG2  5  
ATOM 8615  H H    . VAL A 1 46  ? -8.682  17.604  6.439   1.00 0.00 ? 97  VAL A H    5  
ATOM 8616  H HA   . VAL A 1 46  ? -10.308 17.418  4.048   1.00 0.00 ? 97  VAL A HA   5  
ATOM 8617  H HB   . VAL A 1 46  ? -8.141  16.631  3.123   1.00 0.00 ? 97  VAL A HB   5  
ATOM 8618  H HG11 . VAL A 1 46  ? -7.400  15.774  5.429   1.00 0.00 ? 97  VAL A HG11 5  
ATOM 8619  H HG12 . VAL A 1 46  ? -8.265  14.291  5.017   1.00 0.00 ? 97  VAL A HG12 5  
ATOM 8620  H HG13 . VAL A 1 46  ? -6.918  14.832  4.022   1.00 0.00 ? 97  VAL A HG13 5  
ATOM 8621  H HG21 . VAL A 1 46  ? -10.454 15.520  2.537   1.00 0.00 ? 97  VAL A HG21 5  
ATOM 8622  H HG22 . VAL A 1 46  ? -8.970  14.715  2.019   1.00 0.00 ? 97  VAL A HG22 5  
ATOM 8623  H HG23 . VAL A 1 46  ? -9.828  14.149  3.444   1.00 0.00 ? 97  VAL A HG23 5  
ATOM 8624  N N    . PRO A 1 47  ? -11.206 16.541  6.519   1.00 0.00 ? 98  PRO A N    5  
ATOM 8625  C CA   . PRO A 1 47  ? -12.078 15.797  7.474   1.00 0.00 ? 98  PRO A CA   5  
ATOM 8626  C C    . PRO A 1 47  ? -13.389 15.320  6.806   1.00 0.00 ? 98  PRO A C    5  
ATOM 8627  O O    . PRO A 1 47  ? -14.127 14.533  7.365   1.00 0.00 ? 98  PRO A O    5  
ATOM 8628  C CB   . PRO A 1 47  ? -12.376 16.848  8.548   1.00 0.00 ? 98  PRO A CB   5  
ATOM 8629  C CG   . PRO A 1 47  ? -12.370 18.139  7.802   1.00 0.00 ? 98  PRO A CG   5  
ATOM 8630  C CD   . PRO A 1 47  ? -11.275 17.993  6.747   1.00 0.00 ? 98  PRO A CD   5  
ATOM 8631  H HA   . PRO A 1 47  ? -11.543 14.966  7.912   1.00 0.00 ? 98  PRO A HA   5  
ATOM 8632  H HB2  . PRO A 1 47  ? -13.343 16.669  9.008   1.00 0.00 ? 98  PRO A HB2  5  
ATOM 8633  H HB3  . PRO A 1 47  ? -11.596 16.853  9.297   1.00 0.00 ? 98  PRO A HB3  5  
ATOM 8634  H HG2  . PRO A 1 47  ? -13.334 18.306  7.324   1.00 0.00 ? 98  PRO A HG2  5  
ATOM 8635  H HG3  . PRO A 1 47  ? -12.128 18.957  8.465   1.00 0.00 ? 98  PRO A HG3  5  
ATOM 8636  H HD2  . PRO A 1 47  ? -11.547 18.505  5.842   1.00 0.00 ? 98  PRO A HD2  5  
ATOM 8637  H HD3  . PRO A 1 47  ? -10.333 18.358  7.124   1.00 0.00 ? 98  PRO A HD3  5  
ATOM 8638  N N    . ASP A 1 48  ? -13.696 15.808  5.625   1.00 0.00 ? 99  ASP A N    5  
ATOM 8639  C CA   . ASP A 1 48  ? -14.971 15.397  4.950   1.00 0.00 ? 99  ASP A CA   5  
ATOM 8640  C C    . ASP A 1 48  ? -14.840 13.983  4.348   1.00 0.00 ? 99  ASP A C    5  
ATOM 8641  O O    . ASP A 1 48  ? -13.811 13.342  4.443   1.00 0.00 ? 99  ASP A O    5  
ATOM 8642  C CB   . ASP A 1 48  ? -15.303 16.422  3.850   1.00 0.00 ? 99  ASP A CB   5  
ATOM 8643  C CG   . ASP A 1 48  ? -14.292 16.320  2.699   1.00 0.00 ? 99  ASP A CG   5  
ATOM 8644  O OD1  . ASP A 1 48  ? -13.375 15.528  2.808   1.00 0.00 ? 99  ASP A OD1  5  
ATOM 8645  O OD2  . ASP A 1 48  ? -14.456 17.039  1.729   1.00 0.00 ? 99  ASP A OD2  5  
ATOM 8646  H H    . ASP A 1 48  ? -13.097 16.460  5.194   1.00 0.00 ? 99  ASP A H    5  
ATOM 8647  H HA   . ASP A 1 48  ? -15.774 15.403  5.679   1.00 0.00 ? 99  ASP A HA   5  
ATOM 8648  H HB2  . ASP A 1 48  ? -16.299 16.232  3.471   1.00 0.00 ? 99  ASP A HB2  5  
ATOM 8649  H HB3  . ASP A 1 48  ? -15.265 17.421  4.270   1.00 0.00 ? 99  ASP A HB3  5  
ATOM 8650  N N    . GLY A 1 49  ? -15.878 13.485  3.727   1.00 0.00 ? 100 GLY A N    5  
ATOM 8651  C CA   . GLY A 1 49  ? -15.805 12.126  3.116   1.00 0.00 ? 100 GLY A CA   5  
ATOM 8652  C C    . GLY A 1 49  ? -15.290 12.267  1.688   1.00 0.00 ? 100 GLY A C    5  
ATOM 8653  O O    . GLY A 1 49  ? -15.972 12.795  0.831   1.00 0.00 ? 100 GLY A O    5  
ATOM 8654  H H    . GLY A 1 49  ? -16.697 14.006  3.647   1.00 0.00 ? 100 GLY A H    5  
ATOM 8655  H HA2  . GLY A 1 49  ? -15.141 11.498  3.696   1.00 0.00 ? 100 GLY A HA2  5  
ATOM 8656  H HA3  . GLY A 1 49  ? -16.792 11.685  3.097   1.00 0.00 ? 100 GLY A HA3  5  
ATOM 8657  N N    . THR A 1 50  ? -14.092 11.806  1.419   1.00 0.00 ? 101 THR A N    5  
ATOM 8658  C CA   . THR A 1 50  ? -13.524 11.919  0.029   1.00 0.00 ? 101 THR A CA   5  
ATOM 8659  C C    . THR A 1 50  ? -13.216 10.517  -0.504  1.00 0.00 ? 101 THR A C    5  
ATOM 8660  O O    . THR A 1 50  ? -13.814 9.540   -0.089  1.00 0.00 ? 101 THR A O    5  
ATOM 8661  C CB   . THR A 1 50  ? -12.254 12.773  0.059   1.00 0.00 ? 101 THR A CB   5  
ATOM 8662  O OG1  . THR A 1 50  ? -11.649 12.757  -1.217  1.00 0.00 ? 101 THR A OG1  5  
ATOM 8663  C CG2  . THR A 1 50  ? -11.261 12.245  1.093   1.00 0.00 ? 101 THR A CG2  5  
ATOM 8664  H H    . THR A 1 50  ? -13.557 11.387  2.134   1.00 0.00 ? 101 THR A H    5  
ATOM 8665  H HA   . THR A 1 50  ? -14.247 12.386  -0.636  1.00 0.00 ? 101 THR A HA   5  
ATOM 8666  H HB   . THR A 1 50  ? -12.526 13.785  0.310   1.00 0.00 ? 101 THR A HB   5  
ATOM 8667  H HG1  . THR A 1 50  ? -12.234 13.217  -1.816  1.00 0.00 ? 101 THR A HG1  5  
ATOM 8668  H HG21 . THR A 1 50  ? -11.163 11.172  0.983   1.00 0.00 ? 101 THR A HG21 5  
ATOM 8669  H HG22 . THR A 1 50  ? -10.296 12.712  0.943   1.00 0.00 ? 101 THR A HG22 5  
ATOM 8670  H HG23 . THR A 1 50  ? -11.622 12.488  2.077   1.00 0.00 ? 101 THR A HG23 5  
ATOM 8671  N N    . LEU A 1 51  ? -12.302 10.410  -1.436  1.00 0.00 ? 102 LEU A N    5  
ATOM 8672  C CA   . LEU A 1 51  ? -11.971 9.073   -2.023  1.00 0.00 ? 102 LEU A CA   5  
ATOM 8673  C C    . LEU A 1 51  ? -10.461 8.966   -2.281  1.00 0.00 ? 102 LEU A C    5  
ATOM 8674  O O    . LEU A 1 51  ? -9.835  9.892   -2.748  1.00 0.00 ? 102 LEU A O    5  
ATOM 8675  C CB   . LEU A 1 51  ? -12.717 8.940   -3.353  1.00 0.00 ? 102 LEU A CB   5  
ATOM 8676  C CG   . LEU A 1 51  ? -12.647 7.495   -3.873  1.00 0.00 ? 102 LEU A CG   5  
ATOM 8677  C CD1  . LEU A 1 51  ? -13.666 6.625   -3.132  1.00 0.00 ? 102 LEU A CD1  5  
ATOM 8678  C CD2  . LEU A 1 51  ? -13.001 7.487   -5.360  1.00 0.00 ? 102 LEU A CD2  5  
ATOM 8679  H H    . LEU A 1 51  ? -11.845 11.213  -1.756  1.00 0.00 ? 102 LEU A H    5  
ATOM 8680  H HA   . LEU A 1 51  ? -12.274 8.289   -1.358  1.00 0.00 ? 102 LEU A HA   5  
ATOM 8681  H HB2  . LEU A 1 51  ? -13.748 9.228   -3.219  1.00 0.00 ? 102 LEU A HB2  5  
ATOM 8682  H HB3  . LEU A 1 51  ? -12.261 9.602   -4.077  1.00 0.00 ? 102 LEU A HB3  5  
ATOM 8683  H HG   . LEU A 1 51  ? -11.652 7.092   -3.725  1.00 0.00 ? 102 LEU A HG   5  
ATOM 8684  H HD11 . LEU A 1 51  ? -14.618 7.136   -3.081  1.00 0.00 ? 102 LEU A HD11 5  
ATOM 8685  H HD12 . LEU A 1 51  ? -13.791 5.696   -3.660  1.00 0.00 ? 102 LEU A HD12 5  
ATOM 8686  H HD13 . LEU A 1 51  ? -13.312 6.419   -2.138  1.00 0.00 ? 102 LEU A HD13 5  
ATOM 8687  H HD21 . LEU A 1 51  ? -13.931 8.020   -5.504  1.00 0.00 ? 102 LEU A HD21 5  
ATOM 8688  H HD22 . LEU A 1 51  ? -12.216 7.969   -5.917  1.00 0.00 ? 102 LEU A HD22 5  
ATOM 8689  H HD23 . LEU A 1 51  ? -13.116 6.469   -5.700  1.00 0.00 ? 102 LEU A HD23 5  
ATOM 8690  N N    . VAL A 1 52  ? -9.879  7.826   -1.981  1.00 0.00 ? 103 VAL A N    5  
ATOM 8691  C CA   . VAL A 1 52  ? -8.405  7.621   -2.195  1.00 0.00 ? 103 VAL A CA   5  
ATOM 8692  C C    . VAL A 1 52  ? -8.197  6.535   -3.242  1.00 0.00 ? 103 VAL A C    5  
ATOM 8693  O O    . VAL A 1 52  ? -8.749  5.463   -3.147  1.00 0.00 ? 103 VAL A O    5  
ATOM 8694  C CB   . VAL A 1 52  ? -7.788  7.149   -0.870  1.00 0.00 ? 103 VAL A CB   5  
ATOM 8695  C CG1  . VAL A 1 52  ? -6.255  7.122   -0.965  1.00 0.00 ? 103 VAL A CG1  5  
ATOM 8696  C CG2  . VAL A 1 52  ? -8.226  8.087   0.263   1.00 0.00 ? 103 VAL A CG2  5  
ATOM 8697  H H    . VAL A 1 52  ? -10.417 7.097   -1.611  1.00 0.00 ? 103 VAL A H    5  
ATOM 8698  H HA   . VAL A 1 52  ? -7.927  8.535   -2.519  1.00 0.00 ? 103 VAL A HA   5  
ATOM 8699  H HB   . VAL A 1 52  ? -8.138  6.146   -0.657  1.00 0.00 ? 103 VAL A HB   5  
ATOM 8700  H HG11 . VAL A 1 52  ? -5.954  6.539   -1.824  1.00 0.00 ? 103 VAL A HG11 5  
ATOM 8701  H HG12 . VAL A 1 52  ? -5.888  8.130   -1.066  1.00 0.00 ? 103 VAL A HG12 5  
ATOM 8702  H HG13 . VAL A 1 52  ? -5.848  6.681   -0.062  1.00 0.00 ? 103 VAL A HG13 5  
ATOM 8703  H HG21 . VAL A 1 52  ? -8.235  9.106   -0.089  1.00 0.00 ? 103 VAL A HG21 5  
ATOM 8704  H HG22 . VAL A 1 52  ? -9.215  7.814   0.591   1.00 0.00 ? 103 VAL A HG22 5  
ATOM 8705  H HG23 . VAL A 1 52  ? -7.541  7.999   1.088   1.00 0.00 ? 103 VAL A HG23 5  
ATOM 8706  N N    . THR A 1 53  ? -7.386  6.809   -4.236  1.00 0.00 ? 104 THR A N    5  
ATOM 8707  C CA   . THR A 1 53  ? -7.120  5.802   -5.309  1.00 0.00 ? 104 THR A CA   5  
ATOM 8708  C C    . THR A 1 53  ? -5.630  5.493   -5.324  1.00 0.00 ? 104 THR A C    5  
ATOM 8709  O O    . THR A 1 53  ? -4.809  6.378   -5.204  1.00 0.00 ? 104 THR A O    5  
ATOM 8710  C CB   . THR A 1 53  ? -7.540  6.397   -6.654  1.00 0.00 ? 104 THR A CB   5  
ATOM 8711  O OG1  . THR A 1 53  ? -6.733  7.543   -6.935  1.00 0.00 ? 104 THR A OG1  5  
ATOM 8712  C CG2  . THR A 1 53  ? -9.012  6.795   -6.568  1.00 0.00 ? 104 THR A CG2  5  
ATOM 8713  H H    . THR A 1 53  ? -6.950  7.688   -4.278  1.00 0.00 ? 104 THR A H    5  
ATOM 8714  H HA   . THR A 1 53  ? -7.678  4.893   -5.119  1.00 0.00 ? 104 THR A HA   5  
ATOM 8715  H HB   . THR A 1 53  ? -7.414  5.665   -7.438  1.00 0.00 ? 104 THR A HB   5  
ATOM 8716  H HG1  . THR A 1 53  ? -7.173  8.073   -7.605  1.00 0.00 ? 104 THR A HG1  5  
ATOM 8717  H HG21 . THR A 1 53  ? -9.604  5.932   -6.310  1.00 0.00 ? 104 THR A HG21 5  
ATOM 8718  H HG22 . THR A 1 53  ? -9.138  7.550   -5.809  1.00 0.00 ? 104 THR A HG22 5  
ATOM 8719  H HG23 . THR A 1 53  ? -9.342  7.182   -7.518  1.00 0.00 ? 104 THR A HG23 5  
ATOM 8720  N N    . VAL A 1 54  ? -5.262  4.246   -5.452  1.00 0.00 ? 105 VAL A N    5  
ATOM 8721  C CA   . VAL A 1 54  ? -3.814  3.900   -5.453  1.00 0.00 ? 105 VAL A CA   5  
ATOM 8722  C C    . VAL A 1 54  ? -3.520  2.794   -6.466  1.00 0.00 ? 105 VAL A C    5  
ATOM 8723  O O    . VAL A 1 54  ? -4.349  1.951   -6.753  1.00 0.00 ? 105 VAL A O    5  
ATOM 8724  C CB   . VAL A 1 54  ? -3.408  3.448   -4.050  1.00 0.00 ? 105 VAL A CB   5  
ATOM 8725  C CG1  . VAL A 1 54  ? -4.242  2.240   -3.627  1.00 0.00 ? 105 VAL A CG1  5  
ATOM 8726  C CG2  . VAL A 1 54  ? -1.934  3.063   -4.045  1.00 0.00 ? 105 VAL A CG2  5  
ATOM 8727  H H    . VAL A 1 54  ? -5.933  3.536   -5.534  1.00 0.00 ? 105 VAL A H    5  
ATOM 8728  H HA   . VAL A 1 54  ? -3.235  4.775   -5.723  1.00 0.00 ? 105 VAL A HA   5  
ATOM 8729  H HB   . VAL A 1 54  ? -3.576  4.256   -3.350  1.00 0.00 ? 105 VAL A HB   5  
ATOM 8730  H HG11 . VAL A 1 54  ? -5.277  2.406   -3.884  1.00 0.00 ? 105 VAL A HG11 5  
ATOM 8731  H HG12 . VAL A 1 54  ? -3.879  1.353   -4.129  1.00 0.00 ? 105 VAL A HG12 5  
ATOM 8732  H HG13 . VAL A 1 54  ? -4.156  2.107   -2.559  1.00 0.00 ? 105 VAL A HG13 5  
ATOM 8733  H HG21 . VAL A 1 54  ? -1.362  3.838   -4.530  1.00 0.00 ? 105 VAL A HG21 5  
ATOM 8734  H HG22 . VAL A 1 54  ? -1.598  2.949   -3.026  1.00 0.00 ? 105 VAL A HG22 5  
ATOM 8735  H HG23 . VAL A 1 54  ? -1.801  2.127   -4.578  1.00 0.00 ? 105 VAL A HG23 5  
ATOM 8736  N N    . MET A 1 55  ? -2.328  2.797   -7.006  1.00 0.00 ? 106 MET A N    5  
ATOM 8737  C CA   . MET A 1 55  ? -1.938  1.751   -8.008  1.00 0.00 ? 106 MET A CA   5  
ATOM 8738  C C    . MET A 1 55  ? -0.518  1.289   -7.693  1.00 0.00 ? 106 MET A C    5  
ATOM 8739  O O    . MET A 1 55  ? 0.142   1.889   -6.878  1.00 0.00 ? 106 MET A O    5  
ATOM 8740  C CB   . MET A 1 55  ? -1.984  2.354   -9.403  1.00 0.00 ? 106 MET A CB   5  
ATOM 8741  C CG   . MET A 1 55  ? -1.002  3.534   -9.489  1.00 0.00 ? 106 MET A CG   5  
ATOM 8742  S SD   . MET A 1 55  ? -1.326  4.468   -11.009 1.00 0.00 ? 106 MET A SD   5  
ATOM 8743  C CE   . MET A 1 55  ? -2.725  5.463   -10.407 1.00 0.00 ? 106 MET A CE   5  
ATOM 8744  H H    . MET A 1 55  ? -1.678  3.495   -6.748  1.00 0.00 ? 106 MET A H    5  
ATOM 8745  H HA   . MET A 1 55  ? -2.614  0.902   -7.947  1.00 0.00 ? 106 MET A HA   5  
ATOM 8746  H HB2  . MET A 1 55  ? -1.711  1.597   -10.126 1.00 0.00 ? 106 MET A HB2  5  
ATOM 8747  H HB3  . MET A 1 55  ? -2.982  2.704   -9.607  1.00 0.00 ? 106 MET A HB3  5  
ATOM 8748  H HG2  . MET A 1 55  ? -1.133  4.187   -8.636  1.00 0.00 ? 106 MET A HG2  5  
ATOM 8749  H HG3  . MET A 1 55  ? 0.012   3.162   -9.501  1.00 0.00 ? 106 MET A HG3  5  
ATOM 8750  H HE1  . MET A 1 55  ? -3.069  5.089   -9.456  1.00 0.00 ? 106 MET A HE1  5  
ATOM 8751  H HE2  . MET A 1 55  ? -2.416  6.486   -10.288 1.00 0.00 ? 106 MET A HE2  5  
ATOM 8752  H HE3  . MET A 1 55  ? -3.532  5.416   -11.126 1.00 0.00 ? 106 MET A HE3  5  
ATOM 8753  N N    . ALA A 1 56  ? -0.032  0.223   -8.298  1.00 0.00 ? 107 ALA A N    5  
ATOM 8754  C CA   . ALA A 1 56  ? 1.354   -0.236  -7.944  1.00 0.00 ? 107 ALA A CA   5  
ATOM 8755  C C    . ALA A 1 56  ? 2.081   -0.913  -9.133  1.00 0.00 ? 107 ALA A C    5  
ATOM 8756  O O    . ALA A 1 56  ? 2.762   -1.898  -8.962  1.00 0.00 ? 107 ALA A O    5  
ATOM 8757  C CB   . ALA A 1 56  ? 1.224   -1.234  -6.793  1.00 0.00 ? 107 ALA A CB   5  
ATOM 8758  H H    . ALA A 1 56  ? -0.573  -0.276  -8.950  1.00 0.00 ? 107 ALA A H    5  
ATOM 8759  H HA   . ALA A 1 56  ? 1.935   0.607   -7.603  1.00 0.00 ? 107 ALA A HA   5  
ATOM 8760  H HB1  . ALA A 1 56  ? 0.329   -1.007  -6.233  1.00 0.00 ? 107 ALA A HB1  5  
ATOM 8761  H HB2  . ALA A 1 56  ? 1.157   -2.244  -7.179  1.00 0.00 ? 107 ALA A HB2  5  
ATOM 8762  H HB3  . ALA A 1 56  ? 2.084   -1.150  -6.147  1.00 0.00 ? 107 ALA A HB3  5  
ATOM 8763  N N    . GLY A 1 57  ? 1.950   -0.399  -10.321 1.00 0.00 ? 108 GLY A N    5  
ATOM 8764  C CA   . GLY A 1 57  ? 2.644   -1.020  -11.501 1.00 0.00 ? 108 GLY A CA   5  
ATOM 8765  C C    . GLY A 1 57  ? 4.054   -0.448  -11.652 1.00 0.00 ? 108 GLY A C    5  
ATOM 8766  O O    . GLY A 1 57  ? 4.381   0.572   -11.079 1.00 0.00 ? 108 GLY A O    5  
ATOM 8767  H H    . GLY A 1 57  ? 1.419   0.401   -10.439 1.00 0.00 ? 108 GLY A H    5  
ATOM 8768  H HA2  . GLY A 1 57  ? 2.707   -2.089  -11.361 1.00 0.00 ? 108 GLY A HA2  5  
ATOM 8769  H HA3  . GLY A 1 57  ? 2.087   -0.811  -12.398 1.00 0.00 ? 108 GLY A HA3  5  
ATOM 8770  N N    . ASN A 1 58  ? 4.887   -1.074  -12.457 1.00 0.00 ? 109 ASN A N    5  
ATOM 8771  C CA   . ASN A 1 58  ? 6.259   -0.520  -12.671 1.00 0.00 ? 109 ASN A CA   5  
ATOM 8772  C C    . ASN A 1 58  ? 6.147   0.715   -13.582 1.00 0.00 ? 109 ASN A C    5  
ATOM 8773  O O    . ASN A 1 58  ? 5.107   0.982   -14.155 1.00 0.00 ? 109 ASN A O    5  
ATOM 8774  C CB   . ASN A 1 58  ? 7.193   -1.596  -13.273 1.00 0.00 ? 109 ASN A CB   5  
ATOM 8775  C CG   . ASN A 1 58  ? 8.440   -0.946  -13.904 1.00 0.00 ? 109 ASN A CG   5  
ATOM 8776  O OD1  . ASN A 1 58  ? 9.540   -1.128  -13.418 1.00 0.00 ? 109 ASN A OD1  5  
ATOM 8777  N ND2  . ASN A 1 58  ? 8.320   -0.176  -14.954 1.00 0.00 ? 109 ASN A ND2  5  
ATOM 8778  H H    . ASN A 1 58  ? 4.597   -1.886  -12.937 1.00 0.00 ? 109 ASN A H    5  
ATOM 8779  H HA   . ASN A 1 58  ? 6.650   -0.205  -11.713 1.00 0.00 ? 109 ASN A HA   5  
ATOM 8780  H HB2  . ASN A 1 58  ? 7.515   -2.255  -12.476 1.00 0.00 ? 109 ASN A HB2  5  
ATOM 8781  H HB3  . ASN A 1 58  ? 6.667   -2.173  -14.015 1.00 0.00 ? 109 ASN A HB3  5  
ATOM 8782  H HD21 . ASN A 1 58  ? 7.437   -0.007  -15.339 1.00 0.00 ? 109 ASN A HD21 5  
ATOM 8783  H HD22 . ASN A 1 58  ? 9.116   0.240   -15.355 1.00 0.00 ? 109 ASN A HD22 5  
ATOM 8784  N N    . ASP A 1 59  ? 7.198   1.483   -13.697 1.00 0.00 ? 110 ASP A N    5  
ATOM 8785  C CA   . ASP A 1 59  ? 7.146   2.725   -14.540 1.00 0.00 ? 110 ASP A CA   5  
ATOM 8786  C C    . ASP A 1 59  ? 6.809   2.429   -16.012 1.00 0.00 ? 110 ASP A C    5  
ATOM 8787  O O    . ASP A 1 59  ? 5.931   3.054   -16.577 1.00 0.00 ? 110 ASP A O    5  
ATOM 8788  C CB   . ASP A 1 59  ? 8.521   3.398   -14.498 1.00 0.00 ? 110 ASP A CB   5  
ATOM 8789  C CG   . ASP A 1 59  ? 8.490   4.684   -15.326 1.00 0.00 ? 110 ASP A CG   5  
ATOM 8790  O OD1  . ASP A 1 59  ? 7.448   4.982   -15.881 1.00 0.00 ? 110 ASP A OD1  5  
ATOM 8791  O OD2  . ASP A 1 59  ? 9.511   5.349   -15.394 1.00 0.00 ? 110 ASP A OD2  5  
ATOM 8792  H H    . ASP A 1 59  ? 8.014   1.258   -13.206 1.00 0.00 ? 110 ASP A H    5  
ATOM 8793  H HA   . ASP A 1 59  ? 6.414   3.402   -14.142 1.00 0.00 ? 110 ASP A HA   5  
ATOM 8794  H HB2  . ASP A 1 59  ? 8.773   3.634   -13.477 1.00 0.00 ? 110 ASP A HB2  5  
ATOM 8795  H HB3  . ASP A 1 59  ? 9.262   2.727   -14.906 1.00 0.00 ? 110 ASP A HB3  5  
ATOM 8796  N N    . GLU A 1 60  ? 7.502   1.507   -16.643 1.00 0.00 ? 111 GLU A N    5  
ATOM 8797  C CA   . GLU A 1 60  ? 7.229   1.218   -18.087 1.00 0.00 ? 111 GLU A CA   5  
ATOM 8798  C C    . GLU A 1 60  ? 6.112   0.173   -18.252 1.00 0.00 ? 111 GLU A C    5  
ATOM 8799  O O    . GLU A 1 60  ? 5.732   -0.147  -19.360 1.00 0.00 ? 111 GLU A O    5  
ATOM 8800  C CB   . GLU A 1 60  ? 8.517   0.717   -18.751 1.00 0.00 ? 111 GLU A CB   5  
ATOM 8801  C CG   . GLU A 1 60  ? 8.817   -0.722  -18.331 1.00 0.00 ? 111 GLU A CG   5  
ATOM 8802  C CD   . GLU A 1 60  ? 10.236  -1.079  -18.772 1.00 0.00 ? 111 GLU A CD   5  
ATOM 8803  O OE1  . GLU A 1 60  ? 10.604  -0.684  -19.869 1.00 0.00 ? 111 GLU A OE1  5  
ATOM 8804  O OE2  . GLU A 1 60  ? 10.930  -1.732  -18.009 1.00 0.00 ? 111 GLU A OE2  5  
ATOM 8805  H H    . GLU A 1 60  ? 8.220   1.034   -16.178 1.00 0.00 ? 111 GLU A H    5  
ATOM 8806  H HA   . GLU A 1 60  ? 6.924   2.129   -18.583 1.00 0.00 ? 111 GLU A HA   5  
ATOM 8807  H HB2  . GLU A 1 60  ? 8.408   0.765   -19.823 1.00 0.00 ? 111 GLU A HB2  5  
ATOM 8808  H HB3  . GLU A 1 60  ? 9.340   1.348   -18.447 1.00 0.00 ? 111 GLU A HB3  5  
ATOM 8809  H HG2  . GLU A 1 60  ? 8.734   -0.813  -17.261 1.00 0.00 ? 111 GLU A HG2  5  
ATOM 8810  H HG3  . GLU A 1 60  ? 8.120   -1.391  -18.808 1.00 0.00 ? 111 GLU A HG3  5  
ATOM 8811  N N    . ASN A 1 61  ? 5.571   -0.350  -17.180 1.00 0.00 ? 112 ASN A N    5  
ATOM 8812  C CA   . ASN A 1 61  ? 4.473   -1.359  -17.293 1.00 0.00 ? 112 ASN A CA   5  
ATOM 8813  C C    . ASN A 1 61  ? 3.150   -0.687  -17.003 1.00 0.00 ? 112 ASN A C    5  
ATOM 8814  O O    . ASN A 1 61  ? 3.090   0.454   -16.599 1.00 0.00 ? 112 ASN A O    5  
ATOM 8815  C CB   . ASN A 1 61  ? 4.662   -2.470  -16.275 1.00 0.00 ? 112 ASN A CB   5  
ATOM 8816  C CG   . ASN A 1 61  ? 5.933   -3.232  -16.580 1.00 0.00 ? 112 ASN A CG   5  
ATOM 8817  O OD1  . ASN A 1 61  ? 6.457   -3.160  -17.677 1.00 0.00 ? 112 ASN A OD1  5  
ATOM 8818  N ND2  . ASN A 1 61  ? 6.436   -3.980  -15.648 1.00 0.00 ? 112 ASN A ND2  5  
ATOM 8819  H H    . ASN A 1 61  ? 5.875   -0.072  -16.297 1.00 0.00 ? 112 ASN A H    5  
ATOM 8820  H HA   . ASN A 1 61  ? 4.454   -1.787  -18.286 1.00 0.00 ? 112 ASN A HA   5  
ATOM 8821  H HB2  . ASN A 1 61  ? 4.735   -2.039  -15.290 1.00 0.00 ? 112 ASN A HB2  5  
ATOM 8822  H HB3  . ASN A 1 61  ? 3.820   -3.143  -16.310 1.00 0.00 ? 112 ASN A HB3  5  
ATOM 8823  H HD21 . ASN A 1 61  ? 5.988   -4.038  -14.771 1.00 0.00 ? 112 ASN A HD21 5  
ATOM 8824  H HD22 . ASN A 1 61  ? 7.263   -4.475  -15.808 1.00 0.00 ? 112 ASN A HD22 5  
ATOM 8825  N N    . TYR A 1 62  ? 2.091   -1.397  -17.190 1.00 0.00 ? 113 TYR A N    5  
ATOM 8826  C CA   . TYR A 1 62  ? 0.766   -0.814  -16.910 1.00 0.00 ? 113 TYR A CA   5  
ATOM 8827  C C    . TYR A 1 62  ? 0.675   -0.529  -15.422 1.00 0.00 ? 113 TYR A C    5  
ATOM 8828  O O    . TYR A 1 62  ? 1.512   -0.959  -14.657 1.00 0.00 ? 113 TYR A O    5  
ATOM 8829  C CB   . TYR A 1 62  ? -0.321  -1.818  -17.286 1.00 0.00 ? 113 TYR A CB   5  
ATOM 8830  C CG   . TYR A 1 62  ? 0.046   -3.178  -16.714 1.00 0.00 ? 113 TYR A CG   5  
ATOM 8831  C CD1  . TYR A 1 62  ? -0.096  -3.433  -15.343 1.00 0.00 ? 113 TYR A CD1  5  
ATOM 8832  C CD2  . TYR A 1 62  ? 0.547   -4.170  -17.550 1.00 0.00 ? 113 TYR A CD2  5  
ATOM 8833  C CE1  . TYR A 1 62  ? 0.254   -4.689  -14.813 1.00 0.00 ? 113 TYR A CE1  5  
ATOM 8834  C CE2  . TYR A 1 62  ? 0.899   -5.427  -17.032 1.00 0.00 ? 113 TYR A CE2  5  
ATOM 8835  C CZ   . TYR A 1 62  ? 0.755   -5.695  -15.661 1.00 0.00 ? 113 TYR A CZ   5  
ATOM 8836  O OH   . TYR A 1 62  ? 1.083   -6.951  -15.151 1.00 0.00 ? 113 TYR A OH   5  
ATOM 8837  H H    . TYR A 1 62  ? 2.163   -2.319  -17.509 1.00 0.00 ? 113 TYR A H    5  
ATOM 8838  H HA   . TYR A 1 62  ? 0.654   0.102   -17.465 1.00 0.00 ? 113 TYR A HA   5  
ATOM 8839  H HB2  . TYR A 1 62  ? -1.266  -1.496  -16.876 1.00 0.00 ? 113 TYR A HB2  5  
ATOM 8840  H HB3  . TYR A 1 62  ? -0.397  -1.887  -18.362 1.00 0.00 ? 113 TYR A HB3  5  
ATOM 8841  H HD1  . TYR A 1 62  ? -0.496  -2.673  -14.694 1.00 0.00 ? 113 TYR A HD1  5  
ATOM 8842  H HD2  . TYR A 1 62  ? 0.656   -3.972  -18.602 1.00 0.00 ? 113 TYR A HD2  5  
ATOM 8843  H HE1  . TYR A 1 62  ? 0.156   -4.871  -13.751 1.00 0.00 ? 113 TYR A HE1  5  
ATOM 8844  H HE2  . TYR A 1 62  ? 1.287   -6.186  -17.695 1.00 0.00 ? 113 TYR A HE2  5  
ATOM 8845  H HH   . TYR A 1 62  ? 0.702   -7.627  -15.731 1.00 0.00 ? 113 TYR A HH   5  
ATOM 8846  N N    . SER A 1 63  ? -0.340  0.163   -14.991 1.00 0.00 ? 114 SER A N    5  
ATOM 8847  C CA   . SER A 1 63  ? -0.467  0.435   -13.539 1.00 0.00 ? 114 SER A CA   5  
ATOM 8848  C C    . SER A 1 63  ? -1.020  -0.844  -12.876 1.00 0.00 ? 114 SER A C    5  
ATOM 8849  O O    . SER A 1 63  ? -1.965  -1.437  -13.363 1.00 0.00 ? 114 SER A O    5  
ATOM 8850  C CB   . SER A 1 63  ? -1.442  1.595   -13.358 1.00 0.00 ? 114 SER A CB   5  
ATOM 8851  O OG   . SER A 1 63  ? -2.767  1.129   -13.580 1.00 0.00 ? 114 SER A OG   5  
ATOM 8852  H H    . SER A 1 63  ? -1.023  0.487   -15.621 1.00 0.00 ? 114 SER A H    5  
ATOM 8853  H HA   . SER A 1 63  ? 0.496   0.698   -13.116 1.00 0.00 ? 114 SER A HA   5  
ATOM 8854  H HB2  . SER A 1 63  ? -1.355  1.989   -12.364 1.00 0.00 ? 114 SER A HB2  5  
ATOM 8855  H HB3  . SER A 1 63  ? -1.205  2.382   -14.070 1.00 0.00 ? 114 SER A HB3  5  
ATOM 8856  H HG   . SER A 1 63  ? -3.049  1.434   -14.447 1.00 0.00 ? 114 SER A HG   5  
ATOM 8857  N N    . ALA A 1 64  ? -0.440  -1.295  -11.788 1.00 0.00 ? 115 ALA A N    5  
ATOM 8858  C CA   . ALA A 1 64  ? -0.951  -2.550  -11.153 1.00 0.00 ? 115 ALA A CA   5  
ATOM 8859  C C    . ALA A 1 64  ? -2.427  -2.396  -10.812 1.00 0.00 ? 115 ALA A C    5  
ATOM 8860  O O    . ALA A 1 64  ? -2.942  -1.301  -10.745 1.00 0.00 ? 115 ALA A O    5  
ATOM 8861  C CB   . ALA A 1 64  ? -0.186  -2.846  -9.865  1.00 0.00 ? 115 ALA A CB   5  
ATOM 8862  H H    . ALA A 1 64  ? 0.330   -0.824  -11.399 1.00 0.00 ? 115 ALA A H    5  
ATOM 8863  H HA   . ALA A 1 64  ? -0.827  -3.377  -11.846 1.00 0.00 ? 115 ALA A HA   5  
ATOM 8864  H HB1  . ALA A 1 64  ? -0.292  -2.017  -9.181  1.00 0.00 ? 115 ALA A HB1  5  
ATOM 8865  H HB2  . ALA A 1 64  ? -0.583  -3.741  -9.410  1.00 0.00 ? 115 ALA A HB2  5  
ATOM 8866  H HB3  . ALA A 1 64  ? 0.860   -2.994  -10.093 1.00 0.00 ? 115 ALA A HB3  5  
ATOM 8867  N N    . GLU A 1 65  ? -3.111  -3.490  -10.588 1.00 0.00 ? 116 GLU A N    5  
ATOM 8868  C CA   . GLU A 1 65  ? -4.571  -3.419  -10.256 1.00 0.00 ? 116 GLU A CA   5  
ATOM 8869  C C    . GLU A 1 65  ? -4.829  -3.969  -8.846  1.00 0.00 ? 116 GLU A C    5  
ATOM 8870  O O    . GLU A 1 65  ? -4.631  -5.134  -8.565  1.00 0.00 ? 116 GLU A O    5  
ATOM 8871  C CB   . GLU A 1 65  ? -5.344  -4.283  -11.254 1.00 0.00 ? 116 GLU A CB   5  
ATOM 8872  C CG   . GLU A 1 65  ? -6.853  -4.068  -11.059 1.00 0.00 ? 116 GLU A CG   5  
ATOM 8873  C CD   . GLU A 1 65  ? -7.229  -2.659  -11.541 1.00 0.00 ? 116 GLU A CD   5  
ATOM 8874  O OE1  . GLU A 1 65  ? -6.776  -2.278  -12.609 1.00 0.00 ? 116 GLU A OE1  5  
ATOM 8875  O OE2  . GLU A 1 65  ? -7.948  -1.976  -10.833 1.00 0.00 ? 116 GLU A OE2  5  
ATOM 8876  H H    . GLU A 1 65  ? -2.667  -4.362  -10.647 1.00 0.00 ? 116 GLU A H    5  
ATOM 8877  H HA   . GLU A 1 65  ? -4.929  -2.396  -10.313 1.00 0.00 ? 116 GLU A HA   5  
ATOM 8878  H HB2  . GLU A 1 65  ? -5.059  -4.009  -12.265 1.00 0.00 ? 116 GLU A HB2  5  
ATOM 8879  H HB3  . GLU A 1 65  ? -5.107  -5.319  -11.086 1.00 0.00 ? 116 GLU A HB3  5  
ATOM 8880  H HG2  . GLU A 1 65  ? -7.400  -4.812  -11.629 1.00 0.00 ? 116 GLU A HG2  5  
ATOM 8881  H HG3  . GLU A 1 65  ? -7.105  -4.171  -10.008 1.00 0.00 ? 116 GLU A HG3  5  
ATOM 8882  N N    . LEU A 1 66  ? -5.307  -3.129  -7.976  1.00 0.00 ? 117 LEU A N    5  
ATOM 8883  C CA   . LEU A 1 66  ? -5.648  -3.565  -6.594  1.00 0.00 ? 117 LEU A CA   5  
ATOM 8884  C C    . LEU A 1 66  ? -7.176  -3.602  -6.468  1.00 0.00 ? 117 LEU A C    5  
ATOM 8885  O O    . LEU A 1 66  ? -7.869  -2.892  -7.169  1.00 0.00 ? 117 LEU A O    5  
ATOM 8886  C CB   . LEU A 1 66  ? -5.037  -2.585  -5.580  1.00 0.00 ? 117 LEU A CB   5  
ATOM 8887  C CG   . LEU A 1 66  ? -3.489  -2.675  -5.626  1.00 0.00 ? 117 LEU A CG   5  
ATOM 8888  C CD1  . LEU A 1 66  ? -2.911  -1.666  -6.636  1.00 0.00 ? 117 LEU A CD1  5  
ATOM 8889  C CD2  . LEU A 1 66  ? -2.907  -2.364  -4.242  1.00 0.00 ? 117 LEU A CD2  5  
ATOM 8890  H H    . LEU A 1 66  ? -5.467  -2.206  -8.241  1.00 0.00 ? 117 LEU A H    5  
ATOM 8891  H HA   . LEU A 1 66  ? -5.266  -4.557  -6.414  1.00 0.00 ? 117 LEU A HA   5  
ATOM 8892  H HB2  . LEU A 1 66  ? -5.348  -1.577  -5.820  1.00 0.00 ? 117 LEU A HB2  5  
ATOM 8893  H HB3  . LEU A 1 66  ? -5.382  -2.841  -4.594  1.00 0.00 ? 117 LEU A HB3  5  
ATOM 8894  H HG   . LEU A 1 66  ? -3.196  -3.676  -5.916  1.00 0.00 ? 117 LEU A HG   5  
ATOM 8895  H HD11 . LEU A 1 66  ? -3.506  -1.671  -7.534  1.00 0.00 ? 117 LEU A HD11 5  
ATOM 8896  H HD12 . LEU A 1 66  ? -2.923  -0.679  -6.199  1.00 0.00 ? 117 LEU A HD12 5  
ATOM 8897  H HD13 . LEU A 1 66  ? -1.892  -1.939  -6.878  1.00 0.00 ? 117 LEU A HD13 5  
ATOM 8898  H HD21 . LEU A 1 66  ? -3.268  -1.399  -3.910  1.00 0.00 ? 117 LEU A HD21 5  
ATOM 8899  H HD22 . LEU A 1 66  ? -3.214  -3.131  -3.540  1.00 0.00 ? 117 LEU A HD22 5  
ATOM 8900  H HD23 . LEU A 1 66  ? -1.830  -2.341  -4.306  1.00 0.00 ? 117 LEU A HD23 5  
ATOM 8901  N N    . ARG A 1 67  ? -7.719  -4.414  -5.593  1.00 0.00 ? 118 ARG A N    5  
ATOM 8902  C CA   . ARG A 1 67  ? -9.216  -4.470  -5.448  1.00 0.00 ? 118 ARG A CA   5  
ATOM 8903  C C    . ARG A 1 67  ? -9.608  -3.576  -4.285  1.00 0.00 ? 118 ARG A C    5  
ATOM 8904  O O    . ARG A 1 67  ? -8.909  -3.503  -3.301  1.00 0.00 ? 118 ARG A O    5  
ATOM 8905  C CB   . ARG A 1 67  ? -9.674  -5.908  -5.153  1.00 0.00 ? 118 ARG A CB   5  
ATOM 8906  C CG   . ARG A 1 67  ? -11.207 -6.020  -5.201  1.00 0.00 ? 118 ARG A CG   5  
ATOM 8907  C CD   . ARG A 1 67  ? -11.718 -6.176  -6.648  1.00 0.00 ? 118 ARG A CD   5  
ATOM 8908  N NE   . ARG A 1 67  ? -13.195 -5.901  -6.687  1.00 0.00 ? 118 ARG A NE   5  
ATOM 8909  C CZ   . ARG A 1 67  ? -13.798 -5.752  -7.844  1.00 0.00 ? 118 ARG A CZ   5  
ATOM 8910  N NH1  . ARG A 1 67  ? -13.097 -5.762  -8.941  1.00 0.00 ? 118 ARG A NH1  5  
ATOM 8911  N NH2  . ARG A 1 67  ? -15.094 -5.573  -7.911  1.00 0.00 ? 118 ARG A NH2  5  
ATOM 8912  H H    . ARG A 1 67  ? -7.147  -4.978  -5.026  1.00 0.00 ? 118 ARG A H    5  
ATOM 8913  H HA   . ARG A 1 67  ? -9.685  -4.105  -6.350  1.00 0.00 ? 118 ARG A HA   5  
ATOM 8914  H HB2  . ARG A 1 67  ? -9.250  -6.577  -5.880  1.00 0.00 ? 118 ARG A HB2  5  
ATOM 8915  H HB3  . ARG A 1 67  ? -9.334  -6.187  -4.166  1.00 0.00 ? 118 ARG A HB3  5  
ATOM 8916  H HG2  . ARG A 1 67  ? -11.503 -6.883  -4.626  1.00 0.00 ? 118 ARG A HG2  5  
ATOM 8917  H HG3  . ARG A 1 67  ? -11.650 -5.139  -4.762  1.00 0.00 ? 118 ARG A HG3  5  
ATOM 8918  H HD2  . ARG A 1 67  ? -11.210 -5.484  -7.293  1.00 0.00 ? 118 ARG A HD2  5  
ATOM 8919  H HD3  . ARG A 1 67  ? -11.522 -7.183  -6.992  1.00 0.00 ? 118 ARG A HD3  5  
ATOM 8920  H HE   . ARG A 1 67  ? -13.712 -5.857  -5.849  1.00 0.00 ? 118 ARG A HE   5  
ATOM 8921  H HH11 . ARG A 1 67  ? -12.104 -5.878  -8.894  1.00 0.00 ? 118 ARG A HH11 5  
ATOM 8922  H HH12 . ARG A 1 67  ? -13.552 -5.652  -9.828  1.00 0.00 ? 118 ARG A HH12 5  
ATOM 8923  H HH21 . ARG A 1 67  ? -15.638 -5.539  -7.078  1.00 0.00 ? 118 ARG A HH21 5  
ATOM 8924  H HH22 . ARG A 1 67  ? -15.540 -5.492  -8.803  1.00 0.00 ? 118 ARG A HH22 5  
ATOM 8925  N N    . ASN A 1 68  ? -10.692 -2.857  -4.410  1.00 0.00 ? 119 ASN A N    5  
ATOM 8926  C CA   . ASN A 1 68  ? -11.101 -1.934  -3.320  1.00 0.00 ? 119 ASN A CA   5  
ATOM 8927  C C    . ASN A 1 68  ? -9.976  -0.933  -3.133  1.00 0.00 ? 119 ASN A C    5  
ATOM 8928  O O    . ASN A 1 68  ? -9.625  -0.586  -2.021  1.00 0.00 ? 119 ASN A O    5  
ATOM 8929  C CB   . ASN A 1 68  ? -11.328 -2.700  -2.012  1.00 0.00 ? 119 ASN A CB   5  
ATOM 8930  C CG   . ASN A 1 68  ? -12.150 -1.844  -1.048  1.00 0.00 ? 119 ASN A CG   5  
ATOM 8931  O OD1  . ASN A 1 68  ? -13.290 -1.533  -1.321  1.00 0.00 ? 119 ASN A OD1  5  
ATOM 8932  N ND2  . ASN A 1 68  ? -11.612 -1.448  0.072   1.00 0.00 ? 119 ASN A ND2  5  
ATOM 8933  H H    . ASN A 1 68  ? -11.229 -2.917  -5.230  1.00 0.00 ? 119 ASN A H    5  
ATOM 8934  H HA   . ASN A 1 68  ? -12.001 -1.415  -3.606  1.00 0.00 ? 119 ASN A HA   5  
ATOM 8935  H HB2  . ASN A 1 68  ? -11.869 -3.608  -2.219  1.00 0.00 ? 119 ASN A HB2  5  
ATOM 8936  H HB3  . ASN A 1 68  ? -10.375 -2.947  -1.554  1.00 0.00 ? 119 ASN A HB3  5  
ATOM 8937  H HD21 . ASN A 1 68  ? -10.687 -1.699  0.282   1.00 0.00 ? 119 ASN A HD21 5  
ATOM 8938  H HD22 . ASN A 1 68  ? -12.136 -0.906  0.707   1.00 0.00 ? 119 ASN A HD22 5  
ATOM 8939  N N    . ALA A 1 69  ? -9.409  -0.460  -4.213  1.00 0.00 ? 120 ALA A N    5  
ATOM 8940  C CA   . ALA A 1 69  ? -8.300  0.524   -4.093  1.00 0.00 ? 120 ALA A CA   5  
ATOM 8941  C C    . ALA A 1 69  ? -8.923  1.896   -3.951  1.00 0.00 ? 120 ALA A C    5  
ATOM 8942  O O    . ALA A 1 69  ? -8.276  2.873   -3.640  1.00 0.00 ? 120 ALA A O    5  
ATOM 8943  C CB   . ALA A 1 69  ? -7.425  0.458   -5.350  1.00 0.00 ? 120 ALA A CB   5  
ATOM 8944  H H    . ALA A 1 69  ? -9.724  -0.748  -5.105  1.00 0.00 ? 120 ALA A H    5  
ATOM 8945  H HA   . ALA A 1 69  ? -7.703  0.298   -3.217  1.00 0.00 ? 120 ALA A HA   5  
ATOM 8946  H HB1  . ALA A 1 69  ? -7.445  -0.550  -5.740  1.00 0.00 ? 120 ALA A HB1  5  
ATOM 8947  H HB2  . ALA A 1 69  ? -7.797  1.146   -6.096  1.00 0.00 ? 120 ALA A HB2  5  
ATOM 8948  H HB3  . ALA A 1 69  ? -6.411  0.723   -5.099  1.00 0.00 ? 120 ALA A HB3  5  
ATOM 8949  N N    . THR A 1 70  ? -10.192 1.960   -4.200  1.00 0.00 ? 121 THR A N    5  
ATOM 8950  C CA   . THR A 1 70  ? -10.921 3.244   -4.109  1.00 0.00 ? 121 THR A CA   5  
ATOM 8951  C C    . THR A 1 70  ? -11.708 3.246   -2.796  1.00 0.00 ? 121 THR A C    5  
ATOM 8952  O O    . THR A 1 70  ? -12.888 2.969   -2.774  1.00 0.00 ? 121 THR A O    5  
ATOM 8953  C CB   . THR A 1 70  ? -11.877 3.362   -5.313  1.00 0.00 ? 121 THR A CB   5  
ATOM 8954  O OG1  . THR A 1 70  ? -13.126 3.877   -4.896  1.00 0.00 ? 121 THR A OG1  5  
ATOM 8955  C CG2  . THR A 1 70  ? -12.082 1.981   -5.954  1.00 0.00 ? 121 THR A CG2  5  
ATOM 8956  H H    . THR A 1 70  ? -10.671 1.148   -4.460  1.00 0.00 ? 121 THR A H    5  
ATOM 8957  H HA   . THR A 1 70  ? -10.222 4.067   -4.117  1.00 0.00 ? 121 THR A HA   5  
ATOM 8958  H HB   . THR A 1 70  ? -11.455 4.029   -6.043  1.00 0.00 ? 121 THR A HB   5  
ATOM 8959  H HG1  . THR A 1 70  ? -13.439 3.332   -4.175  1.00 0.00 ? 121 THR A HG1  5  
ATOM 8960  H HG21 . THR A 1 70  ? -12.330 1.261   -5.190  1.00 0.00 ? 121 THR A HG21 5  
ATOM 8961  H HG22 . THR A 1 70  ? -12.880 2.029   -6.676  1.00 0.00 ? 121 THR A HG22 5  
ATOM 8962  H HG23 . THR A 1 70  ? -11.170 1.684   -6.447  1.00 0.00 ? 121 THR A HG23 5  
ATOM 8963  N N    . ALA A 1 71  ? -11.054 3.533   -1.694  1.00 0.00 ? 122 ALA A N    5  
ATOM 8964  C CA   . ALA A 1 71  ? -11.759 3.537   -0.366  1.00 0.00 ? 122 ALA A CA   5  
ATOM 8965  C C    . ALA A 1 71  ? -12.205 4.962   -0.030  1.00 0.00 ? 122 ALA A C    5  
ATOM 8966  O O    . ALA A 1 71  ? -11.622 5.918   -0.488  1.00 0.00 ? 122 ALA A O    5  
ATOM 8967  C CB   . ALA A 1 71  ? -10.807 3.032   0.729   1.00 0.00 ? 122 ALA A CB   5  
ATOM 8968  H H    . ALA A 1 71  ? -10.094 3.736   -1.740  1.00 0.00 ? 122 ALA A H    5  
ATOM 8969  H HA   . ALA A 1 71  ? -12.629 2.896   -0.414  1.00 0.00 ? 122 ALA A HA   5  
ATOM 8970  H HB1  . ALA A 1 71  ? -9.899  3.619   0.715   1.00 0.00 ? 122 ALA A HB1  5  
ATOM 8971  H HB2  . ALA A 1 71  ? -11.283 3.123   1.695   1.00 0.00 ? 122 ALA A HB2  5  
ATOM 8972  H HB3  . ALA A 1 71  ? -10.569 1.999   0.546   1.00 0.00 ? 122 ALA A HB3  5  
ATOM 8973  N N    . ALA A 1 72  ? -13.230 5.117   0.772   1.00 0.00 ? 123 ALA A N    5  
ATOM 8974  C CA   . ALA A 1 72  ? -13.701 6.493   1.130   1.00 0.00 ? 123 ALA A CA   5  
ATOM 8975  C C    . ALA A 1 72  ? -13.090 6.947   2.453   1.00 0.00 ? 123 ALA A C    5  
ATOM 8976  O O    . ALA A 1 72  ? -13.349 6.370   3.487   1.00 0.00 ? 123 ALA A O    5  
ATOM 8977  C CB   . ALA A 1 72  ? -15.228 6.467   1.270   1.00 0.00 ? 123 ALA A CB   5  
ATOM 8978  H H    . ALA A 1 72  ? -13.680 4.331   1.151   1.00 0.00 ? 123 ALA A H    5  
ATOM 8979  H HA   . ALA A 1 72  ? -13.431 7.190   0.347   1.00 0.00 ? 123 ALA A HA   5  
ATOM 8980  H HB1  . ALA A 1 72  ? -15.512 5.641   1.902   1.00 0.00 ? 123 ALA A HB1  5  
ATOM 8981  H HB2  . ALA A 1 72  ? -15.577 7.395   1.709   1.00 0.00 ? 123 ALA A HB2  5  
ATOM 8982  H HB3  . ALA A 1 72  ? -15.675 6.336   0.295   1.00 0.00 ? 123 ALA A HB3  5  
