data_1CO1
# 
_entry.id   1CO1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1CO1         
RCSB  RCSB001133   
WWPDB D_1000001133 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1CO1 
_pdbx_database_status.recvd_initial_deposition_date   1999-05-31 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Berardi, M.J.'    1 
'Bushweller, J.H.' 2 
# 
_citation.id                        primary 
_citation.title                     
;The Ig fold of the core binding factor alpha Runt domain is a member of a family of structurally and functionally related Ig-fold DNA-binding domains.
;
_citation.journal_abbrev            'Structure Fold.Des.' 
_citation.journal_volume            7 
_citation.page_first                1247 
_citation.page_last                 1256 
_citation.year                      1999 
_citation.journal_id_ASTM           FODEFH 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            1263 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10545320 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(00)80058-1' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Berardi, M.J.'    1 
primary 'Sun, C.'          2 
primary 'Zehr, M.'         3 
primary 'Abildgaard, F.'   4 
primary 'Peng, J.'         5 
primary 'Speck, N.A.'      6 
primary 'Bushweller, J.H.' 7 
# 
_cell.entry_id           1CO1 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1CO1 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'CORE BINDING FACTOR ALPHA' 
_entity.formula_weight             12694.494 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'RUNT DOMAIN' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AML1 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRS
GRGKSFTLTITVFTNPPQVATYHRAIKITVDGPRE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRS
GRGKSFTLTITVFTNPPQVATYHRAIKITVDGPRE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   LEU n 
1 3   VAL n 
1 4   ARG n 
1 5   THR n 
1 6   ASP n 
1 7   SER n 
1 8   PRO n 
1 9   ASN n 
1 10  PHE n 
1 11  LEU n 
1 12  CYS n 
1 13  SER n 
1 14  VAL n 
1 15  LEU n 
1 16  PRO n 
1 17  THR n 
1 18  HIS n 
1 19  TRP n 
1 20  ARG n 
1 21  CYS n 
1 22  ASN n 
1 23  LYS n 
1 24  THR n 
1 25  LEU n 
1 26  PRO n 
1 27  ILE n 
1 28  ALA n 
1 29  PHE n 
1 30  LYS n 
1 31  VAL n 
1 32  VAL n 
1 33  ALA n 
1 34  LEU n 
1 35  GLY n 
1 36  ASP n 
1 37  VAL n 
1 38  PRO n 
1 39  ASP n 
1 40  GLY n 
1 41  THR n 
1 42  LEU n 
1 43  VAL n 
1 44  THR n 
1 45  VAL n 
1 46  MET n 
1 47  ALA n 
1 48  GLY n 
1 49  ASN n 
1 50  ASP n 
1 51  GLU n 
1 52  ASN n 
1 53  TYR n 
1 54  SER n 
1 55  ALA n 
1 56  GLU n 
1 57  LEU n 
1 58  ARG n 
1 59  ASN n 
1 60  ALA n 
1 61  THR n 
1 62  ALA n 
1 63  ALA n 
1 64  MET n 
1 65  LYS n 
1 66  ASN n 
1 67  GLN n 
1 68  VAL n 
1 69  ALA n 
1 70  ARG n 
1 71  PHE n 
1 72  ASN n 
1 73  ASP n 
1 74  LEU n 
1 75  ARG n 
1 76  PHE n 
1 77  VAL n 
1 78  GLY n 
1 79  ARG n 
1 80  SER n 
1 81  GLY n 
1 82  ARG n 
1 83  GLY n 
1 84  LYS n 
1 85  SER n 
1 86  PHE n 
1 87  THR n 
1 88  LEU n 
1 89  THR n 
1 90  ILE n 
1 91  THR n 
1 92  VAL n 
1 93  PHE n 
1 94  THR n 
1 95  ASN n 
1 96  PRO n 
1 97  PRO n 
1 98  GLN n 
1 99  VAL n 
1 100 ALA n 
1 101 THR n 
1 102 TYR n 
1 103 HIS n 
1 104 ARG n 
1 105 ALA n 
1 106 ILE n 
1 107 LYS n 
1 108 ILE n 
1 109 THR n 
1 110 VAL n 
1 111 ASP n 
1 112 GLY n 
1 113 PRO n 
1 114 ARG n 
1 115 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RUNX1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          Q01196 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1CO1 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 115 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q01196 
_struct_ref_seq.db_align_beg                  61 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  175 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       21 
_struct_ref_seq.pdbx_auth_seq_align_end       135 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         313 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_ensemble.entry_id                                      1CO1 
_pdbx_nmr_ensemble.conformers_calculated_total_number            ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number             10 
_pdbx_nmr_ensemble.conformer_selection_criteria                  ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             OPAL 
_pdbx_nmr_software.version          2.6 
_pdbx_nmr_software.authors          'K. WURTRICH' 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          1CO1 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1CO1 
_struct.title                     'FOLD OF THE CBFA' 
_struct.pdbx_descriptor           'CORE BINDING FACTOR ALPHA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1CO1 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
_struct_keywords.text            'CBFA RUNT AML-1 RUNT DOMAIN, GENE REGULATION' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 10 ? SER A 13  ? PHE A 30  SER A 33  
A 2 PHE A 29 ? ALA A 33  ? PHE A 49  ALA A 53  
A 3 VAL A 68 ? PHE A 71  ? VAL A 88  PHE A 91  
B 1 THR A 61 ? MET A 64  ? THR A 81  MET A 84  
B 2 THR A 41 ? GLY A 48  ? THR A 61  GLY A 68  
B 3 SER A 85 ? THR A 91  ? SER A 105 THR A 111 
B 4 VAL A 99 ? THR A 101 ? VAL A 119 THR A 121 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 11 ? O LEU A 31  N VAL A 32  ? N VAL A 52  
A 2 3 O PHE A 29 ? O PHE A 49  N PHE A 71  ? N PHE A 91  
B 1 2 O ALA A 62 ? O ALA A 82  N VAL A 43  ? N VAL A 63  
B 2 3 O LEU A 42 ? O LEU A 62  N THR A 91  ? N THR A 111 
B 3 4 O ILE A 90 ? O ILE A 110 N ALA A 100 ? N ALA A 120 
# 
_database_PDB_matrix.entry_id          1CO1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1CO1 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLU A 1 1   ? -8.996  -10.807 -10.248 1.00 1.00 ? 21  GLU A N    1  
ATOM 2     C CA   . GLU A 1 1   ? -8.648  -9.853  -9.155  1.00 1.00 ? 21  GLU A CA   1  
ATOM 3     C C    . GLU A 1 1   ? -9.044  -8.403  -9.488  1.00 1.00 ? 21  GLU A C    1  
ATOM 4     O O    . GLU A 1 1   ? -9.662  -8.166  -10.521 1.00 1.00 ? 21  GLU A O    1  
ATOM 5     C CB   . GLU A 1 1   ? -7.171  -9.980  -8.725  1.00 1.00 ? 21  GLU A CB   1  
ATOM 6     C CG   . GLU A 1 1   ? -6.106  -9.691  -9.799  1.00 1.00 ? 21  GLU A CG   1  
ATOM 7     C CD   . GLU A 1 1   ? -4.894  -8.944  -9.231  1.00 1.00 ? 21  GLU A CD   1  
ATOM 8     O OE1  . GLU A 1 1   ? -4.266  -9.521  -8.313  1.00 1.00 ? 21  GLU A OE1  1  
ATOM 9     O OE2  . GLU A 1 1   ? -4.602  -7.832  -9.726  1.00 1.00 ? 21  GLU A OE2  1  
ATOM 10    H H1   . GLU A 1 1   ? -8.618  -11.739 -10.025 1.00 0.00 ? 21  GLU A H1   1  
ATOM 11    H H2   . GLU A 1 1   ? -10.020 -10.865 -10.340 1.00 0.00 ? 21  GLU A H2   1  
ATOM 12    H HA   . GLU A 1 1   ? -9.249  -10.112 -8.280  1.00 1.00 ? 21  GLU A HA   1  
ATOM 13    H HB2  . GLU A 1 1   ? -6.935  -9.219  -7.982  1.00 0.00 ? 21  GLU A HB2  1  
ATOM 14    H HB3  . GLU A 1 1   ? -6.994  -10.969 -8.293  1.00 1.00 ? 21  GLU A HB3  1  
ATOM 15    H HG2  . GLU A 1 1   ? -5.634  -10.605 -10.161 1.00 0.00 ? 21  GLU A HG2  1  
ATOM 16    H HG3  . GLU A 1 1   ? -6.533  -9.185  -10.672 1.00 1.00 ? 21  GLU A HG3  1  
ATOM 17    N N    . LEU A 1 2   ? -8.743  -7.467  -8.580  1.00 1.00 ? 22  LEU A N    1  
ATOM 18    C CA   . LEU A 1 2   ? -9.065  -6.039  -8.519  1.00 1.00 ? 22  LEU A CA   1  
ATOM 19    C C    . LEU A 1 2   ? -7.919  -5.403  -7.695  1.00 1.00 ? 22  LEU A C    1  
ATOM 20    O O    . LEU A 1 2   ? -6.910  -6.086  -7.455  1.00 1.00 ? 22  LEU A O    1  
ATOM 21    C CB   . LEU A 1 2   ? -10.474 -5.876  -7.901  1.00 1.00 ? 22  LEU A CB   1  
ATOM 22    C CG   . LEU A 1 2   ? -11.531 -5.112  -8.736  1.00 1.00 ? 22  LEU A CG   1  
ATOM 23    C CD1  . LEU A 1 2   ? -11.887 -5.851  -10.037 1.00 1.00 ? 22  LEU A CD1  1  
ATOM 24    C CD2  . LEU A 1 2   ? -12.824 -4.923  -7.924  1.00 1.00 ? 22  LEU A CD2  1  
ATOM 25    H H    . LEU A 1 2   ? -8.091  -7.628  -7.791  1.00 1.00 ? 22  LEU A H    1  
ATOM 26    H HA   . LEU A 1 2   ? -9.036  -5.612  -9.526  1.00 1.00 ? 22  LEU A HA   1  
ATOM 27    H HB2  . LEU A 1 2   ? -10.991 -6.834  -7.848  1.00 0.00 ? 22  LEU A HB2  1  
ATOM 28    H HB3  . LEU A 1 2   ? -10.414 -5.471  -6.890  1.00 1.00 ? 22  LEU A HB3  1  
ATOM 29    H HG   . LEU A 1 2   ? -11.138 -4.127  -8.996  1.00 1.00 ? 22  LEU A HG   1  
ATOM 30    H HD11 . LEU A 1 2   ? -12.261 -6.852  -9.818  1.00 1.00 ? 22  LEU A HD11 1  
ATOM 31    H HD12 . LEU A 1 2   ? -12.646 -5.295  -10.588 1.00 1.00 ? 22  LEU A HD12 1  
ATOM 32    H HD13 . LEU A 1 2   ? -11.006 -5.935  -10.673 1.00 1.00 ? 22  LEU A HD13 1  
ATOM 33    H HD21 . LEU A 1 2   ? -12.610 -4.374  -7.007  1.00 1.00 ? 22  LEU A HD21 1  
ATOM 34    H HD22 . LEU A 1 2   ? -13.546 -4.349  -8.506  1.00 1.00 ? 22  LEU A HD22 1  
ATOM 35    H HD23 . LEU A 1 2   ? -13.255 -5.891  -7.666  1.00 1.00 ? 22  LEU A HD23 1  
ATOM 36    N N    . VAL A 1 3   ? -7.950  -4.111  -7.329  1.00 1.00 ? 23  VAL A N    1  
ATOM 37    C CA   . VAL A 1 3   ? -6.930  -3.622  -6.363  1.00 1.00 ? 23  VAL A CA   1  
ATOM 38    C C    . VAL A 1 3   ? -7.189  -4.241  -4.960  1.00 1.00 ? 23  VAL A C    1  
ATOM 39    O O    . VAL A 1 3   ? -7.691  -3.599  -4.036  1.00 1.00 ? 23  VAL A O    1  
ATOM 40    C CB   . VAL A 1 3   ? -6.622  -2.100  -6.426  1.00 1.00 ? 23  VAL A CB   1  
ATOM 41    C CG1  . VAL A 1 3   ? -6.299  -1.665  -7.872  1.00 1.00 ? 23  VAL A CG1  1  
ATOM 42    C CG2  . VAL A 1 3   ? -7.622  -1.094  -5.844  1.00 1.00 ? 23  VAL A CG2  1  
ATOM 43    H H    . VAL A 1 3   ? -8.816  -3.585  -7.437  1.00 1.00 ? 23  VAL A H    1  
ATOM 44    H HA   . VAL A 1 3   ? -5.975  -4.048  -6.672  1.00 1.00 ? 23  VAL A HA   1  
ATOM 45    H HB   . VAL A 1 3   ? -5.710  -1.969  -5.849  1.00 1.00 ? 23  VAL A HB   1  
ATOM 46    H HG11 . VAL A 1 3   ? -5.554  -2.329  -8.311  1.00 1.00 ? 23  VAL A HG11 1  
ATOM 47    H HG12 . VAL A 1 3   ? -7.203  -1.696  -8.486  1.00 1.00 ? 23  VAL A HG12 1  
ATOM 48    H HG13 . VAL A 1 3   ? -5.908  -0.645  -7.879  1.00 1.00 ? 23  VAL A HG13 1  
ATOM 49    H HG21 . VAL A 1 3   ? -7.789  -1.295  -4.790  1.00 1.00 ? 23  VAL A HG21 1  
ATOM 50    H HG22 . VAL A 1 3   ? -7.192  -0.095  -5.910  1.00 1.00 ? 23  VAL A HG22 1  
ATOM 51    H HG23 . VAL A 1 3   ? -8.557  -1.113  -6.394  1.00 1.00 ? 23  VAL A HG23 1  
ATOM 52    N N    . ARG A 1 4   ? -6.878  -5.555  -4.839  1.00 1.00 ? 24  ARG A N    1  
ATOM 53    C CA   . ARG A 1 4   ? -6.846  -6.363  -3.592  1.00 1.00 ? 24  ARG A CA   1  
ATOM 54    C C    . ARG A 1 4   ? -6.011  -5.717  -2.457  1.00 1.00 ? 24  ARG A C    1  
ATOM 55    O O    . ARG A 1 4   ? -5.100  -4.941  -2.742  1.00 1.00 ? 24  ARG A O    1  
ATOM 56    C CB   . ARG A 1 4   ? -6.313  -7.777  -3.917  1.00 1.00 ? 24  ARG A CB   1  
ATOM 57    C CG   . ARG A 1 4   ? -4.824  -7.767  -4.305  1.00 1.00 ? 24  ARG A CG   1  
ATOM 58    C CD   . ARG A 1 4   ? -4.373  -8.823  -5.321  1.00 1.00 ? 24  ARG A CD   1  
ATOM 59    N NE   . ARG A 1 4   ? -3.804  -10.032 -4.694  1.00 1.00 ? 24  ARG A NE   1  
ATOM 60    C CZ   . ARG A 1 4   ? -3.597  -11.201 -5.280  1.00 1.00 ? 24  ARG A CZ   1  
ATOM 61    N NH1  . ARG A 1 4   ? -3.877  -11.455 -6.531  1.00 1.00 ? 24  ARG A NH1  1  
ATOM 62    N NH2  . ARG A 1 4   ? -3.084  -12.182 -4.590  1.00 1.00 ? 24  ARG A NH2  1  
ATOM 63    H H    . ARG A 1 4   ? -6.815  -6.065  -5.744  1.00 1.00 ? 24  ARG A H    1  
ATOM 64    H HA   . ARG A 1 4   ? -7.864  -6.453  -3.229  1.00 1.00 ? 24  ARG A HA   1  
ATOM 65    H HB2  . ARG A 1 4   ? -6.360  -8.404  -3.027  1.00 0.00 ? 24  ARG A HB2  1  
ATOM 66    H HB3  . ARG A 1 4   ? -6.918  -8.228  -4.704  1.00 1.00 ? 24  ARG A HB3  1  
ATOM 67    H HG2  . ARG A 1 4   ? -4.570  -6.910  -4.929  1.00 0.00 ? 24  ARG A HG2  1  
ATOM 68    H HG3  . ARG A 1 4   ? -4.174  -7.724  -3.432  1.00 1.00 ? 24  ARG A HG3  1  
ATOM 69    H HD2  . ARG A 1 4   ? -5.239  -9.183  -5.877  1.00 0.00 ? 24  ARG A HD2  1  
ATOM 70    H HD3  . ARG A 1 4   ? -3.652  -8.377  -6.014  1.00 1.00 ? 24  ARG A HD3  1  
ATOM 71    H HE   . ARG A 1 4   ? -3.533  -9.966  -3.730  1.00 1.00 ? 24  ARG A HE   1  
ATOM 72    H HH11 . ARG A 1 4   ? -4.287  -10.722 -7.127  1.00 0.00 ? 24  ARG A HH11 1  
ATOM 73    H HH12 . ARG A 1 4   ? -3.690  -12.390 -6.922  1.00 0.00 ? 24  ARG A HH12 1  
ATOM 74    H HH21 . ARG A 1 4   ? -2.843  -12.043 -3.598  1.00 0.00 ? 24  ARG A HH21 1  
ATOM 75    H HH22 . ARG A 1 4   ? -2.919  -13.095 -5.036  1.00 0.00 ? 24  ARG A HH22 1  
ATOM 76    N N    . THR A 1 5   ? -6.244  -6.091  -1.189  1.00 1.00 ? 25  THR A N    1  
ATOM 77    C CA   . THR A 1 5   ? -5.465  -5.586  -0.025  1.00 1.00 ? 25  THR A CA   1  
ATOM 78    C C    . THR A 1 5   ? -4.434  -6.634  0.438   1.00 1.00 ? 25  THR A C    1  
ATOM 79    O O    . THR A 1 5   ? -3.580  -7.013  -0.369  1.00 1.00 ? 25  THR A O    1  
ATOM 80    C CB   . THR A 1 5   ? -6.398  -4.953  1.032   1.00 1.00 ? 25  THR A CB   1  
ATOM 81    O OG1  . THR A 1 5   ? -5.648  -4.433  2.099   1.00 1.00 ? 25  THR A OG1  1  
ATOM 82    C CG2  . THR A 1 5   ? -7.485  -5.851  1.624   1.00 1.00 ? 25  THR A CG2  1  
ATOM 83    H H    . THR A 1 5   ? -6.979  -6.780  -1.032  1.00 1.00 ? 25  THR A H    1  
ATOM 84    H HA   . THR A 1 5   ? -4.843  -4.753  -0.359  1.00 1.00 ? 25  THR A HA   1  
ATOM 85    H HB   . THR A 1 5   ? -6.897  -4.117  0.547   1.00 1.00 ? 25  THR A HB   1  
ATOM 86    H HG1  . THR A 1 5   ? -6.241  -3.902  2.639   1.00 1.00 ? 25  THR A HG1  1  
ATOM 87    H HG21 . THR A 1 5   ? -7.055  -6.723  2.105   1.00 1.00 ? 25  THR A HG21 1  
ATOM 88    H HG22 . THR A 1 5   ? -8.078  -5.304  2.356   1.00 1.00 ? 25  THR A HG22 1  
ATOM 89    H HG23 . THR A 1 5   ? -8.152  -6.181  0.835   1.00 1.00 ? 25  THR A HG23 1  
ATOM 90    N N    . ASP A 1 6   ? -4.473  -7.117  1.690   1.00 1.00 ? 26  ASP A N    1  
ATOM 91    C CA   . ASP A 1 6   ? -3.652  -8.240  2.182   1.00 1.00 ? 26  ASP A CA   1  
ATOM 92    C C    . ASP A 1 6   ? -3.823  -9.534  1.344   1.00 1.00 ? 26  ASP A C    1  
ATOM 93    O O    . ASP A 1 6   ? -2.834  -10.222 1.082   1.00 1.00 ? 26  ASP A O    1  
ATOM 94    C CB   . ASP A 1 6   ? -3.929  -8.499  3.680   1.00 1.00 ? 26  ASP A CB   1  
ATOM 95    C CG   . ASP A 1 6   ? -5.367  -8.866  4.096   1.00 1.00 ? 26  ASP A CG   1  
ATOM 96    O OD1  . ASP A 1 6   ? -6.261  -8.912  3.220   1.00 1.00 ? 26  ASP A OD1  1  
ATOM 97    O OD2  . ASP A 1 6   ? -5.575  -9.077  5.312   1.00 1.00 ? 26  ASP A OD2  1  
ATOM 98    H H    . ASP A 1 6   ? -5.138  -6.692  2.321   1.00 1.00 ? 26  ASP A H    1  
ATOM 99    H HA   . ASP A 1 6   ? -2.607  -7.945  2.100   1.00 1.00 ? 26  ASP A HA   1  
ATOM 100   H HB2  . ASP A 1 6   ? -3.298  -9.332  3.989   1.00 0.00 ? 26  ASP A HB2  1  
ATOM 101   H HB3  . ASP A 1 6   ? -3.563  -7.663  4.280   1.00 1.00 ? 26  ASP A HB3  1  
ATOM 102   N N    . SER A 1 7   ? -5.056  -9.815  0.887   1.00 1.00 ? 27  SER A N    1  
ATOM 103   C CA   . SER A 1 7   ? -5.484  -10.999 0.124   1.00 1.00 ? 27  SER A CA   1  
ATOM 104   C C    . SER A 1 7   ? -6.429  -10.642 -1.053  1.00 1.00 ? 27  SER A C    1  
ATOM 105   O O    . SER A 1 7   ? -7.148  -9.638  -0.982  1.00 1.00 ? 27  SER A O    1  
ATOM 106   C CB   . SER A 1 7   ? -6.240  -11.981 1.043   1.00 1.00 ? 27  SER A CB   1  
ATOM 107   O OG   . SER A 1 7   ? -5.530  -12.392 2.189   1.00 1.00 ? 27  SER A OG   1  
ATOM 108   H H    . SER A 1 7   ? -5.784  -9.194  1.240   1.00 1.00 ? 27  SER A H    1  
ATOM 109   H HA   . SER A 1 7   ? -4.595  -11.500 -0.261  1.00 1.00 ? 27  SER A HA   1  
ATOM 110   H HB2  . SER A 1 7   ? -7.130  -11.500 1.450   1.00 0.00 ? 27  SER A HB2  1  
ATOM 111   H HB3  . SER A 1 7   ? -6.542  -12.865 0.477   1.00 1.00 ? 27  SER A HB3  1  
ATOM 112   H HG   . SER A 1 7   ? -5.843  -11.853 2.934   1.00 1.00 ? 27  SER A HG   1  
ATOM 113   N N    . PRO A 1 8   ? -6.528  -11.499 -2.104  1.00 1.00 ? 28  PRO A N    1  
ATOM 114   C CA   . PRO A 1 8   ? -7.511  -11.361 -3.200  1.00 1.00 ? 28  PRO A CA   1  
ATOM 115   C C    . PRO A 1 8   ? -8.991  -11.542 -2.780  1.00 1.00 ? 28  PRO A C    1  
ATOM 116   O O    . PRO A 1 8   ? -9.881  -11.401 -3.615  1.00 1.00 ? 28  PRO A O    1  
ATOM 117   C CB   . PRO A 1 8   ? -7.122  -12.401 -4.257  1.00 1.00 ? 28  PRO A CB   1  
ATOM 118   C CG   . PRO A 1 8   ? -6.329  -13.454 -3.486  1.00 1.00 ? 28  PRO A CG   1  
ATOM 119   C CD   . PRO A 1 8   ? -5.764  -12.731 -2.267  1.00 1.00 ? 28  PRO A CD   1  
ATOM 120   H HA   . PRO A 1 8   ? -7.419  -10.368 -3.644  1.00 1.00 ? 28  PRO A HA   1  
ATOM 121   H HB2  . PRO A 1 8   ? -8.074  -12.763 -4.648  1.00 0.00 ? 28  PRO A HB2  1  
ATOM 122   H HB3  . PRO A 1 8   ? -6.486  -11.939 -5.014  1.00 1.00 ? 28  PRO A HB3  1  
ATOM 123   H HG2  . PRO A 1 8   ? -6.975  -14.276 -3.178  1.00 0.00 ? 28  PRO A HG2  1  
ATOM 124   H HG3  . PRO A 1 8   ? -5.531  -13.863 -4.102  1.00 1.00 ? 28  PRO A HG3  1  
ATOM 125   H HD2  . PRO A 1 8   ? -5.860  -13.341 -1.368  1.00 0.00 ? 28  PRO A HD2  1  
ATOM 126   H HD3  . PRO A 1 8   ? -4.714  -12.491 -2.430  1.00 1.00 ? 28  PRO A HD3  1  
ATOM 127   N N    . ASN A 1 9   ? -9.257  -11.851 -1.501  1.00 1.00 ? 29  ASN A N    1  
ATOM 128   C CA   . ASN A 1 9   ? -10.556 -11.950 -0.825  1.00 1.00 ? 29  ASN A CA   1  
ATOM 129   C C    . ASN A 1 9   ? -11.214 -10.578 -0.516  1.00 1.00 ? 29  ASN A C    1  
ATOM 130   O O    . ASN A 1 9   ? -12.446 -10.493 -0.462  1.00 1.00 ? 29  ASN A O    1  
ATOM 131   C CB   . ASN A 1 9   ? -10.302 -12.734 0.478   1.00 1.00 ? 29  ASN A CB   1  
ATOM 132   C CG   . ASN A 1 9   ? -9.738  -14.139 0.290   1.00 1.00 ? 29  ASN A CG   1  
ATOM 133   O OD1  . ASN A 1 9   ? -8.551  -14.335 0.093   1.00 1.00 ? 29  ASN A OD1  1  
ATOM 134   N ND2  . ASN A 1 9   ? -10.561 -15.160 0.352   1.00 1.00 ? 29  ASN A ND2  1  
ATOM 135   H H    . ASN A 1 9   ? -8.455  -12.049 -0.922  1.00 1.00 ? 29  ASN A H    1  
ATOM 136   H HA   . ASN A 1 9   ? -11.252 -12.503 -1.459  1.00 1.00 ? 29  ASN A HA   1  
ATOM 137   H HB2  . ASN A 1 9   ? -9.492  -12.299 1.065   1.00 0.00 ? 29  ASN A HB2  1  
ATOM 138   H HB3  . ASN A 1 9   ? -11.180 -12.753 1.119   1.00 1.00 ? 29  ASN A HB3  1  
ATOM 139   H HD21 . ASN A 1 9   ? -11.564 -15.004 0.525   1.00 0.00 ? 29  ASN A HD21 1  
ATOM 140   H HD22 . ASN A 1 9   ? -10.203 -16.118 0.228   1.00 0.00 ? 29  ASN A HD22 1  
ATOM 141   N N    . PHE A 1 10  ? -10.420 -9.506  -0.339  1.00 1.00 ? 30  PHE A N    1  
ATOM 142   C CA   . PHE A 1 10  ? -10.878 -8.117  -0.167  1.00 1.00 ? 30  PHE A CA   1  
ATOM 143   C C    . PHE A 1 10  ? -10.309 -7.290  -1.330  1.00 1.00 ? 30  PHE A C    1  
ATOM 144   O O    . PHE A 1 10  ? -9.106  -7.027  -1.399  1.00 1.00 ? 30  PHE A O    1  
ATOM 145   C CB   . PHE A 1 10  ? -10.507 -7.572  1.225   1.00 1.00 ? 30  PHE A CB   1  
ATOM 146   C CG   . PHE A 1 10  ? -10.576 -8.519  2.415   1.00 1.00 ? 30  PHE A CG   1  
ATOM 147   C CD1  . PHE A 1 10  ? -11.715 -9.322  2.664   1.00 1.00 ? 30  PHE A CD1  1  
ATOM 148   C CD2  . PHE A 1 10  ? -9.452  -8.630  3.259   1.00 1.00 ? 30  PHE A CD2  1  
ATOM 149   C CE1  . PHE A 1 10  ? -11.722 -10.234 3.743   1.00 1.00 ? 30  PHE A CE1  1  
ATOM 150   C CE2  . PHE A 1 10  ? -9.452  -9.545  4.329   1.00 1.00 ? 30  PHE A CE2  1  
ATOM 151   C CZ   . PHE A 1 10  ? -10.586 -10.348 4.573   1.00 1.00 ? 30  PHE A CZ   1  
ATOM 152   H H    . PHE A 1 10  ? -9.420  -9.660  -0.372  1.00 1.00 ? 30  PHE A H    1  
ATOM 153   H HA   . PHE A 1 10  ? -11.962 -8.091  -0.231  1.00 1.00 ? 30  PHE A HA   1  
ATOM 154   H HB2  . PHE A 1 10  ? -9.443  -7.340  1.275   1.00 0.00 ? 30  PHE A HB2  1  
ATOM 155   H HB3  . PHE A 1 10  ? -11.069 -6.657  1.443   1.00 1.00 ? 30  PHE A HB3  1  
ATOM 156   H HD1  . PHE A 1 10  ? -12.575 -9.267  2.018   1.00 1.00 ? 30  PHE A HD1  1  
ATOM 157   H HD2  . PHE A 1 10  ? -8.575  -8.032  3.086   1.00 1.00 ? 30  PHE A HD2  1  
ATOM 158   H HE1  . PHE A 1 10  ? -12.590 -10.855 3.922   1.00 1.00 ? 30  PHE A HE1  1  
ATOM 159   H HE2  . PHE A 1 10  ? -8.572  -9.628  4.951   1.00 1.00 ? 30  PHE A HE2  1  
ATOM 160   H HZ   . PHE A 1 10  ? -10.574 -11.049 5.396   1.00 1.00 ? 30  PHE A HZ   1  
ATOM 161   N N    . LEU A 1 11  ? -11.202 -6.902  -2.247  1.00 1.00 ? 31  LEU A N    1  
ATOM 162   C CA   . LEU A 1 11  ? -10.968 -6.291  -3.559  1.00 1.00 ? 31  LEU A CA   1  
ATOM 163   C C    . LEU A 1 11  ? -11.511 -4.853  -3.651  1.00 1.00 ? 31  LEU A C    1  
ATOM 164   O O    . LEU A 1 11  ? -12.659 -4.587  -3.288  1.00 1.00 ? 31  LEU A O    1  
ATOM 165   C CB   . LEU A 1 11  ? -11.680 -7.210  -4.578  1.00 1.00 ? 31  LEU A CB   1  
ATOM 166   C CG   . LEU A 1 11  ? -11.169 -8.662  -4.713  1.00 1.00 ? 31  LEU A CG   1  
ATOM 167   C CD1  . LEU A 1 11  ? -12.308 -9.564  -5.205  1.00 1.00 ? 31  LEU A CD1  1  
ATOM 168   C CD2  . LEU A 1 11  ? -9.981  -8.754  -5.680  1.00 1.00 ? 31  LEU A CD2  1  
ATOM 169   H H    . LEU A 1 11  ? -12.180 -7.107  -2.044  1.00 1.00 ? 31  LEU A H    1  
ATOM 170   H HA   . LEU A 1 11  ? -9.902  -6.283  -3.786  1.00 1.00 ? 31  LEU A HA   1  
ATOM 171   H HB2  . LEU A 1 11  ? -12.685 -7.484  -4.258  1.00 0.00 ? 31  LEU A HB2  1  
ATOM 172   H HB3  . LEU A 1 11  ? -11.785 -6.743  -5.555  1.00 1.00 ? 31  LEU A HB3  1  
ATOM 173   H HG   . LEU A 1 11  ? -10.853 -9.027  -3.738  1.00 1.00 ? 31  LEU A HG   1  
ATOM 174   H HD11 . LEU A 1 11  ? -13.137 -9.528  -4.497  1.00 1.00 ? 31  LEU A HD11 1  
ATOM 175   H HD12 . LEU A 1 11  ? -12.659 -9.245  -6.186  1.00 1.00 ? 31  LEU A HD12 1  
ATOM 176   H HD13 . LEU A 1 11  ? -11.959 -10.596 -5.267  1.00 1.00 ? 31  LEU A HD13 1  
ATOM 177   H HD21 . LEU A 1 11  ? -9.191  -8.078  -5.358  1.00 1.00 ? 31  LEU A HD21 1  
ATOM 178   H HD22 . LEU A 1 11  ? -9.593  -9.773  -5.685  1.00 1.00 ? 31  LEU A HD22 1  
ATOM 179   H HD23 . LEU A 1 11  ? -10.312 -8.488  -6.681  1.00 1.00 ? 31  LEU A HD23 1  
ATOM 180   N N    . CYS A 1 12  ? -10.711 -3.939  -4.215  1.00 1.00 ? 32  CYS A N    1  
ATOM 181   C CA   . CYS A 1 12  ? -11.083 -2.542  -4.474  1.00 1.00 ? 32  CYS A CA   1  
ATOM 182   C C    . CYS A 1 12  ? -11.036 -2.187  -5.974  1.00 1.00 ? 32  CYS A C    1  
ATOM 183   O O    . CYS A 1 12  ? -10.356 -2.825  -6.780  1.00 1.00 ? 32  CYS A O    1  
ATOM 184   C CB   . CYS A 1 12  ? -10.174 -1.574  -3.681  1.00 1.00 ? 32  CYS A CB   1  
ATOM 185   S SG   . CYS A 1 12  ? -9.776  -2.047  -1.970  1.00 1.00 ? 32  CYS A SG   1  
ATOM 186   H H    . CYS A 1 12  ? -9.755  -4.181  -4.440  1.00 1.00 ? 32  CYS A H    1  
ATOM 187   H HA   . CYS A 1 12  ? -12.106 -2.374  -4.142  1.00 1.00 ? 32  CYS A HA   1  
ATOM 188   H HB2  . CYS A 1 12  ? -9.173  -1.548  -4.113  1.00 0.00 ? 32  CYS A HB2  1  
ATOM 189   H HB3  . CYS A 1 12  ? -10.582 -0.563  -3.700  1.00 1.00 ? 32  CYS A HB3  1  
ATOM 190   H HG   . CYS A 1 12  ? -8.622  -2.657  -2.280  1.00 1.00 ? 32  CYS A HG   1  
ATOM 191   N N    . SER A 1 13  ? -11.737 -1.108  -6.329  1.00 1.00 ? 33  SER A N    1  
ATOM 192   C CA   . SER A 1 13  ? -11.749 -0.446  -7.632  1.00 1.00 ? 33  SER A CA   1  
ATOM 193   C C    . SER A 1 13  ? -11.749 1.073   -7.411  1.00 1.00 ? 33  SER A C    1  
ATOM 194   O O    . SER A 1 13  ? -12.770 1.673   -7.059  1.00 1.00 ? 33  SER A O    1  
ATOM 195   C CB   . SER A 1 13  ? -12.924 -0.924  -8.486  1.00 1.00 ? 33  SER A CB   1  
ATOM 196   O OG   . SER A 1 13  ? -12.708 -0.512  -9.818  1.00 1.00 ? 33  SER A OG   1  
ATOM 197   H H    . SER A 1 13  ? -12.366 -0.723  -5.625  1.00 1.00 ? 33  SER A H    1  
ATOM 198   H HA   . SER A 1 13  ? -10.838 -0.725  -8.167  1.00 1.00 ? 33  SER A HA   1  
ATOM 199   H HB2  . SER A 1 13  ? -12.998 -2.011  -8.466  1.00 0.00 ? 33  SER A HB2  1  
ATOM 200   H HB3  . SER A 1 13  ? -13.862 -0.511  -8.115  1.00 1.00 ? 33  SER A HB3  1  
ATOM 201   H HG   . SER A 1 13  ? -13.363 -0.922  -10.388 1.00 1.00 ? 33  SER A HG   1  
ATOM 202   N N    . VAL A 1 14  ? -10.551 1.655   -7.551  1.00 1.00 ? 34  VAL A N    1  
ATOM 203   C CA   . VAL A 1 14  ? -10.200 3.086   -7.496  1.00 1.00 ? 34  VAL A CA   1  
ATOM 204   C C    . VAL A 1 14  ? -9.206  3.411   -8.624  1.00 1.00 ? 34  VAL A C    1  
ATOM 205   O O    . VAL A 1 14  ? -8.536  2.517   -9.151  1.00 1.00 ? 34  VAL A O    1  
ATOM 206   C CB   . VAL A 1 14  ? -9.594  3.512   -6.118  1.00 1.00 ? 34  VAL A CB   1  
ATOM 207   C CG1  . VAL A 1 14  ? -10.478 3.131   -4.913  1.00 1.00 ? 34  VAL A CG1  1  
ATOM 208   C CG2  . VAL A 1 14  ? -8.177  2.963   -5.849  1.00 1.00 ? 34  VAL A CG2  1  
ATOM 209   H H    . VAL A 1 14  ? -9.802  1.056   -7.872  1.00 1.00 ? 34  VAL A H    1  
ATOM 210   H HA   . VAL A 1 14  ? -11.105 3.668   -7.671  1.00 1.00 ? 34  VAL A HA   1  
ATOM 211   H HB   . VAL A 1 14  ? -9.514  4.601   -6.127  1.00 1.00 ? 34  VAL A HB   1  
ATOM 212   H HG11 . VAL A 1 14  ? -11.486 3.518   -5.041  1.00 1.00 ? 34  VAL A HG11 1  
ATOM 213   H HG12 . VAL A 1 14  ? -10.530 2.046   -4.811  1.00 1.00 ? 34  VAL A HG12 1  
ATOM 214   H HG13 . VAL A 1 14  ? -10.060 3.547   -3.996  1.00 1.00 ? 34  VAL A HG13 1  
ATOM 215   H HG21 . VAL A 1 14  ? -7.482  3.272   -6.631  1.00 1.00 ? 34  VAL A HG21 1  
ATOM 216   H HG22 . VAL A 1 14  ? -7.794  3.345   -4.902  1.00 1.00 ? 34  VAL A HG22 1  
ATOM 217   H HG23 . VAL A 1 14  ? -8.206  1.878   -5.806  1.00 1.00 ? 34  VAL A HG23 1  
ATOM 218   N N    . LEU A 1 15  ? -9.065  4.697   -8.956  1.00 1.00 ? 35  LEU A N    1  
ATOM 219   C CA   . LEU A 1 15  ? -8.033  5.210   -9.862  1.00 1.00 ? 35  LEU A CA   1  
ATOM 220   C C    . LEU A 1 15  ? -6.895  5.908   -9.058  1.00 1.00 ? 35  LEU A C    1  
ATOM 221   O O    . LEU A 1 15  ? -7.137  6.348   -7.926  1.00 1.00 ? 35  LEU A O    1  
ATOM 222   C CB   . LEU A 1 15  ? -8.731  6.084   -10.921 1.00 1.00 ? 35  LEU A CB   1  
ATOM 223   C CG   . LEU A 1 15  ? -8.306  5.893   -12.394 1.00 1.00 ? 35  LEU A CG   1  
ATOM 224   C CD1  . LEU A 1 15  ? -9.529  5.554   -13.257 1.00 1.00 ? 35  LEU A CD1  1  
ATOM 225   C CD2  . LEU A 1 15  ? -7.598  7.134   -12.954 1.00 1.00 ? 35  LEU A CD2  1  
ATOM 226   H H    . LEU A 1 15  ? -9.630  5.377   -8.473  1.00 1.00 ? 35  LEU A H    1  
ATOM 227   H HA   . LEU A 1 15  ? -7.590  4.357   -10.375 1.00 1.00 ? 35  LEU A HA   1  
ATOM 228   H HB2  . LEU A 1 15  ? -9.748  5.757   -11.136 1.00 0.00 ? 35  LEU A HB2  1  
ATOM 229   H HB3  . LEU A 1 15  ? -8.811  7.129   -10.621 1.00 1.00 ? 35  LEU A HB3  1  
ATOM 230   H HG   . LEU A 1 15  ? -7.617  5.051   -12.470 1.00 1.00 ? 35  LEU A HG   1  
ATOM 231   H HD11 . LEU A 1 15  ? -10.012 4.652   -12.875 1.00 1.00 ? 35  LEU A HD11 1  
ATOM 232   H HD12 . LEU A 1 15  ? -10.248 6.373   -13.249 1.00 1.00 ? 35  LEU A HD12 1  
ATOM 233   H HD13 . LEU A 1 15  ? -9.215  5.365   -14.285 1.00 1.00 ? 35  LEU A HD13 1  
ATOM 234   H HD21 . LEU A 1 15  ? -6.745  7.393   -12.326 1.00 1.00 ? 35  LEU A HD21 1  
ATOM 235   H HD22 . LEU A 1 15  ? -7.236  6.924   -13.962 1.00 1.00 ? 35  LEU A HD22 1  
ATOM 236   H HD23 . LEU A 1 15  ? -8.282  7.984   -12.992 1.00 1.00 ? 35  LEU A HD23 1  
ATOM 237   N N    . PRO A 1 16  ? -5.651  5.995   -9.595  1.00 1.00 ? 36  PRO A N    1  
ATOM 238   C CA   . PRO A 1 16  ? -4.481  6.517   -8.874  1.00 1.00 ? 36  PRO A CA   1  
ATOM 239   C C    . PRO A 1 16  ? -4.668  7.896   -8.214  1.00 1.00 ? 36  PRO A C    1  
ATOM 240   O O    . PRO A 1 16  ? -5.380  8.759   -8.724  1.00 1.00 ? 36  PRO A O    1  
ATOM 241   C CB   . PRO A 1 16  ? -3.337  6.578   -9.889  1.00 1.00 ? 36  PRO A CB   1  
ATOM 242   C CG   . PRO A 1 16  ? -3.774  5.753   -11.097 1.00 1.00 ? 36  PRO A CG   1  
ATOM 243   C CD   . PRO A 1 16  ? -5.253  5.437   -10.881 1.00 1.00 ? 36  PRO A CD   1  
ATOM 244   H HA   . PRO A 1 16  ? -4.229  5.787   -8.101  1.00 1.00 ? 36  PRO A HA   1  
ATOM 245   H HB2  . PRO A 1 16  ? -3.197  7.629   -10.142 1.00 0.00 ? 36  PRO A HB2  1  
ATOM 246   H HB3  . PRO A 1 16  ? -2.415  6.189   -9.456  1.00 1.00 ? 36  PRO A HB3  1  
ATOM 247   H HG2  . PRO A 1 16  ? -3.611  6.313   -12.017 1.00 0.00 ? 36  PRO A HG2  1  
ATOM 248   H HG3  . PRO A 1 16  ? -3.203  4.825   -11.148 1.00 1.00 ? 36  PRO A HG3  1  
ATOM 249   H HD2  . PRO A 1 16  ? -5.863  5.872   -11.673 1.00 0.00 ? 36  PRO A HD2  1  
ATOM 250   H HD3  . PRO A 1 16  ? -5.393  4.355   -10.870 1.00 1.00 ? 36  PRO A HD3  1  
ATOM 251   N N    . THR A 1 17  ? -3.949  8.113   -7.101  1.00 1.00 ? 37  THR A N    1  
ATOM 252   C CA   . THR A 1 17  ? -3.991  9.312   -6.227  1.00 1.00 ? 37  THR A CA   1  
ATOM 253   C C    . THR A 1 17  ? -2.603  9.946   -5.949  1.00 1.00 ? 37  THR A C    1  
ATOM 254   O O    . THR A 1 17  ? -2.383  10.537  -4.889  1.00 1.00 ? 37  THR A O    1  
ATOM 255   C CB   . THR A 1 17  ? -4.766  9.013   -4.923  1.00 1.00 ? 37  THR A CB   1  
ATOM 256   O OG1  . THR A 1 17  ? -4.883  10.229  -4.213  1.00 1.00 ? 37  THR A OG1  1  
ATOM 257   C CG2  . THR A 1 17  ? -4.084  7.963   -4.035  1.00 1.00 ? 37  THR A CG2  1  
ATOM 258   H H    . THR A 1 17  ? -3.426  7.318   -6.767  1.00 1.00 ? 37  THR A H    1  
ATOM 259   H HA   . THR A 1 17  ? -4.563  10.088  -6.740  1.00 1.00 ? 37  THR A HA   1  
ATOM 260   H HB   . THR A 1 17  ? -5.770  8.664   -5.169  1.00 1.00 ? 37  THR A HB   1  
ATOM 261   H HG1  . THR A 1 17  ? -3.968  10.561  -4.124  1.00 1.00 ? 37  THR A HG1  1  
ATOM 262   H HG21 . THR A 1 17  ? -3.038  8.210   -3.854  1.00 1.00 ? 37  THR A HG21 1  
ATOM 263   H HG22 . THR A 1 17  ? -4.587  7.901   -3.077  1.00 1.00 ? 37  THR A HG22 1  
ATOM 264   H HG23 . THR A 1 17  ? -4.144  6.984   -4.513  1.00 1.00 ? 37  THR A HG23 1  
ATOM 265   N N    . HIS A 1 18  ? -1.650  9.819   -6.883  1.00 1.00 ? 38  HIS A N    1  
ATOM 266   C CA   . HIS A 1 18  ? -0.252  10.293  -6.812  1.00 1.00 ? 38  HIS A CA   1  
ATOM 267   C C    . HIS A 1 18  ? -0.052  11.839  -6.726  1.00 1.00 ? 38  HIS A C    1  
ATOM 268   O O    . HIS A 1 18  ? 0.888   12.360  -7.329  1.00 1.00 ? 38  HIS A O    1  
ATOM 269   C CB   . HIS A 1 18  ? 0.534   9.627   -7.967  1.00 1.00 ? 38  HIS A CB   1  
ATOM 270   C CG   . HIS A 1 18  ? 0.131   10.024  -9.370  1.00 1.00 ? 38  HIS A CG   1  
ATOM 271   N ND1  . HIS A 1 18  ? 0.235   11.299  -9.886  1.00 1.00 ? 38  HIS A ND1  1  
ATOM 272   C CD2  . HIS A 1 18  ? -0.426  9.221   -10.327 1.00 1.00 ? 38  HIS A CD2  1  
ATOM 273   C CE1  . HIS A 1 18  ? -0.269  11.278  -11.139 1.00 1.00 ? 38  HIS A CE1  1  
ATOM 274   N NE2  . HIS A 1 18  ? -0.674  10.021  -11.431 1.00 1.00 ? 38  HIS A NE2  1  
ATOM 275   H H    . HIS A 1 18  ? -1.941  9.335   -7.721  1.00 1.00 ? 38  HIS A H    1  
ATOM 276   H HA   . HIS A 1 18  ? 0.182   9.906   -5.890  1.00 1.00 ? 38  HIS A HA   1  
ATOM 277   H HB2  . HIS A 1 18  ? 1.566   9.978   -7.991  1.00 0.00 ? 38  HIS A HB2  1  
ATOM 278   H HB3  . HIS A 1 18  ? 0.552   8.541   -7.852  1.00 1.00 ? 38  HIS A HB3  1  
ATOM 279   H HD1  . HIS A 1 18  ? 0.590   12.082  -9.333  1.00 1.00 ? 38  HIS A HD1  1  
ATOM 280   H HD2  . HIS A 1 18  ? -0.643  8.165   -10.224 1.00 1.00 ? 38  HIS A HD2  1  
ATOM 281   H HE1  . HIS A 1 18  ? -0.361  12.136  -11.801 1.00 1.00 ? 38  HIS A HE1  1  
ATOM 282   H HE2  . HIS A 1 18  ? -1.102  9.716   -12.299 1.00 1.00 ? 38  HIS A HE2  1  
ATOM 283   N N    . TRP A 1 19  ? -0.904  12.581  -6.001  1.00 1.00 ? 39  TRP A N    1  
ATOM 284   C CA   . TRP A 1 19  ? -0.890  14.038  -5.745  1.00 1.00 ? 39  TRP A CA   1  
ATOM 285   C C    . TRP A 1 19  ? -1.770  14.415  -4.529  1.00 1.00 ? 39  TRP A C    1  
ATOM 286   O O    . TRP A 1 19  ? -2.629  13.632  -4.125  1.00 1.00 ? 39  TRP A O    1  
ATOM 287   C CB   . TRP A 1 19  ? -1.345  14.845  -6.979  1.00 1.00 ? 39  TRP A CB   1  
ATOM 288   C CG   . TRP A 1 19  ? -2.814  14.859  -7.238  1.00 1.00 ? 39  TRP A CG   1  
ATOM 289   C CD1  . TRP A 1 19  ? -3.667  15.841  -6.874  1.00 1.00 ? 39  TRP A CD1  1  
ATOM 290   C CD2  . TRP A 1 19  ? -3.624  13.805  -7.825  1.00 1.00 ? 39  TRP A CD2  1  
ATOM 291   N NE1  . TRP A 1 19  ? -4.963  15.437  -7.125  1.00 1.00 ? 39  TRP A NE1  1  
ATOM 292   C CE2  . TRP A 1 19  ? -4.994  14.194  -7.713  1.00 1.00 ? 39  TRP A CE2  1  
ATOM 293   C CE3  . TRP A 1 19  ? -3.341  12.556  -8.429  1.00 1.00 ? 39  TRP A CE3  1  
ATOM 294   C CZ2  . TRP A 1 19  ? -6.042  13.370  -8.155  1.00 1.00 ? 39  TRP A CZ2  1  
ATOM 295   C CZ3  . TRP A 1 19  ? -4.384  11.726  -8.887  1.00 1.00 ? 39  TRP A CZ3  1  
ATOM 296   C CH2  . TRP A 1 19  ? -5.733  12.120  -8.738  1.00 1.00 ? 39  TRP A CH2  1  
ATOM 297   H H    . TRP A 1 19  ? -1.533  12.075  -5.379  1.00 1.00 ? 39  TRP A H    1  
ATOM 298   H HA   . TRP A 1 19  ? 0.130   14.311  -5.513  1.00 1.00 ? 39  TRP A HA   1  
ATOM 299   H HB2  . TRP A 1 19  ? -1.157  15.912  -6.855  1.00 0.00 ? 39  TRP A HB2  1  
ATOM 300   H HB3  . TRP A 1 19  ? -0.823  14.530  -7.881  1.00 1.00 ? 39  TRP A HB3  1  
ATOM 301   H HD1  . TRP A 1 19  ? -3.383  16.770  -6.394  1.00 1.00 ? 39  TRP A HD1  1  
ATOM 302   H HE1  . TRP A 1 19  ? -5.778  15.969  -6.855  1.00 1.00 ? 39  TRP A HE1  1  
ATOM 303   H HE3  . TRP A 1 19  ? -2.314  12.259  -8.548  1.00 1.00 ? 39  TRP A HE3  1  
ATOM 304   H HZ2  . TRP A 1 19  ? -7.053  13.725  -8.047  1.00 1.00 ? 39  TRP A HZ2  1  
ATOM 305   H HZ3  . TRP A 1 19  ? -4.156  10.782  -9.360  1.00 1.00 ? 39  TRP A HZ3  1  
ATOM 306   H HH2  . TRP A 1 19  ? -6.520  11.463  -9.086  1.00 1.00 ? 39  TRP A HH2  1  
ATOM 307   N N    . ARG A 1 20  ? -1.578  15.621  -3.966  1.00 1.00 ? 40  ARG A N    1  
ATOM 308   C CA   . ARG A 1 20  ? -2.276  16.160  -2.773  1.00 1.00 ? 40  ARG A CA   1  
ATOM 309   C C    . ARG A 1 20  ? -3.688  16.701  -3.065  1.00 1.00 ? 40  ARG A C    1  
ATOM 310   O O    . ARG A 1 20  ? -3.938  17.239  -4.140  1.00 1.00 ? 40  ARG A O    1  
ATOM 311   C CB   . ARG A 1 20  ? -1.394  17.222  -2.095  1.00 1.00 ? 40  ARG A CB   1  
ATOM 312   C CG   . ARG A 1 20  ? -1.196  18.549  -2.836  1.00 1.00 ? 40  ARG A CG   1  
ATOM 313   C CD   . ARG A 1 20  ? -2.276  19.580  -2.520  1.00 1.00 ? 40  ARG A CD   1  
ATOM 314   N NE   . ARG A 1 20  ? -1.708  20.934  -2.595  1.00 1.00 ? 40  ARG A NE   1  
ATOM 315   C CZ   . ARG A 1 20  ? -2.211  22.043  -2.084  1.00 1.00 ? 40  ARG A CZ   1  
ATOM 316   N NH1  . ARG A 1 20  ? -3.388  22.110  -1.524  1.00 1.00 ? 40  ARG A NH1  1  
ATOM 317   N NH2  . ARG A 1 20  ? -1.551  23.161  -2.162  1.00 1.00 ? 40  ARG A NH2  1  
ATOM 318   H H    . ARG A 1 20  ? -0.907  16.208  -4.448  1.00 1.00 ? 40  ARG A H    1  
ATOM 319   H HA   . ARG A 1 20  ? -2.398  15.346  -2.062  1.00 1.00 ? 40  ARG A HA   1  
ATOM 320   H HB2  . ARG A 1 20  ? -1.866  17.555  -1.170  1.00 0.00 ? 40  ARG A HB2  1  
ATOM 321   H HB3  . ARG A 1 20  ? -0.420  16.799  -1.870  1.00 1.00 ? 40  ARG A HB3  1  
ATOM 322   H HG2  . ARG A 1 20  ? -0.292  19.064  -2.512  1.00 0.00 ? 40  ARG A HG2  1  
ATOM 323   H HG3  . ARG A 1 20  ? -1.110  18.405  -3.911  1.00 1.00 ? 40  ARG A HG3  1  
ATOM 324   H HD2  . ARG A 1 20  ? -3.082  19.515  -3.251  1.00 0.00 ? 40  ARG A HD2  1  
ATOM 325   H HD3  . ARG A 1 20  ? -2.688  19.402  -1.525  1.00 1.00 ? 40  ARG A HD3  1  
ATOM 326   H HE   . ARG A 1 20  ? -0.851  21.024  -3.115  1.00 1.00 ? 40  ARG A HE   1  
ATOM 327   H HH11 . ARG A 1 20  ? -3.978  21.268  -1.465  1.00 0.00 ? 40  ARG A HH11 1  
ATOM 328   H HH12 . ARG A 1 20  ? -3.726  23.004  -1.143  1.00 0.00 ? 40  ARG A HH12 1  
ATOM 329   H HH21 . ARG A 1 20  ? -0.630  23.184  -2.624  1.00 0.00 ? 40  ARG A HH21 1  
ATOM 330   H HH22 . ARG A 1 20  ? -1.947  24.022  -1.761  1.00 0.00 ? 40  ARG A HH22 1  
ATOM 331   N N    . CYS A 1 21  ? -4.585  16.641  -2.067  1.00 1.00 ? 41  CYS A N    1  
ATOM 332   C CA   . CYS A 1 21  ? -6.002  17.032  -2.135  1.00 1.00 ? 41  CYS A CA   1  
ATOM 333   C C    . CYS A 1 21  ? -6.729  16.420  -3.360  1.00 1.00 ? 41  CYS A C    1  
ATOM 334   O O    . CYS A 1 21  ? -7.066  17.123  -4.316  1.00 1.00 ? 41  CYS A O    1  
ATOM 335   C CB   . CYS A 1 21  ? -6.070  18.570  -2.031  1.00 1.00 ? 41  CYS A CB   1  
ATOM 336   S SG   . CYS A 1 21  ? -7.743  19.131  -1.601  1.00 1.00 ? 41  CYS A SG   1  
ATOM 337   H H    . CYS A 1 21  ? -4.290  16.231  -1.185  1.00 1.00 ? 41  CYS A H    1  
ATOM 338   H HA   . CYS A 1 21  ? -6.497  16.630  -1.248  1.00 1.00 ? 41  CYS A HA   1  
ATOM 339   H HB2  . CYS A 1 21  ? -5.408  18.916  -1.238  1.00 0.00 ? 41  CYS A HB2  1  
ATOM 340   H HB3  . CYS A 1 21  ? -5.760  19.019  -2.979  1.00 1.00 ? 41  CYS A HB3  1  
ATOM 341   H HG   . CYS A 1 21  ? -7.701  18.650  -0.344  1.00 1.00 ? 41  CYS A HG   1  
ATOM 342   N N    . ASN A 1 22  ? -6.981  15.096  -3.329  1.00 1.00 ? 42  ASN A N    1  
ATOM 343   C CA   . ASN A 1 22  ? -7.547  14.325  -4.448  1.00 1.00 ? 42  ASN A CA   1  
ATOM 344   C C    . ASN A 1 22  ? -8.838  14.918  -5.074  1.00 1.00 ? 42  ASN A C    1  
ATOM 345   O O    . ASN A 1 22  ? -8.960  14.917  -6.298  1.00 1.00 ? 42  ASN A O    1  
ATOM 346   C CB   . ASN A 1 22  ? -7.773  12.894  -3.935  1.00 1.00 ? 42  ASN A CB   1  
ATOM 347   C CG   . ASN A 1 22  ? -8.152  11.901  -5.027  1.00 1.00 ? 42  ASN A CG   1  
ATOM 348   O OD1  . ASN A 1 22  ? -9.298  11.754  -5.400  1.00 1.00 ? 42  ASN A OD1  1  
ATOM 349   N ND2  . ASN A 1 22  ? -7.219  11.117  -5.499  1.00 1.00 ? 42  ASN A ND2  1  
ATOM 350   H H    . ASN A 1 22  ? -6.686  14.546  -2.522  1.00 1.00 ? 42  ASN A H    1  
ATOM 351   H HA   . ASN A 1 22  ? -6.791  14.283  -5.236  1.00 1.00 ? 42  ASN A HA   1  
ATOM 352   H HB2  . ASN A 1 22  ? -6.850  12.508  -3.501  1.00 0.00 ? 42  ASN A HB2  1  
ATOM 353   H HB3  . ASN A 1 22  ? -8.552  12.894  -3.177  1.00 1.00 ? 42  ASN A HB3  1  
ATOM 354   H HD21 . ASN A 1 22  ? -6.259  11.181  -5.131  1.00 0.00 ? 42  ASN A HD21 1  
ATOM 355   H HD22 . ASN A 1 22  ? -7.444  10.435  -6.237  1.00 0.00 ? 42  ASN A HD22 1  
ATOM 356   N N    . LYS A 1 23  ? -9.746  15.456  -4.231  1.00 1.00 ? 43  LYS A N    1  
ATOM 357   C CA   . LYS A 1 23  ? -11.111 15.947  -4.534  1.00 1.00 ? 43  LYS A CA   1  
ATOM 358   C C    . LYS A 1 23  ? -12.087 14.858  -5.056  1.00 1.00 ? 43  LYS A C    1  
ATOM 359   O O    . LYS A 1 23  ? -11.716 13.711  -5.282  1.00 1.00 ? 43  LYS A O    1  
ATOM 360   C CB   . LYS A 1 23  ? -11.001 17.192  -5.437  1.00 1.00 ? 43  LYS A CB   1  
ATOM 361   C CG   . LYS A 1 23  ? -12.150 18.207  -5.363  1.00 1.00 ? 43  LYS A CG   1  
ATOM 362   C CD   . LYS A 1 23  ? -11.624 19.645  -5.426  1.00 1.00 ? 43  LYS A CD   1  
ATOM 363   C CE   . LYS A 1 23  ? -11.238 20.086  -6.841  1.00 1.00 ? 43  LYS A CE   1  
ATOM 364   N NZ   . LYS A 1 23  ? -10.866 21.515  -6.884  1.00 1.00 ? 43  LYS A NZ   1  
ATOM 365   H H    . LYS A 1 23  ? -9.430  15.496  -3.274  1.00 1.00 ? 43  LYS A H    1  
ATOM 366   H HA   . LYS A 1 23  ? -11.525 16.277  -3.584  1.00 1.00 ? 43  LYS A HA   1  
ATOM 367   H HB2  . LYS A 1 23  ? -10.211 17.868  -5.109  1.00 0.00 ? 43  LYS A HB2  1  
ATOM 368   H HB3  . LYS A 1 23  ? -10.780 16.928  -6.473  1.00 1.00 ? 43  LYS A HB3  1  
ATOM 369   H HG2  . LYS A 1 23  ? -12.839 18.073  -6.198  1.00 0.00 ? 43  LYS A HG2  1  
ATOM 370   H HG3  . LYS A 1 23  ? -12.712 18.087  -4.436  1.00 1.00 ? 43  LYS A HG3  1  
ATOM 371   H HD2  . LYS A 1 23  ? -12.411 20.353  -5.167  1.00 0.00 ? 43  LYS A HD2  1  
ATOM 372   H HD3  . LYS A 1 23  ? -10.794 19.782  -4.727  1.00 1.00 ? 43  LYS A HD3  1  
ATOM 373   H HE2  . LYS A 1 23  ? -10.354 19.538  -7.164  1.00 0.00 ? 43  LYS A HE2  1  
ATOM 374   H HE3  . LYS A 1 23  ? -12.065 19.877  -7.525  1.00 1.00 ? 43  LYS A HE3  1  
ATOM 375   H HZ1  . LYS A 1 23  ? -10.335 21.757  -6.035  1.00 0.00 ? 43  LYS A HZ1  1  
ATOM 376   H HZ2  . LYS A 1 23  ? -10.284 21.694  -7.715  1.00 0.00 ? 43  LYS A HZ2  1  
ATOM 377   N N    . THR A 1 24  ? -13.378 15.197  -5.188  1.00 1.00 ? 44  THR A N    1  
ATOM 378   C CA   . THR A 1 24  ? -14.438 14.322  -5.764  1.00 1.00 ? 44  THR A CA   1  
ATOM 379   C C    . THR A 1 24  ? -14.307 14.243  -7.294  1.00 1.00 ? 44  THR A C    1  
ATOM 380   O O    . THR A 1 24  ? -15.014 14.939  -8.027  1.00 1.00 ? 44  THR A O    1  
ATOM 381   C CB   . THR A 1 24  ? -15.878 14.726  -5.358  1.00 1.00 ? 44  THR A CB   1  
ATOM 382   O OG1  . THR A 1 24  ? -16.117 16.103  -5.553  1.00 1.00 ? 44  THR A OG1  1  
ATOM 383   C CG2  . THR A 1 24  ? -16.211 14.398  -3.905  1.00 1.00 ? 44  THR A CG2  1  
ATOM 384   H H    . THR A 1 24  ? -13.614 16.155  -4.978  1.00 1.00 ? 44  THR A H    1  
ATOM 385   H HA   . THR A 1 24  ? -14.293 13.304  -5.387  1.00 1.00 ? 44  THR A HA   1  
ATOM 386   H HB   . THR A 1 24  ? -16.571 14.153  -5.978  1.00 1.00 ? 44  THR A HB   1  
ATOM 387   H HG1  . THR A 1 24  ? -16.054 16.259  -6.506  1.00 1.00 ? 44  THR A HG1  1  
ATOM 388   H HG21 . THR A 1 24  ? -16.092 13.323  -3.742  1.00 1.00 ? 44  THR A HG21 1  
ATOM 389   H HG22 . THR A 1 24  ? -15.556 14.955  -3.245  1.00 1.00 ? 44  THR A HG22 1  
ATOM 390   H HG23 . THR A 1 24  ? -17.245 14.675  -3.700  1.00 1.00 ? 44  THR A HG23 1  
ATOM 391   N N    . LEU A 1 25  ? -13.365 13.415  -7.768  1.00 1.00 ? 45  LEU A N    1  
ATOM 392   C CA   . LEU A 1 25  ? -13.112 13.130  -9.186  1.00 1.00 ? 45  LEU A CA   1  
ATOM 393   C C    . LEU A 1 25  ? -14.268 12.306  -9.826  1.00 1.00 ? 45  LEU A C    1  
ATOM 394   O O    . LEU A 1 25  ? -14.826 11.423  -9.164  1.00 1.00 ? 45  LEU A O    1  
ATOM 395   C CB   . LEU A 1 25  ? -11.771 12.377  -9.304  1.00 1.00 ? 45  LEU A CB   1  
ATOM 396   C CG   . LEU A 1 25  ? -10.523 13.013  -8.646  1.00 1.00 ? 45  LEU A CG   1  
ATOM 397   C CD1  . LEU A 1 25  ? -9.431  11.948  -8.562  1.00 1.00 ? 45  LEU A CD1  1  
ATOM 398   C CD2  . LEU A 1 25  ? -10.007 14.246  -9.405  1.00 1.00 ? 45  LEU A CD2  1  
ATOM 399   H H    . LEU A 1 25  ? -12.772 12.950  -7.087  1.00 1.00 ? 45  LEU A H    1  
ATOM 400   H HA   . LEU A 1 25  ? -13.021 14.087  -9.706  1.00 1.00 ? 45  LEU A HA   1  
ATOM 401   H HB2  . LEU A 1 25  ? -11.791 11.457  -8.720  1.00 0.00 ? 45  LEU A HB2  1  
ATOM 402   H HB3  . LEU A 1 25  ? -11.562 12.116  -10.342 1.00 1.00 ? 45  LEU A HB3  1  
ATOM 403   H HG   . LEU A 1 25  ? -10.763 13.313  -7.629  1.00 1.00 ? 45  LEU A HG   1  
ATOM 404   H HD11 . LEU A 1 25  ? -9.815  11.080  -8.029  1.00 1.00 ? 45  LEU A HD11 1  
ATOM 405   H HD12 . LEU A 1 25  ? -9.089  11.663  -9.558  1.00 1.00 ? 45  LEU A HD12 1  
ATOM 406   H HD13 . LEU A 1 25  ? -8.605  12.324  -7.973  1.00 1.00 ? 45  LEU A HD13 1  
ATOM 407   H HD21 . LEU A 1 25  ? -9.748  13.978  -10.430 1.00 1.00 ? 45  LEU A HD21 1  
ATOM 408   H HD22 . LEU A 1 25  ? -10.772 15.021  -9.408  1.00 1.00 ? 45  LEU A HD22 1  
ATOM 409   H HD23 . LEU A 1 25  ? -9.123  14.641  -8.907  1.00 1.00 ? 45  LEU A HD23 1  
ATOM 410   N N    . PRO A 1 26  ? -14.601 12.506  -11.127 1.00 1.00 ? 46  PRO A N    1  
ATOM 411   C CA   . PRO A 1 26  ? -15.693 11.789  -11.824 1.00 1.00 ? 46  PRO A CA   1  
ATOM 412   C C    . PRO A 1 26  ? -15.495 10.264  -12.012 1.00 1.00 ? 46  PRO A C    1  
ATOM 413   O O    . PRO A 1 26  ? -16.396 9.588   -12.503 1.00 1.00 ? 46  PRO A O    1  
ATOM 414   C CB   . PRO A 1 26  ? -15.855 12.480  -13.184 1.00 1.00 ? 46  PRO A CB   1  
ATOM 415   C CG   . PRO A 1 26  ? -14.497 13.132  -13.433 1.00 1.00 ? 46  PRO A CG   1  
ATOM 416   C CD   . PRO A 1 26  ? -13.946 13.434  -12.040 1.00 1.00 ? 46  PRO A CD   1  
ATOM 417   H HA   . PRO A 1 26  ? -16.618 11.922  -11.259 1.00 1.00 ? 46  PRO A HA   1  
ATOM 418   H HB2  . PRO A 1 26  ? -16.095 11.666  -13.867 1.00 0.00 ? 46  PRO A HB2  1  
ATOM 419   H HB3  . PRO A 1 26  ? -16.622 13.255  -13.109 1.00 1.00 ? 46  PRO A HB3  1  
ATOM 420   H HG2  . PRO A 1 26  ? -13.837 12.458  -13.978 1.00 0.00 ? 46  PRO A HG2  1  
ATOM 421   H HG3  . PRO A 1 26  ? -14.605 14.044  -14.018 1.00 1.00 ? 46  PRO A HG3  1  
ATOM 422   H HD2  . PRO A 1 26  ? -12.866 13.302  -11.980 1.00 0.00 ? 46  PRO A HD2  1  
ATOM 423   H HD3  . PRO A 1 26  ? -14.202 14.458  -11.764 1.00 1.00 ? 46  PRO A HD3  1  
ATOM 424   N N    . ILE A 1 27  ? -14.335 9.723   -11.607 1.00 1.00 ? 47  ILE A N    1  
ATOM 425   C CA   . ILE A 1 27  ? -13.893 8.313   -11.668 1.00 1.00 ? 47  ILE A CA   1  
ATOM 426   C C    . ILE A 1 27  ? -14.780 7.298   -10.907 1.00 1.00 ? 47  ILE A C    1  
ATOM 427   O O    . ILE A 1 27  ? -14.877 6.157   -11.355 1.00 1.00 ? 47  ILE A O    1  
ATOM 428   C CB   . ILE A 1 27  ? -12.417 8.206   -11.172 1.00 1.00 ? 47  ILE A CB   1  
ATOM 429   C CG1  . ILE A 1 27  ? -12.245 8.791   -9.742  1.00 1.00 ? 47  ILE A CG1  1  
ATOM 430   C CG2  . ILE A 1 27  ? -11.461 8.893   -12.174 1.00 1.00 ? 47  ILE A CG2  1  
ATOM 431   C CD1  . ILE A 1 27  ? -10.869 8.639   -9.088  1.00 1.00 ? 47  ILE A CD1  1  
ATOM 432   H H    . ILE A 1 27  ? -13.695 10.377  -11.184 1.00 1.00 ? 47  ILE A H    1  
ATOM 433   H HA   . ILE A 1 27  ? -13.918 8.005   -12.714 1.00 1.00 ? 47  ILE A HA   1  
ATOM 434   H HB   . ILE A 1 27  ? -12.145 7.148   -11.142 1.00 1.00 ? 47  ILE A HB   1  
ATOM 435   H HG12 . ILE A 1 27  ? -12.372 9.873   -9.754  1.00 0.00 ? 47  ILE A HG12 1  
ATOM 436   H HG13 . ILE A 1 27  ? -12.985 8.365   -9.064  1.00 1.00 ? 47  ILE A HG13 1  
ATOM 437   H HG21 . ILE A 1 27  ? -11.622 8.498   -13.178 1.00 1.00 ? 47  ILE A HG21 1  
ATOM 438   H HG22 . ILE A 1 27  ? -11.624 9.971   -12.189 1.00 1.00 ? 47  ILE A HG22 1  
ATOM 439   H HG23 . ILE A 1 27  ? -10.424 8.699   -11.902 1.00 1.00 ? 47  ILE A HG23 1  
ATOM 440   H HD11 . ILE A 1 27  ? -10.607 7.585   -9.008  1.00 1.00 ? 47  ILE A HD11 1  
ATOM 441   H HD12 . ILE A 1 27  ? -10.113 9.170   -9.665  1.00 1.00 ? 47  ILE A HD12 1  
ATOM 442   H HD13 . ILE A 1 27  ? -10.911 9.070   -8.088  1.00 1.00 ? 47  ILE A HD13 1  
ATOM 443   N N    . ALA A 1 28  ? -15.436 7.713   -9.805  1.00 1.00 ? 48  ALA A N    1  
ATOM 444   C CA   . ALA A 1 28  ? -16.189 6.879   -8.841  1.00 1.00 ? 48  ALA A CA   1  
ATOM 445   C C    . ALA A 1 28  ? -15.376 5.694   -8.226  1.00 1.00 ? 48  ALA A C    1  
ATOM 446   O O    . ALA A 1 28  ? -14.221 5.457   -8.591  1.00 1.00 ? 48  ALA A O    1  
ATOM 447   C CB   . ALA A 1 28  ? -17.537 6.478   -9.473  1.00 1.00 ? 48  ALA A CB   1  
ATOM 448   H H    . ALA A 1 28  ? -15.322 8.691   -9.582  1.00 1.00 ? 48  ALA A H    1  
ATOM 449   H HA   . ALA A 1 28  ? -16.426 7.529   -7.999  1.00 1.00 ? 48  ALA A HA   1  
ATOM 450   H HB1  . ALA A 1 28  ? -18.070 7.369   -9.811  1.00 1.00 ? 48  ALA A HB1  1  
ATOM 451   H HB2  . ALA A 1 28  ? -17.373 5.824   -10.330 1.00 1.00 ? 48  ALA A HB2  1  
ATOM 452   H HB3  . ALA A 1 28  ? -18.160 5.962   -8.744  1.00 1.00 ? 48  ALA A HB3  1  
ATOM 453   N N    . PHE A 1 29  ? -15.954 4.976   -7.244  1.00 1.00 ? 49  PHE A N    1  
ATOM 454   C CA   . PHE A 1 29  ? -15.275 3.903   -6.486  1.00 1.00 ? 49  PHE A CA   1  
ATOM 455   C C    . PHE A 1 29  ? -16.188 2.724   -6.087  1.00 1.00 ? 49  PHE A C    1  
ATOM 456   O O    . PHE A 1 29  ? -17.388 2.888   -5.831  1.00 1.00 ? 49  PHE A O    1  
ATOM 457   C CB   . PHE A 1 29  ? -14.654 4.482   -5.200  1.00 1.00 ? 49  PHE A CB   1  
ATOM 458   C CG   . PHE A 1 29  ? -13.923 5.807   -5.272  1.00 1.00 ? 49  PHE A CG   1  
ATOM 459   C CD1  . PHE A 1 29  ? -12.701 5.916   -5.972  1.00 1.00 ? 49  PHE A CD1  1  
ATOM 460   C CD2  . PHE A 1 29  ? -14.471 6.940   -4.633  1.00 1.00 ? 49  PHE A CD2  1  
ATOM 461   C CE1  . PHE A 1 29  ? -12.017 7.148   -6.019  1.00 1.00 ? 49  PHE A CE1  1  
ATOM 462   C CE2  . PHE A 1 29  ? -13.795 8.178   -4.695  1.00 1.00 ? 49  PHE A CE2  1  
ATOM 463   C CZ   . PHE A 1 29  ? -12.568 8.282   -5.385  1.00 1.00 ? 49  PHE A CZ   1  
ATOM 464   H H    . PHE A 1 29  ? -16.876 5.254   -6.912  1.00 1.00 ? 49  PHE A H    1  
ATOM 465   H HA   . PHE A 1 29  ? -14.466 3.506   -7.101  1.00 1.00 ? 49  PHE A HA   1  
ATOM 466   H HB2  . PHE A 1 29  ? -15.435 4.773   -4.498  1.00 0.00 ? 49  PHE A HB2  1  
ATOM 467   H HB3  . PHE A 1 29  ? -14.015 3.740   -4.720  1.00 1.00 ? 49  PHE A HB3  1  
ATOM 468   H HD1  . PHE A 1 29  ? -12.307 5.058   -6.490  1.00 1.00 ? 49  PHE A HD1  1  
ATOM 469   H HD2  . PHE A 1 29  ? -15.405 6.856   -4.099  1.00 1.00 ? 49  PHE A HD2  1  
ATOM 470   H HE1  . PHE A 1 29  ? -11.076 7.219   -6.544  1.00 1.00 ? 49  PHE A HE1  1  
ATOM 471   H HE2  . PHE A 1 29  ? -14.199 9.053   -4.207  1.00 1.00 ? 49  PHE A HE2  1  
ATOM 472   H HZ   . PHE A 1 29  ? -12.051 9.231   -5.413  1.00 1.00 ? 49  PHE A HZ   1  
ATOM 473   N N    . LYS A 1 30  ? -15.576 1.531   -5.956  1.00 1.00 ? 50  LYS A N    1  
ATOM 474   C CA   . LYS A 1 30  ? -16.179 0.287   -5.447  1.00 1.00 ? 50  LYS A CA   1  
ATOM 475   C C    . LYS A 1 30  ? -15.189 -0.553  -4.621  1.00 1.00 ? 50  LYS A C    1  
ATOM 476   O O    . LYS A 1 30  ? -13.984 -0.565  -4.876  1.00 1.00 ? 50  LYS A O    1  
ATOM 477   C CB   . LYS A 1 30  ? -16.713 -0.538  -6.633  1.00 1.00 ? 50  LYS A CB   1  
ATOM 478   C CG   . LYS A 1 30  ? -17.547 -1.734  -6.155  1.00 1.00 ? 50  LYS A CG   1  
ATOM 479   C CD   . LYS A 1 30  ? -17.631 -2.861  -7.191  1.00 1.00 ? 50  LYS A CD   1  
ATOM 480   C CE   . LYS A 1 30  ? -18.979 -3.579  -7.195  1.00 1.00 ? 50  LYS A CE   1  
ATOM 481   N NZ   . LYS A 1 30  ? -19.998 -2.767  -7.890  1.00 1.00 ? 50  LYS A NZ   1  
ATOM 482   H H    . LYS A 1 30  ? -14.592 1.485   -6.211  1.00 1.00 ? 50  LYS A H    1  
ATOM 483   H HA   . LYS A 1 30  ? -17.021 0.554   -4.804  1.00 1.00 ? 50  LYS A HA   1  
ATOM 484   H HB2  . LYS A 1 30  ? -17.397 0.063   -7.233  1.00 0.00 ? 50  LYS A HB2  1  
ATOM 485   H HB3  . LYS A 1 30  ? -15.888 -0.866  -7.267  1.00 1.00 ? 50  LYS A HB3  1  
ATOM 486   H HG2  . LYS A 1 30  ? -17.051 -2.193  -5.299  1.00 0.00 ? 50  LYS A HG2  1  
ATOM 487   H HG3  . LYS A 1 30  ? -18.536 -1.385  -5.868  1.00 1.00 ? 50  LYS A HG3  1  
ATOM 488   H HD2  . LYS A 1 30  ? -17.526 -2.445  -8.193  1.00 0.00 ? 50  LYS A HD2  1  
ATOM 489   H HD3  . LYS A 1 30  ? -16.831 -3.582  -7.014  1.00 1.00 ? 50  LYS A HD3  1  
ATOM 490   H HE2  . LYS A 1 30  ? -18.920 -4.498  -7.777  1.00 0.00 ? 50  LYS A HE2  1  
ATOM 491   H HE3  . LYS A 1 30  ? -19.280 -3.835  -6.173  1.00 1.00 ? 50  LYS A HE3  1  
ATOM 492   H HZ1  . LYS A 1 30  ? -20.937 -3.100  -7.632  1.00 0.00 ? 50  LYS A HZ1  1  
ATOM 493   H HZ2  . LYS A 1 30  ? -19.896 -1.780  -7.617  1.00 0.00 ? 50  LYS A HZ2  1  
ATOM 494   N N    . VAL A 1 31  ? -15.731 -1.269  -3.636  1.00 1.00 ? 51  VAL A N    1  
ATOM 495   C CA   . VAL A 1 31  ? -15.066 -2.305  -2.813  1.00 1.00 ? 51  VAL A CA   1  
ATOM 496   C C    . VAL A 1 31  ? -15.982 -3.531  -2.621  1.00 1.00 ? 51  VAL A C    1  
ATOM 497   O O    . VAL A 1 31  ? -17.202 -3.389  -2.470  1.00 1.00 ? 51  VAL A O    1  
ATOM 498   C CB   . VAL A 1 31  ? -14.511 -1.769  -1.465  1.00 1.00 ? 51  VAL A CB   1  
ATOM 499   C CG1  . VAL A 1 31  ? -13.283 -0.862  -1.651  1.00 1.00 ? 51  VAL A CG1  1  
ATOM 500   C CG2  . VAL A 1 31  ? -15.547 -0.974  -0.668  1.00 1.00 ? 51  VAL A CG2  1  
ATOM 501   H H    . VAL A 1 31  ? -16.728 -1.140  -3.529  1.00 1.00 ? 51  VAL A H    1  
ATOM 502   H HA   . VAL A 1 31  ? -14.205 -2.661  -3.379  1.00 1.00 ? 51  VAL A HA   1  
ATOM 503   H HB   . VAL A 1 31  ? -14.193 -2.622  -0.865  1.00 1.00 ? 51  VAL A HB   1  
ATOM 504   H HG11 . VAL A 1 31  ? -12.517 -1.400  -2.197  1.00 1.00 ? 51  VAL A HG11 1  
ATOM 505   H HG12 . VAL A 1 31  ? -13.544 0.043   -2.200  1.00 1.00 ? 51  VAL A HG12 1  
ATOM 506   H HG13 . VAL A 1 31  ? -12.872 -0.584  -0.679  1.00 1.00 ? 51  VAL A HG13 1  
ATOM 507   H HG21 . VAL A 1 31  ? -16.440 -1.578  -0.519  1.00 1.00 ? 51  VAL A HG21 1  
ATOM 508   H HG22 . VAL A 1 31  ? -15.141 -0.685  0.302   1.00 1.00 ? 51  VAL A HG22 1  
ATOM 509   H HG23 . VAL A 1 31  ? -15.808 -0.080  -1.225  1.00 1.00 ? 51  VAL A HG23 1  
ATOM 510   N N    . VAL A 1 32  ? -15.377 -4.728  -2.616  1.00 1.00 ? 52  VAL A N    1  
ATOM 511   C CA   . VAL A 1 32  ? -15.984 -6.056  -2.379  1.00 1.00 ? 52  VAL A CA   1  
ATOM 512   C C    . VAL A 1 32  ? -15.084 -6.847  -1.412  1.00 1.00 ? 52  VAL A C    1  
ATOM 513   O O    . VAL A 1 32  ? -13.922 -7.111  -1.728  1.00 1.00 ? 52  VAL A O    1  
ATOM 514   C CB   . VAL A 1 32  ? -16.188 -6.848  -3.702  1.00 1.00 ? 52  VAL A CB   1  
ATOM 515   C CG1  . VAL A 1 32  ? -16.886 -8.198  -3.441  1.00 1.00 ? 52  VAL A CG1  1  
ATOM 516   C CG2  . VAL A 1 32  ? -17.017 -6.066  -4.746  1.00 1.00 ? 52  VAL A CG2  1  
ATOM 517   H H    . VAL A 1 32  ? -14.368 -4.718  -2.779  1.00 1.00 ? 52  VAL A H    1  
ATOM 518   H HA   . VAL A 1 32  ? -16.965 -5.920  -1.921  1.00 1.00 ? 52  VAL A HA   1  
ATOM 519   H HB   . VAL A 1 32  ? -15.213 -7.054  -4.152  1.00 1.00 ? 52  VAL A HB   1  
ATOM 520   H HG11 . VAL A 1 32  ? -17.851 -8.044  -2.957  1.00 1.00 ? 52  VAL A HG11 1  
ATOM 521   H HG12 . VAL A 1 32  ? -17.041 -8.730  -4.379  1.00 1.00 ? 52  VAL A HG12 1  
ATOM 522   H HG13 . VAL A 1 32  ? -16.267 -8.827  -2.803  1.00 1.00 ? 52  VAL A HG13 1  
ATOM 523   H HG21 . VAL A 1 32  ? -17.981 -5.779  -4.326  1.00 1.00 ? 52  VAL A HG21 1  
ATOM 524   H HG22 . VAL A 1 32  ? -16.479 -5.168  -5.049  1.00 1.00 ? 52  VAL A HG22 1  
ATOM 525   H HG23 . VAL A 1 32  ? -17.176 -6.678  -5.637  1.00 1.00 ? 52  VAL A HG23 1  
ATOM 526   N N    . ALA A 1 33  ? -15.607 -7.239  -0.243  1.00 1.00 ? 53  ALA A N    1  
ATOM 527   C CA   . ALA A 1 33  ? -14.856 -7.932  0.815   1.00 1.00 ? 53  ALA A CA   1  
ATOM 528   C C    . ALA A 1 33  ? -15.567 -9.233  1.225   1.00 1.00 ? 53  ALA A C    1  