ATOM 8983  N N    . MET A 1 73  ? -12.293 7.992   2.438   1.00 0.00 ? 124 MET A N    5  
ATOM 8984  C CA   . MET A 1 73  ? -11.691 8.490   3.713   1.00 0.00 ? 124 MET A CA   5  
ATOM 8985  C C    . MET A 1 73  ? -12.806 8.978   4.627   1.00 0.00 ? 124 MET A C    5  
ATOM 8986  O O    . MET A 1 73  ? -13.632 9.778   4.220   1.00 0.00 ? 124 MET A O    5  
ATOM 8987  C CB   . MET A 1 73  ? -10.760 9.671   3.416   1.00 0.00 ? 124 MET A CB   5  
ATOM 8988  C CG   . MET A 1 73  ? -9.936  10.031  4.660   1.00 0.00 ? 124 MET A CG   5  
ATOM 8989  S SD   . MET A 1 73  ? -8.991  11.551  4.354   1.00 0.00 ? 124 MET A SD   5  
ATOM 8990  C CE   . MET A 1 73  ? -7.792  10.894  3.160   1.00 0.00 ? 124 MET A CE   5  
ATOM 8991  H H    . MET A 1 73  ? -12.115 8.462   1.595   1.00 0.00 ? 124 MET A H    5  
ATOM 8992  H HA   . MET A 1 73  ? -11.144 7.704   4.203   1.00 0.00 ? 124 MET A HA   5  
ATOM 8993  H HB2  . MET A 1 73  ? -10.101 9.419   2.601   1.00 0.00 ? 124 MET A HB2  5  
ATOM 8994  H HB3  . MET A 1 73  ? -11.369 10.518  3.145   1.00 0.00 ? 124 MET A HB3  5  
ATOM 8995  H HG2  . MET A 1 73  ? -10.598 10.180  5.493   1.00 0.00 ? 124 MET A HG2  5  
ATOM 8996  H HG3  . MET A 1 73  ? -9.253  9.237   4.891   1.00 0.00 ? 124 MET A HG3  5  
ATOM 8997  H HE1  . MET A 1 73  ? -7.832  9.817   3.152   1.00 0.00 ? 124 MET A HE1  5  
ATOM 8998  H HE2  . MET A 1 73  ? -8.023  11.265  2.169   1.00 0.00 ? 124 MET A HE2  5  
ATOM 8999  H HE3  . MET A 1 73  ? -6.797  11.209  3.444   1.00 0.00 ? 124 MET A HE3  5  
ATOM 9000  N N    . LYS A 1 74  ? -12.836 8.532   5.852   1.00 0.00 ? 125 LYS A N    5  
ATOM 9001  C CA   . LYS A 1 74  ? -13.906 9.009   6.773   1.00 0.00 ? 125 LYS A CA   5  
ATOM 9002  C C    . LYS A 1 74  ? -13.573 10.438  7.199   1.00 0.00 ? 125 LYS A C    5  
ATOM 9003  O O    . LYS A 1 74  ? -14.316 11.360  6.937   1.00 0.00 ? 125 LYS A O    5  
ATOM 9004  C CB   . LYS A 1 74  ? -13.941 8.097   7.991   1.00 0.00 ? 125 LYS A CB   5  
ATOM 9005  C CG   . LYS A 1 74  ? -14.245 6.669   7.539   1.00 0.00 ? 125 LYS A CG   5  
ATOM 9006  C CD   . LYS A 1 74  ? -14.404 5.776   8.764   1.00 0.00 ? 125 LYS A CD   5  
ATOM 9007  C CE   . LYS A 1 74  ? -14.596 4.335   8.302   1.00 0.00 ? 125 LYS A CE   5  
ATOM 9008  N NZ   . LYS A 1 74  ? -13.368 3.872   7.595   1.00 0.00 ? 125 LYS A NZ   5  
ATOM 9009  H H    . LYS A 1 74  ? -12.150 7.890   6.169   1.00 0.00 ? 125 LYS A H    5  
ATOM 9010  H HA   . LYS A 1 74  ? -14.856 8.998   6.272   1.00 0.00 ? 125 LYS A HA   5  
ATOM 9011  H HB2  . LYS A 1 74  ? -12.978 8.130   8.485   1.00 0.00 ? 125 LYS A HB2  5  
ATOM 9012  H HB3  . LYS A 1 74  ? -14.714 8.427   8.673   1.00 0.00 ? 125 LYS A HB3  5  
ATOM 9013  H HG2  . LYS A 1 74  ? -15.159 6.658   6.959   1.00 0.00 ? 125 LYS A HG2  5  
ATOM 9014  H HG3  . LYS A 1 74  ? -13.426 6.302   6.934   1.00 0.00 ? 125 LYS A HG3  5  
ATOM 9015  H HD2  . LYS A 1 74  ? -13.515 5.846   9.375   1.00 0.00 ? 125 LYS A HD2  5  
ATOM 9016  H HD3  . LYS A 1 74  ? -15.268 6.087   9.339   1.00 0.00 ? 125 LYS A HD3  5  
ATOM 9017  H HE2  . LYS A 1 74  ? -14.775 3.704   9.162   1.00 0.00 ? 125 LYS A HE2  5  
ATOM 9018  H HE3  . LYS A 1 74  ? -15.439 4.285   7.628   1.00 0.00 ? 125 LYS A HE3  5  
ATOM 9019  H HZ1  . LYS A 1 74  ? -12.562 4.465   7.880   1.00 0.00 ? 125 LYS A HZ1  5  
ATOM 9020  H HZ2  . LYS A 1 74  ? -13.174 2.883   7.852   1.00 0.00 ? 125 LYS A HZ2  5  
ATOM 9021  H HZ3  . LYS A 1 74  ? -13.510 3.945   6.563   1.00 0.00 ? 125 LYS A HZ3  5  
ATOM 9022  N N    . ASN A 1 75  ? -12.444 10.627  7.828   1.00 0.00 ? 126 ASN A N    5  
ATOM 9023  C CA   . ASN A 1 75  ? -12.005 11.995  8.253   1.00 0.00 ? 126 ASN A CA   5  
ATOM 9024  C C    . ASN A 1 75  ? -10.648 12.238  7.621   1.00 0.00 ? 126 ASN A C    5  
ATOM 9025  O O    . ASN A 1 75  ? -10.528 12.299  6.417   1.00 0.00 ? 126 ASN A O    5  
ATOM 9026  C CB   . ASN A 1 75  ? -11.872 12.065  9.774   1.00 0.00 ? 126 ASN A CB   5  
ATOM 9027  C CG   . ASN A 1 75  ? -11.044 10.884  10.269  1.00 0.00 ? 126 ASN A CG   5  
ATOM 9028  O OD1  . ASN A 1 75  ? -10.563 10.092  9.486   1.00 0.00 ? 126 ASN A OD1  5  
ATOM 9029  N ND2  . ASN A 1 75  ? -10.841 10.746  11.550  1.00 0.00 ? 126 ASN A ND2  5  
ATOM 9030  H H    . ASN A 1 75  ? -11.861 9.857   8.008   1.00 0.00 ? 126 ASN A H    5  
ATOM 9031  H HA   . ASN A 1 75  ? -12.706 12.744  7.912   1.00 0.00 ? 126 ASN A HA   5  
ATOM 9032  H HB2  . ASN A 1 75  ? -11.372 12.983  10.042  1.00 0.00 ? 126 ASN A HB2  5  
ATOM 9033  H HB3  . ASN A 1 75  ? -12.850 12.039  10.230  1.00 0.00 ? 126 ASN A HB3  5  
ATOM 9034  H HD21 . ASN A 1 75  ? -11.213 11.401  12.176  1.00 0.00 ? 126 ASN A HD21 5  
ATOM 9035  H HD22 . ASN A 1 75  ? -10.324 9.987   11.886  1.00 0.00 ? 126 ASN A HD22 5  
ATOM 9036  N N    . GLN A 1 76  ? -9.622  12.333  8.417   1.00 0.00 ? 127 GLN A N    5  
ATOM 9037  C CA   . GLN A 1 76  ? -8.247  12.511  7.873   1.00 0.00 ? 127 GLN A CA   5  
ATOM 9038  C C    . GLN A 1 76  ? -7.602  11.124  7.792   1.00 0.00 ? 127 GLN A C    5  
ATOM 9039  O O    . GLN A 1 76  ? -6.396  10.989  7.695   1.00 0.00 ? 127 GLN A O    5  
ATOM 9040  C CB   . GLN A 1 76  ? -7.437  13.411  8.816   1.00 0.00 ? 127 GLN A CB   5  
ATOM 9041  C CG   . GLN A 1 76  ? -8.079  14.797  8.882   1.00 0.00 ? 127 GLN A CG   5  
ATOM 9042  C CD   . GLN A 1 76  ? -7.287  15.688  9.834   1.00 0.00 ? 127 GLN A CD   5  
ATOM 9043  O OE1  . GLN A 1 76  ? -6.687  15.213  10.786  1.00 0.00 ? 127 GLN A OE1  5  
ATOM 9044  N NE2  . GLN A 1 76  ? -7.258  16.969  9.605   1.00 0.00 ? 127 GLN A NE2  5  
ATOM 9045  H H    . GLN A 1 76  ? -9.752  12.252  9.387   1.00 0.00 ? 127 GLN A H    5  
ATOM 9046  H HA   . GLN A 1 76  ? -8.286  12.950  6.889   1.00 0.00 ? 127 GLN A HA   5  
ATOM 9047  H HB2  . GLN A 1 76  ? -7.427  12.984  9.804   1.00 0.00 ? 127 GLN A HB2  5  
ATOM 9048  H HB3  . GLN A 1 76  ? -6.424  13.496  8.448   1.00 0.00 ? 127 GLN A HB3  5  
ATOM 9049  H HG2  . GLN A 1 76  ? -8.079  15.239  7.896   1.00 0.00 ? 127 GLN A HG2  5  
ATOM 9050  H HG3  . GLN A 1 76  ? -9.096  14.706  9.239   1.00 0.00 ? 127 GLN A HG3  5  
ATOM 9051  H HE21 . GLN A 1 76  ? -7.738  17.338  8.831   1.00 0.00 ? 127 GLN A HE21 5  
ATOM 9052  H HE22 . GLN A 1 76  ? -6.768  17.567  10.205  1.00 0.00 ? 127 GLN A HE22 5  
ATOM 9053  N N    . VAL A 1 77  ? -8.410  10.079  7.852   1.00 0.00 ? 128 VAL A N    5  
ATOM 9054  C CA   . VAL A 1 77  ? -7.848  8.680   7.810   1.00 0.00 ? 128 VAL A CA   5  
ATOM 9055  C C    . VAL A 1 77  ? -8.697  7.753   6.912   1.00 0.00 ? 128 VAL A C    5  
ATOM 9056  O O    . VAL A 1 77  ? -9.897  7.895   6.789   1.00 0.00 ? 128 VAL A O    5  
ATOM 9057  C CB   . VAL A 1 77  ? -7.807  8.124   9.237   1.00 0.00 ? 128 VAL A CB   5  
ATOM 9058  C CG1  . VAL A 1 77  ? -7.009  6.815   9.288   1.00 0.00 ? 128 VAL A CG1  5  
ATOM 9059  C CG2  . VAL A 1 77  ? -7.158  9.156   10.155  1.00 0.00 ? 128 VAL A CG2  5  
ATOM 9060  H H    . VAL A 1 77  ? -9.382  10.217  7.941   1.00 0.00 ? 128 VAL A H    5  
ATOM 9061  H HA   . VAL A 1 77  ? -6.847  8.716   7.423   1.00 0.00 ? 128 VAL A HA   5  
ATOM 9062  H HB   . VAL A 1 77  ? -8.819  7.937   9.571   1.00 0.00 ? 128 VAL A HB   5  
ATOM 9063  H HG11 . VAL A 1 77  ? -7.221  6.223   8.418   1.00 0.00 ? 128 VAL A HG11 5  
ATOM 9064  H HG12 . VAL A 1 77  ? -5.949  7.028   9.329   1.00 0.00 ? 128 VAL A HG12 5  
ATOM 9065  H HG13 . VAL A 1 77  ? -7.298  6.263   10.172  1.00 0.00 ? 128 VAL A HG13 5  
ATOM 9066  H HG21 . VAL A 1 77  ? -6.220  9.484   9.728   1.00 0.00 ? 128 VAL A HG21 5  
ATOM 9067  H HG22 . VAL A 1 77  ? -7.825  10.001  10.262  1.00 0.00 ? 128 VAL A HG22 5  
ATOM 9068  H HG23 . VAL A 1 77  ? -6.980  8.710   11.127  1.00 0.00 ? 128 VAL A HG23 5  
ATOM 9069  N N    . ALA A 1 78  ? -8.055  6.795   6.284   1.00 0.00 ? 129 ALA A N    5  
ATOM 9070  C CA   . ALA A 1 78  ? -8.765  5.833   5.390   1.00 0.00 ? 129 ALA A CA   5  
ATOM 9071  C C    . ALA A 1 78  ? -8.147  4.426   5.582   1.00 0.00 ? 129 ALA A C    5  
ATOM 9072  O O    . ALA A 1 78  ? -7.099  4.279   6.176   1.00 0.00 ? 129 ALA A O    5  
ATOM 9073  C CB   . ALA A 1 78  ? -8.552  6.263   3.931   1.00 0.00 ? 129 ALA A CB   5  
ATOM 9074  H H    . ALA A 1 78  ? -7.091  6.707   6.402   1.00 0.00 ? 129 ALA A H    5  
ATOM 9075  H HA   . ALA A 1 78  ? -9.827  5.819   5.621   1.00 0.00 ? 129 ALA A HA   5  
ATOM 9076  H HB1  . ALA A 1 78  ? -8.729  7.324   3.821   1.00 0.00 ? 129 ALA A HB1  5  
ATOM 9077  H HB2  . ALA A 1 78  ? -7.536  6.044   3.652   1.00 0.00 ? 129 ALA A HB2  5  
ATOM 9078  H HB3  . ALA A 1 78  ? -9.224  5.718   3.284   1.00 0.00 ? 129 ALA A HB3  5  
ATOM 9079  N N    . ARG A 1 79  ? -8.782  3.406   5.060   1.00 0.00 ? 130 ARG A N    5  
ATOM 9080  C CA   . ARG A 1 79  ? -8.242  2.007   5.167   1.00 0.00 ? 130 ARG A CA   5  
ATOM 9081  C C    . ARG A 1 79  ? -8.729  1.182   3.968   1.00 0.00 ? 130 ARG A C    5  
ATOM 9082  O O    . ARG A 1 79  ? -9.699  1.524   3.324   1.00 0.00 ? 130 ARG A O    5  
ATOM 9083  C CB   . ARG A 1 79  ? -8.738  1.335   6.449   1.00 0.00 ? 130 ARG A CB   5  
ATOM 9084  C CG   . ARG A 1 79  ? -8.193  2.088   7.663   1.00 0.00 ? 130 ARG A CG   5  
ATOM 9085  C CD   . ARG A 1 79  ? -8.507  1.288   8.916   1.00 0.00 ? 130 ARG A CD   5  
ATOM 9086  N NE   . ARG A 1 79  ? -7.681  0.042   8.915   1.00 0.00 ? 130 ARG A NE   5  
ATOM 9087  C CZ   . ARG A 1 79  ? -7.561  -0.659  10.011  1.00 0.00 ? 130 ARG A CZ   5  
ATOM 9088  N NH1  . ARG A 1 79  ? -8.211  -0.288  11.070  1.00 0.00 ? 130 ARG A NH1  5  
ATOM 9089  N NH2  . ARG A 1 79  ? -6.789  -1.719  10.050  1.00 0.00 ? 130 ARG A NH2  5  
ATOM 9090  H H    . ARG A 1 79  ? -9.610  3.559   4.588   1.00 0.00 ? 130 ARG A H    5  
ATOM 9091  H HA   . ARG A 1 79  ? -7.160  2.032   5.164   1.00 0.00 ? 130 ARG A HA   5  
ATOM 9092  H HB2  . ARG A 1 79  ? -9.819  1.342   6.468   1.00 0.00 ? 130 ARG A HB2  5  
ATOM 9093  H HB3  . ARG A 1 79  ? -8.387  0.309   6.476   1.00 0.00 ? 130 ARG A HB3  5  
ATOM 9094  H HG2  . ARG A 1 79  ? -7.119  2.191   7.570   1.00 0.00 ? 130 ARG A HG2  5  
ATOM 9095  H HG3  . ARG A 1 79  ? -8.653  3.066   7.734   1.00 0.00 ? 130 ARG A HG3  5  
ATOM 9096  H HD2  . ARG A 1 79  ? -8.266  1.875   9.787   1.00 0.00 ? 130 ARG A HD2  5  
ATOM 9097  H HD3  . ARG A 1 79  ? -9.558  1.035   8.924   1.00 0.00 ? 130 ARG A HD3  5  
ATOM 9098  H HE   . ARG A 1 79  ? -7.211  -0.232  8.098   1.00 0.00 ? 130 ARG A HE   5  
ATOM 9099  H HH11 . ARG A 1 79  ? -8.798  0.523   11.033  1.00 0.00 ? 130 ARG A HH11 5  
ATOM 9100  H HH12 . ARG A 1 79  ? -8.126  -0.805  11.920  1.00 0.00 ? 130 ARG A HH12 5  
ATOM 9101  H HH21 . ARG A 1 79  ? -6.279  -1.995  9.237   1.00 0.00 ? 130 ARG A HH21 5  
ATOM 9102  H HH22 . ARG A 1 79  ? -6.709  -2.254  10.894  1.00 0.00 ? 130 ARG A HH22 5  
ATOM 9103  N N    . PHE A 1 80  ? -8.077  0.079   3.693   1.00 0.00 ? 131 PHE A N    5  
ATOM 9104  C CA   . PHE A 1 80  ? -8.502  -0.810  2.557   1.00 0.00 ? 131 PHE A CA   5  
ATOM 9105  C C    . PHE A 1 80  ? -8.745  -2.214  3.128   1.00 0.00 ? 131 PHE A C    5  
ATOM 9106  O O    . PHE A 1 80  ? -7.875  -2.780  3.743   1.00 0.00 ? 131 PHE A O    5  
ATOM 9107  C CB   . PHE A 1 80  ? -7.381  -0.866  1.514   1.00 0.00 ? 131 PHE A CB   5  
ATOM 9108  C CG   . PHE A 1 80  ? -6.718  0.484   1.397   1.00 0.00 ? 131 PHE A CG   5  
ATOM 9109  C CD1  . PHE A 1 80  ? -5.701  0.830   2.291   1.00 0.00 ? 131 PHE A CD1  5  
ATOM 9110  C CD2  . PHE A 1 80  ? -7.111  1.381   0.395   1.00 0.00 ? 131 PHE A CD2  5  
ATOM 9111  C CE1  . PHE A 1 80  ? -5.078  2.080   2.183   1.00 0.00 ? 131 PHE A CE1  5  
ATOM 9112  C CE2  . PHE A 1 80  ? -6.491  2.633   0.287   1.00 0.00 ? 131 PHE A CE2  5  
ATOM 9113  C CZ   . PHE A 1 80  ? -5.472  2.982   1.179   1.00 0.00 ? 131 PHE A CZ   5  
ATOM 9114  H H    . PHE A 1 80  ? -7.316  -0.181  4.253   1.00 0.00 ? 131 PHE A H    5  
ATOM 9115  H HA   . PHE A 1 80  ? -9.411  -0.438  2.103   1.00 0.00 ? 131 PHE A HA   5  
ATOM 9116  H HB2  . PHE A 1 80  ? -6.644  -1.591  1.815   1.00 0.00 ? 131 PHE A HB2  5  
ATOM 9117  H HB3  . PHE A 1 80  ? -7.799  -1.143  0.560   1.00 0.00 ? 131 PHE A HB3  5  
ATOM 9118  H HD1  . PHE A 1 80  ? -5.398  0.134   3.065   1.00 0.00 ? 131 PHE A HD1  5  
ATOM 9119  H HD2  . PHE A 1 80  ? -7.892  1.106   -0.293  1.00 0.00 ? 131 PHE A HD2  5  
ATOM 9120  H HE1  . PHE A 1 80  ? -4.297  2.350   2.874   1.00 0.00 ? 131 PHE A HE1  5  
ATOM 9121  H HE2  . PHE A 1 80  ? -6.799  3.327   -0.485  1.00 0.00 ? 131 PHE A HE2  5  
ATOM 9122  H HZ   . PHE A 1 80  ? -4.989  3.946   1.096   1.00 0.00 ? 131 PHE A HZ   5  
ATOM 9123  N N    . ASN A 1 81  ? -9.916  -2.775  2.957   1.00 0.00 ? 132 ASN A N    5  
ATOM 9124  C CA   . ASN A 1 81  ? -10.184 -4.137  3.538   1.00 0.00 ? 132 ASN A CA   5  
ATOM 9125  C C    . ASN A 1 81  ? -9.892  -5.231  2.505   1.00 0.00 ? 132 ASN A C    5  
ATOM 9126  O O    . ASN A 1 81  ? -8.831  -5.816  2.482   1.00 0.00 ? 132 ASN A O    5  
ATOM 9127  C CB   . ASN A 1 81  ? -11.653 -4.219  3.957   1.00 0.00 ? 132 ASN A CB   5  
ATOM 9128  C CG   . ASN A 1 81  ? -11.962 -3.150  5.006   1.00 0.00 ? 132 ASN A CG   5  
ATOM 9129  O OD1  . ASN A 1 81  ? -12.894 -2.391  4.840   1.00 0.00 ? 132 ASN A OD1  5  
ATOM 9130  N ND2  . ASN A 1 81  ? -11.235 -3.065  6.088   1.00 0.00 ? 132 ASN A ND2  5  
ATOM 9131  H H    . ASN A 1 81  ? -10.621 -2.303  2.471   1.00 0.00 ? 132 ASN A H    5  
ATOM 9132  H HA   . ASN A 1 81  ? -9.555  -4.295  4.403   1.00 0.00 ? 132 ASN A HA   5  
ATOM 9133  H HB2  . ASN A 1 81  ? -12.281 -4.055  3.094   1.00 0.00 ? 132 ASN A HB2  5  
ATOM 9134  H HB3  . ASN A 1 81  ? -11.854 -5.189  4.372   1.00 0.00 ? 132 ASN A HB3  5  
ATOM 9135  H HD21 . ASN A 1 81  ? -10.486 -3.682  6.230   1.00 0.00 ? 132 ASN A HD21 5  
ATOM 9136  H HD22 . ASN A 1 81  ? -11.445 -2.386  6.769   1.00 0.00 ? 132 ASN A HD22 5  
ATOM 9137  N N    . ASP A 1 82  ? -10.836 -5.502  1.644   1.00 0.00 ? 133 ASP A N    5  
ATOM 9138  C CA   . ASP A 1 82  ? -10.625 -6.551  0.596   1.00 0.00 ? 133 ASP A CA   5  
ATOM 9139  C C    . ASP A 1 82  ? -9.580  -6.052  -0.410  1.00 0.00 ? 133 ASP A C    5  
ATOM 9140  O O    . ASP A 1 82  ? -9.791  -6.094  -1.611  1.00 0.00 ? 133 ASP A O    5  
ATOM 9141  C CB   . ASP A 1 82  ? -11.933 -6.836  -0.145  1.00 0.00 ? 133 ASP A CB   5  
ATOM 9142  C CG   . ASP A 1 82  ? -12.977 -7.338  0.853   1.00 0.00 ? 133 ASP A CG   5  
ATOM 9143  O OD1  . ASP A 1 82  ? -12.607 -7.610  1.988   1.00 0.00 ? 133 ASP A OD1  5  
ATOM 9144  O OD2  . ASP A 1 82  ? -14.132 -7.444  0.463   1.00 0.00 ? 133 ASP A OD2  5  
ATOM 9145  H H    . ASP A 1 82  ? -11.685 -5.012  1.688   1.00 0.00 ? 133 ASP A H    5  
ATOM 9146  H HA   . ASP A 1 82  ? -10.276 -7.459  1.058   1.00 0.00 ? 133 ASP A HA   5  
ATOM 9147  H HB2  . ASP A 1 82  ? -12.288 -5.928  -0.619  1.00 0.00 ? 133 ASP A HB2  5  
ATOM 9148  H HB3  . ASP A 1 82  ? -11.759 -7.592  -0.897  1.00 0.00 ? 133 ASP A HB3  5  
ATOM 9149  N N    . LEU A 1 83  ? -8.463  -5.557  0.060   1.00 0.00 ? 134 LEU A N    5  
ATOM 9150  C CA   . LEU A 1 83  ? -7.433  -5.037  -0.885  1.00 0.00 ? 134 LEU A CA   5  
ATOM 9151  C C    . LEU A 1 83  ? -6.652  -6.185  -1.492  1.00 0.00 ? 134 LEU A C    5  
ATOM 9152  O O    . LEU A 1 83  ? -5.992  -6.935  -0.801  1.00 0.00 ? 134 LEU A O    5  
ATOM 9153  C CB   . LEU A 1 83  ? -6.455  -4.110  -0.151  1.00 0.00 ? 134 LEU A CB   5  
ATOM 9154  C CG   . LEU A 1 83  ? -5.445  -3.490  -1.137  1.00 0.00 ? 134 LEU A CG   5  
ATOM 9155  C CD1  . LEU A 1 83  ? -6.127  -2.402  -1.985  1.00 0.00 ? 134 LEU A CD1  5  
ATOM 9156  C CD2  . LEU A 1 83  ? -4.275  -2.905  -0.344  1.00 0.00 ? 134 LEU A CD2  5  
ATOM 9157  H H    . LEU A 1 83  ? -8.312  -5.519  1.025   1.00 0.00 ? 134 LEU A H    5  
ATOM 9158  H HA   . LEU A 1 83  ? -7.919  -4.494  -1.661  1.00 0.00 ? 134 LEU A HA   5  
ATOM 9159  H HB2  . LEU A 1 83  ? -7.004  -3.321  0.331   1.00 0.00 ? 134 LEU A HB2  5  
ATOM 9160  H HB3  . LEU A 1 83  ? -5.924  -4.681  0.591   1.00 0.00 ? 134 LEU A HB3  5  
ATOM 9161  H HG   . LEU A 1 83  ? -5.066  -4.250  -1.796  1.00 0.00 ? 134 LEU A HG   5  
ATOM 9162  H HD11 . LEU A 1 83  ? -6.768  -1.789  -1.370  1.00 0.00 ? 134 LEU A HD11 5  
ATOM 9163  H HD12 . LEU A 1 83  ? -5.383  -1.779  -2.457  1.00 0.00 ? 134 LEU A HD12 5  
ATOM 9164  H HD13 . LEU A 1 83  ? -6.721  -2.878  -2.741  1.00 0.00 ? 134 LEU A HD13 5  
ATOM 9165  H HD21 . LEU A 1 83  ? -4.641  -2.410  0.538   1.00 0.00 ? 134 LEU A HD21 5  
ATOM 9166  H HD22 . LEU A 1 83  ? -3.610  -3.711  -0.056  1.00 0.00 ? 134 LEU A HD22 5  
ATOM 9167  H HD23 . LEU A 1 83  ? -3.735  -2.199  -0.960  1.00 0.00 ? 134 LEU A HD23 5  
ATOM 9168  N N    . ARG A 1 84  ? -6.697  -6.297  -2.790  1.00 0.00 ? 135 ARG A N    5  
ATOM 9169  C CA   . ARG A 1 84  ? -5.923  -7.380  -3.490  1.00 0.00 ? 135 ARG A CA   5  
ATOM 9170  C C    . ARG A 1 84  ? -4.673  -6.775  -4.113  1.00 0.00 ? 135 ARG A C    5  
ATOM 9171  O O    . ARG A 1 84  ? -4.682  -5.631  -4.517  1.00 0.00 ? 135 ARG A O    5  
ATOM 9172  C CB   . ARG A 1 84  ? -6.765  -7.988  -4.610  1.00 0.00 ? 135 ARG A CB   5  
ATOM 9173  C CG   . ARG A 1 84  ? -7.996  -8.734  -4.055  1.00 0.00 ? 135 ARG A CG   5  
ATOM 9174  C CD   . ARG A 1 84  ? -7.588  -10.069 -3.403  1.00 0.00 ? 135 ARG A CD   5  
ATOM 9175  N NE   . ARG A 1 84  ? -8.807  -10.928 -3.215  1.00 0.00 ? 135 ARG A NE   5  
ATOM 9176  C CZ   . ARG A 1 84  ? -9.833  -10.524 -2.516  1.00 0.00 ? 135 ARG A CZ   5  
ATOM 9177  N NH1  . ARG A 1 84  ? -9.777  -9.420  -1.836  1.00 0.00 ? 135 ARG A NH1  5  
ATOM 9178  N NH2  . ARG A 1 84  ? -10.903 -11.258 -2.442  1.00 0.00 ? 135 ARG A NH2  5  
ATOM 9179  H H    . ARG A 1 84  ? -7.225  -5.642  -3.317  1.00 0.00 ? 135 ARG A H    5  
ATOM 9180  H HA   . ARG A 1 84  ? -5.634  -8.144  -2.790  1.00 0.00 ? 135 ARG A HA   5  
ATOM 9181  H HB2  . ARG A 1 84  ? -7.098  -7.189  -5.252  1.00 0.00 ? 135 ARG A HB2  5  
ATOM 9182  H HB3  . ARG A 1 84  ? -6.157  -8.670  -5.183  1.00 0.00 ? 135 ARG A HB3  5  
ATOM 9183  H HG2  . ARG A 1 84  ? -8.480  -8.113  -3.322  1.00 0.00 ? 135 ARG A HG2  5  
ATOM 9184  H HG3  . ARG A 1 84  ? -8.684  -8.925  -4.862  1.00 0.00 ? 135 ARG A HG3  5  
ATOM 9185  H HD2  . ARG A 1 84  ? -6.915  -10.600 -4.051  1.00 0.00 ? 135 ARG A HD2  5  
ATOM 9186  H HD3  . ARG A 1 84  ? -7.090  -9.874  -2.460  1.00 0.00 ? 135 ARG A HD3  5  
ATOM 9187  H HE   . ARG A 1 84  ? -8.844  -11.802 -3.656  1.00 0.00 ? 135 ARG A HE   5  
ATOM 9188  H HH11 . ARG A 1 84  ? -8.940  -8.878  -1.834  1.00 0.00 ? 135 ARG A HH11 5  
ATOM 9189  H HH12 . ARG A 1 84  ? -10.577 -9.112  -1.317  1.00 0.00 ? 135 ARG A HH12 5  
ATOM 9190  H HH21 . ARG A 1 84  ? -10.945 -12.133 -2.921  1.00 0.00 ? 135 ARG A HH21 5  
ATOM 9191  H HH22 . ARG A 1 84  ? -11.684 -10.945 -1.898  1.00 0.00 ? 135 ARG A HH22 5  
ATOM 9192  N N    . PHE A 1 85  ? -3.594  -7.531  -4.190  1.00 0.00 ? 136 PHE A N    5  
ATOM 9193  C CA   . PHE A 1 85  ? -2.333  -7.002  -4.791  1.00 0.00 ? 136 PHE A CA   5  
ATOM 9194  C C    . PHE A 1 85  ? -1.959  -7.837  -6.029  1.00 0.00 ? 136 PHE A C    5  
ATOM 9195  O O    . PHE A 1 85  ? -1.426  -8.925  -5.909  1.00 0.00 ? 136 PHE A O    5  
ATOM 9196  C CB   . PHE A 1 85  ? -1.211  -7.106  -3.727  1.00 0.00 ? 136 PHE A CB   5  
ATOM 9197  C CG   . PHE A 1 85  ? -0.762  -5.740  -3.273  1.00 0.00 ? 136 PHE A CG   5  
ATOM 9198  C CD1  . PHE A 1 85  ? 0.244   -5.065  -3.973  1.00 0.00 ? 136 PHE A CD1  5  
ATOM 9199  C CD2  . PHE A 1 85  ? -1.350  -5.159  -2.147  1.00 0.00 ? 136 PHE A CD2  5  
ATOM 9200  C CE1  . PHE A 1 85  ? 0.662   -3.803  -3.542  1.00 0.00 ? 136 PHE A CE1  5  
ATOM 9201  C CE2  . PHE A 1 85  ? -0.929  -3.898  -1.716  1.00 0.00 ? 136 PHE A CE2  5  
ATOM 9202  C CZ   . PHE A 1 85  ? 0.078   -3.222  -2.413  1.00 0.00 ? 136 PHE A CZ   5  
ATOM 9203  H H    . PHE A 1 85  ? -3.612  -8.451  -3.848  1.00 0.00 ? 136 PHE A H    5  
ATOM 9204  H HA   . PHE A 1 85  ? -2.474  -5.973  -5.089  1.00 0.00 ? 136 PHE A HA   5  
ATOM 9205  H HB2  . PHE A 1 85  ? -1.584  -7.645  -2.869  1.00 0.00 ? 136 PHE A HB2  5  
ATOM 9206  H HB3  . PHE A 1 85  ? -0.362  -7.638  -4.132  1.00 0.00 ? 136 PHE A HB3  5  
ATOM 9207  H HD1  . PHE A 1 85  ? 0.694   -5.515  -4.847  1.00 0.00 ? 136 PHE A HD1  5  
ATOM 9208  H HD2  . PHE A 1 85  ? -2.124  -5.687  -1.608  1.00 0.00 ? 136 PHE A HD2  5  
ATOM 9209  H HE1  . PHE A 1 85  ? 1.437   -3.281  -4.080  1.00 0.00 ? 136 PHE A HE1  5  
ATOM 9210  H HE2  . PHE A 1 85  ? -1.388  -3.442  -0.853  1.00 0.00 ? 136 PHE A HE2  5  
ATOM 9211  H HZ   . PHE A 1 85  ? 0.407   -2.252  -2.077  1.00 0.00 ? 136 PHE A HZ   5  
ATOM 9212  N N    . VAL A 1 86  ? -2.213  -7.329  -7.219  1.00 0.00 ? 137 VAL A N    5  
ATOM 9213  C CA   . VAL A 1 86  ? -1.839  -8.101  -8.454  1.00 0.00 ? 137 VAL A CA   5  
ATOM 9214  C C    . VAL A 1 86  ? -1.200  -7.165  -9.487  1.00 0.00 ? 137 VAL A C    5  
ATOM 9215  O O    . VAL A 1 86  ? -1.795  -6.778  -10.470 1.00 0.00 ? 137 VAL A O    5  
ATOM 9216  C CB   . VAL A 1 86  ? -3.077  -8.808  -9.035  1.00 0.00 ? 137 VAL A CB   5  
ATOM 9217  C CG1  . VAL A 1 86  ? -4.258  -7.836  -9.104  1.00 0.00 ? 137 VAL A CG1  5  
ATOM 9218  C CG2  . VAL A 1 86  ? -2.769  -9.367  -10.442 1.00 0.00 ? 137 VAL A CG2  5  
ATOM 9219  H H    . VAL A 1 86  ? -2.634  -6.436  -7.296  1.00 0.00 ? 137 VAL A H    5  
ATOM 9220  H HA   . VAL A 1 86  ? -1.103  -8.854  -8.198  1.00 0.00 ? 137 VAL A HA   5  
ATOM 9221  H HB   . VAL A 1 86  ? -3.338  -9.625  -8.380  1.00 0.00 ? 137 VAL A HB   5  
ATOM 9222  H HG11 . VAL A 1 86  ? -4.441  -7.437  -8.119  1.00 0.00 ? 137 VAL A HG11 5  
ATOM 9223  H HG12 . VAL A 1 86  ? -4.021  -7.036  -9.779  1.00 0.00 ? 137 VAL A HG12 5  
ATOM 9224  H HG13 . VAL A 1 86  ? -5.138  -8.358  -9.452  1.00 0.00 ? 137 VAL A HG13 5  
ATOM 9225  H HG21 . VAL A 1 86  ? -1.722  -9.630  -10.515 1.00 0.00 ? 137 VAL A HG21 5  
ATOM 9226  H HG22 . VAL A 1 86  ? -3.369  -10.251 -10.611 1.00 0.00 ? 137 VAL A HG22 5  
ATOM 9227  H HG23 . VAL A 1 86  ? -3.007  -8.632  -11.194 1.00 0.00 ? 137 VAL A HG23 5  
ATOM 9228  N N    . GLY A 1 87  ? 0.035   -6.827  -9.246  1.00 0.00 ? 138 GLY A N    5  
ATOM 9229  C CA   . GLY A 1 87  ? 0.818   -5.952  -10.172 1.00 0.00 ? 138 GLY A CA   5  
ATOM 9230  C C    . GLY A 1 87  ? 1.830   -6.821  -10.932 1.00 0.00 ? 138 GLY A C    5  
ATOM 9231  O O    . GLY A 1 87  ? 1.528   -7.914  -11.353 1.00 0.00 ? 138 GLY A O    5  
ATOM 9232  H H    . GLY A 1 87  ? 0.465   -7.176  -8.445  1.00 0.00 ? 138 GLY A H    5  
ATOM 9233  H HA2  . GLY A 1 87  ? 0.157   -5.468  -10.877 1.00 0.00 ? 138 GLY A HA2  5  
ATOM 9234  H HA3  . GLY A 1 87  ? 1.339   -5.210  -9.597  1.00 0.00 ? 138 GLY A HA3  5  
ATOM 9235  N N    . ARG A 1 88  ? 3.043   -6.347  -11.082 1.00 0.00 ? 139 ARG A N    5  
ATOM 9236  C CA   . ARG A 1 88  ? 4.101   -7.141  -11.781 1.00 0.00 ? 139 ARG A CA   5  
ATOM 9237  C C    . ARG A 1 88  ? 5.068   -7.698  -10.735 1.00 0.00 ? 139 ARG A C    5  
ATOM 9238  O O    . ARG A 1 88  ? 5.282   -7.094  -9.701  1.00 0.00 ? 139 ARG A O    5  
ATOM 9239  C CB   . ARG A 1 88  ? 4.854   -6.216  -12.736 1.00 0.00 ? 139 ARG A CB   5  
ATOM 9240  C CG   . ARG A 1 88  ? 3.871   -5.628  -13.780 1.00 0.00 ? 139 ARG A CG   5  
ATOM 9241  C CD   . ARG A 1 88  ? 4.142   -6.239  -15.143 1.00 0.00 ? 139 ARG A CD   5  
ATOM 9242  N NE   . ARG A 1 88  ? 4.020   -7.725  -15.045 1.00 0.00 ? 139 ARG A NE   5  
ATOM 9243  C CZ   . ARG A 1 88  ? 3.919   -8.423  -16.132 1.00 0.00 ? 139 ARG A CZ   5  
ATOM 9244  N NH1  . ARG A 1 88  ? 3.928   -7.815  -17.288 1.00 0.00 ? 139 ARG A NH1  5  
ATOM 9245  N NH2  . ARG A 1 88  ? 3.791   -9.722  -16.072 1.00 0.00 ? 139 ARG A NH2  5  
ATOM 9246  H H    . ARG A 1 88  ? 3.269   -5.469  -10.718 1.00 0.00 ? 139 ARG A H    5  
ATOM 9247  H HA   . ARG A 1 88  ? 3.659   -7.951  -12.339 1.00 0.00 ? 139 ARG A HA   5  
ATOM 9248  H HB2  . ARG A 1 88  ? 5.282   -5.411  -12.155 1.00 0.00 ? 139 ARG A HB2  5  
ATOM 9249  H HB3  . ARG A 1 88  ? 5.651   -6.766  -13.236 1.00 0.00 ? 139 ARG A HB3  5  
ATOM 9250  H HG2  . ARG A 1 88  ? 2.848   -5.843  -13.495 1.00 0.00 ? 139 ARG A HG2  5  
ATOM 9251  H HG3  . ARG A 1 88  ? 3.999   -4.558  -13.838 1.00 0.00 ? 139 ARG A HG3  5  
ATOM 9252  H HD2  . ARG A 1 88  ? 3.430   -5.864  -15.860 1.00 0.00 ? 139 ARG A HD2  5  
ATOM 9253  H HD3  . ARG A 1 88  ? 5.144   -5.983  -15.458 1.00 0.00 ? 139 ARG A HD3  5  
ATOM 9254  H HE   . ARG A 1 88  ? 4.006   -8.170  -14.168 1.00 0.00 ? 139 ARG A HE   5  
ATOM 9255  H HH11 . ARG A 1 88  ? 4.011   -6.814  -17.331 1.00 0.00 ? 139 ARG A HH11 5  
ATOM 9256  H HH12 . ARG A 1 88  ? 3.843   -8.345  -18.134 1.00 0.00 ? 139 ARG A HH12 5  
ATOM 9257  H HH21 . ARG A 1 88  ? 3.758   -10.180 -15.183 1.00 0.00 ? 139 ARG A HH21 5  
ATOM 9258  H HH22 . ARG A 1 88  ? 3.744   -10.257 -16.907 1.00 0.00 ? 139 ARG A HH22 5  
ATOM 9259  N N    . SER A 1 89  ? 5.640   -8.851  -10.988 1.00 0.00 ? 140 SER A N    5  
ATOM 9260  C CA   . SER A 1 89  ? 6.584   -9.472  -10.008 1.00 0.00 ? 140 SER A CA   5  
ATOM 9261  C C    . SER A 1 89  ? 8.021   -9.310  -10.488 1.00 0.00 ? 140 SER A C    5  
ATOM 9262  O O    . SER A 1 89  ? 8.915   -10.005 -10.051 1.00 0.00 ? 140 SER A O    5  
ATOM 9263  C CB   . SER A 1 89  ? 6.257   -10.953 -9.878  1.00 0.00 ? 140 SER A CB   5  
ATOM 9264  O OG   . SER A 1 89  ? 5.010   -11.095 -9.214  1.00 0.00 ? 140 SER A OG   5  
ATOM 9265  H H    . SER A 1 89  ? 5.441   -9.321  -11.823 1.00 0.00 ? 140 SER A H    5  
ATOM 9266  H HA   . SER A 1 89  ? 6.484   -9.000  -9.044  1.00 0.00 ? 140 SER A HA   5  
ATOM 9267  H HB2  . SER A 1 89  ? 6.193   -11.402 -10.859 1.00 0.00 ? 140 SER A HB2  5  
ATOM 9268  H HB3  . SER A 1 89  ? 7.039   -11.438 -9.306  1.00 0.00 ? 140 SER A HB3  5  
ATOM 9269  H HG   . SER A 1 89  ? 4.738   -12.011 -9.290  1.00 0.00 ? 140 SER A HG   5  
ATOM 9270  N N    . GLY A 1 90  ? 8.267   -8.403  -11.380 1.00 0.00 ? 141 GLY A N    5  
ATOM 9271  C CA   . GLY A 1 90  ? 9.664   -8.223  -11.857 1.00 0.00 ? 141 GLY A CA   5  
ATOM 9272  C C    . GLY A 1 90  ? 10.460  -7.442  -10.809 1.00 0.00 ? 141 GLY A C    5  
ATOM 9273  O O    . GLY A 1 90  ? 10.404  -6.236  -10.752 1.00 0.00 ? 141 GLY A O    5  
ATOM 9274  H H    . GLY A 1 90  ? 7.544   -7.842  -11.733 1.00 0.00 ? 141 GLY A H    5  
ATOM 9275  H HA2  . GLY A 1 90  ? 10.114  -9.193  -12.010 1.00 0.00 ? 141 GLY A HA2  5  
ATOM 9276  H HA3  . GLY A 1 90  ? 9.662   -7.680  -12.780 1.00 0.00 ? 141 GLY A HA3  5  
ATOM 9277  N N    . ARG A 1 91  ? 11.207  -8.124  -9.984  1.00 0.00 ? 142 ARG A N    5  
ATOM 9278  C CA   . ARG A 1 91  ? 12.012  -7.431  -8.938  1.00 0.00 ? 142 ARG A CA   5  
ATOM 9279  C C    . ARG A 1 91  ? 13.009  -6.462  -9.600  1.00 0.00 ? 142 ARG A C    5  
ATOM 9280  O O    . ARG A 1 91  ? 13.220  -5.365  -9.124  1.00 0.00 ? 142 ARG A O    5  
ATOM 9281  C CB   . ARG A 1 91  ? 12.758  -8.497  -8.124  1.00 0.00 ? 142 ARG A CB   5  
ATOM 9282  C CG   . ARG A 1 91  ? 13.470  -7.841  -6.937  1.00 0.00 ? 142 ARG A CG   5  
ATOM 9283  C CD   . ARG A 1 91  ? 14.207  -8.912  -6.135  1.00 0.00 ? 142 ARG A CD   5  
ATOM 9284  N NE   . ARG A 1 91  ? 14.985  -8.275  -5.019  1.00 0.00 ? 142 ARG A NE   5  
ATOM 9285  C CZ   . ARG A 1 91  ? 15.936  -7.414  -5.260  1.00 0.00 ? 142 ARG A CZ   5  
ATOM 9286  N NH1  . ARG A 1 91  ? 16.394  -7.260  -6.484  1.00 0.00 ? 142 ARG A NH1  5  
ATOM 9287  N NH2  . ARG A 1 91  ? 16.465  -6.730  -4.274  1.00 0.00 ? 142 ARG A NH2  5  
ATOM 9288  H H    . ARG A 1 91  ? 11.231  -9.095  -10.046 1.00 0.00 ? 142 ARG A H    5  
ATOM 9289  H HA   . ARG A 1 91  ? 11.363  -6.875  -8.286  1.00 0.00 ? 142 ARG A HA   5  
ATOM 9290  H HB2  . ARG A 1 91  ? 12.041  -9.223  -7.753  1.00 0.00 ? 142 ARG A HB2  5  
ATOM 9291  H HB3  . ARG A 1 91  ? 13.485  -8.993  -8.748  1.00 0.00 ? 142 ARG A HB3  5  
ATOM 9292  H HG2  . ARG A 1 91  ? 14.176  -7.105  -7.296  1.00 0.00 ? 142 ARG A HG2  5  
ATOM 9293  H HG3  . ARG A 1 91  ? 12.739  -7.359  -6.305  1.00 0.00 ? 142 ARG A HG3  5  
ATOM 9294  H HD2  . ARG A 1 91  ? 13.497  -9.570  -5.682  1.00 0.00 ? 142 ARG A HD2  5  
ATOM 9295  H HD3  . ARG A 1 91  ? 14.841  -9.485  -6.810  1.00 0.00 ? 142 ARG A HD3  5  
ATOM 9296  H HE   . ARG A 1 91  ? 14.724  -8.457  -4.092  1.00 0.00 ? 142 ARG A HE   5  
ATOM 9297  H HH11 . ARG A 1 91  ? 16.004  -7.803  -7.235  1.00 0.00 ? 142 ARG A HH11 5  
ATOM 9298  H HH12 . ARG A 1 91  ? 17.141  -6.617  -6.667  1.00 0.00 ? 142 ARG A HH12 5  
ATOM 9299  H HH21 . ARG A 1 91  ? 16.141  -6.856  -3.331  1.00 0.00 ? 142 ARG A HH21 5  
ATOM 9300  H HH22 . ARG A 1 91  ? 17.189  -6.070  -4.464  1.00 0.00 ? 142 ARG A HH22 5  
ATOM 9301  N N    . GLY A 1 92  ? 13.610  -6.849  -10.701 1.00 0.00 ? 143 GLY A N    5  
ATOM 9302  C CA   . GLY A 1 92  ? 14.584  -5.949  -11.390 1.00 0.00 ? 143 GLY A CA   5  
ATOM 9303  C C    . GLY A 1 92  ? 13.865  -4.752  -11.993 1.00 0.00 ? 143 GLY A C    5  
ATOM 9304  O O    . GLY A 1 92  ? 14.483  -3.788  -12.396 1.00 0.00 ? 143 GLY A O    5  
ATOM 9305  H H    . GLY A 1 92  ? 13.415  -7.731  -11.080 1.00 0.00 ? 143 GLY A H    5  
ATOM 9306  H HA2  . GLY A 1 92  ? 15.318  -5.602  -10.677 1.00 0.00 ? 143 GLY A HA2  5  
ATOM 9307  H HA3  . GLY A 1 92  ? 15.080  -6.495  -12.169 1.00 0.00 ? 143 GLY A HA3  5  
ATOM 9308  N N    . LYS A 1 93  ? 12.569  -4.806  -12.066 1.00 0.00 ? 144 LYS A N    5  
ATOM 9309  C CA   . LYS A 1 93  ? 11.798  -3.672  -12.645 1.00 0.00 ? 144 LYS A CA   5  
ATOM 9310  C C    . LYS A 1 93  ? 11.532  -2.676  -11.531 1.00 0.00 ? 144 LYS A C    5  
ATOM 9311  O O    . LYS A 1 93  ? 11.365  -3.047  -10.385 1.00 0.00 ? 144 LYS A O    5  
ATOM 9312  C CB   . LYS A 1 93  ? 10.462  -4.203  -13.186 1.00 0.00 ? 144 LYS A CB   5  
ATOM 9313  C CG   . LYS A 1 93  ? 10.722  -5.268  -14.247 1.00 0.00 ? 144 LYS A CG   5  
ATOM 9314  C CD   . LYS A 1 93  ? 9.406   -5.690  -14.893 1.00 0.00 ? 144 LYS A CD   5  
ATOM 9315  C CE   . LYS A 1 93  ? 9.684   -6.814  -15.890 1.00 0.00 ? 144 LYS A CE   5  
ATOM 9316  N NZ   . LYS A 1 93  ? 10.033  -8.059  -15.158 1.00 0.00 ? 144 LYS A NZ   5  
ATOM 9317  H H    . LYS A 1 93  ? 12.096  -5.588  -11.726 1.00 0.00 ? 144 LYS A H    5  
ATOM 9318  H HA   . LYS A 1 93  ? 12.361  -3.194  -13.440 1.00 0.00 ? 144 LYS A HA   5  
ATOM 9319  H HB2  . LYS A 1 93  ? 9.887   -4.632  -12.379 1.00 0.00 ? 144 LYS A HB2  5  
ATOM 9320  H HB3  . LYS A 1 93  ? 9.909   -3.394  -13.629 1.00 0.00 ? 144 LYS A HB3  5  
ATOM 9321  H HG2  . LYS A 1 93  ? 11.378  -4.869  -15.000 1.00 0.00 ? 144 LYS A HG2  5  
ATOM 9322  H HG3  . LYS A 1 93  ? 11.180  -6.128  -13.788 1.00 0.00 ? 144 LYS A HG3  5  
ATOM 9323  H HD2  . LYS A 1 93  ? 8.727   -6.039  -14.125 1.00 0.00 ? 144 LYS A HD2  5  
ATOM 9324  H HD3  . LYS A 1 93  ? 8.965   -4.850  -15.412 1.00 0.00 ? 144 LYS A HD3  5  
ATOM 9325  H HE2  . LYS A 1 93  ? 8.806   -6.987  -16.483 1.00 0.00 ? 144 LYS A HE2  5  
ATOM 9326  H HE3  . LYS A 1 93  ? 10.503  -6.538  -16.531 1.00 0.00 ? 144 LYS A HE3  5  
ATOM 9327  H HZ1  . LYS A 1 93  ? 10.833  -7.868  -14.529 1.00 0.00 ? 144 LYS A HZ1  5  
ATOM 9328  H HZ2  . LYS A 1 93  ? 9.219   -8.379  -14.595 1.00 0.00 ? 144 LYS A HZ2  5  
ATOM 9329  H HZ3  . LYS A 1 93  ? 10.297  -8.795  -15.843 1.00 0.00 ? 144 LYS A HZ3  5  
ATOM 9330  N N    . SER A 1 94  ? 11.494  -1.417  -11.833 1.00 0.00 ? 145 SER A N    5  
ATOM 9331  C CA   . SER A 1 94  ? 11.243  -0.425  -10.763 1.00 0.00 ? 145 SER A CA   5  
ATOM 9332  C C    . SER A 1 94  ? 9.750   -0.394  -10.477 1.00 0.00 ? 145 SER A C    5  
ATOM 9333  O O    . SER A 1 94  ? 8.937   -0.147  -11.340 1.00 0.00 ? 145 SER A O    5  
ATOM 9334  C CB   . SER A 1 94  ? 11.720  0.952   -11.238 1.00 0.00 ? 145 SER A CB   5  
ATOM 9335  O OG   . SER A 1 94  ? 11.200  1.963   -10.391 1.00 0.00 ? 145 SER A OG   5  
ATOM 9336  H H    . SER A 1 94  ? 11.636  -1.121  -12.754 1.00 0.00 ? 145 SER A H    5  
ATOM 9337  H HA   . SER A 1 94  ? 11.778  -0.717  -9.870  1.00 0.00 ? 145 SER A HA   5  
ATOM 9338  H HB2  . SER A 1 94  ? 12.797  0.993   -11.210 1.00 0.00 ? 145 SER A HB2  5  
ATOM 9339  H HB3  . SER A 1 94  ? 11.381  1.111   -12.253 1.00 0.00 ? 145 SER A HB3  5  
ATOM 9340  H HG   . SER A 1 94  ? 11.218  1.634   -9.495  1.00 0.00 ? 145 SER A HG   5  
ATOM 9341  N N    . PHE A 1 95  ? 9.394   -0.665  -9.260  1.00 0.00 ? 146 PHE A N    5  
ATOM 9342  C CA   . PHE A 1 95  ? 7.968   -0.683  -8.875  1.00 0.00 ? 146 PHE A CA   5  
ATOM 9343  C C    . PHE A 1 95  ? 7.507   0.751   -8.585  1.00 0.00 ? 146 PHE A C    5  
ATOM 9344  O O    . PHE A 1 95  ? 8.174   1.489   -7.876  1.00 0.00 ? 146 PHE A O    5  
ATOM 9345  C CB   . PHE A 1 95  ? 7.860   -1.541  -7.616  1.00 0.00 ? 146 PHE A CB   5  
ATOM 9346  C CG   . PHE A 1 95  ? 6.470   -2.119  -7.448  1.00 0.00 ? 146 PHE A CG   5  
ATOM 9347  C CD1  . PHE A 1 95  ? 5.934   -2.957  -8.432  1.00 0.00 ? 146 PHE A CD1  5  
ATOM 9348  C CD2  . PHE A 1 95  ? 5.731   -1.840  -6.287  1.00 0.00 ? 146 PHE A CD2  5  
ATOM 9349  C CE1  . PHE A 1 95  ? 4.670   -3.519  -8.252  1.00 0.00 ? 146 PHE A CE1  5  
ATOM 9350  C CE2  . PHE A 1 95  ? 4.468   -2.395  -6.105  1.00 0.00 ? 146 PHE A CE2  5  
ATOM 9351  C CZ   . PHE A 1 95  ? 3.930   -3.239  -7.081  1.00 0.00 ? 146 PHE A CZ   5  