ATOM 529   O O    . ALA A 1 33  ? -16.589 -9.200  1.906   1.00 1.00 ? 53  ALA A O    1  
ATOM 530   C CB   . ALA A 1 33  ? -14.626 -6.965  1.992   1.00 1.00 ? 53  ALA A CB   1  
ATOM 531   H H    . ALA A 1 33  ? -16.593 -7.041  -0.076  1.00 1.00 ? 53  ALA A H    1  
ATOM 532   H HA   . ALA A 1 33  ? -13.875 -8.199  0.438   1.00 1.00 ? 53  ALA A HA   1  
ATOM 533   H HB1  . ALA A 1 33  ? -14.074 -6.085  1.658   1.00 1.00 ? 53  ALA A HB1  1  
ATOM 534   H HB2  . ALA A 1 33  ? -15.581 -6.649  2.421   1.00 1.00 ? 53  ALA A HB2  1  
ATOM 535   H HB3  . ALA A 1 33  ? -14.051 -7.458  2.777   1.00 1.00 ? 53  ALA A HB3  1  
ATOM 536   N N    . LEU A 1 34  ? -14.992 -10.372 0.823   1.00 1.00 ? 54  LEU A N    1  
ATOM 537   C CA   . LEU A 1 34  ? -15.561 -11.718 0.955   1.00 1.00 ? 54  LEU A CA   1  
ATOM 538   C C    . LEU A 1 34  ? -15.158 -12.404 2.280   1.00 1.00 ? 54  LEU A C    1  
ATOM 539   O O    . LEU A 1 34  ? -13.978 -12.647 2.537   1.00 1.00 ? 54  LEU A O    1  
ATOM 540   C CB   . LEU A 1 34  ? -15.159 -12.514 -0.305  1.00 1.00 ? 54  LEU A CB   1  
ATOM 541   C CG   . LEU A 1 34  ? -15.836 -12.032 -1.613  1.00 1.00 ? 54  LEU A CG   1  
ATOM 542   C CD1  . LEU A 1 34  ? -14.831 -12.064 -2.769  1.00 1.00 ? 54  LEU A CD1  1  
ATOM 543   C CD2  . LEU A 1 34  ? -17.080 -12.863 -1.965  1.00 1.00 ? 54  LEU A CD2  1  
ATOM 544   H H    . LEU A 1 34  ? -14.123 -10.304 0.298   1.00 1.00 ? 54  LEU A H    1  
ATOM 545   H HA   . LEU A 1 34  ? -16.649 -11.634 0.938   1.00 1.00 ? 54  LEU A HA   1  
ATOM 546   H HB2  . LEU A 1 34  ? -14.110 -12.357 -0.553  1.00 0.00 ? 54  LEU A HB2  1  
ATOM 547   H HB3  . LEU A 1 34  ? -15.309 -13.585 -0.159  1.00 1.00 ? 54  LEU A HB3  1  
ATOM 548   H HG   . LEU A 1 34  ? -16.160 -10.997 -1.507  1.00 1.00 ? 54  LEU A HG   1  
ATOM 549   H HD11 . LEU A 1 34  ? -13.983 -11.421 -2.532  1.00 1.00 ? 54  LEU A HD11 1  
ATOM 550   H HD12 . LEU A 1 34  ? -14.475 -13.079 -2.937  1.00 1.00 ? 54  LEU A HD12 1  
ATOM 551   H HD13 . LEU A 1 34  ? -15.302 -11.690 -3.681  1.00 1.00 ? 54  LEU A HD13 1  
ATOM 552   H HD21 . LEU A 1 34  ? -17.798 -12.821 -1.145  1.00 1.00 ? 54  LEU A HD21 1  
ATOM 553   H HD22 . LEU A 1 34  ? -17.554 -12.462 -2.862  1.00 1.00 ? 54  LEU A HD22 1  
ATOM 554   H HD23 . LEU A 1 34  ? -16.805 -13.902 -2.145  1.00 1.00 ? 54  LEU A HD23 1  
ATOM 555   N N    . GLY A 1 35  ? -16.163 -12.715 3.113   1.00 1.00 ? 55  GLY A N    1  
ATOM 556   C CA   . GLY A 1 35  ? -16.064 -13.316 4.456   1.00 1.00 ? 55  GLY A CA   1  
ATOM 557   C C    . GLY A 1 35  ? -17.415 -13.785 5.037   1.00 1.00 ? 55  GLY A C    1  
ATOM 558   O O    . GLY A 1 35  ? -18.419 -13.866 4.330   1.00 1.00 ? 55  GLY A O    1  
ATOM 559   H H    . GLY A 1 35  ? -17.098 -12.444 2.804   1.00 1.00 ? 55  GLY A H    1  
ATOM 560   H HA2  . GLY A 1 35  ? -15.395 -14.176 4.425   1.00 1.00 ? 55  GLY A HA2  1  
ATOM 561   H HA3  . GLY A 1 35  ? -15.633 -12.573 5.127   1.00 1.00 ? 55  GLY A HA3  1  
ATOM 562   N N    . ASP A 1 36  ? -17.446 -14.105 6.341   1.00 1.00 ? 56  ASP A N    1  
ATOM 563   C CA   . ASP A 1 36  ? -18.654 -14.485 7.105   1.00 1.00 ? 56  ASP A CA   1  
ATOM 564   C C    . ASP A 1 36  ? -19.241 -13.374 8.025   1.00 1.00 ? 56  ASP A C    1  
ATOM 565   O O    . ASP A 1 36  ? -20.305 -13.567 8.615   1.00 1.00 ? 56  ASP A O    1  
ATOM 566   C CB   . ASP A 1 36  ? -18.305 -15.771 7.873   1.00 1.00 ? 56  ASP A CB   1  
ATOM 567   C CG   . ASP A 1 36  ? -19.510 -16.533 8.436   1.00 1.00 ? 56  ASP A CG   1  
ATOM 568   O OD1  . ASP A 1 36  ? -20.335 -16.987 7.611   1.00 1.00 ? 56  ASP A OD1  1  
ATOM 569   O OD2  . ASP A 1 36  ? -19.570 -16.686 9.677   1.00 1.00 ? 56  ASP A OD2  1  
ATOM 570   H H    . ASP A 1 36  ? -16.575 -14.112 6.845   1.00 1.00 ? 56  ASP A H    1  
ATOM 571   H HA   . ASP A 1 36  ? -19.445 -14.752 6.395   1.00 1.00 ? 56  ASP A HA   1  
ATOM 572   H HB2  . ASP A 1 36  ? -17.783 -16.443 7.190   1.00 0.00 ? 56  ASP A HB2  1  
ATOM 573   H HB3  . ASP A 1 36  ? -17.548 -15.576 8.638   1.00 1.00 ? 56  ASP A HB3  1  
ATOM 574   N N    . VAL A 1 37  ? -18.585 -12.201 8.140   1.00 1.00 ? 57  VAL A N    1  
ATOM 575   C CA   . VAL A 1 37  ? -19.082 -11.005 8.862   1.00 1.00 ? 57  VAL A CA   1  
ATOM 576   C C    . VAL A 1 37  ? -20.484 -10.555 8.354   1.00 1.00 ? 57  VAL A C    1  
ATOM 577   O O    . VAL A 1 37  ? -20.739 -10.638 7.143   1.00 1.00 ? 57  VAL A O    1  
ATOM 578   C CB   . VAL A 1 37  ? -18.077 -9.812  8.844   1.00 1.00 ? 57  VAL A CB   1  
ATOM 579   C CG1  . VAL A 1 37  ? -16.938 -10.014 9.865   1.00 1.00 ? 57  VAL A CG1  1  
ATOM 580   C CG2  . VAL A 1 37  ? -17.465 -9.526  7.459   1.00 1.00 ? 57  VAL A CG2  1  
ATOM 581   H H    . VAL A 1 37  ? -17.747 -12.111 7.588   1.00 1.00 ? 57  VAL A H    1  
ATOM 582   H HA   . VAL A 1 37  ? -19.196 -11.313 9.899   1.00 1.00 ? 57  VAL A HA   1  
ATOM 583   H HB   . VAL A 1 37  ? -18.613 -8.914  9.158   1.00 1.00 ? 57  VAL A HB   1  
ATOM 584   H HG11 . VAL A 1 37  ? -17.352 -10.138 10.865  1.00 1.00 ? 57  VAL A HG11 1  
ATOM 585   H HG12 . VAL A 1 37  ? -16.348 -10.894 9.615   1.00 1.00 ? 57  VAL A HG12 1  
ATOM 586   H HG13 . VAL A 1 37  ? -16.284 -9.141  9.880   1.00 1.00 ? 57  VAL A HG13 1  
ATOM 587   H HG21 . VAL A 1 37  ? -18.249 -9.495  6.706   1.00 1.00 ? 57  VAL A HG21 1  
ATOM 588   H HG22 . VAL A 1 37  ? -16.960 -8.559  7.462   1.00 1.00 ? 57  VAL A HG22 1  
ATOM 589   H HG23 . VAL A 1 37  ? -16.748 -10.297 7.180   1.00 1.00 ? 57  VAL A HG23 1  
ATOM 590   N N    . PRO A 1 38  ? -21.389 -10.075 9.253   1.00 1.00 ? 58  PRO A N    1  
ATOM 591   C CA   . PRO A 1 38  ? -22.726 -9.558  8.899   1.00 1.00 ? 58  PRO A CA   1  
ATOM 592   C C    . PRO A 1 38  ? -22.668 -8.281  8.040   1.00 1.00 ? 58  PRO A C    1  
ATOM 593   O O    . PRO A 1 38  ? -23.494 -8.110  7.143   1.00 1.00 ? 58  PRO A O    1  
ATOM 594   C CB   . PRO A 1 38  ? -23.474 -9.319  10.217  1.00 1.00 ? 58  PRO A CB   1  
ATOM 595   C CG   . PRO A 1 38  ? -22.362 -9.186  11.256  1.00 1.00 ? 58  PRO A CG   1  
ATOM 596   C CD   . PRO A 1 38  ? -21.193 -9.992  10.695  1.00 1.00 ? 58  PRO A CD   1  
ATOM 597   H HA   . PRO A 1 38  ? -23.257 -10.324 8.329   1.00 1.00 ? 58  PRO A HA   1  
ATOM 598   H HB2  . PRO A 1 38  ? -24.035 -8.402  10.041  1.00 0.00 ? 58  PRO A HB2  1  
ATOM 599   H HB3  . PRO A 1 38  ? -24.074 -10.202 10.451  1.00 1.00 ? 58  PRO A HB3  1  
ATOM 600   H HG2  . PRO A 1 38  ? -22.086 -8.141  11.401  1.00 0.00 ? 58  PRO A HG2  1  
ATOM 601   H HG3  . PRO A 1 38  ? -22.678 -9.585  12.220  1.00 1.00 ? 58  PRO A HG3  1  
ATOM 602   H HD2  . PRO A 1 38  ? -20.225 -9.532  10.893  1.00 0.00 ? 58  PRO A HD2  1  
ATOM 603   H HD3  . PRO A 1 38  ? -21.221 -11.001 11.114  1.00 1.00 ? 58  PRO A HD3  1  
ATOM 604   N N    . ASP A 1 39  ? -21.720 -7.382  8.342   1.00 1.00 ? 59  ASP A N    1  
ATOM 605   C CA   . ASP A 1 39  ? -21.326 -6.216  7.542   1.00 1.00 ? 59  ASP A CA   1  
ATOM 606   C C    . ASP A 1 39  ? -20.241 -6.613  6.493   1.00 1.00 ? 59  ASP A C    1  
ATOM 607   O O    . ASP A 1 39  ? -20.011 -7.795  6.234   1.00 1.00 ? 59  ASP A O    1  
ATOM 608   C CB   . ASP A 1 39  ? -20.866 -5.087  8.479   1.00 1.00 ? 59  ASP A CB   1  
ATOM 609   C CG   . ASP A 1 39  ? -19.709 -5.505  9.379   1.00 1.00 ? 59  ASP A CG   1  
ATOM 610   O OD1  . ASP A 1 39  ? -19.990 -6.139  10.422  1.00 1.00 ? 59  ASP A OD1  1  
ATOM 611   O OD2  . ASP A 1 39  ? -18.562 -5.226  8.972   1.00 1.00 ? 59  ASP A OD2  1  
ATOM 612   H H    . ASP A 1 39  ? -21.144 -7.558  9.159   1.00 1.00 ? 59  ASP A H    1  
ATOM 613   H HA   . ASP A 1 39  ? -22.198 -5.856  7.002   1.00 1.00 ? 59  ASP A HA   1  
ATOM 614   H HB2  . ASP A 1 39  ? -20.524 -4.204  7.939   1.00 0.00 ? 59  ASP A HB2  1  
ATOM 615   H HB3  . ASP A 1 39  ? -21.707 -4.706  9.063   1.00 1.00 ? 59  ASP A HB3  1  
ATOM 616   N N    . GLY A 1 40  ? -19.578 -5.641  5.844   1.00 1.00 ? 60  GLY A N    1  
ATOM 617   C CA   . GLY A 1 40  ? -18.479 -5.872  4.902   1.00 1.00 ? 60  GLY A CA   1  
ATOM 618   C C    . GLY A 1 40  ? -17.107 -5.603  5.507   1.00 1.00 ? 60  GLY A C    1  
ATOM 619   O O    . GLY A 1 40  ? -16.259 -6.491  5.452   1.00 1.00 ? 60  GLY A O    1  
ATOM 620   H H    . GLY A 1 40  ? -19.753 -4.657  6.074   1.00 1.00 ? 60  GLY A H    1  
ATOM 621   H HA2  . GLY A 1 40  ? -18.497 -6.906  4.555   1.00 1.00 ? 60  GLY A HA2  1  
ATOM 622   H HA3  . GLY A 1 40  ? -18.607 -5.230  4.034   1.00 1.00 ? 60  GLY A HA3  1  
ATOM 623   N N    . THR A 1 41  ? -16.915 -4.378  6.038   1.00 1.00 ? 61  THR A N    1  
ATOM 624   C CA   . THR A 1 41  ? -15.663 -3.773  6.602   1.00 1.00 ? 61  THR A CA   1  
ATOM 625   C C    . THR A 1 41  ? -15.666 -2.229  6.466   1.00 1.00 ? 61  THR A C    1  
ATOM 626   O O    . THR A 1 41  ? -16.650 -1.651  6.002   1.00 1.00 ? 61  THR A O    1  
ATOM 627   C CB   . THR A 1 41  ? -14.349 -4.426  6.066   1.00 1.00 ? 61  THR A CB   1  
ATOM 628   O OG1  . THR A 1 41  ? -13.207 -3.900  6.692   1.00 1.00 ? 61  THR A OG1  1  
ATOM 629   C CG2  . THR A 1 41  ? -14.109 -4.277  4.561   1.00 1.00 ? 61  THR A CG2  1  
ATOM 630   H H    . THR A 1 41  ? -17.750 -3.790  6.044   1.00 1.00 ? 61  THR A H    1  
ATOM 631   H HA   . THR A 1 41  ? -15.682 -3.969  7.674   1.00 1.00 ? 61  THR A HA   1  
ATOM 632   H HB   . THR A 1 41  ? -14.349 -5.484  6.315   1.00 1.00 ? 61  THR A HB   1  
ATOM 633   H HG1  . THR A 1 41  ? -12.444 -4.326  6.293   1.00 1.00 ? 61  THR A HG1  1  
ATOM 634   H HG21 . THR A 1 41  ? -14.952 -4.690  4.012   1.00 1.00 ? 61  THR A HG21 1  
ATOM 635   H HG22 . THR A 1 41  ? -13.986 -3.227  4.295   1.00 1.00 ? 61  THR A HG22 1  
ATOM 636   H HG23 . THR A 1 41  ? -13.223 -4.835  4.264   1.00 1.00 ? 61  THR A HG23 1  
ATOM 637   N N    . LEU A 1 42  ? -14.590 -1.543  6.883   1.00 1.00 ? 62  LEU A N    1  
ATOM 638   C CA   . LEU A 1 42  ? -14.353 -0.099  6.774   1.00 1.00 ? 62  LEU A CA   1  
ATOM 639   C C    . LEU A 1 42  ? -13.009 0.178   6.061   1.00 1.00 ? 62  LEU A C    1  
ATOM 640   O O    . LEU A 1 42  ? -11.934 -0.146  6.565   1.00 1.00 ? 62  LEU A O    1  
ATOM 641   C CB   . LEU A 1 42  ? -14.514 0.514   8.186   1.00 1.00 ? 62  LEU A CB   1  
ATOM 642   C CG   . LEU A 1 42  ? -14.127 1.982   8.446   1.00 1.00 ? 62  LEU A CG   1  
ATOM 643   C CD1  . LEU A 1 42  ? -14.753 2.943   7.432   1.00 1.00 ? 62  LEU A CD1  1  
ATOM 644   C CD2  . LEU A 1 42  ? -14.586 2.389   9.854   1.00 1.00 ? 62  LEU A CD2  1  
ATOM 645   H H    . LEU A 1 42  ? -13.820 -2.088  7.278   1.00 1.00 ? 62  LEU A H    1  
ATOM 646   H HA   . LEU A 1 42  ? -15.135 0.337   6.158   1.00 1.00 ? 62  LEU A HA   1  
ATOM 647   H HB2  . LEU A 1 42  ? -15.563 0.644   8.452   1.00 0.00 ? 62  LEU A HB2  1  
ATOM 648   H HB3  . LEU A 1 42  ? -14.065 -0.117  8.954   1.00 1.00 ? 62  LEU A HB3  1  
ATOM 649   H HG   . LEU A 1 42  ? -13.043 2.085   8.392   1.00 1.00 ? 62  LEU A HG   1  
ATOM 650   H HD11 . LEU A 1 42  ? -15.833 2.812   7.401   1.00 1.00 ? 62  LEU A HD11 1  
ATOM 651   H HD12 . LEU A 1 42  ? -14.531 3.969   7.709   1.00 1.00 ? 62  LEU A HD12 1  
ATOM 652   H HD13 . LEU A 1 42  ? -14.326 2.765   6.450   1.00 1.00 ? 62  LEU A HD13 1  
ATOM 653   H HD21 . LEU A 1 42  ? -14.125 1.737   10.597  1.00 1.00 ? 62  LEU A HD21 1  
ATOM 654   H HD22 . LEU A 1 42  ? -14.288 3.417   10.064  1.00 1.00 ? 62  LEU A HD22 1  
ATOM 655   H HD23 . LEU A 1 42  ? -15.670 2.307   9.936   1.00 1.00 ? 62  LEU A HD23 1  
ATOM 656   N N    . VAL A 1 43  ? -13.042 0.815   4.882   1.00 1.00 ? 63  VAL A N    1  
ATOM 657   C CA   . VAL A 1 43  ? -11.832 1.202   4.127   1.00 1.00 ? 63  VAL A CA   1  
ATOM 658   C C    . VAL A 1 43  ? -11.429 2.630   4.513   1.00 1.00 ? 63  VAL A C    1  
ATOM 659   O O    . VAL A 1 43  ? -12.241 3.557   4.433   1.00 1.00 ? 63  VAL A O    1  
ATOM 660   C CB   . VAL A 1 43  ? -11.951 0.996   2.591   1.00 1.00 ? 63  VAL A CB   1  
ATOM 661   C CG1  . VAL A 1 43  ? -13.057 1.794   1.878   1.00 1.00 ? 63  VAL A CG1  1  
ATOM 662   C CG2  . VAL A 1 43  ? -10.605 1.293   1.897   1.00 1.00 ? 63  VAL A CG2  1  
ATOM 663   H H    . VAL A 1 43  ? -13.946 1.140   4.540   1.00 1.00 ? 63  VAL A H    1  
ATOM 664   H HA   . VAL A 1 43  ? -11.026 0.537   4.433   1.00 1.00 ? 63  VAL A HA   1  
ATOM 665   H HB   . VAL A 1 43  ? -12.165 -0.062  2.425   1.00 1.00 ? 63  VAL A HB   1  
ATOM 666   H HG11 . VAL A 1 43  ? -14.029 1.518   2.280   1.00 1.00 ? 63  VAL A HG11 1  
ATOM 667   H HG12 . VAL A 1 43  ? -12.901 2.867   2.003   1.00 1.00 ? 63  VAL A HG12 1  
ATOM 668   H HG13 . VAL A 1 43  ? -13.060 1.562   0.812   1.00 1.00 ? 63  VAL A HG13 1  
ATOM 669   H HG21 . VAL A 1 43  ? -9.791  0.795   2.423   1.00 1.00 ? 63  VAL A HG21 1  
ATOM 670   H HG22 . VAL A 1 43  ? -10.624 0.927   0.869   1.00 1.00 ? 63  VAL A HG22 1  
ATOM 671   H HG23 . VAL A 1 43  ? -10.405 2.366   1.884   1.00 1.00 ? 63  VAL A HG23 1  
ATOM 672   N N    . THR A 1 44  ? -10.178 2.774   4.979   1.00 1.00 ? 64  THR A N    1  
ATOM 673   C CA   . THR A 1 44  ? -9.524  4.071   5.282   1.00 1.00 ? 64  THR A CA   1  
ATOM 674   C C    . THR A 1 44  ? -8.203  4.286   4.507   1.00 1.00 ? 64  THR A C    1  
ATOM 675   O O    . THR A 1 44  ? -7.246  3.514   4.624   1.00 1.00 ? 64  THR A O    1  
ATOM 676   C CB   . THR A 1 44  ? -9.389  4.284   6.803   1.00 1.00 ? 64  THR A CB   1  
ATOM 677   O OG1  . THR A 1 44  ? -8.936  5.590   7.068   1.00 1.00 ? 64  THR A OG1  1  
ATOM 678   C CG2  . THR A 1 44  ? -8.448  3.329   7.542   1.00 1.00 ? 64  THR A CG2  1  
ATOM 679   H H    . THR A 1 44  ? -9.662  1.900   5.161   1.00 1.00 ? 64  THR A H    1  
ATOM 680   H HA   . THR A 1 44  ? -10.201 4.859   4.958   1.00 1.00 ? 64  THR A HA   1  
ATOM 681   H HB   . THR A 1 44  ? -10.383 4.186   7.247   1.00 1.00 ? 64  THR A HB   1  
ATOM 682   H HG1  . THR A 1 44  ? -7.992  5.531   7.245   1.00 1.00 ? 64  THR A HG1  1  
ATOM 683   H HG21 . THR A 1 44  ? -8.745  2.298   7.349   1.00 1.00 ? 64  THR A HG21 1  
ATOM 684   H HG22 . THR A 1 44  ? -7.422  3.470   7.206   1.00 1.00 ? 64  THR A HG22 1  
ATOM 685   H HG23 . THR A 1 44  ? -8.499  3.508   8.618   1.00 1.00 ? 64  THR A HG23 1  
ATOM 686   N N    . VAL A 1 45  ? -8.103  5.386   3.744   1.00 1.00 ? 65  VAL A N    1  
ATOM 687   C CA   . VAL A 1 45  ? -6.926  5.687   2.888   1.00 1.00 ? 65  VAL A CA   1  
ATOM 688   C C    . VAL A 1 45  ? -5.994  6.627   3.665   1.00 1.00 ? 65  VAL A C    1  
ATOM 689   O O    . VAL A 1 45  ? -6.380  7.740   4.028   1.00 1.00 ? 65  VAL A O    1  
ATOM 690   C CB   . VAL A 1 45  ? -7.275  6.217   1.464   1.00 1.00 ? 65  VAL A CB   1  
ATOM 691   C CG1  . VAL A 1 45  ? -8.442  5.439   0.812   1.00 1.00 ? 65  VAL A CG1  1  
ATOM 692   C CG2  . VAL A 1 45  ? -7.482  7.742   1.363   1.00 1.00 ? 65  VAL A CG2  1  
ATOM 693   H H    . VAL A 1 45  ? -8.925  5.971   3.680   1.00 1.00 ? 65  VAL A H    1  
ATOM 694   H HA   . VAL A 1 45  ? -6.401  4.752   2.721   1.00 1.00 ? 65  VAL A HA   1  
ATOM 695   H HB   . VAL A 1 45  ? -6.403  6.009   0.840   1.00 1.00 ? 65  VAL A HB   1  
ATOM 696   H HG11 . VAL A 1 45  ? -9.344  5.496   1.416   1.00 1.00 ? 65  VAL A HG11 1  
ATOM 697   H HG12 . VAL A 1 45  ? -8.667  5.840   -0.175  1.00 1.00 ? 65  VAL A HG12 1  
ATOM 698   H HG13 . VAL A 1 45  ? -8.171  4.389   0.709   1.00 1.00 ? 65  VAL A HG13 1  
ATOM 699   H HG21 . VAL A 1 45  ? -8.079  8.087   2.201   1.00 1.00 ? 65  VAL A HG21 1  
ATOM 700   H HG22 . VAL A 1 45  ? -6.514  8.246   1.412   1.00 1.00 ? 65  VAL A HG22 1  
ATOM 701   H HG23 . VAL A 1 45  ? -7.964  8.015   0.427   1.00 1.00 ? 65  VAL A HG23 1  
ATOM 702   N N    . MET A 1 46  ? -4.778  6.157   3.975   1.00 1.00 ? 66  MET A N    1  
ATOM 703   C CA   . MET A 1 46  ? -3.850  6.878   4.864   1.00 1.00 ? 66  MET A CA   1  
ATOM 704   C C    . MET A 1 46  ? -2.489  7.185   4.209   1.00 1.00 ? 66  MET A C    1  
ATOM 705   O O    . MET A 1 46  ? -1.702  6.263   4.022   1.00 1.00 ? 66  MET A O    1  
ATOM 706   C CB   . MET A 1 46  ? -3.681  6.059   6.166   1.00 1.00 ? 66  MET A CB   1  
ATOM 707   C CG   . MET A 1 46  ? -4.979  5.870   6.971   1.00 1.00 ? 66  MET A CG   1  
ATOM 708   S SD   . MET A 1 46  ? -4.872  4.766   8.402   1.00 1.00 ? 66  MET A SD   1  
ATOM 709   C CE   . MET A 1 46  ? -4.018  5.829   9.593   1.00 1.00 ? 66  MET A CE   1  
ATOM 710   H H    . MET A 1 46  ? -4.570  5.175   3.776   1.00 1.00 ? 66  MET A H    1  
ATOM 711   H HA   . MET A 1 46  ? -4.298  7.828   5.145   1.00 1.00 ? 66  MET A HA   1  
ATOM 712   H HB2  . MET A 1 46  ? -3.309  5.069   5.901   1.00 0.00 ? 66  MET A HB2  1  
ATOM 713   H HB3  . MET A 1 46  ? -2.924  6.518   6.806   1.00 1.00 ? 66  MET A HB3  1  
ATOM 714   H HG2  . MET A 1 46  ? -5.287  6.847   7.343   1.00 0.00 ? 66  MET A HG2  1  
ATOM 715   H HG3  . MET A 1 46  ? -5.758  5.488   6.313   1.00 1.00 ? 66  MET A HG3  1  
ATOM 716   H HE1  . MET A 1 46  ? -3.047  6.122   9.196   1.00 1.00 ? 66  MET A HE1  1  
ATOM 717   H HE2  . MET A 1 46  ? -4.622  6.716   9.787   1.00 1.00 ? 66  MET A HE2  1  
ATOM 718   H HE3  . MET A 1 46  ? -3.875  5.283   10.526  1.00 1.00 ? 66  MET A HE3  1  
ATOM 719   N N    . ALA A 1 47  ? -2.120  8.455   3.946   1.00 1.00 ? 67  ALA A N    1  
ATOM 720   C CA   . ALA A 1 47  ? -0.788  8.768   3.419   1.00 1.00 ? 67  ALA A CA   1  
ATOM 721   C C    . ALA A 1 47  ? 0.238   9.191   4.503   1.00 1.00 ? 67  ALA A C    1  
ATOM 722   O O    . ALA A 1 47  ? 0.104   10.207  5.184   1.00 1.00 ? 67  ALA A O    1  
ATOM 723   C CB   . ALA A 1 47  ? -0.941  9.828   2.339   1.00 1.00 ? 67  ALA A CB   1  
ATOM 724   H H    . ALA A 1 47  ? -2.785  9.234   3.956   1.00 1.00 ? 67  ALA A H    1  
ATOM 725   H HA   . ALA A 1 47  ? -0.408  7.892   2.910   1.00 1.00 ? 67  ALA A HA   1  
ATOM 726   H HB1  . ALA A 1 47  ? -1.623  9.470   1.568   1.00 1.00 ? 67  ALA A HB1  1  
ATOM 727   H HB2  . ALA A 1 47  ? -1.332  10.733  2.800   1.00 1.00 ? 67  ALA A HB2  1  
ATOM 728   H HB3  . ALA A 1 47  ? 0.022   10.041  1.873   1.00 1.00 ? 67  ALA A HB3  1  
ATOM 729   N N    . GLY A 1 48  ? 1.266   8.349   4.657   1.00 1.00 ? 68  GLY A N    1  
ATOM 730   C CA   . GLY A 1 48  ? 2.488   8.504   5.464   1.00 1.00 ? 68  GLY A CA   1  
ATOM 731   C C    . GLY A 1 48  ? 3.771   8.238   4.648   1.00 1.00 ? 68  GLY A C    1  
ATOM 732   O O    . GLY A 1 48  ? 3.841   8.534   3.459   1.00 1.00 ? 68  GLY A O    1  
ATOM 733   H H    . GLY A 1 48  ? 1.162   7.519   4.095   1.00 1.00 ? 68  GLY A H    1  
ATOM 734   H HA2  . GLY A 1 48  ? 2.546   9.526   5.843   1.00 1.00 ? 68  GLY A HA2  1  
ATOM 735   H HA3  . GLY A 1 48  ? 2.443   7.825   6.314   1.00 1.00 ? 68  GLY A HA3  1  
ATOM 736   N N    . ASN A 1 49  ? 4.827   7.737   5.303   1.00 1.00 ? 69  ASN A N    1  
ATOM 737   C CA   . ASN A 1 49  ? 6.174   7.516   4.739   1.00 1.00 ? 69  ASN A CA   1  
ATOM 738   C C    . ASN A 1 49  ? 6.969   6.436   5.526   1.00 1.00 ? 69  ASN A C    1  
ATOM 739   O O    . ASN A 1 49  ? 8.148   6.620   5.826   1.00 1.00 ? 69  ASN A O    1  
ATOM 740   C CB   . ASN A 1 49  ? 6.841   8.914   4.745   1.00 1.00 ? 69  ASN A CB   1  
ATOM 741   C CG   . ASN A 1 49  ? 8.141   9.067   3.962   1.00 1.00 ? 69  ASN A CG   1  
ATOM 742   O OD1  . ASN A 1 49  ? 8.378   8.466   2.925   1.00 1.00 ? 69  ASN A OD1  1  
ATOM 743   N ND2  . ASN A 1 49  ? 9.019   9.933   4.421   1.00 1.00 ? 69  ASN A ND2  1  
ATOM 744   H H    . ASN A 1 49  ? 4.716   7.553   6.285   1.00 1.00 ? 69  ASN A H    1  
ATOM 745   H HA   . ASN A 1 49  ? 6.087   7.170   3.706   1.00 1.00 ? 69  ASN A HA   1  
ATOM 746   H HB2  . ASN A 1 49  ? 6.204   9.627   4.221   1.00 0.00 ? 69  ASN A HB2  1  
ATOM 747   H HB3  . ASN A 1 49  ? 6.984   9.248   5.774   1.00 1.00 ? 69  ASN A HB3  1  
ATOM 748   H HD21 . ASN A 1 49  ? 8.813   10.471  5.274   1.00 0.00 ? 69  ASN A HD21 1  
ATOM 749   H HD22 . ASN A 1 49  ? 9.911   10.072  3.926   1.00 0.00 ? 69  ASN A HD22 1  
ATOM 750   N N    . ASP A 1 50  ? 6.306   5.339   5.941   1.00 1.00 ? 70  ASP A N    1  
ATOM 751   C CA   . ASP A 1 50  ? 6.765   4.267   6.862   1.00 1.00 ? 70  ASP A CA   1  
ATOM 752   C C    . ASP A 1 50  ? 7.076   4.750   8.309   1.00 1.00 ? 70  ASP A C    1  
ATOM 753   O O    . ASP A 1 50  ? 6.908   4.004   9.277   1.00 1.00 ? 70  ASP A O    1  
ATOM 754   C CB   . ASP A 1 50  ? 7.894   3.441   6.217   1.00 1.00 ? 70  ASP A CB   1  
ATOM 755   C CG   . ASP A 1 50  ? 7.508   2.813   4.870   1.00 1.00 ? 70  ASP A CG   1  
ATOM 756   O OD1  . ASP A 1 50  ? 6.311   2.490   4.682   1.00 1.00 ? 70  ASP A OD1  1  
ATOM 757   O OD2  . ASP A 1 50  ? 8.427   2.674   4.032   1.00 1.00 ? 70  ASP A OD2  1  
ATOM 758   H H    . ASP A 1 50  ? 5.392   5.207   5.544   1.00 1.00 ? 70  ASP A H    1  
ATOM 759   H HA   . ASP A 1 50  ? 5.921   3.584   6.979   1.00 1.00 ? 70  ASP A HA   1  
ATOM 760   H HB2  . ASP A 1 50  ? 8.796   4.016   6.010   1.00 0.00 ? 70  ASP A HB2  1  
ATOM 761   H HB3  . ASP A 1 50  ? 8.215   2.656   6.906   1.00 1.00 ? 70  ASP A HB3  1  
ATOM 762   N N    . GLU A 1 51  ? 7.436   6.030   8.437   1.00 1.00 ? 71  GLU A N    1  
ATOM 763   C CA   . GLU A 1 51  ? 7.610   6.886   9.606   1.00 1.00 ? 71  GLU A CA   1  
ATOM 764   C C    . GLU A 1 51  ? 7.039   8.276   9.229   1.00 1.00 ? 71  GLU A C    1  
ATOM 765   O O    . GLU A 1 51  ? 7.745   9.140   8.707   1.00 1.00 ? 71  GLU A O    1  
ATOM 766   C CB   . GLU A 1 51  ? 9.079   6.912   10.070  1.00 1.00 ? 71  GLU A CB   1  
ATOM 767   C CG   . GLU A 1 51  ? 9.274   7.483   11.484  1.00 1.00 ? 71  GLU A CG   1  
ATOM 768   C CD   . GLU A 1 51  ? 9.153   9.008   11.554  1.00 1.00 ? 71  GLU A CD   1  
ATOM 769   O OE1  . GLU A 1 51  ? 10.180  9.679   11.305  1.00 1.00 ? 71  GLU A OE1  1  
ATOM 770   O OE2  . GLU A 1 51  ? 8.037   9.467   11.894  1.00 1.00 ? 71  GLU A OE2  1  
ATOM 771   H H    . GLU A 1 51  ? 7.678   6.446   7.540   1.00 1.00 ? 71  GLU A H    1  
ATOM 772   H HA   . GLU A 1 51  ? 7.015   6.480   10.428  1.00 1.00 ? 71  GLU A HA   1  
ATOM 773   H HB2  . GLU A 1 51  ? 9.549   5.929   10.101  1.00 0.00 ? 71  GLU A HB2  1  
ATOM 774   H HB3  . GLU A 1 51  ? 9.730   7.409   9.348   1.00 1.00 ? 71  GLU A HB3  1  
ATOM 775   H HG2  . GLU A 1 51  ? 8.551   7.111   12.210  1.00 0.00 ? 71  GLU A HG2  1  
ATOM 776   H HG3  . GLU A 1 51  ? 10.226  7.138   11.901  1.00 1.00 ? 71  GLU A HG3  1  
ATOM 777   N N    . ASN A 1 52  ? 5.711   8.433   9.386   1.00 1.00 ? 72  ASN A N    1  
ATOM 778   C CA   . ASN A 1 52  ? 4.972   9.703   9.272   1.00 1.00 ? 72  ASN A CA   1  
ATOM 779   C C    . ASN A 1 52  ? 3.482   9.590   9.652   1.00 1.00 ? 72  ASN A C    1  
ATOM 780   O O    . ASN A 1 52  ? 2.978   10.495  10.311  1.00 1.00 ? 72  ASN A O    1  
ATOM 781   C CB   . ASN A 1 52  ? 5.119   10.323  7.860   1.00 1.00 ? 72  ASN A CB   1  
ATOM 782   C CG   . ASN A 1 52  ? 4.862   11.829  7.743   1.00 1.00 ? 72  ASN A CG   1  
ATOM 783   O OD1  . ASN A 1 52  ? 5.246   12.476  6.782   1.00 1.00 ? 72  ASN A OD1  1  
ATOM 784   N ND2  . ASN A 1 52  ? 4.146   12.455  8.656   1.00 1.00 ? 72  ASN A ND2  1  
ATOM 785   H H    . ASN A 1 52  ? 5.234   7.616   9.738   1.00 1.00 ? 72  ASN A H    1  
ATOM 786   H HA   . ASN A 1 52  ? 5.440   10.391  9.985   1.00 1.00 ? 72  ASN A HA   1  
ATOM 787   H HB2  . ASN A 1 52  ? 6.152   10.322  7.514   1.00 0.00 ? 72  ASN A HB2  1  
ATOM 788   H HB3  . ASN A 1 52  ? 4.542   9.786   7.115   1.00 1.00 ? 72  ASN A HB3  1  
ATOM 789   H HD21 . ASN A 1 52  ? 3.756   11.931  9.452   1.00 0.00 ? 72  ASN A HD21 1  
ATOM 790   H HD22 . ASN A 1 52  ? 3.977   13.468  8.573   1.00 0.00 ? 72  ASN A HD22 1  
ATOM 791   N N    . TYR A 1 53  ? 2.781   8.547   9.170   1.00 1.00 ? 73  TYR A N    1  
ATOM 792   C CA   . TYR A 1 53  ? 1.372   8.166   9.413   1.00 1.00 ? 73  TYR A CA   1  
ATOM 793   C C    . TYR A 1 53  ? 0.315   9.300   9.385   1.00 1.00 ? 73  TYR A C    1  
ATOM 794   O O    . TYR A 1 53  ? -0.783  9.142   9.916   1.00 1.00 ? 73  TYR A O    1  
ATOM 795   C CB   . TYR A 1 53  ? 1.332   7.256   10.656  1.00 1.00 ? 73  TYR A CB   1  
ATOM 796   C CG   . TYR A 1 53  ? 2.179   6.004   10.499  1.00 1.00 ? 73  TYR A CG   1  
ATOM 797   C CD1  . TYR A 1 53  ? 1.734   4.939   9.682   1.00 1.00 ? 73  TYR A CD1  1  
ATOM 798   C CD2  . TYR A 1 53  ? 3.466   5.959   11.083  1.00 1.00 ? 73  TYR A CD2  1  
ATOM 799   C CE1  . TYR A 1 53  ? 2.573   3.824   9.451   1.00 1.00 ? 73  TYR A CE1  1  
ATOM 800   C CE2  . TYR A 1 53  ? 4.310   4.853   10.847  1.00 1.00 ? 73  TYR A CE2  1  
ATOM 801   C CZ   . TYR A 1 53  ? 3.865   3.788   10.025  1.00 1.00 ? 73  TYR A CZ   1  
ATOM 802   O OH   . TYR A 1 53  ? 4.713   2.769   9.732   1.00 1.00 ? 73  TYR A OH   1  
ATOM 803   H H    . TYR A 1 53  ? 3.325   7.861   8.674   1.00 1.00 ? 73  TYR A H    1  
ATOM 804   H HA   . TYR A 1 53  ? 1.078   7.534   8.574   1.00 1.00 ? 73  TYR A HA   1  
ATOM 805   H HB2  . TYR A 1 53  ? 1.753   7.759   11.526  1.00 0.00 ? 73  TYR A HB2  1  
ATOM 806   H HB3  . TYR A 1 53  ? 0.306   6.969   10.902  1.00 1.00 ? 73  TYR A HB3  1  
ATOM 807   H HD1  . TYR A 1 53  ? 0.764   4.986   9.205   1.00 1.00 ? 73  TYR A HD1  1  
ATOM 808   H HD2  . TYR A 1 53  ? 3.812   6.780   11.695  1.00 1.00 ? 73  TYR A HD2  1  
ATOM 809   H HE1  . TYR A 1 53  ? 2.256   3.009   8.817   1.00 1.00 ? 73  TYR A HE1  1  
ATOM 810   H HE2  . TYR A 1 53  ? 5.297   4.805   11.284  1.00 1.00 ? 73  TYR A HE2  1  
ATOM 811   H HH   . TYR A 1 53  ? 5.622   3.140   9.658   1.00 1.00 ? 73  TYR A HH   1  
ATOM 812   N N    . SER A 1 54  ? 0.629   10.407  8.687   1.00 1.00 ? 74  SER A N    1  
ATOM 813   C CA   . SER A 1 54  ? -0.183  11.622  8.484   1.00 1.00 ? 74  SER A CA   1  
ATOM 814   C C    . SER A 1 54  ? -1.631  11.368  8.028   1.00 1.00 ? 74  SER A C    1  
ATOM 815   O O    . SER A 1 54  ? -2.505  12.161  8.379   1.00 1.00 ? 74  SER A O    1  
ATOM 816   C CB   . SER A 1 54  ? 0.527   12.530  7.478   1.00 1.00 ? 74  SER A CB   1  
ATOM 817   O OG   . SER A 1 54  ? 0.231   13.888  7.680   1.00 1.00 ? 74  SER A OG   1  
ATOM 818   H H    . SER A 1 54  ? 1.585   10.416  8.367   1.00 1.00 ? 74  SER A H    1  
ATOM 819   H HA   . SER A 1 54  ? -0.229  12.144  9.442   1.00 1.00 ? 74  SER A HA   1  
ATOM 820   H HB2  . SER A 1 54  ? 1.608   12.448  7.585   1.00 0.00 ? 74  SER A HB2  1  
ATOM 821   H HB3  . SER A 1 54  ? 0.261   12.254  6.461   1.00 1.00 ? 74  SER A HB3  1  
ATOM 822   H HG   . SER A 1 54  ? -0.708  13.952  7.919   1.00 1.00 ? 74  SER A HG   1  
ATOM 823   N N    . ALA A 1 55  ? -1.880  10.278  7.281   1.00 1.00 ? 75  ALA A N    1  
ATOM 824   C CA   . ALA A 1 55  ? -3.186  9.756   6.878   1.00 1.00 ? 75  ALA A CA   1  
ATOM 825   C C    . ALA A 1 55  ? -4.003  10.688  5.955   1.00 1.00 ? 75  ALA A C    1  
ATOM 826   O O    . ALA A 1 55  ? -4.072  10.416  4.758   1.00 1.00 ? 75  ALA A O    1  
ATOM 827   C CB   . ALA A 1 55  ? -3.961  9.233   8.106   1.00 1.00 ? 75  ALA A CB   1  
ATOM 828   H H    . ALA A 1 55  ? -1.066  9.800   6.891   1.00 1.00 ? 75  ALA A H    1  
ATOM 829   H HA   . ALA A 1 55  ? -2.951  8.872   6.304   1.00 1.00 ? 75  ALA A HA   1  
ATOM 830   H HB1  . ALA A 1 55  ? -3.344  8.537   8.674   1.00 1.00 ? 75  ALA A HB1  1  
ATOM 831   H HB2  . ALA A 1 55  ? -4.245  10.052  8.768   1.00 1.00 ? 75  ALA A HB2  1  
ATOM 832   H HB3  . ALA A 1 55  ? -4.865  8.718   7.780   1.00 1.00 ? 75  ALA A HB3  1  
ATOM 833   N N    . GLU A 1 56  ? -4.582  11.754  6.531   1.00 1.00 ? 76  GLU A N    1  
ATOM 834   C CA   . GLU A 1 56  ? -5.351  12.875  5.960   1.00 1.00 ? 76  GLU A CA   1  
ATOM 835   C C    . GLU A 1 56  ? -6.231  12.550  4.728   1.00 1.00 ? 76  GLU A C    1  
ATOM 836   O O    . GLU A 1 56  ? -5.748  12.542  3.595   1.00 1.00 ? 76  GLU A O    1  
ATOM 837   C CB   . GLU A 1 56  ? -4.377  14.048  5.713   1.00 1.00 ? 76  GLU A CB   1  
ATOM 838   C CG   . GLU A 1 56  ? -4.978  15.390  5.271   1.00 1.00 ? 76  GLU A CG   1  
ATOM 839   C CD   . GLU A 1 56  ? -6.250  15.803  6.005   1.00 1.00 ? 76  GLU A CD   1  
ATOM 840   O OE1  . GLU A 1 56  ? -6.174  16.145  7.205   1.00 1.00 ? 76  GLU A OE1  1  
ATOM 841   O OE2  . GLU A 1 56  ? -7.301  15.780  5.328   1.00 1.00 ? 76  GLU A OE2  1  
ATOM 842   H H    . GLU A 1 56  ? -4.255  11.883  7.484   1.00 1.00 ? 76  GLU A H    1  
ATOM 843   H HA   . GLU A 1 56  ? -6.028  13.207  6.749   1.00 1.00 ? 76  GLU A HA   1  
ATOM 844   H HB2  . GLU A 1 56  ? -3.850  14.238  6.648   1.00 0.00 ? 76  GLU A HB2  1  
ATOM 845   H HB3  . GLU A 1 56  ? -3.602  13.758  4.999   1.00 1.00 ? 76  GLU A HB3  1  
ATOM 846   H HG2  . GLU A 1 56  ? -4.224  16.178  5.319   1.00 1.00 ? 76  GLU A HG2  1  
ATOM 847   H HG3  . GLU A 1 56  ? -5.222  15.319  4.212   1.00 0.00 ? 76  GLU A HG3  1  
ATOM 848   N N    . LEU A 1 57  ? -7.545  12.342  4.922   1.00 1.00 ? 77  LEU A N    1  
ATOM 849   C CA   . LEU A 1 57  ? -8.521  12.138  3.861   1.00 1.00 ? 77  LEU A CA   1  
ATOM 850   C C    . LEU A 1 57  ? -9.786  13.004  4.019   1.00 1.00 ? 77  LEU A C    1  
ATOM 851   O O    . LEU A 1 57  ? -10.088 13.530  5.092   1.00 1.00 ? 77  LEU A O    1  
ATOM 852   C CB   . LEU A 1 57  ? -8.770  10.623  3.715   1.00 1.00 ? 77  LEU A CB   1  
ATOM 853   C CG   . LEU A 1 57  ? -9.602  9.777   4.698   1.00 1.00 ? 77  LEU A CG   1  
ATOM 854   C CD1  . LEU A 1 57  ? -8.823  9.405   5.951   1.00 1.00 ? 77  LEU A CD1  1  
ATOM 855   C CD2  . LEU A 1 57  ? -10.942 10.418  5.081   1.00 1.00 ? 77  LEU A CD2  1  
ATOM 856   H H    . LEU A 1 57  ? -7.975  12.346  5.834   1.00 1.00 ? 77  LEU A H    1  
ATOM 857   H HA   . LEU A 1 57  ? -8.070  12.461  2.924   1.00 1.00 ? 77  LEU A HA   1  
ATOM 858   H HB2  . LEU A 1 57  ? -9.501  10.432  2.930   1.00 0.00 ? 77  LEU A HB2  1  
ATOM 859   H HB3  . LEU A 1 57  ? -7.843  10.109  3.458   1.00 1.00 ? 77  LEU A HB3  1  
ATOM 860   H HG   . LEU A 1 57  ? -9.825  8.841   4.187   1.00 1.00 ? 77  LEU A HG   1  
ATOM 861   H HD11 . LEU A 1 57  ? -7.889  8.915   5.683   1.00 1.00 ? 77  LEU A HD11 1  
ATOM 862   H HD12 . LEU A 1 57  ? -8.596  10.290  6.542   1.00 1.00 ? 77  LEU A HD12 1  
ATOM 863   H HD13 . LEU A 1 57  ? -9.407  8.714   6.559   1.00 1.00 ? 77  LEU A HD13 1  
ATOM 864   H HD21 . LEU A 1 57  ? -11.381 10.917  4.238   1.00 1.00 ? 77  LEU A HD21 1  
ATOM 865   H HD22 . LEU A 1 57  ? -11.624 9.654   5.439   1.00 1.00 ? 77  LEU A HD22 1  
ATOM 866   H HD23 . LEU A 1 57  ? -10.796 11.144  5.884   1.00 1.00 ? 77  LEU A HD23 1  
ATOM 867   N N    . ARG A 1 58  ? -10.572 13.089  2.937   1.00 1.00 ? 78  ARG A N    1  
ATOM 868   C CA   . ARG A 1 58  ? -11.862 13.791  2.829   1.00 1.00 ? 78  ARG A CA   1  
ATOM 869   C C    . ARG A 1 58  ? -12.969 12.792  2.433   1.00 1.00 ? 78  ARG A C    1  
ATOM 870   O O    . ARG A 1 58  ? -13.300 12.647  1.263   1.00 1.00 ? 78  ARG A O    1  
ATOM 871   C CB   . ARG A 1 58  ? -11.652 14.948  1.835   1.00 1.00 ? 78  ARG A CB   1  
ATOM 872   C CG   . ARG A 1 58  ? -11.398 16.304  2.500   1.00 1.00 ? 78  ARG A CG   1  
ATOM 873   C CD   . ARG A 1 58  ? -12.413 17.372  2.079   1.00 1.00 ? 78  ARG A CD   1  
ATOM 874   N NE   . ARG A 1 58  ? -13.779 17.026  2.506   1.00 1.00 ? 78  ARG A NE   1  
ATOM 875   C CZ   . ARG A 1 58  ? -14.677 17.818  3.057   1.00 1.00 ? 78  ARG A CZ   1  
ATOM 876   N NH1  . ARG A 1 58  ? -14.489 19.097  3.204   1.00 1.00 ? 78  ARG A NH1  1  
ATOM 877   N NH2  . ARG A 1 58  ? -15.809 17.328  3.463   1.00 1.00 ? 78  ARG A NH2  1  
ATOM 878   H H    . ARG A 1 58  ? -10.223 12.577  2.124   1.00 1.00 ? 78  ARG A H    1  
ATOM 879   H HA   . ARG A 1 58  ? -12.143 14.217  3.799   1.00 1.00 ? 78  ARG A HA   1  
ATOM 880   H HB2  . ARG A 1 58  ? -10.724 14.837  1.273   1.00 0.00 ? 78  ARG A HB2  1  
ATOM 881   H HB3  . ARG A 1 58  ? -12.457 15.009  1.108   1.00 1.00 ? 78  ARG A HB3  1  
ATOM 882   H HG2  . ARG A 1 58  ? -11.516 16.221  3.581   1.00 0.00 ? 78  ARG A HG2  1  
ATOM 883   H HG3  . ARG A 1 58  ? -10.385 16.646  2.283   1.00 1.00 ? 78  ARG A HG3  1  
ATOM 884   H HD2  . ARG A 1 58  ? -12.173 18.320  2.561   1.00 0.00 ? 78  ARG A HD2  1  
ATOM 885   H HD3  . ARG A 1 58  ? -12.383 17.504  0.995   1.00 1.00 ? 78  ARG A HD3  1  
ATOM 886   H HE   . ARG A 1 58  ? -14.074 16.078  2.364   1.00 1.00 ? 78  ARG A HE   1  
ATOM 887   H HH11 . ARG A 1 58  ? -13.611 19.529  2.884   1.00 0.00 ? 78  ARG A HH11 1  
ATOM 888   H HH12 . ARG A 1 58  ? -15.220 19.677  3.641   1.00 0.00 ? 78  ARG A HH12 1  
ATOM 889   H HH21 . ARG A 1 58  ? -16.005 16.323  3.354   1.00 0.00 ? 78  ARG A HH21 1  
ATOM 890   H HH22 . ARG A 1 58  ? -16.512 17.945  3.895   1.00 0.00 ? 78  ARG A HH22 1  
ATOM 891   N N    . ASN A 1 59  ? -13.547 12.086  3.414   1.00 1.00 ? 79  ASN A N    1  
ATOM 892   C CA   . ASN A 1 59  ? -14.515 11.002  3.224   1.00 1.00 ? 79  ASN A CA   1  
ATOM 893   C C    . ASN A 1 59  ? -13.920 9.716   2.599   1.00 1.00 ? 79  ASN A C    1  
ATOM 894   O O    . ASN A 1 59  ? -14.687 8.805   2.293   1.00 1.00 ? 79  ASN A O    1  
ATOM 895   C CB   . ASN A 1 59  ? -15.780 11.547  2.528   1.00 1.00 ? 79  ASN A CB   1  
ATOM 896   C CG   . ASN A 1 59  ? -17.109 10.902  2.911   1.00 1.00 ? 79  ASN A CG   1  
ATOM 897   O OD1  . ASN A 1 59  ? -18.055 11.580  3.273   1.00 1.00 ? 79  ASN A OD1  1  
ATOM 898   N ND2  . ASN A 1 59  ? -17.233 9.599   2.815   1.00 1.00 ? 79  ASN A ND2  1  
ATOM 899   H H    . ASN A 1 59  ? -13.142 12.128  4.336   1.00 1.00 ? 79  ASN A H    1  
ATOM 900   H HA   . ASN A 1 59  ? -14.820 10.708  4.230   1.00 1.00 ? 79  ASN A HA   1  
ATOM 901   H HB2  . ASN A 1 59  ? -15.931 12.591  2.800   1.00 0.00 ? 79  ASN A HB2  1  
ATOM 902   H HB3  . ASN A 1 59  ? -15.669 11.473  1.456   1.00 1.00 ? 79  ASN A HB3  1  
ATOM 903   H HD21 . ASN A 1 59  ? -16.441 9.028   2.487   1.00 0.00 ? 79  ASN A HD21 1  
ATOM 904   H HD22 . ASN A 1 59  ? -18.123 9.146   3.068   1.00 0.00 ? 79  ASN A HD22 1  
ATOM 905   N N    . ALA A 1 60  ? -12.580 9.577   2.430   1.00 1.00 ? 80  ALA A N    1  
ATOM 906   C CA   . ALA A 1 60  ? -11.956 8.284   2.068   1.00 1.00 ? 80  ALA A CA   1  
ATOM 907   C C    . ALA A 1 60  ? -11.995 7.225   3.218   1.00 1.00 ? 80  ALA A C    1  
ATOM 908   O O    . ALA A 1 60  ? -11.310 6.206   3.172   1.00 1.00 ? 80  ALA A O    1  
ATOM 909   C CB   . ALA A 1 60  ? -10.588 8.472   1.427   1.00 1.00 ? 80  ALA A CB   1  
ATOM 910   H H    . ALA A 1 60  ? -11.949 10.306  2.762   1.00 1.00 ? 80  ALA A H    1  
ATOM 911   H HA   . ALA A 1 60  ? -12.562 7.842   1.291   1.00 1.00 ? 80  ALA A HA   1  
ATOM 912   H HB1  . ALA A 1 60  ? -10.009 9.230   1.936   1.00 1.00 ? 80  ALA A HB1  1  
ATOM 913   H HB2  . ALA A 1 60  ? -10.069 7.530   1.459   1.00 1.00 ? 80  ALA A HB2  1  
ATOM 914   H HB3  . ALA A 1 60  ? -10.662 8.705   0.374   1.00 1.00 ? 80  ALA A HB3  1  
ATOM 915   N N    . THR A 1 61  ? -12.824 7.526   4.225   1.00 1.00 ? 81  THR A N    1  
ATOM 916   C CA   . THR A 1 61  ? -13.256 6.640   5.333   1.00 1.00 ? 81  THR A CA   1  
ATOM 917   C C    . THR A 1 61  ? -14.662 6.162   4.906   1.00 1.00 ? 81  THR A C    1  
ATOM 918   O O    . THR A 1 61  ? -15.606 6.956   4.899   1.00 1.00 ? 81  THR A O    1  
ATOM 919   C CB   . THR A 1 61  ? -13.341 7.438   6.660   1.00 1.00 ? 81  THR A CB   1  
ATOM 920   O OG1  . THR A 1 61  ? -12.072 7.872   7.079   1.00 1.00 ? 81  THR A OG1  1  
ATOM 921   C CG2  . THR A 1 61  ? -13.910 6.658   7.849   1.00 1.00 ? 81  THR A CG2  1  
ATOM 922   H H    . THR A 1 61  ? -13.183 8.464   4.065   1.00 1.00 ? 81  THR A H    1  
ATOM 923   H HA   . THR A 1 61  ? -12.580 5.799   5.450   1.00 1.00 ? 81  THR A HA   1  
ATOM 924   H HB   . THR A 1 61  ? -13.971 8.318   6.503   1.00 1.00 ? 81  THR A HB   1  
ATOM 925   H HG1  . THR A 1 61  ? -11.651 7.158   7.561   1.00 1.00 ? 81  THR A HG1  1  
ATOM 926   H HG21 . THR A 1 61  ? -14.912 6.288   7.613   1.00 1.00 ? 81  THR A HG21 1  
ATOM 927   H HG22 . THR A 1 61  ? -13.269 5.821   8.113   1.00 1.00 ? 81  THR A HG22 1  
ATOM 928   H HG23 . THR A 1 61  ? -14.002 7.317   8.714   1.00 1.00 ? 81  THR A HG23 1  
ATOM 929   N N    . ALA A 1 62  ? -14.805 4.868   4.562   1.00 1.00 ? 82  ALA A N    1  
ATOM 930   C CA   . ALA A 1 62  ? -16.030 4.303   3.996   1.00 1.00 ? 82  ALA A CA   1  
ATOM 931   C C    . ALA A 1 62  ? -16.310 2.862   4.460   1.00 1.00 ? 82  ALA A C    1  
ATOM 932   O O    . ALA A 1 62  ? -15.494 1.965   4.257   1.00 1.00 ? 82  ALA A O    1  
ATOM 933   C CB   . ALA A 1 62  ? -15.944 4.431   2.468   1.00 1.00 ? 82  ALA A CB   1  
ATOM 934   H H    . ALA A 1 62  ? -14.005 4.246   4.598   1.00 1.00 ? 82  ALA A H    1  
ATOM 935   H HA   . ALA A 1 62  ? -16.875 4.922   4.313   1.00 1.00 ? 82  ALA A HA   1  
ATOM 936   H HB1  . ALA A 1 62  ? -15.681 5.453   2.188   1.00 1.00 ? 82  ALA A HB1  1  
ATOM 937   H HB2  . ALA A 1 62  ? -15.203 3.746   2.062   1.00 1.00 ? 82  ALA A HB2  1  
ATOM 938   H HB3  . ALA A 1 62  ? -16.921 4.214   2.047   1.00 1.00 ? 82  ALA A HB3  1  
ATOM 939   N N    . ALA A 1 63  ? -17.499 2.622   5.025   1.00 1.00 ? 83  ALA A N    1  
ATOM 940   C CA   . ALA A 1 63  ? -17.965 1.309   5.494   1.00 1.00 ? 83  ALA A CA   1  
ATOM 941   C C    . ALA A 1 63  ? -18.764 0.522   4.415   1.00 1.00 ? 83  ALA A C    1  
ATOM 942   O O    . ALA A 1 63  ? -19.335 1.096   3.484   1.00 1.00 ? 83  ALA A O    1  
ATOM 943   C CB   . ALA A 1 63  ? -18.779 1.513   6.785   1.00 1.00 ? 83  ALA A CB   1  
ATOM 944   H H    . ALA A 1 63  ? -18.063 3.434   5.193   1.00 1.00 ? 83  ALA A H    1  
ATOM 945   H HA   . ALA A 1 63  ? -17.095 0.711   5.761   1.00 1.00 ? 83  ALA A HA   1  
ATOM 946   H HB1  . ALA A 1 63  ? -18.165 1.998   7.548   1.00 1.00 ? 83  ALA A HB1  1  
ATOM 947   H HB2  . ALA A 1 63  ? -19.657 2.127   6.588   1.00 1.00 ? 83  ALA A HB2  1  
ATOM 948   H HB3  . ALA A 1 63  ? -19.100 0.545   7.175   1.00 1.00 ? 83  ALA A HB3  1  
ATOM 949   N N    . MET A 1 64  ? -18.793 -0.814  4.545   1.00 1.00 ? 84  MET A N    1  
ATOM 950   C CA   . MET A 1 64  ? -19.409 -1.814  3.662   1.00 1.00 ? 84  MET A CA   1  
ATOM 951   C C    . MET A 1 64  ? -20.325 -2.698  4.518   1.00 1.00 ? 84  MET A C    1  
ATOM 952   O O    . MET A 1 64  ? -19.971 -2.988  5.671   1.00 1.00 ? 84  MET A O    1  
ATOM 953   C CB   . MET A 1 64  ? -18.326 -2.694  3.024   1.00 1.00 ? 84  MET A CB   1  
ATOM 954   C CG   . MET A 1 64  ? -17.191 -1.969  2.294   1.00 1.00 ? 84  MET A CG   1  
ATOM 955   S SD   . MET A 1 64  ? -15.771 -3.024  1.900   1.00 1.00 ? 84  MET A SD   1  
ATOM 956   C CE   . MET A 1 64  ? -16.550 -4.218  0.792   1.00 1.00 ? 84  MET A CE   1  
ATOM 957   H H    . MET A 1 64  ? -18.326 -1.253  5.344   1.00 1.00 ? 84  MET A H    1  
ATOM 958   H HA   . MET A 1 64  ? -19.989 -1.321  2.880   1.00 1.00 ? 84  MET A HA   1  
ATOM 959   H HB2  . MET A 1 64  ? -17.865 -3.280  3.819   1.00 0.00 ? 84  MET A HB2  1  
ATOM 960   H HB3  . MET A 1 64  ? -18.793 -3.412  2.347   1.00 1.00 ? 84  MET A HB3  1  
ATOM 961   H HG2  . MET A 1 64  ? -17.583 -1.575  1.356   1.00 0.00 ? 84  MET A HG2  1  
ATOM 962   H HG3  . MET A 1 64  ? -16.832 -1.125  2.887   1.00 1.00 ? 84  MET A HG3  1  
ATOM 963   H HE1  . MET A 1 64  ? -17.214 -3.711  0.094   1.00 1.00 ? 84  MET A HE1  1  
ATOM 964   H HE2  . MET A 1 64  ? -15.768 -4.726  0.237   1.00 1.00 ? 84  MET A HE2  1  
ATOM 965   H HE3  . MET A 1 64  ? -17.117 -4.941  1.375   1.00 1.00 ? 84  MET A HE3  1  
ATOM 966   N N    . LYS A 1 65  ? -21.429 -3.205  3.931   1.00 1.00 ? 85  LYS A N    1  
ATOM 967   C CA   . LYS A 1 65  ? -22.526 -3.905  4.647   1.00 1.00 ? 85  LYS A CA   1  
ATOM 968   C C    . LYS A 1 65  ? -22.865 -5.291  4.082   1.00 1.00 ? 85  LYS A C    1  
ATOM 969   O O    . LYS A 1 65  ? -22.455 -6.290  4.652   1.00 1.00 ? 85  LYS A O    1  
ATOM 970   C CB   . LYS A 1 65  ? -23.743 -2.971  4.802   1.00 1.00 ? 85  LYS A CB   1  
ATOM 971   C CG   . LYS A 1 65  ? -24.280 -2.333  3.509   1.00 1.00 ? 85  LYS A CG   1  
ATOM 972   C CD   . LYS A 1 65  ? -25.291 -1.237  3.846   1.00 1.00 ? 85  LYS A CD   1  
ATOM 973   C CE   . LYS A 1 65  ? -26.084 -0.805  2.616   1.00 1.00 ? 85  LYS A CE   1  
ATOM 974   N NZ   . LYS A 1 65  ? -27.013 0.293   2.952   1.00 1.00 ? 85  LYS A NZ   1  
ATOM 975   H H    . LYS A 1 65  ? -21.478 -3.132  2.917   1.00 1.00 ? 85  LYS A H    1  
ATOM 976   H HA   . LYS A 1 65  ? -22.186 -4.101  5.669   1.00 1.00 ? 85  LYS A HA   1  
ATOM 977   H HB2  . LYS A 1 65  ? -24.588 -3.561  5.156   1.00 0.00 ? 85  LYS A HB2  1  
ATOM 978   H HB3  . LYS A 1 65  ? -23.491 -2.193  5.526   1.00 1.00 ? 85  LYS A HB3  1  
ATOM 979   H HG2  . LYS A 1 65  ? -23.462 -1.882  2.948   1.00 0.00 ? 85  LYS A HG2  1  
ATOM 980   H HG3  . LYS A 1 65  ? -24.757 -3.091  2.890   1.00 1.00 ? 85  LYS A HG3  1  
ATOM 981   H HD2  . LYS A 1 65  ? -26.015 -1.628  4.562   1.00 0.00 ? 85  LYS A HD2  1  
ATOM 982   H HD3  . LYS A 1 65  ? -24.763 -0.386  4.279   1.00 1.00 ? 85  LYS A HD3  1  
ATOM 983   H HE2  . LYS A 1 65  ? -25.390 -0.422  1.868   1.00 0.00 ? 85  LYS A HE2  1  
ATOM 984   H HE3  . LYS A 1 65  ? -26.623 -1.673  2.222   1.00 1.00 ? 85  LYS A HE3  1  
ATOM 985   H HZ1  . LYS A 1 65  ? -27.223 0.269   3.960   1.00 0.00 ? 85  LYS A HZ1  1  
ATOM 986   H HZ2  . LYS A 1 65  ? -26.577 1.196   2.714   1.00 0.00 ? 85  LYS A HZ2  1  
ATOM 987   N N    . ASN A 1 66  ? -23.514 -5.393  2.918   1.00 1.00 ? 86  ASN A N    1  
ATOM 988   C CA   . ASN A 1 66  ? -23.761 -6.650  2.183   1.00 1.00 ? 86  ASN A CA   1  
ATOM 989   C C    . ASN A 1 66  ? -22.458 -7.189  1.523   1.00 1.00 ? 86  ASN A C    1  
ATOM 990   O O    . ASN A 1 66  ? -22.478 -7.740  0.426   1.00 1.00 ? 86  ASN A O    1  
ATOM 991   C CB   . ASN A 1 66  ? -24.908 -6.396  1.189   1.00 1.00 ? 86  ASN A CB   1  
ATOM 992   C CG   . ASN A 1 66  ? -26.226 -6.051  1.870   1.00 1.00 ? 86  ASN A CG   1  
ATOM 993   O OD1  . ASN A 1 66  ? -26.564 -4.895  2.063   1.00 1.00 ? 86  ASN A OD1  1  
ATOM 994   N ND2  . ASN A 1 66  ? -27.009 -7.028  2.268   1.00 1.00 ? 86  ASN A ND2  1  
ATOM 995   H H    . ASN A 1 66  ? -23.783 -4.533  2.483   1.00 1.00 ? 86  ASN A H    1  
ATOM 996   H HA   . ASN A 1 66  ? -24.085 -7.422  2.888   1.00 1.00 ? 86  ASN A HA   1  
ATOM 997   H HB2  . ASN A 1 66  ? -24.676 -5.535  0.562   1.00 0.00 ? 86  ASN A HB2  1  
ATOM 998   H HB3  . ASN A 1 66  ? -25.050 -7.267  0.552   1.00 1.00 ? 86  ASN A HB3  1  
ATOM 999   H HD21 . ASN A 1 66  ? -26.728 -8.008  2.118   1.00 0.00 ? 86  ASN A HD21 1  
ATOM 1000  H HD22 . ASN A 1 66  ? -27.905 -6.815  2.730   1.00 0.00 ? 86  ASN A HD22 1  
ATOM 1001  N N    . GLN A 1 67  ? -21.310 -6.964  2.187   1.00 1.00 ? 87  GLN A N    1  
ATOM 1002  C CA   . GLN A 1 67  ? -19.925 -7.227  1.763   1.00 1.00 ? 87  GLN A CA   1  
ATOM 1003  C C    . GLN A 1 67  ? -19.476 -6.440  0.502   1.00 1.00 ? 87  GLN A C    1  
ATOM 1004  O O    . GLN A 1 67  ? -18.431 -6.726  -0.086  1.00 1.00 ? 87  GLN A O    1  
ATOM 1005  C CB   . GLN A 1 67  ? -19.726 -8.759  1.748   1.00 1.00 ? 87  GLN A CB   1  
ATOM 1006  C CG   . GLN A 1 67  ? -19.497 -9.282  3.183   1.00 1.00 ? 87  GLN A CG   1  
ATOM 1007  C CD   . GLN A 1 67  ? -19.238 -10.779 3.313   1.00 1.00 ? 87  GLN A CD   1  
ATOM 1008  O OE1  . GLN A 1 67  ? -18.672 -11.448 2.457   1.00 1.00 ? 87  GLN A OE1  1  
ATOM 1009  N NE2  . GLN A 1 67  ? -19.625 -11.387 4.417   1.00 1.00 ? 87  GLN A NE2  1  
ATOM 1010  H H    . GLN A 1 67  ? -21.464 -6.571  3.108   1.00 1.00 ? 87  GLN A H    1  
ATOM 1011  H HA   . GLN A 1 67  ? -19.267 -6.842  2.538   1.00 1.00 ? 87  GLN A HA   1  
ATOM 1012  H HB2  . GLN A 1 67  ? -20.616 -9.269  1.380   1.00 0.00 ? 87  GLN A HB2  1  
ATOM 1013  H HB3  . GLN A 1 67  ? -18.894 -9.042  1.105   1.00 1.00 ? 87  GLN A HB3  1  
ATOM 1014  H HG2  . GLN A 1 67  ? -18.587 -8.840  3.588   1.00 0.00 ? 87  GLN A HG2  1  
ATOM 1015  H HG3  . GLN A 1 67  ? -20.346 -9.007  3.808   1.00 1.00 ? 87  GLN A HG3  1  
ATOM 1016  H HE21 . GLN A 1 67  ? -20.089 -10.851 5.164   1.00 0.00 ? 87  GLN A HE21 1  
ATOM 1017  H HE22 . GLN A 1 67  ? -19.463 -12.398 4.532   1.00 0.00 ? 87  GLN A HE22 1  
ATOM 1018  N N    . VAL A 1 68  ? -20.255 -5.411  0.114   1.00 1.00 ? 88  VAL A N    1  
ATOM 1019  C CA   . VAL A 1 68  ? -20.100 -4.494  -1.035  1.00 1.00 ? 88  VAL A CA   1  
ATOM 1020  C C    . VAL A 1 68  ? -20.307 -3.011  -0.637  1.00 1.00 ? 88  VAL A C    1  
ATOM 1021  O O    . VAL A 1 68  ? -21.054 -2.721  0.304   1.00 1.00 ? 88  VAL A O    1  
ATOM 1022  C CB   . VAL A 1 68  ? -21.074 -4.872  -2.189  1.00 1.00 ? 88  VAL A CB   1  
ATOM 1023  C CG1  . VAL A 1 68  ? -20.836 -6.292  -2.734  1.00 1.00 ? 88  VAL A CG1  1  
ATOM 1024  C CG2  . VAL A 1 68  ? -22.569 -4.730  -1.826  1.00 1.00 ? 88  VAL A CG2  1  
ATOM 1025  H H    . VAL A 1 68  ? -21.011 -5.169  0.741   1.00 1.00 ? 88  VAL A H    1  
ATOM 1026  H HA   . VAL A 1 68  ? -19.082 -4.602  -1.414  1.00 1.00 ? 88  VAL A HA   1  
ATOM 1027  H HB   . VAL A 1 68  ? -20.875 -4.183  -3.011  1.00 1.00 ? 88  VAL A HB   1  
ATOM 1028  H HG11 . VAL A 1 68  ? -19.790 -6.418  -3.005  1.00 1.00 ? 88  VAL A HG11 1  
ATOM 1029  H HG12 . VAL A 1 68  ? -21.097 -7.039  -1.982  1.00 1.00 ? 88  VAL A HG12 1  
ATOM 1030  H HG13 . VAL A 1 68  ? -21.450 -6.461  -3.618  1.00 1.00 ? 88  VAL A HG13 1  
ATOM 1031  H HG21 . VAL A 1 68  ? -22.797 -3.710  -1.520  1.00 1.00 ? 88  VAL A HG21 1  
ATOM 1032  H HG22 . VAL A 1 68  ? -23.186 -4.974  -2.692  1.00 1.00 ? 88  VAL A HG22 1  
ATOM 1033  H HG23 . VAL A 1 68  ? -22.830 -5.409  -1.012  1.00 1.00 ? 88  VAL A HG23 1  
ATOM 1034  N N    . ALA A 1 69  ? -19.675 -2.082  -1.372  1.00 1.00 ? 89  ALA A N    1  
ATOM 1035  C CA   . ALA A 1 69  ? -19.885 -0.621  -1.302  1.00 1.00 ? 89  ALA A CA   1  
ATOM 1036  C C    . ALA A 1 69  ? -19.927 0.076   -2.690  1.00 1.00 ? 89  ALA A C    1  
ATOM 1037  O O    . ALA A 1 69  ? -19.206 -0.326  -3.606  1.00 1.00 ? 89  ALA A O    1  
ATOM 1038  C CB   . ALA A 1 69  ? -18.861 0.024   -0.371  1.00 1.00 ? 89  ALA A CB   1  
ATOM 1039  H H    . ALA A 1 69  ? -18.976 -2.433  -2.018  1.00 1.00 ? 89  ALA A H    1  
ATOM 1040  H HA   . ALA A 1 69  ? -20.866 -0.465  -0.841  1.00 1.00 ? 89  ALA A HA   1  
ATOM 1041  H HB1  . ALA A 1 69  ? -18.696 -0.592  0.515   1.00 1.00 ? 89  ALA A HB1  1  
ATOM 1042  H HB2  . ALA A 1 69  ? -17.932 0.170   -0.908  1.00 1.00 ? 89  ALA A HB2  1  
ATOM 1043  H HB3  . ALA A 1 69  ? -19.232 0.996   -0.052  1.00 1.00 ? 89  ALA A HB3  1  
ATOM 1044  N N    . ARG A 1 70  ? -20.736 1.148   -2.816  1.00 1.00 ? 90  ARG A N    1  
ATOM 1045  C CA   . ARG A 1 70  ? -20.923 2.023   -4.001  1.00 1.00 ? 90  ARG A CA   1  
ATOM 1046  C C    . ARG A 1 70  ? -20.861 3.522   -3.610  1.00 1.00 ? 90  ARG A C    1  
ATOM 1047  O O    . ARG A 1 70  ? -21.608 3.944   -2.724  1.00 1.00 ? 90  ARG A O    1  
ATOM 1048  C CB   . ARG A 1 70  ? -22.256 1.660   -4.696  1.00 1.00 ? 90  ARG A CB   1  
ATOM 1049  C CG   . ARG A 1 70  ? -23.489 1.862   -3.799  1.00 1.00 ? 90  ARG A CG   1  
ATOM 1050  C CD   . ARG A 1 70  ? -24.717 1.004   -4.113  1.00 1.00 ? 90  ARG A CD   1  
ATOM 1051  N NE   . ARG A 1 70  ? -25.780 1.221   -3.110  1.00 1.00 ? 90  ARG A NE   1  
ATOM 1052  C CZ   . ARG A 1 70  ? -26.370 0.349   -2.308  1.00 1.00 ? 90  ARG A CZ   1  
ATOM 1053  N NH1  . ARG A 1 70  ? -26.113 -0.928  -2.309  1.00 1.00 ? 90  ARG A NH1  1  
ATOM 1054  N NH2  . ARG A 1 70  ? -27.275 0.748   -1.462  1.00 1.00 ? 90  ARG A NH2  1  
ATOM 1055  H H    . ARG A 1 70  ? -21.262 1.412   -1.994  1.00 1.00 ? 90  ARG A H    1  
ATOM 1056  H HA   . ARG A 1 70  ? -20.113 1.834   -4.712  1.00 1.00 ? 90  ARG A HA   1  
ATOM 1057  H HB2  . ARG A 1 70  ? -22.437 2.347   -5.524  1.00 0.00 ? 90  ARG A HB2  1  
ATOM 1058  H HB3  . ARG A 1 70  ? -22.205 0.642   -5.079  1.00 1.00 ? 90  ARG A HB3  1  
ATOM 1059  H HG2  . ARG A 1 70  ? -23.252 1.543   -2.784  1.00 0.00 ? 90  ARG A HG2  1  
ATOM 1060  H HG3  . ARG A 1 70  ? -23.764 2.916   -3.796  1.00 1.00 ? 90  ARG A HG3  1  
ATOM 1061  H HD2  . ARG A 1 70  ? -25.150 1.312   -5.065  1.00 0.00 ? 90  ARG A HD2  1  
ATOM 1062  H HD3  . ARG A 1 70  ? -24.428 -0.046  -4.175  1.00 1.00 ? 90  ARG A HD3  1  
ATOM 1063  H HE   . ARG A 1 70  ? -26.095 2.169   -3.008  1.00 1.00 ? 90  ARG A HE   1  
ATOM 1064  H HH11 . ARG A 1 70  ? -25.415 -1.312  -2.961  1.00 0.00 ? 90  ARG A HH11 1  
ATOM 1065  H HH12 . ARG A 1 70  ? -26.609 -1.553  -1.659  1.00 0.00 ? 90  ARG A HH12 1  
ATOM 1066  H HH21 . ARG A 1 70  ? -27.534 1.744   -1.416  1.00 0.00 ? 90  ARG A HH21 1  
ATOM 1067  H HH22 . ARG A 1 70  ? -27.733 0.067   -0.839  1.00 0.00 ? 90  ARG A HH22 1  
ATOM 1068  N N    . PHE A 1 71  ? -19.960 4.305   -4.232  1.00 1.00 ? 91  PHE A N    1  
ATOM 1069  C CA   . PHE A 1 71  ? -19.697 5.725   -3.890  1.00 1.00 ? 91  PHE A CA   1  
ATOM 1070  C C    . PHE A 1 71  ? -18.756 6.488   -4.855  1.00 1.00 ? 91  PHE A C    1  
ATOM 1071  O O    . PHE A 1 71  ? -18.141 5.907   -5.751  1.00 1.00 ? 91  PHE A O    1  
ATOM 1072  C CB   . PHE A 1 71  ? -19.111 5.806   -2.462  1.00 1.00 ? 91  PHE A CB   1  
ATOM 1073  C CG   . PHE A 1 71  ? -18.196 4.689   -1.969  1.00 1.00 ? 91  PHE A CG   1  
ATOM 1074  C CD1  . PHE A 1 71  ? -17.104 4.252   -2.755  1.00 1.00 ? 91  PHE A CD1  1  
ATOM 1075  C CD2  . PHE A 1 71  ? -18.435 4.086   -0.712  1.00 1.00 ? 91  PHE A CD2  1  
ATOM 1076  C CE1  . PHE A 1 71  ? -16.232 3.254   -2.270  1.00 1.00 ? 91  PHE A CE1  1  
ATOM 1077  C CE2  . PHE A 1 71  ? -17.559 3.092   -0.229  1.00 1.00 ? 91  PHE A CE2  1  
ATOM 1078  C CZ   . PHE A 1 71  ? -16.442 2.700   -0.992  1.00 1.00 ? 91  PHE A CZ   1  
ATOM 1079  H H    . PHE A 1 71  ? -19.346 3.876   -4.915  1.00 1.00 ? 91  PHE A H    1  
ATOM 1080  H HA   . PHE A 1 71  ? -20.650 6.262   -3.888  1.00 1.00 ? 91  PHE A HA   1  
ATOM 1081  H HB2  . PHE A 1 71  ? -18.378 6.610   -2.407  1.00 0.00 ? 91  PHE A HB2  1  
ATOM 1082  H HB3  . PHE A 1 71  ? -19.909 6.001   -1.743  1.00 1.00 ? 91  PHE A HB3  1  
ATOM 1083  H HD1  . PHE A 1 71  ? -16.931 4.686   -3.727  1.00 1.00 ? 91  PHE A HD1  1  
ATOM 1084  H HD2  . PHE A 1 71  ? -19.277 4.398   -0.111  1.00 1.00 ? 91  PHE A HD2  1  
ATOM 1085  H HE1  . PHE A 1 71  ? -15.390 2.933   -2.867  1.00 1.00 ? 91  PHE A HE1  1  
ATOM 1086  H HE2  . PHE A 1 71  ? -17.736 2.637   0.737   1.00 1.00 ? 91  PHE A HE2  1  
ATOM 1087  H HZ   . PHE A 1 71  ? -15.746 1.979   -0.592  1.00 1.00 ? 91  PHE A HZ   1  
ATOM 1088  N N    . ASN A 1 72  ? -18.619 7.806   -4.636  1.00 1.00 ? 92  ASN A N    1  
ATOM 1089  C CA   . ASN A 1 72  ? -17.670 8.723   -5.321  1.00 1.00 ? 92  ASN A CA   1  
ATOM 1090  C C    . ASN A 1 72  ? -17.026 9.809   -4.403  1.00 1.00 ? 92  ASN A C    1  
ATOM 1091  O O    . ASN A 1 72  ? -16.246 10.651  -4.851  1.00 1.00 ? 92  ASN A O    1  
ATOM 1092  C CB   . ASN A 1 72  ? -18.380 9.342   -6.540  1.00 1.00 ? 92  ASN A CB   1  
ATOM 1093  C CG   . ASN A 1 72  ? -19.484 10.332  -6.196  1.00 1.00 ? 92  ASN A CG   1  
ATOM 1094  O OD1  . ASN A 1 72  ? -20.605 9.981   -5.874  1.00 1.00 ? 92  ASN A OD1  1  
ATOM 1095  N ND2  . ASN A 1 72  ? -19.185 11.606  -6.269  1.00 1.00 ? 92  ASN A ND2  1  
ATOM 1096  H H    . ASN A 1 72  ? -19.232 8.202   -3.923  1.00 1.00 ? 92  ASN A H    1  
ATOM 1097  H HA   . ASN A 1 72  ? -16.835 8.133   -5.702  1.00 1.00 ? 92  ASN A HA   1  
ATOM 1098  H HB2  . ASN A 1 72  ? -17.685 9.942   -7.128  1.00 0.00 ? 92  ASN A HB2  1  
ATOM 1099  H HB3  . ASN A 1 72  ? -18.789 8.563   -7.185  1.00 1.00 ? 92  ASN A HB3  1  
ATOM 1100  H HD21 . ASN A 1 72  ? -18.238 11.897  -6.551  1.00 0.00 ? 92  ASN A HD21 1  
ATOM 1101  H HD22 . ASN A 1 72  ? -19.897 12.316  -6.047  1.00 0.00 ? 92  ASN A HD22 1  
ATOM 1102  N N    . ASP A 1 73  ? -17.372 9.778   -3.113  1.00 1.00 ? 93  ASP A N    1  
ATOM 1103  C CA   . ASP A 1 73  ? -17.090 10.692  -2.004  1.00 1.00 ? 93  ASP A CA   1  
ATOM 1104  C C    . ASP A 1 73  ? -15.654 10.615  -1.438  1.00 1.00 ? 93  ASP A C    1  
ATOM 1105  O O    . ASP A 1 73  ? -15.169 11.611  -0.898  1.00 1.00 ? 93  ASP A O    1  
ATOM 1106  C CB   . ASP A 1 73  ? -18.071 10.338  -0.856  1.00 1.00 ? 93  ASP A CB   1  
ATOM 1107  C CG   . ASP A 1 73  ? -19.500 9.956   -1.290  1.00 1.00 ? 93  ASP A CG   1  
ATOM 1108  O OD1  . ASP A 1 73  ? -19.622 8.898   -1.961  1.00 1.00 ? 93  ASP A OD1  1  
ATOM 1109  O OD2  . ASP A 1 73  ? -20.427 10.729  -0.971  1.00 1.00 ? 93  ASP A OD2  1  
ATOM 1110  H H    . ASP A 1 73  ? -18.083 9.088   -2.868  1.00 1.00 ? 93  ASP A H    1  
ATOM 1111  H HA   . ASP A 1 73  ? -17.283 11.716  -2.330  1.00 1.00 ? 93  ASP A HA   1  
ATOM 1112  H HB2  . ASP A 1 73  ? -17.660 9.485   -0.315  1.00 0.00 ? 93  ASP A HB2  1  
ATOM 1113  H HB3  . ASP A 1 73  ? -18.070 11.130  -0.098  1.00 1.00 ? 93  ASP A HB3  1  
ATOM 1114  N N    . LEU A 1 74  ? -14.995 9.448   -1.531  1.00 1.00 ? 94  LEU A N    1  
ATOM 1115  C CA   . LEU A 1 74  ? -13.679 9.118   -0.965  1.00 1.00 ? 94  LEU A CA   1  
ATOM 1116  C C    . LEU A 1 74  ? -12.582 10.107  -1.423  1.00 1.00 ? 94  LEU A C    1  
ATOM 1117  O O    . LEU A 1 74  ? -12.455 10.317  -2.633  1.00 1.00 ? 94  LEU A O    1  
ATOM 1118  C CB   . LEU A 1 74  ? -13.334 7.657   -1.340  1.00 1.00 ? 94  LEU A CB   1  
ATOM 1119  C CG   . LEU A 1 74  ? -14.063 6.492   -0.620  1.00 1.00 ? 94  LEU A CG   1  
ATOM 1120  C CD1  . LEU A 1 74  ? -15.592 6.564   -0.701  1.00 1.00 ? 94  LEU A CD1  1  
ATOM 1121  C CD2  . LEU A 1 74  ? -13.579 5.164   -1.216  1.00 1.00 ? 94  LEU A CD2  1  
ATOM 1122  H H    . LEU A 1 74  ? -15.496 8.704   -1.993  1.00 1.00 ? 94  LEU A H    1  
ATOM 1123  H HA   . LEU A 1 74  ? -13.764 9.194   0.106   1.00 1.00 ? 94  LEU A HA   1  
ATOM 1124  H HB2  . LEU A 1 74  ? -13.659 7.452   -2.359  1.00 0.00 ? 94  LEU A HB2  1  
ATOM 1125  H HB3  . LEU A 1 74  ? -12.256 7.503   -1.270  1.00 1.00 ? 94  LEU A HB3  1  
ATOM 1126  H HG   . LEU A 1 74  ? -13.795 6.484   0.434   1.00 1.00 ? 94  LEU A HG   1  
ATOM 1127  H HD11 . LEU A 1 74  ? -15.919 6.644   -1.737  1.00 1.00 ? 94  LEU A HD11 1  
ATOM 1128  H HD12 . LEU A 1 74  ? -16.028 5.666   -0.262  1.00 1.00 ? 94  LEU A HD12 1  
ATOM 1129  H HD13 . LEU A 1 74  ? -15.956 7.416   -0.125  1.00 1.00 ? 94  LEU A HD13 1  
ATOM 1130  H HD21 . LEU A 1 74  ? -12.496 5.084   -1.122  1.00 1.00 ? 94  LEU A HD21 1  
ATOM 1131  H HD22 . LEU A 1 74  ? -14.028 4.329   -0.677  1.00 1.00 ? 94  LEU A HD22 1  
ATOM 1132  H HD23 . LEU A 1 74  ? -13.851 5.101   -2.271  1.00 1.00 ? 94  LEU A HD23 1  
ATOM 1133  N N    . ARG A 1 75  ? -11.774 10.688  -0.497  1.00 1.00 ? 95  ARG A N    1  
ATOM 1134  C CA   . ARG A 1 75  ? -10.737 11.676  -0.916  1.00 1.00 ? 95  ARG A CA   1  
ATOM 1135  C C    . ARG A 1 75  ? -9.419  11.453  -0.188  1.00 1.00 ? 95  ARG A C    1  
ATOM 1136  O O    . ARG A 1 75  ? -9.380  11.485  1.035   1.00 1.00 ? 95  ARG A O    1  
ATOM 1137  C CB   . ARG A 1 75  ? -11.233 13.128  -0.760  1.00 1.00 ? 95  ARG A CB   1  
ATOM 1138  C CG   . ARG A 1 75  ? -11.971 13.686  -1.982  1.00 1.00 ? 95  ARG A CG   1  
ATOM 1139  C CD   . ARG A 1 75  ? -12.981 14.773  -1.606  1.00 1.00 ? 95  ARG A CD   1  
ATOM 1140  N NE   . ARG A 1 75  ? -14.140 14.179  -0.933  1.00 1.00 ? 95  ARG A NE   1  
ATOM 1141  C CZ   . ARG A 1 75  ? -15.218 14.740  -0.440  1.00 1.00 ? 95  ARG A CZ   1  
ATOM 1142  N NH1  . ARG A 1 75  ? -15.459 16.019  -0.482  1.00 1.00 ? 95  ARG A NH1  1  
ATOM 1143  N NH2  . ARG A 1 75  ? -16.097 13.976  0.126   1.00 1.00 ? 95  ARG A NH2  1  
ATOM 1144  H H    . ARG A 1 75  ? -11.778 10.353  0.501   1.00 1.00 ? 95  ARG A H    1  
ATOM 1145  H HA   . ARG A 1 75  ? -10.534 11.535  -1.982  1.00 1.00 ? 95  ARG A HA   1  
ATOM 1146  H HB2  . ARG A 1 75  ? -11.964 13.209  0.045   1.00 0.00 ? 95  ARG A HB2  1  
ATOM 1147  H HB3  . ARG A 1 75  ? -10.407 13.803  -0.529  1.00 1.00 ? 95  ARG A HB3  1  
ATOM 1148  H HG2  . ARG A 1 75  ? -11.290 14.185  -2.672  1.00 0.00 ? 95  ARG A HG2  1  
ATOM 1149  H HG3  . ARG A 1 75  ? -12.477 12.899  -2.543  1.00 1.00 ? 95  ARG A HG3  1  
ATOM 1150  H HD2  . ARG A 1 75  ? -12.503 15.491  -0.939  1.00 0.00 ? 95  ARG A HD2  1  
ATOM 1151  H HD3  . ARG A 1 75  ? -13.318 15.277  -2.510  1.00 1.00 ? 95  ARG A HD3  1  
ATOM 1152  H HE   . ARG A 1 75  ? -14.096 13.176  -0.738  1.00 1.00 ? 95  ARG A HE   1  
ATOM 1153  H HH11 . ARG A 1 75  ? -14.781 16.657  -0.922  1.00 0.00 ? 95  ARG A HH11 1  
ATOM 1154  H HH12 . ARG A 1 75  ? -16.329 16.393  -0.074  1.00 0.00 ? 95  ARG A HH12 1  
ATOM 1155  H HH21 . ARG A 1 75  ? -15.938 12.960  0.179   1.00 0.00 ? 95  ARG A HH21 1  
ATOM 1156  H HH22 . ARG A 1 75  ? -16.955 14.385  0.523   1.00 0.00 ? 95  ARG A HH22 1  
ATOM 1157  N N    . PHE A 1 76  ? -8.357  11.252  -0.958  1.00 1.00 ? 96  PHE A N    1  
ATOM 1158  C CA   . PHE A 1 76  ? -7.000  10.892  -0.558  1.00 1.00 ? 96  PHE A CA   1  
ATOM 1159  C C    . PHE A 1 76  ? -6.130  12.158  -0.384  1.00 1.00 ? 96  PHE A C    1  
ATOM 1160  O O    . PHE A 1 76  ? -6.282  13.126  -1.144  1.00 1.00 ? 96  PHE A O    1  
ATOM 1161  C CB   . PHE A 1 76  ? -6.434  9.966   -1.654  1.00 1.00 ? 96  PHE A CB   1  
ATOM 1162  C CG   . PHE A 1 76  ? -7.292  8.831   -2.238  1.00 1.00 ? 96  PHE A CG   1  
ATOM 1163  C CD1  . PHE A 1 76  ? -8.401  9.110   -3.075  1.00 1.00 ? 96  PHE A CD1  1  
ATOM 1164  C CD2  . PHE A 1 76  ? -6.948  7.478   -2.012  1.00 1.00 ? 96  PHE A CD2  1  
ATOM 1165  C CE1  . PHE A 1 76  ? -9.153  8.073   -3.662  1.00 1.00 ? 96  PHE A CE1  1  
ATOM 1166  C CE2  . PHE A 1 76  ? -7.683  6.434   -2.621  1.00 1.00 ? 96  PHE A CE2  1  
ATOM 1167  C CZ   . PHE A 1 76  ? -8.791  6.731   -3.440  1.00 1.00 ? 96  PHE A CZ   1  
ATOM 1168  H H    . PHE A 1 76  ? -8.492  11.379  -1.947  1.00 1.00 ? 96  PHE A H    1  
ATOM 1169  H HA   . PHE A 1 76  ? -7.032  10.343  0.385   1.00 1.00 ? 96  PHE A HA   1  
ATOM 1170  H HB2  . PHE A 1 76  ? -6.348  10.500  -2.600  1.00 0.00 ? 96  PHE A HB2  1  
ATOM 1171  H HB3  . PHE A 1 76  ? -5.444  9.601   -1.373  1.00 1.00 ? 96  PHE A HB3  1  
ATOM 1172  H HD1  . PHE A 1 76  ? -8.700  10.118  -3.289  1.00 1.00 ? 96  PHE A HD1  1  
ATOM 1173  H HD2  . PHE A 1 76  ? -6.105  7.245   -1.383  1.00 1.00 ? 96  PHE A HD2  1  
ATOM 1174  H HE1  . PHE A 1 76  ? -9.998  8.315   -4.291  1.00 1.00 ? 96  PHE A HE1  1  
ATOM 1175  H HE2  . PHE A 1 76  ? -7.406  5.402   -2.465  1.00 1.00 ? 96  PHE A HE2  1  
ATOM 1176  H HZ   . PHE A 1 76  ? -9.359  5.938   -3.904  1.00 1.00 ? 96  PHE A HZ   1  
ATOM 1177  N N    . VAL A 1 77  ? -5.219  12.155  0.612   1.00 1.00 ? 97  VAL A N    1  
ATOM 1178  C CA   . VAL A 1 77  ? -4.357  13.312  1.010   1.00 1.00 ? 97  VAL A CA   1  
ATOM 1179  C C    . VAL A 1 77  ? -5.149  14.646  1.084   1.00 1.00 ? 97  VAL A C    1  
ATOM 1180  O O    . VAL A 1 77  ? -4.722  15.687  0.580   1.00 1.00 ? 97  VAL A O    1  
ATOM 1181  C CB   . VAL A 1 77  ? -3.010  13.353  0.217   1.00 1.00 ? 97  VAL A CB   1  
ATOM 1182  C CG1  . VAL A 1 77  ? -1.981  12.445  0.897   1.00 1.00 ? 97  VAL A CG1  1  
ATOM 1183  C CG2  . VAL A 1 77  ? -3.078  12.883  -1.247  1.00 1.00 ? 97  VAL A CG2  1  
ATOM 1184  H H    . VAL A 1 77  ? -5.196  11.351  1.224   1.00 1.00 ? 97  VAL A H    1  
ATOM 1185  H HA   . VAL A 1 77  ? -4.071  13.143  2.050   1.00 1.00 ? 97  VAL A HA   1  
ATOM 1186  H HB   . VAL A 1 77  ? -2.601  14.363  0.241   1.00 1.00 ? 97  VAL A HB   1  
ATOM 1187  H HG11 . VAL A 1 77  ? -1.837  12.762  1.930   1.00 1.00 ? 97  VAL A HG11 1  
ATOM 1188  H HG12 . VAL A 1 77  ? -2.357  11.426  0.861   1.00 1.00 ? 97  VAL A HG12 1  
ATOM 1189  H HG13 . VAL A 1 77  ? -1.018  12.495  0.383   1.00 1.00 ? 97  VAL A HG13 1  
ATOM 1190  H HG21 . VAL A 1 77  ? -3.794  13.494  -1.797  1.00 1.00 ? 97  VAL A HG21 1  
ATOM 1191  H HG22 . VAL A 1 77  ? -2.099  12.979  -1.713  1.00 1.00 ? 97  VAL A HG22 1  
ATOM 1192  H HG23 . VAL A 1 77  ? -3.382  11.839  -1.318  1.00 1.00 ? 97  VAL A HG23 1  
ATOM 1193  N N    . GLY A 1 78  ? -6.323  14.557  1.737   1.00 1.00 ? 98  GLY A N    1  
ATOM 1194  C CA   . GLY A 1 78  ? -7.450  15.488  1.905   1.00 1.00 ? 98  GLY A CA   1  
ATOM 1195  C C    . GLY A 1 78  ? -7.110  16.975  2.015   1.00 1.00 ? 98  GLY A C    1  
ATOM 1196  O O    . GLY A 1 78  ? -7.033  17.670  1.001   1.00 1.00 ? 98  GLY A O    1  
ATOM 1197  H H    . GLY A 1 78  ? -6.401  13.665  2.221   1.00 1.00 ? 98  GLY A H    1  
ATOM 1198  H HA2  . GLY A 1 78  ? -8.117  15.368  1.052   1.00 1.00 ? 98  GLY A HA2  1  
ATOM 1199  H HA3  . GLY A 1 78  ? -8.011  15.197  2.794   1.00 1.00 ? 98  GLY A HA3  1  
ATOM 1200  N N    . ARG A 1 79  ? -6.929  17.489  3.238   1.00 1.00 ? 99  ARG A N    1  
ATOM 1201  C CA   . ARG A 1 79  ? -6.519  18.871  3.569   1.00 1.00 ? 99  ARG A CA   1  
ATOM 1202  C C    . ARG A 1 79  ? -5.022  19.173  3.274   1.00 1.00 ? 99  ARG A C    1  
ATOM 1203  O O    . ARG A 1 79  ? -4.348  19.855  4.045   1.00 1.00 ? 99  ARG A O    1  
ATOM 1204  C CB   . ARG A 1 79  ? -6.969  19.150  5.016   1.00 1.00 ? 99  ARG A CB   1  
ATOM 1205  C CG   . ARG A 1 79  ? -7.317  20.624  5.251   1.00 1.00 ? 99  ARG A CG   1  
ATOM 1206  C CD   . ARG A 1 79  ? -7.932  20.856  6.630   1.00 1.00 ? 99  ARG A CD   1  
ATOM 1207  N NE   . ARG A 1 79  ? -6.911  21.150  7.646   1.00 1.00 ? 99  ARG A NE   1  
ATOM 1208  C CZ   . ARG A 1 79  ? -6.588  20.446  8.719   1.00 1.00 ? 99  ARG A CZ   1  
ATOM 1209  N NH1  . ARG A 1 79  ? -7.172  19.335  9.077   1.00 1.00 ? 99  ARG A NH1  1  
ATOM 1210  N NH2  . ARG A 1 79  ? -5.629  20.870  9.488   1.00 1.00 ? 99  ARG A NH2  1  
ATOM 1211  H H    . ARG A 1 79  ? -7.092  16.843  4.017   1.00 1.00 ? 99  ARG A H    1  
ATOM 1212  H HA   . ARG A 1 79  ? -7.083  19.535  2.915   1.00 1.00 ? 99  ARG A HA   1  
ATOM 1213  H HB2  . ARG A 1 79  ? -7.922  18.669  5.237   1.00 0.00 ? 99  ARG A HB2  1  
ATOM 1214  H HB3  . ARG A 1 79  ? -6.241  18.779  5.739   1.00 1.00 ? 99  ARG A HB3  1  
ATOM 1215  H HG2  . ARG A 1 79  ? -6.413  21.227  5.168   1.00 0.00 ? 99  ARG A HG2  1  
ATOM 1216  H HG3  . ARG A 1 79  ? -8.041  20.948  4.504   1.00 1.00 ? 99  ARG A HG3  1  
ATOM 1217  H HD2  . ARG A 1 79  ? -8.540  21.762  6.638   1.00 0.00 ? 99  ARG A HD2  1  
ATOM 1218  H HD3  . ARG A 1 79  ? -8.571  20.020  6.918   1.00 1.00 ? 99  ARG A HD3  1  
ATOM 1219  H HE   . ARG A 1 79  ? -6.368  21.983  7.500   1.00 1.00 ? 99  ARG A HE   1  
ATOM 1220  H HH11 . ARG A 1 79  ? -7.941  18.951  8.510   1.00 0.00 ? 99  ARG A HH11 1  
ATOM 1221  H HH12 . ARG A 1 79  ? -6.864  18.842  9.928   1.00 0.00 ? 99  ARG A HH12 1  
ATOM 1222  H HH21 . ARG A 1 79  ? -5.133  21.743  9.259   1.00 0.00 ? 99  ARG A HH21 1  
ATOM 1223  H HH22 . ARG A 1 79  ? -5.366  20.333  10.327  1.00 0.00 ? 99  ARG A HH22 1  
ATOM 1224  N N    . SER A 1 80  ? -4.550  18.688  2.114   1.00 1.00 ? 100 SER A N    1  
ATOM 1225  C CA   . SER A 1 80  ? -3.189  18.675  1.537   1.00 1.00 ? 100 SER A CA   1  
ATOM 1226  C C    . SER A 1 80  ? -2.197  17.692  2.190   1.00 1.00 ? 100 SER A C    1  
ATOM 1227  O O    . SER A 1 80  ? -2.302  17.323  3.357   1.00 1.00 ? 100 SER A O    1  
ATOM 1228  C CB   . SER A 1 80  ? -2.592  20.094  1.492   1.00 1.00 ? 100 SER A CB   1  
ATOM 1229  O OG   . SER A 1 80  ? -1.482  20.201  0.618   1.00 1.00 ? 100 SER A OG   1  
ATOM 1230  H H    . SER A 1 80  ? -5.270  18.203  1.588   1.00 1.00 ? 100 SER A H    1  
ATOM 1231  H HA   . SER A 1 80  ? -3.317  18.349  0.503   1.00 1.00 ? 100 SER A HA   1  
ATOM 1232  H HB2  . SER A 1 80  ? -3.298  20.795  1.048   1.00 0.00 ? 100 SER A HB2  1  
ATOM 1233  H HB3  . SER A 1 80  ? -2.351  20.443  2.500   1.00 1.00 ? 100 SER A HB3  1  
ATOM 1234  H HG   . SER A 1 80  ? -0.647  20.150  1.123   1.00 1.00 ? 100 SER A HG   1  
ATOM 1235  N N    . GLY A 1 81  ? -1.169  17.332  1.409   1.00 1.00 ? 101 GLY A N    1  
ATOM 1236  C CA   . GLY A 1 81  ? -0.003  16.522  1.770   1.00 1.00 ? 101 GLY A CA   1  
ATOM 1237  C C    . GLY A 1 81  ? 1.253   16.896  0.959   1.00 1.00 ? 101 GLY A C    1  
ATOM 1238  O O    . GLY A 1 81  ? 1.176   17.636  -0.025  1.00 1.00 ? 101 GLY A O    1  
ATOM 1239  H H    . GLY A 1 81  ? -1.143  17.752  0.488   1.00 1.00 ? 101 GLY A H    1  
ATOM 1240  H HA2  . GLY A 1 81  ? 0.211   16.647  2.832   1.00 1.00 ? 101 GLY A HA2  1  
ATOM 1241  H HA3  . GLY A 1 81  ? -0.234  15.471  1.588   1.00 1.00 ? 101 GLY A HA3  1  
ATOM 1242  N N    . ARG A 1 82  ? 2.417   16.367  1.375   1.00 1.00 ? 102 ARG A N    1  
ATOM 1243  C CA   . ARG A 1 82  ? 3.733   16.500  0.707   1.00 1.00 ? 102 ARG A CA   1  
ATOM 1244  C C    . ARG A 1 82  ? 4.730   15.417  1.152   1.00 1.00 ? 102 ARG A C    1  
ATOM 1245  O O    . ARG A 1 82  ? 4.754   15.056  2.326   1.00 1.00 ? 102 ARG A O    1  
ATOM 1246  C CB   . ARG A 1 82  ? 4.314   17.910  0.961   1.00 1.00 ? 102 ARG A CB   1  
ATOM 1247  C CG   . ARG A 1 82  ? 4.582   18.318  2.416   1.00 1.00 ? 102 ARG A CG   1  
ATOM 1248  C CD   . ARG A 1 82  ? 5.141   19.747  2.508   1.00 1.00 ? 102 ARG A CD   1  
ATOM 1249  N NE   . ARG A 1 82  ? 6.558   19.856  2.105   1.00 1.00 ? 102 ARG A NE   1  
ATOM 1250  C CZ   . ARG A 1 82  ? 7.042   20.495  1.051   1.00 1.00 ? 102 ARG A CZ   1  
ATOM 1251  N NH1  . ARG A 1 82  ? 6.292   21.140  0.201   1.00 1.00 ? 102 ARG A NH1  1  
ATOM 1252  N NH2  . ARG A 1 82  ? 8.326   20.491  0.827   1.00 1.00 ? 102 ARG A NH2  1  
ATOM 1253  H H    . ARG A 1 82  ? 2.383   15.781  2.198   1.00 1.00 ? 102 ARG A H    1  
ATOM 1254  H HA   . ARG A 1 82  ? 3.576   16.386  -0.369  1.00 1.00 ? 102 ARG A HA   1  
ATOM 1255  H HB2  . ARG A 1 82  ? 5.304   17.981  0.510   1.00 0.00 ? 102 ARG A HB2  1  
ATOM 1256  H HB3  . ARG A 1 82  ? 3.657   18.657  0.517   1.00 1.00 ? 102 ARG A HB3  1  
ATOM 1257  H HG2  . ARG A 1 82  ? 3.657   18.378  2.991   1.00 0.00 ? 102 ARG A HG2  1  
ATOM 1258  H HG3  . ARG A 1 82  ? 5.231   17.602  2.918   1.00 1.00 ? 102 ARG A HG3  1  
ATOM 1259  H HD2  . ARG A 1 82  ? 4.634   20.400  1.798   1.00 0.00 ? 102 ARG A HD2  1  
ATOM 1260  H HD3  . ARG A 1 82  ? 4.997   20.148  3.512   1.00 1.00 ? 102 ARG A HD3  1  
ATOM 1261  H HE   . ARG A 1 82  ? 7.248   19.427  2.694   1.00 1.00 ? 102 ARG A HE   1  
ATOM 1262  H HH11 . ARG A 1 82  ? 5.271   21.169  0.333   1.00 0.00 ? 102 ARG A HH11 1  
ATOM 1263  H HH12 . ARG A 1 82  ? 6.721   21.621  -0.602  1.00 0.00 ? 102 ARG A HH12 1  
ATOM 1264  H HH21 . ARG A 1 82  ? 8.959   19.992  1.468   1.00 0.00 ? 102 ARG A HH21 1  
ATOM 1265  H HH22 . ARG A 1 82  ? 8.707   20.987  0.008   1.00 0.00 ? 102 ARG A HH22 1  
ATOM 1266  N N    . GLY A 1 83  ? 5.561   14.926  0.219   1.00 1.00 ? 103 GLY A N    1  
ATOM 1267  C CA   . GLY A 1 83  ? 6.649   13.958  0.469   1.00 1.00 ? 103 GLY A CA   1  
ATOM 1268  C C    . GLY A 1 83  ? 6.243   12.615  1.106   1.00 1.00 ? 103 GLY A C    1  
ATOM 1269  O O    . GLY A 1 83  ? 7.048   12.033  1.830   1.00 1.00 ? 103 GLY A O    1  
ATOM 1270  H H    . GLY A 1 83  ? 5.450   15.288  -0.717  1.00 1.00 ? 103 GLY A H    1  
ATOM 1271  H HA2  . GLY A 1 83  ? 7.144   13.738  -0.476  1.00 1.00 ? 103 GLY A HA2  1  
ATOM 1272  H HA3  . GLY A 1 83  ? 7.384   14.428  1.125   1.00 1.00 ? 103 GLY A HA3  1  
ATOM 1273  N N    . LYS A 1 84  ? 5.019   12.131  0.833   1.00 1.00 ? 104 LYS A N    1  
ATOM 1274  C CA   . LYS A 1 84  ? 4.358   10.948  1.412   1.00 1.00 ? 104 LYS A CA   1  
ATOM 1275  C C    . LYS A 1 84  ? 3.851   9.967   0.335   1.00 1.00 ? 104 LYS A C    1  
ATOM 1276  O O    . LYS A 1 84  ? 3.561   10.357  -0.796  1.00 1.00 ? 104 LYS A O    1  
ATOM 1277  C CB   . LYS A 1 84  ? 3.179   11.450  2.270   1.00 1.00 ? 104 LYS A CB   1  
ATOM 1278  C CG   . LYS A 1 84  ? 3.559   12.075  3.618   1.00 1.00 ? 104 LYS A CG   1  
ATOM 1279  C CD   . LYS A 1 84  ? 2.350   12.877  4.116   1.00 1.00 ? 104 LYS A CD   1  
ATOM 1280  C CE   . LYS A 1 84  ? 2.658   14.268  4.678   1.00 1.00 ? 104 LYS A CE   1  
ATOM 1281  N NZ   . LYS A 1 84  ? 3.298   14.217  6.005   1.00 1.00 ? 104 LYS A NZ   1  
ATOM 1282  H H    . LYS A 1 84  ? 4.463   12.662  0.181   1.00 1.00 ? 104 LYS A H    1  
ATOM 1283  H HA   . LYS A 1 84  ? 5.057   10.407  2.058   1.00 1.00 ? 104 LYS A HA   1  
ATOM 1284  H HB2  . LYS A 1 84  ? 2.662   12.280  1.790   1.00 0.00 ? 104 LYS A HB2  1  
ATOM 1285  H HB3  . LYS A 1 84  ? 2.443   10.660  2.438   1.00 1.00 ? 104 LYS A HB3  1  
ATOM 1286  H HG2  . LYS A 1 84  ? 3.789   11.298  4.347   1.00 0.00 ? 104 LYS A HG2  1  
ATOM 1287  H HG3  . LYS A 1 84  ? 4.434   12.715  3.508   1.00 1.00 ? 104 LYS A HG3  1  
ATOM 1288  H HD2  . LYS A 1 84  ? 1.712   13.152  3.276   1.00 0.00 ? 104 LYS A HD2  1  
ATOM 1289  H HD3  . LYS A 1 84  ? 1.770   12.282  4.819   1.00 1.00 ? 104 LYS A HD3  1  
ATOM 1290  H HE2  . LYS A 1 84  ? 3.375   14.771  4.030   1.00 0.00 ? 104 LYS A HE2  1  
ATOM 1291  H HE3  . LYS A 1 84  ? 1.735   14.855  4.725   1.00 1.00 ? 104 LYS A HE3  1  
ATOM 1292  H HZ1  . LYS A 1 84  ? 4.246   14.614  5.945   1.00 0.00 ? 104 LYS A HZ1  1  
ATOM 1293  H HZ2  . LYS A 1 84  ? 2.740   14.763  6.678   1.00 0.00 ? 104 LYS A HZ2  1  
ATOM 1294  N N    . SER A 1 85  ? 3.688   8.703   0.729   1.00 1.00 ? 105 SER A N    1  
ATOM 1295  C CA   . SER A 1 85  ? 3.087   7.588   -0.029  1.00 1.00 ? 105 SER A CA   1  
ATOM 1296  C C    . SER A 1 85  ? 1.724   7.194   0.562   1.00 1.00 ? 105 SER A C    1  
ATOM 1297  O O    . SER A 1 85  ? 1.506   7.257   1.774   1.00 1.00 ? 105 SER A O    1  
ATOM 1298  C CB   . SER A 1 85  ? 4.025   6.374   -0.028  1.00 1.00 ? 105 SER A CB   1  
ATOM 1299  O OG   . SER A 1 85  ? 5.062   6.523   -0.972  1.00 1.00 ? 105 SER A OG   1  
ATOM 1300  H H    . SER A 1 85  ? 3.885   8.549   1.716   1.00 1.00 ? 105 SER A H    1  
ATOM 1301  H HA   . SER A 1 85  ? 2.919   7.893   -1.062  1.00 1.00 ? 105 SER A HA   1  
ATOM 1302  H HB2  . SER A 1 85  ? 4.490   6.256   0.951   1.00 0.00 ? 105 SER A HB2  1  
ATOM 1303  H HB3  . SER A 1 85  ? 3.470   5.466   -0.261  1.00 1.00 ? 105 SER A HB3  1  
ATOM 1304  H HG   . SER A 1 85  ? 5.788   5.945   -0.710  1.00 1.00 ? 105 SER A HG   1  
ATOM 1305  N N    . PHE A 1 86  ? 0.809   6.747   -0.303  1.00 1.00 ? 106 PHE A N    1  
ATOM 1306  C CA   . PHE A 1 86  ? -0.592  6.449   -0.003  1.00 1.00 ? 106 PHE A CA   1  
ATOM 1307  C C    . PHE A 1 86  ? -0.772  5.002   0.527   1.00 1.00 ? 106 PHE A C    1  
ATOM 1308  O O    . PHE A 1 86  ? -0.987  4.044   -0.217  1.00 1.00 ? 106 PHE A O    1  
ATOM 1309  C CB   . PHE A 1 86  ? -1.448  6.869   -1.223  1.00 1.00 ? 106 PHE A CB   1  
ATOM 1310  C CG   . PHE A 1 86  ? -2.501  5.931   -1.764  1.00 1.00 ? 106 PHE A CG   1  
ATOM 1311  C CD1  . PHE A 1 86  ? -3.728  5.807   -1.085  1.00 1.00 ? 106 PHE A CD1  1  
ATOM 1312  C CD2  . PHE A 1 86  ? -2.250  5.163   -2.926  1.00 1.00 ? 106 PHE A CD2  1  
ATOM 1313  C CE1  . PHE A 1 86  ? -4.708  4.920   -1.573  1.00 1.00 ? 106 PHE A CE1  1  
ATOM 1314  C CE2  . PHE A 1 86  ? -3.233  4.279   -3.413  1.00 1.00 ? 106 PHE A CE2  1  
ATOM 1315  C CZ   . PHE A 1 86  ? -4.468  4.161   -2.738  1.00 1.00 ? 106 PHE A CZ   1  
ATOM 1316  H H    . PHE A 1 86  ? 1.088   6.595   -1.271  1.00 1.00 ? 106 PHE A H    1  
ATOM 1317  H HA   . PHE A 1 86  ? -0.912  7.113   0.801   1.00 1.00 ? 106 PHE A HA   1  
ATOM 1318  H HB2  . PHE A 1 86  ? -2.196  7.588   -0.887  1.00 0.00 ? 106 PHE A HB2  1  
ATOM 1319  H HB3  . PHE A 1 86  ? -0.874  7.337   -2.029  1.00 1.00 ? 106 PHE A HB3  1  
ATOM 1320  H HD1  . PHE A 1 86  ? -3.916  6.382   -0.189  1.00 1.00 ? 106 PHE A HD1  1  
ATOM 1321  H HD2  . PHE A 1 86  ? -1.297  5.242   -3.429  1.00 1.00 ? 106 PHE A HD2  1  
ATOM 1322  H HE1  . PHE A 1 86  ? -5.638  4.828   -1.038  1.00 1.00 ? 106 PHE A HE1  1  
ATOM 1323  H HE2  . PHE A 1 86  ? -3.037  3.684   -4.294  1.00 1.00 ? 106 PHE A HE2  1  
ATOM 1324  H HZ   . PHE A 1 86  ? -5.218  3.483   -3.113  1.00 1.00 ? 106 PHE A HZ   1  
ATOM 1325  N N    . THR A 1 87  ? -0.669  4.835   1.853   1.00 1.00 ? 107 THR A N    1  
ATOM 1326  C CA   . THR A 1 87  ? -0.921  3.575   2.585   1.00 1.00 ? 107 THR A CA   1  
ATOM 1327  C C    . THR A 1 87  ? -2.442  3.337   2.726   1.00 1.00 ? 107 THR A C    1  
ATOM 1328  O O    . THR A 1 87  ? -3.038  3.539   3.789   1.00 1.00 ? 107 THR A O    1  
ATOM 1329  C CB   . THR A 1 87  ? -0.189  3.526   3.957   1.00 1.00 ? 107 THR A CB   1  
ATOM 1330  O OG1  . THR A 1 87  ? 1.174   3.868   3.821   1.00 1.00 ? 107 THR A OG1  1  
ATOM 1331  C CG2  . THR A 1 87  ? -0.209  2.134   4.604   1.00 1.00 ? 107 THR A CG2  1  
ATOM 1332  H H    . THR A 1 87  ? -0.492  5.645   2.438   1.00 1.00 ? 107 THR A H    1  
ATOM 1333  H HA   . THR A 1 87  ? -0.515  2.755   1.989   1.00 1.00 ? 107 THR A HA   1  
ATOM 1334  H HB   . THR A 1 87  ? -0.644  4.230   4.652   1.00 1.00 ? 107 THR A HB   1  
ATOM 1335  H HG1  . THR A 1 87  ? 1.623   3.128   3.406   1.00 1.00 ? 107 THR A HG1  1  
ATOM 1336  H HG21 . THR A 1 87  ? 0.243   1.395   3.940   1.00 1.00 ? 107 THR A HG21 1  
ATOM 1337  H HG22 . THR A 1 87  ? 0.342   2.160   5.546   1.00 1.00 ? 107 THR A HG22 1  
ATOM 1338  H HG23 . THR A 1 87  ? -1.237  1.840   4.818   1.00 1.00 ? 107 THR A HG23 1  
ATOM 1339  N N    . LEU A 1 88  ? -3.099  2.932   1.624   1.00 1.00 ? 108 LEU A N    1  
ATOM 1340  C CA   . LEU A 1 88  ? -4.502  2.485   1.622   1.00 1.00 ? 108 LEU A CA   1  
ATOM 1341  C C    . LEU A 1 88  ? -4.632  1.241   2.519   1.00 1.00 ? 108 LEU A C    1  
ATOM 1342  O O    . LEU A 1 88  ? -4.003  0.209   2.248   1.00 1.00 ? 108 LEU A O    1  
ATOM 1343  C CB   . LEU A 1 88  ? -5.022  2.237   0.187   1.00 1.00 ? 108 LEU A CB   1  
ATOM 1344  C CG   . LEU A 1 88  ? -6.481  1.728   0.052   1.00 1.00 ? 108 LEU A CG   1  
ATOM 1345  C CD1  . LEU A 1 88  ? -7.112  2.203   -1.263  1.00 1.00 ? 108 LEU A CD1  1  
ATOM 1346  C CD2  . LEU A 1 88  ? -6.606  0.196   0.081   1.00 1.00 ? 108 LEU A CD2  1  
ATOM 1347  H H    . LEU A 1 88  ? -2.562  2.881   0.765   1.00 1.00 ? 108 LEU A H    1  
ATOM 1348  H HA   . LEU A 1 88  ? -5.110  3.281   2.044   1.00 1.00 ? 108 LEU A HA   1  
ATOM 1349  H HB2  . LEU A 1 88  ? -5.161  3.170   -0.360  1.00 0.00 ? 108 LEU A HB2  1  
ATOM 1350  H HB3  . LEU A 1 88  ? -4.332  1.627   -0.393  1.00 1.00 ? 108 LEU A HB3  1  
ATOM 1351  H HG   . LEU A 1 88  ? -7.076  2.137   0.869   1.00 1.00 ? 108 LEU A HG   1  
ATOM 1352  H HD11 . LEU A 1 88  ? -6.546  1.821   -2.114  1.00 1.00 ? 108 LEU A HD11 1  
ATOM 1353  H HD12 . LEU A 1 88  ? -8.140  1.843   -1.336  1.00 1.00 ? 108 LEU A HD12 1  
ATOM 1354  H HD13 . LEU A 1 88  ? -7.144  3.286   -1.296  1.00 1.00 ? 108 LEU A HD13 1  
ATOM 1355  H HD21 . LEU A 1 88  ? -6.022  -0.250  -0.724  1.00 1.00 ? 108 LEU A HD21 1  
ATOM 1356  H HD22 . LEU A 1 88  ? -6.264  -0.207  1.030   1.00 1.00 ? 108 LEU A HD22 1  
ATOM 1357  H HD23 . LEU A 1 88  ? -7.649  -0.094  -0.047  1.00 1.00 ? 108 LEU A HD23 1  
ATOM 1358  N N    . THR A 1 89  ? -5.460  1.343   3.575   1.00 1.00 ? 109 THR A N    1  
ATOM 1359  C CA   . THR A 1 89  ? -5.771  0.212   4.470   1.00 1.00 ? 109 THR A CA   1  
ATOM 1360  C C    . THR A 1 89  ? -7.273  -0.050  4.682   1.00 1.00 ? 109 THR A C    1  
ATOM 1361  O O    . THR A 1 89  ? -8.104  0.847   4.834   1.00 1.00 ? 109 THR A O    1  
ATOM 1362  C CB   . THR A 1 89  ? -4.984  0.307   5.797   1.00 1.00 ? 109 THR A CB   1  
ATOM 1363  O OG1  . THR A 1 89  ? -5.139  -0.867  6.567   1.00 1.00 ? 109 THR A OG1  1  
ATOM 1364  C CG2  . THR A 1 89  ? -5.373  1.471   6.710   1.00 1.00 ? 109 THR A CG2  1  
ATOM 1365  H H    . THR A 1 89  ? -5.865  2.257   3.793   1.00 1.00 ? 109 THR A H    1  
ATOM 1366  H HA   . THR A 1 89  ? -5.385  -0.675  3.973   1.00 1.00 ? 109 THR A HA   1  
ATOM 1367  H HB   . THR A 1 89  ? -3.926  0.405   5.554   1.00 1.00 ? 109 THR A HB   1  
ATOM 1368  H HG1  . THR A 1 89  ? -5.125  -1.649  5.967   1.00 1.00 ? 109 THR A HG1  1  
ATOM 1369  H HG21 . THR A 1 89  ? -5.254  2.417   6.183   1.00 1.00 ? 109 THR A HG21 1  
ATOM 1370  H HG22 . THR A 1 89  ? -6.405  1.357   7.035   1.00 1.00 ? 109 THR A HG22 1  
ATOM 1371  H HG23 . THR A 1 89  ? -4.726  1.478   7.589   1.00 1.00 ? 109 THR A HG23 1  
ATOM 1372  N N    . ILE A 1 90  ? -7.627  -1.338  4.710   1.00 1.00 ? 110 ILE A N    1  
ATOM 1373  C CA   . ILE A 1 90  ? -8.955  -1.850  5.059   1.00 1.00 ? 110 ILE A CA   1  
ATOM 1374  C C    . ILE A 1 90  ? -8.880  -2.176  6.555   1.00 1.00 ? 110 ILE A C    1  
ATOM 1375  O O    . ILE A 1 90  ? -8.136  -3.074  6.957   1.00 1.00 ? 110 ILE A O    1  
ATOM 1376  C CB   . ILE A 1 90  ? -9.338  -3.073  4.181   1.00 1.00 ? 110 ILE A CB   1  
ATOM 1377  C CG1  . ILE A 1 90  ? -9.739  -2.667  2.744   1.00 1.00 ? 110 ILE A CG1  1  
ATOM 1378  C CG2  . ILE A 1 90  ? -10.527 -3.863  4.762   1.00 1.00 ? 110 ILE A CG2  1  
ATOM 1379  C CD1  . ILE A 1 90  ? -8.638  -2.070  1.864   1.00 1.00 ? 110 ILE A CD1  1  
ATOM 1380  H H    . ILE A 1 90  ? -6.874  -2.018  4.653   1.00 1.00 ? 110 ILE A H    1  
ATOM 1381  H HA   . ILE A 1 90  ? -9.713  -1.085  4.901   1.00 1.00 ? 110 ILE A HA   1  
ATOM 1382  H HB   . ILE A 1 90  ? -8.489  -3.754  4.127   1.00 1.00 ? 110 ILE A HB   1  
ATOM 1383  H HG12 . ILE A 1 90  ? -9.989  -3.542  2.144   1.00 0.00 ? 110 ILE A HG12 1  
ATOM 1384  H HG13 . ILE A 1 90  ? -10.609 -2.008  2.748   1.00 1.00 ? 110 ILE A HG13 1  
ATOM 1385  H HG21 . ILE A 1 90  ? -11.385 -3.197  4.878   1.00 1.00 ? 110 ILE A HG21 1  
ATOM 1386  H HG22 . ILE A 1 90  ? -10.791 -4.691  4.099   1.00 1.00 ? 110 ILE A HG22 1  
ATOM 1387  H HG23 . ILE A 1 90  ? -10.262 -4.291  5.732   1.00 1.00 ? 110 ILE A HG23 1  
ATOM 1388  H HD11 . ILE A 1 90  ? -7.721  -2.645  1.965   1.00 1.00 ? 110 ILE A HD11 1  
ATOM 1389  H HD12 . ILE A 1 90  ? -8.958  -2.084  0.825   1.00 1.00 ? 110 ILE A HD12 1  
ATOM 1390  H HD13 . ILE A 1 90  ? -8.439  -1.042  2.155   1.00 1.00 ? 110 ILE A HD13 1  
ATOM 1391  N N    . THR A 1 91  ? -9.642  -1.423  7.361   1.00 1.00 ? 111 THR A N    1  
ATOM 1392  C CA   . THR A 1 91  ? -9.808  -1.644  8.818   1.00 1.00 ? 111 THR A CA   1  
ATOM 1393  C C    . THR A 1 91  ? -11.157 -2.320  9.148   1.00 1.00 ? 111 THR A C    1  
ATOM 1394  O O    . THR A 1 91  ? -12.221 -1.747  8.908   1.00 1.00 ? 111 THR A O    1  
ATOM 1395  C CB   . THR A 1 91  ? -9.537  -0.346  9.612   1.00 1.00 ? 111 THR A CB   1  
ATOM 1396  O OG1  . THR A 1 91  ? -9.382  -0.656  10.975  1.00 1.00 ? 111 THR A OG1  1  
ATOM 1397  C CG2  . THR A 1 91  ? -10.555 0.795   9.492   1.00 1.00 ? 111 THR A CG2  1  
ATOM 1398  H H    . THR A 1 91  ? -10.166 -0.658  6.903   1.00 1.00 ? 111 THR A H    1  
ATOM 1399  H HA   . THR A 1 91  ? -9.033  -2.335  9.137   1.00 1.00 ? 111 THR A HA   1  
ATOM 1400  H HB   . THR A 1 91  ? -8.576  0.042   9.270   1.00 1.00 ? 111 THR A HB   1  
ATOM 1401  H HG1  . THR A 1 91  ? -8.829  0.027   11.370  1.00 1.00 ? 111 THR A HG1  1  
ATOM 1402  H HG21 . THR A 1 91  ? -10.695 1.058   8.443   1.00 1.00 ? 111 THR A HG21 1  
ATOM 1403  H HG22 . THR A 1 91  ? -11.517 0.501   9.914   1.00 1.00 ? 111 THR A HG22 1  
ATOM 1404  H HG23 . THR A 1 91  ? -10.193 1.679   10.021  1.00 1.00 ? 111 THR A HG23 1  
ATOM 1405  N N    . VAL A 1 92  ? -11.146 -3.561  9.677   1.00 1.00 ? 112 VAL A N    1  
ATOM 1406  C CA   . VAL A 1 92  ? -12.392 -4.328  9.920   1.00 1.00 ? 112 VAL A CA   1  
ATOM 1407  C C    . VAL A 1 92  ? -13.203 -3.772  11.105  1.00 1.00 ? 112 VAL A C    1  
ATOM 1408  O O    . VAL A 1 92  ? -12.686 -3.229  12.080  1.00 1.00 ? 112 VAL A O    1  
ATOM 1409  C CB   . VAL A 1 92  ? -12.172 -5.870  9.956   1.00 1.00 ? 112 VAL A CB   1  
ATOM 1410  C CG1  . VAL A 1 92  ? -12.728 -6.621  11.177  1.00 1.00 ? 112 VAL A CG1  1  
ATOM 1411  C CG2  . VAL A 1 92  ? -12.738 -6.539  8.691   1.00 1.00 ? 112 VAL A CG2  1  
ATOM 1412  H H    . VAL A 1 92  ? -10.257 -4.046  9.756   1.00 1.00 ? 112 VAL A H    1  
ATOM 1413  H HA   . VAL A 1 92  ? -13.010 -4.127  9.052   1.00 1.00 ? 112 VAL A HA   1  
ATOM 1414  H HB   . VAL A 1 92  ? -11.111 -6.061  9.948   1.00 1.00 ? 112 VAL A HB   1  
ATOM 1415  H HG11 . VAL A 1 92  ? -12.385 -6.159  12.103  1.00 1.00 ? 112 VAL A HG11 1  
ATOM 1416  H HG12 . VAL A 1 92  ? -13.816 -6.617  11.160  1.00 1.00 ? 112 VAL A HG12 1  
ATOM 1417  H HG13 . VAL A 1 92  ? -12.382 -7.656  11.166  1.00 1.00 ? 112 VAL A HG13 1  
ATOM 1418  H HG21 . VAL A 1 92  ? -12.247 -6.129  7.808   1.00 1.00 ? 112 VAL A HG21 1  
ATOM 1419  H HG22 . VAL A 1 92  ? -12.550 -7.614  8.709   1.00 1.00 ? 112 VAL A HG22 1  
ATOM 1420  H HG23 . VAL A 1 92  ? -13.815 -6.371  8.621   1.00 1.00 ? 112 VAL A HG23 1  
ATOM 1421  N N    . PHE A 1 93  ? -14.513 -3.997  10.995  1.00 1.00 ? 113 PHE A N    1  
ATOM 1422  C CA   . PHE A 1 93  ? -15.615 -3.455  11.800  1.00 1.00 ? 113 PHE A CA   1  
ATOM 1423  C C    . PHE A 1 93  ? -16.218 -4.394  12.876  1.00 1.00 ? 113 PHE A C    1  
ATOM 1424  O O    . PHE A 1 93  ? -17.368 -4.215  13.274  1.00 1.00 ? 113 PHE A O    1  
ATOM 1425  C CB   . PHE A 1 93  ? -16.632 -2.924  10.776  1.00 1.00 ? 113 PHE A CB   1  
ATOM 1426  C CG   . PHE A 1 93  ? -17.656 -1.908  11.248  1.00 1.00 ? 113 PHE A CG   1  
ATOM 1427  C CD1  . PHE A 1 93  ? -17.267 -0.562  11.442  1.00 1.00 ? 113 PHE A CD1  1  
ATOM 1428  C CD2  . PHE A 1 93  ? -18.998 -2.291  11.478  1.00 1.00 ? 113 PHE A CD2  1  
ATOM 1429  C CE1  . PHE A 1 93  ? -18.215 0.395   11.869  1.00 1.00 ? 113 PHE A CE1  1  
ATOM 1430  C CE2  . PHE A 1 93  ? -19.946 -1.336  11.906  1.00 1.00 ? 113 PHE A CE2  1  
ATOM 1431  C CZ   . PHE A 1 93  ? -19.555 0.007   12.101  1.00 1.00 ? 113 PHE A CZ   1  
ATOM 1432  H H    . PHE A 1 93  ? -14.736 -4.586  10.210  1.00 1.00 ? 113 PHE A H    1  
ATOM 1433  H HA   . PHE A 1 93  ? -15.238 -2.587  12.344  1.00 1.00 ? 113 PHE A HA   1  
ATOM 1434  H HB2  . PHE A 1 93  ? -16.148 -2.274  10.048  1.00 0.00 ? 113 PHE A HB2  1  
ATOM 1435  H HB3  . PHE A 1 93  ? -17.100 -3.742  10.237  1.00 1.00 ? 113 PHE A HB3  1  
ATOM 1436  H HD1  . PHE A 1 93  ? -16.240 -0.269  11.272  1.00 1.00 ? 113 PHE A HD1  1  
ATOM 1437  H HD2  . PHE A 1 93  ? -19.292 -3.326  11.347  1.00 1.00 ? 113 PHE A HD2  1  
ATOM 1438  H HE1  . PHE A 1 93  ? -17.913 1.419   12.029  1.00 1.00 ? 113 PHE A HE1  1  
ATOM 1439  H HE2  . PHE A 1 93  ? -20.965 -1.641  12.095  1.00 1.00 ? 113 PHE A HE2  1  
ATOM 1440  H HZ   . PHE A 1 93  ? -20.280 0.737   12.436  1.00 1.00 ? 113 PHE A HZ   1  
ATOM 1441  N N    . THR A 1 94  ? -15.456 -5.381  13.387  1.00 1.00 ? 114 THR A N    1  
ATOM 1442  C CA   . THR A 1 94  ? -15.867 -6.278  14.504  1.00 1.00 ? 114 THR A CA   1  
ATOM 1443  C C    . THR A 1 94  ? -14.797 -6.433  15.605  1.00 1.00 ? 114 THR A C    1  
ATOM 1444  O O    . THR A 1 94  ? -13.701 -5.881  15.506  1.00 1.00 ? 114 THR A O    1  
ATOM 1445  C CB   . THR A 1 94  ? -16.421 -7.621  13.963  1.00 1.00 ? 114 THR A CB   1  
ATOM 1446  O OG1  . THR A 1 94  ? -17.026 -8.377  14.991  1.00 1.00 ? 114 THR A OG1  1  
ATOM 1447  C CG2  . THR A 1 94  ? -15.402 -8.522  13.259  1.00 1.00 ? 114 THR A CG2  1  
ATOM 1448  H H    . THR A 1 94  ? -14.490 -5.420  13.078  1.00 1.00 ? 114 THR A H    1  
ATOM 1449  H HA   . THR A 1 94  ? -16.706 -5.804  15.014  1.00 1.00 ? 114 THR A HA   1  
ATOM 1450  H HB   . THR A 1 94  ? -17.205 -7.389  13.242  1.00 1.00 ? 114 THR A HB   1  
ATOM 1451  H HG1  . THR A 1 94  ? -17.571 -9.037  14.555  1.00 1.00 ? 114 THR A HG1  1  
ATOM 1452  H HG21 . THR A 1 94  ? -14.541 -8.710  13.898  1.00 1.00 ? 114 THR A HG21 1  
ATOM 1453  H HG22 . THR A 1 94  ? -15.860 -9.472  12.987  1.00 1.00 ? 114 THR A HG22 1  
ATOM 1454  H HG23 . THR A 1 94  ? -15.064 -8.034  12.344  1.00 1.00 ? 114 THR A HG23 1  
ATOM 1455  N N    . ASN A 1 95  ? -15.142 -7.170  16.675  1.00 1.00 ? 115 ASN A N    1  
ATOM 1456  C CA   . ASN A 1 95  ? -14.364 -7.414  17.904  1.00 1.00 ? 115 ASN A CA   1  
ATOM 1457  C C    . ASN A 1 95  ? -12.867 -7.707  17.627  1.00 1.00 ? 115 ASN A C    1  
ATOM 1458  O O    . ASN A 1 95  ? -12.036 -7.138  18.334  1.00 1.00 ? 115 ASN A O    1  
ATOM 1459  C CB   . ASN A 1 95  ? -15.037 -8.525  18.730  1.00 1.00 ? 115 ASN A CB   1  
ATOM 1460  C CG   . ASN A 1 95  ? -16.449 -8.209  19.196  1.00 1.00 ? 115 ASN A CG   1  
ATOM 1461  O OD1  . ASN A 1 95  ? -16.693 -7.348  20.023  1.00 1.00 ? 115 ASN A OD1  1  
ATOM 1462  N ND2  . ASN A 1 95  ? -17.416 -8.942  18.699  1.00 1.00 ? 115 ASN A ND2  1  
ATOM 1463  H H    . ASN A 1 95  ? -16.034 -7.639  16.565  1.00 1.00 ? 115 ASN A H    1  
ATOM 1464  H HA   . ASN A 1 95  ? -14.390 -6.495  18.498  1.00 1.00 ? 115 ASN A HA   1  
ATOM 1465  H HB2  . ASN A 1 95  ? -15.106 -9.430  18.126  1.00 0.00 ? 115 ASN A HB2  1  
ATOM 1466  H HB3  . ASN A 1 95  ? -14.444 -8.721  19.617  1.00 1.00 ? 115 ASN A HB3  1  
ATOM 1467  H HD21 . ASN A 1 95  ? -17.201 -9.691  18.025  1.00 0.00 ? 115 ASN A HD21 1  
ATOM 1468  H HD22 . ASN A 1 95  ? -18.391 -8.770  18.982  1.00 0.00 ? 115 ASN A HD22 1  
ATOM 1469  N N    . PRO A 1 96  ? -12.510 -8.599  16.669  1.00 1.00 ? 116 PRO A N    1  
ATOM 1470  C CA   . PRO A 1 96  ? -11.151 -8.786  16.162  1.00 1.00 ? 116 PRO A CA   1  
ATOM 1471  C C    . PRO A 1 96  ? -10.928 -7.791  14.983  1.00 1.00 ? 116 PRO A C    1  
ATOM 1472  O O    . PRO A 1 96  ? -11.328 -8.097  13.853  1.00 1.00 ? 116 PRO A O    1  
ATOM 1473  C CB   . PRO A 1 96  ? -11.071 -10.251 15.708  1.00 1.00 ? 116 PRO A CB   1  
ATOM 1474  C CG   . PRO A 1 96  ? -12.508 -10.555 15.272  1.00 1.00 ? 116 PRO A CG   1  
ATOM 1475  C CD   . PRO A 1 96  ? -13.380 -9.642  16.134  1.00 1.00 ? 116 PRO A CD   1  
ATOM 1476  H HA   . PRO A 1 96  ? -10.407 -8.616  16.942  1.00 1.00 ? 116 PRO A HA   1  
ATOM 1477  H HB2  . PRO A 1 96  ? -10.364 -10.370 14.887  1.00 0.00 ? 116 PRO A HB2  1  
ATOM 1478  H HB3  . PRO A 1 96  ? -10.813 -10.880 16.562  1.00 1.00 ? 116 PRO A HB3  1  
ATOM 1479  H HG2  . PRO A 1 96  ? -12.649 -10.341 14.212  1.00 0.00 ? 116 PRO A HG2  1  
ATOM 1480  H HG3  . PRO A 1 96  ? -12.754 -11.607 15.438  1.00 1.00 ? 116 PRO A HG3  1  
ATOM 1481  H HD2  . PRO A 1 96  ? -14.187 -9.194  15.554  1.00 0.00 ? 116 PRO A HD2  1  
ATOM 1482  H HD3  . PRO A 1 96  ? -13.813 -10.222 16.948  1.00 1.00 ? 116 PRO A HD3  1  
ATOM 1483  N N    . PRO A 1 97  ? -10.325 -6.591  15.198  1.00 1.00 ? 117 PRO A N    1  
ATOM 1484  C CA   . PRO A 1 97  ? -10.054 -5.614  14.135  1.00 1.00 ? 117 PRO A CA   1  
ATOM 1485  C C    . PRO A 1 97  ? -9.040  -6.173  13.120  1.00 1.00 ? 117 PRO A C    1  
ATOM 1486  O O    . PRO A 1 97  ? -7.846  -6.282  13.424  1.00 1.00 ? 117 PRO A O    1  
ATOM 1487  C CB   . PRO A 1 97  ? -9.534  -4.345  14.825  1.00 1.00 ? 117 PRO A CB   1  
ATOM 1488  C CG   . PRO A 1 97  ? -8.959  -4.873  16.139  1.00 1.00 ? 117 PRO A CG   1  
ATOM 1489  C CD   . PRO A 1 97  ? -9.828  -6.083  16.470  1.00 1.00 ? 117 PRO A CD   1  
ATOM 1490  H HA   . PRO A 1 97  ? -10.989 -5.366  13.632  1.00 1.00 ? 117 PRO A HA   1  
ATOM 1491  H HB2  . PRO A 1 97  ? -8.774  -3.853  14.218  1.00 0.00 ? 117 PRO A HB2  1  
ATOM 1492  H HB3  . PRO A 1 97  ? -10.378 -3.689  15.050  1.00 1.00 ? 117 PRO A HB3  1  
ATOM 1493  H HG2  . PRO A 1 97  ? -7.908  -5.137  16.024  1.00 0.00 ? 117 PRO A HG2  1  
ATOM 1494  H HG3  . PRO A 1 97  ? -9.036  -4.121  16.925  1.00 1.00 ? 117 PRO A HG3  1  
ATOM 1495  H HD2  . PRO A 1 97  ? -9.331  -6.901  16.991  1.00 0.00 ? 117 PRO A HD2  1  
ATOM 1496  H HD3  . PRO A 1 97  ? -10.678 -5.719  17.045  1.00 1.00 ? 117 PRO A HD3  1  
ATOM 1497  N N    . GLN A 1 98  ? -9.495  -6.496  11.895  1.00 1.00 ? 118 GLN A N    1  
ATOM 1498  C CA   . GLN A 1 98  ? -8.629  -7.046  10.839  1.00 1.00 ? 118 GLN A CA   1  
ATOM 1499  C C    . GLN A 1 98  ? -8.203  -5.907  9.908   1.00 1.00 ? 118 GLN A C    1  
ATOM 1500  O O    . GLN A 1 98  ? -8.960  -5.381  9.094   1.00 1.00 ? 118 GLN A O    1  
ATOM 1501  C CB   . GLN A 1 98  ? -9.243  -8.254  10.105  1.00 1.00 ? 118 GLN A CB   1  
ATOM 1502  C CG   . GLN A 1 98  ? -8.169  -9.284  9.693   1.00 1.00 ? 118 GLN A CG   1  
ATOM 1503  C CD   . GLN A 1 98  ? -7.835  -9.371  8.201   1.00 1.00 ? 118 GLN A CD   1  
ATOM 1504  O OE1  . GLN A 1 98  ? -8.644  -9.788  7.391   1.00 1.00 ? 118 GLN A OE1  1  
ATOM 1505  N NE2  . GLN A 1 98  ? -6.611  -9.052  7.815   1.00 1.00 ? 118 GLN A NE2  1  
ATOM 1506  H H    . GLN A 1 98  ? -10.478 -6.341  11.694  1.00 1.00 ? 118 GLN A H    1  
ATOM 1507  H HA   . GLN A 1 98  ? -7.735  -7.436  11.325  1.00 1.00 ? 118 GLN A HA   1  
ATOM 1508  H HB2  . GLN A 1 98  ? -9.876  -8.857  10.756  1.00 0.00 ? 118 GLN A HB2  1  
ATOM 1509  H HB3  . GLN A 1 98  ? -9.867  -7.953  9.261   1.00 1.00 ? 118 GLN A HB3  1  
ATOM 1510  H HG2  . GLN A 1 98  ? -7.206  -8.994  10.114  1.00 0.00 ? 118 GLN A HG2  1  
ATOM 1511  H HG3  . GLN A 1 98  ? -8.446  -10.269 10.067  1.00 1.00 ? 118 GLN A HG3  1  
ATOM 1512  H HE21 . GLN A 1 98  ? -5.912  -8.755  8.511   1.00 0.00 ? 118 GLN A HE21 1  
ATOM 1513  H HE22 . GLN A 1 98  ? -6.356  -9.101  6.818   1.00 0.00 ? 118 GLN A HE22 1  
ATOM 1514  N N    . VAL A 1 99  ? -6.952  -5.500  10.110  1.00 1.00 ? 119 VAL A N    1  
ATOM 1515  C CA   . VAL A 1 99  ? -6.273  -4.378  9.450   1.00 1.00 ? 119 VAL A CA   1  
ATOM 1516  C C    . VAL A 1 99  ? -5.349  -4.928  8.356   1.00 1.00 ? 119 VAL A C    1  
ATOM 1517  O O    . VAL A 1 99  ? -4.397  -5.666  8.613   1.00 1.00 ? 119 VAL A O    1  
ATOM 1518  C CB   . VAL A 1 99  ? -5.542  -3.448  10.458  1.00 1.00 ? 119 VAL A CB   1  
ATOM 1519  C CG1  . VAL A 1 99  ? -6.563  -2.720  11.354  1.00 1.00 ? 119 VAL A CG1  1  
ATOM 1520  C CG2  . VAL A 1 99  ? -4.502  -4.147  11.355  1.00 1.00 ? 119 VAL A CG2  1  
ATOM 1521  H H    . VAL A 1 99  ? -6.522  -5.950  10.899  1.00 1.00 ? 119 VAL A H    1  
ATOM 1522  H HA   . VAL A 1 99  ? -7.031  -3.755  8.976   1.00 1.00 ? 119 VAL A HA   1  
ATOM 1523  H HB   . VAL A 1 99  ? -5.023  -2.679  9.881   1.00 1.00 ? 119 VAL A HB   1  
ATOM 1524  H HG11 . VAL A 1 99  ? -7.272  -2.172  10.739  1.00 1.00 ? 119 VAL A HG11 1  
ATOM 1525  H HG12 . VAL A 1 99  ? -7.107  -3.434  11.972  1.00 1.00 ? 119 VAL A HG12 1  
ATOM 1526  H HG13 . VAL A 1 99  ? -6.054  -2.005  12.003  1.00 1.00 ? 119 VAL A HG13 1  
ATOM 1527  H HG21 . VAL A 1 99  ? -4.972  -4.927  11.954  1.00 1.00 ? 119 VAL A HG21 1  
ATOM 1528  H HG22 . VAL A 1 99  ? -3.714  -4.589  10.748  1.00 1.00 ? 119 VAL A HG22 1  
ATOM 1529  H HG23 . VAL A 1 99  ? -4.041  -3.419  12.022  1.00 1.00 ? 119 VAL A HG23 1  
ATOM 1530  N N    . ALA A 1 100 ? -5.690  -4.583  7.111   1.00 1.00 ? 120 ALA A N    1  
ATOM 1531  C CA   . ALA A 1 100 ? -5.093  -5.057  5.860   1.00 1.00 ? 120 ALA A CA   1  
ATOM 1532  C C    . ALA A 1 100 ? -4.589  -3.872  5.011   1.00 1.00 ? 120 ALA A C    1  
ATOM 1533  O O    . ALA A 1 100 ? -5.240  -2.824  4.964   1.00 1.00 ? 120 ALA A O    1  
ATOM 1534  C CB   . ALA A 1 100 ? -6.155  -5.880  5.123   1.00 1.00 ? 120 ALA A CB   1  
ATOM 1535  H H    . ALA A 1 100 ? -6.508  -3.984  7.020   1.00 1.00 ? 120 ALA A H    1  
ATOM 1536  H HA   . ALA A 1 100 ? -4.252  -5.716  6.088   1.00 1.00 ? 120 ALA A HA   1  
ATOM 1537  H HB1  . ALA A 1 100 ? -7.046  -5.287  4.934   1.00 1.00 ? 120 ALA A HB1  1  
ATOM 1538  H HB2  . ALA A 1 100 ? -5.756  -6.225  4.171   1.00 1.00 ? 120 ALA A HB2  1  
ATOM 1539  H HB3  . ALA A 1 100 ? -6.444  -6.743  5.725   1.00 1.00 ? 120 ALA A HB3  1  
ATOM 1540  N N    . THR A 1 101 ? -3.454  -4.029  4.318   1.00 1.00 ? 121 THR A N    1  
ATOM 1541  C CA   . THR A 1 101 ? -2.741  -2.957  3.570   1.00 1.00 ? 121 THR A CA   1  
ATOM 1542  C C    . THR A 1 101 ? -2.563  -3.275  2.075   1.00 1.00 ? 121 THR A C    1  
ATOM 1543  O O    . THR A 1 101 ? -2.351  -4.431  1.696   1.00 1.00 ? 121 THR A O    1  
ATOM 1544  C CB   . THR A 1 101 ? -1.400  -2.594  4.247   1.00 1.00 ? 121 THR A CB   1  
ATOM 1545  O OG1  . THR A 1 101 ? -0.906  -1.389  3.713   1.00 1.00 ? 121 THR A OG1  1  
ATOM 1546  C CG2  . THR A 1 101 ? -0.292  -3.642  4.109   1.00 1.00 ? 121 THR A CG2  1  
ATOM 1547  H H    . THR A 1 101 ? -3.081  -4.968  4.274   1.00 1.00 ? 121 THR A H    1  
ATOM 1548  H HA   . THR A 1 101 ? -3.346  -2.050  3.622   1.00 1.00 ? 121 THR A HA   1  
ATOM 1549  H HB   . THR A 1 101 ? -1.581  -2.423  5.309   1.00 1.00 ? 121 THR A HB   1  
ATOM 1550  H HG1  . THR A 1 101 ? -0.068  -1.207  4.143   1.00 1.00 ? 121 THR A HG1  1  
ATOM 1551  H HG21 . THR A 1 101 ? -0.660  -4.612  4.447   1.00 1.00 ? 121 THR A HG21 1  
ATOM 1552  H HG22 . THR A 1 101 ? 0.033   -3.733  3.071   1.00 1.00 ? 121 THR A HG22 1  
ATOM 1553  H HG23 . THR A 1 101 ? 0.567   -3.368  4.721   1.00 1.00 ? 121 THR A HG23 1  
ATOM 1554  N N    . TYR A 1 102 ? -2.599  -2.241  1.221   1.00 1.00 ? 122 TYR A N    1  
ATOM 1555  C CA   . TYR A 1 102 ? -2.578  -2.378  -0.241  1.00 1.00 ? 122 TYR A CA   1  
ATOM 1556  C C    . TYR A 1 102 ? -1.144  -2.434  -0.819  1.00 1.00 ? 122 TYR A C    1  
ATOM 1557  O O    . TYR A 1 102 ? -0.284  -1.590  -0.561  1.00 1.00 ? 122 TYR A O    1  
ATOM 1558  C CB   . TYR A 1 102 ? -3.382  -1.228  -0.888  1.00 1.00 ? 122 TYR A CB   1  
ATOM 1559  C CG   . TYR A 1 102 ? -3.411  -1.170  -2.416  1.00 1.00 ? 122 TYR A CG   1  
ATOM 1560  C CD1  . TYR A 1 102 ? -3.416  -2.358  -3.184  1.00 1.00 ? 122 TYR A CD1  1  
ATOM 1561  C CD2  . TYR A 1 102 ? -3.402  0.077   -3.080  1.00 1.00 ? 122 TYR A CD2  1  
ATOM 1562  C CE1  . TYR A 1 102 ? -3.346  -2.316  -4.591  1.00 1.00 ? 122 TYR A CE1  1  
ATOM 1563  C CE2  . TYR A 1 102 ? -3.352  0.132   -4.497  1.00 1.00 ? 122 TYR A CE2  1  
ATOM 1564  C CZ   . TYR A 1 102 ? -3.290  -1.063  -5.254  1.00 1.00 ? 122 TYR A CZ   1  
ATOM 1565  O OH   . TYR A 1 102 ? -3.196  -1.015  -6.607  1.00 1.00 ? 122 TYR A OH   1  
ATOM 1566  H H    . TYR A 1 102 ? -2.756  -1.316  1.611   1.00 1.00 ? 122 TYR A H    1  
ATOM 1567  H HA   . TYR A 1 102 ? -3.100  -3.300  -0.496  1.00 1.00 ? 122 TYR A HA   1  
ATOM 1568  H HB2  . TYR A 1 102 ? -4.442  -1.358  -0.672  1.00 0.00 ? 122 TYR A HB2  1  
ATOM 1569  H HB3  . TYR A 1 102 ? -3.044  -0.273  -0.481  1.00 1.00 ? 122 TYR A HB3  1  
ATOM 1570  H HD1  . TYR A 1 102 ? -3.442  -3.318  -2.705  1.00 1.00 ? 122 TYR A HD1  1  
ATOM 1571  H HD2  . TYR A 1 102 ? -3.401  0.997   -2.516  1.00 1.00 ? 122 TYR A HD2  1  
ATOM 1572  H HE1  . TYR A 1 102 ? -3.323  -3.241  -5.148  1.00 1.00 ? 122 TYR A HE1  1  
ATOM 1573  H HE2  . TYR A 1 102 ? -3.333  1.077   -5.014  1.00 1.00 ? 122 TYR A HE2  1  
ATOM 1574  H HH   . TYR A 1 102 ? -3.172  -1.899  -6.971  1.00 1.00 ? 122 TYR A HH   1  
ATOM 1575  N N    . HIS A 1 103 ? -0.908  -3.467  -1.647  1.00 1.00 ? 123 HIS A N    1  
ATOM 1576  C CA   . HIS A 1 103 ? 0.289   -3.712  -2.459  1.00 1.00 ? 123 HIS A CA   1  
ATOM 1577  C C    . HIS A 1 103 ? 0.496   -2.604  -3.515  1.00 1.00 ? 123 HIS A C    1  
ATOM 1578  O O    . HIS A 1 103 ? -0.182  -2.590  -4.543  1.00 1.00 ? 123 HIS A O    1  
ATOM 1579  C CB   . HIS A 1 103 ? 0.165   -5.116  -3.078  1.00 1.00 ? 123 HIS A CB   1  
ATOM 1580  C CG   . HIS A 1 103 ? 0.576   -6.224  -2.141  1.00 1.00 ? 123 HIS A CG   1  
ATOM 1581  N ND1  . HIS A 1 103 ? 1.863   -6.688  -1.958  1.00 1.00 ? 123 HIS A ND1  1  
ATOM 1582  C CD2  . HIS A 1 103 ? -0.248  -6.903  -1.286  1.00 1.00 ? 123 HIS A CD2  1  
ATOM 1583  C CE1  . HIS A 1 103 ? 1.824   -7.640  -1.001  1.00 1.00 ? 123 HIS A CE1  1  
ATOM 1584  N NE2  . HIS A 1 103 ? 0.546   -7.790  -0.582  1.00 1.00 ? 123 HIS A NE2  1  
ATOM 1585  H H    . HIS A 1 103 ? -1.673  -4.115  -1.770  1.00 1.00 ? 123 HIS A H    1  
ATOM 1586  H HA   . HIS A 1 103 ? 1.152   -3.719  -1.794  1.00 1.00 ? 123 HIS A HA   1  
ATOM 1587  H HB2  . HIS A 1 103 ? -0.871  -5.371  -3.303  1.00 0.00 ? 123 HIS A HB2  1  
ATOM 1588  H HB3  . HIS A 1 103 ? 0.724   -5.198  -4.014  1.00 1.00 ? 123 HIS A HB3  1  
ATOM 1589  H HD1  . HIS A 1 103 ? 2.675   -6.364  -2.468  1.00 1.00 ? 123 HIS A HD1  1  
ATOM 1590  H HD2  . HIS A 1 103 ? -1.315  -6.756  -1.168  1.00 1.00 ? 123 HIS A HD2  1  
ATOM 1591  H HE1  . HIS A 1 103 ? 2.685   -8.199  -0.643  1.00 1.00 ? 123 HIS A HE1  1  
ATOM 1592  H HE2  . HIS A 1 103 ? 0.210   -8.433  0.129   1.00 1.00 ? 123 HIS A HE2  1  
ATOM 1593  N N    . ARG A 1 104 ? 1.460   -1.711  -3.217  1.00 1.00 ? 124 ARG A N    1  
ATOM 1594  C CA   . ARG A 1 104 ? 1.919   -0.474  -3.898  1.00 1.00 ? 124 ARG A CA   1  
ATOM 1595  C C    . ARG A 1 104 ? 1.242   0.747   -3.246  1.00 1.00 ? 124 ARG A C    1  
ATOM 1596  O O    . ARG A 1 104 ? 0.015   0.826   -3.197  1.00 1.00 ? 124 ARG A O    1  
ATOM 1597  C CB   . ARG A 1 104 ? 1.608   -0.398  -5.410  1.00 1.00 ? 124 ARG A CB   1  
ATOM 1598  C CG   . ARG A 1 104 ? 2.078   -1.509  -6.358  1.00 1.00 ? 124 ARG A CG   1  
ATOM 1599  C CD   . ARG A 1 104 ? 1.283   -1.283  -7.650  1.00 1.00 ? 124 ARG A CD   1  
ATOM 1600  N NE   . ARG A 1 104 ? 0.860   -2.500  -8.369  1.00 1.00 ? 124 ARG A NE   1  
ATOM 1601  C CZ   . ARG A 1 104 ? 0.185   -2.532  -9.508  1.00 1.00 ? 124 ARG A CZ   1  
ATOM 1602  N NH1  . ARG A 1 104 ? -0.197  -1.456  -10.143 1.00 1.00 ? 124 ARG A NH1  1  
ATOM 1603  N NH2  . ARG A 1 104 ? -0.167  -3.669  -10.039 1.00 1.00 ? 124 ARG A NH2  1  
ATOM 1604  H H    . ARG A 1 104 ? 1.819   -1.859  -2.283  1.00 1.00 ? 124 ARG A H    1  
ATOM 1605  H HA   . ARG A 1 104 ? 3.000   -0.398  -3.775  1.00 1.00 ? 124 ARG A HA   1  
ATOM 1606  H HB2  . ARG A 1 104 ? 0.530   -0.479  -5.548  1.00 0.00 ? 124 ARG A HB2  1  
ATOM 1607  H HB3  . ARG A 1 104 ? 1.969   0.559   -5.791  1.00 1.00 ? 124 ARG A HB3  1  
ATOM 1608  H HG2  . ARG A 1 104 ? 3.150   -1.439  -6.545  1.00 0.00 ? 124 ARG A HG2  1  
ATOM 1609  H HG3  . ARG A 1 104 ? 1.878   -2.490  -5.941  1.00 1.00 ? 124 ARG A HG3  1  
ATOM 1610  H HD2  . ARG A 1 104 ? 0.314   -0.847  -7.404  1.00 0.00 ? 124 ARG A HD2  1  
ATOM 1611  H HD3  . ARG A 1 104 ? 1.837   -0.605  -8.299  1.00 1.00 ? 124 ARG A HD3  1  
ATOM 1612  H HE   . ARG A 1 104 ? 0.985   -3.384  -7.906  1.00 1.00 ? 124 ARG A HE   1  
ATOM 1613  H HH11 . ARG A 1 104 ? 0.026   -0.526  -9.761  1.00 0.00 ? 124 ARG A HH11 1  
ATOM 1614  H HH12 . ARG A 1 104 ? -0.720  -1.538  -11.026 1.00 0.00 ? 124 ARG A HH12 1  
ATOM 1615  H HH21 . ARG A 1 104 ? 0.081   -4.554  -9.571  1.00 0.00 ? 124 ARG A HH21 1  
ATOM 1616  H HH22 . ARG A 1 104 ? -0.692  -3.684  -10.925 1.00 0.00 ? 124 ARG A HH22 1  
ATOM 1617  N N    . ALA A 1 105 ? 2.053   1.718   -2.801  1.00 1.00 ? 125 ALA A N    1  
ATOM 1618  C CA   . ALA A 1 105 ? 1.599   2.942   -2.123  1.00 1.00 ? 125 ALA A CA   1  
ATOM 1619  C C    . ALA A 1 105 ? 1.866   4.266   -2.892  1.00 1.00 ? 125 ALA A C    1  
ATOM 1620  O O    . ALA A 1 105 ? 1.155   5.222   -2.617  1.00 1.00 ? 125 ALA A O    1  
ATOM 1621  C CB   . ALA A 1 105 ? 2.192   2.940   -0.703  1.00 1.00 ? 125 ALA A CB   1  
ATOM 1622  H H    . ALA A 1 105 ? 3.044   1.547   -2.847  1.00 1.00 ? 125 ALA A H    1  
ATOM 1623  H HA   . ALA A 1 105 ? 0.513   2.891   -2.002  1.00 1.00 ? 125 ALA A HA   1  
ATOM 1624  H HB1  . ALA A 1 105 ? 1.887   2.038   -0.169  1.00 1.00 ? 125 ALA A HB1  1  
ATOM 1625  H HB2  . ALA A 1 105 ? 3.280   2.989   -0.738  1.00 1.00 ? 125 ALA A HB2  1  
ATOM 1626  H HB3  . ALA A 1 105 ? 1.814   3.797   -0.147  1.00 1.00 ? 125 ALA A HB3  1  
ATOM 1627  N N    . ILE A 1 106 ? 2.820   4.308   -3.850  1.00 1.00 ? 126 ILE A N    1  
ATOM 1628  C CA   . ILE A 1 106 ? 3.242   5.407   -4.769  1.00 1.00 ? 126 ILE A CA   1  
ATOM 1629  C C    . ILE A 1 106 ? 3.260   6.840   -4.153  1.00 1.00 ? 126 ILE A C    1  
ATOM 1630  O O    . ILE A 1 106 ? 2.235   7.384   -3.734  1.00 1.00 ? 126 ILE A O    1  
ATOM 1631  C CB   . ILE A 1 106 ? 2.490   5.301   -6.134  1.00 1.00 ? 126 ILE A CB   1  
ATOM 1632  C CG1  . ILE A 1 106 ? 3.316   5.785   -7.353  1.00 1.00 ? 126 ILE A CG1  1  
ATOM 1633  C CG2  . ILE A 1 106 ? 1.071   5.905   -6.152  1.00 1.00 ? 126 ILE A CG2  1  
ATOM 1634  C CD1  . ILE A 1 106 ? 3.771   7.247   -7.456  1.00 1.00 ? 126 ILE A CD1  1  
ATOM 1635  H H    . ILE A 1 106 ? 3.300   3.436   -3.993  1.00 1.00 ? 126 ILE A H    1  
ATOM 1636  H HA   . ILE A 1 106 ? 4.283   5.171   -4.999  1.00 1.00 ? 126 ILE A HA   1  
ATOM 1637  H HB   . ILE A 1 106 ? 2.354   4.234   -6.329  1.00 1.00 ? 126 ILE A HB   1  
ATOM 1638  H HG12 . ILE A 1 106 ? 4.302   5.322   -7.333  1.00 0.00 ? 126 ILE A HG12 1  
ATOM 1639  H HG13 . ILE A 1 106 ? 2.803   5.505   -8.276  1.00 1.00 ? 126 ILE A HG13 1  
ATOM 1640  H HG21 . ILE A 1 106 ? 0.479   5.490   -5.334  1.00 1.00 ? 126 ILE A HG21 1  
ATOM 1641  H HG22 . ILE A 1 106 ? 1.111   6.986   -6.036  1.00 1.00 ? 126 ILE A HG22 1  
ATOM 1642  H HG23 . ILE A 1 106 ? 0.574   5.665   -7.095  1.00 1.00 ? 126 ILE A HG23 1  
ATOM 1643  H HD11 . ILE A 1 106 ? 2.955   7.929   -7.216  1.00 1.00 ? 126 ILE A HD11 1  
ATOM 1644  H HD12 . ILE A 1 106 ? 4.613   7.428   -6.792  1.00 1.00 ? 126 ILE A HD12 1  
ATOM 1645  H HD13 . ILE A 1 106 ? 4.106   7.449   -8.474  1.00 1.00 ? 126 ILE A HD13 1  
ATOM 1646  N N    . LYS A 1 107 ? 4.418   7.526   -4.192  1.00 1.00 ? 127 LYS A N    1  
ATOM 1647  C CA   . LYS A 1 107 ? 4.619   8.819   -3.506  1.00 1.00 ? 127 LYS A CA   1  
ATOM 1648  C C    . LYS A 1 107 ? 3.916   9.959   -4.274  1.00 1.00 ? 127 LYS A C    1  
ATOM 1649  O O    . LYS A 1 107 ? 3.962   10.034  -5.505  1.00 1.00 ? 127 LYS A O    1  
ATOM 1650  C CB   . LYS A 1 107 ? 6.125   9.076   -3.315  1.00 1.00 ? 127 LYS A CB   1  
ATOM 1651  C CG   . LYS A 1 107 ? 6.430   9.827   -2.012  1.00 1.00 ? 127 LYS A CG   1  
ATOM 1652  C CD   . LYS A 1 107 ? 7.854   10.396  -1.953  1.00 1.00 ? 127 LYS A CD   1  
ATOM 1653  C CE   . LYS A 1 107 ? 8.324   10.573  -0.508  1.00 1.00 ? 127 LYS A CE   1  
ATOM 1654  N NZ   . LYS A 1 107 ? 9.760   10.888  -0.430  1.00 1.00 ? 127 LYS A NZ   1  
ATOM 1655  H H    . LYS A 1 107 ? 5.218   7.075   -4.603  1.00 1.00 ? 127 LYS A H    1  
ATOM 1656  H HA   . LYS A 1 107 ? 4.161   8.730   -2.521  1.00 1.00 ? 127 LYS A HA   1  
ATOM 1657  H HB2  . LYS A 1 107 ? 6.670   8.142   -3.171  1.00 0.00 ? 127 LYS A HB2  1  
ATOM 1658  H HB3  . LYS A 1 107 ? 6.554   9.578   -4.182  1.00 1.00 ? 127 LYS A HB3  1  
ATOM 1659  H HG2  . LYS A 1 107 ? 5.758   10.683  -1.946  1.00 0.00 ? 127 LYS A HG2  1  
ATOM 1660  H HG3  . LYS A 1 107 ? 6.266   9.145   -1.177  1.00 1.00 ? 127 LYS A HG3  1  
ATOM 1661  H HD2  . LYS A 1 107 ? 8.538   9.700   -2.438  1.00 0.00 ? 127 LYS A HD2  1  
ATOM 1662  H HD3  . LYS A 1 107 ? 7.878   11.358  -2.470  1.00 1.00 ? 127 LYS A HD3  1  
ATOM 1663  H HE2  . LYS A 1 107 ? 7.813   11.421  -0.050  1.00 0.00 ? 127 LYS A HE2  1  
ATOM 1664  H HE3  . LYS A 1 107 ? 8.103   9.671   0.071   1.00 1.00 ? 127 LYS A HE3  1  
ATOM 1665  H HZ1  . LYS A 1 107 ? 9.896   11.902  -0.551  1.00 0.00 ? 127 LYS A HZ1  1  
ATOM 1666  H HZ2  . LYS A 1 107 ? 10.126  10.601  0.490   1.00 0.00 ? 127 LYS A HZ2  1  
ATOM 1667  N N    . ILE A 1 108 ? 3.260   10.850  -3.524  1.00 1.00 ? 128 ILE A N    1  
ATOM 1668  C CA   . ILE A 1 108 ? 2.343   11.894  -4.025  1.00 1.00 ? 128 ILE A CA   1  
ATOM 1669  C C    . ILE A 1 108 ? 3.041   13.237  -4.313  1.00 1.00 ? 128 ILE A C    1  
ATOM 1670  O O    . ILE A 1 108 ? 3.914   13.676  -3.559  1.00 1.00 ? 128 ILE A O    1  
ATOM 1671  C CB   . ILE A 1 108 ? 1.129   12.074  -3.061  1.00 1.00 ? 128 ILE A CB   1  
ATOM 1672  C CG1  . ILE A 1 108 ? 1.457   12.754  -1.710  1.00 1.00 ? 128 ILE A CG1  1  
ATOM 1673  C CG2  . ILE A 1 108 ? 0.396   10.752  -2.752  1.00 1.00 ? 128 ILE A CG2  1  
ATOM 1674  C CD1  . ILE A 1 108 ? 1.103   14.242  -1.620  1.00 1.00 ? 128 ILE A CD1  1  
ATOM 1675  H H    . ILE A 1 108 ? 3.337   10.725  -2.515  1.00 1.00 ? 128 ILE A H    1  
ATOM 1676  H HA   . ILE A 1 108 ? 1.941   11.524  -4.967  1.00 1.00 ? 128 ILE A HA   1  
ATOM 1677  H HB   . ILE A 1 108 ? 0.402   12.699  -3.577  1.00 1.00 ? 128 ILE A HB   1  
ATOM 1678  H HG12 . ILE A 1 108 ? 0.841   12.363  -0.900  1.00 0.00 ? 128 ILE A HG12 1  
ATOM 1679  H HG13 . ILE A 1 108 ? 2.497   12.601  -1.422  1.00 1.00 ? 128 ILE A HG13 1  
ATOM 1680  H HG21 . ILE A 1 108 ? 0.137   10.234  -3.674  1.00 1.00 ? 128 ILE A HG21 1  
ATOM 1681  H HG22 . ILE A 1 108 ? 1.021   10.089  -2.151  1.00 1.00 ? 128 ILE A HG22 1  
ATOM 1682  H HG23 . ILE A 1 108 ? -0.528  10.948  -2.205  1.00 1.00 ? 128 ILE A HG23 1  
ATOM 1683  H HD11 . ILE A 1 108 ? 0.043   14.382  -1.824  1.00 1.00 ? 128 ILE A HD11 1  
ATOM 1684  H HD12 . ILE A 1 108 ? 1.316   14.597  -0.613  1.00 1.00 ? 128 ILE A HD12 1  
ATOM 1685  H HD13 . ILE A 1 108 ? 1.692   14.819  -2.334  1.00 1.00 ? 128 ILE A HD13 1  
ATOM 1686  N N    . THR A 1 109 ? 2.616   13.908  -5.398  1.00 1.00 ? 129 THR A N    1  
ATOM 1687  C CA   . THR A 1 109 ? 3.100   15.264  -5.761  1.00 1.00 ? 129 THR A CA   1  
ATOM 1688  C C    . THR A 1 109 ? 2.279   16.403  -5.121  1.00 1.00 ? 129 THR A C    1  
ATOM 1689  O O    . THR A 1 109 ? 1.054   16.338  -5.003  1.00 1.00 ? 129 THR A O    1  
ATOM 1690  C CB   . THR A 1 109 ? 3.251   15.440  -7.288  1.00 1.00 ? 129 THR A CB   1  
ATOM 1691  O OG1  . THR A 1 109 ? 3.917   16.648  -7.560  1.00 1.00 ? 129 THR A OG1  1  
ATOM 1692  C CG2  . THR A 1 109 ? 1.959   15.496  -8.102  1.00 1.00 ? 129 THR A CG2  1  
ATOM 1693  H H    . THR A 1 109 ? 1.909   13.452  -5.979  1.00 1.00 ? 129 THR A H    1  
ATOM 1694  H HA   . THR A 1 109 ? 4.115   15.354  -5.375  1.00 1.00 ? 129 THR A HA   1  
ATOM 1695  H HB   . THR A 1 109 ? 3.865   14.620  -7.667  1.00 1.00 ? 129 THR A HB   1  
ATOM 1696  H HG1  . THR A 1 109 ? 3.279   17.226  -7.992  1.00 1.00 ? 129 THR A HG1  1  
ATOM 1697  H HG21 . THR A 1 109 ? 1.393   14.594  -7.928  1.00 1.00 ? 129 THR A HG21 1  
ATOM 1698  H HG22 . THR A 1 109 ? 1.348   16.356  -7.826  1.00 1.00 ? 129 THR A HG22 1  
ATOM 1699  H HG23 . THR A 1 109 ? 2.189   15.523  -9.165  1.00 1.00 ? 129 THR A HG23 1  
ATOM 1700  N N    . VAL A 1 110 ? 2.967   17.483  -4.729  1.00 1.00 ? 130 VAL A N    1  
ATOM 1701  C CA   . VAL A 1 110 ? 2.376   18.741  -4.219  1.00 1.00 ? 130 VAL A CA   1  
ATOM 1702  C C    . VAL A 1 110 ? 1.785   19.563  -5.374  1.00 1.00 ? 130 VAL A C    1  
ATOM 1703  O O    . VAL A 1 110 ? 0.630   19.980  -5.308  1.00 1.00 ? 130 VAL A O    1  
ATOM 1704  C CB   . VAL A 1 110 ? 3.421   19.583  -3.435  1.00 1.00 ? 130 VAL A CB   1  
ATOM 1705  C CG1  . VAL A 1 110 ? 2.827   20.900  -2.896  1.00 1.00 ? 130 VAL A CG1  1  
ATOM 1706  C CG2  . VAL A 1 110 ? 3.990   18.782  -2.253  1.00 1.00 ? 130 VAL A CG2  1  
ATOM 1707  H H    . VAL A 1 110 ? 3.963   17.465  -4.891  1.00 1.00 ? 130 VAL A H    1  
ATOM 1708  H HA   . VAL A 1 110 ? 1.560   18.495  -3.538  1.00 1.00 ? 130 VAL A HA   1  
ATOM 1709  H HB   . VAL A 1 110 ? 4.255   19.832  -4.089  1.00 1.00 ? 130 VAL A HB   1  
ATOM 1710  H HG11 . VAL A 1 110 ? 1.982   20.696  -2.239  1.00 1.00 ? 130 VAL A HG11 1  
ATOM 1711  H HG12 . VAL A 1 110 ? 3.586   21.458  -2.348  1.00 1.00 ? 130 VAL A HG12 1  
ATOM 1712  H HG13 . VAL A 1 110 ? 2.499   21.530  -3.724  1.00 1.00 ? 130 VAL A HG13 1  
ATOM 1713  H HG21 . VAL A 1 110 ? 3.165   18.443  -1.627  1.00 1.00 ? 130 VAL A HG21 1  
ATOM 1714  H HG22 . VAL A 1 110 ? 4.542   17.913  -2.612  1.00 1.00 ? 130 VAL A HG22 1  