ATOM 9352  H H    . PHE A 1 95  ? 10.077  -0.877  -8.587  1.00 0.00 ? 146 PHE A H    5  
ATOM 9353  H HA   . PHE A 1 95  ? 7.379   -1.108  -9.669  1.00 0.00 ? 146 PHE A HA   5  
ATOM 9354  H HB2  . PHE A 1 95  ? 8.567   -2.347  -7.697  1.00 0.00 ? 146 PHE A HB2  5  
ATOM 9355  H HB3  . PHE A 1 95  ? 8.105   -0.941  -6.755  1.00 0.00 ? 146 PHE A HB3  5  
ATOM 9356  H HD1  . PHE A 1 95  ? 6.501   -3.180  -9.327  1.00 0.00 ? 146 PHE A HD1  5  
ATOM 9357  H HD2  . PHE A 1 95  ? 6.137   -1.183  -5.535  1.00 0.00 ? 146 PHE A HD2  5  
ATOM 9358  H HE1  . PHE A 1 95  ? 4.257   -4.156  -9.025  1.00 0.00 ? 146 PHE A HE1  5  
ATOM 9359  H HE2  . PHE A 1 95  ? 3.913   -2.176  -5.201  1.00 0.00 ? 146 PHE A HE2  5  
ATOM 9360  H HZ   . PHE A 1 95  ? 2.950   -3.678  -6.935  1.00 0.00 ? 146 PHE A HZ   5  
ATOM 9361  N N    . THR A 1 96  ? 6.376   1.156   -9.138  1.00 0.00 ? 147 THR A N    5  
ATOM 9362  C CA   . THR A 1 96  ? 5.871   2.542   -8.904  1.00 0.00 ? 147 THR A CA   5  
ATOM 9363  C C    . THR A 1 96  ? 4.493   2.506   -8.235  1.00 0.00 ? 147 THR A C    5  
ATOM 9364  O O    . THR A 1 96  ? 3.560   1.851   -8.691  1.00 0.00 ? 147 THR A O    5  
ATOM 9365  C CB   . THR A 1 96  ? 5.759   3.264   -10.248 1.00 0.00 ? 147 THR A CB   5  
ATOM 9366  O OG1  . THR A 1 96  ? 7.006   3.195   -10.920 1.00 0.00 ? 147 THR A OG1  5  
ATOM 9367  C CG2  . THR A 1 96  ? 5.372   4.727   -10.029 1.00 0.00 ? 147 THR A CG2  5  
ATOM 9368  H H    . THR A 1 96  ? 5.861   0.545   -9.706  1.00 0.00 ? 147 THR A H    5  
ATOM 9369  H HA   . THR A 1 96  ? 6.561   3.085   -8.266  1.00 0.00 ? 147 THR A HA   5  
ATOM 9370  H HB   . THR A 1 96  ? 5.004   2.786   -10.846 1.00 0.00 ? 147 THR A HB   5  
ATOM 9371  H HG1  . THR A 1 96  ? 7.485   4.005   -10.733 1.00 0.00 ? 147 THR A HG1  5  
ATOM 9372  H HG21 . THR A 1 96  ? 5.891   5.117   -9.170  1.00 0.00 ? 147 THR A HG21 5  
ATOM 9373  H HG22 . THR A 1 96  ? 5.638   5.305   -10.905 1.00 0.00 ? 147 THR A HG22 5  
ATOM 9374  H HG23 . THR A 1 96  ? 4.302   4.792   -9.869  1.00 0.00 ? 147 THR A HG23 5  
ATOM 9375  N N    . LEU A 1 97  ? 4.382   3.249   -7.167  1.00 0.00 ? 148 LEU A N    5  
ATOM 9376  C CA   . LEU A 1 97  ? 3.115   3.365   -6.385  1.00 0.00 ? 148 LEU A CA   5  
ATOM 9377  C C    . LEU A 1 97  ? 2.690   4.840   -6.416  1.00 0.00 ? 148 LEU A C    5  
ATOM 9378  O O    . LEU A 1 97  ? 3.489   5.731   -6.179  1.00 0.00 ? 148 LEU A O    5  
ATOM 9379  C CB   . LEU A 1 97  ? 3.401   2.914   -4.924  1.00 0.00 ? 148 LEU A CB   5  
ATOM 9380  C CG   . LEU A 1 97  ? 2.944   1.454   -4.677  1.00 0.00 ? 148 LEU A CG   5  
ATOM 9381  C CD1  . LEU A 1 97  ? 3.798   0.810   -3.559  1.00 0.00 ? 148 LEU A CD1  5  
ATOM 9382  C CD2  . LEU A 1 97  ? 1.460   1.430   -4.245  1.00 0.00 ? 148 LEU A CD2  5  
ATOM 9383  H H    . LEU A 1 97  ? 5.164   3.754   -6.871  1.00 0.00 ? 148 LEU A H    5  
ATOM 9384  H HA   . LEU A 1 97  ? 2.341   2.759   -6.828  1.00 0.00 ? 148 LEU A HA   5  
ATOM 9385  H HB2  . LEU A 1 97  ? 4.461   2.978   -4.760  1.00 0.00 ? 148 LEU A HB2  5  
ATOM 9386  H HB3  . LEU A 1 97  ? 2.899   3.570   -4.229  1.00 0.00 ? 148 LEU A HB3  5  
ATOM 9387  H HG   . LEU A 1 97  ? 3.070   0.886   -5.584  1.00 0.00 ? 148 LEU A HG   5  
ATOM 9388  H HD11 . LEU A 1 97  ? 4.052   1.554   -2.818  1.00 0.00 ? 148 LEU A HD11 5  
ATOM 9389  H HD12 . LEU A 1 97  ? 3.239   0.007   -3.085  1.00 0.00 ? 148 LEU A HD12 5  
ATOM 9390  H HD13 . LEU A 1 97  ? 4.698   0.408   -3.988  1.00 0.00 ? 148 LEU A HD13 5  
ATOM 9391  H HD21 . LEU A 1 97  ? 0.920   2.233   -4.726  1.00 0.00 ? 148 LEU A HD21 5  
ATOM 9392  H HD22 . LEU A 1 97  ? 1.018   0.482   -4.517  1.00 0.00 ? 148 LEU A HD22 5  
ATOM 9393  H HD23 . LEU A 1 97  ? 1.392   1.557   -3.169  1.00 0.00 ? 148 LEU A HD23 5  
ATOM 9394  N N    . THR A 1 98  ? 1.439   5.113   -6.693  1.00 0.00 ? 149 THR A N    5  
ATOM 9395  C CA   . THR A 1 98  ? 0.978   6.536   -6.733  1.00 0.00 ? 149 THR A CA   5  
ATOM 9396  C C    . THR A 1 98  ? -0.406  6.644   -6.093  1.00 0.00 ? 149 THR A C    5  
ATOM 9397  O O    . THR A 1 98  ? -1.326  5.938   -6.445  1.00 0.00 ? 149 THR A O    5  
ATOM 9398  C CB   . THR A 1 98  ? 0.908   7.045   -8.184  1.00 0.00 ? 149 THR A CB   5  
ATOM 9399  O OG1  . THR A 1 98  ? 0.033   6.230   -8.954  1.00 0.00 ? 149 THR A OG1  5  
ATOM 9400  C CG2  . THR A 1 98  ? 2.304   7.034   -8.804  1.00 0.00 ? 149 THR A CG2  5  
ATOM 9401  H H    . THR A 1 98  ? 0.805   4.385   -6.871  1.00 0.00 ? 149 THR A H    5  
ATOM 9402  H HA   . THR A 1 98  ? 1.668   7.159   -6.180  1.00 0.00 ? 149 THR A HA   5  
ATOM 9403  H HB   . THR A 1 98  ? 0.542   8.056   -8.183  1.00 0.00 ? 149 THR A HB   5  
ATOM 9404  H HG1  . THR A 1 98  ? -0.080  6.648   -9.815  1.00 0.00 ? 149 THR A HG1  5  
ATOM 9405  H HG21 . THR A 1 98  ? 2.966   7.664   -8.225  1.00 0.00 ? 149 THR A HG21 5  
ATOM 9406  H HG22 . THR A 1 98  ? 2.683   6.026   -8.811  1.00 0.00 ? 149 THR A HG22 5  
ATOM 9407  H HG23 . THR A 1 98  ? 2.248   7.408   -9.816  1.00 0.00 ? 149 THR A HG23 5  
ATOM 9408  N N    . ILE A 1 99  ? -0.548  7.545   -5.162  1.00 0.00 ? 150 ILE A N    5  
ATOM 9409  C CA   . ILE A 1 99  ? -1.864  7.763   -4.479  1.00 0.00 ? 150 ILE A CA   5  
ATOM 9410  C C    . ILE A 1 99  ? -2.274  9.222   -4.669  1.00 0.00 ? 150 ILE A C    5  
ATOM 9411  O O    . ILE A 1 99  ? -1.474  10.137  -4.557  1.00 0.00 ? 150 ILE A O    5  
ATOM 9412  C CB   . ILE A 1 99  ? -1.753  7.437   -2.970  1.00 0.00 ? 150 ILE A CB   5  
ATOM 9413  C CG1  . ILE A 1 99  ? -3.049  7.834   -2.251  1.00 0.00 ? 150 ILE A CG1  5  
ATOM 9414  C CG2  . ILE A 1 99  ? -0.568  8.168   -2.350  1.00 0.00 ? 150 ILE A CG2  5  
ATOM 9415  C CD1  . ILE A 1 99  ? -2.985  7.367   -0.790  1.00 0.00 ? 150 ILE A CD1  5  
ATOM 9416  H H    . ILE A 1 99  ? 0.216   8.100   -4.923  1.00 0.00 ? 150 ILE A H    5  
ATOM 9417  H HA   . ILE A 1 99  ? -2.619  7.126   -4.925  1.00 0.00 ? 150 ILE A HA   5  
ATOM 9418  H HB   . ILE A 1 99  ? -1.609  6.384   -2.842  1.00 0.00 ? 150 ILE A HB   5  
ATOM 9419  H HG12 . ILE A 1 99  ? -3.172  8.909   -2.286  1.00 0.00 ? 150 ILE A HG12 5  
ATOM 9420  H HG13 . ILE A 1 99  ? -3.885  7.361   -2.739  1.00 0.00 ? 150 ILE A HG13 5  
ATOM 9421  H HG21 . ILE A 1 99  ? -0.516  9.160   -2.748  1.00 0.00 ? 150 ILE A HG21 5  
ATOM 9422  H HG22 . ILE A 1 99  ? -0.683  8.218   -1.280  1.00 0.00 ? 150 ILE A HG22 5  
ATOM 9423  H HG23 . ILE A 1 99  ? 0.341   7.632   -2.577  1.00 0.00 ? 150 ILE A HG23 5  
ATOM 9424  H HD11 . ILE A 1 99  ? -2.054  7.697   -0.352  1.00 0.00 ? 150 ILE A HD11 5  
ATOM 9425  H HD12 . ILE A 1 99  ? -3.800  7.787   -0.237  1.00 0.00 ? 150 ILE A HD12 5  
ATOM 9426  H HD13 . ILE A 1 99  ? -3.037  6.293   -0.753  1.00 0.00 ? 150 ILE A HD13 5  
ATOM 9427  N N    . THR A 1 100 ? -3.519  9.452   -4.954  1.00 0.00 ? 151 THR A N    5  
ATOM 9428  C CA   . THR A 1 100 ? -3.997  10.848  -5.145  1.00 0.00 ? 151 THR A CA   5  
ATOM 9429  C C    . THR A 1 100 ? -5.391  10.962  -4.571  1.00 0.00 ? 151 THR A C    5  
ATOM 9430  O O    . THR A 1 100 ? -6.199  10.067  -4.709  1.00 0.00 ? 151 THR A O    5  
ATOM 9431  C CB   . THR A 1 100 ? -4.043  11.195  -6.639  1.00 0.00 ? 151 THR A CB   5  
ATOM 9432  O OG1  . THR A 1 100 ? -5.005  10.376  -7.284  1.00 0.00 ? 151 THR A OG1  5  
ATOM 9433  C CG2  . THR A 1 100 ? -2.676  10.972  -7.292  1.00 0.00 ? 151 THR A CG2  5  
ATOM 9434  H H    . THR A 1 100 ? -4.149  8.705   -5.030  1.00 0.00 ? 151 THR A H    5  
ATOM 9435  H HA   . THR A 1 100 ? -3.348  11.539  -4.627  1.00 0.00 ? 151 THR A HA   5  
ATOM 9436  H HB   . THR A 1 100 ? -4.321  12.230  -6.748  1.00 0.00 ? 151 THR A HB   5  
ATOM 9437  H HG1  . THR A 1 100 ? -4.535  9.679   -7.749  1.00 0.00 ? 151 THR A HG1  5  
ATOM 9438  H HG21 . THR A 1 100 ? -1.900  11.286  -6.619  1.00 0.00 ? 151 THR A HG21 5  
ATOM 9439  H HG22 . THR A 1 100 ? -2.550  9.922   -7.530  1.00 0.00 ? 151 THR A HG22 5  
ATOM 9440  H HG23 . THR A 1 100 ? -2.619  11.550  -8.202  1.00 0.00 ? 151 THR A HG23 5  
ATOM 9441  N N    . VAL A 1 101 ? -5.682  12.058  -3.931  1.00 0.00 ? 152 VAL A N    5  
ATOM 9442  C CA   . VAL A 1 101 ? -7.038  12.247  -3.343  1.00 0.00 ? 152 VAL A CA   5  
ATOM 9443  C C    . VAL A 1 101 ? -7.608  13.576  -3.814  1.00 0.00 ? 152 VAL A C    5  
ATOM 9444  O O    . VAL A 1 101 ? -6.964  14.606  -3.726  1.00 0.00 ? 152 VAL A O    5  
ATOM 9445  C CB   . VAL A 1 101 ? -6.918  12.229  -1.821  1.00 0.00 ? 152 VAL A CB   5  
ATOM 9446  C CG1  . VAL A 1 101 ? -8.317  12.202  -1.189  1.00 0.00 ? 152 VAL A CG1  5  
ATOM 9447  C CG2  . VAL A 1 101 ? -6.112  10.975  -1.399  1.00 0.00 ? 152 VAL A CG2  5  
ATOM 9448  H H    . VAL A 1 101 ? -5.001  12.760  -3.833  1.00 0.00 ? 152 VAL A H    5  
ATOM 9449  H HA   . VAL A 1 101 ? -7.695  11.449  -3.662  1.00 0.00 ? 152 VAL A HA   5  
ATOM 9450  H HB   . VAL A 1 101 ? -6.403  13.125  -1.498  1.00 0.00 ? 152 VAL A HB   5  
ATOM 9451  H HG11 . VAL A 1 101 ? -8.985  12.830  -1.758  1.00 0.00 ? 152 VAL A HG11 5  
ATOM 9452  H HG12 . VAL A 1 101 ? -8.688  11.186  -1.179  1.00 0.00 ? 152 VAL A HG12 5  
ATOM 9453  H HG13 . VAL A 1 101 ? -8.259  12.573  -0.178  1.00 0.00 ? 152 VAL A HG13 5  
ATOM 9454  H HG21 . VAL A 1 101 ? -6.200  10.204  -2.153  1.00 0.00 ? 152 VAL A HG21 5  
ATOM 9455  H HG22 . VAL A 1 101 ? -5.076  11.242  -1.286  1.00 0.00 ? 152 VAL A HG22 5  
ATOM 9456  H HG23 . VAL A 1 101 ? -6.489  10.589  -0.464  1.00 0.00 ? 152 VAL A HG23 5  
ATOM 9457  N N    . PHE A 1 102 ? -8.817  13.553  -4.312  1.00 0.00 ? 153 PHE A N    5  
ATOM 9458  C CA   . PHE A 1 102 ? -9.456  14.804  -4.819  1.00 0.00 ? 153 PHE A CA   5  
ATOM 9459  C C    . PHE A 1 102 ? -10.353 15.442  -3.742  1.00 0.00 ? 153 PHE A C    5  
ATOM 9460  O O    . PHE A 1 102 ? -11.543 15.602  -3.928  1.00 0.00 ? 153 PHE A O    5  
ATOM 9461  C CB   . PHE A 1 102 ? -10.297 14.462  -6.045  1.00 0.00 ? 153 PHE A CB   5  
ATOM 9462  C CG   . PHE A 1 102 ? -9.561  13.439  -6.885  1.00 0.00 ? 153 PHE A CG   5  
ATOM 9463  C CD1  . PHE A 1 102 ? -8.336  13.775  -7.488  1.00 0.00 ? 153 PHE A CD1  5  
ATOM 9464  C CD2  . PHE A 1 102 ? -10.095 12.156  -7.061  1.00 0.00 ? 153 PHE A CD2  5  
ATOM 9465  C CE1  . PHE A 1 102 ? -7.653  12.820  -8.257  1.00 0.00 ? 153 PHE A CE1  5  
ATOM 9466  C CE2  . PHE A 1 102 ? -9.408  11.209  -7.826  1.00 0.00 ? 153 PHE A CE2  5  
ATOM 9467  C CZ   . PHE A 1 102 ? -8.190  11.541  -8.422  1.00 0.00 ? 153 PHE A CZ   5  
ATOM 9468  H H    . PHE A 1 102 ? -9.304  12.700  -4.367  1.00 0.00 ? 153 PHE A H    5  
ATOM 9469  H HA   . PHE A 1 102 ? -8.688  15.508  -5.105  1.00 0.00 ? 153 PHE A HA   5  
ATOM 9470  H HB2  . PHE A 1 102 ? -11.250 14.058  -5.731  1.00 0.00 ? 153 PHE A HB2  5  
ATOM 9471  H HB3  . PHE A 1 102 ? -10.458 15.353  -6.632  1.00 0.00 ? 153 PHE A HB3  5  
ATOM 9472  H HD1  . PHE A 1 102 ? -7.920  14.767  -7.361  1.00 0.00 ? 153 PHE A HD1  5  
ATOM 9473  H HD2  . PHE A 1 102 ? -11.033 11.891  -6.598  1.00 0.00 ? 153 PHE A HD2  5  
ATOM 9474  H HE1  . PHE A 1 102 ? -6.711  13.069  -8.722  1.00 0.00 ? 153 PHE A HE1  5  
ATOM 9475  H HE2  . PHE A 1 102 ? -9.824  10.223  -7.963  1.00 0.00 ? 153 PHE A HE2  5  
ATOM 9476  H HZ   . PHE A 1 102 ? -7.656  10.806  -9.008  1.00 0.00 ? 153 PHE A HZ   5  
ATOM 9477  N N    . THR A 1 103 ? -9.781  15.831  -2.634  1.00 0.00 ? 154 THR A N    5  
ATOM 9478  C CA   . THR A 1 103 ? -10.571 16.489  -1.542  1.00 0.00 ? 154 THR A CA   5  
ATOM 9479  C C    . THR A 1 103 ? -10.587 18.003  -1.833  1.00 0.00 ? 154 THR A C    5  
ATOM 9480  O O    . THR A 1 103 ? -10.644 18.399  -2.984  1.00 0.00 ? 154 THR A O    5  
ATOM 9481  C CB   . THR A 1 103 ? -9.888  16.166  -0.190  1.00 0.00 ? 154 THR A CB   5  
ATOM 9482  O OG1  . THR A 1 103 ? -10.072 17.225  0.741   1.00 0.00 ? 154 THR A OG1  5  
ATOM 9483  C CG2  . THR A 1 103 ? -8.375  15.923  -0.410  1.00 0.00 ? 154 THR A CG2  5  
ATOM 9484  H H    . THR A 1 103 ? -8.815  15.695  -2.516  1.00 0.00 ? 154 THR A H    5  
ATOM 9485  H HA   . THR A 1 103 ? -11.587 16.117  -1.543  1.00 0.00 ? 154 THR A HA   5  
ATOM 9486  H HB   . THR A 1 103 ? -10.329 15.270  0.218   1.00 0.00 ? 154 THR A HB   5  
ATOM 9487  H HG1  . THR A 1 103 ? -10.761 16.961  1.362   1.00 0.00 ? 154 THR A HG1  5  
ATOM 9488  H HG21 . THR A 1 103 ? -8.009  16.581  -1.186  1.00 0.00 ? 154 THR A HG21 5  
ATOM 9489  H HG22 . THR A 1 103 ? -7.841  16.120  0.504   1.00 0.00 ? 154 THR A HG22 5  
ATOM 9490  H HG23 . THR A 1 103 ? -8.206  14.895  -0.708  1.00 0.00 ? 154 THR A HG23 5  
ATOM 9491  N N    . ASN A 1 104 ? -10.537 18.862  -0.839  1.00 0.00 ? 155 ASN A N    5  
ATOM 9492  C CA   . ASN A 1 104 ? -10.546 20.329  -1.143  1.00 0.00 ? 155 ASN A CA   5  
ATOM 9493  C C    . ASN A 1 104 ? -9.106  20.747  -1.494  1.00 0.00 ? 155 ASN A C    5  
ATOM 9494  O O    . ASN A 1 104 ? -8.886  21.456  -2.454  1.00 0.00 ? 155 ASN A O    5  
ATOM 9495  C CB   . ASN A 1 104 ? -11.078 21.142  0.057   1.00 0.00 ? 155 ASN A CB   5  
ATOM 9496  C CG   . ASN A 1 104 ? -11.880 20.226  0.975   1.00 0.00 ? 155 ASN A CG   5  
ATOM 9497  O OD1  . ASN A 1 104 ? -12.641 19.404  0.511   1.00 0.00 ? 155 ASN A OD1  5  
ATOM 9498  N ND2  . ASN A 1 104 ? -11.739 20.334  2.264   1.00 0.00 ? 155 ASN A ND2  5  
ATOM 9499  H H    . ASN A 1 104 ? -10.488 18.544  0.092   1.00 0.00 ? 155 ASN A H    5  
ATOM 9500  H HA   . ASN A 1 104 ? -11.180 20.503  -2.004  1.00 0.00 ? 155 ASN A HA   5  
ATOM 9501  H HB2  . ASN A 1 104 ? -10.261 21.574  0.609   1.00 0.00 ? 155 ASN A HB2  5  
ATOM 9502  H HB3  . ASN A 1 104 ? -11.724 21.932  -0.299  1.00 0.00 ? 155 ASN A HB3  5  
ATOM 9503  H HD21 . ASN A 1 104 ? -11.131 21.009  2.631   1.00 0.00 ? 155 ASN A HD21 5  
ATOM 9504  H HD22 . ASN A 1 104 ? -12.226 19.729  2.863   1.00 0.00 ? 155 ASN A HD22 5  
ATOM 9505  N N    . PRO A 1 105 ? -8.128  20.268  -0.757  1.00 0.00 ? 156 PRO A N    5  
ATOM 9506  C CA   . PRO A 1 105 ? -6.693  20.515  -1.014  1.00 0.00 ? 156 PRO A CA   5  
ATOM 9507  C C    . PRO A 1 105 ? -5.995  19.233  -1.550  1.00 0.00 ? 156 PRO A C    5  
ATOM 9508  O O    . PRO A 1 105 ? -5.228  18.606  -0.847  1.00 0.00 ? 156 PRO A O    5  
ATOM 9509  C CB   . PRO A 1 105 ? -6.202  20.827  0.398   1.00 0.00 ? 156 PRO A CB   5  
ATOM 9510  C CG   . PRO A 1 105 ? -7.055  19.961  1.299   1.00 0.00 ? 156 PRO A CG   5  
ATOM 9511  C CD   . PRO A 1 105 ? -8.239  19.452  0.452   1.00 0.00 ? 156 PRO A CD   5  
ATOM 9512  H HA   . PRO A 1 105 ? -6.536  21.362  -1.658  1.00 0.00 ? 156 PRO A HA   5  
ATOM 9513  H HB2  . PRO A 1 105 ? -5.153  20.576  0.492   1.00 0.00 ? 156 PRO A HB2  5  
ATOM 9514  H HB3  . PRO A 1 105 ? -6.365  21.872  0.634   1.00 0.00 ? 156 PRO A HB3  5  
ATOM 9515  H HG2  . PRO A 1 105 ? -6.471  19.127  1.666   1.00 0.00 ? 156 PRO A HG2  5  
ATOM 9516  H HG3  . PRO A 1 105 ? -7.431  20.539  2.126   1.00 0.00 ? 156 PRO A HG3  5  
ATOM 9517  H HD2  . PRO A 1 105 ? -8.111  18.413  0.230   1.00 0.00 ? 156 PRO A HD2  5  
ATOM 9518  H HD3  . PRO A 1 105 ? -9.176  19.624  0.950   1.00 0.00 ? 156 PRO A HD3  5  
ATOM 9519  N N    . PRO A 1 106 ? -6.269  18.834  -2.774  1.00 0.00 ? 157 PRO A N    5  
ATOM 9520  C CA   . PRO A 1 106 ? -5.690  17.601  -3.385  1.00 0.00 ? 157 PRO A CA   5  
ATOM 9521  C C    . PRO A 1 106 ? -4.283  17.265  -2.903  1.00 0.00 ? 157 PRO A C    5  
ATOM 9522  O O    . PRO A 1 106 ? -3.341  17.981  -3.174  1.00 0.00 ? 157 PRO A O    5  
ATOM 9523  C CB   . PRO A 1 106 ? -5.668  17.936  -4.869  1.00 0.00 ? 157 PRO A CB   5  
ATOM 9524  C CG   . PRO A 1 106 ? -6.880  18.788  -5.071  1.00 0.00 ? 157 PRO A CG   5  
ATOM 9525  C CD   . PRO A 1 106 ? -7.156  19.514  -3.728  1.00 0.00 ? 157 PRO A CD   5  
ATOM 9526  H HA   . PRO A 1 106 ? -6.347  16.765  -3.225  1.00 0.00 ? 157 PRO A HA   5  
ATOM 9527  H HB2  . PRO A 1 106 ? -4.761  18.481  -5.121  1.00 0.00 ? 157 PRO A HB2  5  
ATOM 9528  H HB3  . PRO A 1 106 ? -5.742  17.034  -5.464  1.00 0.00 ? 157 PRO A HB3  5  
ATOM 9529  H HG2  . PRO A 1 106 ? -6.693  19.506  -5.856  1.00 0.00 ? 157 PRO A HG2  5  
ATOM 9530  H HG3  . PRO A 1 106 ? -7.726  18.164  -5.329  1.00 0.00 ? 157 PRO A HG3  5  
ATOM 9531  H HD2  . PRO A 1 106 ? -6.893  20.559  -3.798  1.00 0.00 ? 157 PRO A HD2  5  
ATOM 9532  H HD3  . PRO A 1 106 ? -8.187  19.398  -3.436  1.00 0.00 ? 157 PRO A HD3  5  
ATOM 9533  N N    . GLN A 1 107 ? -4.133  16.159  -2.221  1.00 0.00 ? 158 GLN A N    5  
ATOM 9534  C CA   . GLN A 1 107 ? -2.779  15.734  -1.737  1.00 0.00 ? 158 GLN A CA   5  
ATOM 9535  C C    . GLN A 1 107 ? -2.226  14.656  -2.673  1.00 0.00 ? 158 GLN A C    5  
ATOM 9536  O O    . GLN A 1 107 ? -2.907  13.710  -3.018  1.00 0.00 ? 158 GLN A O    5  
ATOM 9537  C CB   . GLN A 1 107 ? -2.908  15.154  -0.322  1.00 0.00 ? 158 GLN A CB   5  
ATOM 9538  C CG   . GLN A 1 107 ? -3.363  16.236  0.653   1.00 0.00 ? 158 GLN A CG   5  
ATOM 9539  C CD   . GLN A 1 107 ? -2.287  17.323  0.744   1.00 0.00 ? 158 GLN A CD   5  
ATOM 9540  O OE1  . GLN A 1 107 ? -1.106  17.026  0.711   1.00 0.00 ? 158 GLN A OE1  5  
ATOM 9541  N NE2  . GLN A 1 107 ? -2.645  18.571  0.876   1.00 0.00 ? 158 GLN A NE2  5  
ATOM 9542  H H    . GLN A 1 107 ? -4.914  15.589  -2.046  1.00 0.00 ? 158 GLN A H    5  
ATOM 9543  H HA   . GLN A 1 107 ? -2.101  16.578  -1.722  1.00 0.00 ? 158 GLN A HA   5  
ATOM 9544  H HB2  . GLN A 1 107 ? -3.635  14.356  -0.332  1.00 0.00 ? 158 GLN A HB2  5  
ATOM 9545  H HB3  . GLN A 1 107 ? -1.951  14.765  -0.003  1.00 0.00 ? 158 GLN A HB3  5  
ATOM 9546  H HG2  . GLN A 1 107 ? -4.290  16.668  0.307   1.00 0.00 ? 158 GLN A HG2  5  
ATOM 9547  H HG3  . GLN A 1 107 ? -3.505  15.801  1.628   1.00 0.00 ? 158 GLN A HG3  5  
ATOM 9548  H HE21 . GLN A 1 107 ? -3.596  18.809  0.913   1.00 0.00 ? 158 GLN A HE21 5  
ATOM 9549  H HE22 . GLN A 1 107 ? -1.963  19.269  0.946   1.00 0.00 ? 158 GLN A HE22 5  
ATOM 9550  N N    . VAL A 1 108 ? -0.984  14.775  -3.061  1.00 0.00 ? 159 VAL A N    5  
ATOM 9551  C CA   . VAL A 1 108 ? -0.361  13.738  -3.963  1.00 0.00 ? 159 VAL A CA   5  
ATOM 9552  C C    . VAL A 1 108 ? 0.705   12.975  -3.192  1.00 0.00 ? 159 VAL A C    5  
ATOM 9553  O O    . VAL A 1 108 ? 1.563   13.561  -2.582  1.00 0.00 ? 159 VAL A O    5  
ATOM 9554  C CB   . VAL A 1 108 ? 0.300   14.410  -5.173  1.00 0.00 ? 159 VAL A CB   5  
ATOM 9555  C CG1  . VAL A 1 108 ? 0.915   13.338  -6.069  1.00 0.00 ? 159 VAL A CG1  5  
ATOM 9556  C CG2  . VAL A 1 108 ? -0.757  15.196  -5.959  1.00 0.00 ? 159 VAL A CG2  5  
ATOM 9557  H H    . VAL A 1 108 ? -0.449  15.533  -2.738  1.00 0.00 ? 159 VAL A H    5  
ATOM 9558  H HA   . VAL A 1 108 ? -1.114  13.040  -4.311  1.00 0.00 ? 159 VAL A HA   5  
ATOM 9559  H HB   . VAL A 1 108 ? 1.084   15.073  -4.841  1.00 0.00 ? 159 VAL A HB   5  
ATOM 9560  H HG11 . VAL A 1 108 ? 0.157   12.619  -6.341  1.00 0.00 ? 159 VAL A HG11 5  
ATOM 9561  H HG12 . VAL A 1 108 ? 1.307   13.806  -6.957  1.00 0.00 ? 159 VAL A HG12 5  
ATOM 9562  H HG13 . VAL A 1 108 ? 1.722   12.838  -5.542  1.00 0.00 ? 159 VAL A HG13 5  
ATOM 9563  H HG21 . VAL A 1 108 ? -1.560  14.531  -6.235  1.00 0.00 ? 159 VAL A HG21 5  
ATOM 9564  H HG22 . VAL A 1 108 ? -1.148  16.000  -5.346  1.00 0.00 ? 159 VAL A HG22 5  
ATOM 9565  H HG23 . VAL A 1 108 ? -0.316  15.613  -6.853  1.00 0.00 ? 159 VAL A HG23 5  
ATOM 9566  N N    . ALA A 1 109 ? 0.670   11.669  -3.222  1.00 0.00 ? 160 ALA A N    5  
ATOM 9567  C CA   . ALA A 1 109 ? 1.713   10.872  -2.484  1.00 0.00 ? 160 ALA A CA   5  
ATOM 9568  C C    . ALA A 1 109 ? 2.147   9.676   -3.350  1.00 0.00 ? 160 ALA A C    5  
ATOM 9569  O O    . ALA A 1 109 ? 1.348   9.095   -4.061  1.00 0.00 ? 160 ALA A O    5  
ATOM 9570  C CB   . ALA A 1 109 ? 1.123   10.417  -1.134  1.00 0.00 ? 160 ALA A CB   5  
ATOM 9571  H H    . ALA A 1 109 ? -0.043  11.209  -3.728  1.00 0.00 ? 160 ALA A H    5  
ATOM 9572  H HA   . ALA A 1 109 ? 2.582   11.483  -2.302  1.00 0.00 ? 160 ALA A HA   5  
ATOM 9573  H HB1  . ALA A 1 109 ? 0.060   10.621  -1.124  1.00 0.00 ? 160 ALA A HB1  5  
ATOM 9574  H HB2  . ALA A 1 109 ? 1.294   9.362   -0.984  1.00 0.00 ? 160 ALA A HB2  5  
ATOM 9575  H HB3  . ALA A 1 109 ? 1.591   10.965  -0.331  1.00 0.00 ? 160 ALA A HB3  5  
ATOM 9576  N N    . THR A 1 110 ? 3.421   9.324   -3.324  1.00 0.00 ? 161 THR A N    5  
ATOM 9577  C CA   . THR A 1 110 ? 3.905   8.179   -4.154  1.00 0.00 ? 161 THR A CA   5  
ATOM 9578  C C    . THR A 1 110 ? 5.024   7.416   -3.421  1.00 0.00 ? 161 THR A C    5  
ATOM 9579  O O    . THR A 1 110 ? 5.652   7.919   -2.506  1.00 0.00 ? 161 THR A O    5  
ATOM 9580  C CB   . THR A 1 110 ? 4.444   8.699   -5.489  1.00 0.00 ? 161 THR A CB   5  
ATOM 9581  O OG1  . THR A 1 110 ? 5.754   9.225   -5.295  1.00 0.00 ? 161 THR A OG1  5  
ATOM 9582  C CG2  . THR A 1 110 ? 3.513   9.793   -6.023  1.00 0.00 ? 161 THR A CG2  5  
ATOM 9583  H H    . THR A 1 110 ? 4.056   9.818   -2.771  1.00 0.00 ? 161 THR A H    5  
ATOM 9584  H HA   . THR A 1 110 ? 3.084   7.506   -4.345  1.00 0.00 ? 161 THR A HA   5  
ATOM 9585  H HB   . THR A 1 110 ? 4.478   7.882   -6.197  1.00 0.00 ? 161 THR A HB   5  
ATOM 9586  H HG1  . THR A 1 110 ? 6.160   9.333   -6.160  1.00 0.00 ? 161 THR A HG1  5  
ATOM 9587  H HG21 . THR A 1 110 ? 2.509   9.408   -6.094  1.00 0.00 ? 161 THR A HG21 5  
ATOM 9588  H HG22 . THR A 1 110 ? 3.524   10.641  -5.353  1.00 0.00 ? 161 THR A HG22 5  
ATOM 9589  H HG23 . THR A 1 110 ? 3.849   10.103  -7.001  1.00 0.00 ? 161 THR A HG23 5  
ATOM 9590  N N    . TYR A 1 111 ? 5.286   6.212   -3.843  1.00 0.00 ? 162 TYR A N    5  
ATOM 9591  C CA   . TYR A 1 111 ? 6.372   5.379   -3.225  1.00 0.00 ? 162 TYR A CA   5  
ATOM 9592  C C    . TYR A 1 111 ? 7.130   4.658   -4.351  1.00 0.00 ? 162 TYR A C    5  
ATOM 9593  O O    . TYR A 1 111 ? 6.528   4.043   -5.202  1.00 0.00 ? 162 TYR A O    5  
ATOM 9594  C CB   . TYR A 1 111 ? 5.736   4.358   -2.269  1.00 0.00 ? 162 TYR A CB   5  
ATOM 9595  C CG   . TYR A 1 111 ? 6.734   3.320   -1.816  1.00 0.00 ? 162 TYR A CG   5  
ATOM 9596  C CD1  . TYR A 1 111 ? 7.473   3.523   -0.646  1.00 0.00 ? 162 TYR A CD1  5  
ATOM 9597  C CD2  . TYR A 1 111 ? 6.872   2.129   -2.531  1.00 0.00 ? 162 TYR A CD2  5  
ATOM 9598  C CE1  . TYR A 1 111 ? 8.355   2.535   -0.186  1.00 0.00 ? 162 TYR A CE1  5  
ATOM 9599  C CE2  . TYR A 1 111 ? 7.763   1.135   -2.079  1.00 0.00 ? 162 TYR A CE2  5  
ATOM 9600  C CZ   . TYR A 1 111 ? 8.498   1.334   -0.902  1.00 0.00 ? 162 TYR A CZ   5  
ATOM 9601  O OH   . TYR A 1 111 ? 9.356   0.348   -0.431  1.00 0.00 ? 162 TYR A OH   5  
ATOM 9602  H H    . TYR A 1 111 ? 4.773   5.850   -4.591  1.00 0.00 ? 162 TYR A H    5  
ATOM 9603  H HA   . TYR A 1 111 ? 7.051   6.010   -2.680  1.00 0.00 ? 162 TYR A HA   5  
ATOM 9604  H HB2  . TYR A 1 111 ? 5.353   4.871   -1.401  1.00 0.00 ? 162 TYR A HB2  5  
ATOM 9605  H HB3  . TYR A 1 111 ? 4.922   3.868   -2.767  1.00 0.00 ? 162 TYR A HB3  5  
ATOM 9606  H HD1  . TYR A 1 111 ? 7.354   4.442   -0.093  1.00 0.00 ? 162 TYR A HD1  5  
ATOM 9607  H HD2  . TYR A 1 111 ? 6.305   1.982   -3.440  1.00 0.00 ? 162 TYR A HD2  5  
ATOM 9608  H HE1  . TYR A 1 111 ? 8.923   2.701   0.717   1.00 0.00 ? 162 TYR A HE1  5  
ATOM 9609  H HE2  . TYR A 1 111 ? 7.861   0.208   -2.631  1.00 0.00 ? 162 TYR A HE2  5  
ATOM 9610  H HH   . TYR A 1 111 ? 9.971   0.118   -1.126  1.00 0.00 ? 162 TYR A HH   5  
ATOM 9611  N N    . HIS A 1 112 ? 8.446   4.735   -4.374  1.00 0.00 ? 163 HIS A N    5  
ATOM 9612  C CA   . HIS A 1 112 ? 9.222   4.055   -5.472  1.00 0.00 ? 163 HIS A CA   5  
ATOM 9613  C C    . HIS A 1 112 ? 10.309  3.166   -4.867  1.00 0.00 ? 163 HIS A C    5  
ATOM 9614  O O    . HIS A 1 112 ? 11.192  3.630   -4.169  1.00 0.00 ? 163 HIS A O    5  
ATOM 9615  C CB   . HIS A 1 112 ? 9.869   5.117   -6.373  1.00 0.00 ? 163 HIS A CB   5  
ATOM 9616  C CG   . HIS A 1 112 ? 8.884   6.233   -6.616  1.00 0.00 ? 163 HIS A CG   5  
ATOM 9617  N ND1  . HIS A 1 112 ? 9.231   7.573   -6.490  1.00 0.00 ? 163 HIS A ND1  5  
ATOM 9618  C CD2  . HIS A 1 112 ? 7.558   6.224   -6.967  1.00 0.00 ? 163 HIS A CD2  5  
ATOM 9619  C CE1  . HIS A 1 112 ? 8.138   8.307   -6.762  1.00 0.00 ? 163 HIS A CE1  5  
ATOM 9620  N NE2  . HIS A 1 112 ? 7.087   7.535   -7.062  1.00 0.00 ? 163 HIS A NE2  5  
ATOM 9621  H H    . HIS A 1 112 ? 8.918   5.246   -3.684  1.00 0.00 ? 163 HIS A H    5  
ATOM 9622  H HA   . HIS A 1 112 ? 8.560   3.434   -6.074  1.00 0.00 ? 163 HIS A HA   5  
ATOM 9623  H HB2  . HIS A 1 112 ? 10.757  5.515   -5.901  1.00 0.00 ? 163 HIS A HB2  5  
ATOM 9624  H HB3  . HIS A 1 112 ? 10.142  4.667   -7.314  1.00 0.00 ? 163 HIS A HB3  5  
ATOM 9625  H HD1  . HIS A 1 112 ? 10.112  7.921   -6.251  1.00 0.00 ? 163 HIS A HD1  5  
ATOM 9626  H HD2  . HIS A 1 112 ? 6.963   5.336   -7.113  1.00 0.00 ? 163 HIS A HD2  5  
ATOM 9627  H HE1  . HIS A 1 112 ? 8.112   9.390   -6.736  1.00 0.00 ? 163 HIS A HE1  5  
ATOM 9628  N N    . ARG A 1 113 ? 10.250  1.894   -5.135  1.00 0.00 ? 164 ARG A N    5  
ATOM 9629  C CA   . ARG A 1 113 ? 11.284  0.967   -4.583  1.00 0.00 ? 164 ARG A CA   5  
ATOM 9630  C C    . ARG A 1 113 ? 11.212  -0.392  -5.301  1.00 0.00 ? 164 ARG A C    5  
ATOM 9631  O O    . ARG A 1 113 ? 10.291  -0.666  -6.036  1.00 0.00 ? 164 ARG A O    5  
ATOM 9632  C CB   . ARG A 1 113 ? 11.062  0.801   -3.060  1.00 0.00 ? 164 ARG A CB   5  
ATOM 9633  C CG   . ARG A 1 113 ? 12.341  0.274   -2.387  1.00 0.00 ? 164 ARG A CG   5  
ATOM 9634  C CD   . ARG A 1 113 ? 12.120  0.134   -0.881  1.00 0.00 ? 164 ARG A CD   5  
ATOM 9635  N NE   . ARG A 1 113 ? 13.439  0.000   -0.186  1.00 0.00 ? 164 ARG A NE   5  
ATOM 9636  C CZ   . ARG A 1 113 ? 14.295  -0.944  -0.477  1.00 0.00 ? 164 ARG A CZ   5  
ATOM 9637  N NH1  . ARG A 1 113 ? 13.972  -1.923  -1.281  1.00 0.00 ? 164 ARG A NH1  5  
ATOM 9638  N NH2  . ARG A 1 113 ? 15.468  -0.939  0.098   1.00 0.00 ? 164 ARG A NH2  5  
ATOM 9639  H H    . ARG A 1 113 ? 9.531   1.552   -5.701  1.00 0.00 ? 164 ARG A H    5  
ATOM 9640  H HA   . ARG A 1 113 ? 12.256  1.398   -4.757  1.00 0.00 ? 164 ARG A HA   5  
ATOM 9641  H HB2  . ARG A 1 113 ? 10.800  1.756   -2.627  1.00 0.00 ? 164 ARG A HB2  5  
ATOM 9642  H HB3  . ARG A 1 113 ? 10.258  0.095   -2.891  1.00 0.00 ? 164 ARG A HB3  5  
ATOM 9643  H HG2  . ARG A 1 113 ? 12.585  -0.685  -2.795  1.00 0.00 ? 164 ARG A HG2  5  
ATOM 9644  H HG3  . ARG A 1 113 ? 13.151  0.961   -2.568  1.00 0.00 ? 164 ARG A HG3  5  
ATOM 9645  H HD2  . ARG A 1 113 ? 11.663  1.027   -0.508  1.00 0.00 ? 164 ARG A HD2  5  
ATOM 9646  H HD3  . ARG A 1 113 ? 11.467  -0.716  -0.678  1.00 0.00 ? 164 ARG A HD3  5  
ATOM 9647  H HE   . ARG A 1 113 ? 13.685  0.672   0.480   1.00 0.00 ? 164 ARG A HE   5  
ATOM 9648  H HH11 . ARG A 1 113 ? 13.057  -1.963  -1.677  1.00 0.00 ? 164 ARG A HH11 5  
ATOM 9649  H HH12 . ARG A 1 113 ? 14.643  -2.635  -1.497  1.00 0.00 ? 164 ARG A HH12 5  
ATOM 9650  H HH21 . ARG A 1 113 ? 15.703  -0.222  0.753   1.00 0.00 ? 164 ARG A HH21 5  
ATOM 9651  H HH22 . ARG A 1 113 ? 16.129  -1.653  -0.120  1.00 0.00 ? 164 ARG A HH22 5  
ATOM 9652  N N    . ALA A 1 114 ? 12.180  -1.243  -5.078  1.00 0.00 ? 165 ALA A N    5  
ATOM 9653  C CA   . ALA A 1 114 ? 12.197  -2.599  -5.717  1.00 0.00 ? 165 ALA A CA   5  
ATOM 9654  C C    . ALA A 1 114 ? 11.046  -3.440  -5.139  1.00 0.00 ? 165 ALA A C    5  
ATOM 9655  O O    . ALA A 1 114 ? 10.398  -3.034  -4.204  1.00 0.00 ? 165 ALA A O    5  
ATOM 9656  C CB   . ALA A 1 114 ? 13.534  -3.259  -5.377  1.00 0.00 ? 165 ALA A CB   5  
ATOM 9657  H H    . ALA A 1 114 ? 12.910  -0.992  -4.476  1.00 0.00 ? 165 ALA A H    5  
ATOM 9658  H HA   . ALA A 1 114 ? 12.090  -2.508  -6.791  1.00 0.00 ? 165 ALA A HA   5  
ATOM 9659  H HB1  . ALA A 1 114 ? 13.629  -3.334  -4.301  1.00 0.00 ? 165 ALA A HB1  5  
ATOM 9660  H HB2  . ALA A 1 114 ? 13.577  -4.247  -5.810  1.00 0.00 ? 165 ALA A HB2  5  
ATOM 9661  H HB3  . ALA A 1 114 ? 14.343  -2.655  -5.772  1.00 0.00 ? 165 ALA A HB3  5  
ATOM 9662  N N    . ILE A 1 115 ? 10.774  -4.603  -5.686  1.00 0.00 ? 166 ILE A N    5  
ATOM 9663  C CA   . ILE A 1 115 ? 9.653   -5.445  -5.155  1.00 0.00 ? 166 ILE A CA   5  
ATOM 9664  C C    . ILE A 1 115 ? 10.220  -6.504  -4.205  1.00 0.00 ? 166 ILE A C    5  
ATOM 9665  O O    . ILE A 1 115 ? 10.993  -7.347  -4.604  1.00 0.00 ? 166 ILE A O    5  
ATOM 9666  C CB   . ILE A 1 115 ? 8.927   -6.139  -6.332  1.00 0.00 ? 166 ILE A CB   5  
ATOM 9667  C CG1  . ILE A 1 115 ? 8.558   -5.082  -7.388  1.00 0.00 ? 166 ILE A CG1  5  
ATOM 9668  C CG2  . ILE A 1 115 ? 7.633   -6.804  -5.813  1.00 0.00 ? 166 ILE A CG2  5  
ATOM 9669  C CD1  . ILE A 1 115 ? 8.051   -5.777  -8.661  1.00 0.00 ? 166 ILE A CD1  5  
ATOM 9670  H H    . ILE A 1 115 ? 11.293  -4.916  -6.445  1.00 0.00 ? 166 ILE A H    5  
ATOM 9671  H HA   . ILE A 1 115 ? 8.950   -4.828  -4.620  1.00 0.00 ? 166 ILE A HA   5  
ATOM 9672  H HB   . ILE A 1 115 ? 9.575   -6.891  -6.776  1.00 0.00 ? 166 ILE A HB   5  
ATOM 9673  H HG12 . ILE A 1 115 ? 7.786   -4.439  -6.985  1.00 0.00 ? 166 ILE A HG12 5  
ATOM 9674  H HG13 . ILE A 1 115 ? 9.422   -4.492  -7.626  1.00 0.00 ? 166 ILE A HG13 5  
ATOM 9675  H HG21 . ILE A 1 115 ? 7.791   -7.174  -4.813  1.00 0.00 ? 166 ILE A HG21 5  
ATOM 9676  H HG22 . ILE A 1 115 ? 6.828   -6.075  -5.797  1.00 0.00 ? 166 ILE A HG22 5  
ATOM 9677  H HG23 . ILE A 1 115 ? 7.359   -7.627  -6.459  1.00 0.00 ? 166 ILE A HG23 5  
ATOM 9678  H HD11 . ILE A 1 115 ? 8.748   -6.558  -8.943  1.00 0.00 ? 166 ILE A HD11 5  
ATOM 9679  H HD12 . ILE A 1 115 ? 7.081   -6.211  -8.476  1.00 0.00 ? 166 ILE A HD12 5  
ATOM 9680  H HD13 . ILE A 1 115 ? 7.977   -5.056  -9.466  1.00 0.00 ? 166 ILE A HD13 5  
ATOM 9681  N N    . LYS A 1 116 ? 9.837   -6.471  -2.952  1.00 0.00 ? 167 LYS A N    5  
ATOM 9682  C CA   . LYS A 1 116 ? 10.344  -7.481  -1.967  1.00 0.00 ? 167 LYS A CA   5  
ATOM 9683  C C    . LYS A 1 116 ? 9.317   -8.600  -1.761  1.00 0.00 ? 167 LYS A C    5  
ATOM 9684  O O    . LYS A 1 116 ? 9.508   -9.493  -0.955  1.00 0.00 ? 167 LYS A O    5  
ATOM 9685  C CB   . LYS A 1 116 ? 10.584  -6.803  -0.632  1.00 0.00 ? 167 LYS A CB   5  
ATOM 9686  C CG   . LYS A 1 116 ? 11.641  -5.708  -0.796  1.00 0.00 ? 167 LYS A CG   5  
ATOM 9687  C CD   . LYS A 1 116 ? 12.075  -5.194  0.578   1.00 0.00 ? 167 LYS A CD   5  
ATOM 9688  C CE   . LYS A 1 116 ? 12.960  -3.966  0.394   1.00 0.00 ? 167 LYS A CE   5  
ATOM 9689  N NZ   . LYS A 1 116 ? 13.416  -3.478  1.725   1.00 0.00 ? 167 LYS A NZ   5  
ATOM 9690  H H    . LYS A 1 116 ? 9.208   -5.782  -2.655  1.00 0.00 ? 167 LYS A H    5  
ATOM 9691  H HA   . LYS A 1 116 ? 11.272  -7.900  -2.321  1.00 0.00 ? 167 LYS A HA   5  
ATOM 9692  H HB2  . LYS A 1 116 ? 9.662   -6.359  -0.301  1.00 0.00 ? 167 LYS A HB2  5  
ATOM 9693  H HB3  . LYS A 1 116 ? 10.915  -7.534  0.089   1.00 0.00 ? 167 LYS A HB3  5  
ATOM 9694  H HG2  . LYS A 1 116 ? 12.499  -6.106  -1.321  1.00 0.00 ? 167 LYS A HG2  5  
ATOM 9695  H HG3  . LYS A 1 116 ? 11.224  -4.894  -1.358  1.00 0.00 ? 167 LYS A HG3  5  
ATOM 9696  H HD2  . LYS A 1 116 ? 11.201  -4.928  1.157   1.00 0.00 ? 167 LYS A HD2  5  
ATOM 9697  H HD3  . LYS A 1 116 ? 12.628  -5.958  1.094   1.00 0.00 ? 167 LYS A HD3  5  
ATOM 9698  H HE2  . LYS A 1 116 ? 13.818  -4.223  -0.212  1.00 0.00 ? 167 LYS A HE2  5  
ATOM 9699  H HE3  . LYS A 1 116 ? 12.393  -3.191  -0.098  1.00 0.00 ? 167 LYS A HE3  5  
ATOM 9700  H HZ1  . LYS A 1 116 ? 13.645  -4.284  2.343   1.00 0.00 ? 167 LYS A HZ1  5  
ATOM 9701  H HZ2  . LYS A 1 116 ? 14.258  -2.887  1.599   1.00 0.00 ? 167 LYS A HZ2  5  
ATOM 9702  H HZ3  . LYS A 1 116 ? 12.662  -2.913  2.162   1.00 0.00 ? 167 LYS A HZ3  5  
ATOM 9703  N N    . ILE A 1 117 ? 8.223   -8.552  -2.468  1.00 0.00 ? 168 ILE A N    5  
ATOM 9704  C CA   . ILE A 1 117 ? 7.162   -9.593  -2.301  1.00 0.00 ? 168 ILE A CA   5  
ATOM 9705  C C    . ILE A 1 117 ? 7.749   -10.984 -2.561  1.00 0.00 ? 168 ILE A C    5  
ATOM 9706  O O    . ILE A 1 117 ? 8.883   -11.119 -2.991  1.00 0.00 ? 168 ILE A O    5  
ATOM 9707  C CB   . ILE A 1 117 ? 6.001   -9.299  -3.267  1.00 0.00 ? 168 ILE A CB   5  
ATOM 9708  C CG1  . ILE A 1 117 ? 4.744   -10.096 -2.865  1.00 0.00 ? 168 ILE A CG1  5  
ATOM 9709  C CG2  . ILE A 1 117 ? 6.388   -9.670  -4.696  1.00 0.00 ? 168 ILE A CG2  5  
ATOM 9710  C CD1  . ILE A 1 117 ? 3.511   -9.606  -3.650  1.00 0.00 ? 168 ILE A CD1  5  
ATOM 9711  H H    . ILE A 1 117 ? 8.091   -7.818  -3.101  1.00 0.00 ? 168 ILE A H    5  
ATOM 9712  H HA   . ILE A 1 117 ? 6.796   -9.550  -1.290  1.00 0.00 ? 168 ILE A HA   5  
ATOM 9713  H HB   . ILE A 1 117 ? 5.782   -8.244  -3.224  1.00 0.00 ? 168 ILE A HB   5  
ATOM 9714  H HG12 . ILE A 1 117 ? 4.897   -11.141 -3.087  1.00 0.00 ? 168 ILE A HG12 5  
ATOM 9715  H HG13 . ILE A 1 117 ? 4.566   -9.974  -1.808  1.00 0.00 ? 168 ILE A HG13 5  
ATOM 9716  H HG21 . ILE A 1 117 ? 7.422   -9.411  -4.869  1.00 0.00 ? 168 ILE A HG21 5  
ATOM 9717  H HG22 . ILE A 1 117 ? 6.254   -10.732 -4.848  1.00 0.00 ? 168 ILE A HG22 5  
ATOM 9718  H HG23 . ILE A 1 117 ? 5.754   -9.125  -5.384  1.00 0.00 ? 168 ILE A HG23 5  
ATOM 9719  H HD11 . ILE A 1 117 ? 3.815   -9.188  -4.598  1.00 0.00 ? 168 ILE A HD11 5  