ATOM 1715  H HG23 . VAL A 1 110 ? 4.675   19.400  -1.672  1.00 1.00 ? 130 VAL A HG23 1  
ATOM 1716  N N    . ASP A 1 111 ? 2.621   19.812  -6.391  1.00 1.00 ? 131 ASP A N    1  
ATOM 1717  C CA   . ASP A 1 111 ? 2.410   20.655  -7.571  1.00 1.00 ? 131 ASP A CA   1  
ATOM 1718  C C    . ASP A 1 111 ? 2.069   19.806  -8.816  1.00 1.00 ? 131 ASP A C    1  
ATOM 1719  O O    . ASP A 1 111 ? 0.922   19.794  -9.251  1.00 1.00 ? 131 ASP A O    1  
ATOM 1720  C CB   . ASP A 1 111 ? 3.664   21.542  -7.801  1.00 1.00 ? 131 ASP A CB   1  
ATOM 1721  C CG   . ASP A 1 111 ? 4.624   21.682  -6.607  1.00 1.00 ? 131 ASP A CG   1  
ATOM 1722  O OD1  . ASP A 1 111 ? 5.301   20.664  -6.328  1.00 1.00 ? 131 ASP A OD1  1  
ATOM 1723  O OD2  . ASP A 1 111 ? 4.595   22.736  -5.936  1.00 1.00 ? 131 ASP A OD2  1  
ATOM 1724  H H    . ASP A 1 111 ? 3.591   19.544  -6.236  1.00 1.00 ? 131 ASP A H    1  
ATOM 1725  H HA   . ASP A 1 111 ? 1.565   21.319  -7.382  1.00 1.00 ? 131 ASP A HA   1  
ATOM 1726  H HB2  . ASP A 1 111 ? 4.236   21.106  -8.620  1.00 0.00 ? 131 ASP A HB2  1  
ATOM 1727  H HB3  . ASP A 1 111 ? 3.378   22.516  -8.210  1.00 1.00 ? 131 ASP A HB3  1  
ATOM 1728  N N    . GLY A 1 112 ? 3.047   19.051  -9.359  1.00 1.00 ? 132 GLY A N    1  
ATOM 1729  C CA   . GLY A 1 112 ? 2.934   18.223  -10.578 1.00 1.00 ? 132 GLY A CA   1  
ATOM 1730  C C    . GLY A 1 112 ? 4.140   18.282  -11.548 1.00 1.00 ? 132 GLY A C    1  
ATOM 1731  O O    . GLY A 1 112 ? 5.090   19.027  -11.298 1.00 1.00 ? 132 GLY A O    1  
ATOM 1732  H H    . GLY A 1 112 ? 3.973   19.173  -8.970  1.00 1.00 ? 132 GLY A H    1  
ATOM 1733  H HA2  . GLY A 1 112 ? 2.793   17.187  -10.285 1.00 1.00 ? 132 GLY A HA2  1  
ATOM 1734  H HA3  . GLY A 1 112 ? 2.047   18.530  -11.135 1.00 1.00 ? 132 GLY A HA3  1  
ATOM 1735  N N    . PRO A 1 113 ? 4.120   17.510  -12.667 1.00 1.00 ? 133 PRO A N    1  
ATOM 1736  C CA   . PRO A 1 113 ? 5.133   17.575  -13.738 1.00 1.00 ? 133 PRO A CA   1  
ATOM 1737  C C    . PRO A 1 113 ? 5.042   18.861  -14.590 1.00 1.00 ? 133 PRO A C    1  
ATOM 1738  O O    . PRO A 1 113 ? 6.070   19.424  -14.964 1.00 1.00 ? 133 PRO A O    1  
ATOM 1739  C CB   . PRO A 1 113 ? 4.902   16.337  -14.610 1.00 1.00 ? 133 PRO A CB   1  
ATOM 1740  C CG   . PRO A 1 113 ? 3.419   16.021  -14.410 1.00 1.00 ? 133 PRO A CG   1  
ATOM 1741  C CD   . PRO A 1 113 ? 3.092   16.529  -13.004 1.00 1.00 ? 133 PRO A CD   1  
ATOM 1742  H HA   . PRO A 1 113 ? 6.135   17.521  -13.309 1.00 1.00 ? 133 PRO A HA   1  
ATOM 1743  H HB2  . PRO A 1 113 ? 5.129   16.549  -15.654 1.00 0.00 ? 133 PRO A HB2  1  
ATOM 1744  H HB3  . PRO A 1 113 ? 5.499   15.507  -14.231 1.00 1.00 ? 133 PRO A HB3  1  
ATOM 1745  H HG2  . PRO A 1 113 ? 2.803   16.527  -15.153 1.00 0.00 ? 133 PRO A HG2  1  
ATOM 1746  H HG3  . PRO A 1 113 ? 3.227   14.951  -14.495 1.00 1.00 ? 133 PRO A HG3  1  
ATOM 1747  H HD2  . PRO A 1 113 ? 2.110   16.998  -12.957 1.00 0.00 ? 133 PRO A HD2  1  
ATOM 1748  H HD3  . PRO A 1 113 ? 3.132   15.698  -12.296 1.00 1.00 ? 133 PRO A HD3  1  
ATOM 1749  N N    . ARG A 1 114 ? 3.805   19.283  -14.909 1.00 1.00 ? 134 ARG A N    1  
ATOM 1750  C CA   . ARG A 1 114 ? 3.324   20.508  -15.570 1.00 1.00 ? 134 ARG A CA   1  
ATOM 1751  C C    . ARG A 1 114 ? 1.787   20.523  -15.565 1.00 1.00 ? 134 ARG A C    1  
ATOM 1752  O O    . ARG A 1 114 ? 1.154   19.474  -15.695 1.00 1.00 ? 134 ARG A O    1  
ATOM 1753  C CB   . ARG A 1 114 ? 3.817   20.652  -17.023 1.00 1.00 ? 134 ARG A CB   1  
ATOM 1754  C CG   . ARG A 1 114 ? 3.789   19.397  -17.903 1.00 1.00 ? 134 ARG A CG   1  
ATOM 1755  C CD   . ARG A 1 114 ? 5.182   18.817  -18.151 1.00 1.00 ? 134 ARG A CD   1  
ATOM 1756  N NE   . ARG A 1 114 ? 5.120   17.349  -18.243 1.00 1.00 ? 134 ARG A NE   1  
ATOM 1757  C CZ   . ARG A 1 114 ? 6.046   16.476  -17.892 1.00 1.00 ? 134 ARG A CZ   1  
ATOM 1758  N NH1  . ARG A 1 114 ? 7.192   16.803  -17.353 1.00 1.00 ? 134 ARG A NH1  1  
ATOM 1759  N NH2  . ARG A 1 114 ? 5.819   15.206  -18.040 1.00 1.00 ? 134 ARG A NH2  1  
ATOM 1760  H H    . ARG A 1 114 ? 3.051   18.691  -14.590 1.00 1.00 ? 134 ARG A H    1  
ATOM 1761  H HA   . ARG A 1 114 ? 3.670   21.373  -14.998 1.00 1.00 ? 134 ARG A HA   1  
ATOM 1762  H HB2  . ARG A 1 114 ? 3.109   21.219  -17.627 1.00 0.00 ? 134 ARG A HB2  1  
ATOM 1763  H HB3  . ARG A 1 114 ? 4.773   21.168  -17.066 1.00 1.00 ? 134 ARG A HB3  1  
ATOM 1764  H HG2  . ARG A 1 114 ? 3.219   18.612  -17.407 1.00 0.00 ? 134 ARG A HG2  1  
ATOM 1765  H HG3  . ARG A 1 114 ? 3.324   19.627  -18.859 1.00 1.00 ? 134 ARG A HG3  1  
ATOM 1766  H HD2  . ARG A 1 114 ? 5.572   19.179  -19.102 1.00 0.00 ? 134 ARG A HD2  1  
ATOM 1767  H HD3  . ARG A 1 114 ? 5.859   19.119  -17.352 1.00 1.00 ? 134 ARG A HD3  1  
ATOM 1768  H HE   . ARG A 1 114 ? 4.261   16.952  -18.579 1.00 1.00 ? 134 ARG A HE   1  
ATOM 1769  H HH11 . ARG A 1 114 ? 7.416   17.793  -17.179 1.00 0.00 ? 134 ARG A HH11 1  
ATOM 1770  H HH12 . ARG A 1 114 ? 7.870   16.070  -17.102 1.00 0.00 ? 134 ARG A HH12 1  
ATOM 1771  H HH21 . ARG A 1 114 ? 4.922   14.885  -18.429 1.00 0.00 ? 134 ARG A HH21 1  
ATOM 1772  H HH22 . ARG A 1 114 ? 6.538   14.520  -17.768 1.00 0.00 ? 134 ARG A HH22 1  
ATOM 1773  N N    . GLU A 1 115 ? 1.236   21.729  -15.432 1.00 1.00 ? 135 GLU A N    1  
ATOM 1774  C CA   . GLU A 1 115 ? -0.190  22.107  -15.511 1.00 1.00 ? 135 GLU A CA   1  
ATOM 1775  C C    . GLU A 1 115 ? -0.370  23.449  -16.249 1.00 1.00 ? 135 GLU A C    1  
ATOM 1776  O O    . GLU A 1 115 ? 0.335   24.417  -15.876 1.00 1.00 ? 135 GLU A O    1  
ATOM 1777  C CB   . GLU A 1 115 ? -0.796  22.161  -14.096 1.00 1.00 ? 135 GLU A CB   1  
ATOM 1778  C CG   . GLU A 1 115 ? -0.811  20.793  -13.389 1.00 1.00 ? 135 GLU A CG   1  
ATOM 1779  C CD   . GLU A 1 115 ? -2.199  20.287  -12.974 1.00 1.00 ? 135 GLU A CD   1  
ATOM 1780  O OE1  . GLU A 1 115 ? -2.826  20.924  -12.096 1.00 1.00 ? 135 GLU A OE1  1  
ATOM 1781  O OE2  . GLU A 1 115 ? -2.615  19.246  -13.533 1.00 1.00 ? 135 GLU A OE2  1  
ATOM 1782  O OXT  . GLU A 1 115 ? -1.180  23.468  -17.199 1.00 1.00 ? 135 GLU A OXT  1  
ATOM 1783  H H    . GLU A 1 115 ? 1.878   22.497  -15.312 1.00 1.00 ? 135 GLU A H    1  
ATOM 1784  H HA   . GLU A 1 115 ? -0.739  21.368  -16.098 1.00 1.00 ? 135 GLU A HA   1  
ATOM 1785  H HB2  . GLU A 1 115 ? -0.174  22.776  -13.447 1.00 0.00 ? 135 GLU A HB2  1  
ATOM 1786  H HB3  . GLU A 1 115 ? -1.798  22.589  -14.134 1.00 1.00 ? 135 GLU A HB3  1  
ATOM 1787  H HG2  . GLU A 1 115 ? -0.527  20.001  -14.083 1.00 0.00 ? 135 GLU A HG2  1  
ATOM 1788  H HG3  . GLU A 1 115 ? -0.108  20.787  -12.551 1.00 1.00 ? 135 GLU A HG3  1  
ATOM 1789  N N    . GLU A 1 1   ? -8.515  -12.108 -11.145 1.00 1.00 ? 21  GLU A N    2  
ATOM 1790  C CA   . GLU A 1 1   ? -7.900  -10.899 -10.541 1.00 1.00 ? 21  GLU A CA   2  
ATOM 1791  C C    . GLU A 1 1   ? -8.499  -9.581  -11.024 1.00 1.00 ? 21  GLU A C    2  
ATOM 1792  O O    . GLU A 1 1   ? -9.031  -9.507  -12.129 1.00 1.00 ? 21  GLU A O    2  
ATOM 1793  C CB   . GLU A 1 1   ? -6.372  -10.952 -10.701 1.00 1.00 ? 21  GLU A CB   2  
ATOM 1794  C CG   . GLU A 1 1   ? -5.737  -11.367 -9.370  1.00 1.00 ? 21  GLU A CG   2  
ATOM 1795  C CD   . GLU A 1 1   ? -5.963  -12.813 -8.925  1.00 1.00 ? 21  GLU A CD   2  
ATOM 1796  O OE1  . GLU A 1 1   ? -6.957  -13.419 -9.398  1.00 1.00 ? 21  GLU A OE1  2  
ATOM 1797  O OE2  . GLU A 1 1   ? -5.127  -13.261 -8.115  1.00 1.00 ? 21  GLU A OE2  2  
ATOM 1798  H H1   . GLU A 1 1   ? -8.074  -12.951 -10.752 1.00 0.00 ? 21  GLU A H1   2  
ATOM 1799  H H2   . GLU A 1 1   ? -9.525  -12.120 -10.938 1.00 0.00 ? 21  GLU A H2   2  
ATOM 1800  H HA   . GLU A 1 1   ? -8.110  -10.941 -9.469  1.00 1.00 ? 21  GLU A HA   2  
ATOM 1801  H HB2  . GLU A 1 1   ? -6.069  -11.665 -11.467 1.00 0.00 ? 21  GLU A HB2  2  
ATOM 1802  H HB3  . GLU A 1 1   ? -5.961  -9.982  -10.988 1.00 1.00 ? 21  GLU A HB3  2  
ATOM 1803  H HG2  . GLU A 1 1   ? -4.651  -11.331 -9.452  1.00 0.00 ? 21  GLU A HG2  2  
ATOM 1804  H HG3  . GLU A 1 1   ? -6.059  -10.690 -8.580  1.00 1.00 ? 21  GLU A HG3  2  
ATOM 1805  N N    . LEU A 1 2   ? -8.410  -8.572  -10.151 1.00 1.00 ? 22  LEU A N    2  
ATOM 1806  C CA   . LEU A 1 2   ? -8.959  -7.219  -10.187 1.00 1.00 ? 22  LEU A CA   2  
ATOM 1807  C C    . LEU A 1 2   ? -7.940  -6.351  -9.414  1.00 1.00 ? 22  LEU A C    2  
ATOM 1808  O O    . LEU A 1 2   ? -6.811  -6.804  -9.166  1.00 1.00 ? 22  LEU A O    2  
ATOM 1809  C CB   . LEU A 1 2   ? -10.365 -7.228  -9.536  1.00 1.00 ? 22  LEU A CB   2  
ATOM 1810  C CG   . LEU A 1 2   ? -11.647 -7.218  -10.402 1.00 1.00 ? 22  LEU A CG   2  
ATOM 1811  C CD1  . LEU A 1 2   ? -11.556 -6.281  -11.614 1.00 1.00 ? 22  LEU A CD1  2  
ATOM 1812  C CD2  . LEU A 1 2   ? -12.063 -8.628  -10.838 1.00 1.00 ? 22  LEU A CD2  2  
ATOM 1813  H H    . LEU A 1 2   ? -7.803  -8.618  -9.315  1.00 1.00 ? 22  LEU A H    2  
ATOM 1814  H HA   . LEU A 1 2   ? -9.001  -6.856  -11.215 1.00 1.00 ? 22  LEU A HA   2  
ATOM 1815  H HB2  . LEU A 1 2   ? -10.561 -8.183  -9.048  1.00 0.00 ? 22  LEU A HB2  2  
ATOM 1816  H HB3  . LEU A 1 2   ? -10.450 -6.444  -8.788  1.00 1.00 ? 22  LEU A HB3  2  
ATOM 1817  H HG   . LEU A 1 2   ? -12.452 -6.842  -9.764  1.00 1.00 ? 22  LEU A HG   2  
ATOM 1818  H HD11 . LEU A 1 2   ? -11.201 -5.301  -11.299 1.00 1.00 ? 22  LEU A HD11 2  
ATOM 1819  H HD12 . LEU A 1 2   ? -10.876 -6.696  -12.359 1.00 1.00 ? 22  LEU A HD12 2  
ATOM 1820  H HD13 . LEU A 1 2   ? -12.542 -6.169  -12.065 1.00 1.00 ? 22  LEU A HD13 2  
ATOM 1821  H HD21 . LEU A 1 2   ? -12.106 -9.295  -9.976  1.00 1.00 ? 22  LEU A HD21 2  
ATOM 1822  H HD22 . LEU A 1 2   ? -13.048 -8.591  -11.301 1.00 1.00 ? 22  LEU A HD22 2  
ATOM 1823  H HD23 . LEU A 1 2   ? -11.361 -9.021  -11.565 1.00 1.00 ? 22  LEU A HD23 2  
ATOM 1824  N N    . VAL A 1 3   ? -8.223  -5.068  -9.149  1.00 1.00 ? 23  VAL A N    2  
ATOM 1825  C CA   . VAL A 1 3   ? -7.382  -4.301  -8.197  1.00 1.00 ? 23  VAL A CA   2  
ATOM 1826  C C    . VAL A 1 3   ? -7.549  -4.950  -6.790  1.00 1.00 ? 23  VAL A C    2  
ATOM 1827  O O    . VAL A 1 3   ? -8.281  -4.449  -5.936  1.00 1.00 ? 23  VAL A O    2  
ATOM 1828  C CB   . VAL A 1 3   ? -7.703  -2.779  -8.187  1.00 1.00 ? 23  VAL A CB   2  
ATOM 1829  C CG1  . VAL A 1 3   ? -6.762  -1.975  -7.265  1.00 1.00 ? 23  VAL A CG1  2  
ATOM 1830  C CG2  . VAL A 1 3   ? -7.653  -2.137  -9.586  1.00 1.00 ? 23  VAL A CG2  2  
ATOM 1831  H H    . VAL A 1 3   ? -9.137  -4.691  -9.385  1.00 1.00 ? 23  VAL A H    2  
ATOM 1832  H HA   . VAL A 1 3   ? -6.332  -4.396  -8.481  1.00 1.00 ? 23  VAL A HA   2  
ATOM 1833  H HB   . VAL A 1 3   ? -8.716  -2.650  -7.824  1.00 1.00 ? 23  VAL A HB   2  
ATOM 1834  H HG11 . VAL A 1 3   ? -6.826  -2.339  -6.238  1.00 1.00 ? 23  VAL A HG11 2  
ATOM 1835  H HG12 . VAL A 1 3   ? -5.732  -2.058  -7.609  1.00 1.00 ? 23  VAL A HG12 2  
ATOM 1836  H HG13 . VAL A 1 3   ? -7.058  -0.924  -7.258  1.00 1.00 ? 23  VAL A HG13 2  
ATOM 1837  H HG21 . VAL A 1 3   ? -6.658  -2.252  -10.020 1.00 1.00 ? 23  VAL A HG21 2  
ATOM 1838  H HG22 . VAL A 1 3   ? -8.389  -2.610  -10.237 1.00 1.00 ? 23  VAL A HG22 2  
ATOM 1839  H HG23 . VAL A 1 3   ? -7.902  -1.074  -9.519  1.00 1.00 ? 23  VAL A HG23 2  
ATOM 1840  N N    . ARG A 1 4   ? -6.939  -6.141  -6.587  1.00 1.00 ? 24  ARG A N    2  
ATOM 1841  C CA   . ARG A 1 4   ? -6.810  -6.792  -5.261  1.00 1.00 ? 24  ARG A CA   2  
ATOM 1842  C C    . ARG A 1 4   ? -6.011  -5.917  -4.260  1.00 1.00 ? 24  ARG A C    2  
ATOM 1843  O O    . ARG A 1 4   ? -5.366  -4.930  -4.636  1.00 1.00 ? 24  ARG A O    2  
ATOM 1844  C CB   . ARG A 1 4   ? -6.161  -8.179  -5.414  1.00 1.00 ? 24  ARG A CB   2  
ATOM 1845  C CG   . ARG A 1 4   ? -4.662  -8.203  -5.755  1.00 1.00 ? 24  ARG A CG   2  
ATOM 1846  C CD   . ARG A 1 4   ? -4.445  -8.485  -7.245  1.00 1.00 ? 24  ARG A CD   2  
ATOM 1847  N NE   . ARG A 1 4   ? -3.295  -9.369  -7.537  1.00 1.00 ? 24  ARG A NE   2  
ATOM 1848  C CZ   . ARG A 1 4   ? -3.250  -10.677 -7.345  1.00 1.00 ? 24  ARG A CZ   2  
ATOM 1849  N NH1  . ARG A 1 4   ? -4.098  -11.339 -6.626  1.00 1.00 ? 24  ARG A NH1  2  
ATOM 1850  N NH2  . ARG A 1 4   ? -2.372  -11.428 -7.940  1.00 1.00 ? 24  ARG A NH2  2  
ATOM 1851  H H    . ARG A 1 4   ? -6.773  -6.700  -7.446  1.00 1.00 ? 24  ARG A H    2  
ATOM 1852  H HA   . ARG A 1 4   ? -7.811  -6.933  -4.841  1.00 1.00 ? 24  ARG A HA   2  
ATOM 1853  H HB2  . ARG A 1 4   ? -6.043  -8.692  -4.460  1.00 0.00 ? 24  ARG A HB2  2  
ATOM 1854  H HB3  . ARG A 1 4   ? -6.747  -8.846  -6.052  1.00 1.00 ? 24  ARG A HB3  2  
ATOM 1855  H HG2  . ARG A 1 4   ? -4.244  -7.221  -5.531  1.00 0.00 ? 24  ARG A HG2  2  
ATOM 1856  H HG3  . ARG A 1 4   ? -4.184  -8.969  -5.148  1.00 1.00 ? 24  ARG A HG3  2  
ATOM 1857  H HD2  . ARG A 1 4   ? -5.260  -9.080  -7.656  1.00 0.00 ? 24  ARG A HD2  2  
ATOM 1858  H HD3  . ARG A 1 4   ? -4.389  -7.558  -7.819  1.00 1.00 ? 24  ARG A HD3  2  
ATOM 1859  H HE   . ARG A 1 4   ? -2.583  -9.011  -8.146  1.00 1.00 ? 24  ARG A HE   2  
ATOM 1860  H HH11 . ARG A 1 4   ? -4.871  -10.846 -6.158  1.00 0.00 ? 24  ARG A HH11 2  
ATOM 1861  H HH12 . ARG A 1 4   ? -3.999  -12.359 -6.522  1.00 0.00 ? 24  ARG A HH12 2  
ATOM 1862  H HH21 . ARG A 1 4   ? -1.686  -11.008 -8.582  1.00 0.00 ? 24  ARG A HH21 2  
ATOM 1863  H HH22 . ARG A 1 4   ? -2.365  -12.444 -7.770  1.00 0.00 ? 24  ARG A HH22 2  
ATOM 1864  N N    . THR A 1 5   ? -6.017  -6.301  -2.977  1.00 1.00 ? 25  THR A N    2  
ATOM 1865  C CA   . THR A 1 5   ? -5.355  -5.560  -1.883  1.00 1.00 ? 25  THR A CA   2  
ATOM 1866  C C    . THR A 1 5   ? -4.538  -6.533  -1.006  1.00 1.00 ? 25  THR A C    2  
ATOM 1867  O O    . THR A 1 5   ? -3.527  -7.042  -1.484  1.00 1.00 ? 25  THR A O    2  
ATOM 1868  C CB   . THR A 1 5   ? -6.369  -4.652  -1.135  1.00 1.00 ? 25  THR A CB   2  
ATOM 1869  O OG1  . THR A 1 5   ? -7.371  -5.402  -0.479  1.00 1.00 ? 25  THR A OG1  2  
ATOM 1870  C CG2  . THR A 1 5   ? -7.053  -3.615  -2.035  1.00 1.00 ? 25  THR A CG2  2  
ATOM 1871  H H    . THR A 1 5   ? -6.504  -7.150  -2.716  1.00 1.00 ? 25  THR A H    2  
ATOM 1872  H HA   . THR A 1 5   ? -4.611  -4.889  -2.316  1.00 1.00 ? 25  THR A HA   2  
ATOM 1873  H HB   . THR A 1 5   ? -5.838  -4.084  -0.386  1.00 1.00 ? 25  THR A HB   2  
ATOM 1874  H HG1  . THR A 1 5   ? -7.997  -4.776  -0.103  1.00 1.00 ? 25  THR A HG1  2  
ATOM 1875  H HG21 . THR A 1 5   ? -6.291  -3.047  -2.569  1.00 1.00 ? 25  THR A HG21 2  
ATOM 1876  H HG22 . THR A 1 5   ? -7.704  -4.103  -2.762  1.00 1.00 ? 25  THR A HG22 2  
ATOM 1877  H HG23 . THR A 1 5   ? -7.642  -2.926  -1.430  1.00 1.00 ? 25  THR A HG23 2  
ATOM 1878  N N    . ASP A 1 6   ? -5.001  -6.877  0.202   1.00 1.00 ? 26  ASP A N    2  
ATOM 1879  C CA   . ASP A 1 6   ? -4.448  -7.840  1.157   1.00 1.00 ? 26  ASP A CA   2  
ATOM 1880  C C    . ASP A 1 6   ? -5.625  -8.570  1.854   1.00 1.00 ? 26  ASP A C    2  
ATOM 1881  O O    . ASP A 1 6   ? -5.884  -8.365  3.046   1.00 1.00 ? 26  ASP A O    2  
ATOM 1882  C CB   . ASP A 1 6   ? -3.526  -7.068  2.137   1.00 1.00 ? 26  ASP A CB   2  
ATOM 1883  C CG   . ASP A 1 6   ? -2.051  -7.015  1.728   1.00 1.00 ? 26  ASP A CG   2  
ATOM 1884  O OD1  . ASP A 1 6   ? -1.370  -8.036  1.960   1.00 1.00 ? 26  ASP A OD1  2  
ATOM 1885  O OD2  . ASP A 1 6   ? -1.609  -5.946  1.246   1.00 1.00 ? 26  ASP A OD2  2  
ATOM 1886  H H    . ASP A 1 6   ? -5.818  -6.374  0.518   1.00 1.00 ? 26  ASP A H    2  
ATOM 1887  H HA   . ASP A 1 6   ? -3.855  -8.598  0.636   1.00 1.00 ? 26  ASP A HA   2  
ATOM 1888  H HB2  . ASP A 1 6   ? -3.885  -6.041  2.203   1.00 0.00 ? 26  ASP A HB2  2  
ATOM 1889  H HB3  . ASP A 1 6   ? -3.589  -7.457  3.157   1.00 1.00 ? 26  ASP A HB3  2  
ATOM 1890  N N    . SER A 1 7   ? -6.438  -9.360  1.113   1.00 1.00 ? 27  SER A N    2  
ATOM 1891  C CA   . SER A 1 7   ? -7.523  -10.158 1.720   1.00 1.00 ? 27  SER A CA   2  
ATOM 1892  C C    . SER A 1 7   ? -7.978  -11.374 0.898   1.00 1.00 ? 27  SER A C    2  
ATOM 1893  O O    . SER A 1 7   ? -7.743  -11.419 -0.315  1.00 1.00 ? 27  SER A O    2  
ATOM 1894  C CB   . SER A 1 7   ? -8.732  -9.236  1.932   1.00 1.00 ? 27  SER A CB   2  
ATOM 1895  O OG   . SER A 1 7   ? -8.479  -8.397  3.036   1.00 1.00 ? 27  SER A OG   2  
ATOM 1896  H H    . SER A 1 7   ? -6.405  -9.363  0.091   1.00 1.00 ? 27  SER A H    2  
ATOM 1897  H HA   . SER A 1 7   ? -7.188  -10.524 2.691   1.00 1.00 ? 27  SER A HA   2  
ATOM 1898  H HB2  . SER A 1 7   ? -8.905  -8.589  1.072   1.00 0.00 ? 27  SER A HB2  2  
ATOM 1899  H HB3  . SER A 1 7   ? -9.646  -9.798  2.095   1.00 1.00 ? 27  SER A HB3  2  
ATOM 1900  H HG   . SER A 1 7   ? -7.498  -8.332  3.131   1.00 1.00 ? 27  SER A HG   2  
ATOM 1901  N N    . PRO A 1 8   ? -8.674  -12.357 1.515   1.00 1.00 ? 28  PRO A N    2  
ATOM 1902  C CA   . PRO A 1 8   ? -9.326  -13.436 0.773   1.00 1.00 ? 28  PRO A CA   2  
ATOM 1903  C C    . PRO A 1 8   ? -10.409 -12.847 -0.157  1.00 1.00 ? 28  PRO A C    2  
ATOM 1904  O O    . PRO A 1 8   ? -11.033 -11.829 0.153   1.00 1.00 ? 28  PRO A O    2  
ATOM 1905  C CB   . PRO A 1 8   ? -9.922  -14.381 1.824   1.00 1.00 ? 28  PRO A CB   2  
ATOM 1906  C CG   . PRO A 1 8   ? -10.120 -13.471 3.038   1.00 1.00 ? 28  PRO A CG   2  
ATOM 1907  C CD   . PRO A 1 8   ? -9.008  -12.430 2.931   1.00 1.00 ? 28  PRO A CD   2  
ATOM 1908  H HA   . PRO A 1 8   ? -8.588  -13.969 0.175   1.00 1.00 ? 28  PRO A HA   2  
ATOM 1909  H HB2  . PRO A 1 8   ? -10.864 -14.809 1.478   1.00 0.00 ? 28  PRO A HB2  2  
ATOM 1910  H HB3  . PRO A 1 8   ? -9.184  -15.149 2.074   1.00 1.00 ? 28  PRO A HB3  2  
ATOM 1911  H HG2  . PRO A 1 8   ? -11.092 -12.980 3.021   1.00 0.00 ? 28  PRO A HG2  2  
ATOM 1912  H HG3  . PRO A 1 8   ? -10.060 -14.027 3.972   1.00 1.00 ? 28  PRO A HG3  2  
ATOM 1913  H HD2  . PRO A 1 8   ? -9.327  -11.453 3.292   1.00 0.00 ? 28  PRO A HD2  2  
ATOM 1914  H HD3  . PRO A 1 8   ? -8.138  -12.752 3.508   1.00 1.00 ? 28  PRO A HD3  2  
ATOM 1915  N N    . ASN A 1 9   ? -10.622 -13.467 -1.329  1.00 1.00 ? 29  ASN A N    2  
ATOM 1916  C CA   . ASN A 1 9   ? -11.623 -13.060 -2.325  1.00 1.00 ? 29  ASN A CA   2  
ATOM 1917  C C    . ASN A 1 9   ? -11.525 -11.557 -2.743  1.00 1.00 ? 29  ASN A C    2  
ATOM 1918  O O    . ASN A 1 9   ? -12.532 -10.952 -3.118  1.00 1.00 ? 29  ASN A O    2  
ATOM 1919  C CB   . ASN A 1 9   ? -13.027 -13.491 -1.826  1.00 1.00 ? 29  ASN A CB   2  
ATOM 1920  C CG   . ASN A 1 9   ? -13.386 -14.965 -1.982  1.00 1.00 ? 29  ASN A CG   2  
ATOM 1921  O OD1  . ASN A 1 9   ? -12.863 -15.858 -1.335  1.00 1.00 ? 29  ASN A OD1  2  
ATOM 1922  N ND2  . ASN A 1 9   ? -14.322 -15.256 -2.859  1.00 1.00 ? 29  ASN A ND2  2  
ATOM 1923  H H    . ASN A 1 9   ? -9.986  -14.207 -1.571  1.00 1.00 ? 29  ASN A H    2  
ATOM 1924  H HA   . ASN A 1 9   ? -11.421 -13.620 -3.238  1.00 1.00 ? 29  ASN A HA   2  
ATOM 1925  H HB2  . ASN A 1 9   ? -13.192 -13.184 -0.793  1.00 1.00 ? 29  ASN A HB2  2  
ATOM 1926  H HB3  . ASN A 1 9   ? -13.817 -13.047 -2.432  1.00 0.00 ? 29  ASN A HB3  2  
ATOM 1927  H HD21 . ASN A 1 9   ? -14.773 -14.504 -3.399  1.00 0.00 ? 29  ASN A HD21 2  
ATOM 1928  H HD22 . ASN A 1 9   ? -14.604 -16.236 -3.005  1.00 0.00 ? 29  ASN A HD22 2  
ATOM 1929  N N    . PHE A 1 10  ? -10.311 -10.977 -2.770  1.00 1.00 ? 30  PHE A N    2  
ATOM 1930  C CA   . PHE A 1 10  ? -10.075 -9.538  -3.001  1.00 1.00 ? 30  PHE A CA   2  
ATOM 1931  C C    . PHE A 1 10  ? -10.116 -9.102  -4.482  1.00 1.00 ? 30  PHE A C    2  
ATOM 1932  O O    . PHE A 1 10  ? -9.229  -9.415  -5.289  1.00 1.00 ? 30  PHE A O    2  
ATOM 1933  C CB   . PHE A 1 10  ? -8.729  -9.139  -2.366  1.00 1.00 ? 30  PHE A CB   2  
ATOM 1934  C CG   . PHE A 1 10  ? -7.407  -9.819  -2.764  1.00 1.00 ? 30  PHE A CG   2  
ATOM 1935  C CD1  . PHE A 1 10  ? -7.311  -10.944 -3.628  1.00 1.00 ? 30  PHE A CD1  2  
ATOM 1936  C CD2  . PHE A 1 10  ? -6.233  -9.324  -2.162  1.00 1.00 ? 30  PHE A CD2  2  
ATOM 1937  C CE1  . PHE A 1 10  ? -6.059  -11.546 -3.882  1.00 1.00 ? 30  PHE A CE1  2  
ATOM 1938  C CE2  . PHE A 1 10  ? -4.980  -9.923  -2.408  1.00 1.00 ? 30  PHE A CE2  2  
ATOM 1939  C CZ   . PHE A 1 10  ? -4.893  -11.036 -3.269  1.00 1.00 ? 30  PHE A CZ   2  
ATOM 1940  H H    . PHE A 1 10  ? -9.553  -11.463 -2.286  1.00 1.00 ? 30  PHE A H    2  
ATOM 1941  H HA   . PHE A 1 10  ? -10.847 -8.976  -2.478  1.00 1.00 ? 30  PHE A HA   2  
ATOM 1942  H HB2  . PHE A 1 10  ? -8.451  -8.141  -2.707  1.00 0.00 ? 30  PHE A HB2  2  
ATOM 1943  H HB3  . PHE A 1 10  ? -8.828  -9.142  -1.278  1.00 1.00 ? 30  PHE A HB3  2  
ATOM 1944  H HD1  . PHE A 1 10  ? -8.186  -11.368 -4.100  1.00 1.00 ? 30  PHE A HD1  2  
ATOM 1945  H HD2  . PHE A 1 10  ? -6.308  -8.494  -1.480  1.00 1.00 ? 30  PHE A HD2  2  
ATOM 1946  H HE1  . PHE A 1 10  ? -6.002  -12.414 -4.524  1.00 1.00 ? 30  PHE A HE1  2  
ATOM 1947  H HE2  . PHE A 1 10  ? -4.095  -9.539  -1.921  1.00 1.00 ? 30  PHE A HE2  2  
ATOM 1948  H HZ   . PHE A 1 10  ? -3.937  -11.507 -3.442  1.00 1.00 ? 30  PHE A HZ   2  
ATOM 1949  N N    . LEU A 1 11  ? -11.164 -8.346  -4.832  1.00 1.00 ? 31  LEU A N    2  
ATOM 1950  C CA   . LEU A 1 11  ? -11.370 -7.724  -6.154  1.00 1.00 ? 31  LEU A CA   2  
ATOM 1951  C C    . LEU A 1 11  ? -11.952 -6.292  -6.073  1.00 1.00 ? 31  LEU A C    2  
ATOM 1952  O O    . LEU A 1 11  ? -13.085 -6.082  -5.635  1.00 1.00 ? 31  LEU A O    2  
ATOM 1953  C CB   . LEU A 1 11  ? -12.172 -8.680  -7.063  1.00 1.00 ? 31  LEU A CB   2  
ATOM 1954  C CG   . LEU A 1 11  ? -13.664 -8.942  -6.755  1.00 1.00 ? 31  LEU A CG   2  
ATOM 1955  C CD1  . LEU A 1 11  ? -14.529 -8.169  -7.763  1.00 1.00 ? 31  LEU A CD1  2  
ATOM 1956  C CD2  . LEU A 1 11  ? -14.014 -10.434 -6.845  1.00 1.00 ? 31  LEU A CD2  2  
ATOM 1957  H H    . LEU A 1 11  ? -11.817 -8.125  -4.066  1.00 1.00 ? 31  LEU A H    2  
ATOM 1958  H HA   . LEU A 1 11  ? -10.389 -7.639  -6.622  1.00 1.00 ? 31  LEU A HA   2  
ATOM 1959  H HB2  . LEU A 1 11  ? -12.339 -8.215  -8.034  1.00 0.00 ? 31  LEU A HB2  2  
ATOM 1960  H HB3  . LEU A 1 11  ? -11.616 -9.611  -7.203  1.00 1.00 ? 31  LEU A HB3  2  
ATOM 1961  H HG   . LEU A 1 11  ? -13.903 -8.605  -5.747  1.00 1.00 ? 31  LEU A HG   2  
ATOM 1962  H HD11 . LEU A 1 11  ? -14.307 -7.105  -7.714  1.00 1.00 ? 31  LEU A HD11 2  
ATOM 1963  H HD12 . LEU A 1 11  ? -14.345 -8.527  -8.776  1.00 1.00 ? 31  LEU A HD12 2  
ATOM 1964  H HD13 . LEU A 1 11  ? -15.582 -8.309  -7.521  1.00 1.00 ? 31  LEU A HD13 2  
ATOM 1965  H HD21 . LEU A 1 11  ? -13.788 -10.817 -7.841  1.00 1.00 ? 31  LEU A HD21 2  
ATOM 1966  H HD22 . LEU A 1 11  ? -13.433 -10.988 -6.109  1.00 1.00 ? 31  LEU A HD22 2  
ATOM 1967  H HD23 . LEU A 1 11  ? -15.075 -10.580 -6.635  1.00 1.00 ? 31  LEU A HD23 2  
ATOM 1968  N N    . CYS A 1 12  ? -11.176 -5.292  -6.520  1.00 1.00 ? 32  CYS A N    2  
ATOM 1969  C CA   . CYS A 1 12  ? -11.596 -3.889  -6.608  1.00 1.00 ? 32  CYS A CA   2  
ATOM 1970  C C    . CYS A 1 12  ? -11.391 -3.233  -8.001  1.00 1.00 ? 32  CYS A C    2  
ATOM 1971  O O    . CYS A 1 12  ? -10.769 -3.772  -8.926  1.00 1.00 ? 32  CYS A O    2  
ATOM 1972  C CB   . CYS A 1 12  ? -11.018 -3.148  -5.379  1.00 1.00 ? 32  CYS A CB   2  
ATOM 1973  S SG   . CYS A 1 12  ? -9.989  -1.679  -5.645  1.00 1.00 ? 32  CYS A SG   2  
ATOM 1974  H H    . CYS A 1 12  ? -10.197 -5.466  -6.703  1.00 1.00 ? 32  CYS A H    2  
ATOM 1975  H HA   . CYS A 1 12  ? -12.676 -3.871  -6.470  1.00 1.00 ? 32  CYS A HA   2  
ATOM 1976  H HB2  . CYS A 1 12  ? -11.788 -2.625  -4.812  1.00 0.00 ? 32  CYS A HB2  2  
ATOM 1977  H HB3  . CYS A 1 12  ? -10.524 -3.829  -4.678  1.00 1.00 ? 32  CYS A HB3  2  
ATOM 1978  H HG   . CYS A 1 12  ? -10.906 -0.958  -6.293  1.00 1.00 ? 32  CYS A HG   2  
ATOM 1979  N N    . SER A 1 13  ? -12.035 -2.077  -8.189  1.00 1.00 ? 33  SER A N    2  
ATOM 1980  C CA   . SER A 1 13  ? -12.031 -1.197  -9.360  1.00 1.00 ? 33  SER A CA   2  
ATOM 1981  C C    . SER A 1 13  ? -12.283 0.251   -8.898  1.00 1.00 ? 33  SER A C    2  
ATOM 1982  O O    . SER A 1 13  ? -13.416 0.701   -8.703  1.00 1.00 ? 33  SER A O    2  
ATOM 1983  C CB   . SER A 1 13  ? -13.041 -1.670  -10.411 1.00 1.00 ? 33  SER A CB   2  
ATOM 1984  O OG   . SER A 1 13  ? -12.668 -2.947  -10.889 1.00 1.00 ? 33  SER A OG   2  
ATOM 1985  H H    . SER A 1 13  ? -12.709 -1.834  -7.463  1.00 1.00 ? 33  SER A H    2  
ATOM 1986  H HA   . SER A 1 13  ? -11.046 -1.236  -9.831  1.00 1.00 ? 33  SER A HA   2  
ATOM 1987  H HB2  . SER A 1 13  ? -14.036 -1.726  -9.970  1.00 0.00 ? 33  SER A HB2  2  
ATOM 1988  H HB3  . SER A 1 13  ? -13.059 -0.970  -11.249 1.00 1.00 ? 33  SER A HB3  2  
ATOM 1989  H HG   . SER A 1 13  ? -11.970 -3.288  -10.296 1.00 1.00 ? 33  SER A HG   2  
ATOM 1990  N N    . VAL A 1 14  ? -11.156 0.934   -8.675  1.00 1.00 ? 34  VAL A N    2  
ATOM 1991  C CA   . VAL A 1 14  ? -10.929 2.359   -8.369  1.00 1.00 ? 34  VAL A CA   2  
ATOM 1992  C C    . VAL A 1 14  ? -9.738  2.839   -9.219  1.00 1.00 ? 34  VAL A C    2  
ATOM 1993  O O    . VAL A 1 14  ? -8.846  2.047   -9.552  1.00 1.00 ? 34  VAL A O    2  
ATOM 1994  C CB   . VAL A 1 14  ? -10.700 2.589   -6.845  1.00 1.00 ? 34  VAL A CB   2  
ATOM 1995  C CG1  . VAL A 1 14  ? -9.456  1.874   -6.283  1.00 1.00 ? 34  VAL A CG1  2  
ATOM 1996  C CG2  . VAL A 1 14  ? -10.586 4.077   -6.461  1.00 1.00 ? 34  VAL A CG2  2  
ATOM 1997  H H    . VAL A 1 14  ? -10.302 0.424   -8.853  1.00 1.00 ? 34  VAL A H    2  
ATOM 1998  H HA   . VAL A 1 14  ? -11.818 2.919   -8.665  1.00 1.00 ? 34  VAL A HA   2  
ATOM 1999  H HB   . VAL A 1 14  ? -11.575 2.193   -6.325  1.00 1.00 ? 34  VAL A HB   2  
ATOM 2000  H HG11 . VAL A 1 14  ? -9.455  0.831   -6.584  1.00 1.00 ? 34  VAL A HG11 2  
ATOM 2001  H HG12 . VAL A 1 14  ? -8.542  2.336   -6.659  1.00 1.00 ? 34  VAL A HG12 2  
ATOM 2002  H HG13 . VAL A 1 14  ? -9.460  1.924   -5.192  1.00 1.00 ? 34  VAL A HG13 2  
ATOM 2003  H HG21 . VAL A 1 14  ? -11.419 4.646   -6.865  1.00 1.00 ? 34  VAL A HG21 2  
ATOM 2004  H HG22 . VAL A 1 14  ? -10.600 4.181   -5.376  1.00 1.00 ? 34  VAL A HG22 2  
ATOM 2005  H HG23 . VAL A 1 14  ? -9.651  4.503   -6.832  1.00 1.00 ? 34  VAL A HG23 2  
ATOM 2006  N N    . LEU A 1 15  ? -9.721  4.125   -9.589  1.00 1.00 ? 35  LEU A N    2  
ATOM 2007  C CA   . LEU A 1 15  ? -8.610  4.751   -10.320 1.00 1.00 ? 35  LEU A CA   2  
ATOM 2008  C C    . LEU A 1 15  ? -7.282  4.806   -9.492  1.00 1.00 ? 35  LEU A C    2  
ATOM 2009  O O    . LEU A 1 15  ? -7.276  4.440   -8.309  1.00 1.00 ? 35  LEU A O    2  
ATOM 2010  C CB   . LEU A 1 15  ? -9.107  6.104   -10.877 1.00 1.00 ? 35  LEU A CB   2  
ATOM 2011  C CG   . LEU A 1 15  ? -8.921  7.391   -10.052 1.00 1.00 ? 35  LEU A CG   2  
ATOM 2012  C CD1  . LEU A 1 15  ? -9.557  8.569   -10.803 1.00 1.00 ? 35  LEU A CD1  2  
ATOM 2013  C CD2  . LEU A 1 15  ? -9.491  7.309   -8.631  1.00 1.00 ? 35  LEU A CD2  2  
ATOM 2014  H H    . LEU A 1 15  ? -10.461 4.725   -9.260  1.00 1.00 ? 35  LEU A H    2  
ATOM 2015  H HA   . LEU A 1 15  ? -8.400  4.119   -11.185 1.00 1.00 ? 35  LEU A HA   2  
ATOM 2016  H HB2  . LEU A 1 15  ? -8.465  6.464   -11.681 1.00 0.00 ? 35  LEU A HB2  2  
ATOM 2017  H HB3  . LEU A 1 15  ? -10.121 6.021   -11.278 1.00 1.00 ? 35  LEU A HB3  2  
ATOM 2018  H HG   . LEU A 1 15  ? -7.851  7.570   -9.978  1.00 1.00 ? 35  LEU A HG   2  
ATOM 2019  H HD11 . LEU A 1 15  ? -9.108  8.661   -11.793 1.00 1.00 ? 35  LEU A HD11 2  
ATOM 2020  H HD12 . LEU A 1 15  ? -10.632 8.417   -10.911 1.00 1.00 ? 35  LEU A HD12 2  
ATOM 2021  H HD13 . LEU A 1 15  ? -9.388  9.499   -10.262 1.00 1.00 ? 35  LEU A HD13 2  
ATOM 2022  H HD21 . LEU A 1 15  ? -9.032  6.487   -8.084  1.00 1.00 ? 35  LEU A HD21 2  
ATOM 2023  H HD22 . LEU A 1 15  ? -9.249  8.222   -8.088  1.00 1.00 ? 35  LEU A HD22 2  
ATOM 2024  H HD23 . LEU A 1 15  ? -10.569 7.172   -8.654  1.00 1.00 ? 35  LEU A HD23 2  
ATOM 2025  N N    . PRO A 1 16  ? -6.145  5.251   -10.078 1.00 1.00 ? 36  PRO A N    2  
ATOM 2026  C CA   . PRO A 1 16  ? -4.874  5.396   -9.356  1.00 1.00 ? 36  PRO A CA   2  
ATOM 2027  C C    . PRO A 1 16  ? -4.941  6.381   -8.169  1.00 1.00 ? 36  PRO A C    2  
ATOM 2028  O O    . PRO A 1 16  ? -5.850  7.199   -8.045  1.00 1.00 ? 36  PRO A O    2  
ATOM 2029  C CB   . PRO A 1 16  ? -3.830  5.832   -10.392 1.00 1.00 ? 36  PRO A CB   2  
ATOM 2030  C CG   . PRO A 1 16  ? -4.653  6.371   -11.563 1.00 1.00 ? 36  PRO A CG   2  
ATOM 2031  C CD   . PRO A 1 16  ? -6.005  5.668   -11.464 1.00 1.00 ? 36  PRO A CD   2  
ATOM 2032  H HA   . PRO A 1 16  ? -4.591  4.417   -8.963  1.00 1.00 ? 36  PRO A HA   2  
ATOM 2033  H HB2  . PRO A 1 16  ? -3.238  6.590   -9.881  1.00 0.00 ? 36  PRO A HB2  2  
ATOM 2034  H HB3  . PRO A 1 16  ? -3.262  4.959   -10.720 1.00 1.00 ? 36  PRO A HB3  2  
ATOM 2035  H HG2  . PRO A 1 16  ? -4.782  7.451   -11.492 1.00 0.00 ? 36  PRO A HG2  2  
ATOM 2036  H HG3  . PRO A 1 16  ? -4.169  6.158   -12.518 1.00 1.00 ? 36  PRO A HG3  2  
ATOM 2037  H HD2  . PRO A 1 16  ? -6.837  6.320   -11.729 1.00 0.00 ? 36  PRO A HD2  2  
ATOM 2038  H HD3  . PRO A 1 16  ? -6.010  4.786   -12.107 1.00 1.00 ? 36  PRO A HD3  2  
ATOM 2039  N N    . THR A 1 17  ? -3.920  6.320   -7.303  1.00 1.00 ? 37  THR A N    2  
ATOM 2040  C CA   . THR A 1 17  ? -3.735  7.166   -6.096  1.00 1.00 ? 37  THR A CA   2  
ATOM 2041  C C    . THR A 1 17  ? -2.384  7.921   -6.036  1.00 1.00 ? 37  THR A C    2  
ATOM 2042  O O    . THR A 1 17  ? -2.064  8.537   -5.017  1.00 1.00 ? 37  THR A O    2  
ATOM 2043  C CB   . THR A 1 17  ? -4.076  6.377   -4.802  1.00 1.00 ? 37  THR A CB   2  
ATOM 2044  O OG1  . THR A 1 17  ? -3.769  7.127   -3.647  1.00 1.00 ? 37  THR A OG1  2  
ATOM 2045  C CG2  . THR A 1 17  ? -3.348  5.037   -4.703  1.00 1.00 ? 37  THR A CG2  2  
ATOM 2046  H H    . THR A 1 17  ? -3.290  5.543   -7.432  1.00 1.00 ? 37  THR A H    2  
ATOM 2047  H HA   . THR A 1 17  ? -4.467  7.963   -6.147  1.00 1.00 ? 37  THR A HA   2  
ATOM 2048  H HB   . THR A 1 17  ? -5.149  6.171   -4.794  1.00 1.00 ? 37  THR A HB   2  
ATOM 2049  H HG1  . THR A 1 17  ? -3.060  7.752   -3.898  1.00 1.00 ? 37  THR A HG1  2  
ATOM 2050  H HG21 . THR A 1 17  ? -2.293  5.188   -4.902  1.00 1.00 ? 37  THR A HG21 2  
ATOM 2051  H HG22 . THR A 1 17  ? -3.487  4.599   -3.713  1.00 1.00 ? 37  THR A HG22 2  
ATOM 2052  H HG23 . THR A 1 17  ? -3.749  4.345   -5.442  1.00 1.00 ? 37  THR A HG23 2  
ATOM 2053  N N    . HIS A 1 18  ? -1.604  7.914   -7.129  1.00 1.00 ? 38  HIS A N    2  
ATOM 2054  C CA   . HIS A 1 18  ? -0.308  8.586   -7.321  1.00 1.00 ? 38  HIS A CA   2  
ATOM 2055  C C    . HIS A 1 18  ? -0.351  10.136  -7.353  1.00 1.00 ? 38  HIS A C    2  
ATOM 2056  O O    . HIS A 1 18  ? 0.265   10.733  -8.231  1.00 1.00 ? 38  HIS A O    2  
ATOM 2057  C CB   . HIS A 1 18  ? 0.407   7.949   -8.538  1.00 1.00 ? 38  HIS A CB   2  
ATOM 2058  C CG   . HIS A 1 18  ? -0.291  7.929   -9.888  1.00 1.00 ? 38  HIS A CG   2  
ATOM 2059  N ND1  . HIS A 1 18  ? -0.246  6.879   -10.786 1.00 1.00 ? 38  HIS A ND1  2  
ATOM 2060  C CD2  . HIS A 1 18  ? -0.943  8.965   -10.500 1.00 1.00 ? 38  HIS A CD2  2  
ATOM 2061  C CE1  . HIS A 1 18  ? -0.886  7.264   -11.909 1.00 1.00 ? 38  HIS A CE1  2  
ATOM 2062  N NE2  . HIS A 1 18  ? -1.332  8.531   -11.755 1.00 1.00 ? 38  HIS A NE2  2  
ATOM 2063  H H    . HIS A 1 18  ? -1.978  7.405   -7.915  1.00 1.00 ? 38  HIS A H    2  
ATOM 2064  H HA   . HIS A 1 18  ? 0.315   8.357   -6.462  1.00 1.00 ? 38  HIS A HA   2  
ATOM 2065  H HB2  . HIS A 1 18  ? 1.256   8.565   -8.832  1.00 0.00 ? 38  HIS A HB2  2  
ATOM 2066  H HB3  . HIS A 1 18  ? 0.762   6.950   -8.279  1.00 1.00 ? 38  HIS A HB3  2  
ATOM 2067  H HD1  . HIS A 1 18  ? 0.267   6.019   -10.641 1.00 1.00 ? 38  HIS A HD1  2  
ATOM 2068  H HD2  . HIS A 1 18  ? -1.067  9.962   -10.100 1.00 1.00 ? 38  HIS A HD2  2  
ATOM 2069  H HE1  . HIS A 1 18  ? -0.969  6.677   -12.820 1.00 1.00 ? 38  HIS A HE1  2  
ATOM 2070  H HE2  . HIS A 1 18  ? -1.809  9.095   -12.452 1.00 1.00 ? 38  HIS A HE2  2  
ATOM 2071  N N    . TRP A 1 19  ? -1.028  10.816  -6.412  1.00 1.00 ? 39  TRP A N    2  
ATOM 2072  C CA   . TRP A 1 19  ? -1.101  12.292  -6.332  1.00 1.00 ? 39  TRP A CA   2  
ATOM 2073  C C    . TRP A 1 19  ? -1.544  12.880  -4.974  1.00 1.00 ? 39  TRP A C    2  
ATOM 2074  O O    . TRP A 1 19  ? -1.906  12.159  -4.046  1.00 1.00 ? 39  TRP A O    2  
ATOM 2075  C CB   . TRP A 1 19  ? -1.944  12.856  -7.497  1.00 1.00 ? 39  TRP A CB   2  
ATOM 2076  C CG   . TRP A 1 19  ? -3.436  12.754  -7.474  1.00 1.00 ? 39  TRP A CG   2  
ATOM 2077  C CD1  . TRP A 1 19  ? -4.266  13.703  -6.994  1.00 1.00 ? 39  TRP A CD1  2  
ATOM 2078  C CD2  . TRP A 1 19  ? -4.300  11.734  -8.060  1.00 1.00 ? 39  TRP A CD2  2  
ATOM 2079  N NE1  . TRP A 1 19  ? -5.580  13.325  -7.178  1.00 1.00 ? 39  TRP A NE1  2  
ATOM 2080  C CE2  . TRP A 1 19  ? -5.662  12.136  -7.864  1.00 1.00 ? 39  TRP A CE2  2  
ATOM 2081  C CE3  . TRP A 1 19  ? -4.072  10.537  -8.782  1.00 1.00 ? 39  TRP A CE3  2  
ATOM 2082  C CZ2  . TRP A 1 19  ? -6.746  11.383  -8.345  1.00 1.00 ? 39  TRP A CZ2  2  
ATOM 2083  C CZ3  . TRP A 1 19  ? -5.151  9.794   -9.306  1.00 1.00 ? 39  TRP A CZ3  2  
ATOM 2084  C CH2  . TRP A 1 19  ? -6.480  10.208  -9.074  1.00 1.00 ? 39  TRP A CH2  2  
ATOM 2085  H H    . TRP A 1 19  ? -1.379  10.293  -5.618  1.00 1.00 ? 39  TRP A H    2  
ATOM 2086  H HA   . TRP A 1 19  ? -0.083  12.650  -6.465  1.00 1.00 ? 39  TRP A HA   2  
ATOM 2087  H HB2  . TRP A 1 19  ? -1.951  13.946  -7.501  1.00 0.00 ? 39  TRP A HB2  2  
ATOM 2088  H HB3  . TRP A 1 19  ? -1.562  12.535  -8.467  1.00 1.00 ? 39  TRP A HB3  2  
ATOM 2089  H HD1  . TRP A 1 19  ? -3.948  14.637  -6.557  1.00 1.00 ? 39  TRP A HD1  2  
ATOM 2090  H HE1  . TRP A 1 19  ? -6.368  13.895  -6.874  1.00 1.00 ? 39  TRP A HE1  2  
ATOM 2091  H HE3  . TRP A 1 19  ? -3.060  10.209  -8.940  1.00 1.00 ? 39  TRP A HE3  2  
ATOM 2092  H HZ2  . TRP A 1 19  ? -7.759  11.709  -8.164  1.00 1.00 ? 39  TRP A HZ2  2  
ATOM 2093  H HZ3  . TRP A 1 19  ? -4.973  8.889   -9.868  1.00 1.00 ? 39  TRP A HZ3  2  
ATOM 2094  H HH2  . TRP A 1 19  ? -7.295  9.614   -9.445  1.00 1.00 ? 39  TRP A HH2  2  
ATOM 2095  N N    . ARG A 1 20  ? -1.475  14.221  -4.877  1.00 1.00 ? 40  ARG A N    2  
ATOM 2096  C CA   . ARG A 1 20  ? -1.867  15.072  -3.739  1.00 1.00 ? 40  ARG A CA   2  
ATOM 2097  C C    . ARG A 1 20  ? -3.305  15.596  -3.920  1.00 1.00 ? 40  ARG A C    2  
ATOM 2098  O O    . ARG A 1 20  ? -3.602  16.233  -4.928  1.00 1.00 ? 40  ARG A O    2  
ATOM 2099  C CB   . ARG A 1 20  ? -0.817  16.185  -3.542  1.00 1.00 ? 40  ARG A CB   2  
ATOM 2100  C CG   . ARG A 1 20  ? -0.773  17.352  -4.540  1.00 1.00 ? 40  ARG A CG   2  
ATOM 2101  C CD   . ARG A 1 20  ? -1.452  18.548  -3.872  1.00 1.00 ? 40  ARG A CD   2  
ATOM 2102  N NE   . ARG A 1 20  ? -2.381  19.266  -4.745  1.00 1.00 ? 40  ARG A NE   2  
ATOM 2103  C CZ   . ARG A 1 20  ? -3.531  19.810  -4.409  1.00 1.00 ? 40  ARG A CZ   2  
ATOM 2104  N NH1  . ARG A 1 20  ? -4.055  19.712  -3.224  1.00 1.00 ? 40  ARG A NH1  2  
ATOM 2105  N NH2  . ARG A 1 20  ? -4.154  20.551  -5.267  1.00 1.00 ? 40  ARG A NH2  2  
ATOM 2106  H H    . ARG A 1 20  ? -1.198  14.699  -5.722  1.00 1.00 ? 40  ARG A H    2  
ATOM 2107  H HA   . ARG A 1 20  ? -1.848  14.457  -2.842  1.00 1.00 ? 40  ARG A HA   2  
ATOM 2108  H HB2  . ARG A 1 20  ? -1.038  16.759  -2.642  1.00 0.00 ? 40  ARG A HB2  2  
ATOM 2109  H HB3  . ARG A 1 20  ? 0.177   15.753  -3.445  1.00 1.00 ? 40  ARG A HB3  2  
ATOM 2110  H HG2  . ARG A 1 20  ? 0.246   17.673  -4.752  1.00 0.00 ? 40  ARG A HG2  2  
ATOM 2111  H HG3  . ARG A 1 20  ? -1.226  17.092  -5.497  1.00 1.00 ? 40  ARG A HG3  2  
ATOM 2112  H HD2  . ARG A 1 20  ? -2.035  18.207  -3.017  1.00 0.00 ? 40  ARG A HD2  2  
ATOM 2113  H HD3  . ARG A 1 20  ? -0.698  19.254  -3.536  1.00 1.00 ? 40  ARG A HD3  2  
ATOM 2114  H HE   . ARG A 1 20  ? -2.087  19.487  -5.690  1.00 1.00 ? 40  ARG A HE   2  
ATOM 2115  H HH11 . ARG A 1 20  ? -3.566  19.184  -2.486  1.00 0.00 ? 40  ARG A HH11 2  
ATOM 2116  H HH12 . ARG A 1 20  ? -4.960  20.160  -3.022  1.00 0.00 ? 40  ARG A HH12 2  
ATOM 2117  H HH21 . ARG A 1 20  ? -3.750  20.710  -6.200  1.00 0.00 ? 40  ARG A HH21 2  
ATOM 2118  H HH22 . ARG A 1 20  ? -5.056  20.982  -5.017  1.00 0.00 ? 40  ARG A HH22 2  
ATOM 2119  N N    . CYS A 1 21  ? -4.183  15.318  -2.950  1.00 1.00 ? 41  CYS A N    2  
ATOM 2120  C CA   . CYS A 1 21  ? -5.632  15.570  -2.976  1.00 1.00 ? 41  CYS A CA   2  
ATOM 2121  C C    . CYS A 1 21  ? -6.385  14.783  -4.085  1.00 1.00 ? 41  CYS A C    2  
ATOM 2122  O O    . CYS A 1 21  ? -6.506  15.247  -5.220  1.00 1.00 ? 41  CYS A O    2  
ATOM 2123  C CB   . CYS A 1 21  ? -5.899  17.086  -2.995  1.00 1.00 ? 41  CYS A CB   2  
ATOM 2124  S SG   . CYS A 1 21  ? -7.682  17.429  -3.013  1.00 1.00 ? 41  CYS A SG   2  
ATOM 2125  H H    . CYS A 1 21  ? -3.801  14.925  -2.098  1.00 1.00 ? 41  CYS A H    2  
ATOM 2126  H HA   . CYS A 1 21  ? -6.031  15.225  -2.022  1.00 1.00 ? 41  CYS A HA   2  
ATOM 2127  H HB2  . CYS A 1 21  ? -5.464  17.543  -2.106  1.00 0.00 ? 41  CYS A HB2  2  
ATOM 2128  H HB3  . CYS A 1 21  ? -5.449  17.524  -3.886  1.00 1.00 ? 41  CYS A HB3  2  
ATOM 2129  H HG   . CYS A 1 21  ? -7.872  16.921  -4.240  1.00 1.00 ? 41  CYS A HG   2  
ATOM 2130  N N    . ASN A 1 22  ? -6.957  13.621  -3.730  1.00 1.00 ? 42  ASN A N    2  
ATOM 2131  C CA   . ASN A 1 22  ? -7.870  12.786  -4.547  1.00 1.00 ? 42  ASN A CA   2  
ATOM 2132  C C    . ASN A 1 22  ? -8.878  13.621  -5.365  1.00 1.00 ? 42  ASN A C    2  
ATOM 2133  O O    . ASN A 1 22  ? -9.047  13.376  -6.557  1.00 1.00 ? 42  ASN A O    2  
ATOM 2134  C CB   . ASN A 1 22  ? -8.600  11.867  -3.554  1.00 1.00 ? 42  ASN A CB   2  
ATOM 2135  C CG   . ASN A 1 22  ? -9.595  10.831  -4.080  1.00 1.00 ? 42  ASN A CG   2  
ATOM 2136  O OD1  . ASN A 1 22  ? -9.391  9.640   -3.985  1.00 1.00 ? 42  ASN A OD1  2  
ATOM 2137  N ND2  . ASN A 1 22  ? -10.792 11.198  -4.457  1.00 1.00 ? 42  ASN A ND2  2  
ATOM 2138  H H    . ASN A 1 22  ? -6.740  13.281  -2.795  1.00 1.00 ? 42  ASN A H    2  
ATOM 2139  H HA   . ASN A 1 22  ? -7.291  12.176  -5.239  1.00 1.00 ? 42  ASN A HA   2  
ATOM 2140  H HB2  . ASN A 1 22  ? -7.890  11.190  -3.077  1.00 0.00 ? 42  ASN A HB2  2  
ATOM 2141  H HB3  . ASN A 1 22  ? -9.089  12.461  -2.783  1.00 1.00 ? 42  ASN A HB3  2  
ATOM 2142  H HD21 . ASN A 1 22  ? -11.070 12.188  -4.400  1.00 0.00 ? 42  ASN A HD21 2  
ATOM 2143  H HD22 . ASN A 1 22  ? -11.457 10.497  -4.812  1.00 0.00 ? 42  ASN A HD22 2  
ATOM 2144  N N    . LYS A 1 23  ? -9.497  14.615  -4.696  1.00 1.00 ? 43  LYS A N    2  
ATOM 2145  C CA   . LYS A 1 23  ? -10.591 15.505  -5.146  1.00 1.00 ? 43  LYS A CA   2  
ATOM 2146  C C    . LYS A 1 23  ? -11.955 14.778  -5.194  1.00 1.00 ? 43  LYS A C    2  
ATOM 2147  O O    . LYS A 1 23  ? -12.047 13.593  -4.880  1.00 1.00 ? 43  LYS A O    2  
ATOM 2148  C CB   . LYS A 1 23  ? -10.181 16.177  -6.476  1.00 1.00 ? 43  LYS A CB   2  
ATOM 2149  C CG   . LYS A 1 23  ? -10.780 17.566  -6.719  1.00 1.00 ? 43  LYS A CG   2  
ATOM 2150  C CD   . LYS A 1 23  ? -10.320 18.132  -8.067  1.00 1.00 ? 43  LYS A CD   2  
ATOM 2151  C CE   . LYS A 1 23  ? -11.025 19.462  -8.355  1.00 1.00 ? 43  LYS A CE   2  
ATOM 2152  N NZ   . LYS A 1 23  ? -10.854 19.894  -9.757  1.00 1.00 ? 43  LYS A NZ   2  
ATOM 2153  H H    . LYS A 1 23  ? -9.206  14.629  -3.727  1.00 1.00 ? 43  LYS A H    2  
ATOM 2154  H HA   . LYS A 1 23  ? -10.692 16.291  -4.397  1.00 1.00 ? 43  LYS A HA   2  
ATOM 2155  H HB2  . LYS A 1 23  ? -9.118  16.420  -6.476  1.00 0.00 ? 43  LYS A HB2  2  
ATOM 2156  H HB3  . LYS A 1 23  ? -10.378 15.516  -7.322  1.00 1.00 ? 43  LYS A HB3  2  
ATOM 2157  H HG2  . LYS A 1 23  ? -11.867 17.495  -6.750  1.00 0.00 ? 43  LYS A HG2  2  
ATOM 2158  H HG3  . LYS A 1 23  ? -10.485 18.238  -5.913  1.00 1.00 ? 43  LYS A HG3  2  
ATOM 2159  H HD2  . LYS A 1 23  ? -9.245  18.304  -8.020  1.00 0.00 ? 43  LYS A HD2  2  
ATOM 2160  H HD3  . LYS A 1 23  ? -10.558 17.405  -8.847  1.00 1.00 ? 43  LYS A HD3  2  
ATOM 2161  H HE2  . LYS A 1 23  ? -12.103 19.341  -8.256  1.00 0.00 ? 43  LYS A HE2  2  
ATOM 2162  H HE3  . LYS A 1 23  ? -10.686 20.224  -7.647  1.00 1.00 ? 43  LYS A HE3  2  
ATOM 2163  H HZ1  . LYS A 1 23  ? -10.552 19.092  -10.330 1.00 0.00 ? 43  LYS A HZ1  2  
ATOM 2164  H HZ2  . LYS A 1 23  ? -11.748 20.255  -10.118 1.00 0.00 ? 43  LYS A HZ2  2  
ATOM 2165  N N    . THR A 1 24  ? -13.032 15.498  -5.535  1.00 1.00 ? 44  THR A N    2  
ATOM 2166  C CA   . THR A 1 24  ? -14.426 14.987  -5.549  1.00 1.00 ? 44  THR A CA   2  
ATOM 2167  C C    . THR A 1 24  ? -14.658 13.815  -6.523  1.00 1.00 ? 44  THR A C    2  
ATOM 2168  O O    . THR A 1 24  ? -15.441 12.940  -6.184  1.00 1.00 ? 44  THR A O    2  
ATOM 2169  C CB   . THR A 1 24  ? -15.437 16.125  -5.817  1.00 1.00 ? 44  THR A CB   2  
ATOM 2170  O OG1  . THR A 1 24  ? -15.328 17.082  -4.789  1.00 1.00 ? 44  THR A OG1  2  
ATOM 2171  C CG2  . THR A 1 24  ? -16.909 15.692  -5.822  1.00 1.00 ? 44  THR A CG2  2  
ATOM 2172  H H    . THR A 1 24  ? -12.895 16.483  -5.707  1.00 1.00 ? 44  THR A H    2  
ATOM 2173  H HA   . THR A 1 24  ? -14.644 14.596  -4.553  1.00 1.00 ? 44  THR A HA   2  
ATOM 2174  H HB   . THR A 1 24  ? -15.198 16.599  -6.772  1.00 1.00 ? 44  THR A HB   2  
ATOM 2175  H HG1  . THR A 1 24  ? -15.994 16.853  -4.132  1.00 1.00 ? 44  THR A HG1  2  
ATOM 2176  H HG21 . THR A 1 24  ? -17.158 15.149  -4.911  1.00 1.00 ? 44  THR A HG21 2  
ATOM 2177  H HG22 . THR A 1 24  ? -17.561 16.563  -5.916  1.00 1.00 ? 44  THR A HG22 2  
ATOM 2178  H HG23 . THR A 1 24  ? -17.101 15.043  -6.680  1.00 1.00 ? 44  THR A HG23 2  
ATOM 2179  N N    . LEU A 1 25  ? -13.972 13.771  -7.684  1.00 1.00 ? 45  LEU A N    2  
ATOM 2180  C CA   . LEU A 1 25  ? -13.976 12.688  -8.675  1.00 1.00 ? 45  LEU A CA   2  
ATOM 2181  C C    . LEU A 1 25  ? -15.396 12.227  -9.130  1.00 1.00 ? 45  LEU A C    2  
ATOM 2182  O O    . LEU A 1 25  ? -15.932 11.267  -8.574  1.00 1.00 ? 45  LEU A O    2  
ATOM 2183  C CB   . LEU A 1 25  ? -13.064 11.553  -8.148  1.00 1.00 ? 45  LEU A CB   2  
ATOM 2184  C CG   . LEU A 1 25  ? -11.557 11.843  -7.949  1.00 1.00 ? 45  LEU A CG   2  
ATOM 2185  C CD1  . LEU A 1 25  ? -10.824 10.537  -7.620  1.00 1.00 ? 45  LEU A CD1  2  
ATOM 2186  C CD2  . LEU A 1 25  ? -10.866 12.507  -9.153  1.00 1.00 ? 45  LEU A CD2  2  
ATOM 2187  H H    . LEU A 1 25  ? -13.319 14.505  -7.882  1.00 1.00 ? 45  LEU A H    2  
ATOM 2188  H HA   . LEU A 1 25  ? -13.490 13.068  -9.572  1.00 1.00 ? 45  LEU A HA   2  
ATOM 2189  H HB2  . LEU A 1 25  ? -13.260 11.342  -7.096  1.00 0.00 ? 45  LEU A HB2  2  
ATOM 2190  H HB3  . LEU A 1 25  ? -13.219 10.631  -8.701  1.00 1.00 ? 45  LEU A HB3  2  
ATOM 2191  H HG   . LEU A 1 25  ? -11.458 12.511  -7.098  1.00 1.00 ? 45  LEU A HG   2  
ATOM 2192  H HD11 . LEU A 1 25  ? -11.304 10.040  -6.778  1.00 1.00 ? 45  LEU A HD11 2  
ATOM 2193  H HD12 . LEU A 1 25  ? -10.858 9.873   -8.481  1.00 1.00 ? 45  LEU A HD12 2  
ATOM 2194  H HD13 . LEU A 1 25  ? -9.789  10.742  -7.352  1.00 1.00 ? 45  LEU A HD13 2  
ATOM 2195  H HD21 . LEU A 1 25  ? -10.958 11.885  -10.040 1.00 1.00 ? 45  LEU A HD21 2  
ATOM 2196  H HD22 . LEU A 1 25  ? -11.296 13.489  -9.342  1.00 1.00 ? 45  LEU A HD22 2  
ATOM 2197  H HD23 . LEU A 1 25  ? -9.808  12.651  -8.937  1.00 1.00 ? 45  LEU A HD23 2  
ATOM 2198  N N    . PRO A 1 26  ? -16.011 12.865  -10.161 1.00 1.00 ? 46  PRO A N    2  
ATOM 2199  C CA   . PRO A 1 26  ? -17.289 12.448  -10.778 1.00 1.00 ? 46  PRO A CA   2  
ATOM 2200  C C    . PRO A 1 26  ? -17.198 11.091  -11.538 1.00 1.00 ? 46  PRO A C    2  
ATOM 2201  O O    . PRO A 1 26  ? -17.400 10.998  -12.749 1.00 1.00 ? 46  PRO A O    2  
ATOM 2202  C CB   . PRO A 1 26  ? -17.731 13.617  -11.669 1.00 1.00 ? 46  PRO A CB   2  
ATOM 2203  C CG   . PRO A 1 26  ? -16.430 14.349  -11.995 1.00 1.00 ? 46  PRO A CG   2  
ATOM 2204  C CD   . PRO A 1 26  ? -15.506 14.067  -10.812 1.00 1.00 ? 46  PRO A CD   2  
ATOM 2205  H HA   . PRO A 1 26  ? -18.034 12.327  -9.990  1.00 1.00 ? 46  PRO A HA   2  
ATOM 2206  H HB2  . PRO A 1 26  ? -18.202 13.135  -12.526 1.00 0.00 ? 46  PRO A HB2  2  
ATOM 2207  H HB3  . PRO A 1 26  ? -18.386 14.282  -11.102 1.00 1.00 ? 46  PRO A HB3  2  
ATOM 2208  H HG2  . PRO A 1 26  ? -15.999 13.982  -12.926 1.00 0.00 ? 46  PRO A HG2  2  
ATOM 2209  H HG3  . PRO A 1 26  ? -16.600 15.421  -12.104 1.00 1.00 ? 46  PRO A HG3  2  
ATOM 2210  H HD2  . PRO A 1 26  ? -14.474 13.900  -11.120 1.00 0.00 ? 46  PRO A HD2  2  
ATOM 2211  H HD3  . PRO A 1 26  ? -15.552 14.900  -10.109 1.00 1.00 ? 46  PRO A HD3  2  
ATOM 2212  N N    . ILE A 1 27  ? -16.870 10.035  -10.783 1.00 1.00 ? 47  ILE A N    2  
ATOM 2213  C CA   . ILE A 1 27  ? -16.653 8.618   -11.102 1.00 1.00 ? 47  ILE A CA   2  
ATOM 2214  C C    . ILE A 1 27  ? -17.037 7.779   -9.868  1.00 1.00 ? 47  ILE A C    2  
ATOM 2215  O O    . ILE A 1 27  ? -16.681 8.112   -8.735  1.00 1.00 ? 47  ILE A O    2  
ATOM 2216  C CB   . ILE A 1 27  ? -15.178 8.282   -11.498 1.00 1.00 ? 47  ILE A CB   2  
ATOM 2217  C CG1  . ILE A 1 27  ? -14.088 9.150   -10.809 1.00 1.00 ? 47  ILE A CG1  2  
ATOM 2218  C CG2  . ILE A 1 27  ? -15.008 8.178   -13.024 1.00 1.00 ? 47  ILE A CG2  2  
ATOM 2219  C CD1  . ILE A 1 27  ? -13.614 10.442  -11.502 1.00 1.00 ? 47  ILE A CD1  2  
ATOM 2220  H H    . ILE A 1 27  ? -16.720 10.248  -9.800  1.00 1.00 ? 47  ILE A H    2  
ATOM 2221  H HA   . ILE A 1 27  ? -17.317 8.340   -11.926 1.00 1.00 ? 47  ILE A HA   2  
ATOM 2222  H HB   . ILE A 1 27  ? -14.984 7.264   -11.148 1.00 1.00 ? 47  ILE A HB   2  
ATOM 2223  H HG12 . ILE A 1 27  ? -14.476 9.587   -9.890  1.00 0.00 ? 47  ILE A HG12 2  
ATOM 2224  H HG13 . ILE A 1 27  ? -13.217 8.542   -10.566 1.00 1.00 ? 47  ILE A HG13 2  
ATOM 2225  H HG21 . ILE A 1 27  ? -15.678 7.415   -13.425 1.00 1.00 ? 47  ILE A HG21 2  
ATOM 2226  H HG22 . ILE A 1 27  ? -15.239 9.134   -13.496 1.00 1.00 ? 47  ILE A HG22 2  
ATOM 2227  H HG23 . ILE A 1 27  ? -13.983 7.893   -13.266 1.00 1.00 ? 47  ILE A HG23 2  
ATOM 2228  H HD11 . ILE A 1 27  ? -14.448 11.107  -11.699 1.00 1.00 ? 47  ILE A HD11 2  
ATOM 2229  H HD12 . ILE A 1 27  ? -12.904 10.963  -10.864 1.00 1.00 ? 47  ILE A HD12 2  
ATOM 2230  H HD13 . ILE A 1 27  ? -13.104 10.208  -12.433 1.00 1.00 ? 47  ILE A HD13 2  
ATOM 2231  N N    . ALA A 1 28  ? -17.744 6.675   -10.115 1.00 1.00 ? 48  ALA A N    2  
ATOM 2232  C CA   . ALA A 1 28  ? -18.094 5.644   -9.136  1.00 1.00 ? 48  ALA A CA   2  
ATOM 2233  C C    . ALA A 1 28  ? -16.990 4.568   -9.009  1.00 1.00 ? 48  ALA A C    2  
ATOM 2234  O O    . ALA A 1 28  ? -16.319 4.224   -9.987  1.00 1.00 ? 48  ALA A O    2  
ATOM 2235  C CB   . ALA A 1 28  ? -19.426 5.010   -9.566  1.00 1.00 ? 48  ALA A CB   2  
ATOM 2236  H H    . ALA A 1 28  ? -17.973 6.500   -11.078 1.00 1.00 ? 48  ALA A H    2  
ATOM 2237  H HA   . ALA A 1 28  ? -18.229 6.117   -8.163  1.00 1.00 ? 48  ALA A HA   2  
ATOM 2238  H HB1  . ALA A 1 28  ? -20.200 5.776   -9.635  1.00 1.00 ? 48  ALA A HB1  2  
ATOM 2239  H HB2  . ALA A 1 28  ? -19.316 4.521   -10.537 1.00 1.00 ? 48  ALA A HB2  2  
ATOM 2240  H HB3  . ALA A 1 28  ? -19.738 4.263   -8.834  1.00 1.00 ? 48  ALA A HB3  2  
ATOM 2241  N N    . PHE A 1 29  ? -16.862 3.989   -7.810  1.00 1.00 ? 49  PHE A N    2  
ATOM 2242  C CA   . PHE A 1 29  ? -15.921 2.916   -7.469  1.00 1.00 ? 49  PHE A CA   2  
ATOM 2243  C C    . PHE A 1 29  ? -16.639 1.664   -6.934  1.00 1.00 ? 49  PHE A C    2  
ATOM 2244  O O    . PHE A 1 29  ? -17.698 1.744   -6.302  1.00 1.00 ? 49  PHE A O    2  
ATOM 2245  C CB   . PHE A 1 29  ? -14.889 3.453   -6.459  1.00 1.00 ? 49  PHE A CB   2  
ATOM 2246  C CG   . PHE A 1 29  ? -14.250 4.796   -6.781  1.00 1.00 ? 49  PHE A CG   2  
ATOM 2247  C CD1  . PHE A 1 29  ? -13.756 5.070   -8.080  1.00 1.00 ? 49  PHE A CD1  2  
ATOM 2248  C CD2  . PHE A 1 29  ? -14.191 5.794   -5.783  1.00 1.00 ? 49  PHE A CD2  2  
ATOM 2249  C CE1  . PHE A 1 29  ? -13.212 6.338   -8.377  1.00 1.00 ? 49  PHE A CE1  2  
ATOM 2250  C CE2  . PHE A 1 29  ? -13.620 7.051   -6.075  1.00 1.00 ? 49  PHE A CE2  2  
ATOM 2251  C CZ   . PHE A 1 29  ? -13.140 7.326   -7.373  1.00 1.00 ? 49  PHE A CZ   2  
ATOM 2252  H H    . PHE A 1 29  ? -17.383 4.396   -7.035  1.00 1.00 ? 49  PHE A H    2  
ATOM 2253  H HA   . PHE A 1 29  ? -15.376 2.622   -8.369  1.00 1.00 ? 49  PHE A HA   2  
ATOM 2254  H HB2  . PHE A 1 29  ? -15.369 3.686   -5.508  1.00 0.00 ? 49  PHE A HB2  2  
ATOM 2255  H HB3  . PHE A 1 29  ? -14.109 2.711   -6.279  1.00 1.00 ? 49  PHE A HB3  2  
ATOM 2256  H HD1  . PHE A 1 29  ? -13.816 4.321   -8.856  1.00 1.00 ? 49  PHE A HD1  2  
ATOM 2257  H HD2  . PHE A 1 29  ? -14.595 5.608   -4.801  1.00 1.00 ? 49  PHE A HD2  2  
ATOM 2258  H HE1  . PHE A 1 29  ? -12.860 6.547   -9.374  1.00 1.00 ? 49  PHE A HE1  2  
ATOM 2259  H HE2  . PHE A 1 29  ? -13.573 7.813   -5.308  1.00 1.00 ? 49  PHE A HE2  2  
ATOM 2260  H HZ   . PHE A 1 29  ? -12.731 8.298   -7.599  1.00 1.00 ? 49  PHE A HZ   2  
ATOM 2261  N N    . LYS A 1 30  ? -16.015 0.502   -7.178  1.00 1.00 ? 50  LYS A N    2  
ATOM 2262  C CA   . LYS A 1 30  ? -16.448 -0.839  -6.747  1.00 1.00 ? 50  LYS A CA   2  
ATOM 2263  C C    . LYS A 1 30  ? -15.251 -1.556  -6.109  1.00 1.00 ? 50  LYS A C    2  
ATOM 2264  O O    . LYS A 1 30  ? -14.300 -1.910  -6.796  1.00 1.00 ? 50  LYS A O    2  
ATOM 2265  C CB   . LYS A 1 30  ? -17.071 -1.598  -7.938  1.00 1.00 ? 50  LYS A CB   2  
ATOM 2266  C CG   . LYS A 1 30  ? -16.125 -1.814  -9.134  1.00 1.00 ? 50  LYS A CG   2  
ATOM 2267  C CD   . LYS A 1 30  ? -16.788 -1.772  -10.515 1.00 1.00 ? 50  LYS A CD   2  
ATOM 2268  C CE   . LYS A 1 30  ? -17.607 -3.019  -10.875 1.00 1.00 ? 50  LYS A CE   2  
ATOM 2269  N NZ   . LYS A 1 30  ? -16.759 -4.191  -11.184 1.00 1.00 ? 50  LYS A NZ   2  
ATOM 2270  H H    . LYS A 1 30  ? -15.140 0.558   -7.705  1.00 1.00 ? 50  LYS A H    2  
ATOM 2271  H HA   . LYS A 1 30  ? -17.229 -0.738  -5.987  1.00 1.00 ? 50  LYS A HA   2  
ATOM 2272  H HB2  . LYS A 1 30  ? -17.307 -2.616  -7.629  1.00 0.00 ? 50  LYS A HB2  2  
ATOM 2273  H HB3  . LYS A 1 30  ? -17.981 -1.086  -8.252  1.00 1.00 ? 50  LYS A HB3  2  
ATOM 2274  H HG2  . LYS A 1 30  ? -15.424 -0.984  -9.220  1.00 0.00 ? 50  LYS A HG2  2  
ATOM 2275  H HG3  . LYS A 1 30  ? -15.554 -2.734  -9.007  1.00 1.00 ? 50  LYS A HG3  2  
ATOM 2276  H HD2  . LYS A 1 30  ? -17.548 -0.990  -10.544 1.00 0.00 ? 50  LYS A HD2  2  
ATOM 2277  H HD3  . LYS A 1 30  ? -16.042 -1.566  -11.286 1.00 1.00 ? 50  LYS A HD3  2  
ATOM 2278  H HE2  . LYS A 1 30  ? -18.205 -3.306  -10.011 1.00 0.00 ? 50  LYS A HE2  2  
ATOM 2279  H HE3  . LYS A 1 30  ? -18.257 -2.781  -11.721 1.00 1.00 ? 50  LYS A HE3  2  
ATOM 2280  H HZ1  . LYS A 1 30  ? -15.837 -4.077  -10.735 1.00 0.00 ? 50  LYS A HZ1  2  
ATOM 2281  H HZ2  . LYS A 1 30  ? -17.209 -5.046  -10.828 1.00 0.00 ? 50  LYS A HZ2  2  
ATOM 2282  N N    . VAL A 1 31  ? -15.266 -1.740  -4.789  1.00 1.00 ? 51  VAL A N    2  
ATOM 2283  C CA   . VAL A 1 31  ? -14.132 -2.276  -3.996  1.00 1.00 ? 51  VAL A CA   2  
ATOM 2284  C C    . VAL A 1 31  ? -14.637 -3.381  -3.080  1.00 1.00 ? 51  VAL A C    2  
ATOM 2285  O O    . VAL A 1 31  ? -15.548 -3.105  -2.310  1.00 1.00 ? 51  VAL A O    2  
ATOM 2286  C CB   . VAL A 1 31  ? -13.399 -1.163  -3.188  1.00 1.00 ? 51  VAL A CB   2  
ATOM 2287  C CG1  . VAL A 1 31  ? -12.209 -1.697  -2.366  1.00 1.00 ? 51  VAL A CG1  2  
ATOM 2288  C CG2  . VAL A 1 31  ? -12.923 -0.008  -4.096  1.00 1.00 ? 51  VAL A CG2  2  
ATOM 2289  H H    . VAL A 1 31  ? -16.109 -1.460  -4.304  1.00 1.00 ? 51  VAL A H    2  
ATOM 2290  H HA   . VAL A 1 31  ? -13.407 -2.715  -4.672  1.00 1.00 ? 51  VAL A HA   2  
ATOM 2291  H HB   . VAL A 1 31  ? -14.088 -0.741  -2.463  1.00 1.00 ? 51  VAL A HB   2  
ATOM 2292  H HG11 . VAL A 1 31  ? -11.464 -2.162  -3.005  1.00 1.00 ? 51  VAL A HG11 2  
ATOM 2293  H HG12 . VAL A 1 31  ? -11.734 -0.879  -1.820  1.00 1.00 ? 51  VAL A HG12 2  
ATOM 2294  H HG13 . VAL A 1 31  ? -12.551 -2.425  -1.630  1.00 1.00 ? 51  VAL A HG13 2  
ATOM 2295  H HG21 . VAL A 1 31  ? -12.376 -0.398  -4.951  1.00 1.00 ? 51  VAL A HG21 2  
ATOM 2296  H HG22 . VAL A 1 31  ? -13.782 0.554   -4.461  1.00 1.00 ? 51  VAL A HG22 2  
ATOM 2297  H HG23 . VAL A 1 31  ? -12.281 0.682   -3.544  1.00 1.00 ? 51  VAL A HG23 2  
ATOM 2298  N N    . VAL A 1 32  ? -14.088 -4.606  -3.192  1.00 1.00 ? 52  VAL A N    2  
ATOM 2299  C CA   . VAL A 1 32  ? -14.364 -5.761  -2.312  1.00 1.00 ? 52  VAL A CA   2  
ATOM 2300  C C    . VAL A 1 32  ? -13.052 -6.456  -1.910  1.00 1.00 ? 52  VAL A C    2  
ATOM 2301  O O    . VAL A 1 32  ? -12.319 -6.949  -2.764  1.00 1.00 ? 52  VAL A O    2  
ATOM 2302  C CB   . VAL A 1 32  ? -15.324 -6.786  -2.989  1.00 1.00 ? 52  VAL A CB   2  
ATOM 2303  C CG1  . VAL A 1 32  ? -15.506 -8.070  -2.150  1.00 1.00 ? 52  VAL A CG1  2  
ATOM 2304  C CG2  . VAL A 1 32  ? -16.722 -6.187  -3.223  1.00 1.00 ? 52  VAL A CG2  2  
ATOM 2305  H H    . VAL A 1 32  ? -13.434 -4.802  -3.943  1.00 1.00 ? 52  VAL A H    2  
ATOM 2306  H HA   . VAL A 1 32  ? -14.858 -5.402  -1.407  1.00 1.00 ? 52  VAL A HA   2  
ATOM 2307  H HB   . VAL A 1 32  ? -14.918 -7.079  -3.957  1.00 1.00 ? 52  VAL A HB   2  
ATOM 2308  H HG11 . VAL A 1 32  ? -15.855 -7.824  -1.147  1.00 1.00 ? 52  VAL A HG11 2  
ATOM 2309  H HG12 . VAL A 1 32  ? -16.227 -8.735  -2.627  1.00 1.00 ? 52  VAL A HG12 2  
ATOM 2310  H HG13 . VAL A 1 32  ? -14.563 -8.616  -2.080  1.00 1.00 ? 52  VAL A HG13 2  
ATOM 2311  H HG21 . VAL A 1 32  ? -16.653 -5.300  -3.851  1.00 1.00 ? 52  VAL A HG21 2  
ATOM 2312  H HG22 . VAL A 1 32  ? -17.365 -6.910  -3.725  1.00 1.00 ? 52  VAL A HG22 2  
ATOM 2313  H HG23 . VAL A 1 32  ? -17.165 -5.918  -2.267  1.00 1.00 ? 52  VAL A HG23 2  
ATOM 2314  N N    . ALA A 1 33  ? -12.774 -6.529  -0.602  1.00 1.00 ? 53  ALA A N    2  
ATOM 2315  C CA   . ALA A 1 33  ? -11.686 -7.325  -0.018  1.00 1.00 ? 53  ALA A CA   2  
ATOM 2316  C C    . ALA A 1 33  ? -12.306 -8.086  1.170   1.00 1.00 ? 53  ALA A C    2  
ATOM 2317  O O    . ALA A 1 33  ? -12.541 -7.502  2.222   1.00 1.00 ? 53  ALA A O    2  
ATOM 2318  C CB   . ALA A 1 33  ? -10.518 -6.389  0.337   1.00 1.00 ? 53  ALA A CB   2  
ATOM 2319  H H    . ALA A 1 33  ? -13.400 -6.057  0.033   1.00 1.00 ? 53  ALA A H    2  
ATOM 2320  H HA   . ALA A 1 33  ? -11.326 -8.052  -0.736  1.00 1.00 ? 53  ALA A HA   2  
ATOM 2321  H HB1  . ALA A 1 33  ? -10.842 -5.634  1.055   1.00 1.00 ? 53  ALA A HB1  2  
ATOM 2322  H HB2  . ALA A 1 33  ? -9.701  -6.960  0.771   1.00 1.00 ? 53  ALA A HB2  2  
ATOM 2323  H HB3  . ALA A 1 33  ? -10.160 -5.896  -0.568  1.00 1.00 ? 53  ALA A HB3  2  
ATOM 2324  N N    . LEU A 1 34  ? -12.516 -9.405  1.022   1.00 1.00 ? 54  LEU A N    2  
ATOM 2325  C CA   . LEU A 1 34  ? -13.315 -10.181 1.993   1.00 1.00 ? 54  LEU A CA   2  
ATOM 2326  C C    . LEU A 1 34  ? -12.651 -10.506 3.351   1.00 1.00 ? 54  LEU A C    2  
ATOM 2327  O O    . LEU A 1 34  ? -11.437 -10.591 3.485   1.00 1.00 ? 54  LEU A O    2  
ATOM 2328  C CB   . LEU A 1 34  ? -13.799 -11.462 1.288   1.00 1.00 ? 54  LEU A CB   2  
ATOM 2329  C CG   . LEU A 1 34  ? -15.316 -11.697 1.142   1.00 1.00 ? 54  LEU A CG   2  
ATOM 2330  C CD1  . LEU A 1 34  ? -16.069 -11.708 2.481   1.00 1.00 ? 54  LEU A CD1  2  
ATOM 2331  C CD2  . LEU A 1 34  ? -15.940 -10.668 0.192   1.00 1.00 ? 54  LEU A CD2  2  
ATOM 2332  H H    . LEU A 1 34  ? -12.232 -9.843  0.147   1.00 1.00 ? 54  LEU A H    2  
ATOM 2333  H HA   . LEU A 1 34  ? -14.191 -9.569  2.215   1.00 1.00 ? 54  LEU A HA   2  
ATOM 2334  H HB2  . LEU A 1 34  ? -13.614 -11.434 0.215   1.00 0.00 ? 54  LEU A HB2  2  
ATOM 2335  H HB3  . LEU A 1 34  ? -13.299 -12.356 1.671   1.00 1.00 ? 54  LEU A HB3  2  
ATOM 2336  H HG   . LEU A 1 34  ? -15.442 -12.682 0.684   1.00 1.00 ? 54  LEU A HG   2  
ATOM 2337  H HD11 . LEU A 1 34  ? -15.597 -12.411 3.170   1.00 1.00 ? 54  LEU A HD11 2  
ATOM 2338  H HD12 . LEU A 1 34  ? -16.085 -10.709 2.922   1.00 1.00 ? 54  LEU A HD12 2  
ATOM 2339  H HD13 . LEU A 1 34  ? -17.098 -12.025 2.315   1.00 1.00 ? 54  LEU A HD13 2  
ATOM 2340  H HD21 . LEU A 1 34  ? -15.411 -10.685 -0.762  1.00 1.00 ? 54  LEU A HD21 2  
ATOM 2341  H HD22 . LEU A 1 34  ? -16.986 -10.911 0.015   1.00 1.00 ? 54  LEU A HD22 2  
ATOM 2342  H HD23 . LEU A 1 34  ? -15.876 -9.666  0.618   1.00 1.00 ? 54  LEU A HD23 2  
ATOM 2343  N N    . GLY A 1 35  ? -13.500 -10.727 4.364   1.00 1.00 ? 55  GLY A N    2  
ATOM 2344  C CA   . GLY A 1 35  ? -13.145 -11.160 5.730   1.00 1.00 ? 55  GLY A CA   2  
ATOM 2345  C C    . GLY A 1 35  ? -14.112 -10.700 6.836   1.00 1.00 ? 55  GLY A C    2  
ATOM 2346  O O    . GLY A 1 35  ? -14.225 -11.362 7.867   1.00 1.00 ? 55  GLY A O    2  
ATOM 2347  H H    . GLY A 1 35  ? -14.480 -10.610 4.151   1.00 1.00 ? 55  GLY A H    2  
ATOM 2348  H HA2  . GLY A 1 35  ? -13.099 -12.250 5.750   1.00 1.00 ? 55  GLY A HA2  2  
ATOM 2349  H HA3  . GLY A 1 35  ? -12.156 -10.780 5.981   1.00 1.00 ? 55  GLY A HA3  2  
ATOM 2350  N N    . ASP A 1 36  ? -14.817 -9.582  6.632   1.00 1.00 ? 56  ASP A N    2  
ATOM 2351  C CA   . ASP A 1 36  ? -15.839 -8.994  7.500   1.00 1.00 ? 56  ASP A CA   2  
ATOM 2352  C C    . ASP A 1 36  ? -17.238 -9.607  7.255   1.00 1.00 ? 56  ASP A C    2  
ATOM 2353  O O    . ASP A 1 36  ? -18.020 -9.116  6.443   1.00 1.00 ? 56  ASP A O    2  
ATOM 2354  C CB   . ASP A 1 36  ? -15.807 -7.462  7.309   1.00 1.00 ? 56  ASP A CB   2  
ATOM 2355  C CG   . ASP A 1 36  ? -16.110 -6.972  5.887   1.00 1.00 ? 56  ASP A CG   2  
ATOM 2356  O OD1  . ASP A 1 36  ? -15.581 -7.582  4.923   1.00 1.00 ? 56  ASP A OD1  2  
ATOM 2357  O OD2  . ASP A 1 36  ? -16.844 -5.964  5.773   1.00 1.00 ? 56  ASP A OD2  2  
ATOM 2358  H H    . ASP A 1 36  ? -14.711 -9.058  5.760   1.00 1.00 ? 56  ASP A H    2  
ATOM 2359  H HA   . ASP A 1 36  ? -15.571 -9.181  8.541   1.00 1.00 ? 56  ASP A HA   2  
ATOM 2360  H HB2  . ASP A 1 36  ? -16.557 -7.024  7.969   1.00 0.00 ? 56  ASP A HB2  2  
ATOM 2361  H HB3  . ASP A 1 36  ? -14.832 -7.079  7.611   1.00 1.00 ? 56  ASP A HB3  2  
ATOM 2362  N N    . VAL A 1 37  ? -17.554 -10.724 7.934   1.00 1.00 ? 57  VAL A N    2  
ATOM 2363  C CA   . VAL A 1 37  ? -18.910 -11.328 7.936   1.00 1.00 ? 57  VAL A CA   2  
ATOM 2364  C C    . VAL A 1 37  ? -19.921 -10.362 8.606   1.00 1.00 ? 57  VAL A C    2  
ATOM 2365  O O    . VAL A 1 37  ? -20.979 -10.141 8.012   1.00 1.00 ? 57  VAL A O    2  
ATOM 2366  C CB   . VAL A 1 37  ? -18.920 -12.765 8.521   1.00 1.00 ? 57  VAL A CB   2  
ATOM 2367  C CG1  . VAL A 1 37  ? -20.344 -13.340 8.640   1.00 1.00 ? 57  VAL A CG1  2  
ATOM 2368  C CG2  . VAL A 1 37  ? -18.088 -13.721 7.644   1.00 1.00 ? 57  VAL A CG2  2  
ATOM 2369  H H    . VAL A 1 37  ? -16.830 -11.121 8.517   1.00 1.00 ? 57  VAL A H    2  
ATOM 2370  H HA   . VAL A 1 37  ? -19.227 -11.413 6.895   1.00 1.00 ? 57  VAL A HA   2  
ATOM 2371  H HB   . VAL A 1 37  ? -18.471 -12.759 9.512   1.00 1.00 ? 57  VAL A HB   2  
ATOM 2372  H HG11 . VAL A 1 37  ? -20.831 -13.349 7.663   1.00 1.00 ? 57  VAL A HG11 2  
ATOM 2373  H HG12 . VAL A 1 37  ? -20.307 -14.357 9.030   1.00 1.00 ? 57  VAL A HG12 2  
ATOM 2374  H HG13 . VAL A 1 37  ? -20.939 -12.736 9.325   1.00 1.00 ? 57  VAL A HG13 2  
ATOM 2375  H HG21 . VAL A 1 37  ? -17.054 -13.378 7.584   1.00 1.00 ? 57  VAL A HG21 2  
ATOM 2376  H HG22 . VAL A 1 37  ? -18.089 -14.721 8.077   1.00 1.00 ? 57  VAL A HG22 2  
ATOM 2377  H HG23 . VAL A 1 37  ? -18.505 -13.765 6.637   1.00 1.00 ? 57  VAL A HG23 2  
ATOM 2378  N N    . PRO A 1 38  ? -19.658 -9.807  9.818   1.00 1.00 ? 58  PRO A N    2  
ATOM 2379  C CA   . PRO A 1 38  ? -20.457 -8.738  10.429  1.00 1.00 ? 58  PRO A CA   2  
ATOM 2380  C C    . PRO A 1 38  ? -20.059 -7.356  9.865   1.00 1.00 ? 58  PRO A C    2  
ATOM 2381  O O    . PRO A 1 38  ? -18.880 -6.990  9.830   1.00 1.00 ? 58  PRO A O    2  
ATOM 2382  C CB   . PRO A 1 38  ? -20.180 -8.793  11.931  1.00 1.00 ? 58  PRO A CB   2  
ATOM 2383  C CG   . PRO A 1 38  ? -18.791 -9.420  12.013  1.00 1.00 ? 58  PRO A CG   2  
ATOM 2384  C CD   . PRO A 1 38  ? -18.639 -10.265 10.755  1.00 1.00 ? 58  PRO A CD   2  
ATOM 2385  H HA   . PRO A 1 38  ? -21.523 -8.914  10.254  1.00 1.00 ? 58  PRO A HA   2  
ATOM 2386  H HB2  . PRO A 1 38  ? -20.198 -7.795  12.368  1.00 0.00 ? 58  PRO A HB2  2  
ATOM 2387  H HB3  . PRO A 1 38  ? -20.906 -9.459  12.401  1.00 1.00 ? 58  PRO A HB3  2  
ATOM 2388  H HG2  . PRO A 1 38  ? -18.024 -8.648  12.058  1.00 0.00 ? 58  PRO A HG2  2  
ATOM 2389  H HG3  . PRO A 1 38  ? -18.704 -10.042 12.905  1.00 1.00 ? 58  PRO A HG3  2  
ATOM 2390  H HD2  . PRO A 1 38  ? -17.656 -10.187 10.290  1.00 0.00 ? 58  PRO A HD2  2  
ATOM 2391  H HD3  . PRO A 1 38  ? -18.832 -11.303 11.024  1.00 1.00 ? 58  PRO A HD3  2  
ATOM 2392  N N    . ASP A 1 39  ? -21.060 -6.583  9.435   1.00 1.00 ? 59  ASP A N    2  
ATOM 2393  C CA   . ASP A 1 39  ? -20.955 -5.237  8.854   1.00 1.00 ? 59  ASP A CA   2  
ATOM 2394  C C    . ASP A 1 39  ? -20.519 -4.117  9.837   1.00 1.00 ? 59  ASP A C    2  
ATOM 2395  O O    . ASP A 1 39  ? -20.463 -4.295  11.055  1.00 1.00 ? 59  ASP A O    2  
ATOM 2396  C CB   . ASP A 1 39  ? -22.300 -4.908  8.175   1.00 1.00 ? 59  ASP A CB   2  
ATOM 2397  C CG   . ASP A 1 39  ? -23.537 -5.087  9.062   1.00 1.00 ? 59  ASP A CG   2  
ATOM 2398  O OD1  . ASP A 1 39  ? -23.817 -6.248  9.442   1.00 1.00 ? 59  ASP A OD1  2  
ATOM 2399  O OD2  . ASP A 1 39  ? -24.190 -4.057  9.330   1.00 1.00 ? 59  ASP A OD2  2  
ATOM 2400  H H    . ASP A 1 39  ? -22.021 -6.913  9.529   1.00 1.00 ? 59  ASP A H    2  
ATOM 2401  H HA   . ASP A 1 39  ? -20.198 -5.275  8.067   1.00 1.00 ? 59  ASP A HA   2  
ATOM 2402  H HB2  . ASP A 1 39  ? -22.274 -3.865  7.861   1.00 0.00 ? 59  ASP A HB2  2  
ATOM 2403  H HB3  . ASP A 1 39  ? -22.424 -5.493  7.261   1.00 1.00 ? 59  ASP A HB3  2  
ATOM 2404  N N    . GLY A 1 40  ? -20.203 -2.932  9.288   1.00 1.00 ? 60  GLY A N    2  
ATOM 2405  C CA   . GLY A 1 40  ? -19.650 -1.757  9.979   1.00 1.00 ? 60  GLY A CA   2  
ATOM 2406  C C    . GLY A 1 40  ? -18.149 -1.508  9.751   1.00 1.00 ? 60  GLY A C    2  
ATOM 2407  O O    . GLY A 1 40  ? -17.618 -0.570  10.343  1.00 1.00 ? 60  GLY A O    2  
ATOM 2408  H H    . GLY A 1 40  ? -20.237 -2.882  8.270   1.00 1.00 ? 60  GLY A H    2  
ATOM 2409  H HA2  . GLY A 1 40  ? -20.182 -0.868  9.645   1.00 1.00 ? 60  GLY A HA2  2  
ATOM 2410  H HA3  . GLY A 1 40  ? -19.812 -1.854  11.054  1.00 1.00 ? 60  GLY A HA3  2  
ATOM 2411  N N    . THR A 1 41  ? -17.461 -2.307  8.910   1.00 1.00 ? 61  THR A N    2  
ATOM 2412  C CA   . THR A 1 41  ? -15.995 -2.237  8.682   1.00 1.00 ? 61  THR A CA   2  
ATOM 2413  C C    . THR A 1 41  ? -15.527 -0.828  8.289   1.00 1.00 ? 61  THR A C    2  
ATOM 2414  O O    . THR A 1 41  ? -16.010 -0.279  7.296   1.00 1.00 ? 61  THR A O    2  
ATOM 2415  C CB   . THR A 1 41  ? -15.486 -3.296  7.678   1.00 1.00 ? 61  THR A CB   2  
ATOM 2416  O OG1  . THR A 1 41  ? -14.077 -3.309  7.703   1.00 1.00 ? 61  THR A OG1  2  
ATOM 2417  C CG2  . THR A 1 41  ? -15.900 -3.108  6.221   1.00 1.00 ? 61  THR A CG2  2  
ATOM 2418  H H    . THR A 1 41  ? -18.022 -2.984  8.396   1.00 1.00 ? 61  THR A H    2  
ATOM 2419  H HA   . THR A 1 41  ? -15.532 -2.475  9.636   1.00 1.00 ? 61  THR A HA   2  
ATOM 2420  H HB   . THR A 1 41  ? -15.848 -4.270  8.001   1.00 1.00 ? 61  THR A HB   2  
ATOM 2421  H HG1  . THR A 1 41  ? -13.785 -4.029  7.079   1.00 1.00 ? 61  THR A HG1  2  
ATOM 2422  H HG21 . THR A 1 41  ? -15.525 -2.172  5.815   1.00 1.00 ? 61  THR A HG21 2  
ATOM 2423  H HG22 . THR A 1 41  ? -15.500 -3.913  5.616   1.00 1.00 ? 61  THR A HG22 2  
ATOM 2424  H HG23 . THR A 1 41  ? -16.980 -3.154  6.157   1.00 1.00 ? 61  THR A HG23 2  
ATOM 2425  N N    . LEU A 1 42  ? -14.618 -0.227  9.072   1.00 1.00 ? 62  LEU A N    2  
ATOM 2426  C CA   . LEU A 1 42  ? -14.068 1.105   8.835   1.00 1.00 ? 62  LEU A CA   2  
ATOM 2427  C C    . LEU A 1 42  ? -12.910 1.031   7.821   1.00 1.00 ? 62  LEU A C    2  
ATOM 2428  O O    . LEU A 1 42  ? -11.756 0.730   8.143   1.00 1.00 ? 62  LEU A O    2  
ATOM 2429  C CB   . LEU A 1 42  ? -13.680 1.711   10.199  1.00 1.00 ? 62  LEU A CB   2  
ATOM 2430  C CG   . LEU A 1 42  ? -14.612 2.835   10.692  1.00 1.00 ? 62  LEU A CG   2  
ATOM 2431  C CD1  . LEU A 1 42  ? -14.361 3.101   12.181  1.00 1.00 ? 62  LEU A CD1  2  
ATOM 2432  C CD2  . LEU A 1 42  ? -14.390 4.129   9.894   1.00 1.00 ? 62  LEU A CD2  2  
ATOM 2433  H H    . LEU A 1 42  ? -14.167 -0.750  9.816   1.00 1.00 ? 62  LEU A H    2  
ATOM 2434  H HA   . LEU A 1 42  ? -14.856 1.725   8.408   1.00 1.00 ? 62  LEU A HA   2  
ATOM 2435  H HB2  . LEU A 1 42  ? -13.813 1.008   11.021  1.00 0.00 ? 62  LEU A HB2  2  
ATOM 2436  H HB3  . LEU A 1 42  ? -12.634 2.028   10.235  1.00 1.00 ? 62  LEU A HB3  2  
ATOM 2437  H HG   . LEU A 1 42  ? -15.650 2.520   10.575  1.00 1.00 ? 62  LEU A HG   2  
ATOM 2438  H HD11 . LEU A 1 42  ? -14.529 2.185   12.744  1.00 1.00 ? 62  LEU A HD11 2  
ATOM 2439  H HD12 . LEU A 1 42  ? -13.337 3.436   12.343  1.00 1.00 ? 62  LEU A HD12 2  
ATOM 2440  H HD13 . LEU A 1 42  ? -15.052 3.862   12.544  1.00 1.00 ? 62  LEU A HD13 2  
ATOM 2441  H HD21 . LEU A 1 42  ? -13.360 4.465   10.012  1.00 1.00 ? 62  LEU A HD21 2  
ATOM 2442  H HD22 . LEU A 1 42  ? -14.596 3.961   8.838   1.00 1.00 ? 62  LEU A HD22 2  
ATOM 2443  H HD23 . LEU A 1 42  ? -15.062 4.908   10.254  1.00 1.00 ? 62  LEU A HD23 2  
ATOM 2444  N N    . VAL A 1 43  ? -13.207 1.425   6.580   1.00 1.00 ? 63  VAL A N    2  
ATOM 2445  C CA   . VAL A 1 43  ? -12.243 1.463   5.474   1.00 1.00 ? 63  VAL A CA   2  
ATOM 2446  C C    . VAL A 1 43  ? -11.653 2.873   5.481   1.00 1.00 ? 63  VAL A C    2  
ATOM 2447  O O    . VAL A 1 43  ? -12.337 3.844   5.139   1.00 1.00 ? 63  VAL A O    2  
ATOM 2448  C CB   . VAL A 1 43  ? -12.905 1.106   4.116   1.00 1.00 ? 63  VAL A CB   2  
ATOM 2449  C CG1  . VAL A 1 43  ? -11.924 1.270   2.938   1.00 1.00 ? 63  VAL A CG1  2  
ATOM 2450  C CG2  . VAL A 1 43  ? -13.412 -0.350  4.120   1.00 1.00 ? 63  VAL A CG2  2  
ATOM 2451  H H    . VAL A 1 43  ? -14.174 1.699   6.409   1.00 1.00 ? 63  VAL A H    2  
ATOM 2452  H HA   . VAL A 1 43  ? -11.453 0.735   5.642   1.00 1.00 ? 63  VAL A HA   2  
ATOM 2453  H HB   . VAL A 1 43  ? -13.760 1.765   3.946   1.00 1.00 ? 63  VAL A HB   2  
ATOM 2454  H HG11 . VAL A 1 43  ? -11.027 0.675   3.105   1.00 1.00 ? 63  VAL A HG11 2  
ATOM 2455  H HG12 . VAL A 1 43  ? -12.397 0.947   2.007   1.00 1.00 ? 63  VAL A HG12 2  
ATOM 2456  H HG13 . VAL A 1 43  ? -11.641 2.317   2.825   1.00 1.00 ? 63  VAL A HG13 2  
ATOM 2457  H HG21 . VAL A 1 43  ? -14.117 -0.501  4.938   1.00 1.00 ? 63  VAL A HG21 2  
ATOM 2458  H HG22 . VAL A 1 43  ? -13.924 -0.575  3.181   1.00 1.00 ? 63  VAL A HG22 2  
ATOM 2459  H HG23 . VAL A 1 43  ? -12.582 -1.044  4.240   1.00 1.00 ? 63  VAL A HG23 2  
ATOM 2460  N N    . THR A 1 44  ? -10.380 2.960   5.914   1.00 1.00 ? 64  THR A N    2  
ATOM 2461  C CA   . THR A 1 44  ? -9.613  4.235   5.968   1.00 1.00 ? 64  THR A CA   2  
ATOM 2462  C C    . THR A 1 44  ? -8.516  4.329   4.889   1.00 1.00 ? 64  THR A C    2  
ATOM 2463  O O    . THR A 1 44  ? -7.570  3.550   4.882   1.00 1.00 ? 64  THR A O    2  
ATOM 2464  C CB   . THR A 1 44  ? -9.032  4.535   7.370   1.00 1.00 ? 64  THR A CB   2  
ATOM 2465  O OG1  . THR A 1 44  ? -8.060  3.614   7.811   1.00 1.00 ? 64  THR A OG1  2  
ATOM 2466  C CG2  . THR A 1 44  ? -10.114 4.625   8.455   1.00 1.00 ? 64  THR A CG2  2  
ATOM 2467  H H    . THR A 1 44  ? -9.981  2.110   6.340   1.00 1.00 ? 64  THR A H    2  
ATOM 2468  H HA   . THR A 1 44  ? -10.311 5.049   5.792   1.00 1.00 ? 64  THR A HA   2  
ATOM 2469  H HB   . THR A 1 44  ? -8.552  5.513   7.326   1.00 1.00 ? 64  THR A HB   2  
ATOM 2470  H HG1  . THR A 1 44  ? -8.102  2.794   7.263   1.00 1.00 ? 64  THR A HG1  2  
ATOM 2471  H HG21 . THR A 1 44  ? -10.847 5.382   8.181   1.00 1.00 ? 64  THR A HG21 2  
ATOM 2472  H HG22 . THR A 1 44  ? -10.616 3.662   8.579   1.00 1.00 ? 64  THR A HG22 2  
ATOM 2473  H HG23 . THR A 1 44  ? -9.660  4.910   9.410   1.00 1.00 ? 64  THR A HG23 2  
ATOM 2474  N N    . VAL A 1 45  ? -8.596  5.308   3.974   1.00 1.00 ? 65  VAL A N    2  
ATOM 2475  C CA   . VAL A 1 45  ? -7.640  5.490   2.845   1.00 1.00 ? 65  VAL A CA   2  
ATOM 2476  C C    . VAL A 1 45  ? -6.716  6.700   3.088   1.00 1.00 ? 65  VAL A C    2  
ATOM 2477  O O    . VAL A 1 45  ? -7.161  7.847   3.098   1.00 1.00 ? 65  VAL A O    2  
ATOM 2478  C CB   . VAL A 1 45  ? -8.282  5.365   1.419   1.00 1.00 ? 65  VAL A CB   2  
ATOM 2479  C CG1  . VAL A 1 45  ? -9.806  5.120   1.367   1.00 1.00 ? 65  VAL A CG1  2  
ATOM 2480  C CG2  . VAL A 1 45  ? -7.910  6.473   0.416   1.00 1.00 ? 65  VAL A CG2  2  
ATOM 2481  H H    . VAL A 1 45  ? -9.424  5.900   4.048   1.00 1.00 ? 65  VAL A H    2  
ATOM 2482  H HA   . VAL A 1 45  ? -6.972  4.638   2.882   1.00 1.00 ? 65  VAL A HA   2  
ATOM 2483  H HB   . VAL A 1 45  ? -7.846  4.467   0.986   1.00 1.00 ? 65  VAL A HB   2  
ATOM 2484  H HG11 . VAL A 1 45  ? -10.061 4.228   1.940   1.00 1.00 ? 65  VAL A HG11 2  
ATOM 2485  H HG12 . VAL A 1 45  ? -10.347 5.965   1.782   1.00 1.00 ? 65  VAL A HG12 2  
ATOM 2486  H HG13 . VAL A 1 45  ? -10.136 4.962   0.338   1.00 1.00 ? 65  VAL A HG13 2  
ATOM 2487  H HG21 . VAL A 1 45  ? -6.826  6.512   0.304   1.00 1.00 ? 65  VAL A HG21 2  
ATOM 2488  H HG22 . VAL A 1 45  ? -8.343  6.265   -0.564  1.00 1.00 ? 65  VAL A HG22 2  
ATOM 2489  H HG23 . VAL A 1 45  ? -8.272  7.439   0.763   1.00 1.00 ? 65  VAL A HG23 2  
ATOM 2490  N N    . MET A 1 46  ? -5.413  6.426   3.283   1.00 1.00 ? 66  MET A N    2  
ATOM 2491  C CA   . MET A 1 46  ? -4.377  7.404   3.698   1.00 1.00 ? 66  MET A CA   2  
ATOM 2492  C C    . MET A 1 46  ? -3.010  7.245   2.974   1.00 1.00 ? 66  MET A C    2  
ATOM 2493  O O    . MET A 1 46  ? -2.795  6.266   2.259   1.00 1.00 ? 66  MET A O    2  
ATOM 2494  C CB   . MET A 1 46  ? -4.196  7.242   5.219   1.00 1.00 ? 66  MET A CB   2  
ATOM 2495  C CG   . MET A 1 46  ? -5.371  7.686   6.099   1.00 1.00 ? 66  MET A CG   2  
ATOM 2496  S SD   . MET A 1 46  ? -5.597  6.659   7.570   1.00 1.00 ? 66  MET A SD   2  
ATOM 2497  C CE   . MET A 1 46  ? -6.911  7.597   8.386   1.00 1.00 ? 66  MET A CE   2  
ATOM 2498  H H    . MET A 1 46  ? -5.145  5.433   3.302   1.00 1.00 ? 66  MET A H    2  
ATOM 2499  H HA   . MET A 1 46  ? -4.726  8.419   3.506   1.00 1.00 ? 66  MET A HA   2  
ATOM 2500  H HB2  . MET A 1 46  ? -4.029  6.184   5.422   1.00 0.00 ? 66  MET A HB2  2  
ATOM 2501  H HB3  . MET A 1 46  ? -3.319  7.785   5.548   1.00 1.00 ? 66  MET A HB3  2  
ATOM 2502  H HG2  . MET A 1 46  ? -5.273  8.704   6.474   1.00 0.00 ? 66  MET A HG2  2  
ATOM 2503  H HG3  . MET A 1 46  ? -6.303  7.706   5.536   1.00 1.00 ? 66  MET A HG3  2  
ATOM 2504  H HE1  . MET A 1 46  ? -7.782  7.642   7.734   1.00 1.00 ? 66  MET A HE1  2  
ATOM 2505  H HE2  . MET A 1 46  ? -7.183  7.102   9.318   1.00 1.00 ? 66  MET A HE2  2  
ATOM 2506  H HE3  . MET A 1 46  ? -6.559  8.608   8.597   1.00 1.00 ? 66  MET A HE3  2  
ATOM 2507  N N    . ALA A 1 47  ? -2.059  8.191   3.147   1.00 1.00 ? 67  ALA A N    2  
ATOM 2508  C CA   . ALA A 1 47  ? -0.678  8.063   2.622   1.00 1.00 ? 67  ALA A CA   2  
ATOM 2509  C C    . ALA A 1 47  ? 0.467   8.233   3.645   1.00 1.00 ? 67  ALA A C    2  
ATOM 2510  O O    . ALA A 1 47  ? 0.704   9.312   4.183   1.00 1.00 ? 67  ALA A O    2  
ATOM 2511  C CB   . ALA A 1 47  ? -0.472  8.911   1.363   1.00 1.00 ? 67  ALA A CB   2  
ATOM 2512  H H    . ALA A 1 47  ? -2.303  9.031   3.652   1.00 1.00 ? 67  ALA A H    2  
ATOM 2513  H HA   . ALA A 1 47  ? -0.586  7.039   2.290   1.00 1.00 ? 67  ALA A HA   2  
ATOM 2514  H HB1  . ALA A 1 47  ? -1.237  8.664   0.627   1.00 1.00 ? 67  ALA A HB1  2  
ATOM 2515  H HB2  . ALA A 1 47  ? -0.505  9.970   1.610   1.00 1.00 ? 67  ALA A HB2  2  
ATOM 2516  H HB3  . ALA A 1 47  ? 0.502   8.690   0.923   1.00 1.00 ? 67  ALA A HB3  2  
ATOM 2517  N N    . GLY A 1 48  ? 1.170   7.124   3.891   1.00 1.00 ? 68  GLY A N    2  
ATOM 2518  C CA   . GLY A 1 48  ? 2.398   6.984   4.682   1.00 1.00 ? 68  GLY A CA   2  
ATOM 2519  C C    . GLY A 1 48  ? 3.681   7.545   4.029   1.00 1.00 ? 68  GLY A C    2  
ATOM 2520  O O    . GLY A 1 48  ? 3.696   8.017   2.891   1.00 1.00 ? 68  GLY A O    2  
ATOM 2521  H H    . GLY A 1 48  ? 0.866   6.325   3.351   1.00 1.00 ? 68  GLY A H    2  
ATOM 2522  H HA2  . GLY A 1 48  ? 2.253   7.455   5.649   1.00 1.00 ? 68  GLY A HA2  2  
ATOM 2523  H HA3  . GLY A 1 48  ? 2.564   5.918   4.854   1.00 1.00 ? 68  GLY A HA3  2  
ATOM 2524  N N    . ASN A 1 49  ? 4.784   7.444   4.779   1.00 1.00 ? 69  ASN A N    2  
ATOM 2525  C CA   . ASN A 1 49  ? 6.171   7.768   4.395   1.00 1.00 ? 69  ASN A CA   2  
ATOM 2526  C C    . ASN A 1 49  ? 7.039   6.498   4.573   1.00 1.00 ? 69  ASN A C    2  
ATOM 2527  O O    . ASN A 1 49  ? 7.518   5.920   3.600   1.00 1.00 ? 69  ASN A O    2  
ATOM 2528  C CB   . ASN A 1 49  ? 6.625   9.020   5.194   1.00 1.00 ? 69  ASN A CB   2  
ATOM 2529  C CG   . ASN A 1 49  ? 6.688   8.877   6.717   1.00 1.00 ? 69  ASN A CG   2  
ATOM 2530  O OD1  . ASN A 1 49  ? 6.015   8.062   7.333   1.00 1.00 ? 69  ASN A OD1  2  
ATOM 2531  N ND2  . ASN A 1 49  ? 7.541   9.624   7.372   1.00 1.00 ? 69  ASN A ND2  2  
ATOM 2532  H H    . ASN A 1 49  ? 4.674   7.108   5.731   1.00 1.00 ? 69  ASN A H    2  
ATOM 2533  H HA   . ASN A 1 49  ? 6.206   8.025   3.333   1.00 1.00 ? 69  ASN A HA   2  
ATOM 2534  H HB2  . ASN A 1 49  ? 7.660   9.264   4.952   1.00 0.00 ? 69  ASN A HB2  2  
ATOM 2535  H HB3  . ASN A 1 49  ? 5.994   9.874   4.943   1.00 1.00 ? 69  ASN A HB3  2  
ATOM 2536  H HD21 . ASN A 1 49  ? 8.144   10.283  6.862   1.00 0.00 ? 69  ASN A HD21 2  
ATOM 2537  H HD22 . ASN A 1 49  ? 7.608   9.551   8.398   1.00 0.00 ? 69  ASN A HD22 2  
ATOM 2538  N N    . ASP A 1 50  ? 7.118   6.021   5.820   1.00 1.00 ? 70  ASP A N    2  
ATOM 2539  C CA   . ASP A 1 50  ? 7.655   4.762   6.339   1.00 1.00 ? 70  ASP A CA   2  
ATOM 2540  C C    . ASP A 1 50  ? 6.448   3.969   6.911   1.00 1.00 ? 70  ASP A C    2  
ATOM 2541  O O    . ASP A 1 50  ? 6.454   3.501   8.048   1.00 1.00 ? 70  ASP A O    2  
ATOM 2542  C CB   . ASP A 1 50  ? 8.718   5.113   7.405   1.00 1.00 ? 70  ASP A CB   2  
ATOM 2543  C CG   . ASP A 1 50  ? 10.081  5.443   6.806   1.00 1.00 ? 70  ASP A CG   2  
ATOM 2544  O OD1  . ASP A 1 50  ? 10.659  4.534   6.168   1.00 1.00 ? 70  ASP A OD1  2  
ATOM 2545  O OD2  . ASP A 1 50  ? 10.526  6.591   7.018   1.00 1.00 ? 70  ASP A OD2  2  
ATOM 2546  H H    . ASP A 1 50  ? 6.730   6.641   6.525   1.00 1.00 ? 70  ASP A H    2  
ATOM 2547  H HA   . ASP A 1 50  ? 8.113   4.166   5.544   1.00 1.00 ? 70  ASP A HA   2  
ATOM 2548  H HB2  . ASP A 1 50  ? 8.448   5.977   8.011   1.00 0.00 ? 70  ASP A HB2  2  
ATOM 2549  H HB3  . ASP A 1 50  ? 8.835   4.298   8.124   1.00 1.00 ? 70  ASP A HB3  2  
ATOM 2550  N N    . GLU A 1 51  ? 5.339   3.893   6.143   1.00 1.00 ? 71  GLU A N    2  
ATOM 2551  C CA   . GLU A 1 51  ? 3.993   3.389   6.504   1.00 1.00 ? 71  GLU A CA   2  
ATOM 2552  C C    . GLU A 1 51  ? 3.268   4.230   7.593   1.00 1.00 ? 71  GLU A C    2  
ATOM 2553  O O    . GLU A 1 51  ? 2.045   4.339   7.566   1.00 1.00 ? 71  GLU A O    2  
ATOM 2554  C CB   . GLU A 1 51  ? 4.072   1.886   6.856   1.00 1.00 ? 71  GLU A CB   2  
ATOM 2555  C CG   . GLU A 1 51  ? 2.740   1.123   6.810   1.00 1.00 ? 71  GLU A CG   2  
ATOM 2556  C CD   . GLU A 1 51  ? 2.965   -0.391  6.806   1.00 1.00 ? 71  GLU A CD   2  
ATOM 2557  O OE1  . GLU A 1 51  ? 3.686   -0.860  5.890   1.00 1.00 ? 71  GLU A OE1  2  
ATOM 2558  O OE2  . GLU A 1 51  ? 2.411   -1.063  7.696   1.00 1.00 ? 71  GLU A OE2  2  
ATOM 2559  H H    . GLU A 1 51  ? 5.460   4.310   5.232   1.00 1.00 ? 71  GLU A H    2  
ATOM 2560  H HA   . GLU A 1 51  ? 3.374   3.467   5.609   1.00 1.00 ? 71  GLU A HA   2  
ATOM 2561  H HB2  . GLU A 1 51  ? 4.741   1.407   6.140   1.00 0.00 ? 71  GLU A HB2  2  
ATOM 2562  H HB3  . GLU A 1 51  ? 4.545   1.738   7.826   1.00 1.00 ? 71  GLU A HB3  2  
ATOM 2563  H HG2  . GLU A 1 51  ? 2.119   1.360   7.674   1.00 0.00 ? 71  GLU A HG2  2  
ATOM 2564  H HG3  . GLU A 1 51  ? 2.177   1.399   5.917   1.00 1.00 ? 71  GLU A HG3  2  
ATOM 2565  N N    . ASN A 1 52  ? 4.012   4.920   8.475   1.00 1.00 ? 72  ASN A N    2  
ATOM 2566  C CA   . ASN A 1 52  ? 3.596   5.644   9.684   1.00 1.00 ? 72  ASN A CA   2  
ATOM 2567  C C    . ASN A 1 52  ? 3.517   7.195   9.539   1.00 1.00 ? 72  ASN A C    2  
ATOM 2568  O O    . ASN A 1 52  ? 4.019   7.939   10.382  1.00 1.00 ? 72  ASN A O    2  
ATOM 2569  C CB   . ASN A 1 52  ? 4.557   5.142   10.783  1.00 1.00 ? 72  ASN A CB   2  
ATOM 2570  C CG   . ASN A 1 52  ? 4.039   5.215   12.218  1.00 1.00 ? 72  ASN A CG   2  
ATOM 2571  O OD1  . ASN A 1 52  ? 2.855   5.134   12.509  1.00 1.00 ? 72  ASN A OD1  2  
ATOM 2572  N ND2  . ASN A 1 52  ? 4.928   5.303   13.182  1.00 1.00 ? 72  ASN A ND2  2  
ATOM 2573  H H    . ASN A 1 52  ? 5.010   4.749   8.375   1.00 1.00 ? 72  ASN A H    2  
ATOM 2574  H HA   . ASN A 1 52  ? 2.584   5.319   9.950   1.00 1.00 ? 72  ASN A HA   2  
ATOM 2575  H HB2  . ASN A 1 52  ? 4.690   4.061   10.723  1.00 0.00 ? 72  ASN A HB2  2  
ATOM 2576  H HB3  . ASN A 1 52  ? 5.541   5.608   10.685  1.00 1.00 ? 72  ASN A HB3  2  
ATOM 2577  H HD21 . ASN A 1 52  ? 5.932   5.321   12.956  1.00 0.00 ? 72  ASN A HD21 2  
ATOM 2578  H HD22 . ASN A 1 52  ? 4.619   5.354   14.164  1.00 0.00 ? 72  ASN A HD22 2  
ATOM 2579  N N    . TYR A 1 53  ? 2.845   7.673   8.482   1.00 1.00 ? 73  TYR A N    2  
ATOM 2580  C CA   . TYR A 1 53  ? 2.522   9.104   8.227   1.00 1.00 ? 73  TYR A CA   2  
ATOM 2581  C C    . TYR A 1 53  ? 1.053   9.384   7.830   1.00 1.00 ? 73  TYR A C    2  
ATOM 2582  O O    . TYR A 1 53  ? 0.608   10.524  7.940   1.00 1.00 ? 73  TYR A O    2  
ATOM 2583  C CB   . TYR A 1 53  ? 3.469   9.646   7.149   1.00 1.00 ? 73  TYR A CB   2  
ATOM 2584  C CG   . TYR A 1 53  ? 3.864   11.112  7.157   1.00 1.00 ? 73  TYR A CG   2  
ATOM 2585  C CD1  . TYR A 1 53  ? 4.910   11.537  8.009   1.00 1.00 ? 73  TYR A CD1  2  
ATOM 2586  C CD2  . TYR A 1 53  ? 3.303   12.016  6.220   1.00 1.00 ? 73  TYR A CD2  2  
ATOM 2587  C CE1  . TYR A 1 53  ? 5.443   12.842  7.887   1.00 1.00 ? 73  TYR A CE1  2  
ATOM 2588  C CE2  . TYR A 1 53  ? 3.839   13.321  6.090   1.00 1.00 ? 73  TYR A CE2  2  
ATOM 2589  C CZ   . TYR A 1 53  ? 4.926   13.728  6.906   1.00 1.00 ? 73  TYR A CZ   2  
ATOM 2590  O OH   . TYR A 1 53  ? 5.479   14.955  6.734   1.00 1.00 ? 73  TYR A OH   2  
ATOM 2591  H H    . TYR A 1 53  ? 2.530   6.948   7.856   1.00 1.00 ? 73  TYR A H    2  
ATOM 2592  H HA   . TYR A 1 53  ? 2.709   9.667   9.143   1.00 1.00 ? 73  TYR A HA   2  
ATOM 2593  H HB2  . TYR A 1 53  ? 4.487   9.283   7.289   1.00 0.00 ? 73  TYR A HB2  2  
ATOM 2594  H HB3  . TYR A 1 53  ? 3.154   9.346   6.152   1.00 1.00 ? 73  TYR A HB3  2  
ATOM 2595  H HD1  . TYR A 1 53  ? 5.326   10.838  8.721   1.00 1.00 ? 73  TYR A HD1  2  
ATOM 2596  H HD2  . TYR A 1 53  ? 2.490   11.688  5.589   1.00 1.00 ? 73  TYR A HD2  2  
ATOM 2597  H HE1  . TYR A 1 53  ? 6.261   13.142  8.526   1.00 1.00 ? 73  TYR A HE1  2  
ATOM 2598  H HE2  . TYR A 1 53  ? 3.463   14.018  5.360   1.00 1.00 ? 73  TYR A HE2  2  
ATOM 2599  H HH   . TYR A 1 53  ? 6.243   15.072  7.304   1.00 1.00 ? 73  TYR A HH   2  
ATOM 2600  N N    . SER A 1 54  ? 0.322   8.350   7.369   1.00 1.00 ? 74  SER A N    2  
ATOM 2601  C CA   . SER A 1 54  ? -1.095  8.237   6.981   1.00 1.00 ? 74  SER A CA   2  
ATOM 2602  C C    . SER A 1 54  ? -1.815  9.585   6.775   1.00 1.00 ? 74  SER A C    2  
ATOM 2603  O O    . SER A 1 54  ? -2.644  10.013  7.578   1.00 1.00 ? 74  SER A O    2  
ATOM 2604  C CB   . SER A 1 54  ? -1.817  7.275   7.943   1.00 1.00 ? 74  SER A CB   2  
ATOM 2605  O OG   . SER A 1 54  ? -1.588  5.943   7.529   1.00 1.00 ? 74  SER A OG   2  
ATOM 2606  H H    . SER A 1 54  ? 0.811   7.482   7.290   1.00 1.00 ? 74  SER A H    2  
ATOM 2607  H HA   . SER A 1 54  ? -1.092  7.748   6.005   1.00 1.00 ? 74  SER A HA   2  
ATOM 2608  H HB2  . SER A 1 54  ? -1.447  7.397   8.962   1.00 0.00 ? 74  SER A HB2  2  
ATOM 2609  H HB3  . SER A 1 54  ? -2.889  7.465   7.948   1.00 1.00 ? 74  SER A HB3  2  
ATOM 2610  H HG   . SER A 1 54  ? -2.230  5.366   7.965   1.00 1.00 ? 74  SER A HG   2  
ATOM 2611  N N    . ALA A 1 55  ? -1.457  10.235  5.658   1.00 1.00 ? 75  ALA A N    2  
ATOM 2612  C CA   . ALA A 1 55  ? -1.876  11.579  5.242   1.00 1.00 ? 75  ALA A CA   2  
ATOM 2613  C C    . ALA A 1 55  ? -3.406  11.811  5.218   1.00 1.00 ? 75  ALA A C    2  
ATOM 2614  O O    . ALA A 1 55  ? -4.190  10.912  4.907   1.00 1.00 ? 75  ALA A O    2  
ATOM 2615  C CB   . ALA A 1 55  ? -1.252  11.886  3.870   1.00 1.00 ? 75  ALA A CB   2  
ATOM 2616  H H    . ALA A 1 55  ? -0.666  9.796   5.178   1.00 1.00 ? 75  ALA A H    2  
ATOM 2617  H HA   . ALA A 1 55  ? -1.450  12.280  5.965   1.00 1.00 ? 75  ALA A HA   2  
ATOM 2618  H HB1  . ALA A 1 55  ? -0.173  11.741  3.910   1.00 1.00 ? 75  ALA A HB1  2  
ATOM 2619  H HB2  . ALA A 1 55  ? -1.681  11.225  3.114   1.00 1.00 ? 75  ALA A HB2  2  
ATOM 2620  H HB3  . ALA A 1 55  ? -1.454  12.918  3.581   1.00 1.00 ? 75  ALA A HB3  2  
ATOM 2621  N N    . GLU A 1 56  ? -3.792  13.069  5.480   1.00 1.00 ? 76  GLU A N    2  
ATOM 2622  C CA   . GLU A 1 56  ? -5.173  13.568  5.593   1.00 1.00 ? 76  GLU A CA   2  
ATOM 2623  C C    . GLU A 1 56  ? -6.074  13.208  4.395   1.00 1.00 ? 76  GLU A C    2  
ATOM 2624  O O    . GLU A 1 56  ? -5.653  13.276  3.235   1.00 1.00 ? 76  GLU A O    2  
ATOM 2625  C CB   . GLU A 1 56  ? -5.166  15.100  5.764   1.00 1.00 ? 76  GLU A CB   2  
ATOM 2626  C CG   . GLU A 1 56  ? -4.353  15.574  6.970   1.00 1.00 ? 76  GLU A CG   2  
ATOM 2627  C CD   . GLU A 1 56  ? -4.891  16.847  7.617   1.00 1.00 ? 76  GLU A CD   2  
ATOM 2628  O OE1  . GLU A 1 56  ? -4.556  17.957  7.151   1.00 1.00 ? 76  GLU A OE1  2  
ATOM 2629  O OE2  . GLU A 1 56  ? -5.496  16.715  8.696   1.00 1.00 ? 76  GLU A OE2  2  
ATOM 2630  H H    . GLU A 1 56  ? -3.061  13.719  5.720   1.00 1.00 ? 76  GLU A H    2  
ATOM 2631  H HA   . GLU A 1 56  ? -5.613  13.139  6.497   1.00 1.00 ? 76  GLU A HA   2  
ATOM 2632  H HB2  . GLU A 1 56  ? -4.746  15.629  4.908   1.00 0.00 ? 76  GLU A HB2  2  
ATOM 2633  H HB3  . GLU A 1 56  ? -6.192  15.461  5.847   1.00 1.00 ? 76  GLU A HB3  2  
ATOM 2634  H HG2  . GLU A 1 56  ? -4.364  14.786  7.722   1.00 0.00 ? 76  GLU A HG2  2  
ATOM 2635  H HG3  . GLU A 1 56  ? -3.294  15.668  6.709   1.00 1.00 ? 76  GLU A HG3  2  
ATOM 2636  N N    . LEU A 1 57  ? -7.349  12.904  4.679   1.00 1.00 ? 77  LEU A N    2  
ATOM 2637  C CA   . LEU A 1 57  ? -8.397  12.557  3.750   1.00 1.00 ? 77  LEU A CA   2  
ATOM 2638  C C    . LEU A 1 57  ? -9.665  13.416  3.938   1.00 1.00 ? 77  LEU A C    2  
ATOM 2639  O O    . LEU A 1 57  ? -9.799  14.173  4.911   1.00 1.00 ? 77  LEU A O    2  
ATOM 2640  C CB   . LEU A 1 57  ? -8.620  11.035  3.854   1.00 1.00 ? 77  LEU A CB   2  
ATOM 2641  C CG   . LEU A 1 57  ? -9.328  10.343  5.039   1.00 1.00 ? 77  LEU A CG   2  
ATOM 2642  C CD1  . LEU A 1 57  ? -8.463  10.339  6.291   1.00 1.00 ? 77  LEU A CD1  2  
ATOM 2643  C CD2  . LEU A 1 57  ? -10.730 10.895  5.357   1.00 1.00 ? 77  LEU A CD2  2  
ATOM 2644  H H    . LEU A 1 57  ? -7.708  12.772  5.609   1.00 1.00 ? 77  LEU A H    2  
ATOM 2645  H HA   . LEU A 1 57  ? -8.027  12.771  2.746   1.00 1.00 ? 77  LEU A HA   2  
ATOM 2646  H HB2  . LEU A 1 57  ? -9.424  10.713  3.193   1.00 0.00 ? 77  LEU A HB2  2  
ATOM 2647  H HB3  . LEU A 1 57  ? -7.717  10.487  3.576   1.00 1.00 ? 77  LEU A HB3  2  
ATOM 2648  H HG   . LEU A 1 57  ? -9.456  9.301   4.757   1.00 1.00 ? 77  LEU A HG   2  
ATOM 2649  H HD11 . LEU A 1 57  ? -7.458  9.980   6.055   1.00 1.00 ? 77  LEU A HD11 2  
ATOM 2650  H HD12 . LEU A 1 57  ? -8.393  11.336  6.726   1.00 1.00 ? 77  LEU A HD12 2  
ATOM 2651  H HD13 . LEU A 1 57  ? -8.895  9.674   7.039   1.00 1.00 ? 77  LEU A HD13 2  
ATOM 2652  H HD21 . LEU A 1 57  ? -11.249 11.167  4.453   1.00 1.00 ? 77  LEU A HD21 2  
ATOM 2653  H HD22 . LEU A 1 57  ? -11.303 10.140  5.896   1.00 1.00 ? 77  LEU A HD22 2  
ATOM 2654  H HD23 . LEU A 1 57  ? -10.657 11.783  5.989   1.00 1.00 ? 77  LEU A HD23 2  
ATOM 2655  N N    . ARG A 1 58  ? -10.588 13.323  2.972   1.00 1.00 ? 78  ARG A N    2  
ATOM 2656  C CA   . ARG A 1 58  ? -11.938 13.920  2.995   1.00 1.00 ? 78  ARG A CA   2  
ATOM 2657  C C    . ARG A 1 58  ? -12.934 12.885  2.487   1.00 1.00 ? 78  ARG A C    2  
ATOM 2658  O O    . ARG A 1 58  ? -12.938 12.596  1.300   1.00 1.00 ? 78  ARG A O    2  
ATOM 2659  C CB   . ARG A 1 58  ? -12.006 15.201  2.138   1.00 1.00 ? 78  ARG A CB   2  
ATOM 2660  C CG   . ARG A 1 58  ? -11.239 16.411  2.684   1.00 1.00 ? 78  ARG A CG   2  
ATOM 2661  C CD   . ARG A 1 58  ? -9.728  16.322  2.445   1.00 1.00 ? 78  ARG A CD   2  
ATOM 2662  N NE   . ARG A 1 58  ? -9.010  17.490  2.982   1.00 1.00 ? 78  ARG A NE   2  
ATOM 2663  C CZ   . ARG A 1 58  ? -8.598  17.667  4.225   1.00 1.00 ? 78  ARG A CZ   2  
ATOM 2664  N NH1  . ARG A 1 58  ? -8.763  16.789  5.175   1.00 1.00 ? 78  ARG A NH1  2  
ATOM 2665  N NH2  . ARG A 1 58  ? -8.002  18.780  4.560   1.00 1.00 ? 78  ARG A NH2  2  
ATOM 2666  H H    . ARG A 1 58  ? -10.339 12.688  2.207   1.00 1.00 ? 78  ARG A H    2  
ATOM 2667  H HA   . ARG A 1 58  ? -12.212 14.184  4.019   1.00 1.00 ? 78  ARG A HA   2  
ATOM 2668  H HB2  . ARG A 1 58  ? -11.577 14.981  1.160   1.00 0.00 ? 78  ARG A HB2  2  
ATOM 2669  H HB3  . ARG A 1 58  ? -13.053 15.493  2.041   1.00 1.00 ? 78  ARG A HB3  2  
ATOM 2670  H HG2  . ARG A 1 58  ? -11.537 17.307  2.139   1.00 0.00 ? 78  ARG A HG2  2  
ATOM 2671  H HG3  . ARG A 1 58  ? -11.464 16.537  3.743   1.00 1.00 ? 78  ARG A HG3  2  
ATOM 2672  H HD2  . ARG A 1 58  ? -9.299  15.481  2.990   1.00 0.00 ? 78  ARG A HD2  2  
ATOM 2673  H HD3  . ARG A 1 58  ? -9.511  16.185  1.385   1.00 1.00 ? 78  ARG A HD3  2  
ATOM 2674  H HE   . ARG A 1 58  ? -8.849  18.266  2.367   1.00 1.00 ? 78  ARG A HE   2  
ATOM 2675  H HH11 . ARG A 1 58  ? -9.237  15.897  4.975   1.00 0.00 ? 78  ARG A HH11 2  
ATOM 2676  H HH12 . ARG A 1 58  ? -8.419  16.986  6.126   1.00 0.00 ? 78  ARG A HH12 2  
ATOM 2677  H HH21 . ARG A 1 58  ? -7.853  19.517  3.855   1.00 0.00 ? 78  ARG A HH21 2  
ATOM 2678  H HH22 . ARG A 1 58  ? -7.680  18.921  5.528   1.00 0.00 ? 78  ARG A HH22 2  
ATOM 2679  N N    . ASN A 1 59  ? -13.701 12.239  3.373   1.00 1.00 ? 79  ASN A N    2  
ATOM 2680  C CA   . ASN A 1 59  ? -14.622 11.149  3.030   1.00 1.00 ? 79  ASN A CA   2  
ATOM 2681  C C    . ASN A 1 59  ? -13.884 9.799   2.858   1.00 1.00 ? 79  ASN A C    2  
ATOM 2682  O O    . ASN A 1 59  ? -14.568 8.786   2.850   1.00 1.00 ? 79  ASN A O    2  
ATOM 2683  C CB   . ASN A 1 59  ? -15.524 11.501  1.802   1.00 1.00 ? 79  ASN A CB   2  
ATOM 2684  C CG   . ASN A 1 59  ? -16.121 12.915  1.733   1.00 1.00 ? 79  ASN A CG   2  
ATOM 2685  O OD1  . ASN A 1 59  ? -15.735 13.763  0.935   1.00 1.00 ? 79  ASN A OD1  2  
ATOM 2686  N ND2  . ASN A 1 59  ? -17.083 13.235  2.568   1.00 1.00 ? 79  ASN A ND2  2  
ATOM 2687  H H    . ASN A 1 59  ? -13.504 12.303  4.359   1.00 1.00 ? 79  ASN A H    2  
ATOM 2688  H HA   . ASN A 1 59  ? -15.290 11.005  3.881   1.00 1.00 ? 79  ASN A HA   2  
ATOM 2689  H HB2  . ASN A 1 59  ? -14.938 11.536  0.884   1.00 0.00 ? 79  ASN A HB2  2  
ATOM 2690  H HB3  . ASN A 1 59  ? -16.312 10.759  1.670   1.00 1.00 ? 79  ASN A HB3  2  
ATOM 2691  H HD21 . ASN A 1 59  ? -17.422 12.543  3.251   1.00 0.00 ? 79  ASN A HD21 2  
ATOM 2692  H HD22 . ASN A 1 59  ? -17.498 14.177  2.539   1.00 0.00 ? 79  ASN A HD22 2  
ATOM 2693  N N    . ALA A 1 60  ? -12.525 9.710   2.837   1.00 1.00 ? 80  ALA A N    2  
ATOM 2694  C CA   . ALA A 1 60  ? -11.763 8.434   2.799   1.00 1.00 ? 80  ALA A CA   2  
ATOM 2695  C C    . ALA A 1 60  ? -11.839 7.582   4.088   1.00 1.00 ? 80  ALA A C    2  
ATOM 2696  O O    . ALA A 1 60  ? -10.989 6.728   4.333   1.00 1.00 ? 80  ALA A O    2  
ATOM 2697  C CB   . ALA A 1 60  ? -10.353 8.669   2.236   1.00 1.00 ? 80  ALA A CB   2  
ATOM 2698  H H    . ALA A 1 60  ? -11.951 10.532  3.038   1.00 1.00 ? 80  ALA A H    2  
ATOM 2699  H HA   . ALA A 1 60  ? -12.242 7.769   2.085   1.00 1.00 ? 80  ALA A HA   2  
ATOM 2700  H HB1  . ALA A 1 60  ? -10.069 9.707   2.330   1.00 1.00 ? 80  ALA A HB1  2  
ATOM 2701  H HB2  . ALA A 1 60  ? -9.616  8.055   2.753   1.00 1.00 ? 80  ALA A HB2  2  
ATOM 2702  H HB3  . ALA A 1 60  ? -10.325 8.397   1.177   1.00 1.00 ? 80  ALA A HB3  2  
ATOM 2703  N N    . THR A 1 61  ? -12.875 7.839   4.887   1.00 1.00 ? 81  THR A N    2  
ATOM 2704  C CA   . THR A 1 61  ? -13.310 7.030   6.046   1.00 1.00 ? 81  THR A CA   2  
ATOM 2705  C C    . THR A 1 61  ? -14.798 6.671   5.895   1.00 1.00 ? 81  THR A C    2  
ATOM 2706  O O    . THR A 1 61  ? -15.660 7.551   5.901   1.00 1.00 ? 81  THR A O    2  
ATOM 2707  C CB   . THR A 1 61  ? -12.967 7.686   7.397   1.00 1.00 ? 81  THR A CB   2  
ATOM 2708  O OG1  . THR A 1 61  ? -13.296 6.804   8.439   1.00 1.00 ? 81  THR A OG1  2  
ATOM 2709  C CG2  . THR A 1 61  ? -13.649 9.028   7.691   1.00 1.00 ? 81  THR A CG2  2  
ATOM 2710  H H    . THR A 1 61  ? -13.413 8.618   4.480   1.00 1.00 ? 81  THR A H    2  
ATOM 2711  H HA   . THR A 1 61  ? -12.744 6.100   6.023   1.00 1.00 ? 81  THR A HA   2  
ATOM 2712  H HB   . THR A 1 61  ? -11.892 7.844   7.436   1.00 1.00 ? 81  THR A HB   2  
ATOM 2713  H HG1  . THR A 1 61  ? -12.769 6.005   8.377   1.00 1.00 ? 81  THR A HG1  2  
ATOM 2714  H HG21 . THR A 1 61  ? -13.480 9.718   6.868   1.00 1.00 ? 81  THR A HG21 2  
ATOM 2715  H HG22 . THR A 1 61  ? -14.722 8.892   7.825   1.00 1.00 ? 81  THR A HG22 2  
ATOM 2716  H HG23 . THR A 1 61  ? -13.240 9.457   8.607   1.00 1.00 ? 81  THR A HG23 2  
ATOM 2717  N N    . ALA A 1 62  ? -15.092 5.372   5.714   1.00 1.00 ? 82  ALA A N    2  
ATOM 2718  C CA   . ALA A 1 62  ? -16.429 4.825   5.512   1.00 1.00 ? 82  ALA A CA   2  
ATOM 2719  C C    . ALA A 1 62  ? -16.616 3.467   6.213   1.00 1.00 ? 82  ALA A C    2  
ATOM 2720  O O    . ALA A 1 62  ? -15.685 2.674   6.335   1.00 1.00 ? 82  ALA A O    2  
ATOM 2721  C CB   . ALA A 1 62  ? -16.695 4.703   4.001   1.00 1.00 ? 82  ALA A CB   2  
ATOM 2722  H H    . ALA A 1 62  ? -14.372 4.665   5.752   1.00 1.00 ? 82  ALA A H    2  
ATOM 2723  H HA   . ALA A 1 62  ? -17.157 5.529   5.928   1.00 1.00 ? 82  ALA A HA   2  
ATOM 2724  H HB1  . ALA A 1 62  ? -15.951 4.050   3.540   1.00 1.00 ? 82  ALA A HB1  2  
ATOM 2725  H HB2  . ALA A 1 62  ? -17.689 4.282   3.835   1.00 1.00 ? 82  ALA A HB2  2  
ATOM 2726  H HB3  . ALA A 1 62  ? -16.653 5.687   3.526   1.00 1.00 ? 82  ALA A HB3  2  
ATOM 2727  N N    . ALA A 1 63  ? -17.869 3.201   6.582   1.00 1.00 ? 83  ALA A N    2  
ATOM 2728  C CA   . ALA A 1 63  ? -18.378 1.942   7.139   1.00 1.00 ? 83  ALA A CA   2  
ATOM 2729  C C    . ALA A 1 63  ? -18.962 1.017   6.027   1.00 1.00 ? 83  ALA A C    2  
ATOM 2730  O O    . ALA A 1 63  ? -19.799 1.425   5.203   1.00 1.00 ? 83  ALA A O    2  
ATOM 2731  C CB   . ALA A 1 63  ? -19.377 2.253   8.264   1.00 1.00 ? 83  ALA A CB   2  
ATOM 2732  H H    . ALA A 1 63  ? -18.468 3.997   6.473   1.00 1.00 ? 83  ALA A H    2  
ATOM 2733  H HA   . ALA A 1 63  ? -17.542 1.429   7.616   1.00 1.00 ? 83  ALA A HA   2  
ATOM 2734  H HB1  . ALA A 1 63  ? -18.895 2.867   9.027   1.00 1.00 ? 83  ALA A HB1  2  
ATOM 2735  H HB2  . ALA A 1 63  ? -20.249 2.779   7.879   1.00 1.00 ? 83  ALA A HB2  2  
ATOM 2736  H HB3  . ALA A 1 63  ? -19.698 1.325   8.739   1.00 1.00 ? 83  ALA A HB3  2  
ATOM 2737  N N    . MET A 1 64  ? -18.529 -0.255  6.006   1.00 1.00 ? 84  MET A N    2  
ATOM 2738  C CA   . MET A 1 64  ? -18.811 -1.234  4.932   1.00 1.00 ? 84  MET A CA   2  
ATOM 2739  C C    . MET A 1 64  ? -19.466 -2.539  5.438   1.00 1.00 ? 84  MET A C    2  
ATOM 2740  O O    . MET A 1 64  ? -19.563 -2.789  6.640   1.00 1.00 ? 84  MET A O    2  
ATOM 2741  C CB   . MET A 1 64  ? -17.553 -1.443  4.065   1.00 1.00 ? 84  MET A CB   2  
ATOM 2742  C CG   . MET A 1 64  ? -17.032 -0.103  3.535   1.00 1.00 ? 84  MET A CG   2  
ATOM 2743  S SD   . MET A 1 64  ? -16.598 0.019   1.787   1.00 1.00 ? 84  MET A SD   2  
ATOM 2744  C CE   . MET A 1 64  ? -17.209 1.700   1.513   1.00 1.00 ? 84  MET A CE   2  
ATOM 2745  H H    . MET A 1 64  ? -17.857 -0.538  6.716   1.00 1.00 ? 84  MET A H    2  
ATOM 2746  H HA   . MET A 1 64  ? -19.553 -0.795  4.265   1.00 1.00 ? 84  MET A HA   2  
ATOM 2747  H HB2  . MET A 1 64  ? -16.760 -1.913  4.645   1.00 0.00 ? 84  MET A HB2  2  
ATOM 2748  H HB3  . MET A 1 64  ? -17.783 -2.103  3.228   1.00 1.00 ? 84  MET A HB3  2  
ATOM 2749  H HG2  . MET A 1 64  ? -17.813 0.639   3.707   1.00 0.00 ? 84  MET A HG2  2  
ATOM 2750  H HG3  . MET A 1 64  ? -16.240 0.296   4.171   1.00 1.00 ? 84  MET A HG3  2  
ATOM 2751  H HE1  . MET A 1 64  ? -16.693 2.388   2.179   1.00 1.00 ? 84  MET A HE1  2  
ATOM 2752  H HE2  . MET A 1 64  ? -17.024 1.991   0.481   1.00 1.00 ? 84  MET A HE2  2  
ATOM 2753  H HE3  . MET A 1 64  ? -18.280 1.737   1.714   1.00 1.00 ? 84  MET A HE3  2  
ATOM 2754  N N    . LYS A 1 65  ? -19.947 -3.350  4.486   1.00 1.00 ? 85  LYS A N    2  
ATOM 2755  C CA   . LYS A 1 65  ? -20.815 -4.534  4.648   1.00 1.00 ? 85  LYS A CA   2  
ATOM 2756  C C    . LYS A 1 65  ? -20.017 -5.851  4.688   1.00 1.00 ? 85  LYS A C    2  
ATOM 2757  O O    . LYS A 1 65  ? -19.893 -6.450  5.748   1.00 1.00 ? 85  LYS A O    2  
ATOM 2758  C CB   . LYS A 1 65  ? -21.897 -4.472  3.541   1.00 1.00 ? 85  LYS A CB   2  
ATOM 2759  C CG   . LYS A 1 65  ? -22.745 -3.178  3.511   1.00 1.00 ? 85  LYS A CG   2  
ATOM 2760  C CD   . LYS A 1 65  ? -21.999 -1.952  2.941   1.00 1.00 ? 85  LYS A CD   2  
ATOM 2761  C CE   . LYS A 1 65  ? -22.639 -0.598  3.269   1.00 1.00 ? 85  LYS A CE   2  
ATOM 2762  N NZ   . LYS A 1 65  ? -21.697 0.542   3.129   1.00 1.00 ? 85  LYS A NZ   2  
ATOM 2763  H H    . LYS A 1 65  ? -19.670 -3.115  3.544   1.00 1.00 ? 85  LYS A H    2  
ATOM 2764  H HA   . LYS A 1 65  ? -21.322 -4.464  5.614   1.00 1.00 ? 85  LYS A HA   2  
ATOM 2765  H HB2  . LYS A 1 65  ? -21.417 -4.479  2.561   1.00 0.00 ? 85  LYS A HB2  2  
ATOM 2766  H HB3  . LYS A 1 65  ? -22.557 -5.336  3.627   1.00 1.00 ? 85  LYS A HB3  2  
ATOM 2767  H HG2  . LYS A 1 65  ? -23.579 -3.306  2.821   1.00 0.00 ? 85  LYS A HG2  2  
ATOM 2768  H HG3  . LYS A 1 65  ? -23.127 -2.971  4.510   1.00 1.00 ? 85  LYS A HG3  2  
ATOM 2769  H HD2  . LYS A 1 65  ? -21.020 -1.855  3.412   1.00 0.00 ? 85  LYS A HD2  2  
ATOM 2770  H HD3  . LYS A 1 65  ? -21.861 -2.063  1.864   1.00 1.00 ? 85  LYS A HD3  2  
ATOM 2771  H HE2  . LYS A 1 65  ? -23.419 -0.358  2.546   1.00 0.00 ? 85  LYS A HE2  2  
ATOM 2772  H HE3  . LYS A 1 65  ? -23.089 -0.617  4.265   1.00 1.00 ? 85  LYS A HE3  2  
ATOM 2773  H HZ1  . LYS A 1 65  ? -21.641 0.823   2.140   1.00 0.00 ? 85  LYS A HZ1  2  
ATOM 2774  H HZ2  . LYS A 1 65  ? -22.033 1.336   3.693   1.00 0.00 ? 85  LYS A HZ2  2  
ATOM 2775  N N    . ASN A 1 66  ? -19.495 -6.237  3.518   1.00 1.00 ? 86  ASN A N    2  
ATOM 2776  C CA   . ASN A 1 66  ? -18.530 -7.308  3.224   1.00 1.00 ? 86  ASN A CA   2  
ATOM 2777  C C    . ASN A 1 66  ? -17.310 -6.626  2.528   1.00 1.00 ? 86  ASN A C    2  
ATOM 2778  O O    . ASN A 1 66  ? -16.895 -6.997  1.424   1.00 1.00 ? 86  ASN A O    2  
ATOM 2779  C CB   . ASN A 1 66  ? -19.215 -8.396  2.362   1.00 1.00 ? 86  ASN A CB   2  
ATOM 2780  C CG   . ASN A 1 66  ? -20.263 -9.267  3.056   1.00 1.00 ? 86  ASN A CG   2  
ATOM 2781  O OD1  . ASN A 1 66  ? -21.086 -8.832  3.838   1.00 1.00 ? 86  ASN A OD1  2  
ATOM 2782  N ND2  . ASN A 1 66  ? -20.333 -10.532 2.709   1.00 1.00 ? 86  ASN A ND2  2  
ATOM 2783  H H    . ASN A 1 66  ? -19.819 -5.701  2.737   1.00 1.00 ? 86  ASN A H    2  
ATOM 2784  H HA   . ASN A 1 66  ? -18.169 -7.761  4.151   1.00 1.00 ? 86  ASN A HA   2  
ATOM 2785  H HB2  . ASN A 1 66  ? -19.814 -7.927  1.583   1.00 0.00 ? 86  ASN A HB2  2  
ATOM 2786  H HB3  . ASN A 1 66  ? -18.459 -9.030  1.898   1.00 1.00 ? 86  ASN A HB3  2  
ATOM 2787  H HD21 . ASN A 1 66  ? -19.696 -10.906 1.992   1.00 0.00 ? 86  ASN A HD21 2  
ATOM 2788  H HD22 . ASN A 1 66  ? -21.027 -11.149 3.156   1.00 0.00 ? 86  ASN A HD22 2  
ATOM 2789  N N    . GLN A 1 67  ? -16.816 -5.522  3.128   1.00 1.00 ? 87  GLN A N    2  
ATOM 2790  C CA   . GLN A 1 67  ? -15.799 -4.588  2.628   1.00 1.00 ? 87  GLN A CA   2  
ATOM 2791  C C    . GLN A 1 67  ? -16.145 -3.998  1.236   1.00 1.00 ? 87  GLN A C    2  
ATOM 2792  O O    . GLN A 1 67  ? -15.252 -3.596  0.492   1.00 1.00 ? 87  GLN A O    2  
ATOM 2793  C CB   . GLN A 1 67  ? -14.421 -5.276  2.730   1.00 1.00 ? 87  GLN A CB   2  
ATOM 2794  C CG   . GLN A 1 67  ? -13.413 -4.676  3.721   1.00 1.00 ? 87  GLN A CG   2  
ATOM 2795  C CD   . GLN A 1 67  ? -13.149 -5.528  4.967   1.00 1.00 ? 87  GLN A CD   2  
ATOM 2796  O OE1  . GLN A 1 67  ? -13.358 -5.116  6.101   1.00 1.00 ? 87  GLN A OE1  2  
ATOM 2797  N NE2  . GLN A 1 67  ? -12.593 -6.706  4.824   1.00 1.00 ? 87  GLN A NE2  2  
ATOM 2798  H H    . GLN A 1 67  ? -17.118 -5.428  4.102   1.00 1.00 ? 87  GLN A H    2  
ATOM 2799  H HA   . GLN A 1 67  ? -15.791 -3.732  3.303   1.00 1.00 ? 87  GLN A HA   2  
ATOM 2800  H HB2  . GLN A 1 67  ? -14.500 -6.273  3.163   1.00 0.00 ? 87  GLN A HB2  2  
ATOM 2801  H HB3  . GLN A 1 67  ? -13.952 -5.386  1.750   1.00 1.00 ? 87  GLN A HB3  2  
ATOM 2802  H HG2  . GLN A 1 67  ? -12.398 -4.668  3.327   1.00 0.00 ? 87  GLN A HG2  2  
ATOM 2803  H HG3  . GLN A 1 67  ? -13.649 -3.644  3.982   1.00 1.00 ? 87  GLN A HG3  2  
ATOM 2804  H HE21 . GLN A 1 67  ? -12.341 -7.045  3.884   1.00 0.00 ? 87  GLN A HE21 2  
ATOM 2805  H HE22 . GLN A 1 67  ? -12.409 -7.293  5.651   1.00 0.00 ? 87  GLN A HE22 2  
ATOM 2806  N N    . VAL A 1 68  ? -17.455 -3.932  0.914   1.00 1.00 ? 88  VAL A N    2  
ATOM 2807  C CA   . VAL A 1 68  ? -18.051 -3.574  -0.382  1.00 1.00 ? 88  VAL A CA   2  
ATOM 2808  C C    . VAL A 1 68  ? -18.377 -2.069  -0.477  1.00 1.00 ? 88  VAL A C    2  
ATOM 2809  O O    . VAL A 1 68  ? -19.259 -1.554  0.210   1.00 1.00 ? 88  VAL A O    2  
ATOM 2810  C CB   . VAL A 1 68  ? -19.258 -4.488  -0.736  1.00 1.00 ? 88  VAL A CB   2  
ATOM 2811  C CG1  . VAL A 1 68  ? -20.460 -4.420  0.222   1.00 1.00 ? 88  VAL A CG1  2  
ATOM 2812  C CG2  . VAL A 1 68  ? -19.733 -4.235  -2.179  1.00 1.00 ? 88  VAL A CG2  2  
ATOM 2813  H H    . VAL A 1 68  ? -18.068 -4.290  1.625   1.00 1.00 ? 88  VAL A H    2  
ATOM 2814  H HA   . VAL A 1 68  ? -17.314 -3.820  -1.132  1.00 1.00 ? 88  VAL A HA   2  
ATOM 2815  H HB   . VAL A 1 68  ? -18.894 -5.518  -0.701  1.00 1.00 ? 88  VAL A HB   2  
ATOM 2816  H HG11 . VAL A 1 68  ? -20.130 -4.538  1.250   1.00 1.00 ? 88  VAL A HG11 2  
ATOM 2817  H HG12 . VAL A 1 68  ? -20.982 -3.469  0.118   1.00 1.00 ? 88  VAL A HG12 2  
ATOM 2818  H HG13 . VAL A 1 68  ? -21.162 -5.224  -0.010  1.00 1.00 ? 88  VAL A HG13 2  
ATOM 2819  H HG21 . VAL A 1 68  ? -18.894 -4.298  -2.873  1.00 1.00 ? 88  VAL A HG21 2  
ATOM 2820  H HG22 . VAL A 1 68  ? -20.471 -4.985  -2.466  1.00 1.00 ? 88  VAL A HG22 2  
ATOM 2821  H HG23 . VAL A 1 68  ? -20.184 -3.247  -2.270  1.00 1.00 ? 88  VAL A HG23 2  
ATOM 2822  N N    . ALA A 1 69  ? -17.661 -1.389  -1.390  1.00 1.00 ? 89  ALA A N    2  
ATOM 2823  C CA   . ALA A 1 69  ? -17.812 0.028   -1.749  1.00 1.00 ? 89  ALA A CA   2  
ATOM 2824  C C    . ALA A 1 69  ? -18.701 0.249   -2.996  1.00 1.00 ? 89  ALA A C    2  
ATOM 2825  O O    . ALA A 1 69  ? -18.694 -0.552  -3.935  1.00 1.00 ? 89  ALA A O    2  
ATOM 2826  C CB   . ALA A 1 69  ? -16.419 0.644   -1.962  1.00 1.00 ? 89  ALA A CB   2  
ATOM 2827  H H    . ALA A 1 69  ? -16.906 -1.921  -1.817  1.00 1.00 ? 89  ALA A H    2  
ATOM 2828  H HA   . ALA A 1 69  ? -18.276 0.541   -0.907  1.00 1.00 ? 89  ALA A HA   2  
ATOM 2829  H HB1  . ALA A 1 69  ? -15.762 0.400   -1.124  1.00 1.00 ? 89  ALA A HB1  2  
ATOM 2830  H HB2  . ALA A 1 69  ? -15.987 0.270   -2.889  1.00 1.00 ? 89  ALA A HB2  2  
ATOM 2831  H HB3  . ALA A 1 69  ? -16.495 1.731   -2.031  1.00 1.00 ? 89  ALA A HB3  2  
ATOM 2832  N N    . ARG A 1 70  ? -19.439 1.374   -2.991  1.00 1.00 ? 90  ARG A N    2  
ATOM 2833  C CA   . ARG A 1 70  ? -20.303 1.917   -4.059  1.00 1.00 ? 90  ARG A CA   2  
ATOM 2834  C C    . ARG A 1 70  ? -20.119 3.439   -4.226  1.00 1.00 ? 90  ARG A C    2  
ATOM 2835  O O    . ARG A 1 70  ? -19.780 4.134   -3.266  1.00 1.00 ? 90  ARG A O    2  
ATOM 2836  C CB   . ARG A 1 70  ? -21.765 1.570   -3.699  1.00 1.00 ? 90  ARG A CB   2  
ATOM 2837  C CG   . ARG A 1 70  ? -22.782 1.935   -4.792  1.00 1.00 ? 90  ARG A CG   2  
ATOM 2838  C CD   . ARG A 1 70  ? -24.208 2.166   -4.273  1.00 1.00 ? 90  ARG A CD   2  
ATOM 2839  N NE   . ARG A 1 70  ? -24.355 3.456   -3.568  1.00 1.00 ? 90  ARG A NE   2  
ATOM 2840  C CZ   . ARG A 1 70  ? -25.471 4.106   -3.285  1.00 1.00 ? 90  ARG A CZ   2  
ATOM 2841  N NH1  . ARG A 1 70  ? -26.651 3.670   -3.610  1.00 1.00 ? 90  ARG A NH1  2  
ATOM 2842  N NH2  . ARG A 1 70  ? -25.421 5.252   -2.668  1.00 1.00 ? 90  ARG A NH2  2  
ATOM 2843  H H    . ARG A 1 70  ? -19.324 1.985   -2.193  1.00 1.00 ? 90  ARG A H    2  
ATOM 2844  H HA   . ARG A 1 70  ? -20.031 1.439   -5.005  1.00 1.00 ? 90  ARG A HA   2  
ATOM 2845  H HB2  . ARG A 1 70  ? -21.873 0.489   -3.614  1.00 0.00 ? 90  ARG A HB2  2  
ATOM 2846  H HB3  . ARG A 1 70  ? -22.027 2.037   -2.747  1.00 1.00 ? 90  ARG A HB3  2  
ATOM 2847  H HG2  . ARG A 1 70  ? -22.488 2.877   -5.255  1.00 0.00 ? 90  ARG A HG2  2  
ATOM 2848  H HG3  . ARG A 1 70  ? -22.799 1.145   -5.542  1.00 1.00 ? 90  ARG A HG3  2  
ATOM 2849  H HD2  . ARG A 1 70  ? -24.899 2.247   -5.112  1.00 0.00 ? 90  ARG A HD2  2  
ATOM 2850  H HD3  . ARG A 1 70  ? -24.513 1.329   -3.640  1.00 1.00 ? 90  ARG A HD3  2  
ATOM 2851  H HE   . ARG A 1 70  ? -23.516 3.949   -3.318  1.00 1.00 ? 90  ARG A HE   2  
ATOM 2852  H HH11 . ARG A 1 70  ? -26.749 2.776   -4.114  1.00 0.00 ? 90  ARG A HH11 2  
ATOM 2853  H HH12 . ARG A 1 70  ? -27.487 4.218   -3.365  1.00 0.00 ? 90  ARG A HH12 2  
ATOM 2854  H HH21 . ARG A 1 70  ? -24.511 5.652   -2.399  1.00 0.00 ? 90  ARG A HH21 2  
ATOM 2855  H HH22 . ARG A 1 70  ? -26.292 5.757   -2.448  1.00 0.00 ? 90  ARG A HH22 2  
ATOM 2856  N N    . PHE A 1 71  ? -20.463 3.953   -5.413  1.00 1.00 ? 91  PHE A N    2  
ATOM 2857  C CA   . PHE A 1 71  ? -20.442 5.381   -5.784  1.00 1.00 ? 91  PHE A CA   2  
ATOM 2858  C C    . PHE A 1 71  ? -19.085 6.060   -5.468  1.00 1.00 ? 91  PHE A C    2  
ATOM 2859  O O    . PHE A 1 71  ? -18.051 5.444   -5.733  1.00 1.00 ? 91  PHE A O    2  
ATOM 2860  C CB   . PHE A 1 71  ? -21.705 6.031   -5.179  1.00 1.00 ? 91  PHE A CB   2  
ATOM 2861  C CG   . PHE A 1 71  ? -22.371 7.177   -5.924  1.00 1.00 ? 91  PHE A CG   2  
ATOM 2862  C CD1  . PHE A 1 71  ? -22.553 7.110   -7.328  1.00 1.00 ? 91  PHE A CD1  2  
ATOM 2863  C CD2  . PHE A 1 71  ? -22.887 8.283   -5.208  1.00 1.00 ? 91  PHE A CD2  2  
ATOM 2864  C CE1  . PHE A 1 71  ? -23.228 8.144   -8.009  1.00 1.00 ? 91  PHE A CE1  2  
ATOM 2865  C CE2  . PHE A 1 71  ? -23.580 9.309   -5.888  1.00 1.00 ? 91  PHE A CE2  2  
ATOM 2866  C CZ   . PHE A 1 71  ? -23.752 9.238   -7.288  1.00 1.00 ? 91  PHE A CZ   2  
ATOM 2867  H H    . PHE A 1 71  ? -20.703 3.275   -6.119  1.00 1.00 ? 91  PHE A H    2  
ATOM 2868  H HA   . PHE A 1 71  ? -20.527 5.422   -6.867  1.00 1.00 ? 91  PHE A HA   2  
ATOM 2869  H HB2  . PHE A 1 71  ? -22.567 5.369   -5.264  1.00 0.00 ? 91  PHE A HB2  2  
ATOM 2870  H HB3  . PHE A 1 71  ? -21.562 6.256   -4.119  1.00 1.00 ? 91  PHE A HB3  2  
ATOM 2871  H HD1  . PHE A 1 71  ? -22.200 6.266   -7.899  1.00 1.00 ? 91  PHE A HD1  2  
ATOM 2872  H HD2  . PHE A 1 71  ? -22.776 8.348   -4.134  1.00 1.00 ? 91  PHE A HD2  2  
ATOM 2873  H HE1  . PHE A 1 71  ? -23.363 8.088   -9.080  1.00 1.00 ? 91  PHE A HE1  2  
ATOM 2874  H HE2  . PHE A 1 71  ? -23.988 10.147  -5.339  1.00 1.00 ? 91  PHE A HE2  2  
ATOM 2875  H HZ   . PHE A 1 71  ? -24.294 10.015  -7.809  1.00 1.00 ? 91  PHE A HZ   2  
ATOM 2876  N N    . ASN A 1 72  ? -19.060 7.303   -4.963  1.00 1.00 ? 92  ASN A N    2  
ATOM 2877  C CA   . ASN A 1 72  ? -17.835 7.985   -4.513  1.00 1.00 ? 92  ASN A CA   2  
ATOM 2878  C C    . ASN A 1 72  ? -18.002 8.712   -3.160  1.00 1.00 ? 92  ASN A C    2  
ATOM 2879  O O    . ASN A 1 72  ? -18.676 9.741   -3.077  1.00 1.00 ? 92  ASN A O    2  
ATOM 2880  C CB   . ASN A 1 72  ? -17.300 8.933   -5.610  1.00 1.00 ? 92  ASN A CB   2  
ATOM 2881  C CG   . ASN A 1 72  ? -15.899 9.476   -5.319  1.00 1.00 ? 92  ASN A CG   2  
ATOM 2882  O OD1  . ASN A 1 72  ? -15.384 9.471   -4.209  1.00 1.00 ? 92  ASN A OD1  2  
ATOM 2883  N ND2  . ASN A 1 72  ? -15.221 9.973   -6.318  1.00 1.00 ? 92  ASN A ND2  2  
ATOM 2884  H H    . ASN A 1 72  ? -19.939 7.770   -4.789  1.00 1.00 ? 92  ASN A H    2  
ATOM 2885  H HA   . ASN A 1 72  ? -17.062 7.223   -4.377  1.00 1.00 ? 92  ASN A HA   2  
ATOM 2886  H HB2  . ASN A 1 72  ? -17.208 8.406   -6.559  1.00 0.00 ? 92  ASN A HB2  2  
ATOM 2887  H HB3  . ASN A 1 72  ? -17.979 9.779   -5.749  1.00 1.00 ? 92  ASN A HB3  2  
ATOM 2888  H HD21 . ASN A 1 72  ? -15.632 9.992   -7.262  1.00 0.00 ? 92  ASN A HD21 2  
ATOM 2889  H HD22 . ASN A 1 72  ? -14.273 10.347  -6.161  1.00 0.00 ? 92  ASN A HD22 2  
ATOM 2890  N N    . ASP A 1 73  ? -17.363 8.161   -2.122  1.00 1.00 ? 93  ASP A N    2  
ATOM 2891  C CA   . ASP A 1 73  ? -17.167 8.719   -0.778  1.00 1.00 ? 93  ASP A CA   2  
ATOM 2892  C C    . ASP A 1 73  ? -15.833 8.178   -0.213  1.00 1.00 ? 93  ASP A C    2  
ATOM 2893  O O    . ASP A 1 73  ? -15.803 7.318   0.668   1.00 1.00 ? 93  ASP A O    2  
ATOM 2894  C CB   . ASP A 1 73  ? -18.391 8.431   0.120   1.00 1.00 ? 93  ASP A CB   2  
ATOM 2895  C CG   . ASP A 1 73  ? -19.394 9.584   0.148   1.00 1.00 ? 93  ASP A CG   2  
ATOM 2896  O OD1  . ASP A 1 73  ? -19.004 10.669  0.637   1.00 1.00 ? 93  ASP A OD1  2  
ATOM 2897  O OD2  . ASP A 1 73  ? -20.554 9.331   -0.248  1.00 1.00 ? 93  ASP A OD2  2  
ATOM 2898  H H    . ASP A 1 73  ? -16.876 7.296   -2.312  1.00 1.00 ? 93  ASP A H    2  
ATOM 2899  H HA   . ASP A 1 73  ? -17.048 9.805   -0.863  1.00 1.00 ? 93  ASP A HA   2  