ATOM 9720  H HD12 . ILE A 1 117 ? 2.851   -10.442 -3.830  1.00 0.00 ? 168 ILE A HD12 5  
ATOM 9721  H HD13 . ILE A 1 117 ? 2.991   -8.857  -3.077  1.00 0.00 ? 168 ILE A HD13 5  
ATOM 9722  N N    . THR A 1 118 ? 6.991   -12.028 -2.292  1.00 0.00 ? 169 THR A N    5  
ATOM 9723  C CA   . THR A 1 118 ? 7.492   -13.417 -2.504  1.00 0.00 ? 169 THR A CA   5  
ATOM 9724  C C    . THR A 1 118 ? 6.547   -14.127 -3.466  1.00 0.00 ? 169 THR A C    5  
ATOM 9725  O O    . THR A 1 118 ? 5.357   -13.867 -3.510  1.00 0.00 ? 169 THR A O    5  
ATOM 9726  C CB   . THR A 1 118 ? 7.516   -14.184 -1.177  1.00 0.00 ? 169 THR A CB   5  
ATOM 9727  O OG1  . THR A 1 118 ? 8.208   -13.434 -0.189  1.00 0.00 ? 169 THR A OG1  5  
ATOM 9728  C CG2  . THR A 1 118 ? 8.209   -15.534 -1.364  1.00 0.00 ? 169 THR A CG2  5  
ATOM 9729  H H    . THR A 1 118 ? 6.086   -11.899 -1.947  1.00 0.00 ? 169 THR A H    5  
ATOM 9730  H HA   . THR A 1 118 ? 8.487   -13.393 -2.925  1.00 0.00 ? 169 THR A HA   5  
ATOM 9731  H HB   . THR A 1 118 ? 6.508   -14.357 -0.856  1.00 0.00 ? 169 THR A HB   5  
ATOM 9732  H HG1  . THR A 1 118 ? 8.665   -14.052 0.392   1.00 0.00 ? 169 THR A HG1  5  
ATOM 9733  H HG21 . THR A 1 118 ? 7.783   -16.045 -2.212  1.00 0.00 ? 169 THR A HG21 5  
ATOM 9734  H HG22 . THR A 1 118 ? 9.265   -15.385 -1.526  1.00 0.00 ? 169 THR A HG22 5  
ATOM 9735  H HG23 . THR A 1 118 ? 8.060   -16.133 -0.480  1.00 0.00 ? 169 THR A HG23 5  
ATOM 9736  N N    . VAL A 1 119 ? 7.072   -15.019 -4.239  1.00 0.00 ? 170 VAL A N    5  
ATOM 9737  C CA   . VAL A 1 119 ? 6.236   -15.766 -5.217  1.00 0.00 ? 170 VAL A CA   5  
ATOM 9738  C C    . VAL A 1 119 ? 5.806   -17.123 -4.623  1.00 0.00 ? 170 VAL A C    5  
ATOM 9739  O O    . VAL A 1 119 ? 6.614   -17.855 -4.092  1.00 0.00 ? 170 VAL A O    5  
ATOM 9740  C CB   . VAL A 1 119 ? 7.110   -15.995 -6.432  1.00 0.00 ? 170 VAL A CB   5  
ATOM 9741  C CG1  . VAL A 1 119 ? 6.439   -16.975 -7.404  1.00 0.00 ? 170 VAL A CG1  5  
ATOM 9742  C CG2  . VAL A 1 119 ? 7.361   -14.645 -7.119  1.00 0.00 ? 170 VAL A CG2  5  
ATOM 9743  H H    . VAL A 1 119 ? 8.041   -15.199 -4.187  1.00 0.00 ? 170 VAL A H    5  
ATOM 9744  H HA   . VAL A 1 119 ? 5.364   -15.187 -5.494  1.00 0.00 ? 170 VAL A HA   5  
ATOM 9745  H HB   . VAL A 1 119 ? 8.048   -16.399 -6.094  1.00 0.00 ? 170 VAL A HB   5  
ATOM 9746  H HG11 . VAL A 1 119 ? 5.366   -16.838 -7.388  1.00 0.00 ? 170 VAL A HG11 5  
ATOM 9747  H HG12 . VAL A 1 119 ? 6.808   -16.802 -8.409  1.00 0.00 ? 170 VAL A HG12 5  
ATOM 9748  H HG13 . VAL A 1 119 ? 6.680   -17.984 -7.103  1.00 0.00 ? 170 VAL A HG13 5  
ATOM 9749  H HG21 . VAL A 1 119 ? 6.420   -14.182 -7.350  1.00 0.00 ? 170 VAL A HG21 5  
ATOM 9750  H HG22 . VAL A 1 119 ? 7.920   -14.001 -6.460  1.00 0.00 ? 170 VAL A HG22 5  
ATOM 9751  H HG23 . VAL A 1 119 ? 7.920   -14.801 -8.028  1.00 0.00 ? 170 VAL A HG23 5  
ATOM 9752  N N    . ASP A 1 120 ? 4.533   -17.447 -4.695  1.00 0.00 ? 171 ASP A N    5  
ATOM 9753  C CA   . ASP A 1 120 ? 4.043   -18.743 -4.126  1.00 0.00 ? 171 ASP A CA   5  
ATOM 9754  C C    . ASP A 1 120 ? 4.508   -19.905 -5.006  1.00 0.00 ? 171 ASP A C    5  
ATOM 9755  O O    . ASP A 1 120 ? 4.400   -21.060 -4.625  1.00 0.00 ? 171 ASP A O    5  
ATOM 9756  C CB   . ASP A 1 120 ? 2.511   -18.737 -4.083  1.00 0.00 ? 171 ASP A CB   5  
ATOM 9757  C CG   . ASP A 1 120 ? 1.971   -18.448 -5.488  1.00 0.00 ? 171 ASP A CG   5  
ATOM 9758  O OD1  . ASP A 1 120 ? 2.728   -17.923 -6.293  1.00 0.00 ? 171 ASP A OD1  5  
ATOM 9759  O OD2  . ASP A 1 120 ? 0.818   -18.754 -5.742  1.00 0.00 ? 171 ASP A OD2  5  
ATOM 9760  H H    . ASP A 1 120 ? 3.900   -16.827 -5.104  1.00 0.00 ? 171 ASP A H    5  
ATOM 9761  H HA   . ASP A 1 120 ? 4.428   -18.863 -3.126  1.00 0.00 ? 171 ASP A HA   5  
ATOM 9762  H HB2  . ASP A 1 120 ? 2.153   -19.698 -3.744  1.00 0.00 ? 171 ASP A HB2  5  
ATOM 9763  H HB3  . ASP A 1 120 ? 2.169   -17.973 -3.400  1.00 0.00 ? 171 ASP A HB3  5  
ATOM 9764  N N    . GLY A 1 121 ? 5.031   -19.603 -6.177  1.00 0.00 ? 172 GLY A N    5  
ATOM 9765  C CA   . GLY A 1 121 ? 5.519   -20.674 -7.090  1.00 0.00 ? 172 GLY A CA   5  
ATOM 9766  C C    . GLY A 1 121 ? 6.656   -21.437 -6.389  1.00 0.00 ? 172 GLY A C    5  
ATOM 9767  O O    . GLY A 1 121 ? 6.508   -21.831 -5.250  1.00 0.00 ? 172 GLY A O    5  
ATOM 9768  H H    . GLY A 1 121 ? 5.101   -18.667 -6.456  1.00 0.00 ? 172 GLY A H    5  
ATOM 9769  H HA2  . GLY A 1 121 ? 4.702   -21.344 -7.312  1.00 0.00 ? 172 GLY A HA2  5  
ATOM 9770  H HA3  . GLY A 1 121 ? 5.874   -20.228 -7.998  1.00 0.00 ? 172 GLY A HA3  5  
ATOM 9771  N N    . PRO A 1 122 ? 7.788   -21.643 -7.018  1.00 0.00 ? 173 PRO A N    5  
ATOM 9772  C CA   . PRO A 1 122 ? 8.906   -22.360 -6.356  1.00 0.00 ? 173 PRO A CA   5  
ATOM 9773  C C    . PRO A 1 122 ? 9.093   -21.859 -4.918  1.00 0.00 ? 173 PRO A C    5  
ATOM 9774  O O    . PRO A 1 122 ? 9.325   -20.686 -4.695  1.00 0.00 ? 173 PRO A O    5  
ATOM 9775  C CB   . PRO A 1 122 ? 10.122  -22.018 -7.232  1.00 0.00 ? 173 PRO A CB   5  
ATOM 9776  C CG   . PRO A 1 122 ? 9.557   -21.805 -8.597  1.00 0.00 ? 173 PRO A CG   5  
ATOM 9777  C CD   . PRO A 1 122 ? 8.141   -21.235 -8.393  1.00 0.00 ? 173 PRO A CD   5  
ATOM 9778  H HA   . PRO A 1 122 ? 8.729   -23.424 -6.368  1.00 0.00 ? 173 PRO A HA   5  
ATOM 9779  H HB2  . PRO A 1 122 ? 10.601  -21.110 -6.877  1.00 0.00 ? 173 PRO A HB2  5  
ATOM 9780  H HB3  . PRO A 1 122 ? 10.830  -22.840 -7.239  1.00 0.00 ? 173 PRO A HB3  5  
ATOM 9781  H HG2  . PRO A 1 122 ? 10.173  -21.099 -9.144  1.00 0.00 ? 173 PRO A HG2  5  
ATOM 9782  H HG3  . PRO A 1 122 ? 9.501   -22.736 -9.133  1.00 0.00 ? 173 PRO A HG3  5  
ATOM 9783  H HD2  . PRO A 1 122 ? 8.150   -20.154 -8.478  1.00 0.00 ? 173 PRO A HD2  5  
ATOM 9784  H HD3  . PRO A 1 122 ? 7.446   -21.669 -9.097  1.00 0.00 ? 173 PRO A HD3  5  
ATOM 9785  N N    . ARG A 1 123 ? 8.962   -22.731 -3.944  1.00 0.00 ? 174 ARG A N    5  
ATOM 9786  C CA   . ARG A 1 123 ? 9.118   -22.303 -2.516  1.00 0.00 ? 174 ARG A CA   5  
ATOM 9787  C C    . ARG A 1 123 ? 10.567  -22.552 -2.068  1.00 0.00 ? 174 ARG A C    5  
ATOM 9788  O O    . ARG A 1 123 ? 10.902  -22.436 -0.909  1.00 0.00 ? 174 ARG A O    5  
ATOM 9789  C CB   . ARG A 1 123 ? 8.131   -23.086 -1.631  1.00 0.00 ? 174 ARG A CB   5  
ATOM 9790  C CG   . ARG A 1 123 ? 8.510   -24.592 -1.578  1.00 0.00 ? 174 ARG A CG   5  
ATOM 9791  C CD   . ARG A 1 123 ? 9.164   -24.961 -0.238  1.00 0.00 ? 174 ARG A CD   5  
ATOM 9792  N NE   . ARG A 1 123 ? 10.195  -26.017 -0.472  1.00 0.00 ? 174 ARG A NE   5  
ATOM 9793  C CZ   . ARG A 1 123 ? 9.908   -27.125 -1.109  1.00 0.00 ? 174 ARG A CZ   5  
ATOM 9794  N NH1  . ARG A 1 123 ? 8.676   -27.424 -1.408  1.00 0.00 ? 174 ARG A NH1  5  
ATOM 9795  N NH2  . ARG A 1 123 ? 10.864  -27.954 -1.399  1.00 0.00 ? 174 ARG A NH2  5  
ATOM 9796  H H    . ARG A 1 123 ? 8.752   -23.667 -4.152  1.00 0.00 ? 174 ARG A H    5  
ATOM 9797  H HA   . ARG A 1 123 ? 8.897   -21.244 -2.431  1.00 0.00 ? 174 ARG A HA   5  
ATOM 9798  H HB2  . ARG A 1 123 ? 8.124   -22.662 -0.636  1.00 0.00 ? 174 ARG A HB2  5  
ATOM 9799  H HB3  . ARG A 1 123 ? 7.146   -22.984 -2.051  1.00 0.00 ? 174 ARG A HB3  5  
ATOM 9800  H HG2  . ARG A 1 123 ? 7.614   -25.184 -1.700  1.00 0.00 ? 174 ARG A HG2  5  
ATOM 9801  H HG3  . ARG A 1 123 ? 9.194   -24.826 -2.381  1.00 0.00 ? 174 ARG A HG3  5  
ATOM 9802  H HD2  . ARG A 1 123 ? 9.665   -24.107 0.180   1.00 0.00 ? 174 ARG A HD2  5  
ATOM 9803  H HD3  . ARG A 1 123 ? 8.396   -25.300 0.454   1.00 0.00 ? 174 ARG A HD3  5  
ATOM 9804  H HE   . ARG A 1 123 ? 11.115  -25.860 -0.181  1.00 0.00 ? 174 ARG A HE   5  
ATOM 9805  H HH11 . ARG A 1 123 ? 7.940   -26.809 -1.148  1.00 0.00 ? 174 ARG A HH11 5  
ATOM 9806  H HH12 . ARG A 1 123 ? 8.468   -28.276 -1.893  1.00 0.00 ? 174 ARG A HH12 5  
ATOM 9807  H HH21 . ARG A 1 123 ? 11.802  -27.734 -1.143  1.00 0.00 ? 174 ARG A HH21 5  
ATOM 9808  H HH22 . ARG A 1 123 ? 10.659  -28.815 -1.859  1.00 0.00 ? 174 ARG A HH22 5  
ATOM 9809  N N    . GLU A 1 124 ? 11.435  -22.874 -2.995  1.00 0.00 ? 175 GLU A N    5  
ATOM 9810  C CA   . GLU A 1 124 ? 12.866  -23.116 -2.643  1.00 0.00 ? 175 GLU A CA   5  
ATOM 9811  C C    . GLU A 1 124 ? 13.534  -21.809 -2.175  1.00 0.00 ? 175 GLU A C    5  
ATOM 9812  O O    . GLU A 1 124 ? 14.413  -21.834 -1.328  1.00 0.00 ? 175 GLU A O    5  
ATOM 9813  C CB   . GLU A 1 124 ? 13.636  -23.686 -3.850  1.00 0.00 ? 175 GLU A CB   5  
ATOM 9814  C CG   . GLU A 1 124 ? 12.902  -24.910 -4.407  1.00 0.00 ? 175 GLU A CG   5  
ATOM 9815  C CD   . GLU A 1 124 ? 13.475  -25.258 -5.782  1.00 0.00 ? 175 GLU A CD   5  
ATOM 9816  O OE1  . GLU A 1 124 ? 12.973  -24.732 -6.763  1.00 0.00 ? 175 GLU A OE1  5  
ATOM 9817  O OE2  . GLU A 1 124 ? 14.413  -26.041 -5.828  1.00 0.00 ? 175 GLU A OE2  5  
ATOM 9818  H H    . GLU A 1 124 ? 11.150  -22.941 -3.924  1.00 0.00 ? 175 GLU A H    5  
ATOM 9819  H HA   . GLU A 1 124 ? 12.905  -23.835 -1.836  1.00 0.00 ? 175 GLU A HA   5  
ATOM 9820  H HB2  . GLU A 1 124 ? 13.727  -22.932 -4.628  1.00 0.00 ? 175 GLU A HB2  5  
ATOM 9821  H HB3  . GLU A 1 124 ? 14.626  -23.983 -3.526  1.00 0.00 ? 175 GLU A HB3  5  
ATOM 9822  H HG2  . GLU A 1 124 ? 13.046  -25.746 -3.739  1.00 0.00 ? 175 GLU A HG2  5  
ATOM 9823  H HG3  . GLU A 1 124 ? 11.851  -24.698 -4.496  1.00 0.00 ? 175 GLU A HG3  5  
ATOM 9824  N N    . PRO A 1 125 ? 13.148  -20.668 -2.720  1.00 0.00 ? 176 PRO A N    5  
ATOM 9825  C CA   . PRO A 1 125 ? 13.751  -19.357 -2.326  1.00 0.00 ? 176 PRO A CA   5  
ATOM 9826  C C    . PRO A 1 125 ? 13.691  -19.075 -0.809  1.00 0.00 ? 176 PRO A C    5  
ATOM 9827  O O    . PRO A 1 125 ? 14.600  -18.514 -0.232  1.00 0.00 ? 176 PRO A O    5  
ATOM 9828  C CB   . PRO A 1 125 ? 12.919  -18.331 -3.109  1.00 0.00 ? 176 PRO A CB   5  
ATOM 9829  C CG   . PRO A 1 125 ? 12.439  -19.089 -4.295  1.00 0.00 ? 176 PRO A CG   5  
ATOM 9830  C CD   . PRO A 1 125 ? 12.122  -20.475 -3.766  1.00 0.00 ? 176 PRO A CD   5  
ATOM 9831  H HA   . PRO A 1 125 ? 14.765  -19.320 -2.670  1.00 0.00 ? 176 PRO A HA   5  
ATOM 9832  H HB2  . PRO A 1 125 ? 12.084  -17.984 -2.513  1.00 0.00 ? 176 PRO A HB2  5  
ATOM 9833  H HB3  . PRO A 1 125 ? 13.536  -17.500 -3.421  1.00 0.00 ? 176 PRO A HB3  5  
ATOM 9834  H HG2  . PRO A 1 125 ? 11.552  -18.624 -4.714  1.00 0.00 ? 176 PRO A HG2  5  
ATOM 9835  H HG3  . PRO A 1 125 ? 13.214  -19.154 -5.038  1.00 0.00 ? 176 PRO A HG3  5  
ATOM 9836  H HD2  . PRO A 1 125 ? 11.132  -20.482 -3.345  1.00 0.00 ? 176 PRO A HD2  5  
ATOM 9837  H HD3  . PRO A 1 125 ? 12.222  -21.214 -4.545  1.00 0.00 ? 176 PRO A HD3  5  
ATOM 9838  N N    . ARG A 1 126 ? 12.627  -19.434 -0.157  1.00 0.00 ? 177 ARG A N    5  
ATOM 9839  C CA   . ARG A 1 126 ? 12.534  -19.147 1.304   1.00 0.00 ? 177 ARG A CA   5  
ATOM 9840  C C    . ARG A 1 126 ? 13.670  -19.867 2.011   1.00 0.00 ? 177 ARG A C    5  
ATOM 9841  O O    . ARG A 1 126 ? 14.168  -19.428 3.022   1.00 0.00 ? 177 ARG A O    5  
ATOM 9842  C CB   . ARG A 1 126 ? 11.227  -19.709 1.841   1.00 0.00 ? 177 ARG A CB   5  
ATOM 9843  C CG   . ARG A 1 126 ? 10.103  -19.241 0.948   1.00 0.00 ? 177 ARG A CG   5  
ATOM 9844  C CD   . ARG A 1 126 ? 8.763   -19.591 1.585   1.00 0.00 ? 177 ARG A CD   5  
ATOM 9845  N NE   . ARG A 1 126 ? 8.649   -21.080 1.689   1.00 0.00 ? 177 ARG A NE   5  
ATOM 9846  C CZ   . ARG A 1 126 ? 7.684   -21.628 2.379   1.00 0.00 ? 177 ARG A CZ   5  
ATOM 9847  N NH1  . ARG A 1 126 ? 6.843   -20.874 3.026   1.00 0.00 ? 177 ARG A NH1  5  
ATOM 9848  N NH2  . ARG A 1 126 ? 7.587   -22.925 2.418   1.00 0.00 ? 177 ARG A NH2  5  
ATOM 9849  H H    . ARG A 1 126 ? 11.890  -19.871 -0.623  1.00 0.00 ? 177 ARG A H    5  
ATOM 9850  H HA   . ARG A 1 126 ? 12.589  -18.082 1.480   1.00 0.00 ? 177 ARG A HA   5  
ATOM 9851  H HB2  . ARG A 1 126 ? 11.268  -20.788 1.853   1.00 0.00 ? 177 ARG A HB2  5  
ATOM 9852  H HB3  . ARG A 1 126 ? 11.057  -19.340 2.834   1.00 0.00 ? 177 ARG A HB3  5  
ATOM 9853  H HG2  . ARG A 1 126 ? 10.173  -18.173 0.818   1.00 0.00 ? 177 ARG A HG2  5  
ATOM 9854  H HG3  . ARG A 1 126 ? 10.200  -19.737 -0.006  1.00 0.00 ? 177 ARG A HG3  5  
ATOM 9855  H HD2  . ARG A 1 126 ? 8.709   -19.154 2.573   1.00 0.00 ? 177 ARG A HD2  5  
ATOM 9856  H HD3  . ARG A 1 126 ? 7.962   -19.193 0.975   1.00 0.00 ? 177 ARG A HD3  5  
ATOM 9857  H HE   . ARG A 1 126 ? 9.302   -21.649 1.231   1.00 0.00 ? 177 ARG A HE   5  
ATOM 9858  H HH11 . ARG A 1 126 ? 6.950   -19.889 2.992   1.00 0.00 ? 177 ARG A HH11 5  
ATOM 9859  H HH12 . ARG A 1 126 ? 6.097   -21.282 3.550   1.00 0.00 ? 177 ARG A HH12 5  
ATOM 9860  H HH21 . ARG A 1 126 ? 8.251   -23.477 1.916   1.00 0.00 ? 177 ARG A HH21 5  
ATOM 9861  H HH22 . ARG A 1 126 ? 6.863   -23.371 2.958   1.00 0.00 ? 177 ARG A HH22 5  
ATOM 9862  N N    . ARG A 1 127 ? 14.059  -20.981 1.469   1.00 0.00 ? 178 ARG A N    5  
ATOM 9863  C CA   . ARG A 1 127 ? 15.154  -21.799 2.059   1.00 0.00 ? 178 ARG A CA   5  
ATOM 9864  C C    . ARG A 1 127 ? 16.503  -21.260 1.568   1.00 0.00 ? 178 ARG A C    5  
ATOM 9865  O O    . ARG A 1 127 ? 17.405  -21.006 2.342   1.00 0.00 ? 178 ARG A O    5  
ATOM 9866  C CB   . ARG A 1 127 ? 14.976  -23.259 1.606   1.00 0.00 ? 178 ARG A CB   5  
ATOM 9867  C CG   . ARG A 1 127 ? 13.636  -23.828 2.142   1.00 0.00 ? 178 ARG A CG   5  
ATOM 9868  C CD   . ARG A 1 127 ? 12.492  -23.572 1.133   1.00 0.00 ? 178 ARG A CD   5  
ATOM 9869  N NE   . ARG A 1 127 ? 11.207  -23.348 1.867   1.00 0.00 ? 178 ARG A NE   5  
ATOM 9870  C CZ   . ARG A 1 127 ? 10.830  -24.154 2.813   1.00 0.00 ? 178 ARG A CZ   5  
ATOM 9871  N NH1  . ARG A 1 127 ? 11.437  -25.293 2.987   1.00 0.00 ? 178 ARG A NH1  5  
ATOM 9872  N NH2  . ARG A 1 127 ? 9.786   -23.856 3.542   1.00 0.00 ? 178 ARG A NH2  5  
ATOM 9873  H H    . ARG A 1 127 ? 13.616  -21.287 0.655   1.00 0.00 ? 178 ARG A H    5  
ATOM 9874  H HA   . ARG A 1 127 ? 15.116  -21.750 3.137   1.00 0.00 ? 178 ARG A HA   5  
ATOM 9875  H HB2  . ARG A 1 127 ? 14.988  -23.307 0.525   1.00 0.00 ? 178 ARG A HB2  5  
ATOM 9876  H HB3  . ARG A 1 127 ? 15.795  -23.851 1.999   1.00 0.00 ? 178 ARG A HB3  5  
ATOM 9877  H HG2  . ARG A 1 127 ? 13.741  -24.891 2.292   1.00 0.00 ? 178 ARG A HG2  5  
ATOM 9878  H HG3  . ARG A 1 127 ? 13.393  -23.368 3.086   1.00 0.00 ? 178 ARG A HG3  5  
ATOM 9879  H HD2  . ARG A 1 127 ? 12.697  -22.691 0.553   1.00 0.00 ? 178 ARG A HD2  5  
ATOM 9880  H HD3  . ARG A 1 127 ? 12.406  -24.422 0.462   1.00 0.00 ? 178 ARG A HD3  5  
ATOM 9881  H HE   . ARG A 1 127 ? 10.672  -22.556 1.669   1.00 0.00 ? 178 ARG A HE   5  
ATOM 9882  H HH11 . ARG A 1 127 ? 12.187  -25.562 2.384   1.00 0.00 ? 178 ARG A HH11 5  
ATOM 9883  H HH12 . ARG A 1 127 ? 11.158  -25.892 3.729   1.00 0.00 ? 178 ARG A HH12 5  
ATOM 9884  H HH21 . ARG A 1 127 ? 9.282   -23.006 3.376   1.00 0.00 ? 178 ARG A HH21 5  
ATOM 9885  H HH22 . ARG A 1 127 ? 9.482   -24.478 4.262   1.00 0.00 ? 178 ARG A HH22 5  
ATOM 9886  N N    . VAL A 1 1   ? 15.869  0.305   19.285  1.00 0.00 ? 52  VAL A N    6  
ATOM 9887  C CA   . VAL A 1 1   ? 16.021  1.525   20.128  1.00 0.00 ? 52  VAL A CA   6  
ATOM 9888  C C    . VAL A 1 1   ? 14.631  2.029   20.533  1.00 0.00 ? 52  VAL A C    6  
ATOM 9889  O O    . VAL A 1 1   ? 13.812  2.376   19.702  1.00 0.00 ? 52  VAL A O    6  
ATOM 9890  C CB   . VAL A 1 1   ? 16.790  2.599   19.339  1.00 0.00 ? 52  VAL A CB   6  
ATOM 9891  C CG1  . VAL A 1 1   ? 17.411  3.618   20.309  1.00 0.00 ? 52  VAL A CG1  6  
ATOM 9892  C CG2  . VAL A 1 1   ? 17.893  1.920   18.523  1.00 0.00 ? 52  VAL A CG2  6  
ATOM 9893  H H    . VAL A 1 1   ? 15.703  0.396   18.322  1.00 0.00 ? 52  VAL A H    6  
ATOM 9894  H HA   . VAL A 1 1   ? 16.575  1.272   21.020  1.00 0.00 ? 52  VAL A HA   6  
ATOM 9895  H HB   . VAL A 1 1   ? 16.123  3.103   18.666  1.00 0.00 ? 52  VAL A HB   6  
ATOM 9896  H HG11 . VAL A 1 1   ? 18.088  3.114   20.982  1.00 0.00 ? 52  VAL A HG11 6  
ATOM 9897  H HG12 . VAL A 1 1   ? 17.957  4.364   19.750  1.00 0.00 ? 52  VAL A HG12 6  
ATOM 9898  H HG13 . VAL A 1 1   ? 16.622  4.097   20.880  1.00 0.00 ? 52  VAL A HG13 6  
ATOM 9899  H HG21 . VAL A 1 1   ? 18.396  1.183   19.132  1.00 0.00 ? 52  VAL A HG21 6  
ATOM 9900  H HG22 . VAL A 1 1   ? 17.453  1.437   17.666  1.00 0.00 ? 52  VAL A HG22 6  
ATOM 9901  H HG23 . VAL A 1 1   ? 18.603  2.660   18.190  1.00 0.00 ? 52  VAL A HG23 6  
ATOM 9902  N N    . GLU A 1 2   ? 14.347  2.033   21.814  1.00 0.00 ? 53  GLU A N    6  
ATOM 9903  C CA   . GLU A 1 2   ? 13.007  2.485   22.312  1.00 0.00 ? 53  GLU A CA   6  
ATOM 9904  C C    . GLU A 1 2   ? 13.029  3.995   22.605  1.00 0.00 ? 53  GLU A C    6  
ATOM 9905  O O    . GLU A 1 2   ? 12.023  4.596   22.937  1.00 0.00 ? 53  GLU A O    6  
ATOM 9906  C CB   . GLU A 1 2   ? 12.675  1.701   23.590  1.00 0.00 ? 53  GLU A CB   6  
ATOM 9907  C CG   . GLU A 1 2   ? 11.208  1.905   23.971  1.00 0.00 ? 53  GLU A CG   6  
ATOM 9908  C CD   . GLU A 1 2   ? 10.892  1.079   25.217  1.00 0.00 ? 53  GLU A CD   6  
ATOM 9909  O OE1  . GLU A 1 2   ? 11.648  0.167   25.504  1.00 0.00 ? 53  GLU A OE1  6  
ATOM 9910  O OE2  . GLU A 1 2   ? 9.901   1.375   25.864  1.00 0.00 ? 53  GLU A OE2  6  
ATOM 9911  H H    . GLU A 1 2   ? 15.021  1.724   22.455  1.00 0.00 ? 53  GLU A H    6  
ATOM 9912  H HA   . GLU A 1 2   ? 12.256  2.278   21.566  1.00 0.00 ? 53  GLU A HA   6  
ATOM 9913  H HB2  . GLU A 1 2   ? 12.855  0.649   23.421  1.00 0.00 ? 53  GLU A HB2  6  
ATOM 9914  H HB3  . GLU A 1 2   ? 13.305  2.046   24.400  1.00 0.00 ? 53  GLU A HB3  6  
ATOM 9915  H HG2  . GLU A 1 2   ? 11.027  2.948   24.181  1.00 0.00 ? 53  GLU A HG2  6  
ATOM 9916  H HG3  . GLU A 1 2   ? 10.575  1.581   23.158  1.00 0.00 ? 53  GLU A HG3  6  
ATOM 9917  N N    . VAL A 1 3   ? 14.173  4.608   22.495  1.00 0.00 ? 54  VAL A N    6  
ATOM 9918  C CA   . VAL A 1 3   ? 14.282  6.071   22.777  1.00 0.00 ? 54  VAL A CA   6  
ATOM 9919  C C    . VAL A 1 3   ? 13.400  6.874   21.815  1.00 0.00 ? 54  VAL A C    6  
ATOM 9920  O O    . VAL A 1 3   ? 12.701  7.787   22.203  1.00 0.00 ? 54  VAL A O    6  
ATOM 9921  C CB   . VAL A 1 3   ? 15.730  6.498   22.529  1.00 0.00 ? 54  VAL A CB   6  
ATOM 9922  C CG1  . VAL A 1 3   ? 15.861  8.014   22.745  1.00 0.00 ? 54  VAL A CG1  6  
ATOM 9923  C CG2  . VAL A 1 3   ? 16.668  5.753   23.490  1.00 0.00 ? 54  VAL A CG2  6  
ATOM 9924  H H    . VAL A 1 3   ? 14.970  4.104   22.237  1.00 0.00 ? 54  VAL A H    6  
ATOM 9925  H HA   . VAL A 1 3   ? 14.011  6.280   23.802  1.00 0.00 ? 54  VAL A HA   6  
ATOM 9926  H HB   . VAL A 1 3   ? 15.988  6.253   21.493  1.00 0.00 ? 54  VAL A HB   6  
ATOM 9927  H HG11 . VAL A 1 3   ? 15.264  8.314   23.594  1.00 0.00 ? 54  VAL A HG11 6  
ATOM 9928  H HG12 . VAL A 1 3   ? 16.894  8.270   22.926  1.00 0.00 ? 54  VAL A HG12 6  
ATOM 9929  H HG13 . VAL A 1 3   ? 15.513  8.528   21.861  1.00 0.00 ? 54  VAL A HG13 6  
ATOM 9930  H HG21 . VAL A 1 3   ? 16.521  4.692   23.385  1.00 0.00 ? 54  VAL A HG21 6  
ATOM 9931  H HG22 . VAL A 1 3   ? 17.694  6.000   23.255  1.00 0.00 ? 54  VAL A HG22 6  
ATOM 9932  H HG23 . VAL A 1 3   ? 16.452  6.047   24.505  1.00 0.00 ? 54  VAL A HG23 6  
ATOM 9933  N N    . LEU A 1 4   ? 13.463  6.538   20.559  1.00 0.00 ? 55  LEU A N    6  
ATOM 9934  C CA   . LEU A 1 4   ? 12.677  7.263   19.514  1.00 0.00 ? 55  LEU A CA   6  
ATOM 9935  C C    . LEU A 1 4   ? 11.263  6.664   19.435  1.00 0.00 ? 55  LEU A C    6  
ATOM 9936  O O    . LEU A 1 4   ? 10.525  6.918   18.504  1.00 0.00 ? 55  LEU A O    6  
ATOM 9937  C CB   . LEU A 1 4   ? 13.389  7.166   18.127  1.00 0.00 ? 55  LEU A CB   6  
ATOM 9938  C CG   . LEU A 1 4   ? 14.552  6.151   18.143  1.00 0.00 ? 55  LEU A CG   6  
ATOM 9939  C CD1  . LEU A 1 4   ? 15.761  6.705   18.898  1.00 0.00 ? 55  LEU A CD1  6  
ATOM 9940  C CD2  . LEU A 1 4   ? 14.090  4.770   18.674  1.00 0.00 ? 55  LEU A CD2  6  
ATOM 9941  H H    . LEU A 1 4   ? 14.054  5.825   20.302  1.00 0.00 ? 55  LEU A H    6  
ATOM 9942  H HA   . LEU A 1 4   ? 12.598  8.305   19.798  1.00 0.00 ? 55  LEU A HA   6  
ATOM 9943  H HB2  . LEU A 1 4   ? 12.678  6.858   17.370  1.00 0.00 ? 55  LEU A HB2  6  
ATOM 9944  H HB3  . LEU A 1 4   ? 13.783  8.140   17.855  1.00 0.00 ? 55  LEU A HB3  6  
ATOM 9945  H HG   . LEU A 1 4   ? 14.880  6.016   17.154  1.00 0.00 ? 55  LEU A HG   6  
ATOM 9946  H HD11 . LEU A 1 4   ? 15.444  7.394   19.662  1.00 0.00 ? 55  LEU A HD11 6  
ATOM 9947  H HD12 . LEU A 1 4   ? 16.314  5.891   19.333  1.00 0.00 ? 55  LEU A HD12 6  
ATOM 9948  H HD13 . LEU A 1 4   ? 16.400  7.225   18.200  1.00 0.00 ? 55  LEU A HD13 6  
ATOM 9949  H HD21 . LEU A 1 4   ? 13.047  4.798   18.961  1.00 0.00 ? 55  LEU A HD21 6  
ATOM 9950  H HD22 . LEU A 1 4   ? 14.214  4.037   17.890  1.00 0.00 ? 55  LEU A HD22 6  
ATOM 9951  H HD23 . LEU A 1 4   ? 14.687  4.486   19.526  1.00 0.00 ? 55  LEU A HD23 6  
ATOM 9952  N N    . ALA A 1 5   ? 10.881  5.879   20.409  1.00 0.00 ? 56  ALA A N    6  
ATOM 9953  C CA   . ALA A 1 5   ? 9.515   5.279   20.403  1.00 0.00 ? 56  ALA A CA   6  
ATOM 9954  C C    . ALA A 1 5   ? 8.556   6.244   21.091  1.00 0.00 ? 56  ALA A C    6  
ATOM 9955  O O    . ALA A 1 5   ? 7.439   5.897   21.411  1.00 0.00 ? 56  ALA A O    6  
ATOM 9956  C CB   . ALA A 1 5   ? 9.521   3.948   21.156  1.00 0.00 ? 56  ALA A CB   6  
ATOM 9957  H H    . ALA A 1 5   ? 11.490  5.694   21.154  1.00 0.00 ? 56  ALA A H    6  
ATOM 9958  H HA   . ALA A 1 5   ? 9.195   5.113   19.383  1.00 0.00 ? 56  ALA A HA   6  
ATOM 9959  H HB1  . ALA A 1 5   ? 10.282  3.304   20.742  1.00 0.00 ? 56  ALA A HB1  6  
ATOM 9960  H HB2  . ALA A 1 5   ? 9.722   4.125   22.202  1.00 0.00 ? 56  ALA A HB2  6  
ATOM 9961  H HB3  . ALA A 1 5   ? 8.556   3.475   21.051  1.00 0.00 ? 56  ALA A HB3  6  
ATOM 9962  N N    . ASP A 1 6   ? 8.990   7.452   21.335  1.00 0.00 ? 57  ASP A N    6  
ATOM 9963  C CA   . ASP A 1 6   ? 8.098   8.435   22.017  1.00 0.00 ? 57  ASP A CA   6  
ATOM 9964  C C    . ASP A 1 6   ? 7.168   9.110   20.996  1.00 0.00 ? 57  ASP A C    6  
ATOM 9965  O O    . ASP A 1 6   ? 6.302   8.478   20.424  1.00 0.00 ? 57  ASP A O    6  
ATOM 9966  C CB   . ASP A 1 6   ? 8.937   9.500   22.720  1.00 0.00 ? 57  ASP A CB   6  
ATOM 9967  C CG   . ASP A 1 6   ? 8.008   10.406  23.527  1.00 0.00 ? 57  ASP A CG   6  
ATOM 9968  O OD1  . ASP A 1 6   ? 6.804   10.211  23.439  1.00 0.00 ? 57  ASP A OD1  6  
ATOM 9969  O OD2  . ASP A 1 6   ? 8.509   11.273  24.220  1.00 0.00 ? 57  ASP A OD2  6  
ATOM 9970  H H    . ASP A 1 6   ? 9.904   7.707   21.077  1.00 0.00 ? 57  ASP A H    6  
ATOM 9971  H HA   . ASP A 1 6   ? 7.499   7.917   22.751  1.00 0.00 ? 57  ASP A HA   6  
ATOM 9972  H HB2  . ASP A 1 6   ? 9.647   9.028   23.382  1.00 0.00 ? 57  ASP A HB2  6  
ATOM 9973  H HB3  . ASP A 1 6   ? 9.464   10.091  21.984  1.00 0.00 ? 57  ASP A HB3  6  
ATOM 9974  N N    . HIS A 1 7   ? 7.327   10.394  20.772  1.00 0.00 ? 58  HIS A N    6  
ATOM 9975  C CA   . HIS A 1 7   ? 6.427   11.098  19.803  1.00 0.00 ? 58  HIS A CA   6  
ATOM 9976  C C    . HIS A 1 7   ? 6.349   10.334  18.466  1.00 0.00 ? 58  HIS A C    6  
ATOM 9977  O O    . HIS A 1 7   ? 5.270   10.115  17.958  1.00 0.00 ? 58  HIS A O    6  
ATOM 9978  C CB   . HIS A 1 7   ? 6.927   12.551  19.563  1.00 0.00 ? 58  HIS A CB   6  
ATOM 9979  C CG   . HIS A 1 7   ? 5.970   13.556  20.161  1.00 0.00 ? 58  HIS A CG   6  
ATOM 9980  N ND1  . HIS A 1 7   ? 4.776   13.903  19.545  1.00 0.00 ? 58  HIS A ND1  6  
ATOM 9981  C CD2  . HIS A 1 7   ? 6.032   14.308  21.308  1.00 0.00 ? 58  HIS A CD2  6  
ATOM 9982  C CE1  . HIS A 1 7   ? 4.173   14.825  20.319  1.00 0.00 ? 58  HIS A CE1  6  
ATOM 9983  N NE2  . HIS A 1 7   ? 4.897   15.109  21.406  1.00 0.00 ? 58  HIS A NE2  6  
ATOM 9984  H H    . HIS A 1 7   ? 8.020   10.896  21.251  1.00 0.00 ? 58  HIS A H    6  
ATOM 9985  H HA   . HIS A 1 7   ? 5.433   11.127  20.233  1.00 0.00 ? 58  HIS A HA   6  
ATOM 9986  H HB2  . HIS A 1 7   ? 7.896   12.674  20.024  1.00 0.00 ? 58  HIS A HB2  6  
ATOM 9987  H HB3  . HIS A 1 7   ? 7.014   12.742  18.500  1.00 0.00 ? 58  HIS A HB3  6  
ATOM 9988  H HD1  . HIS A 1 7   ? 4.429   13.537  18.705  1.00 0.00 ? 58  HIS A HD1  6  
ATOM 9989  H HD2  . HIS A 1 7   ? 6.836   14.273  22.031  1.00 0.00 ? 58  HIS A HD2  6  
ATOM 9990  H HE1  . HIS A 1 7   ? 3.223   15.279  20.090  1.00 0.00 ? 58  HIS A HE1  6  
ATOM 9991  N N    . PRO A 1 8   ? 7.461   9.946   17.885  1.00 0.00 ? 59  PRO A N    6  
ATOM 9992  C CA   . PRO A 1 8   ? 7.462   9.220   16.577  1.00 0.00 ? 59  PRO A CA   6  
ATOM 9993  C C    . PRO A 1 8   ? 6.467   8.053   16.558  1.00 0.00 ? 59  PRO A C    6  
ATOM 9994  O O    . PRO A 1 8   ? 5.713   7.854   17.488  1.00 0.00 ? 59  PRO A O    6  
ATOM 9995  C CB   . PRO A 1 8   ? 8.906   8.718   16.440  1.00 0.00 ? 59  PRO A CB   6  
ATOM 9996  C CG   . PRO A 1 8   ? 9.719   9.697   17.225  1.00 0.00 ? 59  PRO A CG   6  
ATOM 9997  C CD   . PRO A 1 8   ? 8.833   10.142  18.397  1.00 0.00 ? 59  PRO A CD   6  
ATOM 9998  H HA   . PRO A 1 8   ? 7.245   9.906   15.773  1.00 0.00 ? 59  PRO A HA   6  
ATOM 9999  H HB2  . PRO A 1 8   ? 9.004   7.723   16.856  1.00 0.00 ? 59  PRO A HB2  6  
ATOM 10000 H HB3  . PRO A 1 8   ? 9.216   8.723   15.405  1.00 0.00 ? 59  PRO A HB3  6  
ATOM 10001 H HG2  . PRO A 1 8   ? 10.626  9.223   17.591  1.00 0.00 ? 59  PRO A HG2  6  
ATOM 10002 H HG3  . PRO A 1 8   ? 9.967   10.549  16.613  1.00 0.00 ? 59  PRO A HG3  6  
ATOM 10003 H HD2  . PRO A 1 8   ? 9.019   9.514   19.261  1.00 0.00 ? 59  PRO A HD2  6  
ATOM 10004 H HD3  . PRO A 1 8   ? 9.003   11.177  18.635  1.00 0.00 ? 59  PRO A HD3  6  
ATOM 10005 N N    . GLY A 1 9   ? 6.461   7.280   15.506  1.00 0.00 ? 60  GLY A N    6  
ATOM 10006 C CA   . GLY A 1 9   ? 5.518   6.129   15.427  1.00 0.00 ? 60  GLY A CA   6  
ATOM 10007 C C    . GLY A 1 9   ? 5.958   5.203   14.290  1.00 0.00 ? 60  GLY A C    6  
ATOM 10008 O O    . GLY A 1 9   ? 7.133   5.073   14.012  1.00 0.00 ? 60  GLY A O    6  
ATOM 10009 H H    . GLY A 1 9   ? 7.078   7.458   14.765  1.00 0.00 ? 60  GLY A H    6  
ATOM 10010 H HA2  . GLY A 1 9   ? 5.530   5.590   16.363  1.00 0.00 ? 60  GLY A HA2  6  
ATOM 10011 H HA3  . GLY A 1 9   ? 4.518   6.489   15.234  1.00 0.00 ? 60  GLY A HA3  6  
ATOM 10012 N N    . GLU A 1 10  ? 5.027   4.558   13.633  1.00 0.00 ? 61  GLU A N    6  
ATOM 10013 C CA   . GLU A 1 10  ? 5.382   3.630   12.505  1.00 0.00 ? 61  GLU A CA   6  
ATOM 10014 C C    . GLU A 1 10  ? 4.767   4.141   11.198  1.00 0.00 ? 61  GLU A C    6  
ATOM 10015 O O    . GLU A 1 10  ? 3.851   3.541   10.689  1.00 0.00 ? 61  GLU A O    6  
ATOM 10016 C CB   . GLU A 1 10  ? 4.792   2.242   12.798  1.00 0.00 ? 61  GLU A CB   6  
ATOM 10017 C CG   . GLU A 1 10  ? 5.373   1.693   14.104  1.00 0.00 ? 61  GLU A CG   6  
ATOM 10018 C CD   . GLU A 1 10  ? 4.804   0.302   14.393  1.00 0.00 ? 61  GLU A CD   6  
ATOM 10019 O OE1  . GLU A 1 10  ? 4.623   -0.449  13.452  1.00 0.00 ? 61  GLU A OE1  6  
ATOM 10020 O OE2  . GLU A 1 10  ? 4.569   0.006   15.554  1.00 0.00 ? 61  GLU A OE2  6  
ATOM 10021 H H    . GLU A 1 10  ? 4.088   4.681   13.881  1.00 0.00 ? 61  GLU A H    6  
ATOM 10022 H HA   . GLU A 1 10  ? 6.455   3.549   12.400  1.00 0.00 ? 61  GLU A HA   6  
ATOM 10023 H HB2  . GLU A 1 10  ? 3.717   2.332   12.890  1.00 0.00 ? 61  GLU A HB2  6  
ATOM 10024 H HB3  . GLU A 1 10  ? 5.026   1.568   11.987  1.00 0.00 ? 61  GLU A HB3  6  
ATOM 10025 H HG2  . GLU A 1 10  ? 6.445   1.627   14.019  1.00 0.00 ? 61  GLU A HG2  6  
ATOM 10026 H HG3  . GLU A 1 10  ? 5.117   2.356   14.915  1.00 0.00 ? 61  GLU A HG3  6  
ATOM 10027 N N    . LEU A 1 11  ? 5.244   5.238   10.644  1.00 0.00 ? 62  LEU A N    6  
ATOM 10028 C CA   . LEU A 1 11  ? 4.646   5.760   9.362   1.00 0.00 ? 62  LEU A CA   6  
ATOM 10029 C C    . LEU A 1 11  ? 5.755   6.006   8.332   1.00 0.00 ? 62  LEU A C    6  
ATOM 10030 O O    . LEU A 1 11  ? 6.908   6.158   8.681   1.00 0.00 ? 62  LEU A O    6  
ATOM 10031 C CB   . LEU A 1 11  ? 3.915   7.090   9.632   1.00 0.00 ? 62  LEU A CB   6  
ATOM 10032 C CG   . LEU A 1 11  ? 2.864   6.912   10.760  1.00 0.00 ? 62  LEU A CG   6  
ATOM 10033 C CD1  . LEU A 1 11  ? 3.477   7.258   12.125  1.00 0.00 ? 62  LEU A CD1  6  
ATOM 10034 C CD2  . LEU A 1 11  ? 1.668   7.846   10.530  1.00 0.00 ? 62  LEU A CD2  6  
ATOM 10035 H H    . LEU A 1 11  ? 5.981   5.722   11.070  1.00 0.00 ? 62  LEU A H    6  
ATOM 10036 H HA   . LEU A 1 11  ? 3.944   5.047   8.958   1.00 0.00 ? 62  LEU A HA   6  
ATOM 10037 H HB2  . LEU A 1 11  ? 4.637   7.841   9.917   1.00 0.00 ? 62  LEU A HB2  6  
ATOM 10038 H HB3  . LEU A 1 11  ? 3.420   7.404   8.723   1.00 0.00 ? 62  LEU A HB3  6  
ATOM 10039 H HG   . LEU A 1 11  ? 2.518   5.889   10.776  1.00 0.00 ? 62  LEU A HG   6  
ATOM 10040 H HD11 . LEU A 1 11  ? 4.426   6.759   12.239  1.00 0.00 ? 62  LEU A HD11 6  
ATOM 10041 H HD12 . LEU A 1 11  ? 3.623   8.326   12.193  1.00 0.00 ? 62  LEU A HD12 6  
ATOM 10042 H HD13 . LEU A 1 11  ? 2.808   6.938   12.910  1.00 0.00 ? 62  LEU A HD13 6  
ATOM 10043 H HD21 . LEU A 1 11  ? 1.208   7.620   9.578   1.00 0.00 ? 62  LEU A HD21 6  
ATOM 10044 H HD22 . LEU A 1 11  ? 0.947   7.703   11.322  1.00 0.00 ? 62  LEU A HD22 6  
ATOM 10045 H HD23 . LEU A 1 11  ? 2.006   8.873   10.534  1.00 0.00 ? 62  LEU A HD23 6  
ATOM 10046 N N    . VAL A 1 12  ? 5.405   6.058   7.061   1.00 0.00 ? 63  VAL A N    6  
ATOM 10047 C CA   . VAL A 1 12  ? 6.427   6.318   5.989   1.00 0.00 ? 63  VAL A CA   6  
ATOM 10048 C C    . VAL A 1 12  ? 6.163   7.693   5.372   1.00 0.00 ? 63  VAL A C    6  
ATOM 10049 O O    . VAL A 1 12  ? 5.057   8.006   4.977   1.00 0.00 ? 63  VAL A O    6  
ATOM 10050 C CB   . VAL A 1 12  ? 6.324   5.244   4.895   1.00 0.00 ? 63  VAL A CB   6  
ATOM 10051 C CG1  . VAL A 1 12  ? 7.308   5.556   3.755   1.00 0.00 ? 63  VAL A CG1  6  
ATOM 10052 C CG2  . VAL A 1 12  ? 6.651   3.864   5.483   1.00 0.00 ? 63  VAL A CG2  6  
ATOM 10053 H H    . VAL A 1 12  ? 4.464   5.946   6.813   1.00 0.00 ? 63  VAL A H    6  
ATOM 10054 H HA   . VAL A 1 12  ? 7.422   6.305   6.416   1.00 0.00 ? 63  VAL A HA   6  
ATOM 10055 H HB   . VAL A 1 12  ? 5.320   5.234   4.503   1.00 0.00 ? 63  VAL A HB   6  
ATOM 10056 H HG11 . VAL A 1 12  ? 8.285   5.767   4.159   1.00 0.00 ? 63  VAL A HG11 6  
ATOM 10057 H HG12 . VAL A 1 12  ? 7.370   4.704   3.091   1.00 0.00 ? 63  VAL A HG12 6  
ATOM 10058 H HG13 . VAL A 1 12  ? 6.958   6.414   3.202   1.00 0.00 ? 63  VAL A HG13 6  
ATOM 10059 H HG21 . VAL A 1 12  ? 7.506   3.938   6.137   1.00 0.00 ? 63  VAL A HG21 6  
ATOM 10060 H HG22 . VAL A 1 12  ? 5.801   3.500   6.040   1.00 0.00 ? 63  VAL A HG22 6  
ATOM 10061 H HG23 . VAL A 1 12  ? 6.873   3.173   4.679   1.00 0.00 ? 63  VAL A HG23 6  
ATOM 10062 N N    . ARG A 1 13  ? 7.174   8.506   5.282   1.00 0.00 ? 64  ARG A N    6  
ATOM 10063 C CA   . ARG A 1 13  ? 7.003   9.861   4.694   1.00 0.00 ? 64  ARG A CA   6  
ATOM 10064 C C    . ARG A 1 13  ? 6.609   9.747   3.228   1.00 0.00 ? 64  ARG A C    6  
ATOM 10065 O O    . ARG A 1 13  ? 7.016   8.843   2.526   1.00 0.00 ? 64  ARG A O    6  
ATOM 10066 C CB   . ARG A 1 13  ? 8.310   10.649  4.819   1.00 0.00 ? 64  ARG A CB   6  
ATOM 10067 C CG   . ARG A 1 13  ? 8.553   10.994  6.292   1.00 0.00 ? 64  ARG A CG   6  
ATOM 10068 C CD   . ARG A 1 13  ? 9.747   11.933  6.398   1.00 0.00 ? 64  ARG A CD   6  
ATOM 10069 N NE   . ARG A 1 13  ? 9.457   13.167  5.625   1.00 0.00 ? 64  ARG A NE   6  
ATOM 10070 C CZ   . ARG A 1 13  ? 10.202  14.222  5.782   1.00 0.00 ? 64  ARG A CZ   6  
ATOM 10071 N NH1  . ARG A 1 13  ? 11.239  14.167  6.583   1.00 0.00 ? 64  ARG A NH1  6  
ATOM 10072 N NH2  . ARG A 1 13  ? 9.922   15.315  5.124   1.00 0.00 ? 64  ARG A NH2  6  
ATOM 10073 H H    . ARG A 1 13  ? 8.055   8.224   5.607   1.00 0.00 ? 64  ARG A H    6  
ATOM 10074 H HA   . ARG A 1 13  ? 6.219   10.385  5.224   1.00 0.00 ? 64  ARG A HA   6  
ATOM 10075 H HB2  . ARG A 1 13  ? 9.130   10.052  4.449   1.00 0.00 ? 64  ARG A HB2  6  
ATOM 10076 H HB3  . ARG A 1 13  ? 8.241   11.562  4.245   1.00 0.00 ? 64  ARG A HB3  6  
ATOM 10077 H HG2  . ARG A 1 13  ? 7.677   11.474  6.700   1.00 0.00 ? 64  ARG A HG2  6  
ATOM 10078 H HG3  . ARG A 1 13  ? 8.758   10.091  6.843   1.00 0.00 ? 64  ARG A HG3  6  
ATOM 10079 H HD2  . ARG A 1 13  ? 9.909   12.189  7.434   1.00 0.00 ? 64  ARG A HD2  6  
ATOM 10080 H HD3  . ARG A 1 13  ? 10.628  11.449  6.004   1.00 0.00 ? 64  ARG A HD3  6  
ATOM 10081 H HE   . ARG A 1 13  ? 8.696   13.190  5.003   1.00 0.00 ? 64  ARG A HE   6  
ATOM 10082 H HH11 . ARG A 1 13  ? 11.449  13.317  7.069   1.00 0.00 ? 64  ARG A HH11 6  
ATOM 10083 H HH12 . ARG A 1 13  ? 11.825  14.967  6.705   1.00 0.00 ? 64  ARG A HH12 6  
ATOM 10084 H HH21 . ARG A 1 13  ? 9.145   15.330  4.493   1.00 0.00 ? 64  ARG A HH21 6  
ATOM 10085 H HH22 . ARG A 1 13  ? 10.468  16.142  5.262   1.00 0.00 ? 64  ARG A HH22 6  
ATOM 10086 N N    . THR A 1 14  ? 5.808   10.672  2.771   1.00 0.00 ? 65  THR A N    6  
ATOM 10087 C CA   . THR A 1 14  ? 5.343   10.678  1.363   1.00 0.00 ? 65  THR A CA   6  