ATOM 2900  H HB2  . ASP A 1 73  ? -18.956 7.554   -0.199  1.00 0.00 ? 93  ASP A HB2  2  
ATOM 2901  H HB3  . ASP A 1 73  ? -18.095 8.223   1.150   1.00 1.00 ? 93  ASP A HB3  2  
ATOM 2902  N N    . LEU A 1 74  ? -14.716 8.614   -0.819  1.00 1.00 ? 94  LEU A N    2  
ATOM 2903  C CA   . LEU A 1 74  ? -13.340 8.367   -0.366  1.00 1.00 ? 94  LEU A CA   2  
ATOM 2904  C C    . LEU A 1 74  ? -12.338 9.360   -0.978  1.00 1.00 ? 94  LEU A C    2  
ATOM 2905  O O    . LEU A 1 74  ? -12.211 9.358   -2.208  1.00 1.00 ? 94  LEU A O    2  
ATOM 2906  C CB   . LEU A 1 74  ? -12.903 6.899   -0.580  1.00 1.00 ? 94  LEU A CB   2  
ATOM 2907  C CG   . LEU A 1 74  ? -13.082 6.252   -1.972  1.00 1.00 ? 94  LEU A CG   2  
ATOM 2908  C CD1  . LEU A 1 74  ? -11.706 5.939   -2.573  1.00 1.00 ? 94  LEU A CD1  2  
ATOM 2909  C CD2  . LEU A 1 74  ? -13.904 4.953   -1.891  1.00 1.00 ? 94  LEU A CD2  2  
ATOM 2910  H H    . LEU A 1 74  ? -14.856 9.172   -1.655  1.00 1.00 ? 94  LEU A H    2  
ATOM 2911  H HA   . LEU A 1 74  ? -13.358 8.543   0.694   1.00 1.00 ? 94  LEU A HA   2  
ATOM 2912  H HB2  . LEU A 1 74  ? -11.816 6.815   -0.593  1.00 0.00 ? 94  LEU A HB2  2  
ATOM 2913  H HB3  . LEU A 1 74  ? -13.281 6.259   0.220   1.00 1.00 ? 94  LEU A HB3  2  
ATOM 2914  H HG   . LEU A 1 74  ? -13.599 6.942   -2.640  1.00 1.00 ? 94  LEU A HG   2  
ATOM 2915  H HD11 . LEU A 1 74  ? -11.122 6.858   -2.650  1.00 1.00 ? 94  LEU A HD11 2  
ATOM 2916  H HD12 . LEU A 1 74  ? -11.170 5.221   -1.950  1.00 1.00 ? 94  LEU A HD12 2  
ATOM 2917  H HD13 . LEU A 1 74  ? -11.829 5.527   -3.575  1.00 1.00 ? 94  LEU A HD13 2  
ATOM 2918  H HD21 . LEU A 1 74  ? -13.413 4.235   -1.233  1.00 1.00 ? 94  LEU A HD21 2  
ATOM 2919  H HD22 . LEU A 1 74  ? -14.895 5.178   -1.493  1.00 1.00 ? 94  LEU A HD22 2  
ATOM 2920  H HD23 . LEU A 1 74  ? -14.012 4.511   -2.882  1.00 1.00 ? 94  LEU A HD23 2  
ATOM 2921  N N    . ARG A 1 75  ? -11.623 10.190  -0.164  1.00 1.00 ? 95  ARG A N    2  
ATOM 2922  C CA   . ARG A 1 75  ? -10.638 11.139  -0.767  1.00 1.00 ? 95  ARG A CA   2  
ATOM 2923  C C    . ARG A 1 75  ? -9.308  11.220  -0.020  1.00 1.00 ? 95  ARG A C    2  
ATOM 2924  O O    . ARG A 1 75  ? -9.307  11.661  1.120   1.00 1.00 ? 95  ARG A O    2  
ATOM 2925  C CB   . ARG A 1 75  ? -11.255 12.546  -0.926  1.00 1.00 ? 95  ARG A CB   2  
ATOM 2926  C CG   . ARG A 1 75  ? -12.306 12.718  -2.033  1.00 1.00 ? 95  ARG A CG   2  
ATOM 2927  C CD   . ARG A 1 75  ? -13.401 13.728  -1.677  1.00 1.00 ? 95  ARG A CD   2  
ATOM 2928  N NE   . ARG A 1 75  ? -12.887 15.103  -1.519  1.00 1.00 ? 95  ARG A NE   2  
ATOM 2929  C CZ   . ARG A 1 75  ? -13.487 16.111  -0.911  1.00 1.00 ? 95  ARG A CZ   2  
ATOM 2930  N NH1  . ARG A 1 75  ? -14.584 16.014  -0.215  1.00 1.00 ? 95  ARG A NH1  2  
ATOM 2931  N NH2  . ARG A 1 75  ? -12.955 17.302  -0.954  1.00 1.00 ? 95  ARG A NH2  2  
ATOM 2932  H H    . ARG A 1 75  ? -11.710 10.136  0.880   1.00 1.00 ? 95  ARG A H    2  
ATOM 2933  H HA   . ARG A 1 75  ? -10.407 10.782  -1.764  1.00 1.00 ? 95  ARG A HA   2  
ATOM 2934  H HB2  . ARG A 1 75  ? -11.856 12.809  -0.056  1.00 0.00 ? 95  ARG A HB2  2  
ATOM 2935  H HB3  . ARG A 1 75  ? -10.479 13.303  -1.039  1.00 1.00 ? 95  ARG A HB3  2  
ATOM 2936  H HG2  . ARG A 1 75  ? -11.855 13.083  -2.955  1.00 0.00 ? 95  ARG A HG2  2  
ATOM 2937  H HG3  . ARG A 1 75  ? -12.797 11.779  -2.259  1.00 1.00 ? 95  ARG A HG3  2  
ATOM 2938  H HD2  . ARG A 1 75  ? -14.114 13.795  -2.499  1.00 0.00 ? 95  ARG A HD2  2  
ATOM 2939  H HD3  . ARG A 1 75  ? -13.917 13.402  -0.774  1.00 1.00 ? 95  ARG A HD3  2  
ATOM 2940  H HE   . ARG A 1 75  ? -11.990 15.300  -1.922  1.00 1.00 ? 95  ARG A HE   2  
ATOM 2941  H HH11 . ARG A 1 75  ? -15.048 15.100  -0.108  1.00 0.00 ? 95  ARG A HH11 2  
ATOM 2942  H HH12 . ARG A 1 75  ? -14.989 16.851  0.229   1.00 0.00 ? 95  ARG A HH12 2  
ATOM 2943  H HH21 . ARG A 1 75  ? -12.072 17.454  -1.460  1.00 0.00 ? 95  ARG A HH21 2  
ATOM 2944  H HH22 . ARG A 1 75  ? -13.421 18.089  -0.481  1.00 0.00 ? 95  ARG A HH22 2  
ATOM 2945  N N    . PHE A 1 76  ? -8.195  10.882  -0.684  1.00 1.00 ? 96  PHE A N    2  
ATOM 2946  C CA   . PHE A 1 76  ? -6.823  10.787  -0.147  1.00 1.00 ? 96  PHE A CA   2  
ATOM 2947  C C    . PHE A 1 76  ? -5.936  12.044  -0.289  1.00 1.00 ? 96  PHE A C    2  
ATOM 2948  O O    . PHE A 1 76  ? -6.205  12.941  -1.092  1.00 1.00 ? 96  PHE A O    2  
ATOM 2949  C CB   . PHE A 1 76  ? -6.103  9.622   -0.856  1.00 1.00 ? 96  PHE A CB   2  
ATOM 2950  C CG   . PHE A 1 76  ? -6.026  9.622   -2.384  1.00 1.00 ? 96  PHE A CG   2  
ATOM 2951  C CD1  . PHE A 1 76  ? -5.270  10.598  -3.085  1.00 1.00 ? 96  PHE A CD1  2  
ATOM 2952  C CD2  . PHE A 1 76  ? -6.714  8.632   -3.123  1.00 1.00 ? 96  PHE A CD2  2  
ATOM 2953  C CE1  . PHE A 1 76  ? -5.238  10.609  -4.495  1.00 1.00 ? 96  PHE A CE1  2  
ATOM 2954  C CE2  . PHE A 1 76  ? -6.686  8.644   -4.535  1.00 1.00 ? 96  PHE A CE2  2  
ATOM 2955  C CZ   . PHE A 1 76  ? -5.973  9.650   -5.219  1.00 1.00 ? 96  PHE A CZ   2  
ATOM 2956  H H    . PHE A 1 76  ? -8.327  10.628  -1.656  1.00 1.00 ? 96  PHE A H    2  
ATOM 2957  H HA   . PHE A 1 76  ? -6.883  10.548  0.918   1.00 1.00 ? 96  PHE A HA   2  
ATOM 2958  H HB2  . PHE A 1 76  ? -5.030  9.675   -0.672  1.00 0.00 ? 96  PHE A HB2  2  
ATOM 2959  H HB3  . PHE A 1 76  ? -6.474  8.670   -0.486  1.00 1.00 ? 96  PHE A HB3  2  
ATOM 2960  H HD1  . PHE A 1 76  ? -4.713  11.360  -2.567  1.00 1.00 ? 96  PHE A HD1  2  
ATOM 2961  H HD2  . PHE A 1 76  ? -7.288  7.870   -2.617  1.00 1.00 ? 96  PHE A HD2  2  
ATOM 2962  H HE1  . PHE A 1 76  ? -4.660  11.360  -5.017  1.00 1.00 ? 96  PHE A HE1  2  
ATOM 2963  H HE2  . PHE A 1 76  ? -7.236  7.900   -5.094  1.00 1.00 ? 96  PHE A HE2  2  
ATOM 2964  H HZ   . PHE A 1 76  ? -5.972  9.660   -6.300  1.00 1.00 ? 96  PHE A HZ   2  
ATOM 2965  N N    . VAL A 1 77  ? -4.816  12.047  0.457   1.00 1.00 ? 97  VAL A N    2  
ATOM 2966  C CA   . VAL A 1 77  ? -3.652  12.975  0.423   1.00 1.00 ? 97  VAL A CA   2  
ATOM 2967  C C    . VAL A 1 77  ? -4.027  14.479  0.384   1.00 1.00 ? 97  VAL A C    2  
ATOM 2968  O O    . VAL A 1 77  ? -3.341  15.297  -0.234  1.00 1.00 ? 97  VAL A O    2  
ATOM 2969  C CB   . VAL A 1 77  ? -2.632  12.539  -0.687  1.00 1.00 ? 97  VAL A CB   2  
ATOM 2970  C CG1  . VAL A 1 77  ? -1.219  13.119  -0.451  1.00 1.00 ? 97  VAL A CG1  2  
ATOM 2971  C CG2  . VAL A 1 77  ? -2.423  11.012  -0.803  1.00 1.00 ? 97  VAL A CG2  2  
ATOM 2972  H H    . VAL A 1 77  ? -4.776  11.328  1.164   1.00 1.00 ? 97  VAL A H    2  
ATOM 2973  H HA   . VAL A 1 77  ? -3.139  12.841  1.376   1.00 1.00 ? 97  VAL A HA   2  
ATOM 2974  H HB   . VAL A 1 77  ? -3.006  12.896  -1.645  1.00 1.00 ? 97  VAL A HB   2  
ATOM 2975  H HG11 . VAL A 1 77  ? -1.227  14.203  -0.446  1.00 1.00 ? 97  VAL A HG11 2  
ATOM 2976  H HG12 . VAL A 1 77  ? -0.812  12.763  0.495   1.00 1.00 ? 97  VAL A HG12 2  
ATOM 2977  H HG13 . VAL A 1 77  ? -0.554  12.810  -1.259  1.00 1.00 ? 97  VAL A HG13 2  
ATOM 2978  H HG21 . VAL A 1 77  ? -2.108  10.627  0.160   1.00 1.00 ? 97  VAL A HG21 2  
ATOM 2979  H HG22 . VAL A 1 77  ? -3.339  10.501  -1.082  1.00 1.00 ? 97  VAL A HG22 2  
ATOM 2980  H HG23 . VAL A 1 77  ? -1.676  10.777  -1.564  1.00 1.00 ? 97  VAL A HG23 2  
ATOM 2981  N N    . GLY A 1 78  ? -5.116  14.859  1.064   1.00 1.00 ? 98  GLY A N    2  
ATOM 2982  C CA   . GLY A 1 78  ? -5.707  16.208  1.123   1.00 1.00 ? 98  GLY A CA   2  
ATOM 2983  C C    . GLY A 1 78  ? -4.716  17.333  1.463   1.00 1.00 ? 98  GLY A C    2  
ATOM 2984  O O    . GLY A 1 78  ? -4.766  18.389  0.833   1.00 1.00 ? 98  GLY A O    2  
ATOM 2985  H H    . GLY A 1 78  ? -5.532  14.110  1.618   1.00 1.00 ? 98  GLY A H    2  
ATOM 2986  H HA2  . GLY A 1 78  ? -6.170  16.433  0.163   1.00 1.00 ? 98  GLY A HA2  2  
ATOM 2987  H HA3  . GLY A 1 78  ? -6.490  16.211  1.879   1.00 1.00 ? 98  GLY A HA3  2  
ATOM 2988  N N    . ARG A 1 79  ? -3.799  17.094  2.424   1.00 1.00 ? 99  ARG A N    2  
ATOM 2989  C CA   . ARG A 1 79  ? -2.727  18.011  2.878   1.00 1.00 ? 99  ARG A CA   2  
ATOM 2990  C C    . ARG A 1 79  ? -1.502  18.136  1.938   1.00 1.00 ? 99  ARG A C    2  
ATOM 2991  O O    . ARG A 1 79  ? -0.684  19.027  2.160   1.00 1.00 ? 99  ARG A O    2  
ATOM 2992  C CB   . ARG A 1 79  ? -2.286  17.595  4.299   1.00 1.00 ? 99  ARG A CB   2  
ATOM 2993  C CG   . ARG A 1 79  ? -1.757  18.781  5.118   1.00 1.00 ? 99  ARG A CG   2  
ATOM 2994  C CD   . ARG A 1 79  ? -0.992  18.388  6.389   1.00 1.00 ? 99  ARG A CD   2  
ATOM 2995  N NE   . ARG A 1 79  ? -1.910  18.133  7.510   1.00 1.00 ? 99  ARG A NE   2  
ATOM 2996  C CZ   . ARG A 1 79  ? -1.678  17.504  8.647   1.00 1.00 ? 99  ARG A CZ   2  
ATOM 2997  N NH1  . ARG A 1 79  ? -0.525  16.974  8.941   1.00 1.00 ? 99  ARG A NH1  2  
ATOM 2998  N NH2  . ARG A 1 79  ? -2.626  17.386  9.534   1.00 1.00 ? 99  ARG A NH2  2  
ATOM 2999  H H    . ARG A 1 79  ? -3.860  16.182  2.857   1.00 1.00 ? 99  ARG A H    2  
ATOM 3000  H HA   . ARG A 1 79  ? -3.156  19.017  2.942   1.00 1.00 ? 99  ARG A HA   2  
ATOM 3001  H HB2  . ARG A 1 79  ? -3.142  17.247  4.877   1.00 0.00 ? 99  ARG A HB2  2  
ATOM 3002  H HB3  . ARG A 1 79  ? -1.551  16.789  4.248   1.00 1.00 ? 99  ARG A HB3  2  
ATOM 3003  H HG2  . ARG A 1 79  ? -1.011  19.320  4.535   1.00 0.00 ? 99  ARG A HG2  2  
ATOM 3004  H HG3  . ARG A 1 79  ? -2.584  19.451  5.363   1.00 1.00 ? 99  ARG A HG3  2  
ATOM 3005  H HD2  . ARG A 1 79  ? -0.410  17.489  6.188   1.00 0.00 ? 99  ARG A HD2  2  
ATOM 3006  H HD3  . ARG A 1 79  ? -0.326  19.209  6.670   1.00 1.00 ? 99  ARG A HD3  2  
ATOM 3007  H HE   . ARG A 1 79  ? -2.892  18.403  7.379   1.00 1.00 ? 99  ARG A HE   2  
ATOM 3008  H HH11 . ARG A 1 79  ? 0.257   17.038  8.273   1.00 0.00 ? 99  ARG A HH11 2  
ATOM 3009  H HH12 . ARG A 1 79  ? -0.394  16.493  9.843   1.00 0.00 ? 99  ARG A HH12 2  
ATOM 3010  H HH21 . ARG A 1 79  ? -3.557  17.786  9.349   1.00 0.00 ? 99  ARG A HH21 2  
ATOM 3011  H HH22 . ARG A 1 79  ? -2.443  16.894  10.420  1.00 0.00 ? 99  ARG A HH22 2  
ATOM 3012  N N    . SER A 1 80  ? -1.370  17.300  0.886   1.00 1.00 ? 100 SER A N    2  
ATOM 3013  C CA   . SER A 1 80  ? -0.198  17.252  -0.028  1.00 1.00 ? 100 SER A CA   2  
ATOM 3014  C C    . SER A 1 80  ? 1.159   16.951  0.677   1.00 1.00 ? 100 SER A C    2  
ATOM 3015  O O    . SER A 1 80  ? 1.213   16.634  1.869   1.00 1.00 ? 100 SER A O    2  
ATOM 3016  C CB   . SER A 1 80  ? -0.231  18.528  -0.908  1.00 1.00 ? 100 SER A CB   2  
ATOM 3017  O OG   . SER A 1 80  ? 0.981   18.919  -1.536  1.00 1.00 ? 100 SER A OG   2  
ATOM 3018  H H    . SER A 1 80  ? -2.129  16.646  0.724   1.00 1.00 ? 100 SER A H    2  
ATOM 3019  H HA   . SER A 1 80  ? -0.352  16.408  -0.699  1.00 1.00 ? 100 SER A HA   2  
ATOM 3020  H HB2  . SER A 1 80  ? -0.868  18.381  -1.780  1.00 0.00 ? 100 SER A HB2  2  
ATOM 3021  H HB3  . SER A 1 80  ? -0.618  19.379  -0.345  1.00 1.00 ? 100 SER A HB3  2  
ATOM 3022  H HG   . SER A 1 80  ? 0.869   18.866  -2.503  1.00 1.00 ? 100 SER A HG   2  
ATOM 3023  N N    . GLY A 1 81  ? 2.261   16.947  -0.089  1.00 1.00 ? 101 GLY A N    2  
ATOM 3024  C CA   . GLY A 1 81  ? 3.655   16.684  0.319   1.00 1.00 ? 101 GLY A CA   2  
ATOM 3025  C C    . GLY A 1 81  ? 4.327   15.544  -0.470  1.00 1.00 ? 101 GLY A C    2  
ATOM 3026  O O    . GLY A 1 81  ? 3.769   14.448  -0.563  1.00 1.00 ? 101 GLY A O    2  
ATOM 3027  H H    . GLY A 1 81  ? 2.099   17.249  -1.040  1.00 1.00 ? 101 GLY A H    2  
ATOM 3028  H HA2  . GLY A 1 81  ? 4.234   17.599  0.204   1.00 1.00 ? 101 GLY A HA2  2  
ATOM 3029  H HA3  . GLY A 1 81  ? 3.682   16.420  1.377   1.00 1.00 ? 101 GLY A HA3  2  
ATOM 3030  N N    . ARG A 1 82  ? 5.532   15.803  -1.006  1.00 1.00 ? 102 ARG A N    2  
ATOM 3031  C CA   . ARG A 1 82  ? 6.413   14.840  -1.707  1.00 1.00 ? 102 ARG A CA   2  
ATOM 3032  C C    . ARG A 1 82  ? 6.979   13.762  -0.749  1.00 1.00 ? 102 ARG A C    2  
ATOM 3033  O O    . ARG A 1 82  ? 6.954   13.919  0.472   1.00 1.00 ? 102 ARG A O    2  
ATOM 3034  C CB   . ARG A 1 82  ? 7.553   15.630  -2.393  1.00 1.00 ? 102 ARG A CB   2  
ATOM 3035  C CG   . ARG A 1 82  ? 7.103   16.596  -3.502  1.00 1.00 ? 102 ARG A CG   2  
ATOM 3036  C CD   . ARG A 1 82  ? 8.080   17.774  -3.597  1.00 1.00 ? 102 ARG A CD   2  
ATOM 3037  N NE   . ARG A 1 82  ? 7.705   18.760  -4.629  1.00 1.00 ? 102 ARG A NE   2  
ATOM 3038  C CZ   . ARG A 1 82  ? 7.752   20.077  -4.509  1.00 1.00 ? 102 ARG A CZ   2  
ATOM 3039  N NH1  . ARG A 1 82  ? 8.083   20.682  -3.404  1.00 1.00 ? 102 ARG A NH1  2  
ATOM 3040  N NH2  . ARG A 1 82  ? 7.463   20.831  -5.528  1.00 1.00 ? 102 ARG A NH2  2  
ATOM 3041  H H    . ARG A 1 82  ? 5.926   16.713  -0.817  1.00 1.00 ? 102 ARG A H    2  
ATOM 3042  H HA   . ARG A 1 82  ? 5.832   14.324  -2.475  1.00 1.00 ? 102 ARG A HA   2  
ATOM 3043  H HB2  . ARG A 1 82  ? 8.049   16.297  -1.687  1.00 0.00 ? 102 ARG A HB2  2  
ATOM 3044  H HB3  . ARG A 1 82  ? 8.308   14.958  -2.802  1.00 1.00 ? 102 ARG A HB3  2  
ATOM 3045  H HG2  . ARG A 1 82  ? 7.072   16.084  -4.464  1.00 0.00 ? 102 ARG A HG2  2  
ATOM 3046  H HG3  . ARG A 1 82  ? 6.109   16.988  -3.287  1.00 1.00 ? 102 ARG A HG3  2  
ATOM 3047  H HD2  . ARG A 1 82  ? 8.067   18.374  -2.687  1.00 0.00 ? 102 ARG A HD2  2  
ATOM 3048  H HD3  . ARG A 1 82  ? 9.105   17.429  -3.750  1.00 1.00 ? 102 ARG A HD3  2  
ATOM 3049  H HE   . ARG A 1 82  ? 7.386   18.424  -5.522  1.00 1.00 ? 102 ARG A HE   2  
ATOM 3050  H HH11 . ARG A 1 82  ? 8.323   20.132  -2.567  1.00 0.00 ? 102 ARG A HH11 2  
ATOM 3051  H HH12 . ARG A 1 82  ? 8.104   21.711  -3.368  1.00 0.00 ? 102 ARG A HH12 2  
ATOM 3052  H HH21 . ARG A 1 82  ? 7.197   20.403  -6.426  1.00 0.00 ? 102 ARG A HH21 2  
ATOM 3053  H HH22 . ARG A 1 82  ? 7.501   21.857  -5.437  1.00 0.00 ? 102 ARG A HH22 2  
ATOM 3054  N N    . GLY A 1 83  ? 7.510   12.665  -1.310  1.00 1.00 ? 103 GLY A N    2  
ATOM 3055  C CA   . GLY A 1 83  ? 8.168   11.575  -0.558  1.00 1.00 ? 103 GLY A CA   2  
ATOM 3056  C C    . GLY A 1 83  ? 7.238   10.581  0.165   1.00 1.00 ? 103 GLY A C    2  
ATOM 3057  O O    . GLY A 1 83  ? 7.656   10.016  1.172   1.00 1.00 ? 103 GLY A O    2  
ATOM 3058  H H    . GLY A 1 83  ? 7.517   12.632  -2.318  1.00 1.00 ? 103 GLY A H    2  
ATOM 3059  H HA2  . GLY A 1 83  ? 8.793   11.000  -1.239  1.00 1.00 ? 103 GLY A HA2  2  
ATOM 3060  H HA3  . GLY A 1 83  ? 8.828   12.016  0.192   1.00 1.00 ? 103 GLY A HA3  2  
ATOM 3061  N N    . LYS A 1 84  ? 6.001   10.369  -0.324  1.00 1.00 ? 104 LYS A N    2  
ATOM 3062  C CA   . LYS A 1 84  ? 4.958   9.531   0.297   1.00 1.00 ? 104 LYS A CA   2  
ATOM 3063  C C    . LYS A 1 84  ? 4.554   8.301   -0.542  1.00 1.00 ? 104 LYS A C    2  
ATOM 3064  O O    . LYS A 1 84  ? 4.572   8.312   -1.775  1.00 1.00 ? 104 LYS A O    2  
ATOM 3065  C CB   . LYS A 1 84  ? 3.744   10.414  0.635   1.00 1.00 ? 104 LYS A CB   2  
ATOM 3066  C CG   . LYS A 1 84  ? 4.023   11.275  1.874   1.00 1.00 ? 104 LYS A CG   2  
ATOM 3067  C CD   . LYS A 1 84  ? 2.750   11.989  2.332   1.00 1.00 ? 104 LYS A CD   2  
ATOM 3068  C CE   . LYS A 1 84  ? 2.943   13.496  2.500   1.00 1.00 ? 104 LYS A CE   2  
ATOM 3069  N NZ   . LYS A 1 84  ? 1.663   14.143  2.829   1.00 1.00 ? 104 LYS A NZ   2  
ATOM 3070  H H    . LYS A 1 84  ? 5.738   10.876  -1.150  1.00 1.00 ? 104 LYS A H    2  
ATOM 3071  H HA   . LYS A 1 84  ? 5.352   9.147   1.243   1.00 1.00 ? 104 LYS A HA   2  
ATOM 3072  H HB2  . LYS A 1 84  ? 3.525   11.088  -0.193  1.00 0.00 ? 104 LYS A HB2  2  
ATOM 3073  H HB3  . LYS A 1 84  ? 2.866   9.794   0.824   1.00 1.00 ? 104 LYS A HB3  2  
ATOM 3074  H HG2  . LYS A 1 84  ? 4.307   10.646  2.718   1.00 0.00 ? 104 LYS A HG2  2  
ATOM 3075  H HG3  . LYS A 1 84  ? 4.834   11.976  1.677   1.00 1.00 ? 104 LYS A HG3  2  
ATOM 3076  H HD2  . LYS A 1 84  ? 1.988   11.907  1.557   1.00 0.00 ? 104 LYS A HD2  2  
ATOM 3077  H HD3  . LYS A 1 84  ? 2.385   11.529  3.253   1.00 1.00 ? 104 LYS A HD3  2  
ATOM 3078  H HE2  . LYS A 1 84  ? 3.633   13.664  3.327   1.00 0.00 ? 104 LYS A HE2  2  
ATOM 3079  H HE3  . LYS A 1 84  ? 3.356   13.896  1.570   1.00 1.00 ? 104 LYS A HE3  2  
ATOM 3080  H HZ1  . LYS A 1 84  ? 1.334   13.809  3.745   1.00 0.00 ? 104 LYS A HZ1  2  
ATOM 3081  H HZ2  . LYS A 1 84  ? 1.793   15.165  2.862   1.00 0.00 ? 104 LYS A HZ2  2  
ATOM 3082  N N    . SER A 1 85  ? 4.141   7.260   0.193   1.00 1.00 ? 105 SER A N    2  
ATOM 3083  C CA   . SER A 1 85  ? 3.663   5.927   -0.223  1.00 1.00 ? 105 SER A CA   2  
ATOM 3084  C C    . SER A 1 85  ? 2.272   5.648   0.388   1.00 1.00 ? 105 SER A C    2  
ATOM 3085  O O    . SER A 1 85  ? 2.098   5.679   1.607   1.00 1.00 ? 105 SER A O    2  
ATOM 3086  C CB   . SER A 1 85  ? 4.680   4.872   0.212   1.00 1.00 ? 105 SER A CB   2  
ATOM 3087  O OG   . SER A 1 85  ? 4.284   3.588   -0.219  1.00 1.00 ? 105 SER A OG   2  
ATOM 3088  H H    . SER A 1 85  ? 4.130   7.465   1.190   1.00 1.00 ? 105 SER A H    2  
ATOM 3089  H HA   . SER A 1 85  ? 3.601   5.899   -1.315  1.00 1.00 ? 105 SER A HA   2  
ATOM 3090  H HB2  . SER A 1 85  ? 5.650   5.081   -0.240  1.00 0.00 ? 105 SER A HB2  2  
ATOM 3091  H HB3  . SER A 1 85  ? 4.784   4.883   1.299   1.00 1.00 ? 105 SER A HB3  2  
ATOM 3092  H HG   . SER A 1 85  ? 4.264   3.575   -1.208  1.00 1.00 ? 105 SER A HG   2  
ATOM 3093  N N    . PHE A 1 86  ? 1.269   5.378   -0.453  1.00 1.00 ? 106 PHE A N    2  
ATOM 3094  C CA   . PHE A 1 86  ? -0.160  5.293   -0.074  1.00 1.00 ? 106 PHE A CA   2  
ATOM 3095  C C    . PHE A 1 86  ? -0.634  3.937   0.477   1.00 1.00 ? 106 PHE A C    2  
ATOM 3096  O O    . PHE A 1 86  ? -0.390  2.888   -0.117  1.00 1.00 ? 106 PHE A O    2  
ATOM 3097  C CB   . PHE A 1 86  ? -1.083  5.734   -1.222  1.00 1.00 ? 106 PHE A CB   2  
ATOM 3098  C CG   . PHE A 1 86  ? -0.479  5.707   -2.604  1.00 1.00 ? 106 PHE A CG   2  
ATOM 3099  C CD1  . PHE A 1 86  ? -0.405  4.484   -3.300  1.00 1.00 ? 106 PHE A CD1  2  
ATOM 3100  C CD2  . PHE A 1 86  ? 0.136   6.866   -3.126  1.00 1.00 ? 106 PHE A CD2  2  
ATOM 3101  C CE1  . PHE A 1 86  ? 0.214   4.438   -4.566  1.00 1.00 ? 106 PHE A CE1  2  
ATOM 3102  C CE2  . PHE A 1 86  ? 0.800   6.804   -4.364  1.00 1.00 ? 106 PHE A CE2  2  
ATOM 3103  C CZ   . PHE A 1 86  ? 0.809   5.602   -5.103  1.00 1.00 ? 106 PHE A CZ   2  
ATOM 3104  H H    . PHE A 1 86  ? 1.490   5.251   -1.429  1.00 1.00 ? 106 PHE A H    2  
ATOM 3105  H HA   . PHE A 1 86  ? -0.303  6.024   0.702   1.00 1.00 ? 106 PHE A HA   2  
ATOM 3106  H HB2  . PHE A 1 86  ? -1.894  5.020   -1.363  1.00 0.00 ? 106 PHE A HB2  2  
ATOM 3107  H HB3  . PHE A 1 86  ? -1.522  6.710   -1.013  1.00 1.00 ? 106 PHE A HB3  2  
ATOM 3108  H HD1  . PHE A 1 86  ? -0.836  3.594   -2.864  1.00 1.00 ? 106 PHE A HD1  2  
ATOM 3109  H HD2  . PHE A 1 86  ? 0.124   7.791   -2.567  1.00 1.00 ? 106 PHE A HD2  2  
ATOM 3110  H HE1  . PHE A 1 86  ? 0.225   3.509   -5.115  1.00 1.00 ? 106 PHE A HE1  2  
ATOM 3111  H HE2  . PHE A 1 86  ? 1.300   7.684   -4.734  1.00 1.00 ? 106 PHE A HE2  2  
ATOM 3112  H HZ   . PHE A 1 86  ? 1.288   5.571   -6.069  1.00 1.00 ? 106 PHE A HZ   2  
ATOM 3113  N N    . THR A 1 87  ? -1.384  4.004   1.591   1.00 1.00 ? 107 THR A N    2  
ATOM 3114  C CA   . THR A 1 87  ? -2.014  2.887   2.324   1.00 1.00 ? 107 THR A CA   2  
ATOM 3115  C C    . THR A 1 87  ? -3.550  2.987   2.482   1.00 1.00 ? 107 THR A C    2  
ATOM 3116  O O    . THR A 1 87  ? -4.072  3.772   3.278   1.00 1.00 ? 107 THR A O    2  
ATOM 3117  C CB   . THR A 1 87  ? -1.320  2.641   3.688   1.00 1.00 ? 107 THR A CB   2  
ATOM 3118  O OG1  . THR A 1 87  ? -1.887  1.503   4.303   1.00 1.00 ? 107 THR A OG1  2  
ATOM 3119  C CG2  . THR A 1 87  ? -1.301  3.807   4.690   1.00 1.00 ? 107 THR A CG2  2  
ATOM 3120  H H    . THR A 1 87  ? -1.560  4.932   1.975   1.00 1.00 ? 107 THR A H    2  
ATOM 3121  H HA   . THR A 1 87  ? -1.820  1.978   1.757   1.00 1.00 ? 107 THR A HA   2  
ATOM 3122  H HB   . THR A 1 87  ? -0.280  2.401   3.477   1.00 1.00 ? 107 THR A HB   2  
ATOM 3123  H HG1  . THR A 1 87  ? -2.563  1.784   4.952   1.00 1.00 ? 107 THR A HG1  2  
ATOM 3124  H HG21 . THR A 1 87  ? -0.866  4.689   4.222   1.00 1.00 ? 107 THR A HG21 2  
ATOM 3125  H HG22 . THR A 1 87  ? -2.303  4.047   5.042   1.00 1.00 ? 107 THR A HG22 2  
ATOM 3126  H HG23 . THR A 1 87  ? -0.685  3.541   5.549   1.00 1.00 ? 107 THR A HG23 2  
ATOM 3127  N N    . LEU A 1 88  ? -4.298  2.181   1.706   1.00 1.00 ? 108 LEU A N    2  
ATOM 3128  C CA   . LEU A 1 88  ? -5.740  1.953   1.895   1.00 1.00 ? 108 LEU A CA   2  
ATOM 3129  C C    . LEU A 1 88  ? -5.838  0.932   3.049   1.00 1.00 ? 108 LEU A C    2  
ATOM 3130  O O    . LEU A 1 88  ? -5.715  -0.279  2.846   1.00 1.00 ? 108 LEU A O    2  
ATOM 3131  C CB   . LEU A 1 88  ? -6.454  1.531   0.593   1.00 1.00 ? 108 LEU A CB   2  
ATOM 3132  C CG   . LEU A 1 88  ? -7.997  1.591   0.602   1.00 1.00 ? 108 LEU A CG   2  
ATOM 3133  C CD1  . LEU A 1 88  ? -8.487  2.147   -0.741  1.00 1.00 ? 108 LEU A CD1  2  
ATOM 3134  C CD2  . LEU A 1 88  ? -8.629  0.209   0.824   1.00 1.00 ? 108 LEU A CD2  2  
ATOM 3135  H H    . LEU A 1 88  ? -3.823  1.619   1.022   1.00 1.00 ? 108 LEU A H    2  
ATOM 3136  H HA   . LEU A 1 88  ? -6.197  2.885   2.217   1.00 1.00 ? 108 LEU A HA   2  
ATOM 3137  H HB2  . LEU A 1 88  ? -6.224  2.221   -0.219  1.00 0.00 ? 108 LEU A HB2  2  
ATOM 3138  H HB3  . LEU A 1 88  ? -6.145  0.539   0.287   1.00 1.00 ? 108 LEU A HB3  2  
ATOM 3139  H HG   . LEU A 1 88  ? -8.335  2.254   1.398   1.00 1.00 ? 108 LEU A HG   2  
ATOM 3140  H HD11 . LEU A 1 88  ? -8.047  3.127   -0.921  1.00 1.00 ? 108 LEU A HD11 2  
ATOM 3141  H HD12 . LEU A 1 88  ? -8.204  1.480   -1.557  1.00 1.00 ? 108 LEU A HD12 2  
ATOM 3142  H HD13 . LEU A 1 88  ? -9.571  2.253   -0.726  1.00 1.00 ? 108 LEU A HD13 2  
ATOM 3143  H HD21 . LEU A 1 88  ? -8.245  -0.223  1.745   1.00 1.00 ? 108 LEU A HD21 2  
ATOM 3144  H HD22 . LEU A 1 88  ? -9.712  0.301   0.903   1.00 1.00 ? 108 LEU A HD22 2  
ATOM 3145  H HD23 . LEU A 1 88  ? -8.389  -0.463  0.001   1.00 1.00 ? 108 LEU A HD23 2  
ATOM 3146  N N    . THR A 1 89  ? -5.913  1.479   4.269   1.00 1.00 ? 109 THR A N    2  
ATOM 3147  C CA   . THR A 1 89  ? -5.908  0.810   5.584   1.00 1.00 ? 109 THR A CA   2  
ATOM 3148  C C    . THR A 1 89  ? -7.351  0.520   6.041   1.00 1.00 ? 109 THR A C    2  
ATOM 3149  O O    . THR A 1 89  ? -8.064  1.384   6.561   1.00 1.00 ? 109 THR A O    2  
ATOM 3150  C CB   . THR A 1 89  ? -5.125  1.667   6.611   1.00 1.00 ? 109 THR A CB   2  
ATOM 3151  O OG1  . THR A 1 89  ? -3.747  1.626   6.285   1.00 1.00 ? 109 THR A OG1  2  
ATOM 3152  C CG2  . THR A 1 89  ? -5.224  1.180   8.062   1.00 1.00 ? 109 THR A CG2  2  
ATOM 3153  H H    . THR A 1 89  ? -5.994  2.503   4.278   1.00 1.00 ? 109 THR A H    2  
ATOM 3154  H HA   . THR A 1 89  ? -5.379  -0.141  5.493   1.00 1.00 ? 109 THR A HA   2  
ATOM 3155  H HB   . THR A 1 89  ? -5.467  2.703   6.563   1.00 1.00 ? 109 THR A HB   2  
ATOM 3156  H HG1  . THR A 1 89  ? -3.382  0.892   6.802   1.00 1.00 ? 109 THR A HG1  2  
ATOM 3157  H HG21 . THR A 1 89  ? -4.945  0.131   8.145   1.00 1.00 ? 109 THR A HG21 2  
ATOM 3158  H HG22 . THR A 1 89  ? -4.585  1.787   8.707   1.00 1.00 ? 109 THR A HG22 2  
ATOM 3159  H HG23 . THR A 1 89  ? -6.249  1.297   8.425   1.00 1.00 ? 109 THR A HG23 2  
ATOM 3160  N N    . ILE A 1 90  ? -7.785  -0.733  5.887   1.00 1.00 ? 110 ILE A N    2  
ATOM 3161  C CA   . ILE A 1 90  ? -9.116  -1.228  6.272   1.00 1.00 ? 110 ILE A CA   2  
ATOM 3162  C C    . ILE A 1 90  ? -9.022  -1.780  7.699   1.00 1.00 ? 110 ILE A C    2  
ATOM 3163  O O    . ILE A 1 90  ? -8.257  -2.712  7.942   1.00 1.00 ? 110 ILE A O    2  
ATOM 3164  C CB   . ILE A 1 90  ? -9.591  -2.333  5.293   1.00 1.00 ? 110 ILE A CB   2  
ATOM 3165  C CG1  . ILE A 1 90  ? -9.844  -1.783  3.869   1.00 1.00 ? 110 ILE A CG1  2  
ATOM 3166  C CG2  . ILE A 1 90  ? -10.867 -3.034  5.803   1.00 1.00 ? 110 ILE A CG2  2  
ATOM 3167  C CD1  . ILE A 1 90  ? -9.838  -2.837  2.751   1.00 1.00 ? 110 ILE A CD1  2  
ATOM 3168  H H    . ILE A 1 90  ? -7.129  -1.428  5.532   1.00 1.00 ? 110 ILE A H    2  
ATOM 3169  H HA   . ILE A 1 90  ? -9.838  -0.416  6.247   1.00 1.00 ? 110 ILE A HA   2  
ATOM 3170  H HB   . ILE A 1 90  ? -8.798  -3.077  5.238   1.00 1.00 ? 110 ILE A HB   2  
ATOM 3171  H HG12 . ILE A 1 90  ? -10.838 -1.341  3.807   1.00 0.00 ? 110 ILE A HG12 2  
ATOM 3172  H HG13 . ILE A 1 90  ? -9.107  -1.020  3.624   1.00 1.00 ? 110 ILE A HG13 2  
ATOM 3173  H HG21 . ILE A 1 90  ? -11.677 -2.322  5.956   1.00 1.00 ? 110 ILE A HG21 2  
ATOM 3174  H HG22 . ILE A 1 90  ? -11.176 -3.789  5.088   1.00 1.00 ? 110 ILE A HG22 2  
ATOM 3175  H HG23 . ILE A 1 90  ? -10.679 -3.560  6.742   1.00 1.00 ? 110 ILE A HG23 2  
ATOM 3176  H HD11 . ILE A 1 90  ? -10.595 -3.598  2.933   1.00 1.00 ? 110 ILE A HD11 2  
ATOM 3177  H HD12 . ILE A 1 90  ? -10.061 -2.357  1.798   1.00 1.00 ? 110 ILE A HD12 2  
ATOM 3178  H HD13 . ILE A 1 90  ? -8.857  -3.309  2.688   1.00 1.00 ? 110 ILE A HD13 2  
ATOM 3179  N N    . THR A 1 91  ? -9.829  -1.208  8.605   1.00 1.00 ? 111 THR A N    2  
ATOM 3180  C CA   . THR A 1 91  ? -9.961  -1.671  10.015  1.00 1.00 ? 111 THR A CA   2  
ATOM 3181  C C    . THR A 1 91  ? -11.421 -2.027  10.377  1.00 1.00 ? 111 THR A C    2  
ATOM 3182  O O    . THR A 1 91  ? -12.277 -1.141  10.392  1.00 1.00 ? 111 THR A O    2  
ATOM 3183  C CB   . THR A 1 91  ? -9.382  -0.627  11.000  1.00 1.00 ? 111 THR A CB   2  
ATOM 3184  O OG1  . THR A 1 91  ? -8.007  -0.423  10.746  1.00 1.00 ? 111 THR A OG1  2  
ATOM 3185  C CG2  . THR A 1 91  ? -9.469  -1.041  12.477  1.00 1.00 ? 111 THR A CG2  2  
ATOM 3186  H H    . THR A 1 91  ? -10.309 -0.354  8.274   1.00 1.00 ? 111 THR A H    2  
ATOM 3187  H HA   . THR A 1 91  ? -9.366  -2.574  10.146  1.00 1.00 ? 111 THR A HA   2  
ATOM 3188  H HB   . THR A 1 91  ? -9.906  0.322   10.874  1.00 1.00 ? 111 THR A HB   2  
ATOM 3189  H HG1  . THR A 1 91  ? -7.686  0.219   11.382  1.00 1.00 ? 111 THR A HG1  2  
ATOM 3190  H HG21 . THR A 1 91  ? -8.958  -1.990  12.646  1.00 1.00 ? 111 THR A HG21 2  
ATOM 3191  H HG22 . THR A 1 91  ? -9.019  -0.282  13.118  1.00 1.00 ? 111 THR A HG22 2  
ATOM 3192  H HG23 . THR A 1 91  ? -10.515 -1.146  12.775  1.00 1.00 ? 111 THR A HG23 2  
ATOM 3193  N N    . VAL A 1 92  ? -11.726 -3.292  10.740  1.00 1.00 ? 112 VAL A N    2  
ATOM 3194  C CA   . VAL A 1 92  ? -13.118 -3.728  11.034  1.00 1.00 ? 112 VAL A CA   2  
ATOM 3195  C C    . VAL A 1 92  ? -13.667 -3.164  12.365  1.00 1.00 ? 112 VAL A C    2  
ATOM 3196  O O    . VAL A 1 92  ? -12.959 -2.584  13.189  1.00 1.00 ? 112 VAL A O    2  
ATOM 3197  C CB   . VAL A 1 92  ? -13.287 -5.275  10.954  1.00 1.00 ? 112 VAL A CB   2  
ATOM 3198  C CG1  . VAL A 1 92  ? -13.310 -6.015  12.299  1.00 1.00 ? 112 VAL A CG1  2  
ATOM 3199  C CG2  . VAL A 1 92  ? -14.536 -5.709  10.170  1.00 1.00 ? 112 VAL A CG2  2  
ATOM 3200  H H    . VAL A 1 92  ? -11.030 -4.026  10.633  1.00 1.00 ? 112 VAL A H    2  
ATOM 3201  H HA   . VAL A 1 92  ? -13.721 -3.304  10.236  1.00 1.00 ? 112 VAL A HA   2  
ATOM 3202  H HB   . VAL A 1 92  ? -12.450 -5.663  10.399  1.00 1.00 ? 112 VAL A HB   2  
ATOM 3203  H HG11 . VAL A 1 92  ? -12.526 -5.647  12.961  1.00 1.00 ? 112 VAL A HG11 2  
ATOM 3204  H HG12 . VAL A 1 92  ? -14.262 -5.883  12.791  1.00 1.00 ? 112 VAL A HG12 2  
ATOM 3205  H HG13 . VAL A 1 92  ? -13.203 -7.084  12.129  1.00 1.00 ? 112 VAL A HG13 2  
ATOM 3206  H HG21 . VAL A 1 92  ? -15.446 -5.274  10.579  1.00 1.00 ? 112 VAL A HG21 2  
ATOM 3207  H HG22 . VAL A 1 92  ? -14.419 -5.407  9.135   1.00 1.00 ? 112 VAL A HG22 2  
ATOM 3208  H HG23 . VAL A 1 92  ? -14.632 -6.796  10.177  1.00 1.00 ? 112 VAL A HG23 2  
ATOM 3209  N N    . PHE A 1 93  ? -14.969 -3.373  12.563  1.00 1.00 ? 113 PHE A N    2  
ATOM 3210  C CA   . PHE A 1 93  ? -15.790 -2.870  13.670  1.00 1.00 ? 113 PHE A CA   2  
ATOM 3211  C C    . PHE A 1 93  ? -16.585 -3.955  14.434  1.00 1.00 ? 113 PHE A C    2  
ATOM 3212  O O    . PHE A 1 93  ? -17.675 -3.692  14.946  1.00 1.00 ? 113 PHE A O    2  
ATOM 3213  C CB   . PHE A 1 93  ? -16.633 -1.715  13.107  1.00 1.00 ? 113 PHE A CB   2  
ATOM 3214  C CG   . PHE A 1 93  ? -16.737 -0.464  13.963  1.00 1.00 ? 113 PHE A CG   2  
ATOM 3215  C CD1  . PHE A 1 93  ? -15.563 0.147   14.466  1.00 1.00 ? 113 PHE A CD1  2  
ATOM 3216  C CD2  . PHE A 1 93  ? -17.996 0.115   14.241  1.00 1.00 ? 113 PHE A CD2  2  
ATOM 3217  C CE1  . PHE A 1 93  ? -15.649 1.318   15.252  1.00 1.00 ? 113 PHE A CE1  2  
ATOM 3218  C CE2  . PHE A 1 93  ? -18.081 1.297   15.013  1.00 1.00 ? 113 PHE A CE2  2  
ATOM 3219  C CZ   . PHE A 1 93  ? -16.907 1.894   15.523  1.00 1.00 ? 113 PHE A CZ   2  
ATOM 3220  H H    . PHE A 1 93  ? -15.386 -3.976  11.871  1.00 1.00 ? 113 PHE A H    2  
ATOM 3221  H HA   . PHE A 1 93  ? -15.114 -2.457  14.418  1.00 1.00 ? 113 PHE A HA   2  
ATOM 3222  H HB2  . PHE A 1 93  ? -16.137 -1.231  12.266  1.00 0.00 ? 113 PHE A HB2  2  
ATOM 3223  H HB3  . PHE A 1 93  ? -17.606 -2.064  12.755  1.00 1.00 ? 113 PHE A HB3  2  
ATOM 3224  H HD1  . PHE A 1 93  ? -14.593 -0.282  14.256  1.00 1.00 ? 113 PHE A HD1  2  
ATOM 3225  H HD2  . PHE A 1 93  ? -18.899 -0.344  13.859  1.00 1.00 ? 113 PHE A HD2  2  
ATOM 3226  H HE1  . PHE A 1 93  ? -14.747 1.769   15.641  1.00 1.00 ? 113 PHE A HE1  2  
ATOM 3227  H HE2  . PHE A 1 93  ? -19.045 1.739   15.216  1.00 1.00 ? 113 PHE A HE2  2  
ATOM 3228  H HZ   . PHE A 1 93  ? -16.973 2.790   16.126  1.00 1.00 ? 113 PHE A HZ   2  
ATOM 3229  N N    . THR A 1 94  ? -16.015 -5.167  14.545  1.00 1.00 ? 114 THR A N    2  
ATOM 3230  C CA   . THR A 1 94  ? -16.541 -6.308  15.328  1.00 1.00 ? 114 THR A CA   2  
ATOM 3231  C C    . THR A 1 94  ? -15.491 -6.871  16.315  1.00 1.00 ? 114 THR A C    2  
ATOM 3232  O O    . THR A 1 94  ? -14.340 -6.434  16.330  1.00 1.00 ? 114 THR A O    2  
ATOM 3233  C CB   . THR A 1 94  ? -17.130 -7.388  14.389  1.00 1.00 ? 114 THR A CB   2  
ATOM 3234  O OG1  . THR A 1 94  ? -17.821 -8.351  15.153  1.00 1.00 ? 114 THR A OG1  2  
ATOM 3235  C CG2  . THR A 1 94  ? -16.096 -8.106  13.505  1.00 1.00 ? 114 THR A CG2  2  
ATOM 3236  H H    . THR A 1 94  ? -15.073 -5.280  14.165  1.00 1.00 ? 114 THR A H    2  
ATOM 3237  H HA   . THR A 1 94  ? -17.372 -5.948  15.941  1.00 1.00 ? 114 THR A HA   2  
ATOM 3238  H HB   . THR A 1 94  ? -17.865 -6.915  13.736  1.00 1.00 ? 114 THR A HB   2  
ATOM 3239  H HG1  . THR A 1 94  ? -18.415 -8.809  14.550  1.00 1.00 ? 114 THR A HG1  2  
ATOM 3240  H HG21 . THR A 1 94  ? -15.169 -8.274  14.048  1.00 1.00 ? 114 THR A HG21 2  
ATOM 3241  H HG22 . THR A 1 94  ? -16.464 -9.072  13.169  1.00 1.00 ? 114 THR A HG22 2  
ATOM 3242  H HG23 . THR A 1 94  ? -15.886 -7.498  12.625  1.00 1.00 ? 114 THR A HG23 2  
ATOM 3243  N N    . ASN A 1 95  ? -15.892 -7.847  17.144  1.00 1.00 ? 115 ASN A N    2  
ATOM 3244  C CA   . ASN A 1 95  ? -15.056 -8.531  18.141  1.00 1.00 ? 115 ASN A CA   2  
ATOM 3245  C C    . ASN A 1 95  ? -13.746 -9.130  17.547  1.00 1.00 ? 115 ASN A C    2  
ATOM 3246  O O    . ASN A 1 95  ? -12.693 -8.887  18.138  1.00 1.00 ? 115 ASN A O    2  
ATOM 3247  C CB   . ASN A 1 95  ? -15.933 -9.524  18.931  1.00 1.00 ? 115 ASN A CB   2  
ATOM 3248  C CG   . ASN A 1 95  ? -15.363 -9.915  20.290  1.00 1.00 ? 115 ASN A CG   2  
ATOM 3249  O OD1  . ASN A 1 95  ? -15.460 -9.193  21.263  1.00 1.00 ? 115 ASN A OD1  2  
ATOM 3250  N ND2  . ASN A 1 95  ? -14.761 -11.079 20.419  1.00 1.00 ? 115 ASN A ND2  2  
ATOM 3251  H H    . ASN A 1 95  ? -16.833 -8.181  16.967  1.00 1.00 ? 115 ASN A H    2  
ATOM 3252  H HA   . ASN A 1 95  ? -14.741 -7.757  18.845  1.00 1.00 ? 115 ASN A HA   2  
ATOM 3253  H HB2  . ASN A 1 95  ? -16.865 -9.086  19.289  1.00 0.00 ? 115 ASN A HB2  2  
ATOM 3254  H HB3  . ASN A 1 95  ? -16.227 -10.394 18.349  1.00 1.00 ? 115 ASN A HB3  2  
ATOM 3255  H HD21 . ASN A 1 95  ? -14.682 -11.710 19.609  1.00 0.00 ? 115 ASN A HD21 2  
ATOM 3256  H HD22 . ASN A 1 95  ? -14.371 -11.360 21.331  1.00 0.00 ? 115 ASN A HD22 2  
ATOM 3257  N N    . PRO A 1 96  ? -13.763 -9.900  16.426  1.00 1.00 ? 116 PRO A N    2  
ATOM 3258  C CA   . PRO A 1 96  ? -12.560 -10.333 15.698  1.00 1.00 ? 116 PRO A CA   2  
ATOM 3259  C C    . PRO A 1 96  ? -11.994 -9.158  14.845  1.00 1.00 ? 116 PRO A C    2  
ATOM 3260  O O    . PRO A 1 96  ? -12.657 -8.755  13.884  1.00 1.00 ? 116 PRO A O    2  
ATOM 3261  C CB   . PRO A 1 96  ? -13.002 -11.499 14.803  1.00 1.00 ? 116 PRO A CB   2  
ATOM 3262  C CG   . PRO A 1 96  ? -14.479 -11.203 14.539  1.00 1.00 ? 116 PRO A CG   2  
ATOM 3263  C CD   . PRO A 1 96  ? -14.953 -10.462 15.790  1.00 1.00 ? 116 PRO A CD   2  
ATOM 3264  H HA   . PRO A 1 96  ? -11.811 -10.701 16.401  1.00 1.00 ? 116 PRO A HA   2  
ATOM 3265  H HB2  . PRO A 1 96  ? -12.423 -11.525 13.880  1.00 0.00 ? 116 PRO A HB2  2  
ATOM 3266  H HB3  . PRO A 1 96  ? -12.920 -12.436 15.357  1.00 1.00 ? 116 PRO A HB3  2  
ATOM 3267  H HG2  . PRO A 1 96  ? -14.605 -10.594 13.644  1.00 0.00 ? 116 PRO A HG2  2  
ATOM 3268  H HG3  . PRO A 1 96  ? -15.046 -12.124 14.395  1.00 1.00 ? 116 PRO A HG3  2  
ATOM 3269  H HD2  . PRO A 1 96  ? -15.658 -9.663  15.564  1.00 0.00 ? 116 PRO A HD2  2  
ATOM 3270  H HD3  . PRO A 1 96  ? -15.422 -11.179 16.462  1.00 1.00 ? 116 PRO A HD3  2  
ATOM 3271  N N    . PRO A 1 97  ? -10.813 -8.568  15.160  1.00 1.00 ? 117 PRO A N    2  
ATOM 3272  C CA   . PRO A 1 97  ? -10.260 -7.398  14.456  1.00 1.00 ? 117 PRO A CA   2  
ATOM 3273  C C    . PRO A 1 97  ? -9.818  -7.732  13.008  1.00 1.00 ? 117 PRO A C    2  
ATOM 3274  O O    . PRO A 1 97  ? -8.762  -8.339  12.808  1.00 1.00 ? 117 PRO A O    2  
ATOM 3275  C CB   . PRO A 1 97  ? -9.082  -6.905  15.309  1.00 1.00 ? 117 PRO A CB   2  
ATOM 3276  C CG   . PRO A 1 97  ? -8.636  -8.160  16.062  1.00 1.00 ? 117 PRO A CG   2  
ATOM 3277  C CD   . PRO A 1 97  ? -9.914  -8.982  16.230  1.00 1.00 ? 117 PRO A CD   2  
ATOM 3278  H HA   . PRO A 1 97  ? -11.017 -6.611  14.429  1.00 1.00 ? 117 PRO A HA   2  
ATOM 3279  H HB2  . PRO A 1 97  ? -8.284  -6.506  14.682  1.00 0.00 ? 117 PRO A HB2  2  
ATOM 3280  H HB3  . PRO A 1 97  ? -9.439  -6.165  16.029  1.00 1.00 ? 117 PRO A HB3  2  
ATOM 3281  H HG2  . PRO A 1 97  ? -7.888  -8.721  15.499  1.00 0.00 ? 117 PRO A HG2  2  
ATOM 3282  H HG3  . PRO A 1 97  ? -8.194  -7.913  17.029  1.00 1.00 ? 117 PRO A HG3  2  
ATOM 3283  H HD2  . PRO A 1 97  ? -9.742  -10.056 16.163  1.00 0.00 ? 117 PRO A HD2  2  
ATOM 3284  H HD3  . PRO A 1 97  ? -10.364 -8.744  17.194  1.00 1.00 ? 117 PRO A HD3  2  
ATOM 3285  N N    . GLN A 1 98  ? -10.586 -7.297  11.987  1.00 1.00 ? 118 GLN A N    2  
ATOM 3286  C CA   . GLN A 1 98  ? -10.320 -7.624  10.575  1.00 1.00 ? 118 GLN A CA   2  
ATOM 3287  C C    . GLN A 1 98  ? -9.615  -6.435  9.897   1.00 1.00 ? 118 GLN A C    2  
ATOM 3288  O O    . GLN A 1 98  ? -10.235 -5.436  9.531   1.00 1.00 ? 118 GLN A O    2  
ATOM 3289  C CB   . GLN A 1 98  ? -11.612 -8.095  9.866   1.00 1.00 ? 118 GLN A CB   2  
ATOM 3290  C CG   . GLN A 1 98  ? -11.535 -9.466  9.182   1.00 1.00 ? 118 GLN A CG   2  
ATOM 3291  C CD   . GLN A 1 98  ? -11.573 -10.637 10.158  1.00 1.00 ? 118 GLN A CD   2  
ATOM 3292  O OE1  . GLN A 1 98  ? -10.742 -10.797 11.032  1.00 1.00 ? 118 GLN A OE1  2  
ATOM 3293  N NE2  . GLN A 1 98  ? -12.535 -11.525 10.031  1.00 1.00 ? 118 GLN A NE2  2  
ATOM 3294  H H    . GLN A 1 98  ? -11.411 -6.724  12.178  1.00 1.00 ? 118 GLN A H    2  
ATOM 3295  H HA   . GLN A 1 98  ? -9.632  -8.473  10.547  1.00 1.00 ? 118 GLN A HA   2  
ATOM 3296  H HB2  . GLN A 1 98  ? -12.426 -8.245  10.575  1.00 0.00 ? 118 GLN A HB2  2  
ATOM 3297  H HB3  . GLN A 1 98  ? -11.956 -7.366  9.130   1.00 1.00 ? 118 GLN A HB3  2  
ATOM 3298  H HG2  . GLN A 1 98  ? -12.413 -9.654  8.564   1.00 0.00 ? 118 GLN A HG2  2  
ATOM 3299  H HG3  . GLN A 1 98  ? -10.659 -9.542  8.537   1.00 1.00 ? 118 GLN A HG3  2  
ATOM 3300  H HE21 . GLN A 1 98  ? -13.237 -11.419 9.286   1.00 0.00 ? 118 GLN A HE21 2  
ATOM 3301  H HE22 . GLN A 1 98  ? -12.585 -12.325 10.676  1.00 0.00 ? 118 GLN A HE22 2  
ATOM 3302  N N    . VAL A 1 99  ? -8.287  -6.540  9.792   1.00 1.00 ? 119 VAL A N    2  
ATOM 3303  C CA   . VAL A 1 99  ? -7.402  -5.547  9.153   1.00 1.00 ? 119 VAL A CA   2  
ATOM 3304  C C    . VAL A 1 99  ? -6.943  -6.006  7.763   1.00 1.00 ? 119 VAL A C    2  
ATOM 3305  O O    . VAL A 1 99  ? -6.514  -7.146  7.581   1.00 1.00 ? 119 VAL A O    2  
ATOM 3306  C CB   . VAL A 1 99  ? -6.199  -5.108  10.027  1.00 1.00 ? 119 VAL A CB   2  
ATOM 3307  C CG1  . VAL A 1 99  ? -6.669  -4.385  11.303  1.00 1.00 ? 119 VAL A CG1  2  
ATOM 3308  C CG2  . VAL A 1 99  ? -5.230  -6.248  10.390  1.00 1.00 ? 119 VAL A CG2  2  
ATOM 3309  H H    . VAL A 1 99  ? -7.892  -7.353  10.228  1.00 1.00 ? 119 VAL A H    2  
ATOM 3310  H HA   . VAL A 1 99  ? -8.003  -4.655  9.022   1.00 1.00 ? 119 VAL A HA   2  
ATOM 3311  H HB   . VAL A 1 99  ? -5.631  -4.377  9.450   1.00 1.00 ? 119 VAL A HB   2  
ATOM 3312  H HG11 . VAL A 1 99  ? -7.326  -3.553  11.038  1.00 1.00 ? 119 VAL A HG11 2  
ATOM 3313  H HG12 . VAL A 1 99  ? -7.207  -5.076  11.952  1.00 1.00 ? 119 VAL A HG12 2  
ATOM 3314  H HG13 . VAL A 1 99  ? -5.810  -3.981  11.841  1.00 1.00 ? 119 VAL A HG13 2  
ATOM 3315  H HG21 . VAL A 1 99  ? -4.834  -6.707  9.484   1.00 1.00 ? 119 VAL A HG21 2  
ATOM 3316  H HG22 . VAL A 1 99  ? -4.389  -5.856  10.963  1.00 1.00 ? 119 VAL A HG22 2  
ATOM 3317  H HG23 . VAL A 1 99  ? -5.742  -7.008  10.980  1.00 1.00 ? 119 VAL A HG23 2  
ATOM 3318  N N    . ALA A 1 100 ? -7.025  -5.093  6.790   1.00 1.00 ? 120 ALA A N    2  
ATOM 3319  C CA   . ALA A 1 100 ? -6.519  -5.265  5.423   1.00 1.00 ? 120 ALA A CA   2  
ATOM 3320  C C    . ALA A 1 100 ? -5.810  -4.001  4.882   1.00 1.00 ? 120 ALA A C    2  
ATOM 3321  O O    . ALA A 1 100 ? -6.074  -2.873  5.313   1.00 1.00 ? 120 ALA A O    2  
ATOM 3322  C CB   . ALA A 1 100 ? -7.652  -5.759  4.513   1.00 1.00 ? 120 ALA A CB   2  
ATOM 3323  H H    . ALA A 1 100 ? -7.432  -4.203  7.067   1.00 1.00 ? 120 ALA A H    2  
ATOM 3324  H HA   . ALA A 1 100 ? -5.762  -6.058  5.447   1.00 1.00 ? 120 ALA A HA   2  
ATOM 3325  H HB1  . ALA A 1 100 ? -8.044  -6.696  4.913   1.00 1.00 ? 120 ALA A HB1  2  
ATOM 3326  H HB2  . ALA A 1 100 ? -8.463  -5.040  4.466   1.00 1.00 ? 120 ALA A HB2  2  
ATOM 3327  H HB3  . ALA A 1 100 ? -7.273  -5.935  3.507   1.00 1.00 ? 120 ALA A HB3  2  
ATOM 3328  N N    . THR A 1 101 ? -4.902  -4.214  3.924   1.00 1.00 ? 121 THR A N    2  
ATOM 3329  C CA   . THR A 1 101 ? -3.966  -3.215  3.367   1.00 1.00 ? 121 THR A CA   2  
ATOM 3330  C C    . THR A 1 101 ? -4.031  -3.173  1.835   1.00 1.00 ? 121 THR A C    2  
ATOM 3331  O O    . THR A 1 101 ? -4.243  -4.198  1.195   1.00 1.00 ? 121 THR A O    2  
ATOM 3332  C CB   . THR A 1 101 ? -2.531  -3.432  3.913   1.00 1.00 ? 121 THR A CB   2  
ATOM 3333  O OG1  . THR A 1 101 ? -2.514  -3.227  5.309   1.00 1.00 ? 121 THR A OG1  2  
ATOM 3334  C CG2  . THR A 1 101 ? -1.464  -2.463  3.385   1.00 1.00 ? 121 THR A CG2  2  
ATOM 3335  H H    . THR A 1 101 ? -4.839  -5.142  3.513   1.00 1.00 ? 121 THR A H    2  
ATOM 3336  H HA   . THR A 1 101 ? -4.285  -2.231  3.717   1.00 1.00 ? 121 THR A HA   2  
ATOM 3337  H HB   . THR A 1 101 ? -2.215  -4.455  3.709   1.00 1.00 ? 121 THR A HB   2  
ATOM 3338  H HG1  . THR A 1 101 ? -1.588  -3.193  5.565   1.00 1.00 ? 121 THR A HG1  2  
ATOM 3339  H HG21 . THR A 1 101 ? -1.799  -1.428  3.488   1.00 1.00 ? 121 THR A HG21 2  
ATOM 3340  H HG22 . THR A 1 101 ? -0.528  -2.593  3.929   1.00 1.00 ? 121 THR A HG22 2  
ATOM 3341  H HG23 . THR A 1 101 ? -1.267  -2.683  2.339   1.00 1.00 ? 121 THR A HG23 2  
ATOM 3342  N N    . TYR A 1 102 ? -3.776  -2.009  1.243   1.00 1.00 ? 122 TYR A N    2  
ATOM 3343  C CA   . TYR A 1 102 ? -3.761  -1.746  -0.206  1.00 1.00 ? 122 TYR A CA   2  
ATOM 3344  C C    . TYR A 1 102 ? -2.412  -2.113  -0.865  1.00 1.00 ? 122 TYR A C    2  
ATOM 3345  O O    . TYR A 1 102 ? -1.438  -2.417  -0.177  1.00 1.00 ? 122 TYR A O    2  
ATOM 3346  C CB   . TYR A 1 102 ? -3.903  -0.222  -0.377  1.00 1.00 ? 122 TYR A CB   2  
ATOM 3347  C CG   . TYR A 1 102 ? -3.968  0.334   -1.791  1.00 1.00 ? 122 TYR A CG   2  
ATOM 3348  C CD1  . TYR A 1 102 ? -5.133  0.136   -2.573  1.00 1.00 ? 122 TYR A CD1  2  
ATOM 3349  C CD2  . TYR A 1 102 ? -2.851  1.007   -2.334  1.00 1.00 ? 122 TYR A CD2  2  
ATOM 3350  C CE1  . TYR A 1 102 ? -5.179  0.616   -3.902  1.00 1.00 ? 122 TYR A CE1  2  
ATOM 3351  C CE2  . TYR A 1 102 ? -2.891  1.473   -3.671  1.00 1.00 ? 122 TYR A CE2  2  
ATOM 3352  C CZ   . TYR A 1 102 ? -4.053  1.283   -4.456  1.00 1.00 ? 122 TYR A CZ   2  
ATOM 3353  O OH   . TYR A 1 102 ? -4.088  1.723   -5.742  1.00 1.00 ? 122 TYR A OH   2  
ATOM 3354  H H    . TYR A 1 102 ? -3.807  -1.211  1.866   1.00 1.00 ? 122 TYR A H    2  
ATOM 3355  H HA   . TYR A 1 102 ? -4.583  -2.264  -0.701  1.00 1.00 ? 122 TYR A HA   2  
ATOM 3356  H HB2  . TYR A 1 102 ? -4.879  0.106   -0.018  1.00 0.00 ? 122 TYR A HB2  2  
ATOM 3357  H HB3  . TYR A 1 102 ? -3.125  0.294   0.191   1.00 1.00 ? 122 TYR A HB3  2  
ATOM 3358  H HD1  . TYR A 1 102 ? -5.987  -0.381  -2.162  1.00 1.00 ? 122 TYR A HD1  2  
ATOM 3359  H HD2  . TYR A 1 102 ? -1.957  1.158   -1.742  1.00 1.00 ? 122 TYR A HD2  2  
ATOM 3360  H HE1  . TYR A 1 102 ? -6.069  0.464   -4.501  1.00 1.00 ? 122 TYR A HE1  2  
ATOM 3361  H HE2  . TYR A 1 102 ? -2.036  1.971   -4.107  1.00 1.00 ? 122 TYR A HE2  2  
ATOM 3362  H HH   . TYR A 1 102 ? -4.969  1.616   -6.111  1.00 1.00 ? 122 TYR A HH   2  
ATOM 3363  N N    . HIS A 1 103 ? -2.369  -2.202  -2.207  1.00 1.00 ? 123 HIS A N    2  
ATOM 3364  C CA   . HIS A 1 103 ? -1.146  -2.317  -3.038  1.00 1.00 ? 123 HIS A CA   2  
ATOM 3365  C C    . HIS A 1 103 ? -0.175  -1.109  -2.800  1.00 1.00 ? 123 HIS A C    2  
ATOM 3366  O O    . HIS A 1 103 ? 0.109   -0.299  -3.684  1.00 1.00 ? 123 HIS A O    2  
ATOM 3367  C CB   . HIS A 1 103 ? -1.606  -2.474  -4.501  1.00 1.00 ? 123 HIS A CB   2  
ATOM 3368  C CG   . HIS A 1 103 ? -0.518  -2.622  -5.539  1.00 1.00 ? 123 HIS A CG   2  
ATOM 3369  N ND1  . HIS A 1 103 ? -0.556  -2.077  -6.807  1.00 1.00 ? 123 HIS A ND1  2  
ATOM 3370  C CD2  . HIS A 1 103 ? 0.652   -3.318  -5.410  1.00 1.00 ? 123 HIS A CD2  2  
ATOM 3371  C CE1  . HIS A 1 103 ? 0.577   -2.434  -7.442  1.00 1.00 ? 123 HIS A CE1  2  
ATOM 3372  N NE2  . HIS A 1 103 ? 1.334   -3.189  -6.608  1.00 1.00 ? 123 HIS A NE2  2  
ATOM 3373  H H    . HIS A 1 103 ? -3.239  -2.029  -2.689  1.00 1.00 ? 123 HIS A H    2  
ATOM 3374  H HA   . HIS A 1 103 ? -0.618  -3.225  -2.746  1.00 1.00 ? 123 HIS A HA   2  
ATOM 3375  H HB2  . HIS A 1 103 ? -2.141  -3.416  -4.626  1.00 0.00 ? 123 HIS A HB2  2  
ATOM 3376  H HB3  . HIS A 1 103 ? -2.271  -1.651  -4.776  1.00 1.00 ? 123 HIS A HB3  2  
ATOM 3377  H HD1  . HIS A 1 103 ? -1.327  -1.526  -7.165  1.00 1.00 ? 123 HIS A HD1  2  
ATOM 3378  H HD2  . HIS A 1 103 ? 0.967   -3.870  -4.528  1.00 1.00 ? 123 HIS A HD2  2  
ATOM 3379  H HE1  . HIS A 1 103 ? 0.838   -2.171  -8.464  1.00 1.00 ? 123 HIS A HE1  2  
ATOM 3380  H HE2  . HIS A 1 103 ? 2.235   -3.597  -6.816  1.00 1.00 ? 123 HIS A HE2  2  
ATOM 3381  N N    . ARG A 1 104 ? 0.307   -1.003  -1.553  1.00 1.00 ? 124 ARG A N    2  
ATOM 3382  C CA   . ARG A 1 104 ? 1.075   0.055   -0.883  1.00 1.00 ? 124 ARG A CA   2  
ATOM 3383  C C    . ARG A 1 104 ? 2.599   -0.066  -1.048  1.00 1.00 ? 124 ARG A C    2  
ATOM 3384  O O    . ARG A 1 104 ? 3.281   -0.810  -0.345  1.00 1.00 ? 124 ARG A O    2  
ATOM 3385  C CB   . ARG A 1 104 ? 0.598   0.162   0.590   1.00 1.00 ? 124 ARG A CB   2  
ATOM 3386  C CG   . ARG A 1 104 ? 1.573   0.404   1.744   1.00 1.00 ? 124 ARG A CG   2  
ATOM 3387  C CD   . ARG A 1 104 ? 2.019   -0.905  2.410   1.00 1.00 ? 124 ARG A CD   2  
ATOM 3388  N NE   . ARG A 1 104 ? 3.217   -0.720  3.246   1.00 1.00 ? 124 ARG A NE   2  
ATOM 3389  C CZ   . ARG A 1 104 ? 4.400   -0.225  2.950   1.00 1.00 ? 124 ARG A CZ   2  
ATOM 3390  N NH1  . ARG A 1 104 ? 4.778   0.106   1.756   1.00 1.00 ? 124 ARG A NH1  2  
ATOM 3391  N NH2  . ARG A 1 104 ? 5.244   -0.032  3.915   1.00 1.00 ? 124 ARG A NH2  2  
ATOM 3392  H H    . ARG A 1 104 ? -0.066  -1.719  -0.932  1.00 1.00 ? 124 ARG A H    2  
ATOM 3393  H HA   . ARG A 1 104 ? 0.778   1.004   -1.334  1.00 1.00 ? 124 ARG A HA   2  
ATOM 3394  H HB2  . ARG A 1 104 ? 0.266   1.186   0.762   1.00 0.00 ? 124 ARG A HB2  2  
ATOM 3395  H HB3  . ARG A 1 104 ? -0.227  -0.494  0.869   1.00 1.00 ? 124 ARG A HB3  2  
ATOM 3396  H HG2  . ARG A 1 104 ? 2.466   0.896   1.357   1.00 0.00 ? 124 ARG A HG2  2  
ATOM 3397  H HG3  . ARG A 1 104 ? 1.093   1.037   2.488   1.00 1.00 ? 124 ARG A HG3  2  
ATOM 3398  H HD2  . ARG A 1 104 ? 1.261   -1.273  3.102   1.00 0.00 ? 124 ARG A HD2  2  
ATOM 3399  H HD3  . ARG A 1 104 ? 2.196   -1.686  1.667   1.00 1.00 ? 124 ARG A HD3  2  
ATOM 3400  H HE   . ARG A 1 104 ? 3.147   -0.924  4.244   1.00 1.00 ? 124 ARG A HE   2  
ATOM 3401  H HH11 . ARG A 1 104 ? 4.134   -0.013  0.962   1.00 0.00 ? 124 ARG A HH11 2  
ATOM 3402  H HH12 . ARG A 1 104 ? 5.722   0.487   1.602   1.00 0.00 ? 124 ARG A HH12 2  
ATOM 3403  H HH21 . ARG A 1 104 ? 4.982   -0.263  4.883   1.00 0.00 ? 124 ARG A HH21 2  
ATOM 3404  H HH22 . ARG A 1 104 ? 6.177   0.354   3.713   1.00 0.00 ? 124 ARG A HH22 2  
ATOM 3405  N N    . ALA A 1 105 ? 3.119   0.698   -1.999  1.00 1.00 ? 125 ALA A N    2  
ATOM 3406  C CA   . ALA A 1 105 ? 4.532   0.967   -2.285  1.00 1.00 ? 125 ALA A CA   2  
ATOM 3407  C C    . ALA A 1 105 ? 4.520   2.197   -3.218  1.00 1.00 ? 125 ALA A C    2  
ATOM 3408  O O    . ALA A 1 105 ? 4.200   3.295   -2.750  1.00 1.00 ? 125 ALA A O    2  
ATOM 3409  C CB   . ALA A 1 105 ? 5.232   -0.301  -2.827  1.00 1.00 ? 125 ALA A CB   2  
ATOM 3410  H H    . ALA A 1 105 ? 2.434   1.235   -2.510  1.00 1.00 ? 125 ALA A H    2  
ATOM 3411  H HA   . ALA A 1 105 ? 5.031   1.257   -1.358  1.00 1.00 ? 125 ALA A HA   2  
ATOM 3412  H HB1  . ALA A 1 105 ? 4.704   -0.690  -3.699  1.00 1.00 ? 125 ALA A HB1  2  
ATOM 3413  H HB2  . ALA A 1 105 ? 6.261   -0.065  -3.097  1.00 1.00 ? 125 ALA A HB2  2  
ATOM 3414  H HB3  . ALA A 1 105 ? 5.253   -1.074  -2.058  1.00 1.00 ? 125 ALA A HB3  2  
ATOM 3415  N N    . ILE A 1 106 ? 4.748   1.984   -4.526  1.00 1.00 ? 126 ILE A N    2  
ATOM 3416  C CA   . ILE A 1 106 ? 4.617   2.916   -5.664  1.00 1.00 ? 126 ILE A CA   2  
ATOM 3417  C C    . ILE A 1 106 ? 5.191   4.339   -5.367  1.00 1.00 ? 126 ILE A C    2  
ATOM 3418  O O    . ILE A 1 106 ? 6.109   4.478   -4.554  1.00 1.00 ? 126 ILE A O    2  
ATOM 3419  C CB   . ILE A 1 106 ? 3.143   2.877   -6.207  1.00 1.00 ? 126 ILE A CB   2  
ATOM 3420  C CG1  . ILE A 1 106 ? 2.294   1.617   -5.858  1.00 1.00 ? 126 ILE A CG1  2  
ATOM 3421  C CG2  . ILE A 1 106 ? 3.074   3.109   -7.733  1.00 1.00 ? 126 ILE A CG2  2  
ATOM 3422  C CD1  . ILE A 1 106 ? 2.742   0.236   -6.362  1.00 1.00 ? 126 ILE A CD1  2  
ATOM 3423  H H    . ILE A 1 106 ? 4.978   1.032   -4.762  1.00 1.00 ? 126 ILE A H    2  
ATOM 3424  H HA   . ILE A 1 106 ? 5.254   2.510   -6.452  1.00 1.00 ? 126 ILE A HA   2  
ATOM 3425  H HB   . ILE A 1 106 ? 2.625   3.703   -5.726  1.00 1.00 ? 126 ILE A HB   2  
ATOM 3426  H HG12 . ILE A 1 106 ? 2.345   1.396   -4.792  1.00 0.00 ? 126 ILE A HG12 2  
ATOM 3427  H HG13 . ILE A 1 106 ? 1.243   1.769   -6.119  1.00 1.00 ? 126 ILE A HG13 2  
ATOM 3428  H HG21 . ILE A 1 106 ? 3.569   4.031   -8.029  1.00 1.00 ? 126 ILE A HG21 2  
ATOM 3429  H HG22 . ILE A 1 106 ? 3.550   2.282   -8.261  1.00 1.00 ? 126 ILE A HG22 2  
ATOM 3430  H HG23 . ILE A 1 106 ? 2.031   3.165   -8.053  1.00 1.00 ? 126 ILE A HG23 2  
ATOM 3431  H HD11 . ILE A 1 106 ? 3.806   0.080   -6.181  1.00 1.00 ? 126 ILE A HD11 2  
ATOM 3432  H HD12 . ILE A 1 106 ? 2.182   -0.527  -5.820  1.00 1.00 ? 126 ILE A HD12 2  
ATOM 3433  H HD13 . ILE A 1 106 ? 2.538   0.139   -7.429  1.00 1.00 ? 126 ILE A HD13 2  
ATOM 3434  N N    . LYS A 1 107 ? 4.776   5.385   -6.105  1.00 1.00 ? 127 LYS A N    2  
ATOM 3435  C CA   . LYS A 1 107 ? 5.107   6.805   -5.867  1.00 1.00 ? 127 LYS A CA   2  
ATOM 3436  C C    . LYS A 1 107 ? 3.928   7.783   -6.060  1.00 1.00 ? 127 LYS A C    2  
ATOM 3437  O O    . LYS A 1 107 ? 2.953   7.476   -6.746  1.00 1.00 ? 127 LYS A O    2  
ATOM 3438  C CB   . LYS A 1 107 ? 6.336   7.161   -6.722  1.00 1.00 ? 127 LYS A CB   2  
ATOM 3439  C CG   . LYS A 1 107 ? 7.463   7.819   -5.915  1.00 1.00 ? 127 LYS A CG   2  
ATOM 3440  C CD   . LYS A 1 107 ? 8.699   8.137   -6.758  1.00 1.00 ? 127 LYS A CD   2  
ATOM 3441  C CE   . LYS A 1 107 ? 8.617   9.519   -7.403  1.00 1.00 ? 127 LYS A CE   2  
ATOM 3442  N NZ   . LYS A 1 107 ? 9.440   10.493  -6.660  1.00 1.00 ? 127 LYS A NZ   2  
ATOM 3443  H H    . LYS A 1 107 ? 4.076   5.202   -6.808  1.00 1.00 ? 127 LYS A H    2  
ATOM 3444  H HA   . LYS A 1 107 ? 5.380   6.881   -4.807  1.00 1.00 ? 127 LYS A HA   2  
ATOM 3445  H HB2  . LYS A 1 107 ? 6.847   6.270   -7.087  1.00 0.00 ? 127 LYS A HB2  2  
ATOM 3446  H HB3  . LYS A 1 107 ? 6.062   7.753   -7.597  1.00 1.00 ? 127 LYS A HB3  2  
ATOM 3447  H HG2  . LYS A 1 107 ? 7.110   8.765   -5.504  1.00 0.00 ? 127 LYS A HG2  2  
ATOM 3448  H HG3  . LYS A 1 107 ? 7.761   7.157   -5.102  1.00 1.00 ? 127 LYS A HG3  2  
ATOM 3449  H HD2  . LYS A 1 107 ? 9.594   8.199   -6.138  1.00 0.00 ? 127 LYS A HD2  2  
ATOM 3450  H HD3  . LYS A 1 107 ? 8.871   7.365   -7.514  1.00 1.00 ? 127 LYS A HD3  2  
ATOM 3451  H HE2  . LYS A 1 107 ? 9.049   9.499   -8.404  1.00 0.00 ? 127 LYS A HE2  2  
ATOM 3452  H HE3  . LYS A 1 107 ? 7.575   9.843   -7.481  1.00 1.00 ? 127 LYS A HE3  2  
ATOM 3453  H HZ1  . LYS A 1 107 ? 10.315  10.667  -7.175  1.00 0.00 ? 127 LYS A HZ1  2  
ATOM 3454  H HZ2  . LYS A 1 107 ? 8.919   11.376  -6.560  1.00 0.00 ? 127 LYS A HZ2  2  
ATOM 3455  N N    . ILE A 1 108 ? 4.069   8.988   -5.494  1.00 1.00 ? 128 ILE A N    2  
ATOM 3456  C CA   . ILE A 1 108 ? 3.182   10.165  -5.639  1.00 1.00 ? 128 ILE A CA   2  
ATOM 3457  C C    . ILE A 1 108 ? 3.657   11.105  -6.782  1.00 1.00 ? 128 ILE A C    2  
ATOM 3458  O O    . ILE A 1 108 ? 4.867   11.262  -6.989  1.00 1.00 ? 128 ILE A O    2  
ATOM 3459  C CB   . ILE A 1 108 ? 3.101   10.914  -4.273  1.00 1.00 ? 128 ILE A CB   2  
ATOM 3460  C CG1  . ILE A 1 108 ? 1.947   11.942  -4.327  1.00 1.00 ? 128 ILE A CG1  2  
ATOM 3461  C CG2  . ILE A 1 108 ? 4.440   11.577  -3.860  1.00 1.00 ? 128 ILE A CG2  2  
ATOM 3462  C CD1  . ILE A 1 108 ? 1.710   12.779  -3.062  1.00 1.00 ? 128 ILE A CD1  2  
ATOM 3463  H H    . ILE A 1 108 ? 4.905   9.111   -4.946  1.00 1.00 ? 128 ILE A H    2  
ATOM 3464  H HA   . ILE A 1 108 ? 2.185   9.805   -5.890  1.00 1.00 ? 128 ILE A HA   2  
ATOM 3465  H HB   . ILE A 1 108 ? 2.846   10.179  -3.505  1.00 1.00 ? 128 ILE A HB   2  
ATOM 3466  H HG12 . ILE A 1 108 ? 2.172   12.688  -5.090  1.00 0.00 ? 128 ILE A HG12 2  
ATOM 3467  H HG13 . ILE A 1 108 ? 1.021   11.422  -4.577  1.00 1.00 ? 128 ILE A HG13 2  
ATOM 3468  H HG21 . ILE A 1 108 ? 5.247   10.844  -3.869  1.00 1.00 ? 128 ILE A HG21 2  
ATOM 3469  H HG22 . ILE A 1 108 ? 4.687   12.392  -4.544  1.00 1.00 ? 128 ILE A HG22 2  
ATOM 3470  H HG23 . ILE A 1 108 ? 4.363   11.979  -2.849  1.00 1.00 ? 128 ILE A HG23 2  
ATOM 3471  H HD11 . ILE A 1 108 ? 1.591   12.128  -2.195  1.00 1.00 ? 128 ILE A HD11 2  
ATOM 3472  H HD12 . ILE A 1 108 ? 2.544   13.460  -2.898  1.00 1.00 ? 128 ILE A HD12 2  
ATOM 3473  H HD13 . ILE A 1 108 ? 0.806   13.373  -3.193  1.00 1.00 ? 128 ILE A HD13 2  
ATOM 3474  N N    . THR A 1 109 ? 2.727   11.765  -7.502  1.00 1.00 ? 129 THR A N    2  
ATOM 3475  C CA   . THR A 1 109 ? 3.090   12.755  -8.556  1.00 1.00 ? 129 THR A CA   2  
ATOM 3476  C C    . THR A 1 109 ? 3.685   14.052  -7.983  1.00 1.00 ? 129 THR A C    2  
ATOM 3477  O O    . THR A 1 109 ? 3.177   14.596  -6.998  1.00 1.00 ? 129 THR A O    2  
ATOM 3478  C CB   . THR A 1 109 ? 1.933   13.128  -9.522  1.00 1.00 ? 129 THR A CB   2  
ATOM 3479  O OG1  . THR A 1 109 ? 2.502   13.702  -10.683 1.00 1.00 ? 129 THR A OG1  2  
ATOM 3480  C CG2  . THR A 1 109 ? 0.907   14.152  -9.013  1.00 1.00 ? 129 THR A CG2  2  
ATOM 3481  H H    . THR A 1 109 ? 1.741   11.515  -7.379  1.00 1.00 ? 129 THR A H    2  
ATOM 3482  H HA   . THR A 1 109 ? 3.854   12.275  -9.171  1.00 1.00 ? 129 THR A HA   2  
ATOM 3483  H HB   . THR A 1 109 ? 1.416   12.220  -9.825  1.00 1.00 ? 129 THR A HB   2  
ATOM 3484  H HG1  . THR A 1 109 ? 1.788   13.873  -11.311 1.00 1.00 ? 129 THR A HG1  2  
ATOM 3485  H HG21 . THR A 1 109 ? 0.585   13.888  -8.013  1.00 1.00 ? 129 THR A HG21 2  
ATOM 3486  H HG22 . THR A 1 109 ? 1.349   15.146  -8.953  1.00 1.00 ? 129 THR A HG22 2  
ATOM 3487  H HG23 . THR A 1 109 ? 0.044   14.185  -9.678  1.00 1.00 ? 129 THR A HG23 2  
ATOM 3488  N N    . VAL A 1 110 ? 4.755   14.554  -8.617  1.00 1.00 ? 130 VAL A N    2  
ATOM 3489  C CA   . VAL A 1 110 ? 5.351   15.887  -8.361  1.00 1.00 ? 130 VAL A CA   2  
ATOM 3490  C C    . VAL A 1 110 ? 4.776   17.001  -9.265  1.00 1.00 ? 130 VAL A C    2  
ATOM 3491  O O    . VAL A 1 110 ? 4.992   18.173  -8.963  1.00 1.00 ? 130 VAL A O    2  
ATOM 3492  C CB   . VAL A 1 110 ? 6.901   15.876  -8.390  1.00 1.00 ? 130 VAL A CB   2  
ATOM 3493  C CG1  . VAL A 1 110 ? 7.482   14.845  -7.405  1.00 1.00 ? 130 VAL A CG1  2  
ATOM 3494  C CG2  . VAL A 1 110 ? 7.498   15.653  -9.793  1.00 1.00 ? 130 VAL A CG2  2  
ATOM 3495  H H    . VAL A 1 110 ? 5.123   14.001  -9.376  1.00 1.00 ? 130 VAL A H    2  
ATOM 3496  H HA   . VAL A 1 110 ? 5.073   16.178  -7.345  1.00 1.00 ? 130 VAL A HA   2  
ATOM 3497  H HB   . VAL A 1 110 ? 7.238   16.856  -8.048  1.00 1.00 ? 130 VAL A HB   2  
ATOM 3498  H HG11 . VAL A 1 110 ? 7.039   14.977  -6.416  1.00 1.00 ? 130 VAL A HG11 2  
ATOM 3499  H HG12 . VAL A 1 110 ? 7.271   13.832  -7.753  1.00 1.00 ? 130 VAL A HG12 2  
ATOM 3500  H HG13 . VAL A 1 110 ? 8.560   14.977  -7.330  1.00 1.00 ? 130 VAL A HG13 2  
ATOM 3501  H HG21 . VAL A 1 110 ? 7.179   16.446  -10.469 1.00 1.00 ? 130 VAL A HG21 2  
ATOM 3502  H HG22 . VAL A 1 110 ? 8.586   15.676  -9.738  1.00 1.00 ? 130 VAL A HG22 2  
ATOM 3503  H HG23 . VAL A 1 110 ? 7.185   14.690  -10.198 1.00 1.00 ? 130 VAL A HG23 2  
ATOM 3504  N N    . ASP A 1 111 ? 4.080   16.636  -10.358 1.00 1.00 ? 131 ASP A N    2  
ATOM 3505  C CA   . ASP A 1 111 ? 3.392   17.494  -11.339 1.00 1.00 ? 131 ASP A CA   2  
ATOM 3506  C C    . ASP A 1 111 ? 2.155   18.204  -10.734 1.00 1.00 ? 131 ASP A C    2  
ATOM 3507  O O    . ASP A 1 111 ? 2.202   19.420  -10.561 1.00 1.00 ? 131 ASP A O    2  
ATOM 3508  C CB   . ASP A 1 111 ? 3.112   16.668  -12.628 1.00 1.00 ? 131 ASP A CB   2  
ATOM 3509  C CG   . ASP A 1 111 ? 1.782   16.922  -13.343 1.00 1.00 ? 131 ASP A CG   2  
ATOM 3510  O OD1  . ASP A 1 111 ? 1.744   17.849  -14.181 1.00 1.00 ? 131 ASP A OD1  2  
ATOM 3511  O OD2  . ASP A 1 111 ? 0.830   16.186  -13.005 1.00 1.00 ? 131 ASP A OD2  2  
ATOM 3512  H H    . ASP A 1 111 ? 3.959   15.641  -10.483 1.00 1.00 ? 131 ASP A H    2  
ATOM 3513  H HA   . ASP A 1 111 ? 4.087   18.287  -11.626 1.00 1.00 ? 131 ASP A HA   2  
ATOM 3514  H HB2  . ASP A 1 111 ? 3.901   16.897  -13.345 1.00 0.00 ? 131 ASP A HB2  2  
ATOM 3515  H HB3  . ASP A 1 111 ? 3.239   15.590  -12.475 1.00 1.00 ? 131 ASP A HB3  2  
ATOM 3516  N N    . GLY A 1 112 ? 1.095   17.449  -10.386 1.00 1.00 ? 132 GLY A N    2  
ATOM 3517  C CA   . GLY A 1 112 ? -0.178  17.855  -9.765  1.00 1.00 ? 132 GLY A CA   2  
ATOM 3518  C C    . GLY A 1 112 ? -0.016  18.926  -8.665  1.00 1.00 ? 132 GLY A C    2  
ATOM 3519  O O    . GLY A 1 112 ? 0.250   18.547  -7.518  1.00 1.00 ? 132 GLY A O    2  
ATOM 3520  H H    . GLY A 1 112 ? 1.153   16.489  -10.701 1.00 1.00 ? 132 GLY A H    2  
ATOM 3521  H HA2  . GLY A 1 112 ? -0.855  18.210  -10.541 1.00 1.00 ? 132 GLY A HA2  2  
ATOM 3522  H HA3  . GLY A 1 112 ? -0.635  16.975  -9.310  1.00 1.00 ? 132 GLY A HA3  2  
ATOM 3523  N N    . PRO A 1 113 ? -0.176  20.235  -8.977  1.00 1.00 ? 133 PRO A N    2  
ATOM 3524  C CA   . PRO A 1 113 ? 0.131   21.332  -8.054  1.00 1.00 ? 133 PRO A CA   2  
ATOM 3525  C C    . PRO A 1 113 ? -0.840  21.487  -6.868  1.00 1.00 ? 133 PRO A C    2  
ATOM 3526  O O    . PRO A 1 113 ? -1.979  21.001  -6.881  1.00 1.00 ? 133 PRO A O    2  
ATOM 3527  C CB   . PRO A 1 113 ? 0.147   22.603  -8.909  1.00 1.00 ? 133 PRO A CB   2  
ATOM 3528  C CG   . PRO A 1 113 ? -0.770  22.269  -10.085 1.00 1.00 ? 133 PRO A CG   2  
ATOM 3529  C CD   . PRO A 1 113 ? -0.642  20.760  -10.255 1.00 1.00 ? 133 PRO A CD   2  
ATOM 3530  H HA   . PRO A 1 113 ? 1.132   21.165  -7.653  1.00 1.00 ? 133 PRO A HA   2  
ATOM 3531  H HB2  . PRO A 1 113 ? -0.240  23.375  -8.244  1.00 0.00 ? 133 PRO A HB2  2  
ATOM 3532  H HB3  . PRO A 1 113 ? 1.161   22.767  -9.282  1.00 1.00 ? 133 PRO A HB3  2  
ATOM 3533  H HG2  . PRO A 1 113 ? -1.797  22.568  -9.873  1.00 0.00 ? 133 PRO A HG2  2  
ATOM 3534  H HG3  . PRO A 1 113 ? -0.448  22.788  -10.989 1.00 1.00 ? 133 PRO A HG3  2  
ATOM 3535  H HD2  . PRO A 1 113 ? -1.587  20.289  -10.526 1.00 0.00 ? 133 PRO A HD2  2  
ATOM 3536  H HD3  . PRO A 1 113 ? 0.096   20.551  -11.032 1.00 1.00 ? 133 PRO A HD3  2  
ATOM 3537  N N    . ARG A 1 114 ? -0.380  22.225  -5.844  1.00 1.00 ? 134 ARG A N    2  
ATOM 3538  C CA   . ARG A 1 114 ? -1.104  22.637  -4.622  1.00 1.00 ? 134 ARG A CA   2  
ATOM 3539  C C    . ARG A 1 114 ? -1.159  24.172  -4.502  1.00 1.00 ? 134 ARG A C    2  
ATOM 3540  O O    . ARG A 1 114 ? -0.383  24.771  -3.758  1.00 1.00 ? 134 ARG A O    2  
ATOM 3541  C CB   . ARG A 1 114 ? -0.497  21.939  -3.392  1.00 1.00 ? 134 ARG A CB   2  
ATOM 3542  C CG   . ARG A 1 114 ? -1.268  22.289  -2.108  1.00 1.00 ? 134 ARG A CG   2  
ATOM 3543  C CD   . ARG A 1 114 ? -0.393  22.731  -0.927  1.00 1.00 ? 134 ARG A CD   2  
ATOM 3544  N NE   . ARG A 1 114 ? 0.547   21.670  -0.528  1.00 1.00 ? 134 ARG A NE   2  
ATOM 3545  C CZ   . ARG A 1 114 ? 1.418   21.659  0.454   1.00 1.00 ? 134 ARG A CZ   2  
ATOM 3546  N NH1  . ARG A 1 114 ? 1.608   22.665  1.256   1.00 1.00 ? 134 ARG A NH1  2  
ATOM 3547  N NH2  . ARG A 1 114 ? 2.159   20.602  0.595   1.00 1.00 ? 134 ARG A NH2  2  
ATOM 3548  H H    . ARG A 1 114 ? 0.559   22.584  -5.962  1.00 1.00 ? 134 ARG A H    2  
ATOM 3549  H HA   . ARG A 1 114 ? -2.139  22.304  -4.683  1.00 1.00 ? 134 ARG A HA   2  
ATOM 3550  H HB2  . ARG A 1 114 ? -0.596  20.858  -3.485  1.00 0.00 ? 134 ARG A HB2  2  
ATOM 3551  H HB3  . ARG A 1 114 ? 0.563   22.187  -3.302  1.00 1.00 ? 134 ARG A HB3  2  
ATOM 3552  H HG2  . ARG A 1 114 ? -1.887  23.174  -2.256  1.00 0.00 ? 134 ARG A HG2  2  
ATOM 3553  H HG3  . ARG A 1 114 ? -1.919  21.468  -1.810  1.00 1.00 ? 134 ARG A HG3  2  
ATOM 3554  H HD2  . ARG A 1 114 ? 0.221   23.579  -1.229  1.00 0.00 ? 134 ARG A HD2  2  
ATOM 3555  H HD3  . ARG A 1 114 ? -1.032  23.023  -0.090  1.00 1.00 ? 134 ARG A HD3  2  
ATOM 3556  H HE   . ARG A 1 114 ? 0.587   20.846  -1.107  1.00 1.00 ? 134 ARG A HE   2  
ATOM 3557  H HH11 . ARG A 1 114 ? 1.060   23.528  1.137   1.00 0.00 ? 134 ARG A HH11 2  
ATOM 3558  H HH12 . ARG A 1 114 ? 2.306   22.599  2.010   1.00 0.00 ? 134 ARG A HH12 2  
ATOM 3559  H HH21 . ARG A 1 114 ? 2.050   19.808  -0.054  1.00 0.00 ? 134 ARG A HH21 2  
ATOM 3560  H HH22 . ARG A 1 114 ? 2.853   20.556  1.354   1.00 0.00 ? 134 ARG A HH22 2  
ATOM 3561  N N    . GLU A 1 115 ? -2.119  24.736  -5.245  1.00 1.00 ? 135 GLU A N    2  
ATOM 3562  C CA   . GLU A 1 115 ? -2.480  26.166  -5.390  1.00 1.00 ? 135 GLU A CA   2  
ATOM 3563  C C    . GLU A 1 115 ? -1.446  26.981  -6.202  1.00 1.00 ? 135 GLU A C    2  
ATOM 3564  O O    . GLU A 1 115 ? -1.669  27.058  -7.432  1.00 1.00 ? 135 GLU A O    2  
ATOM 3565  C CB   . GLU A 1 115 ? -2.851  26.775  -4.020  1.00 1.00 ? 135 GLU A CB   2  
ATOM 3566  C CG   . GLU A 1 115 ? -4.129  26.159  -3.420  1.00 1.00 ? 135 GLU A CG   2  
ATOM 3567  C CD   . GLU A 1 115 ? -4.344  26.537  -1.952  1.00 1.00 ? 135 GLU A CD   2  
ATOM 3568  O OE1  . GLU A 1 115 ? -4.893  27.636  -1.720  1.00 1.00 ? 135 GLU A OE1  2  
ATOM 3569  O OE2  . GLU A 1 115 ? -4.003  25.704  -1.080  1.00 1.00 ? 135 GLU A OE2  2  
ATOM 3570  O OXT  . GLU A 1 115 ? -0.464  27.495  -5.621  1.00 1.00 ? 135 GLU A OXT  2  
ATOM 3571  H H    . GLU A 1 115 ? -2.597  24.093  -5.852  1.00 1.00 ? 135 GLU A H    2  
ATOM 3572  H HA   . GLU A 1 115 ? -3.382  26.223  -5.999  1.00 1.00 ? 135 GLU A HA   2  
ATOM 3573  H HB2  . GLU A 1 115 ? -2.044  26.591  -3.311  1.00 0.00 ? 135 GLU A HB2  2  
ATOM 3574  H HB3  . GLU A 1 115 ? -3.002  27.850  -4.128  1.00 1.00 ? 135 GLU A HB3  2  
ATOM 3575  H HG2  . GLU A 1 115 ? -5.023  26.560  -3.895  1.00 0.00 ? 135 GLU A HG2  2  
ATOM 3576  H HG3  . GLU A 1 115 ? -4.146  25.073  -3.549  1.00 1.00 ? 135 GLU A HG3  2  
ATOM 3577  N N    . GLU A 1 1   ? -7.919  -12.085 -11.305 1.00 1.00 ? 21  GLU A N    3  
ATOM 3578  C CA   . GLU A 1 1   ? -7.747  -11.194 -10.124 1.00 1.00 ? 21  GLU A CA   3  
ATOM 3579  C C    . GLU A 1 1   ? -8.162  -9.745  -10.447 1.00 1.00 ? 21  GLU A C    3  
ATOM 3580  O O    . GLU A 1 1   ? -8.525  -9.481  -11.591 1.00 1.00 ? 21  GLU A O    3  
ATOM 3581  C CB   . GLU A 1 1   ? -6.326  -11.339 -9.547  1.00 1.00 ? 21  GLU A CB   3  
ATOM 3582  C CG   . GLU A 1 1   ? -6.219  -10.820 -8.110  1.00 1.00 ? 21  GLU A CG   3  
ATOM 3583  C CD   . GLU A 1 1   ? -5.034  -11.405 -7.352  1.00 1.00 ? 21  GLU A CD   3  
ATOM 3584  O OE1  . GLU A 1 1   ? -5.068  -12.583 -6.930  1.00 1.00 ? 21  GLU A OE1  3  
ATOM 3585  O OE2  . GLU A 1 1   ? -4.097  -10.632 -7.079  1.00 1.00 ? 21  GLU A OE2  3  
ATOM 3586  H H1   . GLU A 1 1   ? -8.181  -11.521 -12.126 1.00 0.00 ? 21  GLU A H1   3  
ATOM 3587  H H2   . GLU A 1 1   ? -7.035  -12.578 -11.495 1.00 0.00 ? 21  GLU A H2   3  
ATOM 3588  H HA   . GLU A 1 1   ? -8.443  -11.531 -9.358  1.00 1.00 ? 21  GLU A HA   3  
ATOM 3589  H HB2  . GLU A 1 1   ? -6.048  -12.386 -9.429  1.00 0.00 ? 21  GLU A HB2  3  
ATOM 3590  H HB3  . GLU A 1 1   ? -5.582  -10.875 -10.196 1.00 1.00 ? 21  GLU A HB3  3  
ATOM 3591  H HG2  . GLU A 1 1   ? -6.002  -9.753  -8.083  1.00 0.00 ? 21  GLU A HG2  3  
ATOM 3592  H HG3  . GLU A 1 1   ? -7.145  -10.974 -7.557  1.00 1.00 ? 21  GLU A HG3  3  
ATOM 3593  N N    . LEU A 1 2   ? -8.197  -8.851  -9.445  1.00 1.00 ? 22  LEU A N    3  
ATOM 3594  C CA   . LEU A 1 2   ? -8.709  -7.475  -9.464  1.00 1.00 ? 22  LEU A CA   3  
ATOM 3595  C C    . LEU A 1 2   ? -7.802  -6.698  -8.486  1.00 1.00 ? 22  LEU A C    3  
ATOM 3596  O O    . LEU A 1 2   ? -6.733  -7.223  -8.126  1.00 1.00 ? 22  LEU A O    3  
ATOM 3597  C CB   . LEU A 1 2   ? -10.239 -7.489  -9.192  1.00 1.00 ? 22  LEU A CB   3  
ATOM 3598  C CG   . LEU A 1 2   ? -11.122 -7.668  -10.466 1.00 1.00 ? 22  LEU A CG   3  
ATOM 3599  C CD1  . LEU A 1 2   ? -12.527 -8.219  -10.169 1.00 1.00 ? 22  LEU A CD1  3  
ATOM 3600  C CD2  . LEU A 1 2   ? -11.270 -6.360  -11.260 1.00 1.00 ? 22  LEU A CD2  3  
ATOM 3601  H H    . LEU A 1 2   ? -7.684  -8.936  -8.542  1.00 1.00 ? 22  LEU A H    3  
ATOM 3602  H HA   . LEU A 1 2   ? -8.516  -7.034  -10.449 1.00 1.00 ? 22  LEU A HA   3  
ATOM 3603  H HB2  . LEU A 1 2   ? -10.542 -8.364  -8.617  1.00 0.00 ? 22  LEU A HB2  3  
ATOM 3604  H HB3  . LEU A 1 2   ? -10.559 -6.612  -8.630  1.00 1.00 ? 22  LEU A HB3  3  
ATOM 3605  H HG   . LEU A 1 2   ? -10.645 -8.395  -11.121 1.00 1.00 ? 22  LEU A HG   3  
ATOM 3606  H HD11 . LEU A 1 2   ? -12.452 -9.200  -9.699  1.00 1.00 ? 22  LEU A HD11 3  
ATOM 3607  H HD12 . LEU A 1 2   ? -13.082 -7.542  -9.521  1.00 1.00 ? 22  LEU A HD12 3  
ATOM 3608  H HD13 . LEU A 1 2   ? -13.082 -8.338  -11.100 1.00 1.00 ? 22  LEU A HD13 3  
ATOM 3609  H HD21 . LEU A 1 2   ? -10.294 -5.893  -11.410 1.00 1.00 ? 22  LEU A HD21 3  
ATOM 3610  H HD22 . LEU A 1 2   ? -11.711 -6.565  -12.238 1.00 1.00 ? 22  LEU A HD22 3  
ATOM 3611  H HD23 . LEU A 1 2   ? -11.921 -5.672  -10.728 1.00 1.00 ? 22  LEU A HD23 3  
ATOM 3612  N N    . VAL A 1 3   ? -8.056  -5.425  -8.153  1.00 1.00 ? 23  VAL A N    3  
ATOM 3613  C CA   . VAL A 1 3   ? -7.177  -4.745  -7.167  1.00 1.00 ? 23  VAL A CA   3  
ATOM 3614  C C    . VAL A 1 3   ? -7.402  -5.353  -5.763  1.00 1.00 ? 23  VAL A C    3  
ATOM 3615  O O    . VAL A 1 3   ? -7.997  -4.720  -4.890  1.00 1.00 ? 23  VAL A O    3  
ATOM 3616  C CB   . VAL A 1 3   ? -7.281  -3.192  -7.208  1.00 1.00 ? 23  VAL A CB   3  
ATOM 3617  C CG1  . VAL A 1 3   ? -6.005  -2.595  -6.581  1.00 1.00 ? 23  VAL A CG1  3  
ATOM 3618  C CG2  . VAL A 1 3   ? -7.426  -2.615  -8.633  1.00 1.00 ? 23  VAL A CG2  3  
ATOM 3619  H H    . VAL A 1 3   ? -8.958  -5.012  -8.367  1.00 1.00 ? 23  VAL A H    3  
ATOM 3620  H HA   . VAL A 1 3   ? -6.142  -4.973  -7.428  1.00 1.00 ? 23  VAL A HA   3  
ATOM 3621  H HB   . VAL A 1 3   ? -8.149  -2.861  -6.635  1.00 1.00 ? 23  VAL A HB   3  
ATOM 3622  H HG11 . VAL A 1 3   ? -5.122  -2.982  -7.089  1.00 1.00 ? 23  VAL A HG11 3  
ATOM 3623  H HG12 . VAL A 1 3   ? -6.007  -1.510  -6.678  1.00 1.00 ? 23  VAL A HG12 3  
ATOM 3624  H HG13 . VAL A 1 3   ? -5.952  -2.857  -5.524  1.00 1.00 ? 23  VAL A HG13 3  
ATOM 3625  H HG21 . VAL A 1 3   ? -6.599  -2.952  -9.260  1.00 1.00 ? 23  VAL A HG21 3  
ATOM 3626  H HG22 . VAL A 1 3   ? -8.365  -2.948  -9.077  1.00 1.00 ? 23  VAL A HG22 3  
ATOM 3627  H HG23 . VAL A 1 3   ? -7.443  -1.521  -8.610  1.00 1.00 ? 23  VAL A HG23 3  
ATOM 3628  N N    . ARG A 1 4   ? -6.933  -6.604  -5.544  1.00 1.00 ? 24  ARG A N    3  
ATOM 3629  C CA   . ARG A 1 4   ? -6.884  -7.260  -4.216  1.00 1.00 ? 24  ARG A CA   3  
ATOM 3630  C C    . ARG A 1 4   ? -6.147  -6.460  -3.099  1.00 1.00 ? 24  ARG A C    3  
ATOM 3631  O O    . ARG A 1 4   ? -5.485  -5.448  -3.346  1.00 1.00 ? 24  ARG A O    3  
ATOM 3632  C CB   . ARG A 1 4   ? -6.310  -8.686  -4.349  1.00 1.00 ? 24  ARG A CB   3  
ATOM 3633  C CG   . ARG A 1 4   ? -4.804  -8.810  -4.624  1.00 1.00 ? 24  ARG A CG   3  
ATOM 3634  C CD   . ARG A 1 4   ? -4.117  -9.846  -3.719  1.00 1.00 ? 24  ARG A CD   3  
ATOM 3635  N NE   . ARG A 1 4   ? -3.955  -11.114 -4.430  1.00 1.00 ? 24  ARG A NE   3  
ATOM 3636  C CZ   . ARG A 1 4   ? -3.383  -12.237 -4.071  1.00 1.00 ? 24  ARG A CZ   3  
ATOM 3637  N NH1  . ARG A 1 4   ? -2.801  -12.440 -2.920  1.00 1.00 ? 24  ARG A NH1  3  
ATOM 3638  N NH2  . ARG A 1 4   ? -3.367  -13.205 -4.936  1.00 1.00 ? 24  ARG A NH2  3  
ATOM 3639  H H    . ARG A 1 4   ? -6.798  -7.178  -6.416  1.00 1.00 ? 24  ARG A H    3  
ATOM 3640  H HA   . ARG A 1 4   ? -7.908  -7.355  -3.857  1.00 1.00 ? 24  ARG A HA   3  
ATOM 3641  H HB2  . ARG A 1 4   ? -6.339  -9.211  -3.393  1.00 0.00 ? 24  ARG A HB2  3  
ATOM 3642  H HB3  . ARG A 1 4   ? -6.878  -9.273  -5.067  1.00 1.00 ? 24  ARG A HB3  3  
ATOM 3643  H HG2  . ARG A 1 4   ? -4.594  -9.210  -5.617  1.00 0.00 ? 24  ARG A HG2  3  
ATOM 3644  H HG3  . ARG A 1 4   ? -4.291  -7.853  -4.566  1.00 1.00 ? 24  ARG A HG3  3  
ATOM 3645  H HD2  . ARG A 1 4   ? -3.087  -9.573  -3.486  1.00 0.00 ? 24  ARG A HD2  3  
ATOM 3646  H HD3  . ARG A 1 4   ? -4.631  -9.965  -2.763  1.00 1.00 ? 24  ARG A HD3  3  
ATOM 3647  H HE   . ARG A 1 4   ? -4.065  -11.060 -5.450  1.00 1.00 ? 24  ARG A HE   3  
ATOM 3648  H HH11 . ARG A 1 4   ? -2.770  -11.686 -2.219  1.00 0.00 ? 24  ARG A HH11 3  
ATOM 3649  H HH12 . ARG A 1 4   ? -2.374  -13.354 -2.712  1.00 0.00 ? 24  ARG A HH12 3  
ATOM 3650  H HH21 . ARG A 1 4   ? -3.796  -13.072 -5.864  1.00 0.00 ? 24  ARG A HH21 3  
ATOM 3651  H HH22 . ARG A 1 4   ? -2.928  -14.105 -4.695  1.00 0.00 ? 24  ARG A HH22 3  
ATOM 3652  N N    . THR A 1 5   ? -6.240  -6.967  -1.860  1.00 1.00 ? 25  THR A N    3  
ATOM 3653  C CA   . THR A 1 5   ? -5.500  -6.485  -0.666  1.00 1.00 ? 25  THR A CA   3  
ATOM 3654  C C    . THR A 1 5   ? -4.425  -7.532  -0.299  1.00 1.00 ? 25  THR A C    3  
ATOM 3655  O O    . THR A 1 5   ? -3.713  -8.003  -1.187  1.00 1.00 ? 25  THR A O    3  
ATOM 3656  C CB   . THR A 1 5   ? -6.488  -6.072  0.460   1.00 1.00 ? 25  THR A CB   3  
ATOM 3657  O OG1  . THR A 1 5   ? -5.789  -5.625  1.598   1.00 1.00 ? 25  THR A OG1  3  
ATOM 3658  C CG2  . THR A 1 5   ? -7.451  -7.162  0.949   1.00 1.00 ? 25  THR A CG2  3  
ATOM 3659  H H    . THR A 1 5   ? -6.771  -7.827  -1.759  1.00 1.00 ? 25  THR A H    3  
ATOM 3660  H HA   . THR A 1 5   ? -4.938  -5.586  -0.930  1.00 1.00 ? 25  THR A HA   3  
ATOM 3661  H HB   . THR A 1 5   ? -7.083  -5.235  0.088   1.00 1.00 ? 25  THR A HB   3  
ATOM 3662  H HG1  . THR A 1 5   ? -5.149  -4.922  1.314   1.00 1.00 ? 25  THR A HG1  3  
ATOM 3663  H HG21 . THR A 1 5   ? -8.024  -7.544  0.112   1.00 1.00 ? 25  THR A HG21 3  
ATOM 3664  H HG22 . THR A 1 5   ? -6.924  -7.992  1.417   1.00 1.00 ? 25  THR A HG22 3  
ATOM 3665  H HG23 . THR A 1 5   ? -8.137  -6.732  1.676   1.00 1.00 ? 25  THR A HG23 3  
ATOM 3666  N N    . ASP A 1 6   ? -4.273  -7.884  0.983   1.00 1.00 ? 26  ASP A N    3  
ATOM 3667  C CA   . ASP A 1 6   ? -3.454  -8.996  1.494   1.00 1.00 ? 26  ASP A CA   3  
ATOM 3668  C C    . ASP A 1 6   ? -3.705  -10.306 0.694   1.00 1.00 ? 26  ASP A C    3  
ATOM 3669  O O    . ASP A 1 6   ? -2.763  -10.965 0.244   1.00 1.00 ? 26  ASP A O    3  
ATOM 3670  C CB   . ASP A 1 6   ? -3.771  -9.128  3.006   1.00 1.00 ? 26  ASP A CB   3  
ATOM 3671  C CG   . ASP A 1 6   ? -3.559  -10.501 3.648   1.00 1.00 ? 26  ASP A CG   3  
ATOM 3672  O OD1  . ASP A 1 6   ? -4.363  -11.416 3.341   1.00 1.00 ? 26  ASP A OD1  3  
ATOM 3673  O OD2  . ASP A 1 6   ? -2.614  -10.596 4.454   1.00 1.00 ? 26  ASP A OD2  3  
ATOM 3674  H H    . ASP A 1 6   ? -4.828  -7.336  1.635   1.00 1.00 ? 26  ASP A H    3  
ATOM 3675  H HA   . ASP A 1 6   ? -2.393  -8.744  1.398   1.00 1.00 ? 26  ASP A HA   3  
ATOM 3676  H HB2  . ASP A 1 6   ? -3.125  -8.431  3.541   1.00 0.00 ? 26  ASP A HB2  3  
ATOM 3677  H HB3  . ASP A 1 6   ? -4.781  -8.797  3.256   1.00 1.00 ? 26  ASP A HB3  3  
ATOM 3678  N N    . SER A 1 7   ? -4.987  -10.641 0.479   1.00 1.00 ? 27  SER A N    3  
ATOM 3679  C CA   . SER A 1 7   ? -5.476  -11.900 -0.102  1.00 1.00 ? 27  SER A CA   3  
ATOM 3680  C C    . SER A 1 7   ? -6.510  -11.652 -1.226  1.00 1.00 ? 27  SER A C    3  
ATOM 3681  O O    . SER A 1 7   ? -7.130  -10.582 -1.272  1.00 1.00 ? 27  SER A O    3  
ATOM 3682  C CB   . SER A 1 7   ? -6.081  -12.754 1.027   1.00 1.00 ? 27  SER A CB   3  
ATOM 3683  O OG   . SER A 1 7   ? -5.101  -13.215 1.935   1.00 1.00 ? 27  SER A OG   3  
ATOM 3684  H H    . SER A 1 7   ? -5.698  -9.988  0.787   1.00 1.00 ? 27  SER A H    3  
ATOM 3685  H HA   . SER A 1 7   ? -4.630  -12.453 -0.509  1.00 1.00 ? 27  SER A HA   3  
ATOM 3686  H HB2  . SER A 1 7   ? -6.802  -12.179 1.609   1.00 0.00 ? 27  SER A HB2  3  
ATOM 3687  H HB3  . SER A 1 7   ? -6.596  -13.625 0.624   1.00 1.00 ? 27  SER A HB3  3  
ATOM 3688  H HG   . SER A 1 7   ? -4.797  -12.435 2.538   1.00 1.00 ? 27  SER A HG   3  
ATOM 3689  N N    . PRO A 1 8   ? -6.738  -12.631 -2.139  1.00 1.00 ? 28  PRO A N    3  
ATOM 3690  C CA   . PRO A 1 8   ? -7.678  -12.501 -3.264  1.00 1.00 ? 28  PRO A CA   3  
ATOM 3691  C C    . PRO A 1 8   ? -9.185  -12.520 -2.902  1.00 1.00 ? 28  PRO A C    3  
ATOM 3692  O O    . PRO A 1 8   ? -10.010 -12.265 -3.776  1.00 1.00 ? 28  PRO A O    3  
ATOM 3693  C CB   . PRO A 1 8   ? -7.332  -13.647 -4.221  1.00 1.00 ? 28  PRO A CB   3  
ATOM 3694  C CG   . PRO A 1 8   ? -6.656  -14.703 -3.347  1.00 1.00 ? 28  PRO A CG   3  
ATOM 3695  C CD   . PRO A 1 8   ? -6.078  -13.931 -2.166  1.00 1.00 ? 28  PRO A CD   3  
ATOM 3696  H HA   . PRO A 1 8   ? -7.489  -11.558 -3.780  1.00 1.00 ? 28  PRO A HA   3  
ATOM 3697  H HB2  . PRO A 1 8   ? -8.288  -13.971 -4.633  1.00 0.00 ? 28  PRO A HB2  3  
ATOM 3698  H HB3  . PRO A 1 8   ? -6.623  -13.288 -4.969  1.00 1.00 ? 28  PRO A HB3  3  
ATOM 3699  H HG2  . PRO A 1 8   ? -7.378  -15.449 -3.014  1.00 0.00 ? 28  PRO A HG2  3  
ATOM 3700  H HG3  . PRO A 1 8   ? -5.868  -15.215 -3.901  1.00 1.00 ? 28  PRO A HG3  3  
ATOM 3701  H HD2  . PRO A 1 8   ? -6.258  -14.458 -1.230  1.00 0.00 ? 28  PRO A HD2  3  
ATOM 3702  H HD3  . PRO A 1 8   ? -5.004  -13.799 -2.300  1.00 1.00 ? 28  PRO A HD3  3  
ATOM 3703  N N    . ASN A 1 9   ? -9.550  -12.799 -1.637  1.00 1.00 ? 29  ASN A N    3  
ATOM 3704  C CA   . ASN A 1 9   ? -10.910 -12.792 -1.066  1.00 1.00 ? 29  ASN A CA   3  
ATOM 3705  C C    . ASN A 1 9   ? -11.565 -11.388 -0.988  1.00 1.00 ? 29  ASN A C    3  
ATOM 3706  O O    . ASN A 1 9   ? -12.772 -11.267 -1.218  1.00 1.00 ? 29  ASN A O    3  
ATOM 3707  C CB   . ASN A 1 9   ? -10.848 -13.482 0.323   1.00 1.00 ? 29  ASN A CB   3  
ATOM 3708  C CG   . ASN A 1 9   ? -9.956  -12.822 1.371   1.00 1.00 ? 29  ASN A CG   3  
ATOM 3709  O OD1  . ASN A 1 9   ? -9.016  -12.097 1.079   1.00 1.00 ? 29  ASN A OD1  3  
ATOM 3710  N ND2  . ASN A 1 9   ? -10.202 -13.068 2.633   1.00 1.00 ? 29  ASN A ND2  3  
ATOM 3711  H H    . ASN A 1 9   ? -8.803  -12.919 -0.967  1.00 1.00 ? 29  ASN A H    3  
ATOM 3712  H HA   . ASN A 1 9   ? -11.549 -13.401 -1.708  1.00 1.00 ? 29  ASN A HA   3  
ATOM 3713  H HB2  . ASN A 1 9   ? -11.823 -13.448 0.809   1.00 0.00 ? 29  ASN A HB2  3  
ATOM 3714  H HB3  . ASN A 1 9   ? -10.552 -14.524 0.216   1.00 1.00 ? 29  ASN A HB3  3  
ATOM 3715  H HD21 . ASN A 1 9   ? -10.979 -13.691 2.894   1.00 0.00 ? 29  ASN A HD21 3  
ATOM 3716  H HD22 . ASN A 1 9   ? -9.618  -12.637 3.364   1.00 0.00 ? 29  ASN A HD22 3  
ATOM 3717  N N    . PHE A 1 10  ? -10.768 -10.343 -0.702  1.00 1.00 ? 30  PHE A N    3  
ATOM 3718  C CA   . PHE A 1 10  ? -11.145 -8.924  -0.661  1.00 1.00 ? 30  PHE A CA   3  
ATOM 3719  C C    . PHE A 1 10  ? -10.618 -8.188  -1.920  1.00 1.00 ? 30  PHE A C    3  
ATOM 3720  O O    . PHE A 1 10  ? -9.408  -7.962  -2.036  1.00 1.00 ? 30  PHE A O    3  
ATOM 3721  C CB   . PHE A 1 10  ? -10.559 -8.315  0.632   1.00 1.00 ? 30  PHE A CB   3  
ATOM 3722  C CG   . PHE A 1 10  ? -11.166 -8.715  1.967   1.00 1.00 ? 30  PHE A CG   3  
ATOM 3723  C CD1  . PHE A 1 10  ? -12.386 -8.148  2.390   1.00 1.00 ? 30  PHE A CD1  3  
ATOM 3724  C CD2  . PHE A 1 10  ? -10.480 -9.607  2.825   1.00 1.00 ? 30  PHE A CD2  3  
ATOM 3725  C CE1  . PHE A 1 10  ? -12.953 -8.504  3.634   1.00 1.00 ? 30  PHE A CE1  3  
ATOM 3726  C CE2  . PHE A 1 10  ? -11.039 -9.959  4.074   1.00 1.00 ? 30  PHE A CE2  3  
ATOM 3727  C CZ   . PHE A 1 10  ? -12.282 -9.418  4.473   1.00 1.00 ? 30  PHE A CZ   3  
ATOM 3728  H H    . PHE A 1 10  ? -9.800  -10.567 -0.489  1.00 1.00 ? 30  PHE A H    3  
ATOM 3729  H HA   . PHE A 1 10  ? -12.229 -8.817  -0.629  1.00 1.00 ? 30  PHE A HA   3  
ATOM 3730  H HB2  . PHE A 1 10  ? -9.548  -8.681  0.809   1.00 0.00 ? 30  PHE A HB2  3  
ATOM 3731  H HB3  . PHE A 1 10  ? -10.519 -7.229  0.564   1.00 1.00 ? 30  PHE A HB3  3  
ATOM 3732  H HD1  . PHE A 1 10  ? -12.876 -7.427  1.760   1.00 1.00 ? 30  PHE A HD1  3  
ATOM 3733  H HD2  . PHE A 1 10  ? -9.522  -10.009 2.527   1.00 1.00 ? 30  PHE A HD2  3  
ATOM 3734  H HE1  . PHE A 1 10  ? -13.894 -8.074  3.942   1.00 1.00 ? 30  PHE A HE1  3  
ATOM 3735  H HE2  . PHE A 1 10  ? -10.519 -10.639 4.729   1.00 1.00 ? 30  PHE A HE2  3  
ATOM 3736  H HZ   . PHE A 1 10  ? -12.712 -9.690  5.427   1.00 1.00 ? 30  PHE A HZ   3  
ATOM 3737  N N    . LEU A 1 11  ? -11.509 -7.778  -2.845  1.00 1.00 ? 31  LEU A N    3  
ATOM 3738  C CA   . LEU A 1 11  ? -11.165 -7.075  -4.104  1.00 1.00 ? 31  LEU A CA   3  
ATOM 3739  C C    . LEU A 1 11  ? -11.598 -5.591  -4.182  1.00 1.00 ? 31  LEU A C    3  
ATOM 3740  O O    . LEU A 1 11  ? -12.575 -5.149  -3.569  1.00 1.00 ? 31  LEU A O    3  
ATOM 3741  C CB   . LEU A 1 11  ? -11.621 -7.911  -5.329  1.00 1.00 ? 31  LEU A CB   3  
ATOM 3742  C CG   . LEU A 1 11  ? -13.101 -7.887  -5.798  1.00 1.00 ? 31  LEU A CG   3  
ATOM 3743  C CD1  . LEU A 1 11  ? -13.411 -6.655  -6.669  1.00 1.00 ? 31  LEU A CD1  3  
ATOM 3744  C CD2  . LEU A 1 11  ? -13.457 -9.162  -6.580  1.00 1.00 ? 31  LEU A CD2  3  
ATOM 3745  H H    . LEU A 1 11  ? -12.504 -7.963  -2.680  1.00 1.00 ? 31  LEU A H    3  
ATOM 3746  H HA   . LEU A 1 11  ? -10.078 -7.059  -4.173  1.00 1.00 ? 31  LEU A HA   3  
ATOM 3747  H HB2  . LEU A 1 11  ? -11.231 -7.465  -6.244  1.00 0.00 ? 31  LEU A HB2  3  
ATOM 3748  H HB3  . LEU A 1 11  ? -11.246 -8.932  -5.239  1.00 1.00 ? 31  LEU A HB3  3  
ATOM 3749  H HG   . LEU A 1 11  ? -13.757 -7.867  -4.940  1.00 1.00 ? 31  LEU A HG   3  
ATOM 3750  H HD11 . LEU A 1 11  ? -12.658 -6.540  -7.447  1.00 1.00 ? 31  LEU A HD11 3  
ATOM 3751  H HD12 . LEU A 1 11  ? -14.392 -6.747  -7.136  1.00 1.00 ? 31  LEU A HD12 3  
ATOM 3752  H HD13 . LEU A 1 11  ? -13.433 -5.755  -6.060  1.00 1.00 ? 31  LEU A HD13 3  
ATOM 3753  H HD21 . LEU A 1 11  ? -12.792 -9.287  -7.431  1.00 1.00 ? 31  LEU A HD21 3  
ATOM 3754  H HD22 . LEU A 1 11  ? -13.362 -10.032 -5.929  1.00 1.00 ? 31  LEU A HD22 3  
ATOM 3755  H HD23 . LEU A 1 11  ? -14.490 -9.113  -6.931  1.00 1.00 ? 31  LEU A HD23 3  
ATOM 3756  N N    . CYS A 1 12  ? -10.882 -4.836  -5.027  1.00 1.00 ? 32  CYS A N    3  
ATOM 3757  C CA   . CYS A 1 12  ? -11.122 -3.432  -5.389  1.00 1.00 ? 32  CYS A CA   3  
ATOM 3758  C C    . CYS A 1 12  ? -11.064 -3.209  -6.918  1.00 1.00 ? 32  CYS A C    3  
ATOM 3759  O O    . CYS A 1 12  ? -10.599 -4.049  -7.701  1.00 1.00 ? 32  CYS A O    3  
ATOM 3760  C CB   . CYS A 1 12  ? -10.135 -2.473  -4.681  1.00 1.00 ? 32  CYS A CB   3  
ATOM 3761  S SG   . CYS A 1 12  ? -9.623  -2.924  -2.995  1.00 1.00 ? 32  CYS A SG   3  
ATOM 3762  H H    . CYS A 1 12  ? -10.051 -5.250  -5.422  1.00 1.00 ? 32  CYS A H    3  
ATOM 3763  H HA   . CYS A 1 12  ? -12.125 -3.167  -5.070  1.00 1.00 ? 32  CYS A HA   3  
ATOM 3764  H HB2  . CYS A 1 12  ? -9.174  -2.479  -5.195  1.00 0.00 ? 32  CYS A HB2  3  
ATOM 3765  H HB3  . CYS A 1 12  ? -10.532 -1.457  -4.686  1.00 1.00 ? 32  CYS A HB3  3  
ATOM 3766  H HG   . CYS A 1 12  ? -8.824  -3.923  -3.417  1.00 1.00 ? 32  CYS A HG   3  
ATOM 3767  N N    . SER A 1 13  ? -11.572 -2.058  -7.368  1.00 1.00 ? 33  SER A N    3  
ATOM 3768  C CA   . SER A 1 13  ? -11.667 -1.612  -8.753  1.00 1.00 ? 33  SER A CA   3  
ATOM 3769  C C    . SER A 1 13  ? -11.670 -0.077  -8.771  1.00 1.00 ? 33  SER A C    3  
ATOM 3770  O O    . SER A 1 13  ? -12.710 0.574   -8.630  1.00 1.00 ? 33  SER A O    3  
ATOM 3771  C CB   . SER A 1 13  ? -12.932 -2.211  -9.383  1.00 1.00 ? 33  SER A CB   3  
ATOM 3772  O OG   . SER A 1 13  ? -12.740 -3.599  -9.570  1.00 1.00 ? 33  SER A OG   3  
ATOM 3773  H H    . SER A 1 13  ? -12.201 -1.545  -6.749  1.00 1.00 ? 33  SER A H    3  
ATOM 3774  H HA   . SER A 1 13  ? -10.801 -1.969  -9.315  1.00 1.00 ? 33  SER A HA   3  
ATOM 3775  H HB2  . SER A 1 13  ? -13.790 -2.051  -8.728  1.00 0.00 ? 33  SER A HB2  3  
ATOM 3776  H HB3  . SER A 1 13  ? -13.132 -1.741  -10.344 1.00 1.00 ? 33  SER A HB3  3  
ATOM 3777  H HG   . SER A 1 13  ? -12.072 -3.901  -8.931  1.00 1.00 ? 33  SER A HG   3  
ATOM 3778  N N    . VAL A 1 14  ? -10.453 0.476   -8.887  1.00 1.00 ? 34  VAL A N    3  
ATOM 3779  C CA   . VAL A 1 14  ? -10.079 1.896   -9.027  1.00 1.00 ? 34  VAL A CA   3  
ATOM 3780  C C    . VAL A 1 14  ? -8.755  1.991   -9.830  1.00 1.00 ? 34  VAL A C    3  
ATOM 3781  O O    . VAL A 1 14  ? -7.927  1.076   -9.781  1.00 1.00 ? 34  VAL A O    3  
ATOM 3782  C CB   . VAL A 1 14  ? -9.993  2.583   -7.634  1.00 1.00 ? 34  VAL A CB   3  
ATOM 3783  C CG1  . VAL A 1 14  ? -8.807  2.102   -6.777  1.00 1.00 ? 34  VAL A CG1  3  
ATOM 3784  C CG2  . VAL A 1 14  ? -9.955  4.115   -7.754  1.00 1.00 ? 34  VAL A CG2  3  
ATOM 3785  H H    . VAL A 1 14  ? -9.674  -0.164  -8.964  1.00 1.00 ? 34  VAL A H    3  
ATOM 3786  H HA   . VAL A 1 14  ? -10.868 2.391   -9.598  1.00 1.00 ? 34  VAL A HA   3  
ATOM 3787  H HB   . VAL A 1 14  ? -10.906 2.340   -7.085  1.00 1.00 ? 34  VAL A HB   3  
ATOM 3788  H HG11 . VAL A 1 14  ? -8.841  1.017   -6.663  1.00 1.00 ? 34  VAL A HG11 3  
ATOM 3789  H HG12 . VAL A 1 14  ? -7.864  2.382   -7.245  1.00 1.00 ? 34  VAL A HG12 3  
ATOM 3790  H HG13 . VAL A 1 14  ? -8.853  2.549   -5.786  1.00 1.00 ? 34  VAL A HG13 3  
ATOM 3791  H HG21 . VAL A 1 14  ? -10.837 4.462   -8.297  1.00 1.00 ? 34  VAL A HG21 3  
ATOM 3792  H HG22 . VAL A 1 14  ? -9.977  4.563   -6.760  1.00 1.00 ? 34  VAL A HG22 3  
ATOM 3793  H HG23 . VAL A 1 14  ? -9.050  4.447   -8.264  1.00 1.00 ? 34  VAL A HG23 3  
ATOM 3794  N N    . LEU A 1 15  ? -8.566  3.080   -10.588 1.00 1.00 ? 35  LEU A N    3  
ATOM 3795  C CA   . LEU A 1 15  ? -7.417  3.302   -11.488 1.00 1.00 ? 35  LEU A CA   3  
ATOM 3796  C C    . LEU A 1 15  ? -6.137  3.873   -10.801 1.00 1.00 ? 35  LEU A C    3  
ATOM 3797  O O    . LEU A 1 15  ? -6.148  4.160   -9.598  1.00 1.00 ? 35  LEU A O    3  
ATOM 3798  C CB   . LEU A 1 15  ? -7.903  4.129   -12.704 1.00 1.00 ? 35  LEU A CB   3  
ATOM 3799  C CG   . LEU A 1 15  ? -8.098  5.663   -12.673 1.00 1.00 ? 35  LEU A CG   3  
ATOM 3800  C CD1  . LEU A 1 15  ? -8.461  6.240   -11.300 1.00 1.00 ? 35  LEU A CD1  3  
ATOM 3801  C CD2  . LEU A 1 15  ? -6.874  6.405   -13.219 1.00 1.00 ? 35  LEU A CD2  3  
ATOM 3802  H H    . LEU A 1 15  ? -9.272  3.797   -10.544 1.00 1.00 ? 35  LEU A H    3  
ATOM 3803  H HA   . LEU A 1 15  ? -7.129  2.322   -11.878 1.00 1.00 ? 35  LEU A HA   3  
ATOM 3804  H HB2  . LEU A 1 15  ? -7.107  4.227   -13.443 1.00 0.00 ? 35  LEU A HB2  3  
ATOM 3805  H HB3  . LEU A 1 15  ? -8.757  3.644   -13.183 1.00 1.00 ? 35  LEU A HB3  3  
ATOM 3806  H HG   . LEU A 1 15  ? -8.918  5.880   -13.358 1.00 1.00 ? 35  LEU A HG   3  
ATOM 3807  H HD11 . LEU A 1 15  ? -9.339  5.744   -10.907 1.00 1.00 ? 35  LEU A HD11 3  
ATOM 3808  H HD12 . LEU A 1 15  ? -7.643  6.100   -10.599 1.00 1.00 ? 35  LEU A HD12 3  
ATOM 3809  H HD13 . LEU A 1 15  ? -8.675  7.305   -11.387 1.00 1.00 ? 35  LEU A HD13 3  
ATOM 3810  H HD21 . LEU A 1 15  ? -6.570  5.975   -14.174 1.00 1.00 ? 35  LEU A HD21 3  
ATOM 3811  H HD22 . LEU A 1 15  ? -7.120  7.455   -13.377 1.00 1.00 ? 35  LEU A HD22 3  
ATOM 3812  H HD23 . LEU A 1 15  ? -6.044  6.351   -12.519 1.00 1.00 ? 35  LEU A HD23 3  
ATOM 3813  N N    . PRO A 1 16  ? -5.024  4.088   -11.544 1.00 1.00 ? 36  PRO A N    3  
ATOM 3814  C CA   . PRO A 1 16  ? -3.782  4.722   -11.066 1.00 1.00 ? 36  PRO A CA   3  
ATOM 3815  C C    . PRO A 1 16  ? -3.873  6.227   -10.677 1.00 1.00 ? 36  PRO A C    3  
ATOM 3816  O O    . PRO A 1 16  ? -2.970  7.005   -10.992 1.00 1.00 ? 36  PRO A O    3  
ATOM 3817  C CB   . PRO A 1 16  ? -2.735  4.458   -12.160 1.00 1.00 ? 36  PRO A CB   3  
ATOM 3818  C CG   . PRO A 1 16  ? -3.561  4.265   -13.430 1.00 1.00 ? 36  PRO A CG   3  
ATOM 3819  C CD   . PRO A 1 16  ? -4.864  3.658   -12.929 1.00 1.00 ? 36  PRO A CD   3  
ATOM 3820  H HA   . PRO A 1 16  ? -3.457  4.199   -10.165 1.00 1.00 ? 36  PRO A HA   3  
ATOM 3821  H HB2  . PRO A 1 16  ? -2.117  5.356   -12.162 1.00 0.00 ? 36  PRO A HB2  3  
ATOM 3822  H HB3  . PRO A 1 16  ? -2.198  3.536   -11.932 1.00 1.00 ? 36  PRO A HB3  3  
ATOM 3823  H HG2  . PRO A 1 16  ? -3.728  5.211   -13.945 1.00 0.00 ? 36  PRO A HG2  3  
ATOM 3824  H HG3  . PRO A 1 16  ? -3.061  3.594   -14.133 1.00 1.00 ? 36  PRO A HG3  3  
ATOM 3825  H HD2  . PRO A 1 16  ? -5.724  3.995   -13.509 1.00 0.00 ? 36  PRO A HD2  3  
ATOM 3826  H HD3  . PRO A 1 16  ? -4.799  2.570   -12.960 1.00 1.00 ? 36  PRO A HD3  3  
ATOM 3827  N N    . THR A 1 17  ? -4.880  6.635   -9.877  1.00 1.00 ? 37  THR A N    3  
ATOM 3828  C CA   . THR A 1 17  ? -5.097  7.977   -9.233  1.00 1.00 ? 37  THR A CA   3  
ATOM 3829  C C    . THR A 1 17  ? -4.017  8.356   -8.177  1.00 1.00 ? 37  THR A C    3  
ATOM 3830  O O    . THR A 1 17  ? -4.173  9.264   -7.366  1.00 1.00 ? 37  THR A O    3  
ATOM 3831  C CB   . THR A 1 17  ? -6.559  8.108   -8.713  1.00 1.00 ? 37  THR A CB   3  
ATOM 3832  O OG1  . THR A 1 17  ? -6.867  9.358   -8.129  1.00 1.00 ? 37  THR A OG1  3  
ATOM 3833  C CG2  . THR A 1 17  ? -6.971  7.067   -7.669  1.00 1.00 ? 37  THR A CG2  3  
ATOM 3834  H H    . THR A 1 17  ? -5.485  5.872   -9.588  1.00 1.00 ? 37  THR A H    3  
ATOM 3835  H HA   . THR A 1 17  ? -4.993  8.727   -10.017 1.00 1.00 ? 37  THR A HA   3  
ATOM 3836  H HB   . THR A 1 17  ? -7.214  7.997   -9.574  1.00 1.00 ? 37  THR A HB   3  
ATOM 3837  H HG1  . THR A 1 17  ? -6.389  10.054  -8.594  1.00 1.00 ? 37  THR A HG1  3  
ATOM 3838  H HG21 . THR A 1 17  ? -6.809  6.054   -8.032  1.00 1.00 ? 37  THR A HG21 3  
ATOM 3839  H HG22 . THR A 1 17  ? -6.395  7.225   -6.763  1.00 1.00 ? 37  THR A HG22 3  
ATOM 3840  H HG23 . THR A 1 17  ? -8.031  7.173   -7.442  1.00 1.00 ? 37  THR A HG23 3  
ATOM 3841  N N    . HIS A 1 18  ? -2.880  7.647   -8.218  1.00 1.00 ? 38  HIS A N    3  
ATOM 3842  C CA   . HIS A 1 18  ? -1.616  7.765   -7.478  1.00 1.00 ? 38  HIS A CA   3  
ATOM 3843  C C    . HIS A 1 18  ? -0.946  9.160   -7.573  1.00 1.00 ? 38  HIS A C    3  
ATOM 3844  O O    . HIS A 1 18  ? 0.121   9.327   -8.164  1.00 1.00 ? 38  HIS A O    3  
ATOM 3845  C CB   . HIS A 1 18  ? -0.717  6.581   -7.917  1.00 1.00 ? 38  HIS A CB   3  
ATOM 3846  C CG   . HIS A 1 18  ? 0.133   6.698   -9.167  1.00 1.00 ? 38  HIS A CG   3  
ATOM 3847  N ND1  . HIS A 1 18  ? -0.308  6.964   -10.447 1.00 1.00 ? 38  HIS A ND1  3  
ATOM 3848  C CD2  . HIS A 1 18  ? 1.498   6.743   -9.176  1.00 1.00 ? 38  HIS A CD2  3  
ATOM 3849  C CE1  . HIS A 1 18  ? 0.774   7.141   -11.230 1.00 1.00 ? 38  HIS A CE1  3  
ATOM 3850  N NE2  . HIS A 1 18  ? 1.891   7.014   -10.478 1.00 1.00 ? 38  HIS A NE2  3  
ATOM 3851  H H    . HIS A 1 18  ? -2.930  6.946   -8.941  1.00 1.00 ? 38  HIS A H    3  
ATOM 3852  H HA   . HIS A 1 18  ? -1.832  7.614   -6.421  1.00 1.00 ? 38  HIS A HA   3  
ATOM 3853  H HB2  . HIS A 1 18  ? 0.179   6.491   -7.302  1.00 0.00 ? 38  HIS A HB2  3  
ATOM 3854  H HB3  . HIS A 1 18  ? -1.233  5.619   -7.853  1.00 1.00 ? 38  HIS A HB3  3  
ATOM 3855  H HD1  . HIS A 1 18  ? -1.288  7.080   -10.722 1.00 1.00 ? 38  HIS A HD1  3  
ATOM 3856  H HD2  . HIS A 1 18  ? 2.125   6.673   -8.296  1.00 1.00 ? 38  HIS A HD2  3  
ATOM 3857  H HE1  . HIS A 1 18  ? 0.745   7.405   -12.282 1.00 1.00 ? 38  HIS A HE1  3  
ATOM 3858  H HE2  . HIS A 1 18  ? 2.838   7.184   -10.801 1.00 1.00 ? 38  HIS A HE2  3  
ATOM 3859  N N    . TRP A 1 19  ? -1.550  10.177  -6.951  1.00 1.00 ? 39  TRP A N    3  
ATOM 3860  C CA   . TRP A 1 19  ? -1.095  11.576  -6.885  1.00 1.00 ? 39  TRP A CA   3  
ATOM 3861  C C    . TRP A 1 19  ? -1.628  12.322  -5.642  1.00 1.00 ? 39  TRP A C    3  
ATOM 3862  O O    . TRP A 1 19  ? -2.542  11.845  -4.972  1.00 1.00 ? 39  TRP A O    3  
ATOM 3863  C CB   . TRP A 1 19  ? -1.467  12.305  -8.192  1.00 1.00 ? 39  TRP A CB   3  
ATOM 3864  C CG   . TRP A 1 19  ? -2.913  12.575  -8.456  1.00 1.00 ? 39  TRP A CG   3  
ATOM 3865  C CD1  . TRP A 1 19  ? -3.679  13.409  -7.721  1.00 1.00 ? 39  TRP A CD1  3  
ATOM 3866  C CD2  . TRP A 1 19  ? -3.779  12.054  -9.512  1.00 1.00 ? 39  TRP A CD2  3  
ATOM 3867  N NE1  . TRP A 1 19  ? -4.959  13.423  -8.212  1.00 1.00 ? 39  TRP A NE1  3  
ATOM 3868  C CE2  . TRP A 1 19  ? -5.073  12.642  -9.343  1.00 1.00 ? 39  TRP A CE2  3  
ATOM 3869  C CE3  . TRP A 1 19  ? -3.605  11.173  -10.611 1.00 1.00 ? 39  TRP A CE3  3  
ATOM 3870  C CZ2  . TRP A 1 19  ? -6.134  12.386  -10.227 1.00 1.00 ? 39  TRP A CZ2  3  
ATOM 3871  C CZ3  . TRP A 1 19  ? -4.671  10.897  -11.500 1.00 1.00 ? 39  TRP A CZ3  3  
ATOM 3872  C CH2  . TRP A 1 19  ? -5.929  11.507  -11.313 1.00 1.00 ? 39  TRP A CH2  3  
ATOM 3873  H H    . TRP A 1 19  ? -2.440  9.986   -6.510  1.00 1.00 ? 39  TRP A H    3  
ATOM 3874  H HA   . TRP A 1 19  ? -0.014  11.577  -6.812  1.00 1.00 ? 39  TRP A HA   3  
ATOM 3875  H HB2  . TRP A 1 19  ? -1.131  13.341  -8.178  1.00 0.00 ? 39  TRP A HB2  3  
ATOM 3876  H HB3  . TRP A 1 19  ? -1.012  11.822  -9.061  1.00 1.00 ? 39  TRP A HB3  3  
ATOM 3877  H HD1  . TRP A 1 19  ? -3.351  13.963  -6.857  1.00 1.00 ? 39  TRP A HD1  3  
ATOM 3878  H HE1  . TRP A 1 19  ? -5.690  13.922  -7.723  1.00 1.00 ? 39  TRP A HE1  3  
ATOM 3879  H HE3  . TRP A 1 19  ? -2.631  10.736  -10.783 1.00 1.00 ? 39  TRP A HE3  3  
ATOM 3880  H HZ2  . TRP A 1 19  ? -7.081  12.881  -10.076 1.00 1.00 ? 39  TRP A HZ2  3  
ATOM 3881  H HZ3  . TRP A 1 19  ? -4.515  10.241  -12.347 1.00 1.00 ? 39  TRP A HZ3  3  
ATOM 3882  H HH2  . TRP A 1 19  ? -6.727  11.317  -12.019 1.00 1.00 ? 39  TRP A HH2  3  
ATOM 3883  N N    . ARG A 1 20  ? -1.094  13.525  -5.378  1.00 1.00 ? 40  ARG A N    3  
ATOM 3884  C CA   . ARG A 1 20  ? -1.387  14.409  -4.227  1.00 1.00 ? 40  ARG A CA   3  
ATOM 3885  C C    . ARG A 1 20  ? -2.837  14.922  -4.289  1.00 1.00 ? 40  ARG A C    3  
ATOM 3886  O O    . ARG A 1 20  ? -3.183  15.646  -5.216  1.00 1.00 ? 40  ARG A O    3  
ATOM 3887  C CB   . ARG A 1 20  ? -0.368  15.557  -4.217  1.00 1.00 ? 40  ARG A CB   3  
ATOM 3888  C CG   . ARG A 1 20  ? -0.264  16.324  -2.897  1.00 1.00 ? 40  ARG A CG   3  
ATOM 3889  C CD   . ARG A 1 20  ? 1.085   15.973  -2.270  1.00 1.00 ? 40  ARG A CD   3  
ATOM 3890  N NE   . ARG A 1 20  ? 0.986   15.216  -1.007  1.00 1.00 ? 40  ARG A NE   3  
ATOM 3891  C CZ   . ARG A 1 20  ? 1.850   14.327  -0.559  1.00 1.00 ? 40  ARG A CZ   3  
ATOM 3892  N NH1  . ARG A 1 20  ? 2.885   13.947  -1.241  1.00 1.00 ? 40  ARG A NH1  3  
ATOM 3893  N NH2  . ARG A 1 20  ? 1.713   13.823  0.629   1.00 1.00 ? 40  ARG A NH2  3  
ATOM 3894  H H    . ARG A 1 20  ? -0.469  13.854  -6.097  1.00 1.00 ? 40  ARG A H    3  
ATOM 3895  H HA   . ARG A 1 20  ? -1.252  13.834  -3.311  1.00 1.00 ? 40  ARG A HA   3  
ATOM 3896  H HB2  . ARG A 1 20  ? 0.650   15.184  -4.327  1.00 0.00 ? 40  ARG A HB2  3  
ATOM 3897  H HB3  . ARG A 1 20  ? -0.551  16.257  -5.031  1.00 1.00 ? 40  ARG A HB3  3  
ATOM 3898  H HG2  . ARG A 1 20  ? -0.249  17.403  -3.044  1.00 0.00 ? 40  ARG A HG2  3  
ATOM 3899  H HG3  . ARG A 1 20  ? -1.102  16.114  -2.227  1.00 1.00 ? 40  ARG A HG3  3  
ATOM 3900  H HD2  . ARG A 1 20  ? 1.627   15.277  -2.910  1.00 0.00 ? 40  ARG A HD2  3  
ATOM 3901  H HD3  . ARG A 1 20  ? 1.687   16.875  -2.145  1.00 1.00 ? 40  ARG A HD3  3  
ATOM 3902  H HE   . ARG A 1 20  ? 0.237   15.442  -0.359  1.00 1.00 ? 40  ARG A HE   3  
ATOM 3903  H HH11 . ARG A 1 20  ? 3.060   14.344  -2.175  1.00 0.00 ? 40  ARG A HH11 3  
ATOM 3904  H HH12 . ARG A 1 20  ? 3.532   13.249  -0.850  1.00 0.00 ? 40  ARG A HH12 3  
ATOM 3905  H HH21 . ARG A 1 20  ? 0.928   14.119  1.227   1.00 0.00 ? 40  ARG A HH21 3  
ATOM 3906  H HH22 . ARG A 1 20  ? 2.391   13.129  0.975   1.00 0.00 ? 40  ARG A HH22 3  
ATOM 3907  N N    . CYS A 1 21  ? -3.670  14.556  -3.303  1.00 1.00 ? 41  CYS A N    3  
ATOM 3908  C CA   . CYS A 1 21  ? -5.125  14.751  -3.269  1.00 1.00 ? 41  CYS A CA   3  
ATOM 3909  C C    . CYS A 1 21  ? -5.794  14.046  -4.470  1.00 1.00 ? 41  CYS A C    3  
ATOM 3910  O O    . CYS A 1 21  ? -6.046  14.662  -5.511  1.00 1.00 ? 41  CYS A O    3  
ATOM 3911  C CB   . CYS A 1 21  ? -5.447  16.250  -3.124  1.00 1.00 ? 41  CYS A CB   3  
ATOM 3912  S SG   . CYS A 1 21  ? -7.200  16.541  -2.738  1.00 1.00 ? 41  CYS A SG   3  
ATOM 3913  H H    . CYS A 1 21  ? -3.255  14.073  -2.514  1.00 1.00 ? 41  CYS A H    3  
ATOM 3914  H HA   . CYS A 1 21  ? -5.500  14.254  -2.375  1.00 1.00 ? 41  CYS A HA   3  
ATOM 3915  H HB2  . CYS A 1 21  ? -4.874  16.666  -2.296  1.00 0.00 ? 41  CYS A HB2  3  
ATOM 3916  H HB3  . CYS A 1 21  ? -5.180  16.770  -4.049  1.00 1.00 ? 41  CYS A HB3  3  
ATOM 3917  H HG   . CYS A 1 21  ? -7.094  17.874  -2.784  1.00 1.00 ? 41  CYS A HG   3  
ATOM 3918  N N    . ASN A 1 22  ? -6.066  12.735  -4.328  1.00 1.00 ? 42  ASN A N    3  
ATOM 3919  C CA   . ASN A 1 22  ? -6.591  11.896  -5.416  1.00 1.00 ? 42  ASN A CA   3  
ATOM 3920  C C    . ASN A 1 22  ? -7.931  12.440  -6.005  1.00 1.00 ? 42  ASN A C    3  
ATOM 3921  O O    . ASN A 1 22  ? -8.122  12.418  -7.220  1.00 1.00 ? 42  ASN A O    3  
ATOM 3922  C CB   . ASN A 1 22  ? -6.635  10.424  -4.941  1.00 1.00 ? 42  ASN A CB   3  
ATOM 3923  C CG   . ASN A 1 22  ? -8.024  9.882   -4.687  1.00 1.00 ? 42  ASN A CG   3  
ATOM 3924  O OD1  . ASN A 1 22  ? -8.612  10.058  -3.630  1.00 1.00 ? 42  ASN A OD1  3  
ATOM 3925  N ND2  . ASN A 1 22  ? -8.612  9.332   -5.720  1.00 1.00 ? 42  ASN A ND2  3  
ATOM 3926  H H    . ASN A 1 22  ? -5.872  12.279  -3.436  1.00 1.00 ? 42  ASN A H    3  
ATOM 3927  H HA   . ASN A 1 22  ? -5.857  11.915  -6.222  1.00 1.00 ? 42  ASN A HA   3  
ATOM 3928  H HB2  . ASN A 1 22  ? -6.347  9.786   -5.776  1.00 0.00 ? 42  ASN A HB2  3  
ATOM 3929  H HB3  . ASN A 1 22  ? -5.966  10.202  -4.109  1.00 1.00 ? 42  ASN A HB3  3  
ATOM 3930  H HD21 . ASN A 1 22  ? -8.126  9.291   -6.627  1.00 0.00 ? 42  ASN A HD21 3  
ATOM 3931  H HD22 . ASN A 1 22  ? -9.559  8.940   -5.625  1.00 0.00 ? 42  ASN A HD22 3  
ATOM 3932  N N    . LYS A 1 23  ? -8.805  12.971  -5.119  1.00 1.00 ? 43  LYS A N    3  
ATOM 3933  C CA   . LYS A 1 23  ? -10.161 13.539  -5.300  1.00 1.00 ? 43  LYS A CA   3  
ATOM 3934  C C    . LYS A 1 23  ? -11.266 12.494  -5.613  1.00 1.00 ? 43  LYS A C    3  
ATOM 3935  O O    . LYS A 1 23  ? -11.001 11.379  -6.067  1.00 1.00 ? 43  LYS A O    3  
ATOM 3936  C CB   . LYS A 1 23  ? -10.085 14.697  -6.326  1.00 1.00 ? 43  LYS A CB   3  
ATOM 3937  C CG   . LYS A 1 23  ? -11.060 15.864  -6.095  1.00 1.00 ? 43  LYS A CG   3  
ATOM 3938  C CD   . LYS A 1 23  ? -10.865 16.997  -7.115  1.00 1.00 ? 43  LYS A CD   3  
ATOM 3939  C CE   . LYS A 1 23  ? -11.640 18.260  -6.720  1.00 1.00 ? 43  LYS A CE   3  
ATOM 3940  N NZ   . LYS A 1 23  ? -11.658 19.280  -7.791  1.00 1.00 ? 43  LYS A NZ   3  
ATOM 3941  H H    . LYS A 1 23  ? -8.449  12.910  -4.178  1.00 1.00 ? 43  LYS A H    3  
ATOM 3942  H HA   . LYS A 1 23  ? -10.428 13.974  -4.337  1.00 1.00 ? 43  LYS A HA   3  
ATOM 3943  H HB2  . LYS A 1 23  ? -9.151  15.250  -6.227  1.00 0.00 ? 43  LYS A HB2  3  
ATOM 3944  H HB3  . LYS A 1 23  ? -10.144 14.321  -7.350  1.00 1.00 ? 43  LYS A HB3  3  
ATOM 3945  H HG2  . LYS A 1 23  ? -12.080 15.495  -6.198  1.00 0.00 ? 43  LYS A HG2  3  
ATOM 3946  H HG3  . LYS A 1 23  ? -10.903 16.258  -5.091  1.00 1.00 ? 43  LYS A HG3  3  
ATOM 3947  H HD2  . LYS A 1 23  ? -9.811  17.270  -7.151  1.00 0.00 ? 43  LYS A HD2  3  
ATOM 3948  H HD3  . LYS A 1 23  ? -11.191 16.652  -8.100  1.00 1.00 ? 43  LYS A HD3  3  
ATOM 3949  H HE2  . LYS A 1 23  ? -12.690 18.013  -6.567  1.00 0.00 ? 43  LYS A HE2  3  
ATOM 3950  H HE3  . LYS A 1 23  ? -11.228 18.668  -5.795  1.00 1.00 ? 43  LYS A HE3  3  
ATOM 3951  H HZ1  . LYS A 1 23  ? -10.784 19.824  -7.762  1.00 0.00 ? 43  LYS A HZ1  3  
ATOM 3952  H HZ2  . LYS A 1 23  ? -11.743 18.816  -8.707  1.00 0.00 ? 43  LYS A HZ2  3  
ATOM 3953  N N    . THR A 1 24  ? -12.537 12.873  -5.385  1.00 1.00 ? 44  THR A N    3  
ATOM 3954  C CA   . THR A 1 24  ? -13.752 12.080  -5.725  1.00 1.00 ? 44  THR A CA   3  
ATOM 3955  C C    . THR A 1 24  ? -13.977 12.091  -7.256  1.00 1.00 ? 44  THR A C    3  
ATOM 3956  O O    . THR A 1 24  ? -14.904 12.732  -7.750  1.00 1.00 ? 44  THR A O    3  
ATOM 3957  C CB   . THR A 1 24  ? -15.030 12.552  -4.971  1.00 1.00 ? 44  THR A CB   3  
ATOM 3958  O OG1  . THR A 1 24  ? -14.807 12.650  -3.584  1.00 1.00 ? 44  THR A OG1  3  
ATOM 3959  C CG2  . THR A 1 24  ? -16.196 11.556  -5.117  1.00 1.00 ? 44  THR A CG2  3  
ATOM 3960  H H    . THR A 1 24  ? -12.676 13.786  -4.984  1.00 1.00 ? 44  THR A H    3  
ATOM 3961  H HA   . THR A 1 24  ? -13.577 11.047  -5.415  1.00 1.00 ? 44  THR A HA   3  
ATOM 3962  H HB   . THR A 1 24  ? -15.346 13.533  -5.322  1.00 1.00 ? 44  THR A HB   3  
ATOM 3963  H HG1  . THR A 1 24  ? -15.615 12.325  -3.176  1.00 1.00 ? 44  THR A HG1  3  
ATOM 3964  H HG21 . THR A 1 24  ? -15.891 10.546  -4.849  1.00 1.00 ? 44  THR A HG21 3  
ATOM 3965  H HG22 . THR A 1 24  ? -17.055 11.834  -4.503  1.00 1.00 ? 44  THR A HG22 3  
ATOM 3966  H HG23 . THR A 1 24  ? -16.539 11.549  -6.153  1.00 1.00 ? 44  THR A HG23 3  
ATOM 3967  N N    . LEU A 1 25  ? -13.091 11.435  -8.023  1.00 1.00 ? 45  LEU A N    3  
ATOM 3968  C CA   . LEU A 1 25  ? -13.130 11.379  -9.499  1.00 1.00 ? 45  LEU A CA   3  
ATOM 3969  C C    . LEU A 1 25  ? -14.340 10.569  -10.065 1.00 1.00 ? 45  LEU A C    3  
ATOM 3970  O O    . LEU A 1 25  ? -14.880 9.699   -9.366  1.00 1.00 ? 45  LEU A O    3  
ATOM 3971  C CB   . LEU A 1 25  ? -11.789 10.802  -9.998  1.00 1.00 ? 45  LEU A CB   3  
ATOM 3972  C CG   . LEU A 1 25  ? -10.509 11.592  -9.654  1.00 1.00 ? 45  LEU A CG   3  
ATOM 3973  C CD1  . LEU A 1 25  ? -9.332  10.626  -9.779  1.00 1.00 ? 45  LEU A CD1  3  
ATOM 3974  C CD2  . LEU A 1 25  ? -10.303 12.809  -10.570 1.00 1.00 ? 45  LEU A CD2  3  
ATOM 3975  H H    . LEU A 1 25  ? -12.292 11.036  -7.541  1.00 1.00 ? 45  LEU A H    3  
ATOM 3976  H HA   . LEU A 1 25  ? -13.218 12.405  -9.865  1.00 1.00 ? 45  LEU A HA   3  
ATOM 3977  H HB2  . LEU A 1 25  ? -11.541 9.871   -9.489  1.00 0.00 ? 45  LEU A HB2  3  
ATOM 3978  H HB3  . LEU A 1 25  ? -11.818 10.593  -11.070 1.00 1.00 ? 45  LEU A HB3  3  
ATOM 3979  H HG   . LEU A 1 25  ? -10.558 11.945  -8.624  1.00 1.00 ? 45  LEU A HG   3  
ATOM 3980  H HD11 . LEU A 1 25  ? -9.486  9.775   -9.116  1.00 1.00 ? 45  LEU A HD11 3  
ATOM 3981  H HD12 . LEU A 1 25  ? -9.226  10.277  -10.806 1.00 1.00 ? 45  LEU A HD12 3  
ATOM 3982  H HD13 . LEU A 1 25  ? -8.418  11.123  -9.470  1.00 1.00 ? 45  LEU A HD13 3  
ATOM 3983  H HD21 . LEU A 1 25  ? -10.222 12.489  -11.609 1.00 1.00 ? 45  LEU A HD21 3  
ATOM 3984  H HD22 . LEU A 1 25  ? -11.142 13.498  -10.471 1.00 1.00 ? 45  LEU A HD22 3  
ATOM 3985  H HD23 . LEU A 1 25  ? -9.393  13.336  -10.285 1.00 1.00 ? 45  LEU A HD23 3  
ATOM 3986  N N    . PRO A 1 26  ? -14.741 10.769  -11.351 1.00 1.00 ? 46  PRO A N    3  
ATOM 3987  C CA   . PRO A 1 26  ? -15.884 10.082  -11.984 1.00 1.00 ? 46  PRO A CA   3  
ATOM 3988  C C    . PRO A 1 26  ? -15.730 8.564   -12.219 1.00 1.00 ? 46  PRO A C    3  
ATOM 3989  O O    . PRO A 1 26  ? -16.712 7.918   -12.571 1.00 1.00 ? 46  PRO A O    3  
ATOM 3990  C CB   . PRO A 1 26  ? -16.125 10.790  -13.321 1.00 1.00 ? 46  PRO A CB   3  
ATOM 3991  C CG   . PRO A 1 26  ? -14.776 11.422  -13.657 1.00 1.00 ? 46  PRO A CG   3  
ATOM 3992  C CD   . PRO A 1 26  ? -14.146 11.712  -12.295 1.00 1.00 ? 46  PRO A CD   3  
ATOM 3993  H HA   . PRO A 1 26  ? -16.773 10.209  -11.363 1.00 1.00 ? 46  PRO A HA   3  
ATOM 3994  H HB2  . PRO A 1 26  ? -16.424 9.989   -13.997 1.00 0.00 ? 46  PRO A HB2  3  
ATOM 3995  H HB3  . PRO A 1 26  ? -16.871 11.576  -13.184 1.00 1.00 ? 46  PRO A HB3  3  
ATOM 3996  H HG2  . PRO A 1 26  ? -14.167 10.734  -14.242 1.00 0.00 ? 46  PRO A HG2  3  
ATOM 3997  H HG3  . PRO A 1 26  ? -14.916 12.337  -14.236 1.00 1.00 ? 46  PRO A HG3  3  
ATOM 3998  H HD2  . PRO A 1 26  ? -13.063 11.588  -12.290 1.00 0.00 ? 46  PRO A HD2  3  
ATOM 3999  H HD3  . PRO A 1 26  ? -14.402 12.727  -11.997 1.00 1.00 ? 46  PRO A HD3  3  
ATOM 4000  N N    . ILE A 1 27  ? -14.535 7.983   -12.005 1.00 1.00 ? 47  ILE A N    3  
ATOM 4001  C CA   . ILE A 1 27  ? -14.206 6.548   -12.197 1.00 1.00 ? 47  ILE A CA   3  
ATOM 4002  C C    . ILE A 1 27  ? -14.935 5.564   -11.251 1.00 1.00 ? 47  ILE A C    3  
ATOM 4003  O O    . ILE A 1 27  ? -14.927 4.363   -11.519 1.00 1.00 ? 47  ILE A O    3  
ATOM 4004  C CB   . ILE A 1 27  ? -12.673 6.295   -12.081 1.00 1.00 ? 47  ILE A CB   3  
ATOM 4005  C CG1  . ILE A 1 27  ? -12.194 6.177   -10.612 1.00 1.00 ? 47  ILE A CG1  3  
ATOM 4006  C CG2  . ILE A 1 27  ? -11.815 7.261   -12.922 1.00 1.00 ? 47  ILE A CG2  3  
ATOM 4007  C CD1  . ILE A 1 27  ? -11.856 7.437   -9.808  1.00 1.00 ? 47  ILE A CD1  3  
ATOM 4008  H H    . ILE A 1 27  ? -13.798 8.592   -11.690 1.00 1.00 ? 47  ILE A H    3  
ATOM 4009  H HA   . ILE A 1 27  ? -14.510 6.282   -13.212 1.00 1.00 ? 47  ILE A HA   3  
ATOM 4010  H HB   . ILE A 1 27  ? -12.510 5.305   -12.513 1.00 1.00 ? 47  ILE A HB   3  
ATOM 4011  H HG12 . ILE A 1 27  ? -13.013 5.895   -9.949  1.00 0.00 ? 47  ILE A HG12 3  
ATOM 4012  H HG13 . ILE A 1 27  ? -11.415 5.422   -10.510 1.00 1.00 ? 47  ILE A HG13 3  
ATOM 4013  H HG21 . ILE A 1 27  ? -12.124 7.219   -13.967 1.00 1.00 ? 47  ILE A HG21 3  
ATOM 4014  H HG22 . ILE A 1 27  ? -11.909 8.284   -12.563 1.00 1.00 ? 47  ILE A HG22 3  
ATOM 4015  H HG23 . ILE A 1 27  ? -10.770 6.973   -12.859 1.00 1.00 ? 47  ILE A HG23 3  
ATOM 4016  H HD11 . ILE A 1 27  ? -12.704 8.118   -9.818  1.00 1.00 ? 47  ILE A HD11 3  
ATOM 4017  H HD12 . ILE A 1 27  ? -11.642 7.155   -8.777  1.00 1.00 ? 47  ILE A HD12 3  
ATOM 4018  H HD13 . ILE A 1 27  ? -10.979 7.925   -10.233 1.00 1.00 ? 47  ILE A HD13 3  
ATOM 4019  N N    . ALA A 1 28  ? -15.548 6.074   -10.167 1.00 1.00 ? 48  ALA A N    3  
ATOM 4020  C CA   . ALA A 1 28  ? -16.128 5.340   -9.033  1.00 1.00 ? 48  ALA A CA   3  
ATOM 4021  C C    . ALA A 1 28  ? -15.058 4.588   -8.183  1.00 1.00 ? 48  ALA A C    3  
ATOM 4022  O O    . ALA A 1 28  ? -13.865 4.590   -8.494  1.00 1.00 ? 48  ALA A O    3  
ATOM 4023  C CB   . ALA A 1 28  ? -17.329 4.494   -9.523  1.00 1.00 ? 48  ALA A CB   3  
ATOM 4024  H H    . ALA A 1 28  ? -15.529 7.080   -10.109 1.00 1.00 ? 48  ALA A H    3  
ATOM 4025  H HA   . ALA A 1 28  ? -16.545 6.091   -8.368  1.00 1.00 ? 48  ALA A HA   3  
ATOM 4026  H HB1  . ALA A 1 28  ? -18.008 5.120   -10.104 1.00 1.00 ? 48  ALA A HB1  3  
ATOM 4027  H HB2  . ALA A 1 28  ? -16.995 3.667   -10.147 1.00 1.00 ? 48  ALA A HB2  3  
ATOM 4028  H HB3  . ALA A 1 28  ? -17.883 4.089   -8.679  1.00 1.00 ? 48  ALA A HB3  3  
ATOM 4029  N N    . PHE A 1 29  ? -15.483 3.964   -7.078  1.00 1.00 ? 49  PHE A N    3  
ATOM 4030  C CA   . PHE A 1 29  ? -14.661 3.121   -6.201  1.00 1.00 ? 49  PHE A CA   3  
ATOM 4031  C C    . PHE A 1 29  ? -15.386 1.800   -5.923  1.00 1.00 ? 49  PHE A C    3  
ATOM 4032  O O    . PHE A 1 29  ? -16.069 1.630   -4.907  1.00 1.00 ? 49  PHE A O    3  
ATOM 4033  C CB   . PHE A 1 29  ? -14.244 3.889   -4.938  1.00 1.00 ? 49  PHE A CB   3  
ATOM 4034  C CG   . PHE A 1 29  ? -13.057 3.278   -4.214  1.00 1.00 ? 49  PHE A CG   3  
ATOM 4035  C CD1  . PHE A 1 29  ? -13.202 2.118   -3.415  1.00 1.00 ? 49  PHE A CD1  3  
ATOM 4036  C CD2  . PHE A 1 29  ? -11.776 3.850   -4.387  1.00 1.00 ? 49  PHE A CD2  3  
ATOM 4037  C CE1  . PHE A 1 29  ? -12.076 1.530   -2.803  1.00 1.00 ? 49  PHE A CE1  3  
ATOM 4038  C CE2  . PHE A 1 29  ? -10.649 3.266   -3.767  1.00 1.00 ? 49  PHE A CE2  3  
ATOM 4039  C CZ   . PHE A 1 29  ? -10.799 2.101   -2.979  1.00 1.00 ? 49  PHE A CZ   3  
ATOM 4040  H H    . PHE A 1 29  ? -16.465 4.074   -6.830  1.00 1.00 ? 49  PHE A H    3  
ATOM 4041  H HA   . PHE A 1 29  ? -13.737 2.874   -6.726  1.00 1.00 ? 49  PHE A HA   3  
ATOM 4042  H HB2  . PHE A 1 29  ? -13.833 4.871   -5.173  1.00 0.00 ? 49  PHE A HB2  3  
ATOM 4043  H HB3  . PHE A 1 29  ? -15.086 4.052   -4.261  1.00 1.00 ? 49  PHE A HB3  3  
ATOM 4044  H HD1  . PHE A 1 29  ? -14.173 1.671   -3.268  1.00 1.00 ? 49  PHE A HD1  3  
ATOM 4045  H HD2  . PHE A 1 29  ? -11.665 4.736   -4.998  1.00 1.00 ? 49  PHE A HD2  3  
ATOM 4046  H HE1  . PHE A 1 29  ? -12.191 0.644   -2.194  1.00 1.00 ? 49  PHE A HE1  3  
ATOM 4047  H HE2  . PHE A 1 29  ? -9.672  3.709   -3.887  1.00 1.00 ? 49  PHE A HE2  3  
ATOM 4048  H HZ   . PHE A 1 29  ? -9.937  1.651   -2.504  1.00 1.00 ? 49  PHE A HZ   3  
ATOM 4049  N N    . LYS A 1 30  ? -15.237 0.840   -6.848  1.00 1.00 ? 50  LYS A N    3  
ATOM 4050  C CA   . LYS A 1 30  ? -15.956 -0.440  -6.825  1.00 1.00 ? 50  LYS A CA   3  
ATOM 4051  C C    . LYS A 1 30  ? -15.101 -1.369  -5.966  1.00 1.00 ? 50  LYS A C    3  
ATOM 4052  O O    . LYS A 1 30  ? -13.949 -1.646  -6.292  1.00 1.00 ? 50  LYS A O    3  
ATOM 4053  C CB   . LYS A 1 30  ? -16.158 -0.981  -8.258  1.00 1.00 ? 50  LYS A CB   3  
ATOM 4054  C CG   . LYS A 1 30  ? -16.895 -0.005  -9.195  1.00 1.00 ? 50  LYS A CG   3  
ATOM 4055  C CD   . LYS A 1 30  ? -17.263 -0.588  -10.568 1.00 1.00 ? 50  LYS A CD   3  
ATOM 4056  C CE   . LYS A 1 30  ? -17.731 0.533   -11.499 1.00 1.00 ? 50  LYS A CE   3  
ATOM 4057  N NZ   . LYS A 1 30  ? -18.107 0.035   -12.838 1.00 1.00 ? 50  LYS A NZ   3  
ATOM 4058  H H    . LYS A 1 30  ? -14.511 0.932   -7.552  1.00 1.00 ? 50  LYS A H    3  
ATOM 4059  H HA   . LYS A 1 30  ? -16.941 -0.315  -6.358  1.00 1.00 ? 50  LYS A HA   3  
ATOM 4060  H HB2  . LYS A 1 30  ? -15.182 -1.122  -8.724  1.00 0.00 ? 50  LYS A HB2  3  
ATOM 4061  H HB3  . LYS A 1 30  ? -16.688 -1.933  -8.207  1.00 1.00 ? 50  LYS A HB3  3  
ATOM 4062  H HG2  . LYS A 1 30  ? -17.844 0.275   -8.737  1.00 0.00 ? 50  LYS A HG2  3  
ATOM 4063  H HG3  . LYS A 1 30  ? -16.276 0.880   -9.340  1.00 1.00 ? 50  LYS A HG3  3  
ATOM 4064  H HD2  . LYS A 1 30  ? -16.385 -1.062  -11.009 1.00 0.00 ? 50  LYS A HD2  3  
ATOM 4065  H HD3  . LYS A 1 30  ? -18.054 -1.328  -10.450 1.00 1.00 ? 50  LYS A HD3  3  
ATOM 4066  H HE2  . LYS A 1 30  ? -18.633 0.983   -11.084 1.00 0.00 ? 50  LYS A HE2  3  
ATOM 4067  H HE3  . LYS A 1 30  ? -16.938 1.284   -11.576 1.00 1.00 ? 50  LYS A HE3  3  
ATOM 4068  H HZ1  . LYS A 1 30  ? -18.156 0.825   -13.499 1.00 0.00 ? 50  LYS A HZ1  3  
ATOM 4069  H HZ2  . LYS A 1 30  ? -17.401 -0.641  -13.164 1.00 0.00 ? 50  LYS A HZ2  3  
ATOM 4070  N N    . VAL A 1 31  ? -15.601 -1.732  -4.790  1.00 1.00 ? 51  VAL A N    3  
ATOM 4071  C CA   . VAL A 1 31  ? -14.912 -2.540  -3.770  1.00 1.00 ? 51  VAL A CA   3  
ATOM 4072  C C    . VAL A 1 31  ? -15.894 -3.614  -3.279  1.00 1.00 ? 51  VAL A C    3  
ATOM 4073  O O    . VAL A 1 31  ? -17.050 -3.298  -2.989  1.00 1.00 ? 51  VAL A O    3  
ATOM 4074  C CB   . VAL A 1 31  ? -14.262 -1.624  -2.702  1.00 1.00 ? 51  VAL A CB   3  
ATOM 4075  C CG1  . VAL A 1 31  ? -15.250 -0.791  -1.875  1.00 1.00 ? 51  VAL A CG1  3  
ATOM 4076  C CG2  . VAL A 1 31  ? -13.299 -2.402  -1.807  1.00 1.00 ? 51  VAL A CG2  3  
ATOM 4077  H H    . VAL A 1 31  ? -16.545 -1.425  -4.571  1.00 1.00 ? 51  VAL A H    3  
ATOM 4078  H HA   . VAL A 1 31  ? -14.093 -3.066  -4.264  1.00 1.00 ? 51  VAL A HA   3  
ATOM 4079  H HB   . VAL A 1 31  ? -13.645 -0.909  -3.244  1.00 1.00 ? 51  VAL A HB   3  
ATOM 4080  H HG11 . VAL A 1 31  ? -15.857 -0.190  -2.553  1.00 1.00 ? 51  VAL A HG11 3  
ATOM 4081  H HG12 . VAL A 1 31  ? -15.897 -1.429  -1.275  1.00 1.00 ? 51  VAL A HG12 3  
ATOM 4082  H HG13 . VAL A 1 31  ? -14.708 -0.117  -1.211  1.00 1.00 ? 51  VAL A HG13 3  
ATOM 4083  H HG21 . VAL A 1 31  ? -13.824 -3.222  -1.329  1.00 1.00 ? 51  VAL A HG21 3  
ATOM 4084  H HG22 . VAL A 1 31  ? -12.485 -2.807  -2.405  1.00 1.00 ? 51  VAL A HG22 3  