ATOM 10088 C C    . THR A 1 14  ? 5.786   11.981  0.712   1.00 0.00 ? 65  THR A C    6  
ATOM 10089 O O    . THR A 1 14  ? 6.338   12.845  1.363   1.00 0.00 ? 65  THR A O    6  
ATOM 10090 C CB   . THR A 1 14  ? 3.818   10.613  1.351   1.00 0.00 ? 65  THR A CB   6  
ATOM 10091 O OG1  . THR A 1 14  ? 3.289   11.815  1.900   1.00 0.00 ? 65  THR A OG1  6  
ATOM 10092 C CG2  . THR A 1 14  ? 3.347   9.415   2.178   1.00 0.00 ? 65  THR A CG2  6  
ATOM 10093 H H    . THR A 1 14  ? 5.496   11.377  3.370   1.00 0.00 ? 65  THR A H    6  
ATOM 10094 H HA   . THR A 1 14  ? 5.749   9.833   0.826   1.00 0.00 ? 65  THR A HA   6  
ATOM 10095 H HB   . THR A 1 14  ? 3.479   10.501  0.343   1.00 0.00 ? 65  THR A HB   6  
ATOM 10096 H HG1  . THR A 1 14  ? 3.198   12.457  1.189   1.00 0.00 ? 65  THR A HG1  6  
ATOM 10097 H HG21 . THR A 1 14  ? 3.853   9.408   3.133   1.00 0.00 ? 65  THR A HG21 6  
ATOM 10098 H HG22 . THR A 1 14  ? 2.283   9.486   2.336   1.00 0.00 ? 65  THR A HG22 6  
ATOM 10099 H HG23 . THR A 1 14  ? 3.571   8.506   1.649   1.00 0.00 ? 65  THR A HG23 6  
ATOM 10100 N N    . ASP A 1 15  ? 5.544   12.148  -0.554  1.00 0.00 ? 66  ASP A N    6  
ATOM 10101 C CA   . ASP A 1 15  ? 5.947   13.416  -1.207  1.00 0.00 ? 66  ASP A CA   6  
ATOM 10102 C C    . ASP A 1 15  ? 5.065   14.551  -0.665  1.00 0.00 ? 66  ASP A C    6  
ATOM 10103 O O    . ASP A 1 15  ? 5.472   15.690  -0.617  1.00 0.00 ? 66  ASP A O    6  
ATOM 10104 C CB   . ASP A 1 15  ? 5.778   13.294  -2.720  1.00 0.00 ? 66  ASP A CB   6  
ATOM 10105 C CG   . ASP A 1 15  ? 6.667   12.165  -3.243  1.00 0.00 ? 66  ASP A CG   6  
ATOM 10106 O OD1  . ASP A 1 15  ? 7.322   11.528  -2.434  1.00 0.00 ? 66  ASP A OD1  6  
ATOM 10107 O OD2  . ASP A 1 15  ? 6.686   11.961  -4.444  1.00 0.00 ? 66  ASP A OD2  6  
ATOM 10108 H H    . ASP A 1 15  ? 5.088   11.446  -1.070  1.00 0.00 ? 66  ASP A H    6  
ATOM 10109 H HA   . ASP A 1 15  ? 6.981   13.622  -0.971  1.00 0.00 ? 66  ASP A HA   6  
ATOM 10110 H HB2  . ASP A 1 15  ? 4.746   13.074  -2.946  1.00 0.00 ? 66  ASP A HB2  6  
ATOM 10111 H HB3  . ASP A 1 15  ? 6.062   14.222  -3.192  1.00 0.00 ? 66  ASP A HB3  6  
ATOM 10112 N N    . SER A 1 16  ? 3.856   14.243  -0.245  1.00 0.00 ? 67  SER A N    6  
ATOM 10113 C CA   . SER A 1 16  ? 2.956   15.311  0.302   1.00 0.00 ? 67  SER A CA   6  
ATOM 10114 C C    . SER A 1 16  ? 3.385   15.638  1.739   1.00 0.00 ? 67  SER A C    6  
ATOM 10115 O O    . SER A 1 16  ? 3.891   14.780  2.437   1.00 0.00 ? 67  SER A O    6  
ATOM 10116 C CB   . SER A 1 16  ? 1.513   14.803  0.324   1.00 0.00 ? 67  SER A CB   6  
ATOM 10117 O OG   . SER A 1 16  ? 1.014   14.731  -1.003  1.00 0.00 ? 67  SER A OG   6  
ATOM 10118 H H    . SER A 1 16  ? 3.544   13.315  -0.288  1.00 0.00 ? 67  SER A H    6  
ATOM 10119 H HA   . SER A 1 16  ? 3.023   16.188  -0.322  1.00 0.00 ? 67  SER A HA   6  
ATOM 10120 H HB2  . SER A 1 16  ? 1.485   13.820  0.762   1.00 0.00 ? 67  SER A HB2  6  
ATOM 10121 H HB3  . SER A 1 16  ? 0.903   15.477  0.914   1.00 0.00 ? 67  SER A HB3  6  
ATOM 10122 H HG   . SER A 1 16  ? 0.682   15.599  -1.243  1.00 0.00 ? 67  SER A HG   6  
ATOM 10123 N N    . PRO A 1 17  ? 3.208   16.861  2.189   1.00 0.00 ? 68  PRO A N    6  
ATOM 10124 C CA   . PRO A 1 17  ? 3.614   17.260  3.572   1.00 0.00 ? 68  PRO A CA   6  
ATOM 10125 C C    . PRO A 1 17  ? 2.618   16.824  4.665   1.00 0.00 ? 68  PRO A C    6  
ATOM 10126 O O    . PRO A 1 17  ? 2.826   17.112  5.828   1.00 0.00 ? 68  PRO A O    6  
ATOM 10127 C CB   . PRO A 1 17  ? 3.673   18.789  3.477   1.00 0.00 ? 68  PRO A CB   6  
ATOM 10128 C CG   . PRO A 1 17  ? 2.600   19.127  2.502   1.00 0.00 ? 68  PRO A CG   6  
ATOM 10129 C CD   . PRO A 1 17  ? 2.621   18.005  1.456   1.00 0.00 ? 68  PRO A CD   6  
ATOM 10130 H HA   . PRO A 1 17  ? 4.592   16.885  3.795   1.00 0.00 ? 68  PRO A HA   6  
ATOM 10131 H HB2  . PRO A 1 17  ? 3.476   19.244  4.441   1.00 0.00 ? 68  PRO A HB2  6  
ATOM 10132 H HB3  . PRO A 1 17  ? 4.634   19.110  3.098   1.00 0.00 ? 68  PRO A HB3  6  
ATOM 10133 H HG2  . PRO A 1 17  ? 1.646   19.154  3.009   1.00 0.00 ? 68  PRO A HG2  6  
ATOM 10134 H HG3  . PRO A 1 17  ? 2.808   20.076  2.031   1.00 0.00 ? 68  PRO A HG3  6  
ATOM 10135 H HD2  . PRO A 1 17  ? 1.620   17.778  1.121   1.00 0.00 ? 68  PRO A HD2  6  
ATOM 10136 H HD3  . PRO A 1 17  ? 3.250   18.280  0.621   1.00 0.00 ? 68  PRO A HD3  6  
ATOM 10137 N N    . ASN A 1 18  ? 1.533   16.161  4.325   1.00 0.00 ? 69  ASN A N    6  
ATOM 10138 C CA   . ASN A 1 18  ? 0.546   15.765  5.385   1.00 0.00 ? 69  ASN A CA   6  
ATOM 10139 C C    . ASN A 1 18  ? -0.033  14.374  5.128   1.00 0.00 ? 69  ASN A C    6  
ATOM 10140 O O    . ASN A 1 18  ? -0.656  13.801  5.994   1.00 0.00 ? 69  ASN A O    6  
ATOM 10141 C CB   . ASN A 1 18  ? -0.587  16.788  5.387   1.00 0.00 ? 69  ASN A CB   6  
ATOM 10142 C CG   . ASN A 1 18  ? -0.047  18.131  5.878   1.00 0.00 ? 69  ASN A CG   6  
ATOM 10143 O OD1  . ASN A 1 18  ? 0.878   18.177  6.667   1.00 0.00 ? 69  ASN A OD1  6  
ATOM 10144 N ND2  . ASN A 1 18  ? -0.578  19.234  5.430   1.00 0.00 ? 69  ASN A ND2  6  
ATOM 10145 H H    . ASN A 1 18  ? 1.355   15.952  3.382   1.00 0.00 ? 69  ASN A H    6  
ATOM 10146 H HA   . ASN A 1 18  ? 1.022   15.766  6.356   1.00 0.00 ? 69  ASN A HA   6  
ATOM 10147 H HB2  . ASN A 1 18  ? -0.969  16.902  4.384   1.00 0.00 ? 69  ASN A HB2  6  
ATOM 10148 H HB3  . ASN A 1 18  ? -1.376  16.456  6.043   1.00 0.00 ? 69  ASN A HB3  6  
ATOM 10149 H HD21 . ASN A 1 18  ? -1.312  19.197  4.784   1.00 0.00 ? 69  ASN A HD21 6  
ATOM 10150 H HD22 . ASN A 1 18  ? -0.244  20.100  5.742   1.00 0.00 ? 69  ASN A HD22 6  
ATOM 10151 N N    . PHE A 1 19  ? 0.154   13.816  3.962   1.00 0.00 ? 70  PHE A N    6  
ATOM 10152 C CA   . PHE A 1 19  ? -0.411  12.453  3.690   1.00 0.00 ? 70  PHE A CA   6  
ATOM 10153 C C    . PHE A 1 19  ? 0.629   11.392  4.084   1.00 0.00 ? 70  PHE A C    6  
ATOM 10154 O O    . PHE A 1 19  ? 1.754   11.427  3.630   1.00 0.00 ? 70  PHE A O    6  
ATOM 10155 C CB   . PHE A 1 19  ? -0.761  12.351  2.179   1.00 0.00 ? 70  PHE A CB   6  
ATOM 10156 C CG   . PHE A 1 19  ? -2.208  11.919  2.002   1.00 0.00 ? 70  PHE A CG   6  
ATOM 10157 C CD1  . PHE A 1 19  ? -3.235  12.698  2.556   1.00 0.00 ? 70  PHE A CD1  6  
ATOM 10158 C CD2  . PHE A 1 19  ? -2.520  10.763  1.271   1.00 0.00 ? 70  PHE A CD2  6  
ATOM 10159 C CE1  . PHE A 1 19  ? -4.572  12.326  2.378   1.00 0.00 ? 70  PHE A CE1  6  
ATOM 10160 C CE2  . PHE A 1 19  ? -3.856  10.391  1.101   1.00 0.00 ? 70  PHE A CE2  6  
ATOM 10161 C CZ   . PHE A 1 19  ? -4.882  11.173  1.650   1.00 0.00 ? 70  PHE A CZ   6  
ATOM 10162 H H    . PHE A 1 19  ? 0.658   14.292  3.266   1.00 0.00 ? 70  PHE A H    6  
ATOM 10163 H HA   . PHE A 1 19  ? -1.303  12.308  4.287   1.00 0.00 ? 70  PHE A HA   6  
ATOM 10164 H HB2  . PHE A 1 19  ? -0.623  13.317  1.717   1.00 0.00 ? 70  PHE A HB2  6  
ATOM 10165 H HB3  . PHE A 1 19  ? -0.110  11.633  1.692   1.00 0.00 ? 70  PHE A HB3  6  
ATOM 10166 H HD1  . PHE A 1 19  ? -2.993  13.587  3.121   1.00 0.00 ? 70  PHE A HD1  6  
ATOM 10167 H HD2  . PHE A 1 19  ? -1.729  10.157  0.841   1.00 0.00 ? 70  PHE A HD2  6  
ATOM 10168 H HE1  . PHE A 1 19  ? -5.361  12.921  2.808   1.00 0.00 ? 70  PHE A HE1  6  
ATOM 10169 H HE2  . PHE A 1 19  ? -4.100  9.505   0.534   1.00 0.00 ? 70  PHE A HE2  6  
ATOM 10170 H HZ   . PHE A 1 19  ? -5.913  10.892  1.502   1.00 0.00 ? 70  PHE A HZ   6  
ATOM 10171 N N    . LEU A 1 20  ? 0.260   10.455  4.932   1.00 0.00 ? 71  LEU A N    6  
ATOM 10172 C CA   . LEU A 1 20  ? 1.241   9.389   5.362   1.00 0.00 ? 71  LEU A CA   6  
ATOM 10173 C C    . LEU A 1 20  ? 0.563   8.011   5.449   1.00 0.00 ? 71  LEU A C    6  
ATOM 10174 O O    . LEU A 1 20  ? -0.587  7.903   5.828   1.00 0.00 ? 71  LEU A O    6  
ATOM 10175 C CB   . LEU A 1 20  ? 1.820   9.727   6.748   1.00 0.00 ? 71  LEU A CB   6  
ATOM 10176 C CG   . LEU A 1 20  ? 2.672   11.020  6.685   1.00 0.00 ? 71  LEU A CG   6  
ATOM 10177 C CD1  . LEU A 1 20  ? 1.800   12.250  6.992   1.00 0.00 ? 71  LEU A CD1  6  
ATOM 10178 C CD2  . LEU A 1 20  ? 3.810   10.933  7.710   1.00 0.00 ? 71  LEU A CD2  6  
ATOM 10179 H H    . LEU A 1 20  ? -0.659  10.459  5.291   1.00 0.00 ? 71  LEU A H    6  
ATOM 10180 H HA   . LEU A 1 20  ? 2.051   9.335   4.652   1.00 0.00 ? 71  LEU A HA   6  
ATOM 10181 H HB2  . LEU A 1 20  ? 1.005   9.860   7.450   1.00 0.00 ? 71  LEU A HB2  6  
ATOM 10182 H HB3  . LEU A 1 20  ? 2.438   8.901   7.076   1.00 0.00 ? 71  LEU A HB3  6  
ATOM 10183 H HG   . LEU A 1 20  ? 3.097   11.127  5.694   1.00 0.00 ? 71  LEU A HG   6  
ATOM 10184 H HD11 . LEU A 1 20  ? 0.818   12.103  6.578   1.00 0.00 ? 71  LEU A HD11 6  
ATOM 10185 H HD12 . LEU A 1 20  ? 1.721   12.388  8.060   1.00 0.00 ? 71  LEU A HD12 6  
ATOM 10186 H HD13 . LEU A 1 20  ? 2.246   13.129  6.551   1.00 0.00 ? 71  LEU A HD13 6  
ATOM 10187 H HD21 . LEU A 1 20  ? 3.417   10.603  8.658   1.00 0.00 ? 71  LEU A HD21 6  
ATOM 10188 H HD22 . LEU A 1 20  ? 4.549   10.225  7.364   1.00 0.00 ? 71  LEU A HD22 6  
ATOM 10189 H HD23 . LEU A 1 20  ? 4.265   11.905  7.827   1.00 0.00 ? 71  LEU A HD23 6  
ATOM 10190 N N    . CYS A 1 21  ? 1.288   6.951   5.140   1.00 0.00 ? 72  CYS A N    6  
ATOM 10191 C CA   . CYS A 1 21  ? 0.717   5.566   5.238   1.00 0.00 ? 72  CYS A CA   6  
ATOM 10192 C C    . CYS A 1 21  ? 1.233   4.917   6.540   1.00 0.00 ? 72  CYS A C    6  
ATOM 10193 O O    . CYS A 1 21  ? 2.419   4.877   6.787   1.00 0.00 ? 72  CYS A O    6  
ATOM 10194 C CB   . CYS A 1 21  ? 1.181   4.746   4.023   1.00 0.00 ? 72  CYS A CB   6  
ATOM 10195 S SG   . CYS A 1 21  ? 2.835   5.291   3.544   1.00 0.00 ? 72  CYS A SG   6  
ATOM 10196 H H    . CYS A 1 21  ? 2.221   7.068   4.864   1.00 0.00 ? 72  CYS A H    6  
ATOM 10197 H HA   . CYS A 1 21  ? -0.363  5.612   5.254   1.00 0.00 ? 72  CYS A HA   6  
ATOM 10198 H HB2  . CYS A 1 21  ? 1.206   3.696   4.272   1.00 0.00 ? 72  CYS A HB2  6  
ATOM 10199 H HB3  . CYS A 1 21  ? 0.503   4.903   3.199   1.00 0.00 ? 72  CYS A HB3  6  
ATOM 10200 H HG   . CYS A 1 21  ? 2.761   6.180   3.185   1.00 0.00 ? 72  CYS A HG   6  
ATOM 10201 N N    . SER A 1 22  ? 0.350   4.443   7.384   1.00 0.00 ? 73  SER A N    6  
ATOM 10202 C CA   . SER A 1 22  ? 0.796   3.837   8.682   1.00 0.00 ? 73  SER A CA   6  
ATOM 10203 C C    . SER A 1 22  ? 1.695   2.606   8.486   1.00 0.00 ? 73  SER A C    6  
ATOM 10204 O O    . SER A 1 22  ? 2.862   2.642   8.812   1.00 0.00 ? 73  SER A O    6  
ATOM 10205 C CB   . SER A 1 22  ? -0.432  3.448   9.498   1.00 0.00 ? 73  SER A CB   6  
ATOM 10206 O OG   . SER A 1 22  ? -1.034  2.295   8.924   1.00 0.00 ? 73  SER A OG   6  
ATOM 10207 H H    . SER A 1 22  ? -0.608  4.505   7.178   1.00 0.00 ? 73  SER A H    6  
ATOM 10208 H HA   . SER A 1 22  ? 1.352   4.576   9.234   1.00 0.00 ? 73  SER A HA   6  
ATOM 10209 H HB2  . SER A 1 22  ? -0.136  3.228   10.510  1.00 0.00 ? 73  SER A HB2  6  
ATOM 10210 H HB3  . SER A 1 22  ? -1.132  4.276   9.501   1.00 0.00 ? 73  SER A HB3  6  
ATOM 10211 H HG   . SER A 1 22  ? -1.312  2.516   8.033   1.00 0.00 ? 73  SER A HG   6  
ATOM 10212 N N    . VAL A 1 23  ? 1.180   1.506   7.984   1.00 0.00 ? 74  VAL A N    6  
ATOM 10213 C CA   . VAL A 1 23  ? 2.046   0.282   7.815   1.00 0.00 ? 74  VAL A CA   6  
ATOM 10214 C C    . VAL A 1 23  ? 2.398   0.091   6.347   1.00 0.00 ? 74  VAL A C    6  
ATOM 10215 O O    . VAL A 1 23  ? 1.590   -0.329  5.545   1.00 0.00 ? 74  VAL A O    6  
ATOM 10216 C CB   . VAL A 1 23  ? 1.302   -0.959  8.347   1.00 0.00 ? 74  VAL A CB   6  
ATOM 10217 C CG1  . VAL A 1 23  ? -0.059  -1.109  7.644   1.00 0.00 ? 74  VAL A CG1  6  
ATOM 10218 C CG2  . VAL A 1 23  ? 2.156   -2.225  8.107   1.00 0.00 ? 74  VAL A CG2  6  
ATOM 10219 H H    . VAL A 1 23  ? 0.234   1.479   7.737   1.00 0.00 ? 74  VAL A H    6  
ATOM 10220 H HA   . VAL A 1 23  ? 2.961   0.398   8.376   1.00 0.00 ? 74  VAL A HA   6  
ATOM 10221 H HB   . VAL A 1 23  ? 1.140   -0.835  9.409   1.00 0.00 ? 74  VAL A HB   6  
ATOM 10222 H HG11 . VAL A 1 23  ? -0.479  -0.135  7.442   1.00 0.00 ? 74  VAL A HG11 6  
ATOM 10223 H HG12 . VAL A 1 23  ? 0.064   -1.646  6.718   1.00 0.00 ? 74  VAL A HG12 6  
ATOM 10224 H HG13 . VAL A 1 23  ? -0.733  -1.658  8.281   1.00 0.00 ? 74  VAL A HG13 6  
ATOM 10225 H HG21 . VAL A 1 23  ? 3.202   -1.996  8.258   1.00 0.00 ? 74  VAL A HG21 6  
ATOM 10226 H HG22 . VAL A 1 23  ? 1.858   -2.996  8.803   1.00 0.00 ? 74  VAL A HG22 6  
ATOM 10227 H HG23 . VAL A 1 23  ? 2.006   -2.579  7.099   1.00 0.00 ? 74  VAL A HG23 6  
ATOM 10228 N N    . LEU A 1 24  ? 3.621   0.384   5.994   1.00 0.00 ? 75  LEU A N    6  
ATOM 10229 C CA   . LEU A 1 24  ? 4.068   0.208   4.581   1.00 0.00 ? 75  LEU A CA   6  
ATOM 10230 C C    . LEU A 1 24  ? 5.496   -0.355  4.579   1.00 0.00 ? 75  LEU A C    6  
ATOM 10231 O O    . LEU A 1 24  ? 6.445   0.346   4.290   1.00 0.00 ? 75  LEU A O    6  
ATOM 10232 C CB   . LEU A 1 24  ? 4.034   1.568   3.859   1.00 0.00 ? 75  LEU A CB   6  
ATOM 10233 C CG   . LEU A 1 24  ? 4.293   1.385   2.349   1.00 0.00 ? 75  LEU A CG   6  
ATOM 10234 C CD1  . LEU A 1 24  ? 2.989   1.040   1.609   1.00 0.00 ? 75  LEU A CD1  6  
ATOM 10235 C CD2  . LEU A 1 24  ? 4.861   2.689   1.773   1.00 0.00 ? 75  LEU A CD2  6  
ATOM 10236 H H    . LEU A 1 24  ? 4.253   0.711   6.669   1.00 0.00 ? 75  LEU A H    6  
ATOM 10237 H HA   . LEU A 1 24  ? 3.414   -0.485  4.077   1.00 0.00 ? 75  LEU A HA   6  
ATOM 10238 H HB2  . LEU A 1 24  ? 3.066   2.029   4.006   1.00 0.00 ? 75  LEU A HB2  6  
ATOM 10239 H HB3  . LEU A 1 24  ? 4.796   2.202   4.281   1.00 0.00 ? 75  LEU A HB3  6  
ATOM 10240 H HG   . LEU A 1 24  ? 5.009   0.590   2.199   1.00 0.00 ? 75  LEU A HG   6  
ATOM 10241 H HD11 . LEU A 1 24  ? 2.416   0.336   2.189   1.00 0.00 ? 75  LEU A HD11 6  
ATOM 10242 H HD12 . LEU A 1 24  ? 2.405   1.937   1.458   1.00 0.00 ? 75  LEU A HD12 6  
ATOM 10243 H HD13 . LEU A 1 24  ? 3.226   0.602   0.649   1.00 0.00 ? 75  LEU A HD13 6  
ATOM 10244 H HD21 . LEU A 1 24  ? 5.778   2.936   2.285   1.00 0.00 ? 75  LEU A HD21 6  
ATOM 10245 H HD22 . LEU A 1 24  ? 5.059   2.563   0.723   1.00 0.00 ? 75  LEU A HD22 6  
ATOM 10246 H HD23 . LEU A 1 24  ? 4.143   3.484   1.913   1.00 0.00 ? 75  LEU A HD23 6  
ATOM 10247 N N    . PRO A 1 25  ? 5.646   -1.617  4.901   1.00 0.00 ? 76  PRO A N    6  
ATOM 10248 C CA   . PRO A 1 25  ? 6.976   -2.291  4.936   1.00 0.00 ? 76  PRO A CA   6  
ATOM 10249 C C    . PRO A 1 25  ? 7.616   -2.372  3.546   1.00 0.00 ? 76  PRO A C    6  
ATOM 10250 O O    . PRO A 1 25  ? 6.940   -2.481  2.543   1.00 0.00 ? 76  PRO A O    6  
ATOM 10251 C CB   . PRO A 1 25  ? 6.678   -3.701  5.496   1.00 0.00 ? 76  PRO A CB   6  
ATOM 10252 C CG   . PRO A 1 25  ? 5.291   -3.626  6.065   1.00 0.00 ? 76  PRO A CG   6  
ATOM 10253 C CD   . PRO A 1 25  ? 4.565   -2.534  5.276   1.00 0.00 ? 76  PRO A CD   6  
ATOM 10254 H HA   . PRO A 1 25  ? 7.630   -1.766  5.612   1.00 0.00 ? 76  PRO A HA   6  
ATOM 10255 H HB2  . PRO A 1 25  ? 6.721   -4.440  4.708   1.00 0.00 ? 76  PRO A HB2  6  
ATOM 10256 H HB3  . PRO A 1 25  ? 7.387   -3.953  6.278   1.00 0.00 ? 76  PRO A HB3  6  
ATOM 10257 H HG2  . PRO A 1 25  ? 4.784   -4.576  5.950   1.00 0.00 ? 76  PRO A HG2  6  
ATOM 10258 H HG3  . PRO A 1 25  ? 5.329   -3.354  7.109   1.00 0.00 ? 76  PRO A HG3  6  
ATOM 10259 H HD2  . PRO A 1 25  ? 4.083   -2.947  4.399   1.00 0.00 ? 76  PRO A HD2  6  
ATOM 10260 H HD3  . PRO A 1 25  ? 3.850   -2.024  5.900   1.00 0.00 ? 76  PRO A HD3  6  
ATOM 10261 N N    . THR A 1 26  ? 8.914   -2.321  3.483   1.00 0.00 ? 77  THR A N    6  
ATOM 10262 C CA   . THR A 1 26  ? 9.595   -2.395  2.166   1.00 0.00 ? 77  THR A CA   6  
ATOM 10263 C C    . THR A 1 26  ? 9.290   -3.744  1.509   1.00 0.00 ? 77  THR A C    6  
ATOM 10264 O O    . THR A 1 26  ? 9.339   -3.880  0.302   1.00 0.00 ? 77  THR A O    6  
ATOM 10265 C CB   . THR A 1 26  ? 11.098  -2.235  2.376   1.00 0.00 ? 77  THR A CB   6  
ATOM 10266 O OG1  . THR A 1 26  ? 11.608  -3.397  3.015   1.00 0.00 ? 77  THR A OG1  6  
ATOM 10267 C CG2  . THR A 1 26  ? 11.344  -1.002  3.254   1.00 0.00 ? 77  THR A CG2  6  
ATOM 10268 H H    . THR A 1 26  ? 9.444   -2.236  4.304   1.00 0.00 ? 77  THR A H    6  
ATOM 10269 H HA   . THR A 1 26  ? 9.237   -1.600  1.530   1.00 0.00 ? 77  THR A HA   6  
ATOM 10270 H HB   . THR A 1 26  ? 11.589  -2.099  1.424   1.00 0.00 ? 77  THR A HB   6  
ATOM 10271 H HG1  . THR A 1 26  ? 10.914  -4.062  3.019   1.00 0.00 ? 77  THR A HG1  6  
ATOM 10272 H HG21 . THR A 1 26  ? 10.849  -0.147  2.815   1.00 0.00 ? 77  THR A HG21 6  
ATOM 10273 H HG22 . THR A 1 26  ? 10.946  -1.177  4.241   1.00 0.00 ? 77  THR A HG22 6  
ATOM 10274 H HG23 . THR A 1 26  ? 12.403  -0.809  3.324   1.00 0.00 ? 77  THR A HG23 6  
ATOM 10275 N N    . HIS A 1 27  ? 8.973   -4.749  2.296   1.00 0.00 ? 78  HIS A N    6  
ATOM 10276 C CA   . HIS A 1 27  ? 8.664   -6.099  1.715   1.00 0.00 ? 78  HIS A CA   6  
ATOM 10277 C C    . HIS A 1 27  ? 7.469   -6.744  2.446   1.00 0.00 ? 78  HIS A C    6  
ATOM 10278 O O    . HIS A 1 27  ? 7.157   -6.417  3.572   1.00 0.00 ? 78  HIS A O    6  
ATOM 10279 C CB   . HIS A 1 27  ? 9.905   -6.993  1.863   1.00 0.00 ? 78  HIS A CB   6  
ATOM 10280 C CG   . HIS A 1 27  ? 10.100  -7.353  3.308   1.00 0.00 ? 78  HIS A CG   6  
ATOM 10281 N ND1  . HIS A 1 27  ? 10.899  -6.607  4.160   1.00 0.00 ? 78  HIS A ND1  6  
ATOM 10282 C CD2  . HIS A 1 27  ? 9.584   -8.371  4.068   1.00 0.00 ? 78  HIS A CD2  6  
ATOM 10283 C CE1  . HIS A 1 27  ? 10.838  -7.181  5.375   1.00 0.00 ? 78  HIS A CE1  6  
ATOM 10284 N NE2  . HIS A 1 27  ? 10.049  -8.262  5.374   1.00 0.00 ? 78  HIS A NE2  6  
ATOM 10285 H H    . HIS A 1 27  ? 8.944   -4.616  3.268   1.00 0.00 ? 78  HIS A H    6  
ATOM 10286 H HA   . HIS A 1 27  ? 8.420   -6.001  0.664   1.00 0.00 ? 78  HIS A HA   6  
ATOM 10287 H HB2  . HIS A 1 27  ? 9.775   -7.895  1.281   1.00 0.00 ? 78  HIS A HB2  6  
ATOM 10288 H HB3  . HIS A 1 27  ? 10.777  -6.461  1.512   1.00 0.00 ? 78  HIS A HB3  6  
ATOM 10289 H HD1  . HIS A 1 27  ? 11.422  -5.813  3.919   1.00 0.00 ? 78  HIS A HD1  6  
ATOM 10290 H HD2  . HIS A 1 27  ? 8.922   -9.142  3.706   1.00 0.00 ? 78  HIS A HD2  6  
ATOM 10291 H HE1  . HIS A 1 27  ? 11.364  -6.817  6.243   1.00 0.00 ? 78  HIS A HE1  6  
ATOM 10292 N N    . TRP A 1 28  ? 6.814   -7.685  1.807   1.00 0.00 ? 79  TRP A N    6  
ATOM 10293 C CA   . TRP A 1 28  ? 5.657   -8.390  2.434   1.00 0.00 ? 79  TRP A CA   6  
ATOM 10294 C C    . TRP A 1 28  ? 5.619   -9.821  1.899   1.00 0.00 ? 79  TRP A C    6  
ATOM 10295 O O    . TRP A 1 28  ? 6.236   -10.126 0.900   1.00 0.00 ? 79  TRP A O    6  
ATOM 10296 C CB   . TRP A 1 28  ? 4.336   -7.681  2.080   1.00 0.00 ? 79  TRP A CB   6  
ATOM 10297 C CG   . TRP A 1 28  ? 3.193   -8.558  2.490   1.00 0.00 ? 79  TRP A CG   6  
ATOM 10298 C CD1  . TRP A 1 28  ? 2.269   -9.089  1.647   1.00 0.00 ? 79  TRP A CD1  6  
ATOM 10299 C CD2  . TRP A 1 28  ? 2.856   -9.033  3.821   1.00 0.00 ? 79  TRP A CD2  6  
ATOM 10300 N NE1  . TRP A 1 28  ? 1.397   -9.878  2.382   1.00 0.00 ? 79  TRP A NE1  6  
ATOM 10301 C CE2  . TRP A 1 28  ? 1.717   -9.868  3.728   1.00 0.00 ? 79  TRP A CE2  6  
ATOM 10302 C CE3  . TRP A 1 28  ? 3.424   -8.823  5.092   1.00 0.00 ? 79  TRP A CE3  6  
ATOM 10303 C CZ2  . TRP A 1 28  ? 1.165   -10.474 4.855   1.00 0.00 ? 79  TRP A CZ2  6  
ATOM 10304 C CZ3  . TRP A 1 28  ? 2.870   -9.429  6.226   1.00 0.00 ? 79  TRP A CZ3  6  
ATOM 10305 C CH2  . TRP A 1 28  ? 1.745   -10.254 6.109   1.00 0.00 ? 79  TRP A CH2  6  
ATOM 10306 H H    . TRP A 1 28  ? 7.099   -7.944  0.907   1.00 0.00 ? 79  TRP A H    6  
ATOM 10307 H HA   . TRP A 1 28  ? 5.782   -8.415  3.506   1.00 0.00 ? 79  TRP A HA   6  
ATOM 10308 H HB2  . TRP A 1 28  ? 4.275   -6.740  2.606   1.00 0.00 ? 79  TRP A HB2  6  
ATOM 10309 H HB3  . TRP A 1 28  ? 4.294   -7.509  1.018   1.00 0.00 ? 79  TRP A HB3  6  
ATOM 10310 H HD1  . TRP A 1 28  ? 2.224   -8.933  0.580   1.00 0.00 ? 79  TRP A HD1  6  
ATOM 10311 H HE1  . TRP A 1 28  ? 0.634   -10.384 2.011   1.00 0.00 ? 79  TRP A HE1  6  
ATOM 10312 H HE3  . TRP A 1 28  ? 4.285   -8.184  5.198   1.00 0.00 ? 79  TRP A HE3  6  
ATOM 10313 H HZ2  . TRP A 1 28  ? 0.299   -11.109 4.761   1.00 0.00 ? 79  TRP A HZ2  6  
ATOM 10314 H HZ3  . TRP A 1 28  ? 3.315   -9.262  7.196   1.00 0.00 ? 79  TRP A HZ3  6  
ATOM 10315 H HH2  . TRP A 1 28  ? 1.327   -10.715 6.984   1.00 0.00 ? 79  TRP A HH2  6  
ATOM 10316 N N    . ARG A 1 29  ? 4.895   -10.699 2.552   1.00 0.00 ? 80  ARG A N    6  
ATOM 10317 C CA   . ARG A 1 29  ? 4.805   -12.117 2.081   1.00 0.00 ? 80  ARG A CA   6  
ATOM 10318 C C    . ARG A 1 29  ? 3.337   -12.558 2.031   1.00 0.00 ? 80  ARG A C    6  
ATOM 10319 O O    . ARG A 1 29  ? 2.778   -12.973 3.027   1.00 0.00 ? 80  ARG A O    6  
ATOM 10320 C CB   . ARG A 1 29  ? 5.559   -13.012 3.073   1.00 0.00 ? 80  ARG A CB   6  
ATOM 10321 C CG   . ARG A 1 29  ? 5.691   -14.435 2.513   1.00 0.00 ? 80  ARG A CG   6  
ATOM 10322 C CD   . ARG A 1 29  ? 6.313   -15.356 3.577   1.00 0.00 ? 80  ARG A CD   6  
ATOM 10323 N NE   . ARG A 1 29  ? 7.657   -14.825 3.998   1.00 0.00 ? 80  ARG A NE   6  
ATOM 10324 C CZ   . ARG A 1 29  ? 8.636   -14.660 3.149   1.00 0.00 ? 80  ARG A CZ   6  
ATOM 10325 N NH1  . ARG A 1 29  ? 8.536   -15.111 1.931   1.00 0.00 ? 80  ARG A NH1  6  
ATOM 10326 N NH2  . ARG A 1 29  ? 9.735   -14.072 3.541   1.00 0.00 ? 80  ARG A NH2  6  
ATOM 10327 H H    . ARG A 1 29  ? 4.402   -10.423 3.353   1.00 0.00 ? 80  ARG A H    6  
ATOM 10328 H HA   . ARG A 1 29  ? 5.243   -12.219 1.097   1.00 0.00 ? 80  ARG A HA   6  
ATOM 10329 H HB2  . ARG A 1 29  ? 6.542   -12.600 3.247   1.00 0.00 ? 80  ARG A HB2  6  
ATOM 10330 H HB3  . ARG A 1 29  ? 5.015   -13.042 4.005   1.00 0.00 ? 80  ARG A HB3  6  
ATOM 10331 H HG2  . ARG A 1 29  ? 4.706   -14.800 2.254   1.00 0.00 ? 80  ARG A HG2  6  
ATOM 10332 H HG3  . ARG A 1 29  ? 6.306   -14.421 1.631   1.00 0.00 ? 80  ARG A HG3  6  
ATOM 10333 H HD2  . ARG A 1 29  ? 5.688   -15.365 4.449   1.00 0.00 ? 80  ARG A HD2  6  
ATOM 10334 H HD3  . ARG A 1 29  ? 6.379   -16.369 3.181   1.00 0.00 ? 80  ARG A HD3  6  
ATOM 10335 H HE   . ARG A 1 29  ? 7.784   -14.537 4.926   1.00 0.00 ? 80  ARG A HE   6  
ATOM 10336 H HH11 . ARG A 1 29  ? 7.702   -15.586 1.641   1.00 0.00 ? 80  ARG A HH11 6  
ATOM 10337 H HH12 . ARG A 1 29  ? 9.291   -14.982 1.285   1.00 0.00 ? 80  ARG A HH12 6  
ATOM 10338 H HH21 . ARG A 1 29  ? 9.818   -13.746 4.484   1.00 0.00 ? 80  ARG A HH21 6  
ATOM 10339 H HH22 . ARG A 1 29  ? 10.494  -13.947 2.902   1.00 0.00 ? 80  ARG A HH22 6  
ATOM 10340 N N    . SER A 1 30  ? 2.719   -12.501 0.876   1.00 0.00 ? 81  SER A N    6  
ATOM 10341 C CA   . SER A 1 30  ? 1.290   -12.958 0.757   1.00 0.00 ? 81  SER A CA   6  
ATOM 10342 C C    . SER A 1 30  ? 1.282   -14.345 0.112   1.00 0.00 ? 81  SER A C    6  
ATOM 10343 O O    . SER A 1 30  ? 1.786   -14.526 -0.980  1.00 0.00 ? 81  SER A O    6  
ATOM 10344 C CB   . SER A 1 30  ? 0.498   -12.003 -0.134  1.00 0.00 ? 81  SER A CB   6  
ATOM 10345 O OG   . SER A 1 30  ? -0.831  -12.496 -0.267  1.00 0.00 ? 81  SER A OG   6  
ATOM 10346 H H    . SER A 1 30  ? 3.198   -12.179 0.085   1.00 0.00 ? 81  SER A H    6  
ATOM 10347 H HA   . SER A 1 30  ? 0.829   -13.009 1.738   1.00 0.00 ? 81  SER A HA   6  
ATOM 10348 H HB2  . SER A 1 30  ? 0.470   -11.023 0.311   1.00 0.00 ? 81  SER A HB2  6  
ATOM 10349 H HB3  . SER A 1 30  ? 0.969   -11.942 -1.106  1.00 0.00 ? 81  SER A HB3  6  
ATOM 10350 H HG   . SER A 1 30  ? -1.135  -12.768 0.603   1.00 0.00 ? 81  SER A HG   6  
ATOM 10351 N N    . ASN A 1 31  ? 0.738   -15.336 0.770   1.00 0.00 ? 82  ASN A N    6  
ATOM 10352 C CA   . ASN A 1 31  ? 0.739   -16.701 0.165   1.00 0.00 ? 82  ASN A CA   6  
ATOM 10353 C C    . ASN A 1 31  ? -0.144  -16.744 -1.087  1.00 0.00 ? 82  ASN A C    6  
ATOM 10354 O O    . ASN A 1 31  ? 0.199   -17.379 -2.067  1.00 0.00 ? 82  ASN A O    6  
ATOM 10355 C CB   . ASN A 1 31  ? 0.240   -17.745 1.183   1.00 0.00 ? 82  ASN A CB   6  
ATOM 10356 C CG   . ASN A 1 31  ? -1.263  -17.568 1.459   1.00 0.00 ? 82  ASN A CG   6  
ATOM 10357 O OD1  . ASN A 1 31  ? -1.831  -16.533 1.182   1.00 0.00 ? 82  ASN A OD1  6  
ATOM 10358 N ND2  . ASN A 1 31  ? -1.939  -18.549 2.000   1.00 0.00 ? 82  ASN A ND2  6  
ATOM 10359 H H    . ASN A 1 31  ? 0.345   -15.186 1.656   1.00 0.00 ? 82  ASN A H    6  
ATOM 10360 H HA   . ASN A 1 31  ? 1.754   -16.949 -0.118  1.00 0.00 ? 82  ASN A HA   6  
ATOM 10361 H HB2  . ASN A 1 31  ? 0.409   -18.734 0.782   1.00 0.00 ? 82  ASN A HB2  6  
ATOM 10362 H HB3  . ASN A 1 31  ? 0.788   -17.638 2.108   1.00 0.00 ? 82  ASN A HB3  6  
ATOM 10363 H HD21 . ASN A 1 31  ? -1.489  -19.391 2.222   1.00 0.00 ? 82  ASN A HD21 6  
ATOM 10364 H HD22 . ASN A 1 31  ? -2.895  -18.440 2.190   1.00 0.00 ? 82  ASN A HD22 6  
ATOM 10365 N N    . LYS A 1 32  ? -1.282  -16.099 -1.074  1.00 0.00 ? 83  LYS A N    6  
ATOM 10366 C CA   . LYS A 1 32  ? -2.168  -16.141 -2.276  1.00 0.00 ? 83  LYS A CA   6  
ATOM 10367 C C    . LYS A 1 32  ? -3.145  -14.957 -2.243  1.00 0.00 ? 83  LYS A C    6  
ATOM 10368 O O    . LYS A 1 32  ? -2.790  -13.833 -2.537  1.00 0.00 ? 83  LYS A O    6  
ATOM 10369 C CB   . LYS A 1 32  ? -2.941  -17.465 -2.261  1.00 0.00 ? 83  LYS A CB   6  
ATOM 10370 C CG   . LYS A 1 32  ? -3.753  -17.650 -3.558  1.00 0.00 ? 83  LYS A CG   6  
ATOM 10371 C CD   . LYS A 1 32  ? -2.843  -18.147 -4.702  1.00 0.00 ? 83  LYS A CD   6  
ATOM 10372 C CE   . LYS A 1 32  ? -3.703  -18.560 -5.905  1.00 0.00 ? 83  LYS A CE   6  
ATOM 10373 N NZ   . LYS A 1 32  ? -2.885  -19.357 -6.875  1.00 0.00 ? 83  LYS A NZ   6  
ATOM 10374 H H    . LYS A 1 32  ? -1.555  -15.593 -0.274  1.00 0.00 ? 83  LYS A H    6  
ATOM 10375 H HA   . LYS A 1 32  ? -1.565  -16.084 -3.167  1.00 0.00 ? 83  LYS A HA   6  
ATOM 10376 H HB2  . LYS A 1 32  ? -2.240  -18.278 -2.163  1.00 0.00 ? 83  LYS A HB2  6  
ATOM 10377 H HB3  . LYS A 1 32  ? -3.609  -17.479 -1.415  1.00 0.00 ? 83  LYS A HB3  6  
ATOM 10378 H HG2  . LYS A 1 32  ? -4.538  -18.373 -3.382  1.00 0.00 ? 83  LYS A HG2  6  
ATOM 10379 H HG3  . LYS A 1 32  ? -4.196  -16.705 -3.842  1.00 0.00 ? 83  LYS A HG3  6  
ATOM 10380 H HD2  . LYS A 1 32  ? -2.175  -17.355 -5.002  1.00 0.00 ? 83  LYS A HD2  6  
ATOM 10381 H HD3  . LYS A 1 32  ? -2.268  -18.994 -4.371  1.00 0.00 ? 83  LYS A HD3  6  
ATOM 10382 H HE2  . LYS A 1 32  ? -4.533  -19.160 -5.563  1.00 0.00 ? 83  LYS A HE2  6  
ATOM 10383 H HE3  . LYS A 1 32  ? -4.079  -17.678 -6.396  1.00 0.00 ? 83  LYS A HE3  6  
ATOM 10384 H HZ1  . LYS A 1 32  ? -1.886  -19.343 -6.584  1.00 0.00 ? 83  LYS A HZ1  6  
ATOM 10385 H HZ2  . LYS A 1 32  ? -3.228  -20.336 -6.893  1.00 0.00 ? 83  LYS A HZ2  6  
ATOM 10386 H HZ3  . LYS A 1 32  ? -2.976  -18.947 -7.826  1.00 0.00 ? 83  LYS A HZ3  6  
ATOM 10387 N N    . THR A 1 33  ? -4.382  -15.208 -1.888  1.00 0.00 ? 84  THR A N    6  
ATOM 10388 C CA   . THR A 1 33  ? -5.396  -14.120 -1.833  1.00 0.00 ? 84  THR A CA   6  
ATOM 10389 C C    . THR A 1 33  ? -5.379  -13.502 -0.435  1.00 0.00 ? 84  THR A C    6  
ATOM 10390 O O    . THR A 1 33  ? -6.377  -13.001 0.042   1.00 0.00 ? 84  THR A O    6  
ATOM 10391 C CB   . THR A 1 33  ? -6.785  -14.709 -2.121  1.00 0.00 ? 84  THR A CB   6  
ATOM 10392 O OG1  . THR A 1 33  ? -6.671  -15.690 -3.138  1.00 0.00 ? 84  THR A OG1  6  
ATOM 10393 C CG2  . THR A 1 33  ? -7.743  -13.611 -2.591  1.00 0.00 ? 84  THR A CG2  6  
ATOM 10394 H H    . THR A 1 33  ? -4.648  -16.117 -1.659  1.00 0.00 ? 84  THR A H    6  
ATOM 10395 H HA   . THR A 1 33  ? -5.158  -13.364 -2.568  1.00 0.00 ? 84  THR A HA   6  
ATOM 10396 H HB   . THR A 1 33  ? -7.180  -15.165 -1.227  1.00 0.00 ? 84  THR A HB   6  
ATOM 10397 H HG1  . THR A 1 33  ? -6.857  -16.545 -2.742  1.00 0.00 ? 84  THR A HG1  6  
ATOM 10398 H HG21 . THR A 1 33  ? -7.299  -13.071 -3.415  1.00 0.00 ? 84  THR A HG21 6  
ATOM 10399 H HG22 . THR A 1 33  ? -8.669  -14.062 -2.917  1.00 0.00 ? 84  THR A HG22 6  
ATOM 10400 H HG23 . THR A 1 33  ? -7.943  -12.929 -1.778  1.00 0.00 ? 84  THR A HG23 6  
ATOM 10401 N N    . LEU A 1 34  ? -4.247  -13.549 0.227   1.00 0.00 ? 85  LEU A N    6  
ATOM 10402 C CA   . LEU A 1 34  ? -4.132  -12.978 1.606   1.00 0.00 ? 85  LEU A CA   6  
ATOM 10403 C C    . LEU A 1 34  ? -3.092  -11.854 1.578   1.00 0.00 ? 85  LEU A C    6  
ATOM 10404 O O    . LEU A 1 34  ? -1.927  -12.071 1.834   1.00 0.00 ? 85  LEU A O    6  
ATOM 10405 C CB   . LEU A 1 34  ? -3.677  -14.090 2.564   1.00 0.00 ? 85  LEU A CB   6  
ATOM 10406 C CG   . LEU A 1 34  ? -3.547  -13.562 4.005   1.00 0.00 ? 85  LEU A CG   6  
ATOM 10407 C CD1  . LEU A 1 34  ? -4.933  -13.305 4.613   1.00 0.00 ? 85  LEU A CD1  6  
ATOM 10408 C CD2  . LEU A 1 34  ? -2.815  -14.610 4.849   1.00 0.00 ? 85  LEU A CD2  6  
ATOM 10409 H H    . LEU A 1 34  ? -3.463  -13.970 -0.188  1.00 0.00 ? 85  LEU A H    6  
ATOM 10410 H HA   . LEU A 1 34  ? -5.080  -12.595 1.930   1.00 0.00 ? 85  LEU A HA   6  
ATOM 10411 H HB2  . LEU A 1 34  ? -4.400  -14.890 2.541   1.00 0.00 ? 85  LEU A HB2  6  
ATOM 10412 H HB3  . LEU A 1 34  ? -2.721  -14.468 2.239   1.00 0.00 ? 85  LEU A HB3  6  
ATOM 10413 H HG   . LEU A 1 34  ? -2.980  -12.643 4.009   1.00 0.00 ? 85  LEU A HG   6  
ATOM 10414 H HD11 . LEU A 1 34  ? -5.600  -14.116 4.366   1.00 0.00 ? 85  LEU A HD11 6  
ATOM 10415 H HD12 . LEU A 1 34  ? -4.847  -13.230 5.687   1.00 0.00 ? 85  LEU A HD12 6  
ATOM 10416 H HD13 . LEU A 1 34  ? -5.331  -12.379 4.225   1.00 0.00 ? 85  LEU A HD13 6  
ATOM 10417 H HD21 . LEU A 1 34  ? -3.271  -15.578 4.697   1.00 0.00 ? 85  LEU A HD21 6  
ATOM 10418 H HD22 . LEU A 1 34  ? -1.778  -14.652 4.552   1.00 0.00 ? 85  LEU A HD22 6  
ATOM 10419 H HD23 . LEU A 1 34  ? -2.877  -14.344 5.892   1.00 0.00 ? 85  LEU A HD23 6  
ATOM 10420 N N    . PRO A 1 35  ? -3.516  -10.659 1.247   1.00 0.00 ? 86  PRO A N    6  
ATOM 10421 C CA   . PRO A 1 35  ? -2.630  -9.472  1.159   1.00 0.00 ? 86  PRO A CA   6  
ATOM 10422 C C    . PRO A 1 35  ? -2.580  -8.700  2.477   1.00 0.00 ? 86  PRO A C    6  
ATOM 10423 O O    . PRO A 1 35  ? -2.794  -9.255  3.535   1.00 0.00 ? 86  PRO A O    6  
ATOM 10424 C CB   . PRO A 1 35  ? -3.325  -8.654  0.079   1.00 0.00 ? 86  PRO A CB   6  
ATOM 10425 C CG   . PRO A 1 35  ? -4.776  -8.850  0.373   1.00 0.00 ? 86  PRO A CG   6  
ATOM 10426 C CD   . PRO A 1 35  ? -4.903  -10.284 0.919   1.00 0.00 ? 86  PRO A CD   6  
ATOM 10427 H HA   . PRO A 1 35  ? -1.644  -9.748  0.831   1.00 0.00 ? 86  PRO A HA   6  
ATOM 10428 H HB2  . PRO A 1 35  ? -3.053  -7.612  0.148   1.00 0.00 ? 86  PRO A HB2  6  
ATOM 10429 H HB3  . PRO A 1 35  ? -3.086  -9.043  -0.896  1.00 0.00 ? 86  PRO A HB3  6  
ATOM 10430 H HG2  . PRO A 1 35  ? -5.103  -8.132  1.117   1.00 0.00 ? 86  PRO A HG2  6  
ATOM 10431 H HG3  . PRO A 1 35  ? -5.361  -8.745  -0.528  1.00 0.00 ? 86  PRO A HG3  6  
ATOM 10432 H HD2  . PRO A 1 35  ? -5.520  -10.300 1.807   1.00 0.00 ? 86  PRO A HD2  6  
ATOM 10433 H HD3  . PRO A 1 35  ? -5.301  -10.946 0.165   1.00 0.00 ? 86  PRO A HD3  6  
ATOM 10434 N N    . ILE A 1 36  ? -2.308  -7.420  2.414   1.00 0.00 ? 87  ILE A N    6  
ATOM 10435 C CA   . ILE A 1 36  ? -2.251  -6.588  3.651   1.00 0.00 ? 87  ILE A CA   6  
ATOM 10436 C C    . ILE A 1 36  ? -3.044  -5.293  3.445   1.00 0.00 ? 87  ILE A C    6  
ATOM 10437 O O    . ILE A 1 36  ? -3.182  -4.808  2.339   1.00 0.00 ? 87  ILE A O    6  
ATOM 10438 C CB   . ILE A 1 36  ? -0.789  -6.273  3.962   1.00 0.00 ? 87  ILE A CB   6  
ATOM 10439 C CG1  . ILE A 1 36  ? -0.152  -5.507  2.798   1.00 0.00 ? 87  ILE A CG1  6  
ATOM 10440 C CG2  . ILE A 1 36  ? -0.034  -7.576  4.165   1.00 0.00 ? 87  ILE A CG2  6  
ATOM 10441 C CD1  . ILE A 1 36  ? 1.205   -4.972  3.242   1.00 0.00 ? 87  ILE A CD1  6  
ATOM 10442 H H    . ILE A 1 36  ? -2.146  -7.000  1.542   1.00 0.00 ? 87  ILE A H    6  
ATOM 10443 H HA   . ILE A 1 36  ? -2.681  -7.131  4.480   1.00 0.00 ? 87  ILE A HA   6  
ATOM 10444 H HB   . ILE A 1 36  ? -0.729  -5.684  4.860   1.00 0.00 ? 87  ILE A HB   6  
ATOM 10445 H HG12 . ILE A 1 36  ? -0.018  -6.174  1.959   1.00 0.00 ? 87  ILE A HG12 6  
ATOM 10446 H HG13 . ILE A 1 36  ? -0.779  -4.682  2.507   1.00 0.00 ? 87  ILE A HG13 6  
ATOM 10447 H HG21 . ILE A 1 36  ? -0.498  -8.142  4.961   1.00 0.00 ? 87  ILE A HG21 6  
ATOM 10448 H HG22 . ILE A 1 36  ? -0.063  -8.142  3.249   1.00 0.00 ? 87  ILE A HG22 6  
ATOM 10449 H HG23 . ILE A 1 36  ? 0.990   -7.357  4.424   1.00 0.00 ? 87  ILE A HG23 6  
ATOM 10450 H HD11 . ILE A 1 36  ? 1.069   -4.316  4.092   1.00 0.00 ? 87  ILE A HD11 6  
ATOM 10451 H HD12 . ILE A 1 36  ? 1.846   -5.799  3.517   1.00 0.00 ? 87  ILE A HD12 6  
ATOM 10452 H HD13 . ILE A 1 36  ? 1.655   -4.422  2.432   1.00 0.00 ? 87  ILE A HD13 6  
ATOM 10453 N N    . ALA A 1 37  ? -3.555  -4.727  4.510   1.00 0.00 ? 88  ALA A N    6  
ATOM 10454 C CA   . ALA A 1 37  ? -4.337  -3.453  4.405   1.00 0.00 ? 88  ALA A CA   6  
ATOM 10455 C C    . ALA A 1 37  ? -3.718  -2.405  5.335   1.00 0.00 ? 88  ALA A C    6  
ATOM 10456 O O    . ALA A 1 37  ? -3.403  -2.684  6.475   1.00 0.00 ? 88  ALA A O    6  
ATOM 10457 C CB   . ALA A 1 37  ? -5.786  -3.726  4.820   1.00 0.00 ? 88  ALA A CB   6  
ATOM 10458 H H    . ALA A 1 37  ? -3.416  -5.137  5.388   1.00 0.00 ? 88  ALA A H    6  
ATOM 10459 H HA   . ALA A 1 37  ? -4.320  -3.079  3.389   1.00 0.00 ? 88  ALA A HA   6  
ATOM 10460 H HB1  . ALA A 1 37  ? -5.798  -4.249  5.767   1.00 0.00 ? 88  ALA A HB1  6  
ATOM 10461 H HB2  . ALA A 1 37  ? -6.320  -2.791  4.916   1.00 0.00 ? 88  ALA A HB2  6  
ATOM 10462 H HB3  . ALA A 1 37  ? -6.263  -4.339  4.066   1.00 0.00 ? 88  ALA A HB3  6  
ATOM 10463 N N    . PHE A 1 38  ? -3.543  -1.196  4.852   1.00 0.00 ? 89  PHE A N    6  
ATOM 10464 C CA   . PHE A 1 38  ? -2.942  -0.107  5.691   1.00 0.00 ? 89  PHE A CA   6  
ATOM 10465 C C    . PHE A 1 38  ? -3.918  1.055   5.793   1.00 0.00 ? 89  PHE A C    6  
ATOM 10466 O O    . PHE A 1 38  ? -4.865  1.142   5.041   1.00 0.00 ? 89  PHE A O    6  
ATOM 10467 C CB   . PHE A 1 38  ? -1.646  0.400   5.046   1.00 0.00 ? 89  PHE A CB   6  
ATOM 10468 C CG   . PHE A 1 38  ? -1.915  0.891   3.635   1.00 0.00 ? 89  PHE A CG   6  
ATOM 10469 C CD1  . PHE A 1 38  ? -2.179  -0.023  2.600   1.00 0.00 ? 89  PHE A CD1  6  
ATOM 10470 C CD2  . PHE A 1 38  ? -1.875  2.264   3.356   1.00 0.00 ? 89  PHE A CD2  6  
ATOM 10471 C CE1  . PHE A 1 38  ? -2.407  0.445   1.295   1.00 0.00 ? 89  PHE A CE1  6  
ATOM 10472 C CE2  . PHE A 1 38  ? -2.097  2.723   2.055   1.00 0.00 ? 89  PHE A CE2  6  
ATOM 10473 C CZ   . PHE A 1 38  ? -2.365  1.816   1.026   1.00 0.00 ? 89  PHE A CZ   6  
ATOM 10474 H H    . PHE A 1 38  ? -3.810  -1.002  3.929   1.00 0.00 ? 89  PHE A H    6  
ATOM 10475 H HA   . PHE A 1 38  ? -2.723  -0.476  6.683   1.00 0.00 ? 89  PHE A HA   6  
ATOM 10476 H HB2  . PHE A 1 38  ? -1.254  1.216   5.636   1.00 0.00 ? 89  PHE A HB2  6  
ATOM 10477 H HB3  . PHE A 1 38  ? -0.924  -0.396  5.014   1.00 0.00 ? 89  PHE A HB3  6  
ATOM 10478 H HD1  . PHE A 1 38  ? -2.210  -1.082  2.805   1.00 0.00 ? 89  PHE A HD1  6  
ATOM 10479 H HD2  . PHE A 1 38  ? -1.675  2.969   4.151   1.00 0.00 ? 89  PHE A HD2  6  
ATOM 10480 H HE1  . PHE A 1 38  ? -2.615  -0.252  0.496   1.00 0.00 ? 89  PHE A HE1  6  
ATOM 10481 H HE2  . PHE A 1 38  ? -2.064  3.780   1.846   1.00 0.00 ? 89  PHE A HE2  6  
ATOM 10482 H HZ   . PHE A 1 38  ? -2.535  2.173   0.021   1.00 0.00 ? 89  PHE A HZ   6  
ATOM 10483 N N    . LYS A 1 39  ? -3.692  1.962   6.709   1.00 0.00 ? 90  LYS A N    6  
ATOM 10484 C CA   . LYS A 1 39  ? -4.599  3.135   6.852   1.00 0.00 ? 90  LYS A CA   6  
ATOM 10485 C C    . LYS A 1 39  ? -3.770  4.377   6.580   1.00 0.00 ? 90  LYS A C    6  
ATOM 10486 O O    . LYS A 1 39  ? -2.599  4.435   6.910   1.00 0.00 ? 90  LYS A O    6  
ATOM 10487 C CB   . LYS A 1 39  ? -5.200  3.190   8.266   1.00 0.00 ? 90  LYS A CB   6  
ATOM 10488 C CG   . LYS A 1 39  ? -4.133  3.556   9.303   1.00 0.00 ? 90  LYS A CG   6  
ATOM 10489 C CD   . LYS A 1 39  ? -4.712  3.353   10.706  1.00 0.00 ? 90  LYS A CD   6  
ATOM 10490 C CE   . LYS A 1 39  ? -3.773  3.968   11.747  1.00 0.00 ? 90  LYS A CE   6  
ATOM 10491 N NZ   . LYS A 1 39  ? -4.391  3.867   13.102  1.00 0.00 ? 90  LYS A NZ   6  
ATOM 10492 H H    . LYS A 1 39  ? -2.912  1.874   7.296   1.00 0.00 ? 90  LYS A H    6  
ATOM 10493 H HA   . LYS A 1 39  ? -5.399  3.084   6.122   1.00 0.00 ? 90  LYS A HA   6  
ATOM 10494 H HB2  . LYS A 1 39  ? -5.983  3.932   8.290   1.00 0.00 ? 90  LYS A HB2  6  
ATOM 10495 H HB3  . LYS A 1 39  ? -5.618  2.225   8.511   1.00 0.00 ? 90  LYS A HB3  6  
ATOM 10496 H HG2  . LYS A 1 39  ? -3.272  2.922   9.174   1.00 0.00 ? 90  LYS A HG2  6  
ATOM 10497 H HG3  . LYS A 1 39  ? -3.846  4.590   9.180   1.00 0.00 ? 90  LYS A HG3  6  
ATOM 10498 H HD2  . LYS A 1 39  ? -5.678  3.828   10.767  1.00 0.00 ? 90  LYS A HD2  6  
ATOM 10499 H HD3  . LYS A 1 39  ? -4.818  2.295   10.901  1.00 0.00 ? 90  LYS A HD3  6  
ATOM 10500 H HE2  . LYS A 1 39  ? -2.830  3.440   11.740  1.00 0.00 ? 90  LYS A HE2  6  
ATOM 10501 H HE3  . LYS A 1 39  ? -3.605  5.008   11.505  1.00 0.00 ? 90  LYS A HE3  6  
ATOM 10502 H HZ1  . LYS A 1 39  ? -5.317  4.348   13.098  1.00 0.00 ? 90  LYS A HZ1  6  
ATOM 10503 H HZ2  . LYS A 1 39  ? -4.527  2.865   13.351  1.00 0.00 ? 90  LYS A HZ2  6  
ATOM 10504 H HZ3  . LYS A 1 39  ? -3.769  4.319   13.804  1.00 0.00 ? 90  LYS A HZ3  6  
ATOM 10505 N N    . VAL A 1 40  ? -4.347  5.351   5.936   1.00 0.00 ? 91  VAL A N    6  
ATOM 10506 C CA   . VAL A 1 40  ? -3.574  6.579   5.593   1.00 0.00 ? 91  VAL A CA   6  
ATOM 10507 C C    . VAL A 1 40  ? -3.987  7.709   6.517   1.00 0.00 ? 91  VAL A C    6  
ATOM 10508 O O    . VAL A 1 40  ? -5.142  8.053   6.613   1.00 0.00 ? 91  VAL A O    6  
ATOM 10509 C CB   . VAL A 1 40  ? -3.882  6.969   4.149   1.00 0.00 ? 91  VAL A CB   6  
ATOM 10510 C CG1  . VAL A 1 40  ? -2.842  7.983   3.661   1.00 0.00 ? 91  VAL A CG1  6  
ATOM 10511 C CG2  . VAL A 1 40  ? -3.852  5.714   3.282   1.00 0.00 ? 91  VAL A CG2  6  
ATOM 10512 H H    . VAL A 1 40  ? -5.279  5.262   5.647   1.00 0.00 ? 91  VAL A H    6  
ATOM 10513 H HA   . VAL A 1 40  ? -2.513  6.401   5.694   1.00 0.00 ? 91  VAL A HA   6  
ATOM 10514 H HB   . VAL A 1 40  ? -4.864  7.417   4.098   1.00 0.00 ? 91  VAL A HB   6  
ATOM 10515 H HG11 . VAL A 1 40  ? -1.853  7.569   3.778   1.00 0.00 ? 91  VAL A HG11 6  
ATOM 10516 H HG12 . VAL A 1 40  ? -3.019  8.205   2.620   1.00 0.00 ? 91  VAL A HG12 6  
ATOM 10517 H HG13 . VAL A 1 40  ? -2.923  8.888   4.248   1.00 0.00 ? 91  VAL A HG13 6  
ATOM 10518 H HG21 . VAL A 1 40  ? -2.982  5.123   3.528   1.00 0.00 ? 91  VAL A HG21 6  
ATOM 10519 H HG22 . VAL A 1 40  ? -4.745  5.136   3.471   1.00 0.00 ? 91  VAL A HG22 6  
ATOM 10520 H HG23 . VAL A 1 40  ? -3.816  5.993   2.240   1.00 0.00 ? 91  VAL A HG23 6  
ATOM 10521 N N    . VAL A 1 41  ? -3.036  8.302   7.182   1.00 0.00 ? 92  VAL A N    6  
ATOM 10522 C CA   . VAL A 1 41  ? -3.338  9.433   8.101   1.00 0.00 ? 92  VAL A CA   6  
ATOM 10523 C C    . VAL A 1 41  ? -3.003  10.724  7.374   1.00 0.00 ? 92  VAL A C    6  
ATOM 10524 O O    . VAL A 1 41  ? -1.927  10.879  6.835   1.00 0.00 ? 92  VAL A O    6  
ATOM 10525 C CB   . VAL A 1 41  ? -2.456  9.307   9.342   1.00 0.00 ? 92  VAL A CB   6  
ATOM 10526 C CG1  . VAL A 1 41  ? -2.746  10.457  10.313  1.00 0.00 ? 92  VAL A CG1  6  
ATOM 10527 C CG2  . VAL A 1 41  ? -2.746  7.968   10.024  1.00 0.00 ? 92  VAL A CG2  6  
ATOM 10528 H H    . VAL A 1 41  ? -2.116  8.007   7.068   1.00 0.00 ? 92  VAL A H    6  
ATOM 10529 H HA   . VAL A 1 41  ? -4.382  9.428   8.383   1.00 0.00 ? 92  VAL A HA   6  
ATOM 10530 H HB   . VAL A 1 41  ? -1.417  9.343   9.047   1.00 0.00 ? 92  VAL A HB   6  
ATOM 10531 H HG11 . VAL A 1 41  ? -3.814  10.595  10.404  1.00 0.00 ? 92  VAL A HG11 6  
ATOM 10532 H HG12 . VAL A 1 41  ? -2.329  10.223  11.284  1.00 0.00 ? 92  VAL A HG12 6  
ATOM 10533 H HG13 . VAL A 1 41  ? -2.294  11.364  9.937   1.00 0.00 ? 92  VAL A HG13 6  
ATOM 10534 H HG21 . VAL A 1 41  ? -2.779  7.183   9.284   1.00 0.00 ? 92  VAL A HG21 6  
ATOM 10535 H HG22 . VAL A 1 41  ? -1.969  7.752   10.738  1.00 0.00 ? 92  VAL A HG22 6  
ATOM 10536 H HG23 . VAL A 1 41  ? -3.700  8.023   10.530  1.00 0.00 ? 92  VAL A HG23 6  
ATOM 10537 N N    . ALA A 1 42  ? -3.928  11.643  7.346   1.00 0.00 ? 93  ALA A N    6  
ATOM 10538 C CA   . ALA A 1 42  ? -3.699  12.934  6.638   1.00 0.00 ? 93  ALA A CA   6  
ATOM 10539 C C    . ALA A 1 42  ? -3.702  14.077  7.657   1.00 0.00 ? 93  ALA A C    6  
ATOM 10540 O O    . ALA A 1 42  ? -4.678  14.315  8.338   1.00 0.00 ? 93  ALA A O    6  
ATOM 10541 C CB   . ALA A 1 42  ? -4.822  13.115  5.626   1.00 0.00 ? 93  ALA A CB   6  
ATOM 10542 H H    . ALA A 1 42  ? -4.790  11.475  7.781   1.00 0.00 ? 93  ALA A H    6  
ATOM 10543 H HA   . ALA A 1 42  ? -2.756  12.915  6.120   1.00 0.00 ? 93  ALA A HA   6  
ATOM 10544 H HB1  . ALA A 1 42  ? -4.950  12.191  5.077   1.00 0.00 ? 93  ALA A HB1  6  
ATOM 10545 H HB2  . ALA A 1 42  ? -5.736  13.358  6.143   1.00 0.00 ? 93  ALA A HB2  6  
ATOM 10546 H HB3  . ALA A 1 42  ? -4.567  13.907  4.940   1.00 0.00 ? 93  ALA A HB3  6  
ATOM 10547 N N    . LEU A 1 43  ? -2.605  14.778  7.779   1.00 0.00 ? 94  LEU A N    6  
ATOM 10548 C CA   . LEU A 1 43  ? -2.529  15.893  8.769   1.00 0.00 ? 94  LEU A CA   6  
ATOM 10549 C C    . LEU A 1 43  ? -3.011  17.197  8.121   1.00 0.00 ? 94  LEU A C    6  
ATOM 10550 O O    . LEU A 1 43  ? -2.930  18.261  8.704   1.00 0.00 ? 94  LEU A O    6  
ATOM 10551 C CB   . LEU A 1 43  ? -1.076  16.059  9.227   1.00 0.00 ? 94  LEU A CB   6  
ATOM 10552 C CG   . LEU A 1 43  ? -0.509  14.701  9.646   1.00 0.00 ? 94  LEU A CG   6  
ATOM 10553 C CD1  . LEU A 1 43  ? 0.908   14.898  10.183  1.00 0.00 ? 94  LEU A CD1  6  
ATOM 10554 C CD2  . LEU A 1 43  ? -1.380  14.091  10.747  1.00 0.00 ? 94  LEU A CD2  6  
ATOM 10555 H H    . LEU A 1 43  ? -1.823  14.559  7.229   1.00 0.00 ? 94  LEU A H    6  
ATOM 10556 H HA   . LEU A 1 43  ? -3.150  15.669  9.624   1.00 0.00 ? 94  LEU A HA   6  
ATOM 10557 H HB2  . LEU A 1 43  ? -0.481  16.466  8.415   1.00 0.00 ? 94  LEU A HB2  6  
ATOM 10558 H HB3  . LEU A 1 43  ? -1.041  16.731  10.070  1.00 0.00 ? 94  LEU A HB3  6  
ATOM 10559 H HG   . LEU A 1 43  ? -0.485  14.037  8.792   1.00 0.00 ? 94  LEU A HG   6  
ATOM 10560 H HD11 . LEU A 1 43  ? 1.465   15.535  9.512   1.00 0.00 ? 94  LEU A HD11 6  
ATOM 10561 H HD12 . LEU A 1 43  ? 0.859   15.358  11.158  1.00 0.00 ? 94  LEU A HD12 6  
ATOM 10562 H HD13 . LEU A 1 43  ? 1.397   13.938  10.263  1.00 0.00 ? 94  LEU A HD13 6  
ATOM 10563 H HD21 . LEU A 1 43  ? -1.675  14.863  11.444  1.00 0.00 ? 94  LEU A HD21 6  
ATOM 10564 H HD22 . LEU A 1 43  ? -2.259  13.649  10.306  1.00 0.00 ? 94  LEU A HD22 6  
ATOM 10565 H HD23 . LEU A 1 43  ? -0.821  13.326  11.270  1.00 0.00 ? 94  LEU A HD23 6  
ATOM 10566 N N    . GLY A 1 44  ? -3.509  17.125  6.914   1.00 0.00 ? 95  GLY A N    6  
ATOM 10567 C CA   . GLY A 1 44  ? -3.990  18.359  6.222   1.00 0.00 ? 95  GLY A CA   6  
ATOM 10568 C C    . GLY A 1 44  ? -5.467  18.601  6.524   1.00 0.00 ? 95  GLY A C    6  
ATOM 10569 O O    . GLY A 1 44  ? -6.047  18.005  7.415   1.00 0.00 ? 95  GLY A O    6  
ATOM 10570 H H    . GLY A 1 44  ? -3.562  16.259  6.458   1.00 0.00 ? 95  GLY A H    6  
ATOM 10571 H HA2  . GLY A 1 44  ? -3.417  19.212  6.548   1.00 0.00 ? 95  GLY A HA2  6  
ATOM 10572 H HA3  . GLY A 1 44  ? -3.871  18.234  5.154   1.00 0.00 ? 95  GLY A HA3  6  
ATOM 10573 N N    . ASP A 1 45  ? -6.077  19.474  5.769   1.00 0.00 ? 96  ASP A N    6  
ATOM 10574 C CA   . ASP A 1 45  ? -7.516  19.785  5.965   1.00 0.00 ? 96  ASP A CA   6  
ATOM 10575 C C    . ASP A 1 45  ? -8.341  18.803  5.154   1.00 0.00 ? 96  ASP A C    6  
ATOM 10576 O O    . ASP A 1 45  ? -8.456  18.923  3.953   1.00 0.00 ? 96  ASP A O    6  
ATOM 10577 C CB   . ASP A 1 45  ? -7.785  21.199  5.449   1.00 0.00 ? 96  ASP A CB   6  
ATOM 10578 C CG   . ASP A 1 45  ? -7.129  22.206  6.392   1.00 0.00 ? 96  ASP A CG   6  
ATOM 10579 O OD1  . ASP A 1 45  ? -7.384  22.120  7.581   1.00 0.00 ? 96  ASP A OD1  6  
ATOM 10580 O OD2  . ASP A 1 45  ? -6.385  23.046  5.911   1.00 0.00 ? 96  ASP A OD2  6  
ATOM 10581 H H    . ASP A 1 45  ? -5.582  19.926  5.059   1.00 0.00 ? 96  ASP A H    6  
ATOM 10582 H HA   . ASP A 1 45  ? -7.778  19.717  7.008   1.00 0.00 ? 96  ASP A HA   6  
ATOM 10583 H HB2  . ASP A 1 45  ? -7.370  21.306  4.454   1.00 0.00 ? 96  ASP A HB2  6  
ATOM 10584 H HB3  . ASP A 1 45  ? -8.849  21.373  5.417   1.00 0.00 ? 96  ASP A HB3  6  
ATOM 10585 N N    . VAL A 1 46  ? -8.928  17.836  5.788   1.00 0.00 ? 97  VAL A N    6  
ATOM 10586 C CA   . VAL A 1 46  ? -9.740  16.879  5.011   1.00 0.00 ? 97  VAL A CA   6  
ATOM 10587 C C    . VAL A 1 46  ? -10.588 16.024  5.956   1.00 0.00 ? 97  VAL A C    6  
ATOM 10588 O O    . VAL A 1 46  ? -10.397 14.837  6.084   1.00 0.00 ? 97  VAL A O    6  
ATOM 10589 C CB   . VAL A 1 46  ? -8.801  15.995  4.174   1.00 0.00 ? 97  VAL A CB   6  
ATOM 10590 C CG1  . VAL A 1 46  ? -7.813  15.243  5.088   1.00 0.00 ? 97  VAL A CG1  6  
ATOM 10591 C CG2  . VAL A 1 46  ? -9.629  15.000  3.347   1.00 0.00 ? 97  VAL A CG2  6  
ATOM 10592 H H    . VAL A 1 46  ? -8.839  17.745  6.759   1.00 0.00 ? 97  VAL A H    6  
ATOM 10593 H HA   . VAL A 1 46  ? -10.387 17.431  4.350   1.00 0.00 ? 97  VAL A HA   6  
ATOM 10594 H HB   . VAL A 1 46  ? -8.239  16.631  3.502   1.00 0.00 ? 97  VAL A HB   6  
ATOM 10595 H HG11 . VAL A 1 46  ? -7.587  15.847  5.957   1.00 0.00 ? 97  VAL A HG11 6  
ATOM 10596 H HG12 . VAL A 1 46  ? -8.247  14.307  5.407   1.00 0.00 ? 97  VAL A HG12 6  
ATOM 10597 H HG13 . VAL A 1 46  ? -6.899  15.044  4.544   1.00 0.00 ? 97  VAL A HG13 6  
ATOM 10598 H HG21 . VAL A 1 46  ? -10.517 15.490  2.980   1.00 0.00 ? 97  VAL A HG21 6  
ATOM 10599 H HG22 . VAL A 1 46  ? -9.041  14.647  2.515   1.00 0.00 ? 97  VAL A HG22 6  
ATOM 10600 H HG23 . VAL A 1 46  ? -9.911  14.166  3.961   1.00 0.00 ? 97  VAL A HG23 6  
ATOM 10601 N N    . PRO A 1 47  ? -11.539 16.629  6.608   1.00 0.00 ? 98  PRO A N    6  
ATOM 10602 C CA   . PRO A 1 47  ? -12.452 15.916  7.534   1.00 0.00 ? 98  PRO A CA   6  
ATOM 10603 C C    . PRO A 1 47  ? -13.708 15.435  6.802   1.00 0.00 ? 98  PRO A C    6  
ATOM 10604 O O    . PRO A 1 47  ? -14.500 14.678  7.329   1.00 0.00 ? 98  PRO A O    6  
ATOM 10605 C CB   . PRO A 1 47  ? -12.804 17.002  8.546   1.00 0.00 ? 98  PRO A CB   6  
ATOM 10606 C CG   . PRO A 1 47  ? -12.850 18.264  7.730   1.00 0.00 ? 98  PRO A CG   6  
ATOM 10607 C CD   . PRO A 1 47  ? -11.863 18.068  6.556   1.00 0.00 ? 98  PRO A CD   6  
ATOM 10608 H HA   . PRO A 1 47  ? -11.952 15.093  8.021   1.00 0.00 ? 98  PRO A HA   6  
ATOM 10609 H HB2  . PRO A 1 47  ? -13.768 16.797  9.001   1.00 0.00 ? 98  PRO A HB2  6  
ATOM 10610 H HB3  . PRO A 1 47  ? -12.037 17.072  9.302   1.00 0.00 ? 98  PRO A HB3  6  
ATOM 10611 H HG2  . PRO A 1 47  ? -13.856 18.424  7.354   1.00 0.00 ? 98  PRO A HG2  6  
ATOM 10612 H HG3  . PRO A 1 47  ? -12.543 19.110  8.331   1.00 0.00 ? 98  PRO A HG3  6  
ATOM 10613 H HD2  . PRO A 1 47  ? -12.334 18.324  5.614   1.00 0.00 ? 98  PRO A HD2  6  
ATOM 10614 H HD3  . PRO A 1 47  ? -10.973 18.656  6.702   1.00 0.00 ? 98  PRO A HD3  6  
ATOM 10615 N N    . ASP A 1 48  ? -13.903 15.893  5.597   1.00 0.00 ? 99  ASP A N    6  
ATOM 10616 C CA   . ASP A 1 48  ? -15.115 15.489  4.830   1.00 0.00 ? 99  ASP A CA   6  
ATOM 10617 C C    . ASP A 1 48  ? -14.911 14.112  4.213   1.00 0.00 ? 99  ASP A C    6  
ATOM 10618 O O    . ASP A 1 48  ? -13.845 13.535  4.294   1.00 0.00 ? 99  ASP A O    6  
ATOM 10619 C CB   . ASP A 1 48  ? -15.392 16.518  3.735   1.00 0.00 ? 99  ASP A CB   6  
ATOM 10620 C CG   . ASP A 1 48  ? -14.258 16.497  2.705   1.00 0.00 ? 99  ASP A CG   6  
ATOM 10621 O OD1  . ASP A 1 48  ? -13.320 15.738  2.902   1.00 0.00 ? 99  ASP A OD1  6  
ATOM 10622 O OD2  . ASP A 1 48  ? -14.349 17.240  1.740   1.00 0.00 ? 99  ASP A OD2  6  
ATOM 10623 H H    . ASP A 1 48  ? -13.255 16.513  5.199   1.00 0.00 ? 99  ASP A H    6  
ATOM 10624 H HA   . ASP A 1 48  ? -15.961 15.450  5.500   1.00 0.00 ? 99  ASP A HA   6  
ATOM 10625 H HB2  . ASP A 1 48  ? -16.326 16.285  3.250   1.00 0.00 ? 99  ASP A HB2  6  
ATOM 10626 H HB3  . ASP A 1 48  ? -15.453 17.498  4.176   1.00 0.00 ? 99  ASP A HB3  6  
ATOM 10627 N N    . GLY A 1 49  ? -15.924 13.577  3.593   1.00 0.00 ? 100 GLY A N    6  
ATOM 10628 C CA   . GLY A 1 49  ? -15.783 12.235  2.974   1.00 0.00 ? 100 GLY A CA   6  
ATOM 10629 C C    . GLY A 1 49  ? -15.227 12.398  1.565   1.00 0.00 ? 100 GLY A C    6  
ATOM 10630 O O    . GLY A 1 49  ? -15.885 12.920  0.687   1.00 0.00 ? 100 GLY A O    6  
ATOM 10631 H H    . GLY A 1 49  ? -16.776 14.059  3.539   1.00 0.00 ? 100 GLY A H    6  
ATOM 10632 H HA2  . GLY A 1 49  ? -15.105 11.636  3.563   1.00 0.00 ? 100 GLY A HA2  6  
ATOM 10633 H HA3  . GLY A 1 49  ? -16.746 11.754  2.930   1.00 0.00 ? 100 GLY A HA3  6  
ATOM 10634 N N    . THR A 1 50  ? -14.012 11.954  1.341   1.00 0.00 ? 101 THR A N    6  
ATOM 10635 C CA   . THR A 1 50  ? -13.386 12.078  -0.021  1.00 0.00 ? 101 THR A CA   6  
ATOM 10636 C C    . THR A 1 50  ? -13.015 10.690  -0.541  1.00 0.00 ? 101 THR A C    6  
ATOM 10637 O O    . THR A 1 50  ? -13.523 9.695   -0.071  1.00 0.00 ? 101 THR A O    6  
ATOM 10638 C CB   . THR A 1 50  ? -12.135 12.964  0.046   1.00 0.00 ? 101 THR A CB   6  
ATOM 10639 O OG1  . THR A 1 50  ? -11.505 12.970  -1.224  1.00 0.00 ? 101 THR A OG1  6  
ATOM 10640 C CG2  . THR A 1 50  ? -11.155 12.437  1.094   1.00 0.00 ? 101 THR A CG2  6  
ATOM 10641 H H    . THR A 1 50  ? -13.506 11.535  2.076   1.00 0.00 ? 101 THR A H    6  
ATOM 10642 H HA   . THR A 1 50  ? -14.090 12.524  -0.708  1.00 0.00 ? 101 THR A HA   6  
ATOM 10643 H HB   . THR A 1 50  ? -12.425 13.971  0.307   1.00 0.00 ? 101 THR A HB   6  
ATOM 10644 H HG1  . THR A 1 50  ? -11.929 13.639  -1.763  1.00 0.00 ? 101 THR A HG1  6  
ATOM 10645 H HG21 . THR A 1 50  ? -11.094 11.365  1.027   1.00 0.00 ? 101 THR A HG21 6  
ATOM 10646 H HG22 . THR A 1 50  ? -10.178 12.863  0.912   1.00 0.00 ? 101 THR A HG22 6  
ATOM 10647 H HG23 . THR A 1 50  ? -11.495 12.720  2.080   1.00 0.00 ? 101 THR A HG23 6  
ATOM 10648 N N    . LEU A 1 51  ? -12.133 10.604  -1.513  1.00 0.00 ? 102 LEU A N    6  
ATOM 10649 C CA   . LEU A 1 51  ? -11.742 9.260   -2.056  1.00 0.00 ? 102 LEU A CA   6  
ATOM 10650 C C    . LEU A 1 51  ? -10.231 9.184   -2.235  1.00 0.00 ? 102 LEU A C    6  
ATOM 10651 O O    . LEU A 1 51  ? -9.590  10.139  -2.625  1.00 0.00 ? 102 LEU A O    6  
ATOM 10652 C CB   . LEU A 1 51  ? -12.377 9.034   -3.440  1.00 0.00 ? 102 LEU A CB   6  
ATOM 10653 C CG   . LEU A 1 51  ? -13.907 8.940   -3.346  1.00 0.00 ? 102 LEU A CG   6  
ATOM 10654 C CD1  . LEU A 1 51  ? -14.518 9.252   -4.715  1.00 0.00 ? 102 LEU A CD1  6  
ATOM 10655 C CD2  . LEU A 1 51  ? -14.328 7.516   -2.947  1.00 0.00 ? 102 LEU A CD2  6  
ATOM 10656 H H    . LEU A 1 51  ? -11.731 11.422  -1.887  1.00 0.00 ? 102 LEU A H    6  
ATOM 10657 H HA   . LEU A 1 51  ? -12.055 8.481   -1.382  1.00 0.00 ? 102 LEU A HA   6  
ATOM 10658 H HB2  . LEU A 1 51  ? -12.104 9.854   -4.088  1.00 0.00 ? 102 LEU A HB2  6  
ATOM 10659 H HB3  . LEU A 1 51  ? -11.990 8.116   -3.855  1.00 0.00 ? 102 LEU A HB3  6  
ATOM 10660 H HG   . LEU A 1 51  ? -14.269 9.645   -2.616  1.00 0.00 ? 102 LEU A HG   6  
ATOM 10661 H HD11 . LEU A 1 51  ? -14.117 8.574   -5.455  1.00 0.00 ? 102 LEU A HD11 6  
ATOM 10662 H HD12 . LEU A 1 51  ? -15.594 9.138   -4.667  1.00 0.00 ? 102 LEU A HD12 6  
ATOM 10663 H HD13 . LEU A 1 51  ? -14.272 10.266  -4.996  1.00 0.00 ? 102 LEU A HD13 6  
ATOM 10664 H HD21 . LEU A 1 51  ? -13.815 7.218   -2.048  1.00 0.00 ? 102 LEU A HD21 6  
ATOM 10665 H HD22 . LEU A 1 51  ? -15.394 7.495   -2.772  1.00 0.00 ? 102 LEU A HD22 6  
ATOM 10666 H HD23 . LEU A 1 51  ? -14.084 6.831   -3.746  1.00 0.00 ? 102 LEU A HD23 6  
ATOM 10667 N N    . VAL A 1 52  ? -9.668  8.028   -1.987  1.00 0.00 ? 103 VAL A N    6  
ATOM 10668 C CA   . VAL A 1 52  ? -8.198  7.829   -2.172  1.00 0.00 ? 103 VAL A CA   6  
ATOM 10669 C C    . VAL A 1 52  ? -8.027  6.730   -3.224  1.00 0.00 ? 103 VAL A C    6  
ATOM 10670 O O    . VAL A 1 52  ? -8.643  5.689   -3.129  1.00 0.00 ? 103 VAL A O    6  
ATOM 10671 C CB   . VAL A 1 52  ? -7.558  7.388   -0.840  1.00 0.00 ? 103 VAL A CB   6  
ATOM 10672 C CG1  . VAL A 1 52  ? -6.037  7.329   -0.994  1.00 0.00 ? 103 VAL A CG1  6  
ATOM 10673 C CG2  . VAL A 1 52  ? -7.907  8.390   0.273   1.00 0.00 ? 103 VAL A CG2  6  
ATOM 10674 H H    . VAL A 1 52  ? -10.225 7.266   -1.704  1.00 0.00 ? 103 VAL A H    6  
ATOM 10675 H HA   . VAL A 1 52  ? -7.733  8.743   -2.520  1.00 0.00 ? 103 VAL A HA   6  
ATOM 10676 H HB   . VAL A 1 52  ? -7.924  6.407   -0.573  1.00 0.00 ? 103 VAL A HB   6  
ATOM 10677 H HG11 . VAL A 1 52  ? -5.781  6.682   -1.820  1.00 0.00 ? 103 VAL A HG11 6  
ATOM 10678 H HG12 . VAL A 1 52  ? -5.654  8.321   -1.182  1.00 0.00 ? 103 VAL A HG12 6  
ATOM 10679 H HG13 . VAL A 1 52  ? -5.599  6.940   -0.087  1.00 0.00 ? 103 VAL A HG13 6  
ATOM 10680 H HG21 . VAL A 1 52  ? -8.961  8.613   0.244   1.00 0.00 ? 103 VAL A HG21 6  
ATOM 10681 H HG22 . VAL A 1 52  ? -7.654  7.963   1.237   1.00 0.00 ? 103 VAL A HG22 6  
ATOM 10682 H HG23 . VAL A 1 52  ? -7.348  9.302   0.127   1.00 0.00 ? 103 VAL A HG23 6  
ATOM 10683 N N    . THR A 1 53  ? -7.221  6.949   -4.232  1.00 0.00 ? 104 THR A N    6  
ATOM 10684 C CA   . THR A 1 53  ? -7.045  5.901   -5.296  1.00 0.00 ? 104 THR A CA   6  
ATOM 10685 C C    . THR A 1 53  ? -5.561  5.558   -5.417  1.00 0.00 ? 104 THR A C    6  
ATOM 10686 O O    . THR A 1 53  ? -4.718  6.417   -5.279  1.00 0.00 ? 104 THR A O    6  
ATOM 10687 C CB   . THR A 1 53  ? -7.536  6.460   -6.628  1.00 0.00 ? 104 THR A CB   6  
ATOM 10688 O OG1  . THR A 1 53  ? -6.584  7.394   -7.107  1.00 0.00 ? 104 THR A OG1  6  
ATOM 10689 C CG2  . THR A 1 53  ? -8.885  7.162   -6.433  1.00 0.00 ? 104 THR A CG2  6  
ATOM 10690 H H    . THR A 1 53  ? -6.742  7.808   -4.304  1.00 0.00 ? 104 THR A H    6  
ATOM 10691 H HA   . THR A 1 53  ? -7.607  5.006   -5.052  1.00 0.00 ? 104 THR A HA   6  
ATOM 10692 H HB   . THR A 1 53  ? -7.648  5.658   -7.342  1.00 0.00 ? 104 THR A HB   6  
ATOM 10693 H HG1  . THR A 1 53  ? -5.812  7.348   -6.536  1.00 0.00 ? 104 THR A HG1  6  
ATOM 10694 H HG21 . THR A 1 53  ? -9.546  6.531   -5.859  1.00 0.00 ? 104 THR A HG21 6  
ATOM 10695 H HG22 . THR A 1 53  ? -8.732  8.094   -5.906  1.00 0.00 ? 104 THR A HG22 6  
ATOM 10696 H HG23 . THR A 1 53  ? -9.328  7.364   -7.398  1.00 0.00 ? 104 THR A HG23 6  
ATOM 10697 N N    . VAL A 1 54  ? -5.240  4.309   -5.662  1.00 0.00 ? 105 VAL A N    6  
ATOM 10698 C CA   . VAL A 1 54  ? -3.802  3.902   -5.779  1.00 0.00 ? 105 VAL A CA   6  
ATOM 10699 C C    . VAL A 1 54  ? -3.589  2.853   -6.897  1.00 0.00 ? 105 VAL A C    6  
ATOM 10700 O O    . VAL A 1 54  ? -4.461  2.066   -7.211  1.00 0.00 ? 105 VAL A O    6  
ATOM 10701 C CB   . VAL A 1 54  ? -3.352  3.333   -4.427  1.00 0.00 ? 105 VAL A CB   6  
ATOM 10702 C CG1  . VAL A 1 54  ? -4.291  2.196   -3.999  1.00 0.00 ? 105 VAL A CG1  6  
ATOM 10703 C CG2  . VAL A 1 54  ? -1.906  2.825   -4.546  1.00 0.00 ? 105 VAL A CG2  6  
ATOM 10704 H H    . VAL A 1 54  ? -5.944  3.635   -5.757  1.00 0.00 ? 105 VAL A H    6  
ATOM 10705 H HA   . VAL A 1 54  ? -3.201  4.771   -6.002  1.00 0.00 ? 105 VAL A HA   6  
ATOM 10706 H HB   . VAL A 1 54  ? -3.394  4.118   -3.683  1.00 0.00 ? 105 VAL A HB   6  
ATOM 10707 H HG11 . VAL A 1 54  ? -4.558  1.599   -4.853  1.00 0.00 ? 105 VAL A HG11 6  
ATOM 10708 H HG12 . VAL A 1 54  ? -3.802  1.576   -3.262  1.00 0.00 ? 105 VAL A HG12 6  
ATOM 10709 H HG13 . VAL A 1 54  ? -5.190  2.620   -3.568  1.00 0.00 ? 105 VAL A HG13 6  
ATOM 10710 H HG21 . VAL A 1 54  ? -1.328  3.522   -5.137  1.00 0.00 ? 105 VAL A HG21 6  
ATOM 10711 H HG22 . VAL A 1 54  ? -1.470  2.742   -3.560  1.00 0.00 ? 105 VAL A HG22 6  
ATOM 10712 H HG23 . VAL A 1 54  ? -1.897  1.860   -5.022  1.00 0.00 ? 105 VAL A HG23 6  
ATOM 10713 N N    . MET A 1 55  ? -2.402  2.834   -7.466  1.00 0.00 ? 106 MET A N    6  
ATOM 10714 C CA   . MET A 1 55  ? -2.040  1.843   -8.535  1.00 0.00 ? 106 MET A CA   6  
ATOM 10715 C C    . MET A 1 55  ? -0.602  1.416   -8.245  1.00 0.00 ? 106 MET A C    6  
ATOM 10716 O O    . MET A 1 55  ? 0.059   2.070   -7.478  1.00 0.00 ? 106 MET A O    6  
ATOM 10717 C CB   . MET A 1 55  ? -2.135  2.480   -9.931  1.00 0.00 ? 106 MET A CB   6  
ATOM 10718 C CG   . MET A 1 55  ? -1.039  3.540   -10.122 1.00 0.00 ? 106 MET A CG   6  
ATOM 10719 S SD   . MET A 1 55  ? -1.396  4.516   -11.614 1.00 0.00 ? 106 MET A SD   6  
ATOM 10720 C CE   . MET A 1 55  ? 0.276   5.166   -11.893 1.00 0.00 ? 106 MET A CE   6  
ATOM 10721 H H    . MET A 1 55  ? -1.722  3.469   -7.159  1.00 0.00 ? 106 MET A H    6  
ATOM 10722 H HA   . MET A 1 55  ? -2.692  0.980   -8.476  1.00 0.00 ? 106 MET A HA   6  
ATOM 10723 H HB2  . MET A 1 55  ? -2.011  1.707   -10.680 1.00 0.00 ? 106 MET A HB2  6  
ATOM 10724 H HB3  . MET A 1 55  ? -3.105  2.941   -10.049 1.00 0.00 ? 106 MET A HB3  6  
ATOM 10725 H HG2  . MET A 1 55  ? -1.013  4.195   -9.262  1.00 0.00 ? 106 MET A HG2  6  
ATOM 10726 H HG3  . MET A 1 55  ? -0.083  3.053   -10.233 1.00 0.00 ? 106 MET A HG3  6  
ATOM 10727 H HE1  . MET A 1 55  ? 0.842   5.117   -10.972 1.00 0.00 ? 106 MET A HE1  6  
ATOM 10728 H HE2  . MET A 1 55  ? 0.767   4.575   -12.655 1.00 0.00 ? 106 MET A HE2  6  
ATOM 10729 H HE3  . MET A 1 55  ? 0.214   6.192   -12.223 1.00 0.00 ? 106 MET A HE3  6  
ATOM 10730 N N    . ALA A 1 56  ? -0.106  0.327   -8.798  1.00 0.00 ? 107 ALA A N    6  
ATOM 10731 C CA   . ALA A 1 56  ? 1.302   -0.088  -8.447  1.00 0.00 ? 107 ALA A CA   6  
ATOM 10732 C C    . ALA A 1 56  ? 2.000   -0.843  -9.576  1.00 0.00 ? 107 ALA A C    6  
ATOM 10733 O O    . ALA A 1 56  ? 2.582   -1.894  -9.382  1.00 0.00 ? 107 ALA A O    6  
ATOM 10734 C CB   . ALA A 1 56  ? 1.234   -0.960  -7.204  1.00 0.00 ? 107 ALA A CB   6  
ATOM 10735 H H    . ALA A 1 56  ? -0.652  -0.222  -9.401  1.00 0.00 ? 107 ALA A H    6  
ATOM 10736 H HA   . ALA A 1 56  ? 1.883   0.779   -8.231  1.00 0.00 ? 107 ALA A HA   6  
ATOM 10737 H HB1  . ALA A 1 56  ? 0.468   -0.578  -6.544  1.00 0.00 ? 107 ALA A HB1  6  
ATOM 10738 H HB2  . ALA A 1 56  ? 0.989   -1.972  -7.489  1.00 0.00 ? 107 ALA A HB2  6  
ATOM 10739 H HB3  . ALA A 1 56  ? 2.186   -0.938  -6.696  1.00 0.00 ? 107 ALA A HB3  6  
ATOM 10740 N N    . GLY A 1 57  ? 1.970   -0.288  -10.740 1.00 0.00 ? 108 GLY A N    6  
ATOM 10741 C CA   . GLY A 1 57  ? 2.647   -0.910  -11.915 1.00 0.00 ? 108 GLY A CA   6  
ATOM 10742 C C    . GLY A 1 57  ? 4.041   -0.305  -12.085 1.00 0.00 ? 108 GLY A C    6  
ATOM 10743 O O    . GLY A 1 57  ? 4.318   0.779   -11.615 1.00 0.00 ? 108 GLY A O    6  
ATOM 10744 H H    . GLY A 1 57  ? 1.528   0.567   -10.839 1.00 0.00 ? 108 GLY A H    6  
ATOM 10745 H HA2  . GLY A 1 57  ? 2.731   -1.980  -11.772 1.00 0.00 ? 108 GLY A HA2  6  
ATOM 10746 H HA3  . GLY A 1 57  ? 2.070   -0.713  -12.793 1.00 0.00 ? 108 GLY A HA3  6  
ATOM 10747 N N    . ASN A 1 58  ? 4.911   -0.985  -12.779 1.00 0.00 ? 109 ASN A N    6  
ATOM 10748 C CA   . ASN A 1 58  ? 6.279   -0.434  -13.011 1.00 0.00 ? 109 ASN A CA   6  
ATOM 10749 C C    . ASN A 1 58  ? 6.196   0.677   -14.061 1.00 0.00 ? 109 ASN A C    6  
ATOM 10750 O O    . ASN A 1 58  ? 5.203   0.811   -14.752 1.00 0.00 ? 109 ASN A O    6  
ATOM 10751 C CB   . ASN A 1 58  ? 7.205   -1.539  -13.514 1.00 0.00 ? 109 ASN A CB   6  
ATOM 10752 C CG   . ASN A 1 58  ? 7.102   -2.747  -12.587 1.00 0.00 ? 109 ASN A CG   6  
ATOM 10753 O OD1  . ASN A 1 58  ? 6.406   -3.685  -12.893 1.00 0.00 ? 109 ASN A OD1  6  
ATOM 10754 N ND2  . ASN A 1 58  ? 7.786   -2.778  -11.478 1.00 0.00 ? 109 ASN A ND2  6  
ATOM 10755 H H    . ASN A 1 58  ? 4.655   -1.850  -13.166 1.00 0.00 ? 109 ASN A H    6  
ATOM 10756 H HA   . ASN A 1 58  ? 6.662   -0.031  -12.087 1.00 0.00 ? 109 ASN A HA   6  
ATOM 10757 H HB2  . ASN A 1 58  ? 6.913   -1.824  -14.514 1.00 0.00 ? 109 ASN A HB2  6  
ATOM 10758 H HB3  . ASN A 1 58  ? 8.222   -1.179  -13.525 1.00 0.00 ? 109 ASN A HB3  6  
ATOM 10759 H HD21 . ASN A 1 58  ? 8.367   -2.027  -11.236 1.00 0.00 ? 109 ASN A HD21 6  
ATOM 10760 H HD22 . ASN A 1 58  ? 7.715   -3.554  -10.882 1.00 0.00 ? 109 ASN A HD22 6  
ATOM 10761 N N    . ASP A 1 59  ? 7.222   1.480   -14.180 1.00 0.00 ? 110 ASP A N    6  
ATOM 10762 C CA   . ASP A 1 59  ? 7.198   2.593   -15.179 1.00 0.00 ? 110 ASP A CA   6  
ATOM 10763 C C    . ASP A 1 59  ? 7.025   2.053   -16.605 1.00 0.00 ? 110 ASP A C    6  
ATOM 10764 O O    . ASP A 1 59  ? 6.326   2.633   -17.413 1.00 0.00 ? 110 ASP A O    6  
ATOM 10765 C CB   . ASP A 1 59  ? 8.527   3.348   -15.109 1.00 0.00 ? 110 ASP A CB   6  
ATOM 10766 C CG   . ASP A 1 59  ? 8.621   4.128   -13.796 1.00 0.00 ? 110 ASP A CG   6  
ATOM 10767 O OD1  . ASP A 1 59  ? 7.607   4.647   -13.361 1.00 0.00 ? 110 ASP A OD1  6  
ATOM 10768 O OD2  . ASP A 1 59  ? 9.709   4.196   -13.246 1.00 0.00 ? 110 ASP A OD2  6  
ATOM 10769 H H    . ASP A 1 59  ? 8.009   1.355   -13.611 1.00 0.00 ? 110 ASP A H    6  
ATOM 10770 H HA   . ASP A 1 59  ? 6.389   3.268   -14.949 1.00 0.00 ? 110 ASP A HA   6  
ATOM 10771 H HB2  . ASP A 1 59  ? 9.342   2.641   -15.168 1.00 0.00 ? 110 ASP A HB2  6  
ATOM 10772 H HB3  . ASP A 1 59  ? 8.589   4.037   -15.941 1.00 0.00 ? 110 ASP A HB3  6  
ATOM 10773 N N    . GLU A 1 60  ? 7.676   0.964   -16.930 1.00 0.00 ? 111 GLU A N    6  
ATOM 10774 C CA   . GLU A 1 60  ? 7.569   0.403   -18.316 1.00 0.00 ? 111 GLU A CA   6  
ATOM 10775 C C    . GLU A 1 60  ? 6.460   -0.654  -18.399 1.00 0.00 ? 111 GLU A C    6  
ATOM 10776 O O    . GLU A 1 60  ? 6.304   -1.315  -19.408 1.00 0.00 ? 111 GLU A O    6  
ATOM 10777 C CB   . GLU A 1 60  ? 8.917   -0.208  -18.718 1.00 0.00 ? 111 GLU A CB   6  
ATOM 10778 C CG   . GLU A 1 60  ? 9.190   -1.484  -17.911 1.00 0.00 ? 111 GLU A CG   6  
ATOM 10779 C CD   . GLU A 1 60  ? 10.644  -1.921  -18.123 1.00 0.00 ? 111 GLU A CD   6  
ATOM 10780 O OE1  . GLU A 1 60  ? 11.204  -1.575  -19.151 1.00 0.00 ? 111 GLU A OE1  6  
ATOM 10781 O OE2  . GLU A 1 60  ? 11.173  -2.593  -17.252 1.00 0.00 ? 111 GLU A OE2  6  
ATOM 10782 H H    . GLU A 1 60  ? 8.252   0.525   -16.270 1.00 0.00 ? 111 GLU A H    6  
ATOM 10783 H HA   . GLU A 1 60  ? 7.336   1.205   -19.009 1.00 0.00 ? 111 GLU A HA   6  
ATOM 10784 H HB2  . GLU A 1 60  ? 8.899   -0.449  -19.773 1.00 0.00 ? 111 GLU A HB2  6  
ATOM 10785 H HB3  . GLU A 1 60  ? 9.703   0.509   -18.528 1.00 0.00 ? 111 GLU A HB3  6  
ATOM 10786 H HG2  . GLU A 1 60  ? 9.019   -1.291  -16.864 1.00 0.00 ? 111 GLU A HG2  6  
ATOM 10787 H HG3  . GLU A 1 60  ? 8.531   -2.269  -18.245 1.00 0.00 ? 111 GLU A HG3  6  
ATOM 10788 N N    . ASN A 1 61  ? 5.683   -0.811  -17.355 1.00 0.00 ? 112 ASN A N    6  
ATOM 10789 C CA   . ASN A 1 61  ? 4.574   -1.816  -17.359 1.00 0.00 ? 112 ASN A CA   6  
ATOM 10790 C C    . ASN A 1 61  ? 3.246   -1.085  -17.206 1.00 0.00 ? 112 ASN A C    6  
ATOM 10791 O O    . ASN A 1 61  ? 3.202   0.084   -16.881 1.00 0.00 ? 112 ASN A O    6  
ATOM 10792 C CB   . ASN A 1 61  ? 4.741   -2.786  -16.183 1.00 0.00 ? 112 ASN A CB   6  
ATOM 10793 C CG   . ASN A 1 61  ? 6.064   -3.540  -16.312 1.00 0.00 ? 112 ASN A CG   6  
ATOM 10794 O OD1  . ASN A 1 61  ? 6.637   -3.617  -17.381 1.00 0.00 ? 112 ASN A OD1  6  
ATOM 10795 N ND2  . ASN A 1 61  ? 6.561   -4.118  -15.256 1.00 0.00 ? 112 ASN A ND2  6  
ATOM 10796 H H    . ASN A 1 61  ? 5.822   -0.257  -16.564 1.00 0.00 ? 112 ASN A H    6  
ATOM 10797 H HA   . ASN A 1 61  ? 4.569   -2.374  -18.287 1.00 0.00 ? 112 ASN A HA   6  
ATOM 10798 H HB2  . ASN A 1 61  ? 4.737   -2.231  -15.257 1.00 0.00 ? 112 ASN A HB2  6  
ATOM 10799 H HB3  . ASN A 1 61  ? 3.923   -3.494  -16.175 1.00 0.00 ? 112 ASN A HB3  6  
ATOM 10800 H HD21 . ASN A 1 61  ? 6.078   -4.069  -14.403 1.00 0.00 ? 112 ASN A HD21 6  
ATOM 10801 H HD22 . ASN A 1 61  ? 7.413   -4.593  -15.308 1.00 0.00 ? 112 ASN A HD22 6  
ATOM 10802 N N    . TYR A 1 62  ? 2.169   -1.773  -17.415 1.00 0.00 ? 113 TYR A N    6  
ATOM 10803 C CA   . TYR A 1 62  ? 0.839   -1.132  -17.255 1.00 0.00 ? 113 TYR A CA   6  
ATOM 10804 C C    . TYR A 1 62  ? 0.684   -0.731  -15.792 1.00 0.00 ? 113 TYR A C    6  
ATOM 10805 O O    . TYR A 1 62  ? 1.546   -0.997  -14.987 1.00 0.00 ? 113 TYR A O    6  
ATOM 10806 C CB   . TYR A 1 62  ? -0.248  -2.150  -17.596 1.00 0.00 ? 113 TYR A CB   6  
ATOM 10807 C CG   . TYR A 1 62  ? 0.106   -3.466  -16.934 1.00 0.00 ? 113 TYR A CG   6  
ATOM 10808 C CD1  . TYR A 1 62  ? -0.057  -3.634  -15.545 1.00 0.00 ? 113 TYR A CD1  6  
ATOM 10809 C CD2  . TYR A 1 62  ? 0.616   -4.517  -17.707 1.00 0.00 ? 113 TYR A CD2  6  
ATOM 10810 C CE1  . TYR A 1 62  ? 0.288   -4.843  -14.943 1.00 0.00 ? 113 TYR A CE1  6  
ATOM 10811 C CE2  . TYR A 1 62  ? 0.955   -5.731  -17.099 1.00 0.00 ? 113 TYR A CE2  6  
ATOM 10812 C CZ   . TYR A 1 62  ? 0.790   -5.891  -15.716 1.00 0.00 ? 113 TYR A CZ   6  
ATOM 10813 O OH   . TYR A 1 62  ? 1.123   -7.082  -15.111 1.00 0.00 ? 113 TYR A OH   6  
ATOM 10814 H H    . TYR A 1 62  ? 2.229   -2.720  -17.661 1.00 0.00 ? 113 TYR A H    6  
ATOM 10815 H HA   . TYR A 1 62  ? 0.765   -0.268  -17.896 1.00 0.00 ? 113 TYR A HA   6  
ATOM 10816 H HB2  . TYR A 1 62  ? -1.205  -1.800  -17.229 1.00 0.00 ? 113 TYR A HB2  6  
ATOM 10817 H HB3  . TYR A 1 62  ? -0.299  -2.283  -18.669 1.00 0.00 ? 113 TYR A HB3  6  
ATOM 10818 H HD1  . TYR A 1 62  ? -0.453  -2.834  -14.943 1.00 0.00 ? 113 TYR A HD1  6  
ATOM 10819 H HD2  . TYR A 1 62  ? 0.740   -4.390  -18.771 1.00 0.00 ? 113 TYR A HD2  6  
ATOM 10820 H HE1  . TYR A 1 62  ? 0.169   -4.970  -13.873 1.00 0.00 ? 113 TYR A HE1  6  
ATOM 10821 H HE2  . TYR A 1 62  ? 1.346   -6.540  -17.694 1.00 0.00 ? 113 TYR A HE2  6  
ATOM 10822 H HH   . TYR A 1 62  ? 0.402   -7.324  -14.524 1.00 0.00 ? 113 TYR A HH   6  
ATOM 10823 N N    . SER A 1 63  ? -0.416  -0.135  -15.431 1.00 0.00 ? 114 SER A N    6  
ATOM 10824 C CA   . SER A 1 63  ? -0.622  0.233   -14.002 1.00 0.00 ? 114 SER A CA   6  
ATOM 10825 C C    . SER A 1 63  ? -1.159  -1.004  -13.279 1.00 0.00 ? 114 SER A C    6  
ATOM 10826 O O    . SER A 1 63  ? -2.136  -1.596  -13.693 1.00 0.00 ? 114 SER A O    6  
ATOM 10827 C CB   . SER A 1 63  ? -1.632  1.380   -13.923 1.00 0.00 ? 114 SER A CB   6  
ATOM 10828 O OG   . SER A 1 63  ? -2.949  0.859   -14.016 1.00 0.00 ? 114 SER A OG   6  
ATOM 10829 H H    . SER A 1 63  ? -1.119  0.043   -16.091 1.00 0.00 ? 114 SER A H    6  
ATOM 10830 H HA   . SER A 1 63  ? 0.312   0.541   -13.560 1.00 0.00 ? 114 SER A HA   6  
ATOM 10831 H HB2  . SER A 1 63  ? -1.523  1.903   -12.987 1.00 0.00 ? 114 SER A HB2  6  
ATOM 10832 H HB3  . SER A 1 63  ? -1.450  2.067   -14.739 1.00 0.00 ? 114 SER A HB3  6  
ATOM 10833 H HG   . SER A 1 63  ? -3.483  1.489   -14.509 1.00 0.00 ? 114 SER A HG   6  
ATOM 10834 N N    . ALA A 1 64  ? -0.524  -1.427  -12.217 1.00 0.00 ? 115 ALA A N    6  
ATOM 10835 C CA   . ALA A 1 64  ? -1.004  -2.649  -11.509 1.00 0.00 ? 115 ALA A CA   6  
ATOM 10836 C C    . ALA A 1 64  ? -2.495  -2.516  -11.238 1.00 0.00 ? 115 ALA A C    6  
ATOM 10837 O O    . ALA A 1 64  ? -3.059  -1.449  -11.381 1.00 0.00 ? 115 ALA A O    6  
ATOM 10838 C CB   . ALA A 1 64  ? -0.247  -2.826  -10.193 1.00 0.00 ? 115 ALA A CB   6  
ATOM 10839 H H    . ALA A 1 64  ? 0.274   -0.953  -11.902 1.00 0.00 ? 115 ALA A H    6  
ATOM 10840 H HA   . ALA A 1 64  ? -0.836  -3.512  -12.136 1.00 0.00 ? 115 ALA A HA   6  
ATOM 10841 H HB1  . ALA A 1 64  ? -0.358  -1.937  -9.590  1.00 0.00 ? 115 ALA A HB1  6  
ATOM 10842 H HB2  . ALA A 1 64  ? -0.643  -3.677  -9.661  1.00 0.00 ? 115 ALA A HB2  6  
ATOM 10843 H HB3  . ALA A 1 64  ? 0.795   -2.993  -10.406 1.00 0.00 ? 115 ALA A HB3  6  
ATOM 10844 N N    . GLU A 1 65  ? -3.150  -3.591  -10.868 1.00 0.00 ? 116 GLU A N    6  
ATOM 10845 C CA   . GLU A 1 65  ? -4.628  -3.511  -10.608 1.00 0.00 ? 116 GLU A CA   6  
ATOM 10846 C C    . GLU A 1 65  ? -4.906  -3.855  -9.147  1.00 0.00 ? 116 GLU A C    6  
ATOM 10847 O O    . GLU A 1 65  ? -4.638  -4.947  -8.685  1.00 0.00 ? 116 GLU A O    6  
ATOM 10848 C CB   . GLU A 1 65  ? -5.345  -4.513  -11.516 1.00 0.00 ? 116 GLU A CB   6  
ATOM 10849 C CG   . GLU A 1 65  ? -6.857  -4.312  -11.420 1.00 0.00 ? 116 GLU A CG   6  
ATOM 10850 C CD   . GLU A 1 65  ? -7.559  -5.302  -12.346 1.00 0.00 ? 116 GLU A CD   6  
ATOM 10851 O OE1  . GLU A 1 65  ? -7.493  -5.105  -13.549 1.00 0.00 ? 116 GLU A OE1  6  
ATOM 10852 O OE2  . GLU A 1 65  ? -8.150  -6.236  -11.837 1.00 0.00 ? 116 GLU A OE2  6  
ATOM 10853 H H    . GLU A 1 65  ? -2.670  -4.451  -10.771 1.00 0.00 ? 116 GLU A H    6  
ATOM 10854 H HA   . GLU A 1 65  ? -4.999  -2.516  -10.818 1.00 0.00 ? 116 GLU A HA   6  
ATOM 10855 H HB2  . GLU A 1 65  ? -5.022  -4.371  -12.538 1.00 0.00 ? 116 GLU A HB2  6  
ATOM 10856 H HB3  . GLU A 1 65  ? -5.104  -5.512  -11.199 1.00 0.00 ? 116 GLU A HB3  6  
ATOM 10857 H HG2  . GLU A 1 65  ? -7.176  -4.493  -10.402 1.00 0.00 ? 116 GLU A HG2  6  
ATOM 10858 H HG3  . GLU A 1 65  ? -7.114  -3.304  -11.707 1.00 0.00 ? 116 GLU A HG3  6  
ATOM 10859 N N    . LEU A 1 66  ? -5.436  -2.918  -8.413  1.00 0.00 ? 117 LEU A N    6  
ATOM 10860 C CA   . LEU A 1 66  ? -5.746  -3.159  -6.976  1.00 0.00 ? 117 LEU A CA   6  
ATOM 10861 C C    . LEU A 1 66  ? -7.266  -3.298  -6.819  1.00 0.00 ? 117 LEU A C    6  
ATOM 10862 O O    . LEU A 1 66  ? -8.029  -2.655  -7.513  1.00 0.00 ? 117 LEU A O    6  
ATOM 10863 C CB   . LEU A 1 66  ? -5.208  -1.976  -6.181  1.00 0.00 ? 117 LEU A CB   6  
ATOM 10864 C CG   . LEU A 1 66  ? -3.691  -1.840  -6.408  1.00 0.00 ? 117 LEU A CG   6  
ATOM 10865 C CD1  . LEU A 1 66  ? -3.154  -0.626  -5.633  1.00 0.00 ? 117 LEU A CD1  6  
ATOM 10866 C CD2  . LEU A 1 66  ? -2.962  -3.105  -5.932  1.00 0.00 ? 117 LEU A CD2  6  
ATOM 10867 H H    . LEU A 1 66  ? -5.637  -2.041  -8.808  1.00 0.00 ? 117 LEU A H    6  
ATOM 10868 H HA   . LEU A 1 66  ? -5.275  -4.068  -6.634  1.00 0.00 ? 117 LEU A HA   6  
ATOM 10869 H HB2  . LEU A 1 66  ? -5.698  -1.077  -6.517  1.00 0.00 ? 117 LEU A HB2  6  
ATOM 10870 H HB3  . LEU A 1 66  ? -5.398  -2.127  -5.135  1.00 0.00 ? 117 LEU A HB3  6  
ATOM 10871 H HG   . LEU A 1 66  ? -3.505  -1.699  -7.461  1.00 0.00 ? 117 LEU A HG   6  
ATOM 10872 H HD11 . LEU A 1 66  ? -3.685  -0.529  -4.699  1.00 0.00 ? 117 LEU A HD11 6  
ATOM 10873 H HD12 . LEU A 1 66  ? -2.098  -0.757  -5.434  1.00 0.00 ? 117 LEU A HD12 6  
ATOM 10874 H HD13 . LEU A 1 66  ? -3.295  0.262   -6.225  1.00 0.00 ? 117 LEU A HD13 6  
ATOM 10875 H HD21 . LEU A 1 66  ? -3.435  -3.485  -5.042  1.00 0.00 ? 117 LEU A HD21 6  
ATOM 10876 H HD22 . LEU A 1 66  ? -2.993  -3.852  -6.709  1.00 0.00 ? 117 LEU A HD22 6  
ATOM 10877 H HD23 . LEU A 1 66  ? -1.932  -2.861  -5.712  1.00 0.00 ? 117 LEU A HD23 6  
ATOM 10878 N N    . ARG A 1 67  ? -7.717  -4.134  -5.921  1.00 0.00 ? 118 ARG A N    6  
ATOM 10879 C CA   . ARG A 1 67  ? -9.190  -4.322  -5.733  1.00 0.00 ? 118 ARG A CA   6  
ATOM 10880 C C    . ARG A 1 67  ? -9.644  -3.449  -4.579  1.00 0.00 ? 118 ARG A C    6  
ATOM 10881 O O    . ARG A 1 67  ? -8.980  -3.374  -3.571  1.00 0.00 ? 118 ARG A O    6  
ATOM 10882 C CB   . ARG A 1 67  ? -9.481  -5.792  -5.392  1.00 0.00 ? 118 ARG A CB   6  
ATOM 10883 C CG   . ARG A 1 67  ? -10.997 -6.074  -5.405  1.00 0.00 ? 118 ARG A CG   6  
ATOM 10884 C CD   . ARG A 1 67  ? -11.522 -6.235  -6.840  1.00 0.00 ? 118 ARG A CD   6  
ATOM 10885 N NE   . ARG A 1 67  ? -12.998 -6.417  -6.793  1.00 0.00 ? 118 ARG A NE   6  
ATOM 10886 C CZ   . ARG A 1 67  ? -13.689 -6.328  -7.889  1.00 0.00 ? 118 ARG A CZ   6  
ATOM 10887 N NH1  . ARG A 1 67  ? -13.073 -6.145  -9.026  1.00 0.00 ? 118 ARG A NH1  6  
ATOM 10888 N NH2  . ARG A 1 67  ? -14.985 -6.443  -7.862  1.00 0.00 ? 118 ARG A NH2  6  
ATOM 10889 H H    . ARG A 1 67  ? -7.087  -4.643  -5.369  1.00 0.00 ? 118 ARG A H    6  
ATOM 10890 H HA   . ARG A 1 67  ? -9.713  -4.035  -6.628  1.00 0.00 ? 118 ARG A HA   6  
ATOM 10891 H HB2  . ARG A 1 67  ? -8.990  -6.431  -6.110  1.00 0.00 ? 118 ARG A HB2  6  
ATOM 10892 H HB3  . ARG A 1 67  ? -9.094  -6.005  -4.405  1.00 0.00 ? 118 ARG A HB3  6  
ATOM 10893 H HG2  . ARG A 1 67  ? -11.190 -6.986  -4.859  1.00 0.00 ? 118 ARG A HG2  6  
ATOM 10894 H HG3  . ARG A 1 67  ? -11.515 -5.256  -4.928  1.00 0.00 ? 118 ARG A HG3  6  
ATOM 10895 H HD2  . ARG A 1 67  ? -11.298 -5.363  -7.427  1.00 0.00 ? 118 ARG A HD2  6  
ATOM 10896 H HD3  . ARG A 1 67  ? -11.067 -7.102  -7.299  1.00 0.00 ? 118 ARG A HD3  6  
ATOM 10897 H HE   . ARG A 1 67  ? -13.449 -6.584  -5.938  1.00 0.00 ? 118 ARG A HE   6  
ATOM 10898 H HH11 . ARG A 1 67  ? -12.076 -6.075  -9.046  1.00 0.00 ? 118 ARG A HH11 6  
ATOM 10899 H HH12 . ARG A 1 67  ? -13.596 -6.076  -9.874  1.00 0.00 ? 118 ARG A HH12 6  
ATOM 10900 H HH21 . ARG A 1 67  ? -15.455 -6.608  -6.994  1.00 0.00 ? 118 ARG A HH21 6  
ATOM 10901 H HH22 . ARG A 1 67  ? -15.514 -6.357  -8.710  1.00 0.00 ? 118 ARG A HH22 6  
ATOM 10902 N N    . ASN A 1 68  ? -10.762 -2.788  -4.738  1.00 0.00 ? 119 ASN A N    6  
ATOM 10903 C CA   . ASN A 1 68  ? -11.296 -1.886  -3.675  1.00 0.00 ? 119 ASN A CA   6  
ATOM 10904 C C    . ASN A 1 68  ? -10.208 -0.894  -3.245  1.00 0.00 ? 119 ASN A C    6  
ATOM 10905 O O    . ASN A 1 68  ? -10.116 -0.507  -2.096  1.00 0.00 ? 119 ASN A O    6  
ATOM 10906 C CB   . ASN A 1 68  ? -11.814 -2.714  -2.474  1.00 0.00 ? 119 ASN A CB   6  
ATOM 10907 C CG   . ASN A 1 68  ? -10.695 -2.992  -1.455  1.00 0.00 ? 119 ASN A CG   6  
ATOM 10908 O OD1  . ASN A 1 68  ? -9.974  -3.947  -1.585  1.00 0.00 ? 119 ASN A OD1  6  
ATOM 10909 N ND2  . ASN A 1 68  ? -10.525 -2.190  -0.437  1.00 0.00 ? 119 ASN A ND2  6  
ATOM 10910 H H    . ASN A 1 68  ? -11.256 -2.882  -5.577  1.00 0.00 ? 119 ASN A H    6  
ATOM 10911 H HA   . ASN A 1 68  ? -12.121 -1.322  -4.092  1.00 0.00 ? 119 ASN A HA   6  
ATOM 10912 H HB2  . ASN A 1 68  ? -12.612 -2.175  -1.985  1.00 0.00 ? 119 ASN A HB2  6  
ATOM 10913 H HB3  . ASN A 1 68  ? -12.196 -3.657  -2.841  1.00 0.00 ? 119 ASN A HB3  6  
ATOM 10914 H HD21 . ASN A 1 68  ? -11.105 -1.409  -0.321  1.00 0.00 ? 119 ASN A HD21 6  
ATOM 10915 H HD22 . ASN A 1 68  ? -9.811  -2.369  0.213   1.00 0.00 ? 119 ASN A HD22 6  
ATOM 10916 N N    . ALA A 1 69  ? -9.397  -0.459  -4.169  1.00 0.00 ? 120 ALA A N    6  
ATOM 10917 C CA   . ALA A 1 69  ? -8.334  0.527   -3.826  1.00 0.00 ? 120 ALA A CA   6  
ATOM 10918 C C    . ALA A 1 69  ? -8.956  1.928   -3.759  1.00 0.00 ? 120 ALA A C    6  
ATOM 10919 O O    . ALA A 1 69  ? -8.294  2.896   -3.443  1.00 0.00 ? 120 ALA A O    6  
ATOM 10920 C CB   . ALA A 1 69  ? -7.247  0.488   -4.910  1.00 0.00 ? 120 ALA A CB   6  
ATOM 10921 H H    . ALA A 1 69  ? -9.497  -0.771  -5.094  1.00 0.00 ? 120 ALA A H    6  
ATOM 10922 H HA   . ALA A 1 69  ? -7.902  0.276   -2.864  1.00 0.00 ? 120 ALA A HA   6  
ATOM 10923 H HB1  . ALA A 1 69  ? -7.670  0.084   -5.819  1.00 0.00 ? 120 ALA A HB1  6  
ATOM 10924 H HB2  . ALA A 1 69  ? -6.871  1.485   -5.101  1.00 0.00 ? 120 ALA A HB2  6  
ATOM 10925 H HB3  . ALA A 1 69  ? -6.436  -0.141  -4.580  1.00 0.00 ? 120 ALA A HB3  6  
ATOM 10926 N N    . THR A 1 70  ? -10.220 2.036   -4.063  1.00 0.00 ? 121 THR A N    6  
ATOM 10927 C CA   . THR A 1 70  ? -10.902 3.360   -4.026  1.00 0.00 ? 121 THR A CA   6  
ATOM 10928 C C    . THR A 1 70  ? -11.695 3.457   -2.714  1.00 0.00 ? 121 THR A C    6  
ATOM 10929 O O    . THR A 1 70  ? -12.907 3.392   -2.713  1.00 0.00 ? 121 THR A O    6  
ATOM 10930 C CB   . THR A 1 70  ? -11.886 3.437   -5.200  1.00 0.00 ? 121 THR A CB   6  
ATOM 10931 O OG1  . THR A 1 70  ? -12.625 2.227   -5.260  1.00 0.00 ? 121 THR A OG1  6  
ATOM 10932 C CG2  . THR A 1 70  ? -11.149 3.644   -6.532  1.00 0.00 ? 121 THR A CG2  6  
ATOM 10933 H H    . THR A 1 70  ? -10.731 1.240   -4.317  1.00 0.00 ? 121 THR A H    6  
ATOM 10934 H HA   . THR A 1 70  ? -10.174 4.163   -4.093  1.00 0.00 ? 121 THR A HA   6  
ATOM 10935 H HB   . THR A 1 70  ? -12.561 4.255   -5.038  1.00 0.00 ? 121 THR A HB   6  
ATOM 10936 H HG1  . THR A 1 70  ? -13.003 2.148   -6.136  1.00 0.00 ? 121 THR A HG1  6  
ATOM 10937 H HG21 . THR A 1 70  ? -10.375 4.387   -6.413  1.00 0.00 ? 121 THR A HG21 6  
ATOM 10938 H HG22 . THR A 1 70  ? -10.706 2.713   -6.853  1.00 0.00 ? 121 THR A HG22 6  
ATOM 10939 H HG23 . THR A 1 70  ? -11.858 3.979   -7.278  1.00 0.00 ? 121 THR A HG23 6  
ATOM 10940 N N    . ALA A 1 71  ? -11.026 3.594   -1.597  1.00 0.00 ? 122 ALA A N    6  
ATOM 10941 C CA   . ALA A 1 71  ? -11.764 3.666   -0.296  1.00 0.00 ? 122 ALA A CA   6  
ATOM 10942 C C    . ALA A 1 71  ? -12.157 5.114   -0.001  1.00 0.00 ? 122 ALA A C    6  
ATOM 10943 O O    . ALA A 1 71  ? -11.493 6.044   -0.414  1.00 0.00 ? 122 ALA A O    6  
ATOM 10944 C CB   . ALA A 1 71  ? -10.886 3.130   0.839   1.00 0.00 ? 122 ALA A CB   6  
ATOM 10945 H H    . ALA A 1 71  ? -10.047 3.635   -1.613  1.00 0.00 ? 122 ALA A H    6  
ATOM 10946 H HA   . ALA A 1 71  ? -12.658 3.067   -0.359  1.00 0.00 ? 122 ALA A HA   6  
ATOM 10947 H HB1  . ALA A 1 71  ? -9.984  3.716   0.915   1.00 0.00 ? 122 ALA A HB1  6  
ATOM 10948 H HB2  . ALA A 1 71  ? -11.434 3.192   1.768   1.00 0.00 ? 122 ALA A HB2  6  
ATOM 10949 H HB3  . ALA A 1 71  ? -10.632 2.096   0.643   1.00 0.00 ? 122 ALA A HB3  6  
ATOM 10950 N N    . ALA A 1 72  ? -13.246 5.308   0.701   1.00 0.00 ? 123 ALA A N    6  
ATOM 10951 C CA   . ALA A 1 72  ? -13.706 6.692   1.011   1.00 0.00 ? 123 ALA A CA   6  
ATOM 10952 C C    . ALA A 1 72  ? -13.183 7.129   2.381   1.00 0.00 ? 123 ALA A C    6  
ATOM 10953 O O    . ALA A 1 72  ? -13.540 6.577   3.403   1.00 0.00 ? 123 ALA A O    6  
ATOM 10954 C CB   . ALA A 1 72  ? -15.233 6.715   1.023   1.00 0.00 ? 123 ALA A CB   6  
ATOM 10955 H H    . ALA A 1 72  ? -13.769 4.538   1.013   1.00 0.00 ? 123 ALA A H    6  
ATOM 10956 H HA   . ALA A 1 72  ? -13.346 7.374   0.255   1.00 0.00 ? 123 ALA A HA   6  
ATOM 10957 H HB1  . ALA A 1 72  ? -15.605 6.386   0.064   1.00 0.00 ? 123 ALA A HB1  6  
ATOM 10958 H HB2  . ALA A 1 72  ? -15.596 6.053   1.796   1.00 0.00 ? 123 ALA A HB2  6  
ATOM 10959 H HB3  . ALA A 1 72  ? -15.575 7.721   1.219   1.00 0.00 ? 123 ALA A HB3  6  
ATOM 10960 N N    . MET A 1 73  ? -12.358 8.135   2.405   1.00 0.00 ? 124 MET A N    6  
ATOM 10961 C CA   . MET A 1 73  ? -11.821 8.628   3.701   1.00 0.00 ? 124 MET A CA   6  
ATOM 10962 C C    . MET A 1 73  ? -12.982 9.071   4.578   1.00 0.00 ? 124 MET A C    6  
ATOM 10963 O O    . MET A 1 73  ? -13.841 9.813   4.145   1.00 0.00 ? 124 MET A O    6  
ATOM 10964 C CB   . MET A 1 73  ? -10.912 9.829   3.457   1.00 0.00 ? 124 MET A CB   6  
ATOM 10965 C CG   . MET A 1 73  ? -10.159 10.164  4.742   1.00 0.00 ? 124 MET A CG   6  
ATOM 10966 S SD   . MET A 1 73  ? -9.154  11.645  4.473   1.00 0.00 ? 124 MET A SD   6  
ATOM 10967 C CE   . MET A 1 73  ? -7.958  10.938  3.309   1.00 0.00 ? 124 MET A CE   6  
ATOM 10968 H H    . MET A 1 73  ? -12.099 8.568   1.564   1.00 0.00 ? 124 MET A H    6  
ATOM 10969 H HA   . MET A 1 73  ? -11.267 7.846   4.194   1.00 0.00 ? 124 MET A HA   6  
ATOM 10970 H HB2  . MET A 1 73  ? -10.209 9.602   2.670   1.00 0.00 ? 124 MET A HB2  6  
ATOM 10971 H HB3  . MET A 1 73  ? -11.517 10.677  3.171   1.00 0.00 ? 124 MET A HB3  6  
ATOM 10972 H HG2  . MET A 1 73  ? -10.871 10.346  5.536   1.00 0.00 ? 124 MET A HG2  6  
ATOM 10973 H HG3  . MET A 1 73  ? -9.524  9.342   5.016   1.00 0.00 ? 124 MET A HG3  6  
ATOM 10974 H HE1  . MET A 1 73  ? -7.879  9.874   3.470   1.00 0.00 ? 124 MET A HE1  6  
ATOM 10975 H HE2  . MET A 1 73  ? -8.286  11.129  2.296   1.00 0.00 ? 124 MET A HE2  6  
ATOM 10976 H HE3  . MET A 1 73  ? -6.997  11.395  3.466   1.00 0.00 ? 124 MET A HE3  6  
ATOM 10977 N N    . LYS A 1 74  ? -12.998 8.644   5.808   1.00 0.00 ? 125 LYS A N    6  
ATOM 10978 C CA   . LYS A 1 74  ? -14.097 9.048   6.729   1.00 0.00 ? 125 LYS A CA   6  
ATOM 10979 C C    . LYS A 1 74  ? -13.832 10.478  7.202   1.00 0.00 ? 125 LYS A C    6  
ATOM 10980 O O    . LYS A 1 74  ? -14.603 11.388  6.961   1.00 0.00 ? 125 LYS A O    6  
ATOM 10981 C CB   . LYS A 1 74  ? -14.055 8.118   7.946   1.00 0.00 ? 125 LYS A CB   6  
ATOM 10982 C CG   . LYS A 1 74  ? -14.176 6.645   7.521   1.00 0.00 ? 125 LYS A CG   6  
ATOM 10983 C CD   . LYS A 1 74  ? -15.533 6.385   6.858   1.00 0.00 ? 125 LYS A CD   6  
ATOM 10984 C CE   . LYS A 1 74  ? -15.760 4.879   6.717   1.00 0.00 ? 125 LYS A CE   6  
ATOM 10985 N NZ   . LYS A 1 74  ? -16.907 4.645   5.798   1.00 0.00 ? 125 LYS A NZ   6  
ATOM 10986 H H    . LYS A 1 74  ? -12.279 8.058   6.129   1.00 0.00 ? 125 LYS A H    6  
ATOM 10987 H HA   . LYS A 1 74  ? -15.052 8.994   6.237   1.00 0.00 ? 125 LYS A HA   6  
ATOM 10988 H HB2  . LYS A 1 74  ? -13.114 8.259   8.457   1.00 0.00 ? 125 LYS A HB2  6  
ATOM 10989 H HB3  . LYS A 1 74  ? -14.863 8.365   8.614   1.00 0.00 ? 125 LYS A HB3  6  
ATOM 10990 H HG2  . LYS A 1 74  ? -13.383 6.408   6.825   1.00 0.00 ? 125 LYS A HG2  6  
ATOM 10991 H HG3  . LYS A 1 74  ? -14.080 6.018   8.394   1.00 0.00 ? 125 LYS A HG3  6  
ATOM 10992 H HD2  . LYS A 1 74  ? -16.316 6.811   7.463   1.00 0.00 ? 125 LYS A HD2  6  
ATOM 10993 H HD3  . LYS A 1 74  ? -15.552 6.832   5.879   1.00 0.00 ? 125 LYS A HD3  6  
ATOM 10994 H HE2  . LYS A 1 74  ? -14.873 4.418   6.311   1.00 0.00 ? 125 LYS A HE2  6  
ATOM 10995 H HE3  . LYS A 1 74  ? -15.977 4.452   7.688   1.00 0.00 ? 125 LYS A HE3  6  
ATOM 10996 H HZ1  . LYS A 1 74  ? -17.178 5.539   5.344   1.00 0.00 ? 125 LYS A HZ1  6  
ATOM 10997 H HZ2  . LYS A 1 74  ? -16.631 3.960   5.067   1.00 0.00 ? 125 LYS A HZ2  6  
ATOM 10998 H HZ3  . LYS A 1 74  ? -17.717 4.269   6.340   1.00 0.00 ? 125 LYS A HZ3  6  
ATOM 10999 N N    . ASN A 1 75  ? -12.716 10.665  7.847   1.00 0.00 ? 126 ASN A N    6  
ATOM 11000 C CA   . ASN A 1 75  ? -12.300 12.010  8.335   1.00 0.00 ? 126 ASN A CA   6  
ATOM 11001 C C    . ASN A 1 75  ? -10.881 12.237  7.836   1.00 0.00 ? 126 ASN A C    6  
ATOM 11002 O O    . ASN A 1 75  ? -10.647 12.370  6.654   1.00 0.00 ? 126 ASN A O    6  
ATOM 11003 C CB   . ASN A 1 75  ? -12.318 12.052  9.859   1.00 0.00 ? 126 ASN A CB   6  
ATOM 11004 C CG   . ASN A 1 75  ? -13.729 11.769  10.356  1.00 0.00 ? 126 ASN A CG   6  
ATOM 11005 O OD1  . ASN A 1 75  ? -13.911 11.226  11.427  1.00 0.00 ? 126 ASN A OD1  6  
ATOM 11006 N ND2  . ASN A 1 75  ? -14.739 12.120  9.617   1.00 0.00 ? 126 ASN A ND2  6  
ATOM 11007 H H    . ASN A 1 75  ? -12.119 9.911   7.987   1.00 0.00 ? 126 ASN A H    6  
ATOM 11008 H HA   . ASN A 1 75  ? -12.957 12.774  7.935   1.00 0.00 ? 126 ASN A HA   6  
ATOM 11009 H HB2  . ASN A 1 75  ? -11.637 11.309  10.250  1.00 0.00 ? 126 ASN A HB2  6  
ATOM 11010 H HB3  . ASN A 1 75  ? -12.018 13.033  10.190  1.00 0.00 ? 126 ASN A HB3  6  
ATOM 11011 H HD21 . ASN A 1 75  ? -14.583 12.559  8.752   1.00 0.00 ? 126 ASN A HD21 6  
ATOM 11012 H HD22 . ASN A 1 75  ? -15.652 11.947  9.920   1.00 0.00 ? 126 ASN A HD22 6  
ATOM 11013 N N    . GLN A 1 76  ? -9.923  12.257  8.723   1.00 0.00 ? 127 GLN A N    6  
ATOM 11014 C CA   . GLN A 1 76  ? -8.515  12.443  8.287   1.00 0.00 ? 127 GLN A CA   6  
ATOM 11015 C C    . GLN A 1 76  ? -7.880  11.062  8.088   1.00 0.00 ? 127 GLN A C    6  
ATOM 11016 O O    . GLN A 1 76  ? -6.692  10.952  7.864   1.00 0.00 ? 127 GLN A O    6  
ATOM 11017 C CB   . GLN A 1 76  ? -7.749  13.223  9.355   1.00 0.00 ? 127 GLN A CB   6  
ATOM 11018 C CG   . GLN A 1 76  ? -8.429  14.571  9.550   1.00 0.00 ? 127 GLN A CG   6  
ATOM 11019 C CD   . GLN A 1 76  ? -7.634  15.398  10.555  1.00 0.00 ? 127 GLN A CD   6  
ATOM 11020 O OE1  . GLN A 1 76  ? -7.147  14.881  11.540  1.00 0.00 ? 127 GLN A OE1  6  
ATOM 11021 N NE2  . GLN A 1 76  ? -7.488  16.672  10.343  1.00 0.00 ? 127 GLN A NE2  6  
ATOM 11022 H H    . GLN A 1 76  ? -10.130 12.134  9.677   1.00 0.00 ? 127 GLN A H    6  
ATOM 11023 H HA   . GLN A 1 76  ? -8.486  12.990  7.352   1.00 0.00 ? 127 GLN A HA   6  
ATOM 11024 H HB2  . GLN A 1 76  ? -7.758  12.675  10.287  1.00 0.00 ? 127 GLN A HB2  6  
ATOM 11025 H HB3  . GLN A 1 76  ? -6.728  13.379  9.032   1.00 0.00 ? 127 GLN A HB3  6  
ATOM 11026 H HG2  . GLN A 1 76  ? -8.473  15.089  8.604   1.00 0.00 ? 127 GLN A HG2  6  
ATOM 11027 H HG3  . GLN A 1 76  ? -9.428  14.416  9.922   1.00 0.00 ? 127 GLN A HG3  6  
ATOM 11028 H HE21 . GLN A 1 76  ? -7.883  17.083  9.546   1.00 0.00 ? 127 GLN A HE21 6  
ATOM 11029 H HE22 . GLN A 1 76  ? -6.972  17.216  10.969  1.00 0.00 ? 127 GLN A HE22 6  
ATOM 11030 N N    . VAL A 1 77  ? -8.664  9.999   8.177   1.00 0.00 ? 128 VAL A N    6  
ATOM 11031 C CA   . VAL A 1 77  ? -8.091  8.618   8.002   1.00 0.00 ? 128 VAL A CA   6  
ATOM 11032 C C    . VAL A 1 77  ? -8.904  7.790   6.999   1.00 0.00 ? 128 VAL A C    6  
ATOM 11033 O O    . VAL A 1 77  ? -10.118 7.816   6.988   1.00 0.00 ? 128 VAL A O    6  
ATOM 11034 C CB   . VAL A 1 77  ? -8.086  7.895   9.344   1.00 0.00 ? 128 VAL A CB   6  
ATOM 11035 C CG1  . VAL A 1 77  ? -7.295  6.588   9.202   1.00 0.00 ? 128 VAL A CG1  6  
ATOM 11036 C CG2  . VAL A 1 77  ? -7.427  8.795   10.394  1.00 0.00 ? 128 VAL A CG2  6  
ATOM 11037 H H    . VAL A 1 77  ? -9.620  10.112  8.368   1.00 0.00 ? 128 VAL A H    6  
ATOM 11038 H HA   . VAL A 1 77  ? -7.079  8.688   7.647   1.00 0.00 ? 128 VAL A HA   6  
ATOM 11039 H HB   . VAL A 1 77  ? -9.099  7.673   9.639   1.00 0.00 ? 128 VAL A HB   6  
ATOM 11040 H HG11 . VAL A 1 77  ? -6.287  6.809   8.868   1.00 0.00 ? 128 VAL A HG11 6  
ATOM 11041 H HG12 . VAL A 1 77  ? -7.259  6.079   10.154  1.00 0.00 ? 128 VAL A HG12 6  
ATOM 11042 H HG13 . VAL A 1 77  ? -7.780  5.952   8.475   1.00 0.00 ? 128 VAL A HG13 6  
ATOM 11043 H HG21 . VAL A 1 77  ? -6.439  9.082   10.055  1.00 0.00 ? 128 VAL A HG21 6  
ATOM 11044 H HG22 . VAL A 1 77  ? -8.029  9.679   10.538  1.00 0.00 ? 128 VAL A HG22 6  
ATOM 11045 H HG23 . VAL A 1 77  ? -7.349  8.260   11.331  1.00 0.00 ? 128 VAL A HG23 6  
ATOM 11046 N N    . ALA A 1 78  ? -8.216  7.036   6.172   1.00 0.00 ? 129 ALA A N    6  
ATOM 11047 C CA   . ALA A 1 78  ? -8.880  6.155   5.160   1.00 0.00 ? 129 ALA A CA   6  
ATOM 11048 C C    . ALA A 1 78  ? -8.366  4.727   5.338   1.00 0.00 ? 129 ALA A C    6  
ATOM 11049 O O    . ALA A 1 78  ? -7.413  4.483   6.055   1.00 0.00 ? 129 ALA A O    6  
ATOM 11050 C CB   . ALA A 1 78  ? -8.521  6.643   3.757   1.00 0.00 ? 129 ALA A CB   6  
ATOM 11051 H H    . ALA A 1 78  ? -7.243  7.030   6.234   1.00 0.00 ? 129 ALA A H    6  
ATOM 11052 H HA   . ALA A 1 78  ? -9.955  6.172   5.294   1.00 0.00 ? 129 ALA A HA   6  
ATOM 11053 H HB1  . ALA A 1 78  ? -7.447  6.689   3.660   1.00 0.00 ? 129 ALA A HB1  6  
ATOM 11054 H HB2  . ALA A 1 78  ? -8.920  5.961   3.024   1.00 0.00 ? 129 ALA A HB2  6  
ATOM 11055 H HB3  . ALA A 1 78  ? -8.935  7.623   3.600   1.00 0.00 ? 129 ALA A HB3  6  
ATOM 11056 N N    . ARG A 1 79  ? -8.984  3.771   4.704   1.00 0.00 ? 130 ARG A N    6  
ATOM 11057 C CA   . ARG A 1 79  ? -8.525  2.366   4.860   1.00 0.00 ? 130 ARG A CA   6  
ATOM 11058 C C    . ARG A 1 79  ? -8.986  1.548   3.651   1.00 0.00 ? 130 ARG A C    6  
ATOM 11059 O O    . ARG A 1 79  ? -9.844  1.961   2.910   1.00 0.00 ? 130 ARG A O    6  
ATOM 11060 C CB   . ARG A 1 79  ? -9.135  1.801   6.147   1.00 0.00 ? 130 ARG A CB   6  
ATOM 11061 C CG   . ARG A 1 79  ? -10.660 1.688   5.986   1.00 0.00 ? 130 ARG A CG   6  
ATOM 11062 C CD   . ARG A 1 79  ? -11.336 1.453   7.347   1.00 0.00 ? 130 ARG A CD   6  
ATOM 11063 N NE   . ARG A 1 79  ? -11.545 2.766   8.035   1.00 0.00 ? 130 ARG A NE   6  
ATOM 11064 C CZ   . ARG A 1 79  ? -12.371 2.858   9.047   1.00 0.00 ? 130 ARG A CZ   6  
ATOM 11065 N NH1  . ARG A 1 79  ? -13.044 1.822   9.441   1.00 0.00 ? 130 ARG A NH1  6  
ATOM 11066 N NH2  . ARG A 1 79  ? -12.541 3.996   9.663   1.00 0.00 ? 130 ARG A NH2  6  
ATOM 11067 H H    . ARG A 1 79  ? -9.752  3.977   4.135   1.00 0.00 ? 130 ARG A H    6  
ATOM 11068 H HA   . ARG A 1 79  ? -7.444  2.334   4.925   1.00 0.00 ? 130 ARG A HA   6  
ATOM 11069 H HB2  . ARG A 1 79  ? -8.712  0.827   6.354   1.00 0.00 ? 130 ARG A HB2  6  
ATOM 11070 H HB3  . ARG A 1 79  ? -8.914  2.469   6.966   1.00 0.00 ? 130 ARG A HB3  6  
ATOM 11071 H HG2  . ARG A 1 79  ? -11.038 2.605   5.556   1.00 0.00 ? 130 ARG A HG2  6  
ATOM 11072 H HG3  . ARG A 1 79  ? -10.889 0.866   5.325   1.00 0.00 ? 130 ARG A HG3  6  
ATOM 11073 H HD2  . ARG A 1 79  ? -12.295 0.976   7.193   1.00 0.00 ? 130 ARG A HD2  6  
ATOM 11074 H HD3  . ARG A 1 79  ? -10.713 0.819   7.962   1.00 0.00 ? 130 ARG A HD3  6  
ATOM 11075 H HE   . ARG A 1 79  ? -11.058 3.558   7.731   1.00 0.00 ? 130 ARG A HE   6  
ATOM 11076 H HH11 . ARG A 1 79  ? -12.936 0.948   8.972   1.00 0.00 ? 130 ARG A HH11 6  
ATOM 11077 H HH12 . ARG A 1 79  ? -13.675 1.904   10.216  1.00 0.00 ? 130 ARG A HH12 6  
ATOM 11078 H HH21 . ARG A 1 79  ? -12.043 4.807   9.368   1.00 0.00 ? 130 ARG A HH21 6  
ATOM 11079 H HH22 . ARG A 1 79  ? -13.178 4.054   10.434  1.00 0.00 ? 130 ARG A HH22 6  
ATOM 11080 N N    . PHE A 1 80  ? -8.405  0.397   3.446   1.00 0.00 ? 131 PHE A N    6  
ATOM 11081 C CA   . PHE A 1 80  ? -8.789  -0.467  2.282   1.00 0.00 ? 131 PHE A CA   6  
ATOM 11082 C C    . PHE A 1 80  ? -9.181  -1.852  2.814   1.00 0.00 ? 131 PHE A C    6  
ATOM 11083 O O    . PHE A 1 80  ? -8.545  -2.368  3.710   1.00 0.00 ? 131 PHE A O    6  
ATOM 11084 C CB   . PHE A 1 80  ? -7.577  -0.597  1.358   1.00 0.00 ? 131 PHE A CB   6  
ATOM 11085 C CG   . PHE A 1 80  ? -6.869  0.731   1.242   1.00 0.00 ? 131 PHE A CG   6  
ATOM 11086 C CD1  . PHE A 1 80  ? -5.947  1.098   2.220   1.00 0.00 ? 131 PHE A CD1  6  
ATOM 11087 C CD2  . PHE A 1 80  ? -7.112  1.579   0.154   1.00 0.00 ? 131 PHE A CD2  6  
ATOM 11088 C CE1  . PHE A 1 80  ? -5.257  2.312   2.121   1.00 0.00 ? 131 PHE A CE1  6  
ATOM 11089 C CE2  . PHE A 1 80  ? -6.428  2.799   0.052   1.00 0.00 ? 131 PHE A CE2  6  
ATOM 11090 C CZ   . PHE A 1 80  ? -5.497  3.165   1.035   1.00 0.00 ? 131 PHE A CZ   6  
ATOM 11091 H H    . PHE A 1 80  ? -7.708  0.092   4.062   1.00 0.00 ? 131 PHE A H    6  
ATOM 11092 H HA   . PHE A 1 80  ? -9.619  -0.032  1.737   1.00 0.00 ? 131 PHE A HA   6  
ATOM 11093 H HB2  . PHE A 1 80  ? -6.890  -1.322  1.771   1.00 0.00 ? 131 PHE A HB2  6  
ATOM 11094 H HB3  . PHE A 1 80  ? -7.902  -0.917  0.381   1.00 0.00 ? 131 PHE A HB3  6  
ATOM 11095 H HD1  . PHE A 1 80  ? -5.767  0.439   3.054   1.00 0.00 ? 131 PHE A HD1  6  
ATOM 11096 H HD2  . PHE A 1 80  ? -7.827  1.295   -0.603  1.00 0.00 ? 131 PHE A HD2  6  
ATOM 11097 H HE1  . PHE A 1 80  ? -4.543  2.595   2.885   1.00 0.00 ? 131 PHE A HE1  6  
ATOM 11098 H HE2  . PHE A 1 80  ? -6.615  3.455   -0.787  1.00 0.00 ? 131 PHE A HE2  6  
ATOM 11099 H HZ   . PHE A 1 80  ? -4.959  4.098   0.954   1.00 0.00 ? 131 PHE A HZ   6  
ATOM 11100 N N    . ASN A 1 81  ? -10.218 -2.466  2.287   1.00 0.00 ? 132 ASN A N    6  
ATOM 11101 C CA   . ASN A 1 81  ? -10.625 -3.814  2.808   1.00 0.00 ? 132 ASN A CA   6  
ATOM 11102 C C    . ASN A 1 81  ? -10.007 -4.958  1.995   1.00 0.00 ? 132 ASN A C    6  
ATOM 11103 O O    . ASN A 1 81  ? -8.924  -5.428  2.281   1.00 0.00 ? 132 ASN A O    6  
ATOM 11104 C CB   . ASN A 1 81  ? -12.151 -3.938  2.743   1.00 0.00 ? 132 ASN A CB   6  
ATOM 11105 C CG   . ASN A 1 81  ? -12.800 -2.997  3.760   1.00 0.00 ? 132 ASN A CG   6  
ATOM 11106 O OD1  . ASN A 1 81  ? -12.623 -3.151  4.951   1.00 0.00 ? 132 ASN A OD1  6  
ATOM 11107 N ND2  . ASN A 1 81  ? -13.544 -2.017  3.337   1.00 0.00 ? 132 ASN A ND2  6  
ATOM 11108 H H    . ASN A 1 81  ? -10.734 -2.037  1.570   1.00 0.00 ? 132 ASN A H    6  
ATOM 11109 H HA   . ASN A 1 81  ? -10.308 -3.914  3.832   1.00 0.00 ? 132 ASN A HA   6  
ATOM 11110 H HB2  . ASN A 1 81  ? -12.492 -3.682  1.750   1.00 0.00 ? 132 ASN A HB2  6  
ATOM 11111 H HB3  . ASN A 1 81  ? -12.437 -4.956  2.967   1.00 0.00 ? 132 ASN A HB3  6  
ATOM 11112 H HD21 . ASN A 1 81  ? -13.683 -1.885  2.377   1.00 0.00 ? 132 ASN A HD21 6  
ATOM 11113 H HD22 . ASN A 1 81  ? -13.979 -1.419  3.983   1.00 0.00 ? 132 ASN A HD22 6  
ATOM 11114 N N    . ASP A 1 82  ? -10.711 -5.425  1.004   1.00 0.00 ? 133 ASP A N    6  
ATOM 11115 C CA   . ASP A 1 82  ? -10.200 -6.567  0.186   1.00 0.00 ? 133 ASP A CA   6  
ATOM 11116 C C    . ASP A 1 82  ? -9.040  -6.115  -0.693  1.00 0.00 ? 133 ASP A C    6  
ATOM 11117 O O    . ASP A 1 82  ? -8.826  -6.648  -1.763  1.00 0.00 ? 133 ASP A O    6  
ATOM 11118 C CB   . ASP A 1 82  ? -11.330 -7.121  -0.690  1.00 0.00 ? 133 ASP A CB   6  
ATOM 11119 C CG   . ASP A 1 82  ? -11.787 -6.061  -1.690  1.00 0.00 ? 133 ASP A CG   6  
ATOM 11120 O OD1  . ASP A 1 82  ? -11.098 -5.870  -2.679  1.00 0.00 ? 133 ASP A OD1  6  
ATOM 11121 O OD2  . ASP A 1 82  ? -12.824 -5.461  -1.451  1.00 0.00 ? 133 ASP A OD2  6  
ATOM 11122 H H    . ASP A 1 82  ? -11.591 -5.042  0.808   1.00 0.00 ? 133 ASP A H    6  
ATOM 11123 H HA   . ASP A 1 82  ? -9.855  -7.343  0.850   1.00 0.00 ? 133 ASP A HA   6  
ATOM 11124 H HB2  . ASP A 1 82  ? -10.974 -7.983  -1.230  1.00 0.00 ? 133 ASP A HB2  6  
ATOM 11125 H HB3  . ASP A 1 82  ? -12.162 -7.406  -0.066  1.00 0.00 ? 133 ASP A HB3  6  
ATOM 11126 N N    . LEU A 1 83  ? -8.308  -5.112  -0.273  1.00 0.00 ? 134 LEU A N    6  
ATOM 11127 C CA   . LEU A 1 83  ? -7.179  -4.610  -1.114  1.00 0.00 ? 134 LEU A CA   6  
ATOM 11128 C C    . LEU A 1 83  ? -6.392  -5.781  -1.684  1.00 0.00 ? 134 LEU A C    6  
ATOM 11129 O O    . LEU A 1 83  ? -5.525  -6.324  -1.030  1.00 0.00 ? 134 LEU A O    6  
ATOM 11130 C CB   . LEU A 1 83  ? -6.242  -3.744  -0.265  1.00 0.00 ? 134 LEU A CB   6  
ATOM 11131 C CG   . LEU A 1 83  ? -5.100  -3.162  -1.127  1.00 0.00 ? 134 LEU A CG   6  
ATOM 11132 C CD1  . LEU A 1 83  ? -5.664  -2.180  -2.169  1.00 0.00 ? 134 LEU A CD1  6  
ATOM 11133 C CD2  . LEU A 1 83  ? -4.094  -2.435  -0.221  1.00 0.00 ? 134 LEU A CD2  6  
ATOM 11134 H H    . LEU A 1 83  ? -8.516  -4.676  0.583   1.00 0.00 ? 134 LEU A H    6  
ATOM 11135 H HA   . LEU A 1 83  ? -7.575  -4.021  -1.913  1.00 0.00 ? 134 LEU A HA   6  
ATOM 11136 H HB2  . LEU A 1 83  ? -6.806  -2.944  0.171   1.00 0.00 ? 134 LEU A HB2  6  
ATOM 11137 H HB3  . LEU A 1 83  ? -5.820  -4.349  0.520   1.00 0.00 ? 134 LEU A HB3  6  
ATOM 11138 H HG   . LEU A 1 83  ? -4.593  -3.963  -1.642  1.00 0.00 ? 134 LEU A HG   6  
ATOM 11139 H HD11 . LEU A 1 83  ? -6.489  -1.627  -1.745  1.00 0.00 ? 134 LEU A HD11 6  
ATOM 11140 H HD12 . LEU A 1 83  ? -4.890  -1.492  -2.483  1.00 0.00 ? 134 LEU A HD12 6  
ATOM 11141 H HD13 . LEU A 1 83  ? -6.009  -2.734  -3.026  1.00 0.00 ? 134 LEU A HD13 6  
ATOM 11142 H HD21 . LEU A 1 83  ? -3.696  -3.128  0.504   1.00 0.00 ? 134 LEU A HD21 6  
ATOM 11143 H HD22 . LEU A 1 83  ? -3.285  -2.048  -0.822  1.00 0.00 ? 134 LEU A HD22 6  
ATOM 11144 H HD23 . LEU A 1 83  ? -4.582  -1.621  0.290   1.00 0.00 ? 134 LEU A HD23 6  
ATOM 11145 N N    . ARG A 1 84  ? -6.661  -6.164  -2.906  1.00 0.00 ? 135 ARG A N    6  
ATOM 11146 C CA   . ARG A 1 84  ? -5.885  -7.300  -3.509  1.00 0.00 ? 135 ARG A CA   6  
ATOM 11147 C C    . ARG A 1 84  ? -4.722  -6.725  -4.329  1.00 0.00 ? 135 ARG A C    6  
ATOM 11148 O O    . ARG A 1 84  ? -4.903  -5.832  -5.133  1.00 0.00 ? 135 ARG A O    6  
ATOM 11149 C CB   . ARG A 1 84  ? -6.796  -8.166  -4.391  1.00 0.00 ? 135 ARG A CB   6  
ATOM 11150 C CG   . ARG A 1 84  ? -6.049  -9.448  -4.777  1.00 0.00 ? 135 ARG A CG   6  
ATOM 11151 C CD   . ARG A 1 84  ? -6.949  -10.349 -5.624  1.00 0.00 ? 135 ARG A CD   6  
ATOM 11152 N NE   . ARG A 1 84  ? -7.141  -9.753  -6.978  1.00 0.00 ? 135 ARG A NE   6  
ATOM 11153 C CZ   . ARG A 1 84  ? -7.545  -10.505 -7.969  1.00 0.00 ? 135 ARG A CZ   6  
ATOM 11154 N NH1  . ARG A 1 84  ? -7.769  -11.776 -7.774  1.00 0.00 ? 135 ARG A NH1  6  
ATOM 11155 N NH2  . ARG A 1 84  ? -7.722  -9.988  -9.154  1.00 0.00 ? 135 ARG A NH2  6  
ATOM 11156 H H    . ARG A 1 84  ? -7.359  -5.694  -3.428  1.00 0.00 ? 135 ARG A H    6  
ATOM 11157 H HA   . ARG A 1 84  ? -5.475  -7.917  -2.720  1.00 0.00 ? 135 ARG A HA   6  
ATOM 11158 H HB2  . ARG A 1 84  ? -7.692  -8.421  -3.840  1.00 0.00 ? 135 ARG A HB2  6  
ATOM 11159 H HB3  . ARG A 1 84  ? -7.061  -7.620  -5.284  1.00 0.00 ? 135 ARG A HB3  6  
ATOM 11160 H HG2  . ARG A 1 84  ? -5.166  -9.191  -5.344  1.00 0.00 ? 135 ARG A HG2  6  
ATOM 11161 H HG3  . ARG A 1 84  ? -5.758  -9.978  -3.881  1.00 0.00 ? 135 ARG A HG3  6  
ATOM 11162 H HD2  . ARG A 1 84  ? -6.490  -11.327 -5.714  1.00 0.00 ? 135 ARG A HD2  6  
ATOM 11163 H HD3  . ARG A 1 84  ? -7.909  -10.446 -5.143  1.00 0.00 ? 135 ARG A HD3  6  
ATOM 11164 H HE   . ARG A 1 84  ? -6.969  -8.798  -7.124  1.00 0.00 ? 135 ARG A HE   6  
ATOM 11165 H HH11 . ARG A 1 84  ? -7.628  -12.177 -6.867  1.00 0.00 ? 135 ARG A HH11 6  
ATOM 11166 H HH12 . ARG A 1 84  ? -8.090  -12.349 -8.527  1.00 0.00 ? 135 ARG A HH12 6  
ATOM 11167 H HH21 . ARG A 1 84  ? -7.551  -9.014  -9.308  1.00 0.00 ? 135 ARG A HH21 6  
ATOM 11168 H HH22 . ARG A 1 84  ? -8.025  -10.568 -9.912  1.00 0.00 ? 135 ARG A HH22 6  
ATOM 11169 N N    . PHE A 1 85  ? -3.526  -7.213  -4.115  1.00 0.00 ? 136 PHE A N    6  
ATOM 11170 C CA   . PHE A 1 85  ? -2.338  -6.680  -4.865  1.00 0.00 ? 136 PHE A CA   6  
ATOM 11171 C C    . PHE A 1 85  ? -2.000  -7.590  -6.048  1.00 0.00 ? 136 PHE A C    6  
ATOM 11172 O O    . PHE A 1 85  ? -1.473  -8.671  -5.864  1.00 0.00 ? 136 PHE A O    6  
ATOM 11173 C CB   . PHE A 1 85  ? -1.110  -6.652  -3.923  1.00 0.00 ? 136 PHE A CB   6  
ATOM 11174 C CG   . PHE A 1 85  ? -1.001  -5.332  -3.179  1.00 0.00 ? 136 PHE A CG   6  
ATOM 11175 C CD1  . PHE A 1 85  ? -0.527  -4.182  -3.831  1.00 0.00 ? 136 PHE A CD1  6  
ATOM 11176 C CD2  . PHE A 1 85  ? -1.347  -5.271  -1.825  1.00 0.00 ? 136 PHE A CD2  6  
ATOM 11177 C CE1  . PHE A 1 85  ? -0.407  -2.973  -3.126  1.00 0.00 ? 136 PHE A CE1  6  
ATOM 11178 C CE2  . PHE A 1 85  ? -1.223  -4.067  -1.120  1.00 0.00 ? 136 PHE A CE2  6  
ATOM 11179 C CZ   . PHE A 1 85  ? -0.755  -2.918  -1.769  1.00 0.00 ? 136 PHE A CZ   6  
ATOM 11180 H H    . PHE A 1 85  ? -3.405  -7.923  -3.450  1.00 0.00 ? 136 PHE A H    6  
ATOM 11181 H HA   . PHE A 1 85  ? -2.545  -5.682  -5.223  1.00 0.00 ? 136 PHE A HA   6  
ATOM 11182 H HB2  . PHE A 1 85  ? -1.207  -7.454  -3.206  1.00 0.00 ? 136 PHE A HB2  6  
ATOM 11183 H HB3  . PHE A 1 85  ? -0.204  -6.806  -4.495  1.00 0.00 ? 136 PHE A HB3  6  
ATOM 11184 H HD1  . PHE A 1 85  ? -0.255  -4.225  -4.876  1.00 0.00 ? 136 PHE A HD1  6  
ATOM 11185 H HD2  . PHE A 1 85  ? -1.706  -6.156  -1.325  1.00 0.00 ? 136 PHE A HD2  6  
ATOM 11186 H HE1  . PHE A 1 85  ? -0.040  -2.087  -3.625  1.00 0.00 ? 136 PHE A HE1  6  
ATOM 11187 H HE2  . PHE A 1 85  ? -1.489  -4.027  -0.076  1.00 0.00 ? 136 PHE A HE2  6  
ATOM 11188 H HZ   . PHE A 1 85  ? -0.661  -1.988  -1.223  1.00 0.00 ? 136 PHE A HZ   6  
ATOM 11189 N N    . VAL A 1 86  ? -2.236  -7.148  -7.261  1.00 0.00 ? 137 VAL A N    6  
ATOM 11190 C CA   . VAL A 1 86  ? -1.853  -7.985  -8.443  1.00 0.00 ? 137 VAL A CA   6  
ATOM 11191 C C    . VAL A 1 86  ? -1.121  -7.114  -9.469  1.00 0.00 ? 137 VAL A C    6  
ATOM 11192 O O    . VAL A 1 86  ? -1.593  -6.862  -10.563 1.00 0.00 ? 137 VAL A O    6  
ATOM 11193 C CB   . VAL A 1 86  ? -3.091  -8.647  -9.060  1.00 0.00 ? 137 VAL A CB   6  
ATOM 11194 C CG1  . VAL A 1 86  ? -4.190  -7.602  -9.252  1.00 0.00 ? 137 VAL A CG1  6  
ATOM 11195 C CG2  . VAL A 1 86  ? -2.717  -9.313  -10.411 1.00 0.00 ? 137 VAL A CG2  6  
ATOM 11196 H H    . VAL A 1 86  ? -2.631  -6.253  -7.396  1.00 0.00 ? 137 VAL A H    6  
ATOM 11197 H HA   . VAL A 1 86  ? -1.168  -8.764  -8.128  1.00 0.00 ? 137 VAL A HA   6  
ATOM 11198 H HB   . VAL A 1 86  ? -3.449  -9.405  -8.378  1.00 0.00 ? 137 VAL A HB   6  
ATOM 11199 H HG11 . VAL A 1 86  ? -3.794  -6.770  -9.810  1.00 0.00 ? 137 VAL A HG11 6  
ATOM 11200 H HG12 . VAL A 1 86  ? -5.019  -8.037  -9.791  1.00 0.00 ? 137 VAL A HG12 6  
ATOM 11201 H HG13 . VAL A 1 86  ? -4.532  -7.258  -8.284  1.00 0.00 ? 137 VAL A HG13 6  
ATOM 11202 H HG21 . VAL A 1 86  ? -1.662  -9.567  -10.418 1.00 0.00 ? 137 VAL A HG21 6  
ATOM 11203 H HG22 . VAL A 1 86  ? -3.296  -10.218 -10.539 1.00 0.00 ? 137 VAL A HG22 6  
ATOM 11204 H HG23 . VAL A 1 86  ? -2.926  -8.642  -11.229 1.00 0.00 ? 137 VAL A HG23 6  
ATOM 11205 N N    . GLY A 1 87  ? 0.058   -6.674  -9.119  1.00 0.00 ? 138 GLY A N    6  
ATOM 11206 C CA   . GLY A 1 87  ? 0.882   -5.856  -10.054 1.00 0.00 ? 138 GLY A CA   6  
ATOM 11207 C C    . GLY A 1 87  ? 1.936   -6.789  -10.643 1.00 0.00 ? 138 GLY A C    6  
ATOM 11208 O O    . GLY A 1 87  ? 1.656   -7.925  -10.970 1.00 0.00 ? 138 GLY A O    6  
ATOM 11209 H H    . GLY A 1 87  ? 0.416   -6.905  -8.239  1.00 0.00 ? 138 GLY A H    6  
ATOM 11210 H HA2  . GLY A 1 87  ? 0.260   -5.445  -10.846 1.00 0.00 ? 138 GLY A HA2  6  
ATOM 11211 H HA3  . GLY A 1 87  ? 1.369   -5.055  -9.519  1.00 0.00 ? 138 GLY A HA3  6  
ATOM 11212 N N    . ARG A 1 88  ? 3.147   -6.326  -10.759 1.00 0.00 ? 139 ARG A N    6  
ATOM 11213 C CA   . ARG A 1 88  ? 4.245   -7.187  -11.305 1.00 0.00 ? 139 ARG A CA   6  
ATOM 11214 C C    . ARG A 1 88  ? 5.171   -7.604  -10.164 1.00 0.00 ? 139 ARG A C    6  
ATOM 11215 O O    . ARG A 1 88  ? 5.355   -6.877  -9.208  1.00 0.00 ? 139 ARG A O    6  
ATOM 11216 C CB   . ARG A 1 88  ? 5.032   -6.397  -12.346 1.00 0.00 ? 139 ARG A CB   6  
ATOM 11217 C CG   . ARG A 1 88  ? 4.141   -6.107  -13.571 1.00 0.00 ? 139 ARG A CG   6  
ATOM 11218 C CD   . ARG A 1 88  ? 4.054   -7.338  -14.496 1.00 0.00 ? 139 ARG A CD   6  
ATOM 11219 N NE   . ARG A 1 88  ? 3.020   -8.282  -13.982 1.00 0.00 ? 139 ARG A NE   6  
ATOM 11220 C CZ   . ARG A 1 88  ? 2.592   -9.263  -14.730 1.00 0.00 ? 139 ARG A CZ   6  
ATOM 11221 N NH1  . ARG A 1 88  ? 3.056   -9.420  -15.939 1.00 0.00 ? 139 ARG A NH1  6  
ATOM 11222 N NH2  . ARG A 1 88  ? 1.704   -10.098 -14.265 1.00 0.00 ? 139 ARG A NH2  6  
ATOM 11223 H H    . ARG A 1 88  ? 3.342   -5.409  -10.472 1.00 0.00 ? 139 ARG A H    6  
ATOM 11224 H HA   . ARG A 1 88  ? 3.836   -8.071  -11.762 1.00 0.00 ? 139 ARG A HA   6  
ATOM 11225 H HB2  . ARG A 1 88  ? 5.350   -5.464  -11.906 1.00 0.00 ? 139 ARG A HB2  6  
ATOM 11226 H HB3  . ARG A 1 88  ? 5.899   -6.961  -12.650 1.00 0.00 ? 139 ARG A HB3  6  
ATOM 11227 H HG2  . ARG A 1 88  ? 3.147   -5.846  -13.234 1.00 0.00 ? 139 ARG A HG2  6  
ATOM 11228 H HG3  . ARG A 1 88  ? 4.555   -5.279  -14.124 1.00 0.00 ? 139 ARG A HG3  6  
ATOM 11229 H HD2  . ARG A 1 88  ? 3.780   -7.016  -15.487 1.00 0.00 ? 139 ARG A HD2  6  
ATOM 11230 H HD3  . ARG A 1 88  ? 5.012   -7.832  -14.540 1.00 0.00 ? 139 ARG A HD3  6  
ATOM 11231 H HE   . ARG A 1 88  ? 2.663   -8.169  -13.077 1.00 0.00 ? 139 ARG A HE   6  
ATOM 11232 H HH11 . ARG A 1 88  ? 3.742   -8.789  -16.298 1.00 0.00 ? 139 ARG A HH11 6  
ATOM 11233 H HH12 . ARG A 1 88  ? 2.724   -10.176 -16.505 1.00 0.00 ? 139 ARG A HH12 6  
ATOM 11234 H HH21 . ARG A 1 88  ? 1.362   -9.993  -13.333 1.00 0.00 ? 139 ARG A HH21 6  
ATOM 11235 H HH22 . ARG A 1 88  ? 1.354   -10.830 -14.846 1.00 0.00 ? 139 ARG A HH22 6  
ATOM 11236 N N    . SER A 1 89  ? 5.751   -8.774  -10.250 1.00 0.00 ? 140 SER A N    6  
ATOM 11237 C CA   . SER A 1 89  ? 6.666   -9.251  -9.164  1.00 0.00 ? 140 SER A CA   6  
ATOM 11238 C C    . SER A 1 89  ? 8.122   -9.195  -9.631  1.00 0.00 ? 140 SER A C    6  
ATOM 11239 O O    . SER A 1 89  ? 9.015   -9.632  -8.935  1.00 0.00 ? 140 SER A O    6  
ATOM 11240 C CB   . SER A 1 89  ? 6.310   -10.693 -8.814  1.00 0.00 ? 140 SER A CB   6  
ATOM 11241 O OG   . SER A 1 89  ? 7.212   -11.171 -7.821  1.00 0.00 ? 140 SER A OG   6  
ATOM 11242 H H    . SER A 1 89  ? 5.585   -9.345  -11.032 1.00 0.00 ? 140 SER A H    6  
ATOM 11243 H HA   . SER A 1 89  ? 6.548   -8.637  -8.282  1.00 0.00 ? 140 SER A HA   6  
ATOM 11244 H HB2  . SER A 1 89  ? 5.304   -10.734 -8.430  1.00 0.00 ? 140 SER A HB2  6  
ATOM 11245 H HB3  . SER A 1 89  ? 6.382   -11.305 -9.706  1.00 0.00 ? 140 SER A HB3  6  
ATOM 11246 H HG   . SER A 1 89  ? 8.077   -10.800 -8.002  1.00 0.00 ? 140 SER A HG   6  
ATOM 11247 N N    . GLY A 1 90  ? 8.379   -8.686  -10.809 1.00 0.00 ? 141 GLY A N    6  
ATOM 11248 C CA   . GLY A 1 90  ? 9.792   -8.643  -11.305 1.00 0.00 ? 141 GLY A CA   6  
ATOM 11249 C C    . GLY A 1 90  ? 10.544  -7.449  -10.712 1.00 0.00 ? 141 GLY A C    6  
ATOM 11250 O O    . GLY A 1 90  ? 10.483  -6.350  -11.227 1.00 0.00 ? 141 GLY A O    6  
ATOM 11251 H H    . GLY A 1 90  ? 7.648   -8.353  -11.372 1.00 0.00 ? 141 GLY A H    6  
ATOM 11252 H HA2  . GLY A 1 90  ? 10.295  -9.554  -11.023 1.00 0.00 ? 141 GLY A HA2  6  
ATOM 11253 H HA3  . GLY A 1 90  ? 9.791   -8.559  -12.382 1.00 0.00 ? 141 GLY A HA3  6  
ATOM 11254 N N    . ARG A 1 91  ? 11.282  -7.661  -9.657  1.00 0.00 ? 142 ARG A N    6  
ATOM 11255 C CA   . ARG A 1 91  ? 12.061  -6.542  -9.061  1.00 0.00 ? 142 ARG A CA   6  
ATOM 11256 C C    . ARG A 1 91  ? 13.051  -6.002  -10.099 1.00 0.00 ? 142 ARG A C    6  
ATOM 11257 O O    . ARG A 1 91  ? 13.554  -4.903  -9.982  1.00 0.00 ? 142 ARG A O    6  
ATOM 11258 C CB   . ARG A 1 91  ? 12.830  -7.037  -7.831  1.00 0.00 ? 142 ARG A CB   6  
ATOM 11259 C CG   . ARG A 1 91  ? 13.891  -8.057  -8.259  1.00 0.00 ? 142 ARG A CG   6  
ATOM 11260 C CD   . ARG A 1 91  ? 14.488  -8.731  -7.019  1.00 0.00 ? 142 ARG A CD   6  
ATOM 11261 N NE   . ARG A 1 91  ? 15.660  -9.571  -7.425  1.00 0.00 ? 142 ARG A NE   6  
ATOM 11262 C CZ   . ARG A 1 91  ? 15.539  -10.545 -8.278  1.00 0.00 ? 142 ARG A CZ   6  
ATOM 11263 N NH1  . ARG A 1 91  ? 14.356  -10.934 -8.670  1.00 0.00 ? 142 ARG A NH1  6  
ATOM 11264 N NH2  . ARG A 1 91  ? 16.608  -11.157 -8.707  1.00 0.00 ? 142 ARG A NH2  6  
ATOM 11265 H H    . ARG A 1 91  ? 11.340  -8.560  -9.265  1.00 0.00 ? 142 ARG A H    6  
ATOM 11266 H HA   . ARG A 1 91  ? 11.385  -5.750  -8.766  1.00 0.00 ? 142 ARG A HA   6  
ATOM 11267 H HB2  . ARG A 1 91  ? 13.311  -6.198  -7.349  1.00 0.00 ? 142 ARG A HB2  6  
ATOM 11268 H HB3  . ARG A 1 91  ? 12.138  -7.505  -7.142  1.00 0.00 ? 142 ARG A HB3  6  
ATOM 11269 H HG2  . ARG A 1 91  ? 13.430  -8.798  -8.892  1.00 0.00 ? 142 ARG A HG2  6  
ATOM 11270 H HG3  . ARG A 1 91  ? 14.676  -7.557  -8.804  1.00 0.00 ? 142 ARG A HG3  6  
ATOM 11271 H HD2  . ARG A 1 91  ? 14.857  -7.979  -6.349  1.00 0.00 ? 142 ARG A HD2  6  
ATOM 11272 H HD3  . ARG A 1 91  ? 13.722  -9.314  -6.507  1.00 0.00 ? 142 ARG A HD3  6  
ATOM 11273 H HE   . ARG A 1 91  ? 16.548  -9.350  -7.081  1.00 0.00 ? 142 ARG A HE   6  
ATOM 11274 H HH11 . ARG A 1 91  ? 13.539  -10.485 -8.312  1.00 0.00 ? 142 ARG A HH11 6  
ATOM 11275 H HH12 . ARG A 1 91  ? 14.264  -11.680 -9.329  1.00 0.00 ? 142 ARG A HH12 6  
ATOM 11276 H HH21 . ARG A 1 91  ? 17.509  -10.870 -8.379  1.00 0.00 ? 142 ARG A HH21 6  
ATOM 11277 H HH22 . ARG A 1 91  ? 16.531  -11.912 -9.357  1.00 0.00 ? 142 ARG A HH22 6  
ATOM 11278 N N    . GLY A 1 92  ? 13.355  -6.780  -11.100 1.00 0.00 ? 143 GLY A N    6  
ATOM 11279 C CA   . GLY A 1 92  ? 14.331  -6.324  -12.132 1.00 0.00 ? 143 GLY A CA   6  
ATOM 11280 C C    . GLY A 1 92  ? 13.948  -4.936  -12.651 1.00 0.00 ? 143 GLY A C    6  
ATOM 11281 O O    . GLY A 1 92  ? 14.795  -4.097  -12.880 1.00 0.00 ? 143 GLY A O    6  
ATOM 11282 H H    . GLY A 1 92  ? 12.950  -7.675  -11.167 1.00 0.00 ? 143 GLY A H    6  
ATOM 11283 H HA2  . GLY A 1 92  ? 15.318  -6.277  -11.689 1.00 0.00 ? 143 GLY A HA2  6  
ATOM 11284 H HA3  . GLY A 1 92  ? 14.341  -7.023  -12.955 1.00 0.00 ? 143 GLY A HA3  6  
ATOM 11285 N N    . LYS A 1 93  ? 12.678  -4.678  -12.817 1.00 0.00 ? 144 LYS A N    6  
ATOM 11286 C CA   . LYS A 1 93  ? 12.234  -3.341  -13.299 1.00 0.00 ? 144 LYS A CA   6  
ATOM 11287 C C    . LYS A 1 93  ? 11.861  -2.517  -12.067 1.00 0.00 ? 144 LYS A C    6  
ATOM 11288 O O    . LYS A 1 93  ? 11.878  -3.019  -10.962 1.00 0.00 ? 144 LYS A O    6  
ATOM 11289 C CB   . LYS A 1 93  ? 11.035  -3.502  -14.251 1.00 0.00 ? 144 LYS A CB   6  
ATOM 11290 C CG   . LYS A 1 93  ? 9.909   -4.332  -13.587 1.00 0.00 ? 144 LYS A CG   6  
ATOM 11291 C CD   . LYS A 1 93  ? 9.988   -5.823  -13.985 1.00 0.00 ? 144 LYS A CD   6  
ATOM 11292 C CE   . LYS A 1 93  ? 9.741   -6.001  -15.493 1.00 0.00 ? 144 LYS A CE   6  
ATOM 11293 N NZ   . LYS A 1 93  ? 8.935   -7.236  -15.704 1.00 0.00 ? 144 LYS A NZ   6  
ATOM 11294 H H    . LYS A 1 93  ? 12.011  -5.356  -12.606 1.00 0.00 ? 144 LYS A H    6  
ATOM 11295 H HA   . LYS A 1 93  ? 13.045  -2.846  -13.821 1.00 0.00 ? 144 LYS A HA   6  
ATOM 11296 H HB2  . LYS A 1 93  ? 10.659  -2.519  -14.505 1.00 0.00 ? 144 LYS A HB2  6  
ATOM 11297 H HB3  . LYS A 1 93  ? 11.368  -3.993  -15.154 1.00 0.00 ? 144 LYS A HB3  6  
ATOM 11298 H HG2  . LYS A 1 93  ? 9.979   -4.253  -12.512 1.00 0.00 ? 144 LYS A HG2  6  
ATOM 11299 H HG3  . LYS A 1 93  ? 8.954   -3.945  -13.907 1.00 0.00 ? 144 LYS A HG3  6  
ATOM 11300 H HD2  . LYS A 1 93  ? 10.960  -6.217  -13.730 1.00 0.00 ? 144 LYS A HD2  6  
ATOM 11301 H HD3  . LYS A 1 93  ? 9.231   -6.375  -13.440 1.00 0.00 ? 144 LYS A HD3  6  
ATOM 11302 H HE2  . LYS A 1 93  ? 9.199   -5.153  -15.887 1.00 0.00 ? 144 LYS A HE2  6  
ATOM 11303 H HE3  . LYS A 1 93  ? 10.688  -6.098  -16.010 1.00 0.00 ? 144 LYS A HE3  6  
ATOM 11304 H HZ1  . LYS A 1 93  ? 8.145   -7.254  -15.028 1.00 0.00 ? 144 LYS A HZ1  6  
ATOM 11305 H HZ2  . LYS A 1 93  ? 8.557   -7.243  -16.672 1.00 0.00 ? 144 LYS A HZ2  6  
ATOM 11306 H HZ3  . LYS A 1 93  ? 9.539   -8.072  -15.557 1.00 0.00 ? 144 LYS A HZ3  6  
ATOM 11307 N N    . SER A 1 94  ? 11.565  -1.257  -12.222 1.00 0.00 ? 145 SER A N    6  
ATOM 11308 C CA   . SER A 1 94  ? 11.247  -0.426  -11.026 1.00 0.00 ? 145 SER A CA   6  
ATOM 11309 C C    . SER A 1 94  ? 9.745   -0.464  -10.703 1.00 0.00 ? 145 SER A C    6  
ATOM 11310 O O    . SER A 1 94  ? 8.914   -0.215  -11.544 1.00 0.00 ? 145 SER A O    6  
ATOM 11311 C CB   . SER A 1 94  ? 11.652  1.010   -11.326 1.00 0.00 ? 145 SER A CB   6  
ATOM 11312 O OG   . SER A 1 94  ? 10.667  1.606   -12.160 1.00 0.00 ? 145 SER A OG   6  
ATOM 11313 H H    . SER A 1 94  ? 11.584  -0.850  -13.112 1.00 0.00 ? 145 SER A H    6  
ATOM 11314 H HA   . SER A 1 94  ? 11.807  -0.785  -10.175 1.00 0.00 ? 145 SER A HA   6  
ATOM 11315 H HB2  . SER A 1 94  ? 11.730  1.566   -10.409 1.00 0.00 ? 145 SER A HB2  6  
ATOM 11316 H HB3  . SER A 1 94  ? 12.609  1.010   -11.829 1.00 0.00 ? 145 SER A HB3  6  
ATOM 11317 H HG   . SER A 1 94  ? 9.986   0.948   -12.326 1.00 0.00 ? 145 SER A HG   6  
ATOM 11318 N N    . PHE A 1 95  ? 9.407   -0.759  -9.474  1.00 0.00 ? 146 PHE A N    6  
ATOM 11319 C CA   . PHE A 1 95  ? 7.978   -0.800  -9.052  1.00 0.00 ? 146 PHE A CA   6  
ATOM 11320 C C    . PHE A 1 95  ? 7.581   0.585   -8.552  1.00 0.00 ? 146 PHE A C    6  
ATOM 11321 O O    . PHE A 1 95  ? 8.259   1.162   -7.725  1.00 0.00 ? 146 PHE A O    6  
ATOM 11322 C CB   . PHE A 1 95  ? 7.870   -1.813  -7.905  1.00 0.00 ? 146 PHE A CB   6  
ATOM 11323 C CG   . PHE A 1 95  ? 6.432   -2.164  -7.601  1.00 0.00 ? 146 PHE A CG   6  
ATOM 11324 C CD1  . PHE A 1 95  ? 5.725   -2.978  -8.489  1.00 0.00 ? 146 PHE A CD1  6  
ATOM 11325 C CD2  . PHE A 1 95  ? 5.814   -1.715  -6.414  1.00 0.00 ? 146 PHE A CD2  6  
ATOM 11326 C CE1  . PHE A 1 95  ? 4.412   -3.352  -8.204  1.00 0.00 ? 146 PHE A CE1  6  
ATOM 11327 C CE2  . PHE A 1 95  ? 4.496   -2.082  -6.134  1.00 0.00 ? 146 PHE A CE2  6  
ATOM 11328 C CZ   . PHE A 1 95  ? 3.797   -2.906  -7.026  1.00 0.00 ? 146 PHE A CZ   6  
ATOM 11329 H H    . PHE A 1 95  ? 10.100  -0.940  -8.812  1.00 0.00 ? 146 PHE A H    6  
ATOM 11330 H HA   . PHE A 1 95  ? 7.342   -1.095  -9.876  1.00 0.00 ? 146 PHE A HA   6  
ATOM 11331 H HB2  . PHE A 1 95  ? 8.397   -2.714  -8.185  1.00 0.00 ? 146 PHE A HB2  6  
ATOM 11332 H HB3  . PHE A 1 95  ? 8.330   -1.395  -7.022  1.00 0.00 ? 146 PHE A HB3  6  
ATOM 11333 H HD1  . PHE A 1 95  ? 6.201   -3.326  -9.394  1.00 0.00 ? 146 PHE A HD1  6  
ATOM 11334 H HD2  . PHE A 1 95  ? 6.349   -1.075  -5.723  1.00 0.00 ? 146 PHE A HD2  6  
ATOM 11335 H HE1  . PHE A 1 95  ? 3.867   -3.977  -8.900  1.00 0.00 ? 146 PHE A HE1  6  
ATOM 11336 H HE2  . PHE A 1 95  ? 4.023   -1.738  -5.223  1.00 0.00 ? 146 PHE A HE2  6  
ATOM 11337 H HZ   . PHE A 1 95  ? 2.785   -3.201  -6.804  1.00 0.00 ? 146 PHE A HZ   6  
ATOM 11338 N N    . THR A 1 96  ? 6.489   1.128   -9.031  1.00 0.00 ? 147 THR A N    6  
ATOM 11339 C CA   . THR A 1 96  ? 6.053   2.484   -8.557  1.00 0.00 ? 147 THR A CA   6  
ATOM 11340 C C    . THR A 1 96  ? 4.537   2.504   -8.334  1.00 0.00 ? 147 THR A C    6  
ATOM 11341 O O    . THR A 1 96  ? 3.763   1.943   -9.109  1.00 0.00 ? 147 THR A O    6  
ATOM 11342 C CB   . THR A 1 96  ? 6.435   3.551   -9.597  1.00 0.00 ? 147 THR A CB   6  
ATOM 11343 O OG1  . THR A 1 96  ? 6.019   4.834   -9.146  1.00 0.00 ? 147 THR A OG1  6  
ATOM 11344 C CG2  . THR A 1 96  ? 5.770   3.239   -10.934 1.00 0.00 ? 147 THR A CG2  6  
ATOM 11345 H H    . THR A 1 96  ? 5.951   0.642   -9.694  1.00 0.00 ? 147 THR A H    6  
ATOM 11346 H HA   . THR A 1 96  ? 6.542   2.717   -7.620  1.00 0.00 ? 147 THR A HA   6  
ATOM 11347 H HB   . THR A 1 96  ? 7.506   3.556   -9.731  1.00 0.00 ? 147 THR A HB   6  
ATOM 11348 H HG1  . THR A 1 96  ? 5.258   4.716   -8.570  1.00 0.00 ? 147 THR A HG1  6  
ATOM 11349 H HG21 . THR A 1 96  ? 6.086   2.266   -11.269 1.00 0.00 ? 147 THR A HG21 6  
ATOM 11350 H HG22 . THR A 1 96  ? 4.697   3.251   -10.822 1.00 0.00 ? 147 THR A HG22 6  
ATOM 11351 H HG23 . THR A 1 96  ? 6.063   3.985   -11.662 1.00 0.00 ? 147 THR A HG23 6  
ATOM 11352 N N    . LEU A 1 97  ? 4.101   3.173   -7.285  1.00 0.00 ? 148 LEU A N    6  
ATOM 11353 C CA   . LEU A 1 97  ? 2.638   3.276   -7.005  1.00 0.00 ? 148 LEU A CA   6  
ATOM 11354 C C    . LEU A 1 97  ? 2.303   4.744   -6.809  1.00 0.00 ? 148 LEU A C    6  
ATOM 11355 O O    . LEU A 1 97  ? 2.992   5.466   -6.113  1.00 0.00 ? 148 LEU A O    6  
ATOM 11356 C CB   . LEU A 1 97  ? 2.208   2.445   -5.756  1.00 0.00 ? 148 LEU A CB   6  
ATOM 11357 C CG   . LEU A 1 97  ? 3.385   2.124   -4.817  1.00 0.00 ? 148 LEU A CG   6  
ATOM 11358 C CD1  . LEU A 1 97  ? 2.821   1.382   -3.584  1.00 0.00 ? 148 LEU A CD1  6  
ATOM 11359 C CD2  . LEU A 1 97  ? 4.452   1.236   -5.510  1.00 0.00 ? 148 LEU A CD2  6  
ATOM 11360 H H    . LEU A 1 97  ? 4.743   3.628   -6.696  1.00 0.00 ? 148 LEU A H    6  
ATOM 11361 H HA   . LEU A 1 97  ? 2.090   2.947   -7.866  1.00 0.00 ? 148 LEU A HA   6  
ATOM 11362 H HB2  . LEU A 1 97  ? 1.463   2.996   -5.196  1.00 0.00 ? 148 LEU A HB2  6  
ATOM 11363 H HB3  . LEU A 1 97  ? 1.768   1.516   -6.078  1.00 0.00 ? 148 LEU A HB3  6  
ATOM 11364 H HG   . LEU A 1 97  ? 3.834   3.052   -4.503  1.00 0.00 ? 148 LEU A HG   6  
ATOM 11365 H HD11 . LEU A 1 97  ? 2.062   0.676   -3.894  1.00 0.00 ? 148 LEU A HD11 6  
ATOM 11366 H HD12 . LEU A 1 97  ? 3.616   0.847   -3.082  1.00 0.00 ? 148 LEU A HD12 6  
ATOM 11367 H HD13 . LEU A 1 97  ? 2.387   2.098   -2.903  1.00 0.00 ? 148 LEU A HD13 6  
ATOM 11368 H HD21 . LEU A 1 97  ? 4.046   0.807   -6.416  1.00 0.00 ? 148 LEU A HD21 6  
ATOM 11369 H HD22 . LEU A 1 97  ? 5.314   1.837   -5.755  1.00 0.00 ? 148 LEU A HD22 6  
ATOM 11370 H HD23 . LEU A 1 97  ? 4.765   0.439   -4.843  1.00 0.00 ? 148 LEU A HD23 6  
ATOM 11371 N N    . THR A 1 98  ? 1.250   5.184   -7.441  1.00 0.00 ? 149 THR A N    6  
ATOM 11372 C CA   . THR A 1 98  ? 0.842   6.611   -7.331  1.00 0.00 ? 149 THR A CA   6  
ATOM 11373 C C    . THR A 1 98  ? -0.465  6.707   -6.558  1.00 0.00 ? 149 THR A C    6  
ATOM 11374 O O    . THR A 1 98  ? -1.437  6.053   -6.881  1.00 0.00 ? 149 THR A O    6  
ATOM 11375 C CB   . THR A 1 98  ? 0.632   7.187   -8.740  1.00 0.00 ? 149 THR A CB   6  
ATOM 11376 O OG1  . THR A 1 98  ? -0.389  6.456   -9.401  1.00 0.00 ? 149 THR A OG1  6  
ATOM 11377 C CG2  . THR A 1 98  ? 1.929   7.088   -9.549  1.00 0.00 ? 149 THR A CG2  6  
ATOM 11378 H H    . THR A 1 98  ? 0.726   4.569   -7.998  1.00 0.00 ? 149 THR A H    6  
ATOM 11379 H HA   . THR A 1 98  ? 1.603   7.180   -6.822  1.00 0.00 ? 149 THR A HA   6  
ATOM 11380 H HB   . THR A 1 98  ? 0.339   8.224   -8.666  1.00 0.00 ? 149 THR A HB   6  
ATOM 11381 H HG1  . THR A 1 98  ? -1.226  6.672   -8.986  1.00 0.00 ? 149 THR A HG1  6  
ATOM 11382 H HG21 . THR A 1 98  ? 2.360   6.106   -9.423  1.00 0.00 ? 149 THR A HG21 6  
ATOM 11383 H HG22 . THR A 1 98  ? 1.714   7.254   -10.594 1.00 0.00 ? 149 THR A HG22 6  
ATOM 11384 H HG23 . THR A 1 98  ? 2.628   7.834   -9.203  1.00 0.00 ? 149 THR A HG23 6  
ATOM 11385 N N    . ILE A 1 99  ? -0.499  7.546   -5.558  1.00 0.00 ? 150 ILE A N    6  
ATOM 11386 C CA   . ILE A 1 99  ? -1.745  7.735   -4.758  1.00 0.00 ? 150 ILE A CA   6  
ATOM 11387 C C    . ILE A 1 99  ? -2.141  9.198   -4.893  1.00 0.00 ? 150 ILE A C    6  
ATOM 11388 O O    . ILE A 1 99  ? -1.324  10.077  -4.700  1.00 0.00 ? 150 ILE A O    6  
ATOM 11389 C CB   . ILE A 1 99  ? -1.485  7.448   -3.276  1.00 0.00 ? 150 ILE A CB   6  
ATOM 11390 C CG1  . ILE A 1 99  ? -0.766  6.108   -3.111  1.00 0.00 ? 150 ILE A CG1  6  
ATOM 11391 C CG2  . ILE A 1 99  ? -2.824  7.387   -2.535  1.00 0.00 ? 150 ILE A CG2  6  
ATOM 11392 C CD1  . ILE A 1 99  ? -0.250  5.995   -1.677  1.00 0.00 ? 150 ILE A CD1  6  
ATOM 11393 H H    . ILE A 1 99  ? 0.300   8.073   -5.341  1.00 0.00 ? 150 ILE A H    6  
ATOM 11394 H HA   . ILE A 1 99  ? -2.536  7.103   -5.126  1.00 0.00 ? 150 ILE A HA   6  
ATOM 11395 H HB   . ILE A 1 99  ? -0.888  8.238   -2.854  1.00 0.00 ? 150 ILE A HB   6  
ATOM 11396 H HG12 . ILE A 1 99  ? -1.449  5.301   -3.315  1.00 0.00 ? 150 ILE A HG12 6  
ATOM 11397 H HG13 . ILE A 1 99  ? 0.067   6.055   -3.794  1.00 0.00 ? 150 ILE A HG13 6  
ATOM 11398 H HG21 . ILE A 1 99  ? -3.436  6.601   -2.958  1.00 0.00 ? 150 ILE A HG21 6  
ATOM 11399 H HG22 . ILE A 1 99  ? -2.646  7.180   -1.491  1.00 0.00 ? 150 ILE A HG22 6  
ATOM 11400 H HG23 . ILE A 1 99  ? -3.337  8.334   -2.636  1.00 0.00 ? 150 ILE A HG23 6  
ATOM 11401 H HD11 . ILE A 1 99  ? -1.039  6.253   -0.987  1.00 0.00 ? 150 ILE A HD11 6  
ATOM 11402 H HD12 . ILE A 1 99  ? 0.077   4.985   -1.491  1.00 0.00 ? 150 ILE A HD12 6  
ATOM 11403 H HD13 . ILE A 1 99  ? 0.582   6.672   -1.543  1.00 0.00 ? 150 ILE A HD13 6  
ATOM 11404 N N    . THR A 1 100 ? -3.373  9.474   -5.205  1.00 0.00 ? 151 THR A N    6  
ATOM 11405 C CA   . THR A 1 100 ? -3.816  10.896  -5.333  1.00 0.00 ? 151 THR A CA   6  
ATOM 11406 C C    . THR A 1 100 ? -5.031  11.105  -4.451  1.00 0.00 ? 151 THR A C    6  
ATOM 11407 O O    . THR A 1 100 ? -5.815  10.201  -4.231  1.00 0.00 ? 151 THR A O    6  
ATOM 11408 C CB   . THR A 1 100 ? -4.185  11.203  -6.782  1.00 0.00 ? 151 THR A CB   6  
ATOM 11409 O OG1  . THR A 1 100 ? -5.232  10.342  -7.201  1.00 0.00 ? 151 THR A OG1  6  
ATOM 11410 C CG2  . THR A 1 100 ? -2.965  11.016  -7.678  1.00 0.00 ? 151 THR A CG2  6  
ATOM 11411 H H    . THR A 1 100 ? -4.016  8.749   -5.346  1.00 0.00 ? 151 THR A H    6  
ATOM 11412 H HA   . THR A 1 100 ? -3.029  11.569  -5.014  1.00 0.00 ? 151 THR A HA   6  
ATOM 11413 H HB   . THR A 1 100 ? -4.510  12.225  -6.847  1.00 0.00 ? 151 THR A HB   6  
ATOM 11414 H HG1  . THR A 1 100 ? -6.055  10.832  -7.148  1.00 0.00 ? 151 THR A HG1  6  
ATOM 11415 H HG21 . THR A 1 100 ? -2.166  11.651  -7.328  1.00 0.00 ? 151 THR A HG21 6  
ATOM 11416 H HG22 . THR A 1 100 ? -2.652  9.981   -7.652  1.00 0.00 ? 151 THR A HG22 6  
ATOM 11417 H HG23 . THR A 1 100 ? -3.221  11.291  -8.689  1.00 0.00 ? 151 THR A HG23 6  
ATOM 11418 N N    . VAL A 1 101 ? -5.182  12.291  -3.930  1.00 0.00 ? 152 VAL A N    6  
ATOM 11419 C CA   . VAL A 1 101 ? -6.338  12.585  -3.036  1.00 0.00 ? 152 VAL A CA   6  
ATOM 11420 C C    . VAL A 1 101 ? -7.079  13.791  -3.625  1.00 0.00 ? 152 VAL A C    6  
ATOM 11421 O O    . VAL A 1 101 ? -6.459  14.775  -3.990  1.00 0.00 ? 152 VAL A O    6  
ATOM 11422 C CB   . VAL A 1 101 ? -5.807  12.922  -1.633  1.00 0.00 ? 152 VAL A CB   6  
ATOM 11423 C CG1  . VAL A 1 101 ? -6.907  12.675  -0.592  1.00 0.00 ? 152 VAL A CG1  6  
ATOM 11424 C CG2  . VAL A 1 101 ? -4.593  12.046  -1.297  1.00 0.00 ? 152 VAL A CG2  6  
ATOM 11425 H H    . VAL A 1 101 ? -4.516  12.988  -4.118  1.00 0.00 ? 152 VAL A H    6  
ATOM 11426 H HA   . VAL A 1 101 ? -7.010  11.737  -2.984  1.00 0.00 ? 152 VAL A HA   6  
ATOM 11427 H HB   . VAL A 1 101 ? -5.513  13.965  -1.598  1.00 0.00 ? 152 VAL A HB   6  
ATOM 11428 H HG11 . VAL A 1 101 ? -7.856  13.007  -0.983  1.00 0.00 ? 152 VAL A HG11 6  
ATOM 11429 H HG12 . VAL A 1 101 ? -6.968  11.620  -0.379  1.00 0.00 ? 152 VAL A HG12 6  
ATOM 11430 H HG13 . VAL A 1 101 ? -6.674  13.210  0.316   1.00 0.00 ? 152 VAL A HG13 6  
ATOM 11431 H HG21 . VAL A 1 101 ? -3.894  12.036  -2.119  1.00 0.00 ? 152 VAL A HG21 6  
ATOM 11432 H HG22 . VAL A 1 101 ? -4.104  12.444  -0.432  1.00 0.00 ? 152 VAL A HG22 6  
ATOM 11433 H HG23 . VAL A 1 101 ? -4.929  11.043  -1.095  1.00 0.00 ? 152 VAL A HG23 6  
ATOM 11434 N N    . PHE A 1 102 ? -8.390  13.709  -3.743  1.00 0.00 ? 153 PHE A N    6  
ATOM 11435 C CA   . PHE A 1 102 ? -9.182  14.837  -4.343  1.00 0.00 ? 153 PHE A CA   6  
ATOM 11436 C C    . PHE A 1 102 ? -10.093 15.504  -3.303  1.00 0.00 ? 153 PHE A C    6  
ATOM 11437 O O    . PHE A 1 102 ? -11.241 15.794  -3.582  1.00 0.00 ? 153 PHE A O    6  
ATOM 11438 C CB   . PHE A 1 102 ? -10.049 14.300  -5.483  1.00 0.00 ? 153 PHE A CB   6  
ATOM 11439 C CG   . PHE A 1 102 ? -9.199  13.480  -6.428  1.00 0.00 ? 153 PHE A CG   6  
ATOM 11440 C CD1  . PHE A 1 102 ? -8.146  14.084  -7.132  1.00 0.00 ? 153 PHE A CD1  6  
ATOM 11441 C CD2  . PHE A 1 102 ? -9.469  12.116  -6.607  1.00 0.00 ? 153 PHE A CD2  6  
ATOM 11442 C CE1  . PHE A 1 102 ? -7.365  13.326  -8.011  1.00 0.00 ? 153 PHE A CE1  6  
ATOM 11443 C CE2  . PHE A 1 102 ? -8.688  11.361  -7.486  1.00 0.00 ? 153 PHE A CE2  6  
ATOM 11444 C CZ   . PHE A 1 102 ? -7.640  11.965  -8.189  1.00 0.00 ? 153 PHE A CZ   6  
ATOM 11445 H H    . PHE A 1 102 ? -8.852  12.898  -3.452  1.00 0.00 ? 153 PHE A H    6  
ATOM 11446 H HA   . PHE A 1 102 ? -8.510  15.583  -4.744  1.00 0.00 ? 153 PHE A HA   6  
ATOM 11447 H HB2  . PHE A 1 102 ? -10.840 13.687  -5.075  1.00 0.00 ? 153 PHE A HB2  6  
ATOM 11448 H HB3  . PHE A 1 102 ? -10.479 15.132  -6.025  1.00 0.00 ? 153 PHE A HB3  6  
ATOM 11449 H HD1  . PHE A 1 102 ? -7.934  15.133  -6.996  1.00 0.00 ? 153 PHE A HD1  6  
ATOM 11450 H HD2  . PHE A 1 102 ? -10.279 11.647  -6.065  1.00 0.00 ? 153 PHE A HD2  6  
ATOM 11451 H HE1  . PHE A 1 102 ? -6.553  13.788  -8.551  1.00 0.00 ? 153 PHE A HE1  6  
ATOM 11452 H HE2  . PHE A 1 102 ? -8.896  10.309  -7.621  1.00 0.00 ? 153 PHE A HE2  6  
ATOM 11453 H HZ   . PHE A 1 102 ? -7.038  11.379  -8.867  1.00 0.00 ? 153 PHE A HZ   6  
ATOM 11454 N N    . THR A 1 103 ? -9.602  15.773  -2.119  1.00 0.00 ? 154 THR A N    6  
ATOM 11455 C CA   . THR A 1 103 ? -10.473 16.452  -1.106  1.00 0.00 ? 154 THR A CA   6  
ATOM 11456 C C    . THR A 1 103 ? -10.425 17.956  -1.411  1.00 0.00 ? 154 THR A C    6  
ATOM 11457 O O    . THR A 1 103 ? -10.547 18.345  -2.558  1.00 0.00 ? 154 THR A O    6  
ATOM 11458 C CB   . THR A 1 103 ? -9.945  16.164  0.318   1.00 0.00 ? 154 THR A CB   6  
ATOM 11459 O OG1  . THR A 1 103 ? -10.278 17.232  1.197   1.00 0.00 ? 154 THR A OG1  6  
ATOM 11460 C CG2  . THR A 1 103 ? -8.420  15.971  0.285   1.00 0.00 ? 154 THR A CG2  6  
ATOM 11461 H H    . THR A 1 103 ? -8.669  15.538  -1.900  1.00 0.00 ? 154 THR A H    6  
ATOM 11462 H HA   . THR A 1 103 ? -11.491 16.096  -1.201  1.00 0.00 ? 154 THR A HA   6  
ATOM 11463 H HB   . THR A 1 103 ? -10.404 15.261  0.685   1.00 0.00 ? 154 THR A HB   6  
ATOM 11464 H HG1  . THR A 1 103 ? -11.167 17.082  1.537   1.00 0.00 ? 154 THR A HG1  6  
ATOM 11465 H HG21 . THR A 1 103 ? -7.986  16.571  -0.501  1.00 0.00 ? 154 THR A HG21 6  
ATOM 11466 H HG22 . THR A 1 103 ? -7.994  16.263  1.235   1.00 0.00 ? 154 THR A HG22 6  
ATOM 11467 H HG23 . THR A 1 103 ? -8.197  14.941  0.102   1.00 0.00 ? 154 THR A HG23 6  
ATOM 11468 N N    . ASN A 1 104 ? -10.245 18.812  -0.440  1.00 0.00 ? 155 ASN A N    6  
ATOM 11469 C CA   . ASN A 1 104 ? -10.193 20.277  -0.752  1.00 0.00 ? 155 ASN A CA   6  
ATOM 11470 C C    . ASN A 1 104 ? -8.752  20.644  -1.140  1.00 0.00 ? 155 ASN A C    6  
ATOM 11471 O O    . ASN A 1 104 ? -8.537  21.268  -2.154  1.00 0.00 ? 155 ASN A O    6  
ATOM 11472 C CB   . ASN A 1 104 ? -10.688 21.114  0.459   1.00 0.00 ? 155 ASN A CB   6  
ATOM 11473 C CG   . ASN A 1 104 ? -11.955 21.901  0.086   1.00 0.00 ? 155 ASN A CG   6  
ATOM 11474 O OD1  . ASN A 1 104 ? -12.983 21.751  0.715   1.00 0.00 ? 155 ASN A OD1  6  
ATOM 11475 N ND2  . ASN A 1 104 ? -11.922 22.733  -0.921  1.00 0.00 ? 155 ASN A ND2  6  
ATOM 11476 H H    . ASN A 1 104 ? -10.142 18.496  0.482   1.00 0.00 ? 155 ASN A H    6  
ATOM 11477 H HA   . ASN A 1 104 ? -10.831 20.471  -1.609  1.00 0.00 ? 155 ASN A HA   6  
ATOM 11478 H HB2  . ASN A 1 104 ? -10.924 20.447  1.280   1.00 0.00 ? 155 ASN A HB2  6  
ATOM 11479 H HB3  . ASN A 1 104 ? -9.920  21.807  0.773   1.00 0.00 ? 155 ASN A HB3  6  
ATOM 11480 H HD21 . ASN A 1 104 ? -11.095 22.849  -1.436  1.00 0.00 ? 155 ASN A HD21 6  
ATOM 11481 H HD22 . ASN A 1 104 ? -12.726 23.246  -1.158  1.00 0.00 ? 155 ASN A HD22 6  
ATOM 11482 N N    . PRO A 1 105 ? -7.773  20.231  -0.364  1.00 0.00 ? 156 PRO A N    6  
ATOM 11483 C CA   . PRO A 1 105 ? -6.332  20.468  -0.655  1.00 0.00 ? 156 PRO A CA   6  
ATOM 11484 C C    . PRO A 1 105 ? -5.609  19.219  -1.224  1.00 0.00 ? 156 PRO A C    6  
ATOM 11485 O O    . PRO A 1 105 ? -4.783  18.630  -0.555  1.00 0.00 ? 156 PRO A O    6  
ATOM 11486 C CB   . PRO A 1 105 ? -5.814  20.746  0.745   1.00 0.00 ? 156 PRO A CB   6  
ATOM 11487 C CG   . PRO A 1 105 ? -6.533  19.737  1.587   1.00 0.00 ? 156 PRO A CG   6  
ATOM 11488 C CD   . PRO A 1 105 ? -7.909  19.525  0.920   1.00 0.00 ? 156 PRO A CD   6  
ATOM 11489 H HA   . PRO A 1 105 ? -6.187  21.333  -1.280  1.00 0.00 ? 156 PRO A HA   6  
ATOM 11490 H HB2  . PRO A 1 105 ? -4.741  20.603  0.795   1.00 0.00 ? 156 PRO A HB2  6  
ATOM 11491 H HB3  . PRO A 1 105 ? -6.083  21.746  1.056   1.00 0.00 ? 156 PRO A HB3  6  
ATOM 11492 H HG2  . PRO A 1 105 ? -5.977  18.810  1.605   1.00 0.00 ? 156 PRO A HG2  6  
ATOM 11493 H HG3  . PRO A 1 105 ? -6.663  20.108  2.589   1.00 0.00 ? 156 PRO A HG3  6  
ATOM 11494 H HD2  . PRO A 1 105 ? -8.105  18.484  0.767   1.00 0.00 ? 156 PRO A HD2  6  
ATOM 11495 H HD3  . PRO A 1 105 ? -8.683  19.970  1.514   1.00 0.00 ? 156 PRO A HD3  6  
ATOM 11496 N N    . PRO A 1 106 ? -5.902  18.829  -2.445  1.00 0.00 ? 157 PRO A N    6  
ATOM 11497 C CA   . PRO A 1 106 ? -5.268  17.658  -3.107  1.00 0.00 ? 157 PRO A CA   6  
ATOM 11498 C C    . PRO A 1 106 ? -3.836  17.381  -2.640  1.00 0.00 ? 157 PRO A C    6  
ATOM 11499 O O    . PRO A 1 106 ? -3.017  18.272  -2.527  1.00 0.00 ? 157 PRO A O    6  
ATOM 11500 C CB   . PRO A 1 106 ? -5.282  18.075  -4.578  1.00 0.00 ? 157 PRO A CB   6  
ATOM 11501 C CG   . PRO A 1 106 ? -6.551  18.860  -4.733  1.00 0.00 ? 157 PRO A CG   6  
ATOM 11502 C CD   . PRO A 1 106 ? -6.886  19.447  -3.345  1.00 0.00 ? 157 PRO A CD   6  
ATOM 11503 H HA   . PRO A 1 106 ? -5.878  16.782  -2.981  1.00 0.00 ? 157 PRO A HA   6  
ATOM 11504 H HB2  . PRO A 1 106 ? -4.420  18.697  -4.796  1.00 0.00 ? 157 PRO A HB2  6  
ATOM 11505 H HB3  . PRO A 1 106 ? -5.293  17.205  -5.223  1.00 0.00 ? 157 PRO A HB3  6  
ATOM 11506 H HG2  . PRO A 1 106 ? -6.408  19.658  -5.454  1.00 0.00 ? 157 PRO A HG2  6  
ATOM 11507 H HG3  . PRO A 1 106 ? -7.355  18.214  -5.055  1.00 0.00 ? 157 PRO A HG3  6  
ATOM 11508 H HD2  . PRO A 1 106 ? -6.768  20.519  -3.353  1.00 0.00 ? 157 PRO A HD2  6  
ATOM 11509 H HD3  . PRO A 1 106 ? -7.886  19.166  -3.046  1.00 0.00 ? 157 PRO A HD3  6  
ATOM 11510 N N    . GLN A 1 107 ? -3.539  16.133  -2.370  1.00 0.00 ? 158 GLN A N    6  
ATOM 11511 C CA   . GLN A 1 107 ? -2.157  15.746  -1.909  1.00 0.00 ? 158 GLN A CA   6  
ATOM 11512 C C    . GLN A 1 107 ? -1.604  14.635  -2.803  1.00 0.00 ? 158 GLN A C    6  
ATOM 11513 O O    . GLN A 1 107 ? -2.339  13.796  -3.287  1.00 0.00 ? 158 GLN A O    6  
ATOM 11514 C CB   . GLN A 1 107 ? -2.213  15.251  -0.465  1.00 0.00 ? 158 GLN A CB   6  
ATOM 11515 C CG   . GLN A 1 107 ? -2.725  16.369  0.445   1.00 0.00 ? 158 GLN A CG   6  
ATOM 11516 C CD   . GLN A 1 107 ? -2.627  15.916  1.904   1.00 0.00 ? 158 GLN A CD   6  
ATOM 11517 O OE1  . GLN A 1 107 ? -1.568  15.531  2.362   1.00 0.00 ? 158 GLN A OE1  6  
ATOM 11518 N NE2  . GLN A 1 107 ? -3.692  15.935  2.659   1.00 0.00 ? 158 GLN A NE2  6  
ATOM 11519 H H    . GLN A 1 107 ? -4.232  15.441  -2.482  1.00 0.00 ? 158 GLN A H    6  
ATOM 11520 H HA   . GLN A 1 107 ? -1.494  16.598  -1.961  1.00 0.00 ? 158 GLN A HA   6  
ATOM 11521 H HB2  . GLN A 1 107 ? -2.881  14.407  -0.404  1.00 0.00 ? 158 GLN A HB2  6  
ATOM 11522 H HB3  . GLN A 1 107 ? -1.225  14.954  -0.147  1.00 0.00 ? 158 GLN A HB3  6  
ATOM 11523 H HG2  . GLN A 1 107 ? -2.120  17.255  0.300   1.00 0.00 ? 158 GLN A HG2  6  
ATOM 11524 H HG3  . GLN A 1 107 ? -3.756  16.591  0.206   1.00 0.00 ? 158 GLN A HG3  6  
ATOM 11525 H HE21 . GLN A 1 107 ? -4.549  16.237  2.291   1.00 0.00 ? 158 GLN A HE21 6  
ATOM 11526 H HE22 . GLN A 1 107 ? -3.635  15.638  3.592   1.00 0.00 ? 158 GLN A HE22 6  
ATOM 11527 N N    . VAL A 1 108 ? -0.310  14.619  -3.022  1.00 0.00 ? 159 VAL A N    6  
ATOM 11528 C CA   . VAL A 1 108 ? 0.307   13.561  -3.882  1.00 0.00 ? 159 VAL A CA   6  
ATOM 11529 C C    . VAL A 1 108 ? 1.139   12.616  -3.022  1.00 0.00 ? 159 VAL A C    6  
ATOM 11530 O O    . VAL A 1 108 ? 1.981   13.039  -2.253  1.00 0.00 ? 159 VAL A O    6  
ATOM 11531 C CB   . VAL A 1 108 ? 1.214   14.223  -4.911  1.00 0.00 ? 159 VAL A CB   6  
ATOM 11532 C CG1  . VAL A 1 108 ? 1.846   13.149  -5.790  1.00 0.00 ? 159 VAL A CG1  6  
ATOM 11533 C CG2  . VAL A 1 108 ? 0.372   15.165  -5.770  1.00 0.00 ? 159 VAL A CG2  6  
ATOM 11534 H H    . VAL A 1 108 ? 0.260   15.308  -2.615  1.00 0.00 ? 159 VAL A H    6  
ATOM 11535 H HA   . VAL A 1 108 ? -0.462  12.994  -4.394  1.00 0.00 ? 159 VAL A HA   6  
ATOM 11536 H HB   . VAL A 1 108 ? 1.989   14.782  -4.407  1.00 0.00 ? 159 VAL A HB   6  
ATOM 11537 H HG11 . VAL A 1 108 ? 1.079   12.471  -6.138  1.00 0.00 ? 159 VAL A HG11 6  
ATOM 11538 H HG12 . VAL A 1 108 ? 2.331   13.617  -6.636  1.00 0.00 ? 159 VAL A HG12 6  
ATOM 11539 H HG13 . VAL A 1 108 ? 2.576   12.600  -5.215  1.00 0.00 ? 159 VAL A HG13 6  
ATOM 11540 H HG21 . VAL A 1 108 ? -0.243  15.781  -5.129  1.00 0.00 ? 159 VAL A HG21 6  
ATOM 11541 H HG22 . VAL A 1 108 ? 1.020   15.792  -6.359  1.00 0.00 ? 159 VAL A HG22 6  
ATOM 11542 H HG23 . VAL A 1 108 ? -0.259  14.584  -6.422  1.00 0.00 ? 159 VAL A HG23 6  
ATOM 11543 N N    . ALA A 1 109 ? 0.915   11.336  -3.146  1.00 0.00 ? 160 ALA A N    6  
ATOM 11544 C CA   . ALA A 1 109 ? 1.695   10.355  -2.333  1.00 0.00 ? 160 ALA A CA   6  
ATOM 11545 C C    . ALA A 1 109 ? 2.094   9.165   -3.220  1.00 0.00 ? 160 ALA A C    6  
ATOM 11546 O O    . ALA A 1 109 ? 1.280   8.336   -3.570  1.00 0.00 ? 160 ALA A O    6  
ATOM 11547 C CB   . ALA A 1 109 ? 0.811   9.892   -1.167  1.00 0.00 ? 160 ALA A CB   6  
ATOM 11548 H H    . ALA A 1 109 ? 0.230   11.018  -3.772  1.00 0.00 ? 160 ALA A H    6  
ATOM 11549 H HA   . ALA A 1 109 ? 2.591   10.818  -1.943  1.00 0.00 ? 160 ALA A HA   6  
ATOM 11550 H HB1  . ALA A 1 109 ? -0.228  9.963   -1.459  1.00 0.00 ? 160 ALA A HB1  6  
ATOM 11551 H HB2  . ALA A 1 109 ? 1.043   8.870   -0.905  1.00 0.00 ? 160 ALA A HB2  6  
ATOM 11552 H HB3  . ALA A 1 109 ? 0.983   10.529  -0.310  1.00 0.00 ? 160 ALA A HB3  6  
ATOM 11553 N N    . THR A 1 110 ? 3.348   9.083   -3.596  1.00 0.00 ? 161 THR A N    6  
ATOM 11554 C CA   . THR A 1 110 ? 3.804   7.955   -4.471  1.00 0.00 ? 161 THR A CA   6  
ATOM 11555 C C    . THR A 1 110 ? 5.172   7.449   -3.994  1.00 0.00 ? 161 THR A C    6  
ATOM 11556 O O    . THR A 1 110 ? 5.933   8.189   -3.401  1.00 0.00 ? 161 THR A O    6  
ATOM 11557 C CB   . THR A 1 110 ? 3.967   8.473   -5.901  1.00 0.00 ? 161 THR A CB   6  
ATOM 11558 O OG1  . THR A 1 110 ? 5.216   9.141   -6.005  1.00 0.00 ? 161 THR A OG1  6  
ATOM 11559 C CG2  . THR A 1 110 ? 2.857   9.472   -6.236  1.00 0.00 ? 161 THR A CG2  6  
ATOM 11560 H H    . THR A 1 110 ? 3.988   9.768   -3.313  1.00 0.00 ? 161 THR A H    6  
ATOM 11561 H HA   . THR A 1 110 ? 3.086   7