ATOM 4085  H HG23 . VAL A 1 31  ? -12.871 -1.751  -1.046  1.00 1.00 ? 51  VAL A HG23 3  
ATOM 4086  N N    . VAL A 1 32  ? -15.483 -4.891  -3.420  1.00 1.00 ? 52  VAL A N    3  
ATOM 4087  C CA   . VAL A 1 32  ? -16.255 -6.138  -3.192  1.00 1.00 ? 52  VAL A CA   3  
ATOM 4088  C C    . VAL A 1 32  ? -15.419 -7.235  -2.480  1.00 1.00 ? 52  VAL A C    3  
ATOM 4089  O O    . VAL A 1 32  ? -14.207 -7.312  -2.666  1.00 1.00 ? 52  VAL A O    3  
ATOM 4090  C CB   . VAL A 1 32  ? -16.859 -6.659  -4.541  1.00 1.00 ? 52  VAL A CB   3  
ATOM 4091  C CG1  . VAL A 1 32  ? -17.652 -7.978  -4.403  1.00 1.00 ? 52  VAL A CG1  3  
ATOM 4092  C CG2  . VAL A 1 32  ? -17.800 -5.634  -5.210  1.00 1.00 ? 52  VAL A CG2  3  
ATOM 4093  H H    . VAL A 1 32  ? -14.495 -5.020  -3.643  1.00 1.00 ? 52  VAL A H    3  
ATOM 4094  H HA   . VAL A 1 32  ? -17.087 -5.898  -2.529  1.00 1.00 ? 52  VAL A HA   3  
ATOM 4095  H HB   . VAL A 1 32  ? -16.039 -6.851  -5.232  1.00 1.00 ? 52  VAL A HB   3  
ATOM 4096  H HG11 . VAL A 1 32  ? -18.461 -7.872  -3.677  1.00 1.00 ? 52  VAL A HG11 3  
ATOM 4097  H HG12 . VAL A 1 32  ? -18.086 -8.257  -5.366  1.00 1.00 ? 52  VAL A HG12 3  
ATOM 4098  H HG13 . VAL A 1 32  ? -16.997 -8.791  -4.097  1.00 1.00 ? 52  VAL A HG13 3  
ATOM 4099  H HG21 . VAL A 1 32  ? -18.618 -5.384  -4.536  1.00 1.00 ? 52  VAL A HG21 3  
ATOM 4100  H HG22 . VAL A 1 32  ? -17.257 -4.725  -5.462  1.00 1.00 ? 52  VAL A HG22 3  
ATOM 4101  H HG23 . VAL A 1 32  ? -18.208 -6.038  -6.135  1.00 1.00 ? 52  VAL A HG23 3  
ATOM 4102  N N    . ALA A 1 33  ? -16.033 -8.093  -1.660  1.00 1.00 ? 53  ALA A N    3  
ATOM 4103  C CA   . ALA A 1 33  ? -15.417 -9.314  -1.110  1.00 1.00 ? 53  ALA A CA   3  
ATOM 4104  C C    . ALA A 1 33  ? -16.380 -10.499 -1.273  1.00 1.00 ? 53  ALA A C    3  
ATOM 4105  O O    . ALA A 1 33  ? -17.597 -10.339 -1.134  1.00 1.00 ? 53  ALA A O    3  
ATOM 4106  C CB   . ALA A 1 33  ? -14.985 -9.147  0.350   1.00 1.00 ? 53  ALA A CB   3  
ATOM 4107  H H    . ALA A 1 33  ? -17.003 -7.941  -1.415  1.00 1.00 ? 53  ALA A H    3  
ATOM 4108  H HA   . ALA A 1 33  ? -14.522 -9.536  -1.695  1.00 1.00 ? 53  ALA A HA   3  
ATOM 4109  H HB1  . ALA A 1 33  ? -14.485 -8.196  0.476   1.00 1.00 ? 53  ALA A HB1  3  
ATOM 4110  H HB2  . ALA A 1 33  ? -15.844 -9.204  1.013   1.00 1.00 ? 53  ALA A HB2  3  
ATOM 4111  H HB3  . ALA A 1 33  ? -14.296 -9.946  0.623   1.00 1.00 ? 53  ALA A HB3  3  
ATOM 4112  N N    . LEU A 1 34  ? -15.836 -11.693 -1.548  1.00 1.00 ? 54  LEU A N    3  
ATOM 4113  C CA   . LEU A 1 34  ? -16.661 -12.917 -1.566  1.00 1.00 ? 54  LEU A CA   3  
ATOM 4114  C C    . LEU A 1 34  ? -16.804 -13.497 -0.135  1.00 1.00 ? 54  LEU A C    3  
ATOM 4115  O O    . LEU A 1 34  ? -15.828 -13.947 0.471   1.00 1.00 ? 54  LEU A O    3  
ATOM 4116  C CB   . LEU A 1 34  ? -16.119 -13.926 -2.600  1.00 1.00 ? 54  LEU A CB   3  
ATOM 4117  C CG   . LEU A 1 34  ? -17.216 -14.780 -3.283  1.00 1.00 ? 54  LEU A CG   3  
ATOM 4118  C CD1  . LEU A 1 34  ? -18.022 -13.965 -4.314  1.00 1.00 ? 54  LEU A CD1  3  
ATOM 4119  C CD2  . LEU A 1 34  ? -16.610 -15.984 -4.017  1.00 1.00 ? 54  LEU A CD2  3  
ATOM 4120  H H    . LEU A 1 34  ? -14.819 -11.721 -1.631  1.00 1.00 ? 54  LEU A H    3  
ATOM 4121  H HA   . LEU A 1 34  ? -17.657 -12.625 -1.903  1.00 1.00 ? 54  LEU A HA   3  
ATOM 4122  H HB2  . LEU A 1 34  ? -15.675 -13.389 -3.439  1.00 0.00 ? 54  LEU A HB2  3  
ATOM 4123  H HB3  . LEU A 1 34  ? -15.361 -14.558 -2.136  1.00 1.00 ? 54  LEU A HB3  3  
ATOM 4124  H HG   . LEU A 1 34  ? -17.902 -15.157 -2.523  1.00 1.00 ? 54  LEU A HG   3  
ATOM 4125  H HD11 . LEU A 1 34  ? -17.364 -13.581 -5.093  1.00 1.00 ? 54  LEU A HD11 3  
ATOM 4126  H HD12 . LEU A 1 34  ? -18.783 -14.599 -4.776  1.00 1.00 ? 54  LEU A HD12 3  
ATOM 4127  H HD13 . LEU A 1 34  ? -18.534 -13.126 -3.840  1.00 1.00 ? 54  LEU A HD13 3  
ATOM 4128  H HD21 . LEU A 1 34  ? -15.910 -15.651 -4.786  1.00 1.00 ? 54  LEU A HD21 3  
ATOM 4129  H HD22 . LEU A 1 34  ? -16.083 -16.625 -3.309  1.00 1.00 ? 54  LEU A HD22 3  
ATOM 4130  H HD23 . LEU A 1 34  ? -17.401 -16.570 -4.487  1.00 1.00 ? 54  LEU A HD23 3  
ATOM 4131  N N    . GLY A 1 35  ? -18.034 -13.464 0.401   1.00 1.00 ? 55  GLY A N    3  
ATOM 4132  C CA   . GLY A 1 35  ? -18.435 -13.902 1.750   1.00 1.00 ? 55  GLY A CA   3  
ATOM 4133  C C    . GLY A 1 35  ? -19.784 -13.326 2.226   1.00 1.00 ? 55  GLY A C    3  
ATOM 4134  O O    . GLY A 1 35  ? -20.469 -12.613 1.488   1.00 1.00 ? 55  GLY A O    3  
ATOM 4135  H H    . GLY A 1 35  ? -18.753 -13.024 -0.159  1.00 1.00 ? 55  GLY A H    3  
ATOM 4136  H HA2  . GLY A 1 35  ? -18.507 -14.989 1.752   1.00 1.00 ? 55  GLY A HA2  3  
ATOM 4137  H HA3  . GLY A 1 35  ? -17.673 -13.613 2.470   1.00 1.00 ? 55  GLY A HA3  3  
ATOM 4138  N N    . ASP A 1 36  ? -20.167 -13.671 3.467   1.00 1.00 ? 56  ASP A N    3  
ATOM 4139  C CA   . ASP A 1 36  ? -21.383 -13.207 4.163   1.00 1.00 ? 56  ASP A CA   3  
ATOM 4140  C C    . ASP A 1 36  ? -21.399 -11.701 4.548   1.00 1.00 ? 56  ASP A C    3  
ATOM 4141  O O    . ASP A 1 36  ? -20.497 -10.942 4.192   1.00 1.00 ? 56  ASP A O    3  
ATOM 4142  C CB   . ASP A 1 36  ? -21.588 -14.138 5.376   1.00 1.00 ? 56  ASP A CB   3  
ATOM 4143  C CG   . ASP A 1 36  ? -22.974 -14.788 5.387   1.00 1.00 ? 56  ASP A CG   3  
ATOM 4144  O OD1  . ASP A 1 36  ? -23.949 -14.011 5.416   1.00 1.00 ? 56  ASP A OD1  3  
ATOM 4145  O OD2  . ASP A 1 36  ? -23.017 -16.043 5.328   1.00 1.00 ? 56  ASP A OD2  3  
ATOM 4146  H H    . ASP A 1 36  ? -19.577 -14.299 3.990   1.00 1.00 ? 56  ASP A H    3  
ATOM 4147  H HA   . ASP A 1 36  ? -22.217 -13.349 3.474   1.00 1.00 ? 56  ASP A HA   3  
ATOM 4148  H HB2  . ASP A 1 36  ? -20.865 -14.954 5.400   1.00 0.00 ? 56  ASP A HB2  3  
ATOM 4149  H HB3  . ASP A 1 36  ? -21.408 -13.607 6.316   1.00 1.00 ? 56  ASP A HB3  3  
ATOM 4150  N N    . VAL A 1 37  ? -22.444 -11.231 5.249   1.00 1.00 ? 57  VAL A N    3  
ATOM 4151  C CA   . VAL A 1 37  ? -22.646 -9.809  5.652   1.00 1.00 ? 57  VAL A CA   3  
ATOM 4152  C C    . VAL A 1 37  ? -22.280 -9.521  7.144   1.00 1.00 ? 57  VAL A C    3  
ATOM 4153  O O    . VAL A 1 37  ? -23.118 -9.756  8.013   1.00 1.00 ? 57  VAL A O    3  
ATOM 4154  C CB   . VAL A 1 37  ? -24.074 -9.306  5.283   1.00 1.00 ? 57  VAL A CB   3  
ATOM 4155  C CG1  . VAL A 1 37  ? -24.208 -9.016  3.775   1.00 1.00 ? 57  VAL A CG1  3  
ATOM 4156  C CG2  . VAL A 1 37  ? -25.218 -10.255 5.700   1.00 1.00 ? 57  VAL A CG2  3  
ATOM 4157  H H    . VAL A 1 37  ? -23.172 -11.911 5.465   1.00 1.00 ? 57  VAL A H    3  
ATOM 4158  H HA   . VAL A 1 37  ? -21.968 -9.195  5.057   1.00 1.00 ? 57  VAL A HA   3  
ATOM 4159  H HB   . VAL A 1 37  ? -24.230 -8.356  5.790   1.00 1.00 ? 57  VAL A HB   3  
ATOM 4160  H HG11 . VAL A 1 37  ? -23.468 -8.279  3.464   1.00 1.00 ? 57  VAL A HG11 3  
ATOM 4161  H HG12 . VAL A 1 37  ? -24.074 -9.926  3.188   1.00 1.00 ? 57  VAL A HG12 3  
ATOM 4162  H HG13 . VAL A 1 37  ? -25.201 -8.608  3.575   1.00 1.00 ? 57  VAL A HG13 3  
ATOM 4163  H HG21 . VAL A 1 37  ? -25.180 -10.444 6.770   1.00 1.00 ? 57  VAL A HG21 3  
ATOM 4164  H HG22 . VAL A 1 37  ? -26.179 -9.793  5.472   1.00 1.00 ? 57  VAL A HG22 3  
ATOM 4165  H HG23 . VAL A 1 37  ? -25.150 -11.207 5.171   1.00 1.00 ? 57  VAL A HG23 3  
ATOM 4166  N N    . PRO A 1 38  ? -21.047 -9.042  7.479   1.00 1.00 ? 58  PRO A N    3  
ATOM 4167  C CA   . PRO A 1 38  ? -20.606 -8.745  8.864   1.00 1.00 ? 58  PRO A CA   3  
ATOM 4168  C C    . PRO A 1 38  ? -20.870 -7.320  9.422   1.00 1.00 ? 58  PRO A C    3  
ATOM 4169  O O    . PRO A 1 38  ? -20.542 -7.071  10.579  1.00 1.00 ? 58  PRO A O    3  
ATOM 4170  C CB   . PRO A 1 38  ? -19.086 -8.960  8.855   1.00 1.00 ? 58  PRO A CB   3  
ATOM 4171  C CG   . PRO A 1 38  ? -18.715 -8.483  7.453   1.00 1.00 ? 58  PRO A CG   3  
ATOM 4172  C CD   . PRO A 1 38  ? -19.889 -8.957  6.594   1.00 1.00 ? 58  PRO A CD   3  
ATOM 4173  H HA   . PRO A 1 38  ? -21.056 -9.461  9.552   1.00 1.00 ? 58  PRO A HA   3  
ATOM 4174  H HB2  . PRO A 1 38  ? -18.597 -8.378  9.636   1.00 0.00 ? 58  PRO A HB2  3  
ATOM 4175  H HB3  . PRO A 1 38  ? -18.866 -10.025 8.953   1.00 1.00 ? 58  PRO A HB3  3  
ATOM 4176  H HG2  . PRO A 1 38  ? -18.603 -7.399  7.424   1.00 0.00 ? 58  PRO A HG2  3  
ATOM 4177  H HG3  . PRO A 1 38  ? -17.773 -8.924  7.125   1.00 1.00 ? 58  PRO A HG3  3  
ATOM 4178  H HD2  . PRO A 1 38  ? -20.147 -8.309  5.756   1.00 0.00 ? 58  PRO A HD2  3  
ATOM 4179  H HD3  . PRO A 1 38  ? -19.653 -9.960  6.245   1.00 1.00 ? 58  PRO A HD3  3  
ATOM 4180  N N    . ASP A 1 39  ? -21.407 -6.390  8.618   1.00 1.00 ? 59  ASP A N    3  
ATOM 4181  C CA   . ASP A 1 39  ? -21.728 -4.967  8.883   1.00 1.00 ? 59  ASP A CA   3  
ATOM 4182  C C    . ASP A 1 39  ? -20.828 -4.261  9.939   1.00 1.00 ? 59  ASP A C    3  
ATOM 4183  O O    . ASP A 1 39  ? -21.226 -4.063  11.089  1.00 1.00 ? 59  ASP A O    3  
ATOM 4184  C CB   . ASP A 1 39  ? -23.243 -4.830  9.197   1.00 1.00 ? 59  ASP A CB   3  
ATOM 4185  C CG   . ASP A 1 39  ? -24.228 -5.656  8.337   1.00 1.00 ? 59  ASP A CG   3  
ATOM 4186  O OD1  . ASP A 1 39  ? -23.772 -6.293  7.349   1.00 1.00 ? 59  ASP A OD1  3  
ATOM 4187  O OD2  . ASP A 1 39  ? -25.437 -5.600  8.623   1.00 1.00 ? 59  ASP A OD2  3  
ATOM 4188  H H    . ASP A 1 39  ? -21.916 -6.772  7.822   1.00 1.00 ? 59  ASP A H    3  
ATOM 4189  H HA   . ASP A 1 39  ? -21.542 -4.444  7.941   1.00 1.00 ? 59  ASP A HA   3  
ATOM 4190  H HB2  . ASP A 1 39  ? -23.393 -5.145  10.230  1.00 0.00 ? 59  ASP A HB2  3  
ATOM 4191  H HB3  . ASP A 1 39  ? -23.531 -3.771  9.196   1.00 1.00 ? 59  ASP A HB3  3  
ATOM 4192  N N    . GLY A 1 40  ? -19.620 -3.834  9.524   1.00 1.00 ? 60  GLY A N    3  
ATOM 4193  C CA   . GLY A 1 40  ? -18.561 -3.315  10.408  1.00 1.00 ? 60  GLY A CA   3  
ATOM 4194  C C    . GLY A 1 40  ? -17.147 -3.464  9.826   1.00 1.00 ? 60  GLY A C    3  
ATOM 4195  O O    . GLY A 1 40  ? -16.238 -3.958  10.494  1.00 1.00 ? 60  GLY A O    3  
ATOM 4196  H H    . GLY A 1 40  ? -19.449 -3.774  8.517   1.00 1.00 ? 60  GLY A H    3  
ATOM 4197  H HA2  . GLY A 1 40  ? -18.737 -2.254  10.585  1.00 1.00 ? 60  GLY A HA2  3  
ATOM 4198  H HA3  . GLY A 1 40  ? -18.607 -3.827  11.375  1.00 1.00 ? 60  GLY A HA3  3  
ATOM 4199  N N    . THR A 1 41  ? -16.954 -2.997  8.586   1.00 1.00 ? 61  THR A N    3  
ATOM 4200  C CA   . THR A 1 41  ? -15.709 -3.101  7.801   1.00 1.00 ? 61  THR A CA   3  
ATOM 4201  C C    . THR A 1 41  ? -15.352 -1.706  7.260   1.00 1.00 ? 61  THR A C    3  
ATOM 4202  O O    . THR A 1 41  ? -15.882 -1.297  6.226   1.00 1.00 ? 61  THR A O    3  
ATOM 4203  C CB   . THR A 1 41  ? -15.866 -4.160  6.686   1.00 1.00 ? 61  THR A CB   3  
ATOM 4204  O OG1  . THR A 1 41  ? -16.186 -5.419  7.229   1.00 1.00 ? 61  THR A OG1  3  
ATOM 4205  C CG2  . THR A 1 41  ? -14.609 -4.376  5.851   1.00 1.00 ? 61  THR A CG2  3  
ATOM 4206  H H    . THR A 1 41  ? -17.786 -2.701  8.086   1.00 1.00 ? 61  THR A H    3  
ATOM 4207  H HA   . THR A 1 41  ? -14.900 -3.437  8.445   1.00 1.00 ? 61  THR A HA   3  
ATOM 4208  H HB   . THR A 1 41  ? -16.674 -3.856  6.020   1.00 1.00 ? 61  THR A HB   3  
ATOM 4209  H HG1  . THR A 1 41  ? -16.794 -5.851  6.577   1.00 1.00 ? 61  THR A HG1  3  
ATOM 4210  H HG21 . THR A 1 41  ? -13.776 -4.681  6.488   1.00 1.00 ? 61  THR A HG21 3  
ATOM 4211  H HG22 . THR A 1 41  ? -14.784 -5.151  5.099   1.00 1.00 ? 61  THR A HG22 3  
ATOM 4212  H HG23 . THR A 1 41  ? -14.368 -3.445  5.348   1.00 1.00 ? 61  THR A HG23 3  
ATOM 4213  N N    . LEU A 1 42  ? -14.504 -0.949  7.977   1.00 1.00 ? 62  LEU A N    3  
ATOM 4214  C CA   . LEU A 1 42  ? -14.147 0.442   7.681   1.00 1.00 ? 62  LEU A CA   3  
ATOM 4215  C C    . LEU A 1 42  ? -12.899 0.529   6.775   1.00 1.00 ? 62  LEU A C    3  
ATOM 4216  O O    . LEU A 1 42  ? -11.788 0.201   7.199   1.00 1.00 ? 62  LEU A O    3  
ATOM 4217  C CB   . LEU A 1 42  ? -13.985 1.201   9.021   1.00 1.00 ? 62  LEU A CB   3  
ATOM 4218  C CG   . LEU A 1 42  ? -13.891 2.742   8.945   1.00 1.00 ? 62  LEU A CG   3  
ATOM 4219  C CD1  . LEU A 1 42  ? -15.291 3.363   8.891   1.00 1.00 ? 62  LEU A CD1  3  
ATOM 4220  C CD2  . LEU A 1 42  ? -13.160 3.327   10.161  1.00 1.00 ? 62  LEU A CD2  3  
ATOM 4221  H H    . LEU A 1 42  ? -14.006 -1.353  8.765   1.00 1.00 ? 62  LEU A H    3  
ATOM 4222  H HA   . LEU A 1 42  ? -14.985 0.900   7.164   1.00 1.00 ? 62  LEU A HA   3  
ATOM 4223  H HB2  . LEU A 1 42  ? -14.885 1.107   9.626   1.00 0.00 ? 62  LEU A HB2  3  
ATOM 4224  H HB3  . LEU A 1 42  ? -13.147 0.799   9.589   1.00 1.00 ? 62  LEU A HB3  3  
ATOM 4225  H HG   . LEU A 1 42  ? -13.346 3.029   8.042   1.00 1.00 ? 62  LEU A HG   3  
ATOM 4226  H HD11 . LEU A 1 42  ? -15.837 2.952   8.053   1.00 1.00 ? 62  LEU A HD11 3  
ATOM 4227  H HD12 . LEU A 1 42  ? -15.841 3.139   9.805   1.00 1.00 ? 62  LEU A HD12 3  
ATOM 4228  H HD13 . LEU A 1 42  ? -15.223 4.444   8.767   1.00 1.00 ? 62  LEU A HD13 3  
ATOM 4229  H HD21 . LEU A 1 42  ? -12.177 2.867   10.259  1.00 1.00 ? 62  LEU A HD21 3  
ATOM 4230  H HD22 . LEU A 1 42  ? -13.034 4.403   10.036  1.00 1.00 ? 62  LEU A HD22 3  
ATOM 4231  H HD23 . LEU A 1 42  ? -13.722 3.138   11.073  1.00 1.00 ? 62  LEU A HD23 3  
ATOM 4232  N N    . VAL A 1 43  ? -13.041 1.087   5.564   1.00 1.00 ? 63  VAL A N    3  
ATOM 4233  C CA   . VAL A 1 43  ? -11.905 1.328   4.652   1.00 1.00 ? 63  VAL A CA   3  
ATOM 4234  C C    . VAL A 1 43  ? -11.395 2.727   4.989   1.00 1.00 ? 63  VAL A C    3  
ATOM 4235  O O    . VAL A 1 43  ? -12.125 3.706   4.845   1.00 1.00 ? 63  VAL A O    3  
ATOM 4236  C CB   . VAL A 1 43  ? -12.238 1.158   3.141   1.00 1.00 ? 63  VAL A CB   3  
ATOM 4237  C CG1  . VAL A 1 43  ? -13.324 2.074   2.550   1.00 1.00 ? 63  VAL A CG1  3  
ATOM 4238  C CG2  . VAL A 1 43  ? -10.965 1.264   2.284   1.00 1.00 ? 63  VAL A CG2  3  
ATOM 4239  H H    . VAL A 1 43  ? -13.966 1.431   5.316   1.00 1.00 ? 63  VAL A H    3  
ATOM 4240  H HA   . VAL A 1 43  ? -11.124 0.606   4.865   1.00 1.00 ? 63  VAL A HA   3  
ATOM 4241  H HB   . VAL A 1 43  ? -12.592 0.140   3.016   1.00 1.00 ? 63  VAL A HB   3  
ATOM 4242  H HG11 . VAL A 1 43  ? -14.242 1.991   3.130   1.00 1.00 ? 63  VAL A HG11 3  
ATOM 4243  H HG12 . VAL A 1 43  ? -12.995 3.113   2.542   1.00 1.00 ? 63  VAL A HG12 3  
ATOM 4244  H HG13 . VAL A 1 43  ? -13.549 1.773   1.525   1.00 1.00 ? 63  VAL A HG13 3  
ATOM 4245  H HG21 . VAL A 1 43  ? -10.233 0.523   2.605   1.00 1.00 ? 63  VAL A HG21 3  
ATOM 4246  H HG22 . VAL A 1 43  ? -11.196 1.073   1.235   1.00 1.00 ? 63  VAL A HG22 3  
ATOM 4247  H HG23 . VAL A 1 43  ? -10.526 2.255   2.374   1.00 1.00 ? 63  VAL A HG23 3  
ATOM 4248  N N    . THR A 1 44  ? -10.180 2.769   5.559   1.00 1.00 ? 64  THR A N    3  
ATOM 4249  C CA   . THR A 1 44  ? -9.490  4.014   5.956   1.00 1.00 ? 64  THR A CA   3  
ATOM 4250  C C    . THR A 1 44  ? -8.260  4.192   5.050   1.00 1.00 ? 64  THR A C    3  
ATOM 4251  O O    . THR A 1 44  ? -7.250  3.502   5.186   1.00 1.00 ? 64  THR A O    3  
ATOM 4252  C CB   . THR A 1 44  ? -9.123  3.983   7.467   1.00 1.00 ? 64  THR A CB   3  
ATOM 4253  O OG1  . THR A 1 44  ? -8.409  2.829   7.866   1.00 1.00 ? 64  THR A OG1  3  
ATOM 4254  C CG2  . THR A 1 44  ? -10.355 4.009   8.380   1.00 1.00 ? 64  THR A CG2  3  
ATOM 4255  H H    . THR A 1 44  ? -9.677  1.887   5.655   1.00 1.00 ? 64  THR A H    3  
ATOM 4256  H HA   . THR A 1 44  ? -10.150 4.869   5.811   1.00 1.00 ? 64  THR A HA   3  
ATOM 4257  H HB   . THR A 1 44  ? -8.515  4.859   7.695   1.00 1.00 ? 64  THR A HB   3  
ATOM 4258  H HG1  . THR A 1 44  ? -9.024  2.202   8.291   1.00 1.00 ? 64  THR A HG1  3  
ATOM 4259  H HG21 . THR A 1 44  ? -10.970 4.876   8.174   1.00 1.00 ? 64  THR A HG21 3  
ATOM 4260  H HG22 . THR A 1 44  ? -10.964 3.120   8.214   1.00 1.00 ? 64  THR A HG22 3  
ATOM 4261  H HG23 . THR A 1 44  ? -10.044 4.047   9.429   1.00 1.00 ? 64  THR A HG23 3  
ATOM 4262  N N    . VAL A 1 45  ? -8.262  5.239   4.207   1.00 1.00 ? 65  VAL A N    3  
ATOM 4263  C CA   . VAL A 1 45  ? -7.239  5.403   3.140   1.00 1.00 ? 65  VAL A CA   3  
ATOM 4264  C C    . VAL A 1 45  ? -6.515  6.760   3.190   1.00 1.00 ? 65  VAL A C    3  
ATOM 4265  O O    . VAL A 1 45  ? -7.068  7.800   2.843   1.00 1.00 ? 65  VAL A O    3  
ATOM 4266  C CB   . VAL A 1 45  ? -7.814  4.974   1.745   1.00 1.00 ? 65  VAL A CB   3  
ATOM 4267  C CG1  . VAL A 1 45  ? -9.342  5.013   1.507   1.00 1.00 ? 65  VAL A CG1  3  
ATOM 4268  C CG2  . VAL A 1 45  ? -7.173  5.707   0.563   1.00 1.00 ? 65  VAL A CG2  3  
ATOM 4269  H H    . VAL A 1 45  ? -9.123  5.773   4.126   1.00 1.00 ? 65  VAL A H    3  
ATOM 4270  H HA   . VAL A 1 45  ? -6.465  4.670   3.330   1.00 1.00 ? 65  VAL A HA   3  
ATOM 4271  H HB   . VAL A 1 45  ? -7.540  3.924   1.628   1.00 1.00 ? 65  VAL A HB   3  
ATOM 4272  H HG11 . VAL A 1 45  ? -9.870  4.477   2.296   1.00 1.00 ? 65  VAL A HG11 3  
ATOM 4273  H HG12 . VAL A 1 45  ? -9.716  6.031   1.455   1.00 1.00 ? 65  VAL A HG12 3  
ATOM 4274  H HG13 . VAL A 1 45  ? -9.575  4.512   0.563   1.00 1.00 ? 65  VAL A HG13 3  
ATOM 4275  H HG21 . VAL A 1 45  ? -6.090  5.693   0.655   1.00 1.00 ? 65  VAL A HG21 3  
ATOM 4276  H HG22 . VAL A 1 45  ? -7.452  5.225   -0.379  1.00 1.00 ? 65  VAL A HG22 3  
ATOM 4277  H HG23 . VAL A 1 45  ? -7.520  6.740   0.542   1.00 1.00 ? 65  VAL A HG23 3  
ATOM 4278  N N    . MET A 1 46  ? -5.218  6.739   3.533   1.00 1.00 ? 66  MET A N    3  
ATOM 4279  C CA   . MET A 1 46  ? -4.397  7.941   3.798   1.00 1.00 ? 66  MET A CA   3  
ATOM 4280  C C    . MET A 1 46  ? -2.953  7.936   3.237   1.00 1.00 ? 66  MET A C    3  
ATOM 4281  O O    . MET A 1 46  ? -2.473  6.942   2.685   1.00 1.00 ? 66  MET A O    3  
ATOM 4282  C CB   . MET A 1 46  ? -4.420  8.189   5.318   1.00 1.00 ? 66  MET A CB   3  
ATOM 4283  C CG   . MET A 1 46  ? -4.347  9.683   5.647   1.00 1.00 ? 66  MET A CG   3  
ATOM 4284  S SD   . MET A 1 46  ? -3.921  10.159  7.343   1.00 1.00 ? 66  MET A SD   3  
ATOM 4285  C CE   . MET A 1 46  ? -5.440  9.687   8.213   1.00 1.00 ? 66  MET A CE   3  
ATOM 4286  H H    . MET A 1 46  ? -4.827  5.825   3.797   1.00 1.00 ? 66  MET A H    3  
ATOM 4287  H HA   . MET A 1 46  ? -4.899  8.783   3.315   1.00 1.00 ? 66  MET A HA   3  
ATOM 4288  H HB2  . MET A 1 46  ? -5.332  7.802   5.773   1.00 0.00 ? 66  MET A HB2  3  
ATOM 4289  H HB3  . MET A 1 46  ? -3.612  7.644   5.816   1.00 1.00 ? 66  MET A HB3  3  
ATOM 4290  H HG2  . MET A 1 46  ? -3.585  10.121  5.004   1.00 0.00 ? 66  MET A HG2  3  
ATOM 4291  H HG3  . MET A 1 46  ? -5.264  10.186  5.337   1.00 1.00 ? 66  MET A HG3  3  
ATOM 4292  H HE1  . MET A 1 46  ? -5.643  8.629   8.057   1.00 1.00 ? 66  MET A HE1  3  
ATOM 4293  H HE2  . MET A 1 46  ? -5.315  9.874   9.279   1.00 1.00 ? 66  MET A HE2  3  
ATOM 4294  H HE3  . MET A 1 46  ? -6.278  10.279  7.844   1.00 1.00 ? 66  MET A HE3  3  
ATOM 4295  N N    . ALA A 1 47  ? -2.254  9.077   3.341   1.00 1.00 ? 67  ALA A N    3  
ATOM 4296  C CA   . ALA A 1 47  ? -0.827  9.191   3.031   1.00 1.00 ? 67  ALA A CA   3  
ATOM 4297  C C    . ALA A 1 47  ? 0.009   9.119   4.326   1.00 1.00 ? 67  ALA A C    3  
ATOM 4298  O O    . ALA A 1 47  ? -0.337  9.663   5.370   1.00 1.00 ? 67  ALA A O    3  
ATOM 4299  C CB   . ALA A 1 47  ? -0.512  10.480  2.255   1.00 1.00 ? 67  ALA A CB   3  
ATOM 4300  H H    . ALA A 1 47  ? -2.660  9.900   3.783   1.00 1.00 ? 67  ALA A H    3  
ATOM 4301  H HA   . ALA A 1 47  ? -0.540  8.357   2.388   1.00 1.00 ? 67  ALA A HA   3  
ATOM 4302  H HB1  . ALA A 1 47  ? -1.379  11.124  2.186   1.00 1.00 ? 67  ALA A HB1  3  
ATOM 4303  H HB2  . ALA A 1 47  ? 0.279   11.040  2.751   1.00 1.00 ? 67  ALA A HB2  3  
ATOM 4304  H HB3  . ALA A 1 47  ? -0.165  10.239  1.254   1.00 1.00 ? 67  ALA A HB3  3  
ATOM 4305  N N    . GLY A 1 48  ? 1.169   8.483   4.195   1.00 1.00 ? 68  GLY A N    3  
ATOM 4306  C CA   . GLY A 1 48  ? 2.208   8.281   5.210   1.00 1.00 ? 68  GLY A CA   3  
ATOM 4307  C C    . GLY A 1 48  ? 2.982   6.980   5.001   1.00 1.00 ? 68  GLY A C    3  
ATOM 4308  O O    . GLY A 1 48  ? 2.487   5.924   5.365   1.00 1.00 ? 68  GLY A O    3  
ATOM 4309  H H    . GLY A 1 48  ? 1.275   8.107   3.275   1.00 1.00 ? 68  GLY A H    3  
ATOM 4310  H HA2  . GLY A 1 48  ? 2.899   9.124   5.199   1.00 1.00 ? 68  GLY A HA2  3  
ATOM 4311  H HA3  . GLY A 1 48  ? 1.752   8.239   6.197   1.00 1.00 ? 68  GLY A HA3  3  
ATOM 4312  N N    . ASN A 1 49  ? 4.175   7.065   4.411   1.00 1.00 ? 69  ASN A N    3  
ATOM 4313  C CA   . ASN A 1 49  ? 5.170   5.993   4.228   1.00 1.00 ? 69  ASN A CA   3  
ATOM 4314  C C    . ASN A 1 49  ? 6.524   6.428   4.846   1.00 1.00 ? 69  ASN A C    3  
ATOM 4315  O O    . ASN A 1 49  ? 7.179   5.630   5.505   1.00 1.00 ? 69  ASN A O    3  
ATOM 4316  C CB   . ASN A 1 49  ? 5.215   5.627   2.733   1.00 1.00 ? 69  ASN A CB   3  
ATOM 4317  C CG   . ASN A 1 49  ? 6.194   4.530   2.352   1.00 1.00 ? 69  ASN A CG   3  
ATOM 4318  O OD1  . ASN A 1 49  ? 7.259   4.768   1.807   1.00 1.00 ? 69  ASN A OD1  3  
ATOM 4319  N ND2  . ASN A 1 49  ? 5.858   3.286   2.584   1.00 1.00 ? 69  ASN A ND2  3  
ATOM 4320  H H    . ASN A 1 49  ? 4.484   7.998   4.186   1.00 1.00 ? 69  ASN A H    3  
ATOM 4321  H HA   . ASN A 1 49  ? 4.839   5.108   4.784   1.00 1.00 ? 69  ASN A HA   3  
ATOM 4322  H HB2  . ASN A 1 49  ? 4.264   5.207   2.406   1.00 0.00 ? 69  ASN A HB2  3  
ATOM 4323  H HB3  . ASN A 1 49  ? 5.420   6.501   2.127   1.00 1.00 ? 69  ASN A HB3  3  
ATOM 4324  H HD21 . ASN A 1 49  ? 4.947   3.071   3.015   1.00 0.00 ? 69  ASN A HD21 3  
ATOM 4325  H HD22 . ASN A 1 49  ? 6.503   2.522   2.336   1.00 0.00 ? 69  ASN A HD22 3  
ATOM 4326  N N    . ASP A 1 50  ? 6.885   7.713   4.680   1.00 1.00 ? 70  ASP A N    3  
ATOM 4327  C CA   . ASP A 1 50  ? 7.982   8.455   5.316   1.00 1.00 ? 70  ASP A CA   3  
ATOM 4328  C C    . ASP A 1 50  ? 8.028   8.254   6.861   1.00 1.00 ? 70  ASP A C    3  
ATOM 4329  O O    . ASP A 1 50  ? 9.089   7.982   7.422   1.00 1.00 ? 70  ASP A O    3  
ATOM 4330  C CB   . ASP A 1 50  ? 7.724   9.914   4.900   1.00 1.00 ? 70  ASP A CB   3  
ATOM 4331  C CG   . ASP A 1 50  ? 8.847   10.916  5.142   1.00 1.00 ? 70  ASP A CG   3  
ATOM 4332  O OD1  . ASP A 1 50  ? 9.719   11.019  4.247   1.00 1.00 ? 70  ASP A OD1  3  
ATOM 4333  O OD2  . ASP A 1 50  ? 8.757   11.629  6.162   1.00 1.00 ? 70  ASP A OD2  3  
ATOM 4334  H H    . ASP A 1 50  ? 6.447   8.199   3.906   1.00 1.00 ? 70  ASP A H    3  
ATOM 4335  H HA   . ASP A 1 50  ? 8.938   8.142   4.893   1.00 1.00 ? 70  ASP A HA   3  
ATOM 4336  H HB2  . ASP A 1 50  ? 7.527   9.921   3.829   1.00 0.00 ? 70  ASP A HB2  3  
ATOM 4337  H HB3  . ASP A 1 50  ? 6.779   10.286  5.306   1.00 1.00 ? 70  ASP A HB3  3  
ATOM 4338  N N    . GLU A 1 51  ? 6.865   8.338   7.533   1.00 1.00 ? 71  GLU A N    3  
ATOM 4339  C CA   . GLU A 1 51  ? 6.651   8.167   8.991   1.00 1.00 ? 71  GLU A CA   3  
ATOM 4340  C C    . GLU A 1 51  ? 5.319   7.471   9.417   1.00 1.00 ? 71  GLU A C    3  
ATOM 4341  O O    . GLU A 1 51  ? 5.194   7.086   10.577  1.00 1.00 ? 71  GLU A O    3  
ATOM 4342  C CB   . GLU A 1 51  ? 6.707   9.600   9.549   1.00 1.00 ? 71  GLU A CB   3  
ATOM 4343  C CG   . GLU A 1 51  ? 6.660   9.822   11.068  1.00 1.00 ? 71  GLU A CG   3  
ATOM 4344  C CD   . GLU A 1 51  ? 6.261   11.263  11.434  1.00 1.00 ? 71  GLU A CD   3  
ATOM 4345  O OE1  . GLU A 1 51  ? 6.527   12.199  10.635  1.00 1.00 ? 71  GLU A OE1  3  
ATOM 4346  O OE2  . GLU A 1 51  ? 5.673   11.399  12.535  1.00 1.00 ? 71  GLU A OE2  3  
ATOM 4347  H H    . GLU A 1 51  ? 6.122   8.746   6.988   1.00 1.00 ? 71  GLU A H    3  
ATOM 4348  H HA   . GLU A 1 51  ? 7.478   7.583   9.409   1.00 1.00 ? 71  GLU A HA   3  
ATOM 4349  H HB2  . GLU A 1 51  ? 7.650   10.036  9.216   1.00 0.00 ? 71  GLU A HB2  3  
ATOM 4350  H HB3  . GLU A 1 51  ? 5.919   10.191  9.076   1.00 1.00 ? 71  GLU A HB3  3  
ATOM 4351  H HG2  . GLU A 1 51  ? 5.940   9.166   11.558  1.00 0.00 ? 71  GLU A HG2  3  
ATOM 4352  H HG3  . GLU A 1 51  ? 7.619   9.555   11.527  1.00 1.00 ? 71  GLU A HG3  3  
ATOM 4353  N N    . ASN A 1 52  ? 4.356   7.295   8.491   1.00 1.00 ? 72  ASN A N    3  
ATOM 4354  C CA   . ASN A 1 52  ? 2.958   6.856   8.636   1.00 1.00 ? 72  ASN A CA   3  
ATOM 4355  C C    . ASN A 1 52  ? 2.051   8.057   8.999   1.00 1.00 ? 72  ASN A C    3  
ATOM 4356  O O    . ASN A 1 52  ? 2.513   9.076   9.518   1.00 1.00 ? 72  ASN A O    3  
ATOM 4357  C CB   . ASN A 1 52  ? 2.769   5.611   9.529   1.00 1.00 ? 72  ASN A CB   3  
ATOM 4358  C CG   . ASN A 1 52  ? 3.279   4.321   8.896   1.00 1.00 ? 72  ASN A CG   3  
ATOM 4359  O OD1  . ASN A 1 52  ? 4.308   3.784   9.262   1.00 1.00 ? 72  ASN A OD1  3  
ATOM 4360  N ND2  . ASN A 1 52  ? 2.588   3.738   7.936   1.00 1.00 ? 72  ASN A ND2  3  
ATOM 4361  H H    . ASN A 1 52  ? 4.567   7.669   7.586   1.00 1.00 ? 72  ASN A H    3  
ATOM 4362  H HA   . ASN A 1 52  ? 2.647   6.551   7.646   1.00 1.00 ? 72  ASN A HA   3  
ATOM 4363  H HB2  . ASN A 1 52  ? 3.342   5.703   10.452  1.00 0.00 ? 72  ASN A HB2  3  
ATOM 4364  H HB3  . ASN A 1 52  ? 1.721   5.477   9.796   1.00 1.00 ? 72  ASN A HB3  3  
ATOM 4365  H HD21 . ASN A 1 52  ? 1.703   4.153   7.613   1.00 0.00 ? 72  ASN A HD21 3  
ATOM 4366  H HD22 . ASN A 1 52  ? 2.934   2.865   7.509   1.00 0.00 ? 72  ASN A HD22 3  
ATOM 4367  N N    . TYR A 1 53  ? 0.773   7.956   8.595   1.00 1.00 ? 73  TYR A N    3  
ATOM 4368  C CA   . TYR A 1 53  ? -0.309  8.974   8.680   1.00 1.00 ? 73  TYR A CA   3  
ATOM 4369  C C    . TYR A 1 53  ? 0.165   10.445  8.527   1.00 1.00 ? 73  TYR A C    3  
ATOM 4370  O O    . TYR A 1 53  ? -0.248  11.354  9.245   1.00 1.00 ? 73  TYR A O    3  
ATOM 4371  C CB   . TYR A 1 53  ? -1.135  8.702   9.947   1.00 1.00 ? 73  TYR A CB   3  
ATOM 4372  C CG   . TYR A 1 53  ? -1.828  7.351   9.986   1.00 1.00 ? 73  TYR A CG   3  
ATOM 4373  C CD1  . TYR A 1 53  ? -2.908  7.085   9.114   1.00 1.00 ? 73  TYR A CD1  3  
ATOM 4374  C CD2  . TYR A 1 53  ? -1.396  6.364   10.898  1.00 1.00 ? 73  TYR A CD2  3  
ATOM 4375  C CE1  . TYR A 1 53  ? -3.598  5.857   9.183   1.00 1.00 ? 73  TYR A CE1  3  
ATOM 4376  C CE2  . TYR A 1 53  ? -2.074  5.123   10.967  1.00 1.00 ? 73  TYR A CE2  3  
ATOM 4377  C CZ   . TYR A 1 53  ? -3.178  4.872   10.115  1.00 1.00 ? 73  TYR A CZ   3  
ATOM 4378  O OH   . TYR A 1 53  ? -3.822  3.678   10.156  1.00 1.00 ? 73  TYR A OH   3  
ATOM 4379  H H    . TYR A 1 53  ? 0.560   7.073   8.161   1.00 1.00 ? 73  TYR A H    3  
ATOM 4380  H HA   . TYR A 1 53  ? -0.977  8.814   7.833   1.00 1.00 ? 73  TYR A HA   3  
ATOM 4381  H HB2  . TYR A 1 53  ? -0.485  8.693   10.823  1.00 0.00 ? 73  TYR A HB2  3  
ATOM 4382  H HB3  . TYR A 1 53  ? -1.891  9.483   10.076  1.00 1.00 ? 73  TYR A HB3  3  
ATOM 4383  H HD1  . TYR A 1 53  ? -3.207  7.817   8.386   1.00 1.00 ? 73  TYR A HD1  3  
ATOM 4384  H HD2  . TYR A 1 53  ? -0.551  6.552   11.541  1.00 1.00 ? 73  TYR A HD2  3  
ATOM 4385  H HE1  . TYR A 1 53  ? -4.430  5.671   8.515   1.00 1.00 ? 73  TYR A HE1  3  
ATOM 4386  H HE2  . TYR A 1 53  ? -1.769  4.355   11.659  1.00 1.00 ? 73  TYR A HE2  3  
ATOM 4387  H HH   . TYR A 1 53  ? -4.500  3.649   9.482   1.00 1.00 ? 73  TYR A HH   3  
ATOM 4388  N N    . SER A 1 54  ? 1.060   10.652  7.553   1.00 1.00 ? 74  SER A N    3  
ATOM 4389  C CA   . SER A 1 54  ? 1.834   11.860  7.242   1.00 1.00 ? 74  SER A CA   3  
ATOM 4390  C C    . SER A 1 54  ? 1.081   12.899  6.382   1.00 1.00 ? 74  SER A C    3  
ATOM 4391  O O    . SER A 1 54  ? 1.426   14.078  6.473   1.00 1.00 ? 74  SER A O    3  
ATOM 4392  C CB   . SER A 1 54  ? 3.166   11.459  6.585   1.00 1.00 ? 74  SER A CB   3  
ATOM 4393  O OG   . SER A 1 54  ? 3.826   10.402  7.276   1.00 1.00 ? 74  SER A OG   3  
ATOM 4394  H H    . SER A 1 54  ? 1.170   9.850   6.953   1.00 1.00 ? 74  SER A H    3  
ATOM 4395  H HA   . SER A 1 54  ? 2.069   12.357  8.187   1.00 1.00 ? 74  SER A HA   3  
ATOM 4396  H HB2  . SER A 1 54  ? 2.993   11.068  5.583   1.00 0.00 ? 74  SER A HB2  3  
ATOM 4397  H HB3  . SER A 1 54  ? 3.828   12.321  6.512   1.00 1.00 ? 74  SER A HB3  3  
ATOM 4398  H HG   . SER A 1 54  ? 3.450   10.326  8.173   1.00 1.00 ? 74  SER A HG   3  
ATOM 4399  N N    . ALA A 1 55  ? 0.090   12.504  5.553   1.00 1.00 ? 75  ALA A N    3  
ATOM 4400  C CA   . ALA A 1 55  ? -0.823  13.444  4.874   1.00 1.00 ? 75  ALA A CA   3  
ATOM 4401  C C    . ALA A 1 55  ? -2.274  12.904  4.811   1.00 1.00 ? 75  ALA A C    3  
ATOM 4402  O O    . ALA A 1 55  ? -2.537  11.821  4.285   1.00 1.00 ? 75  ALA A O    3  
ATOM 4403  C CB   . ALA A 1 55  ? -0.289  13.910  3.514   1.00 1.00 ? 75  ALA A CB   3  
ATOM 4404  H H    . ALA A 1 55  ? -0.053  11.496  5.431   1.00 1.00 ? 75  ALA A H    3  
ATOM 4405  H HA   . ALA A 1 55  ? -0.855  14.343  5.492   1.00 1.00 ? 75  ALA A HA   3  
ATOM 4406  H HB1  . ALA A 1 55  ? 0.715   14.312  3.625   1.00 1.00 ? 75  ALA A HB1  3  
ATOM 4407  H HB2  . ALA A 1 55  ? -0.291  13.100  2.795   1.00 1.00 ? 75  ALA A HB2  3  
ATOM 4408  H HB3  . ALA A 1 55  ? -0.941  14.693  3.137   1.00 1.00 ? 75  ALA A HB3  3  
ATOM 4409  N N    . GLU A 1 56  ? -3.205  13.687  5.376   1.00 1.00 ? 76  GLU A N    3  
ATOM 4410  C CA   . GLU A 1 56  ? -4.627  13.363  5.597   1.00 1.00 ? 76  GLU A CA   3  
ATOM 4411  C C    . GLU A 1 56  ? -5.472  12.999  4.348   1.00 1.00 ? 76  GLU A C    3  
ATOM 4412  O O    . GLU A 1 56  ? -5.054  13.100  3.193   1.00 1.00 ? 76  GLU A O    3  
ATOM 4413  C CB   . GLU A 1 56  ? -5.275  14.507  6.410   1.00 1.00 ? 76  GLU A CB   3  
ATOM 4414  C CG   . GLU A 1 56  ? -4.717  14.550  7.839   1.00 1.00 ? 76  GLU A CG   3  
ATOM 4415  C CD   . GLU A 1 56  ? -5.651  15.278  8.804   1.00 1.00 ? 76  GLU A CD   3  
ATOM 4416  O OE1  . GLU A 1 56  ? -6.629  14.622  9.226   1.00 1.00 ? 76  GLU A OE1  3  
ATOM 4417  O OE2  . GLU A 1 56  ? -5.379  16.462  9.094   1.00 1.00 ? 76  GLU A OE2  3  
ATOM 4418  H H    . GLU A 1 56  ? -2.877  14.534  5.811   1.00 1.00 ? 76  GLU A H    3  
ATOM 4419  H HA   . GLU A 1 56  ? -4.647  12.473  6.224   1.00 1.00 ? 76  GLU A HA   3  
ATOM 4420  H HB2  . GLU A 1 56  ? -5.080  15.474  5.945   1.00 0.00 ? 76  GLU A HB2  3  
ATOM 4421  H HB3  . GLU A 1 56  ? -6.356  14.366  6.449   1.00 1.00 ? 76  GLU A HB3  3  
ATOM 4422  H HG2  . GLU A 1 56  ? -4.561  13.553  8.253   1.00 0.00 ? 76  GLU A HG2  3  
ATOM 4423  H HG3  . GLU A 1 56  ? -3.713  14.986  7.843   1.00 1.00 ? 76  GLU A HG3  3  
ATOM 4424  N N    . LEU A 1 57  ? -6.705  12.555  4.615   1.00 1.00 ? 77  LEU A N    3  
ATOM 4425  C CA   . LEU A 1 57  ? -7.741  12.100  3.708   1.00 1.00 ? 77  LEU A CA   3  
ATOM 4426  C C    . LEU A 1 57  ? -8.968  13.027  3.770   1.00 1.00 ? 77  LEU A C    3  
ATOM 4427  O O    . LEU A 1 57  ? -9.097  13.843  4.687   1.00 1.00 ? 77  LEU A O    3  
ATOM 4428  C CB   . LEU A 1 57  ? -8.032  10.639  4.081   1.00 1.00 ? 77  LEU A CB   3  
ATOM 4429  C CG   . LEU A 1 57  ? -8.520  10.278  5.507   1.00 1.00 ? 77  LEU A CG   3  
ATOM 4430  C CD1  . LEU A 1 57  ? -9.974  10.690  5.784   1.00 1.00 ? 77  LEU A CD1  3  
ATOM 4431  C CD2  . LEU A 1 57  ? -8.401  8.763   5.737   1.00 1.00 ? 77  LEU A CD2  3  
ATOM 4432  H H    . LEU A 1 57  ? -7.054  12.547  5.561   1.00 1.00 ? 77  LEU A H    3  
ATOM 4433  H HA   . LEU A 1 57  ? -7.360  12.126  2.686   1.00 1.00 ? 77  LEU A HA   3  
ATOM 4434  H HB2  . LEU A 1 57  ? -8.882  10.317  3.480   1.00 0.00 ? 77  LEU A HB2  3  
ATOM 4435  H HB3  . LEU A 1 57  ? -7.136  10.064  3.850   1.00 1.00 ? 77  LEU A HB3  3  
ATOM 4436  H HG   . LEU A 1 57  ? -7.880  10.778  6.235   1.00 1.00 ? 77  LEU A HG   3  
ATOM 4437  H HD11 . LEU A 1 57  ? -10.122 11.754  5.641   1.00 1.00 ? 77  LEU A HD11 3  
ATOM 4438  H HD12 . LEU A 1 57  ? -10.659 10.125  5.163   1.00 1.00 ? 77  LEU A HD12 3  
ATOM 4439  H HD13 . LEU A 1 57  ? -10.199 10.495  6.834   1.00 1.00 ? 77  LEU A HD13 3  
ATOM 4440  H HD21 . LEU A 1 57  ? -7.386  8.427   5.526   1.00 1.00 ? 77  LEU A HD21 3  
ATOM 4441  H HD22 . LEU A 1 57  ? -8.622  8.526   6.779   1.00 1.00 ? 77  LEU A HD22 3  
ATOM 4442  H HD23 . LEU A 1 57  ? -9.090  8.218   5.095   1.00 1.00 ? 77  LEU A HD23 3  
ATOM 4443  N N    . ARG A 1 58  ? -9.898  12.895  2.810   1.00 1.00 ? 78  ARG A N    3  
ATOM 4444  C CA   . ARG A 1 58  ? -11.141 13.699  2.762   1.00 1.00 ? 78  ARG A CA   3  
ATOM 4445  C C    . ARG A 1 58  ? -12.357 12.784  2.563   1.00 1.00 ? 78  ARG A C    3  
ATOM 4446  O O    . ARG A 1 58  ? -12.806 12.578  1.439   1.00 1.00 ? 78  ARG A O    3  
ATOM 4447  C CB   . ARG A 1 58  ? -10.963 14.793  1.686   1.00 1.00 ? 78  ARG A CB   3  
ATOM 4448  C CG   . ARG A 1 58  ? -10.077 15.967  2.132   1.00 1.00 ? 78  ARG A CG   3  
ATOM 4449  C CD   . ARG A 1 58  ? -9.160  16.558  1.057   1.00 1.00 ? 78  ARG A CD   3  
ATOM 4450  N NE   . ARG A 1 58  ? -9.637  17.879  0.648   1.00 1.00 ? 78  ARG A NE   3  
ATOM 4451  C CZ   . ARG A 1 58  ? -8.906  18.974  0.501   1.00 1.00 ? 78  ARG A CZ   3  
ATOM 4452  N NH1  . ARG A 1 58  ? -7.599  19.045  0.595   1.00 1.00 ? 78  ARG A NH1  3  
ATOM 4453  N NH2  . ARG A 1 58  ? -9.502  20.095  0.222   1.00 1.00 ? 78  ARG A NH2  3  
ATOM 4454  H H    . ARG A 1 58  ? -9.733  12.173  2.101   1.00 1.00 ? 78  ARG A H    3  
ATOM 4455  H HA   . ARG A 1 58  ? -11.298 14.217  3.715   1.00 1.00 ? 78  ARG A HA   3  
ATOM 4456  H HB2  . ARG A 1 58  ? -10.460 14.383  0.811   1.00 0.00 ? 78  ARG A HB2  3  
ATOM 4457  H HB3  . ARG A 1 58  ? -11.933 15.182  1.380   1.00 1.00 ? 78  ARG A HB3  3  
ATOM 4458  H HG2  . ARG A 1 58  ? -10.654 16.856  2.381   1.00 0.00 ? 78  ARG A HG2  3  
ATOM 4459  H HG3  . ARG A 1 58  ? -9.486  15.732  3.014   1.00 1.00 ? 78  ARG A HG3  3  
ATOM 4460  H HD2  . ARG A 1 58  ? -8.153  16.752  1.426   1.00 0.00 ? 78  ARG A HD2  3  
ATOM 4461  H HD3  . ARG A 1 58  ? -9.047  15.901  0.199   1.00 1.00 ? 78  ARG A HD3  3  
ATOM 4462  H HE   . ARG A 1 58  ? -10.633 17.992  0.575   1.00 1.00 ? 78  ARG A HE   3  
ATOM 4463  H HH11 . ARG A 1 58  ? -7.050  18.198  0.800   1.00 0.00 ? 78  ARG A HH11 3  
ATOM 4464  H HH12 . ARG A 1 58  ? -7.122  19.949  0.464   1.00 0.00 ? 78  ARG A HH12 3  
ATOM 4465  H HH21 . ARG A 1 58  ? -10.527 20.123  0.119   1.00 0.00 ? 78  ARG A HH21 3  
ATOM 4466  H HH22 . ARG A 1 58  ? -8.950  20.957  0.104   1.00 0.00 ? 78  ARG A HH22 3  
ATOM 4467  N N    . ASN A 1 59  ? -12.856 12.200  3.669   1.00 1.00 ? 79  ASN A N    3  
ATOM 4468  C CA   . ASN A 1 59  ? -13.924 11.196  3.713   1.00 1.00 ? 79  ASN A CA   3  
ATOM 4469  C C    . ASN A 1 59  ? -13.432 9.817   3.213   1.00 1.00 ? 79  ASN A C    3  
ATOM 4470  O O    . ASN A 1 59  ? -14.235 8.905   3.061   1.00 1.00 ? 79  ASN A O    3  
ATOM 4471  C CB   . ASN A 1 59  ? -15.220 11.748  3.065   1.00 1.00 ? 79  ASN A CB   3  
ATOM 4472  C CG   . ASN A 1 59  ? -15.901 12.877  3.850   1.00 1.00 ? 79  ASN A CG   3  
ATOM 4473  O OD1  . ASN A 1 59  ? -15.298 13.709  4.513   1.00 1.00 ? 79  ASN A OD1  3  
ATOM 4474  N ND2  . ASN A 1 59  ? -17.211 12.943  3.830   1.00 1.00 ? 79  ASN A ND2  3  
ATOM 4475  H H    . ASN A 1 59  ? -12.335 12.228  4.532   1.00 1.00 ? 79  ASN A H    3  
ATOM 4476  H HA   . ASN A 1 59  ? -14.164 11.028  4.763   1.00 1.00 ? 79  ASN A HA   3  
ATOM 4477  H HB2  . ASN A 1 59  ? -14.983 12.198  2.101   1.00 0.00 ? 79  ASN A HB2  3  
ATOM 4478  H HB3  . ASN A 1 59  ? -15.931 10.935  2.920   1.00 1.00 ? 79  ASN A HB3  3  
ATOM 4479  H HD21 . ASN A 1 59  ? -17.752 12.249  3.296   1.00 0.00 ? 79  ASN A HD21 3  
ATOM 4480  H HD22 . ASN A 1 59  ? -17.697 13.689  4.347   1.00 0.00 ? 79  ASN A HD22 3  
ATOM 4481  N N    . ALA A 1 60  ? -12.101 9.607   3.046   1.00 1.00 ? 80  ALA A N    3  
ATOM 4482  C CA   . ALA A 1 60  ? -11.474 8.298   2.771   1.00 1.00 ? 80  ALA A CA   3  
ATOM 4483  C C    . ALA A 1 60  ? -11.658 7.252   3.899   1.00 1.00 ? 80  ALA A C    3  
ATOM 4484  O O    . ALA A 1 60  ? -11.034 6.190   3.863   1.00 1.00 ? 80  ALA A O    3  
ATOM 4485  C CB   . ALA A 1 60  ? -10.012 8.502   2.375   1.00 1.00 ? 80  ALA A CB   3  
ATOM 4486  H H    . ALA A 1 60  ? -11.455 10.352  3.301   1.00 1.00 ? 80  ALA A H    3  
ATOM 4487  H HA   . ALA A 1 60  ? -11.965 7.866   1.909   1.00 1.00 ? 80  ALA A HA   3  
ATOM 4488  H HB1  . ALA A 1 60  ? -9.667  9.483   2.671   1.00 1.00 ? 80  ALA A HB1  3  
ATOM 4489  H HB2  . ALA A 1 60  ? -9.393  7.766   2.864   1.00 1.00 ? 80  ALA A HB2  3  
ATOM 4490  H HB3  . ALA A 1 60  ? -9.872  8.379   1.302   1.00 1.00 ? 80  ALA A HB3  3  
ATOM 4491  N N    . THR A 1 61  ? -12.470 7.592   4.904   1.00 1.00 ? 81  THR A N    3  
ATOM 4492  C CA   . THR A 1 61  ? -12.949 6.654   5.953   1.00 1.00 ? 81  THR A CA   3  
ATOM 4493  C C    . THR A 1 61  ? -14.429 6.307   5.703   1.00 1.00 ? 81  THR A C    3  
ATOM 4494  O O    . THR A 1 61  ? -15.287 7.160   5.943   1.00 1.00 ? 81  THR A O    3  
ATOM 4495  C CB   . THR A 1 61  ? -12.767 7.197   7.388   1.00 1.00 ? 81  THR A CB   3  
ATOM 4496  O OG1  . THR A 1 61  ? -13.579 8.328   7.633   1.00 1.00 ? 81  THR A OG1  3  
ATOM 4497  C CG2  . THR A 1 61  ? -11.322 7.584   7.714   1.00 1.00 ? 81  THR A CG2  3  
ATOM 4498  H H    . THR A 1 61  ? -12.785 8.558   4.761   1.00 1.00 ? 81  THR A H    3  
ATOM 4499  H HA   . THR A 1 61  ? -12.364 5.736   5.916   1.00 1.00 ? 81  THR A HA   3  
ATOM 4500  H HB   . THR A 1 61  ? -13.056 6.399   8.072   1.00 1.00 ? 81  THR A HB   3  
ATOM 4501  H HG1  . THR A 1 61  ? -14.419 8.172   7.160   1.00 1.00 ? 81  THR A HG1  3  
ATOM 4502  H HG21 . THR A 1 61  ? -10.633 6.828   7.342   1.00 1.00 ? 81  THR A HG21 3  
ATOM 4503  H HG22 . THR A 1 61  ? -11.081 8.530   7.230   1.00 1.00 ? 81  THR A HG22 3  
ATOM 4504  H HG23 . THR A 1 61  ? -11.202 7.696   8.794   1.00 1.00 ? 81  THR A HG23 3  
ATOM 4505  N N    . ALA A 1 62  ? -14.740 5.063   5.312   1.00 1.00 ? 82  ALA A N    3  
ATOM 4506  C CA   . ALA A 1 62  ? -16.081 4.602   4.934   1.00 1.00 ? 82  ALA A CA   3  
ATOM 4507  C C    . ALA A 1 62  ? -16.355 3.173   5.444   1.00 1.00 ? 82  ALA A C    3  
ATOM 4508  O O    . ALA A 1 62  ? -15.516 2.280   5.319   1.00 1.00 ? 82  ALA A O    3  
ATOM 4509  C CB   . ALA A 1 62  ? -16.230 4.726   3.404   1.00 1.00 ? 82  ALA A CB   3  
ATOM 4510  H H    . ALA A 1 62  ? -14.016 4.362   5.205   1.00 1.00 ? 82  ALA A H    3  
ATOM 4511  H HA   . ALA A 1 62  ? -16.817 5.271   5.387   1.00 1.00 ? 82  ALA A HA   3  
ATOM 4512  H HB1  . ALA A 1 62  ? -16.098 5.766   3.097   1.00 1.00 ? 82  ALA A HB1  3  
ATOM 4513  H HB2  . ALA A 1 62  ? -15.494 4.109   2.890   1.00 1.00 ? 82  ALA A HB2  3  
ATOM 4514  H HB3  . ALA A 1 62  ? -17.229 4.411   3.096   1.00 1.00 ? 82  ALA A HB3  3  
ATOM 4515  N N    . ALA A 1 63  ? -17.545 2.962   6.011   1.00 1.00 ? 83  ALA A N    3  
ATOM 4516  C CA   . ALA A 1 63  ? -18.011 1.716   6.650   1.00 1.00 ? 83  ALA A CA   3  
ATOM 4517  C C    . ALA A 1 63  ? -18.768 0.792   5.659   1.00 1.00 ? 83  ALA A C    3  
ATOM 4518  O O    . ALA A 1 63  ? -19.499 1.268   4.787   1.00 1.00 ? 83  ALA A O    3  
ATOM 4519  C CB   . ALA A 1 63  ? -18.911 2.092   7.838   1.00 1.00 ? 83  ALA A CB   3  
ATOM 4520  H H    . ALA A 1 63  ? -18.095 3.798   6.071   1.00 1.00 ? 83  ALA A H    3  
ATOM 4521  H HA   . ALA A 1 63  ? -17.145 1.176   7.037   1.00 1.00 ? 83  ALA A HA   3  
ATOM 4522  H HB1  . ALA A 1 63  ? -18.368 2.724   8.546   1.00 1.00 ? 83  ALA A HB1  3  
ATOM 4523  H HB2  . ALA A 1 63  ? -19.795 2.626   7.487   1.00 1.00 ? 83  ALA A HB2  3  
ATOM 4524  H HB3  . ALA A 1 63  ? -19.231 1.186   8.356   1.00 1.00 ? 83  ALA A HB3  3  
ATOM 4525  N N    . MET A 1 64  ? -18.602 -0.535  5.801   1.00 1.00 ? 84  MET A N    3  
ATOM 4526  C CA   . MET A 1 64  ? -19.078 -1.580  4.873   1.00 1.00 ? 84  MET A CA   3  
ATOM 4527  C C    . MET A 1 64  ? -19.353 -2.919  5.609   1.00 1.00 ? 84  MET A C    3  
ATOM 4528  O O    . MET A 1 64  ? -19.257 -3.004  6.840   1.00 1.00 ? 84  MET A O    3  
ATOM 4529  C CB   . MET A 1 64  ? -18.009 -1.789  3.777   1.00 1.00 ? 84  MET A CB   3  
ATOM 4530  C CG   . MET A 1 64  ? -17.642 -0.588  2.898   1.00 1.00 ? 84  MET A CG   3  
ATOM 4531  S SD   . MET A 1 64  ? -16.195 -0.889  1.852   1.00 1.00 ? 84  MET A SD   3  
ATOM 4532  C CE   . MET A 1 64  ? -14.960 -1.170  3.139   1.00 1.00 ? 84  MET A CE   3  
ATOM 4533  H H    . MET A 1 64  ? -18.063 -0.896  6.581   1.00 1.00 ? 84  MET A H    3  
ATOM 4534  H HA   . MET A 1 64  ? -20.005 -1.246  4.402   1.00 1.00 ? 84  MET A HA   3  
ATOM 4535  H HB2  . MET A 1 64  ? -17.090 -2.100  4.272   1.00 0.00 ? 84  MET A HB2  3  
ATOM 4536  H HB3  . MET A 1 64  ? -18.302 -2.600  3.115   1.00 1.00 ? 84  MET A HB3  3  
ATOM 4537  H HG2  . MET A 1 64  ? -18.441 -0.297  2.216   1.00 0.00 ? 84  MET A HG2  3  
ATOM 4538  H HG3  . MET A 1 64  ? -17.446 0.290   3.509   1.00 1.00 ? 84  MET A HG3  3  
ATOM 4539  H HE1  . MET A 1 64  ? -15.264 -1.996  3.777   1.00 1.00 ? 84  MET A HE1  3  
ATOM 4540  H HE2  . MET A 1 64  ? -14.017 -1.416  2.659   1.00 1.00 ? 84  MET A HE2  3  
ATOM 4541  H HE3  . MET A 1 64  ? -14.852 -0.272  3.750   1.00 1.00 ? 84  MET A HE3  3  
ATOM 4542  N N    . LYS A 1 65  ? -19.667 -3.980  4.838   1.00 1.00 ? 85  LYS A N    3  
ATOM 4543  C CA   . LYS A 1 65  ? -19.968 -5.355  5.282   1.00 1.00 ? 85  LYS A CA   3  
ATOM 4544  C C    . LYS A 1 65  ? -18.822 -6.291  4.843   1.00 1.00 ? 85  LYS A C    3  
ATOM 4545  O O    . LYS A 1 65  ? -17.763 -6.287  5.468   1.00 1.00 ? 85  LYS A O    3  
ATOM 4546  C CB   . LYS A 1 65  ? -21.376 -5.757  4.783   1.00 1.00 ? 85  LYS A CB   3  
ATOM 4547  C CG   . LYS A 1 65  ? -22.509 -4.787  5.168   1.00 1.00 ? 85  LYS A CG   3  
ATOM 4548  C CD   . LYS A 1 65  ? -23.840 -5.145  4.499   1.00 1.00 ? 85  LYS A CD   3  
ATOM 4549  C CE   . LYS A 1 65  ? -25.008 -4.410  5.161   1.00 1.00 ? 85  LYS A CE   3  
ATOM 4550  N NZ   . LYS A 1 65  ? -25.206 -3.057  4.601   1.00 1.00 ? 85  LYS A NZ   3  
ATOM 4551  H H    . LYS A 1 65  ? -19.685 -3.800  3.846   1.00 1.00 ? 85  LYS A H    3  
ATOM 4552  H HA   . LYS A 1 65  ? -19.984 -5.385  6.372   1.00 1.00 ? 85  LYS A HA   3  
ATOM 4553  H HB2  . LYS A 1 65  ? -21.380 -5.757  3.692   1.00 0.00 ? 85  LYS A HB2  3  
ATOM 4554  H HB3  . LYS A 1 65  ? -21.615 -6.753  5.155   1.00 1.00 ? 85  LYS A HB3  3  
ATOM 4555  H HG2  . LYS A 1 65  ? -22.718 -4.832  6.237   1.00 0.00 ? 85  LYS A HG2  3  
ATOM 4556  H HG3  . LYS A 1 65  ? -22.247 -3.758  4.924   1.00 1.00 ? 85  LYS A HG3  3  
ATOM 4557  H HD2  . LYS A 1 65  ? -23.791 -4.892  3.440   1.00 0.00 ? 85  LYS A HD2  3  
ATOM 4558  H HD3  . LYS A 1 65  ? -24.026 -6.210  4.613   1.00 1.00 ? 85  LYS A HD3  3  
ATOM 4559  H HE2  . LYS A 1 65  ? -25.954 -4.895  4.919   1.00 0.00 ? 85  LYS A HE2  3  
ATOM 4560  H HE3  . LYS A 1 65  ? -24.893 -4.403  6.249   1.00 1.00 ? 85  LYS A HE3  3  
ATOM 4561  H HZ1  . LYS A 1 65  ? -24.538 -2.902  3.832   1.00 0.00 ? 85  LYS A HZ1  3  
ATOM 4562  H HZ2  . LYS A 1 65  ? -26.167 -2.971  4.240   1.00 0.00 ? 85  LYS A HZ2  3  
ATOM 4563  N N    . ASN A 1 66  ? -18.955 -6.996  3.714   1.00 1.00 ? 86  ASN A N    3  
ATOM 4564  C CA   . ASN A 1 66  ? -17.911 -7.785  3.033   1.00 1.00 ? 86  ASN A CA   3  
ATOM 4565  C C    . ASN A 1 66  ? -17.131 -6.859  2.077   1.00 1.00 ? 86  ASN A C    3  
ATOM 4566  O O    . ASN A 1 66  ? -17.078 -7.054  0.868   1.00 1.00 ? 86  ASN A O    3  
ATOM 4567  C CB   . ASN A 1 66  ? -18.508 -9.045  2.370   1.00 1.00 ? 86  ASN A CB   3  
ATOM 4568  C CG   . ASN A 1 66  ? -19.806 -8.835  1.594   1.00 1.00 ? 86  ASN A CG   3  
ATOM 4569  O OD1  . ASN A 1 66  ? -19.851 -8.337  0.490   1.00 1.00 ? 86  ASN A OD1  3  
ATOM 4570  N ND2  . ASN A 1 66  ? -20.936 -9.160  2.166   1.00 1.00 ? 86  ASN A ND2  3  
ATOM 4571  H H    . ASN A 1 66  ? -19.793 -6.823  3.197   1.00 1.00 ? 86  ASN A H    3  
ATOM 4572  H HA   . ASN A 1 66  ? -17.179 -8.136  3.763   1.00 1.00 ? 86  ASN A HA   3  
ATOM 4573  H HB2  . ASN A 1 66  ? -17.868 -9.388  1.557   1.00 0.00 ? 86  ASN A HB2  3  
ATOM 4574  H HB3  . ASN A 1 66  ? -18.603 -9.850  3.098   1.00 1.00 ? 86  ASN A HB3  3  
ATOM 4575  H HD21 . ASN A 1 66  ? -20.938 -9.550  3.120   1.00 0.00 ? 86  ASN A HD21 3  
ATOM 4576  H HD22 . ASN A 1 66  ? -21.825 -9.028  1.663   1.00 0.00 ? 86  ASN A HD22 3  
ATOM 4577  N N    . GLN A 1 67  ? -16.575 -5.781  2.651   1.00 1.00 ? 87  GLN A N    3  
ATOM 4578  C CA   . GLN A 1 67  ? -15.832 -4.715  1.949   1.00 1.00 ? 87  GLN A CA   3  
ATOM 4579  C C    . GLN A 1 67  ? -16.601 -4.119  0.729   1.00 1.00 ? 87  GLN A C    3  
ATOM 4580  O O    . GLN A 1 67  ? -15.985 -3.731  -0.258  1.00 1.00 ? 87  GLN A O    3  
ATOM 4581  C CB   . GLN A 1 67  ? -14.425 -5.256  1.603   1.00 1.00 ? 87  GLN A CB   3  
ATOM 4582  C CG   . GLN A 1 67  ? -13.431 -4.197  1.110   1.00 1.00 ? 87  GLN A CG   3  
ATOM 4583  C CD   . GLN A 1 67  ? -12.091 -4.761  0.645   1.00 1.00 ? 87  GLN A CD   3  
ATOM 4584  O OE1  . GLN A 1 67  ? -11.119 -4.803  1.379   1.00 1.00 ? 87  GLN A OE1  3  
ATOM 4585  N NE2  . GLN A 1 67  ? -11.957 -5.206  -0.589  1.00 1.00 ? 87  GLN A NE2  3  
ATOM 4586  H H    . GLN A 1 67  ? -16.844 -5.694  3.624   1.00 1.00 ? 87  GLN A H    3  
ATOM 4587  H HA   . GLN A 1 67  ? -15.692 -3.896  2.651   1.00 1.00 ? 87  GLN A HA   3  
ATOM 4588  H HB2  . GLN A 1 67  ? -13.977 -5.682  2.500   1.00 0.00 ? 87  GLN A HB2  3  
ATOM 4589  H HB3  . GLN A 1 67  ? -14.518 -6.024  0.836   1.00 1.00 ? 87  GLN A HB3  3  
ATOM 4590  H HG2  . GLN A 1 67  ? -13.814 -3.704  0.217   1.00 0.00 ? 87  GLN A HG2  3  
ATOM 4591  H HG3  . GLN A 1 67  ? -13.268 -3.446  1.878   1.00 1.00 ? 87  GLN A HG3  3  
ATOM 4592  H HE21 . GLN A 1 67  ? -12.757 -5.172  -1.237  1.00 0.00 ? 87  GLN A HE21 3  
ATOM 4593  H HE22 . GLN A 1 67  ? -11.053 -5.585  -0.905  1.00 0.00 ? 87  GLN A HE22 3  
ATOM 4594  N N    . VAL A 1 68  ? -17.947 -4.057  0.780   1.00 1.00 ? 88  VAL A N    3  
ATOM 4595  C CA   . VAL A 1 68  ? -18.856 -3.616  -0.301  1.00 1.00 ? 88  VAL A CA   3  
ATOM 4596  C C    . VAL A 1 68  ? -19.209 -2.122  -0.179  1.00 1.00 ? 88  VAL A C    3  
ATOM 4597  O O    . VAL A 1 68  ? -19.896 -1.729  0.768   1.00 1.00 ? 88  VAL A O    3  
ATOM 4598  C CB   . VAL A 1 68  ? -20.129 -4.512  -0.412  1.00 1.00 ? 88  VAL A CB   3  
ATOM 4599  C CG1  . VAL A 1 68  ? -21.294 -3.886  -1.208  1.00 1.00 ? 88  VAL A CG1  3  
ATOM 4600  C CG2  . VAL A 1 68  ? -19.773 -5.822  -1.134  1.00 1.00 ? 88  VAL A CG2  3  
ATOM 4601  H H    . VAL A 1 68  ? -18.372 -4.407  1.618   1.00 1.00 ? 88  VAL A H    3  
ATOM 4602  H HA   . VAL A 1 68  ? -18.334 -3.752  -1.234  1.00 1.00 ? 88  VAL A HA   3  
ATOM 4603  H HB   . VAL A 1 68  ? -20.499 -4.746  0.589   1.00 1.00 ? 88  VAL A HB   3  
ATOM 4604  H HG11 . VAL A 1 68  ? -20.951 -3.564  -2.193  1.00 1.00 ? 88  VAL A HG11 3  
ATOM 4605  H HG12 . VAL A 1 68  ? -22.100 -4.612  -1.329  1.00 1.00 ? 88  VAL A HG12 3  
ATOM 4606  H HG13 . VAL A 1 68  ? -21.699 -3.032  -0.665  1.00 1.00 ? 88  VAL A HG13 3  
ATOM 4607  H HG21 . VAL A 1 68  ? -19.374 -5.629  -2.129  1.00 1.00 ? 88  VAL A HG21 3  
ATOM 4608  H HG22 . VAL A 1 68  ? -19.012 -6.346  -0.562  1.00 1.00 ? 88  VAL A HG22 3  
ATOM 4609  H HG23 . VAL A 1 68  ? -20.650 -6.466  -1.220  1.00 1.00 ? 88  VAL A HG23 3  
ATOM 4610  N N    . ALA A 1 69  ? -18.785 -1.317  -1.170  1.00 1.00 ? 89  ALA A N    3  
ATOM 4611  C CA   . ALA A 1 69  ? -19.158 0.104   -1.345  1.00 1.00 ? 89  ALA A CA   3  
ATOM 4612  C C    . ALA A 1 69  ? -19.531 0.433   -2.815  1.00 1.00 ? 89  ALA A C    3  
ATOM 4613  O O    . ALA A 1 69  ? -19.017 -0.180  -3.757  1.00 1.00 ? 89  ALA A O    3  
ATOM 4614  C CB   . ALA A 1 69  ? -18.094 1.050   -0.763  1.00 1.00 ? 89  ALA A CB   3  
ATOM 4615  H H    . ALA A 1 69  ? -18.201 -1.744  -1.890  1.00 1.00 ? 89  ALA A H    3  
ATOM 4616  H HA   . ALA A 1 69  ? -20.060 0.266   -0.753  1.00 1.00 ? 89  ALA A HA   3  
ATOM 4617  H HB1  . ALA A 1 69  ? -17.873 0.786   0.270   1.00 1.00 ? 89  ALA A HB1  3  
ATOM 4618  H HB2  . ALA A 1 69  ? -17.181 1.017   -1.347  1.00 1.00 ? 89  ALA A HB2  3  
ATOM 4619  H HB3  . ALA A 1 69  ? -18.469 2.072   -0.773  1.00 1.00 ? 89  ALA A HB3  3  
ATOM 4620  N N    . ARG A 1 70  ? -20.471 1.380   -2.996  1.00 1.00 ? 90  ARG A N    3  
ATOM 4621  C CA   . ARG A 1 70  ? -21.085 1.814   -4.268  1.00 1.00 ? 90  ARG A CA   3  
ATOM 4622  C C    . ARG A 1 70  ? -20.751 3.278   -4.596  1.00 1.00 ? 90  ARG A C    3  
ATOM 4623  O O    . ARG A 1 70  ? -20.589 4.108   -3.702  1.00 1.00 ? 90  ARG A O    3  
ATOM 4624  C CB   . ARG A 1 70  ? -22.619 1.641   -4.185  1.00 1.00 ? 90  ARG A CB   3  
ATOM 4625  C CG   . ARG A 1 70  ? -23.120 0.194   -4.226  1.00 1.00 ? 90  ARG A CG   3  
ATOM 4626  C CD   . ARG A 1 70  ? -23.493 -0.430  -2.876  1.00 1.00 ? 90  ARG A CD   3  
ATOM 4627  N NE   . ARG A 1 70  ? -24.893 -0.918  -2.876  1.00 1.00 ? 90  ARG A NE   3  
ATOM 4628  C CZ   . ARG A 1 70  ? -25.405 -1.879  -3.639  1.00 1.00 ? 90  ARG A CZ   3  
ATOM 4629  N NH1  . ARG A 1 70  ? -24.688 -2.525  -4.522  1.00 1.00 ? 90  ARG A NH1  3  
ATOM 4630  N NH2  . ARG A 1 70  ? -26.655 -2.238  -3.547  1.00 1.00 ? 90  ARG A NH2  3  
ATOM 4631  H H    . ARG A 1 70  ? -20.728 1.924   -2.185  1.00 1.00 ? 90  ARG A H    3  
ATOM 4632  H HA   . ARG A 1 70  ? -20.691 1.199   -5.081  1.00 1.00 ? 90  ARG A HA   3  
ATOM 4633  H HB2  . ARG A 1 70  ? -23.001 2.017   -3.236  1.00 0.00 ? 90  ARG A HB2  3  
ATOM 4634  H HB3  . ARG A 1 70  ? -23.115 2.188   -4.990  1.00 1.00 ? 90  ARG A HB3  3  
ATOM 4635  H HG2  . ARG A 1 70  ? -24.120 0.102   -4.649  1.00 0.00 ? 90  ARG A HG2  3  
ATOM 4636  H HG3  . ARG A 1 70  ? -22.482 -0.459  -4.824  1.00 1.00 ? 90  ARG A HG3  3  
ATOM 4637  H HD2  . ARG A 1 70  ? -22.916 -1.334  -2.682  1.00 0.00 ? 90  ARG A HD2  3  
ATOM 4638  H HD3  . ARG A 1 70  ? -23.306 0.262   -2.049  1.00 1.00 ? 90  ARG A HD3  3  
ATOM 4639  H HE   . ARG A 1 70  ? -25.562 -0.412  -2.320  1.00 1.00 ? 90  ARG A HE   3  
ATOM 4640  H HH11 . ARG A 1 70  ? -23.693 -2.296  -4.645  1.00 0.00 ? 90  ARG A HH11 3  
ATOM 4641  H HH12 . ARG A 1 70  ? -25.122 -3.263  -5.095  1.00 0.00 ? 90  ARG A HH12 3  
ATOM 4642  H HH21 . ARG A 1 70  ? -27.275 -1.774  -2.868  1.00 0.00 ? 90  ARG A HH21 3  
ATOM 4643  H HH22 . ARG A 1 70  ? -27.021 -2.986  -4.152  1.00 0.00 ? 90  ARG A HH22 3  
ATOM 4644  N N    . PHE A 1 71  ? -20.750 3.584   -5.899  1.00 1.00 ? 91  PHE A N    3  
ATOM 4645  C CA   . PHE A 1 71  ? -20.397 4.881   -6.496  1.00 1.00 ? 91  PHE A CA   3  
ATOM 4646  C C    . PHE A 1 71  ? -18.965 5.338   -6.113  1.00 1.00 ? 91  PHE A C    3  
ATOM 4647  O O    . PHE A 1 71  ? -18.042 4.522   -6.159  1.00 1.00 ? 91  PHE A O    3  
ATOM 4648  C CB   . PHE A 1 71  ? -21.550 5.856   -6.177  1.00 1.00 ? 91  PHE A CB   3  
ATOM 4649  C CG   . PHE A 1 71  ? -21.694 7.050   -7.091  1.00 1.00 ? 91  PHE A CG   3  
ATOM 4650  C CD1  . PHE A 1 71  ? -22.065 6.847   -8.439  1.00 1.00 ? 91  PHE A CD1  3  
ATOM 4651  C CD2  . PHE A 1 71  ? -21.484 8.361   -6.603  1.00 1.00 ? 91  PHE A CD2  3  
ATOM 4652  C CE1  . PHE A 1 71  ? -22.220 7.952   -9.301  1.00 1.00 ? 91  PHE A CE1  3  
ATOM 4653  C CE2  . PHE A 1 71  ? -21.641 9.465   -7.466  1.00 1.00 ? 91  PHE A CE2  3  
ATOM 4654  C CZ   . PHE A 1 71  ? -22.011 9.261   -8.814  1.00 1.00 ? 91  PHE A CZ   3  
ATOM 4655  H H    . PHE A 1 71  ? -20.920 2.804   -6.510  1.00 1.00 ? 91  PHE A H    3  
ATOM 4656  H HA   . PHE A 1 71  ? -20.380 4.736   -7.577  1.00 1.00 ? 91  PHE A HA   3  
ATOM 4657  H HB2  . PHE A 1 71  ? -22.521 5.403   -6.378  1.00 0.00 ? 91  PHE A HB2  3  
ATOM 4658  H HB3  . PHE A 1 71  ? -21.540 6.156   -5.126  1.00 1.00 ? 91  PHE A HB3  3  
ATOM 4659  H HD1  . PHE A 1 71  ? -22.241 5.847   -8.811  1.00 1.00 ? 91  PHE A HD1  3  
ATOM 4660  H HD2  . PHE A 1 71  ? -21.219 8.529   -5.566  1.00 1.00 ? 91  PHE A HD2  3  
ATOM 4661  H HE1  . PHE A 1 71  ? -22.511 7.796   -10.330 1.00 1.00 ? 91  PHE A HE1  3  
ATOM 4662  H HE2  . PHE A 1 71  ? -21.488 10.464  -7.087  1.00 1.00 ? 91  PHE A HE2  3  
ATOM 4663  H HZ   . PHE A 1 71  ? -22.151 10.108  -9.472  1.00 1.00 ? 91  PHE A HZ   3  
ATOM 4664  N N    . ASN A 1 72  ? -18.753 6.626   -5.805  1.00 1.00 ? 92  ASN A N    3  
ATOM 4665  C CA   . ASN A 1 72  ? -17.512 7.188   -5.265  1.00 1.00 ? 92  ASN A CA   3  
ATOM 4666  C C    . ASN A 1 72  ? -17.812 8.223   -4.155  1.00 1.00 ? 92  ASN A C    3  
ATOM 4667  O O    . ASN A 1 72  ? -18.704 9.057   -4.315  1.00 1.00 ? 92  ASN A O    3  
ATOM 4668  C CB   . ASN A 1 72  ? -16.655 7.782   -6.405  1.00 1.00 ? 92  ASN A CB   3  
ATOM 4669  C CG   . ASN A 1 72  ? -15.182 7.970   -6.037  1.00 1.00 ? 92  ASN A CG   3  
ATOM 4670  O OD1  . ASN A 1 72  ? -14.713 7.615   -4.967  1.00 1.00 ? 92  ASN A OD1  3  
ATOM 4671  N ND2  . ASN A 1 72  ? -14.383 8.541   -6.906  1.00 1.00 ? 92  ASN A ND2  3  
ATOM 4672  H H    . ASN A 1 72  ? -19.558 7.236   -5.820  1.00 1.00 ? 92  ASN A H    3  
ATOM 4673  H HA   . ASN A 1 72  ? -16.949 6.363   -4.817  1.00 1.00 ? 92  ASN A HA   3  
ATOM 4674  H HB2  . ASN A 1 72  ? -16.607 7.095   -7.250  1.00 0.00 ? 92  ASN A HB2  3  
ATOM 4675  H HB3  . ASN A 1 72  ? -17.080 8.726   -6.755  1.00 1.00 ? 92  ASN A HB3  3  
ATOM 4676  H HD21 . ASN A 1 72  ? -14.751 8.854   -7.816  1.00 0.00 ? 92  ASN A HD21 3  
ATOM 4677  H HD22 . ASN A 1 72  ? -13.387 8.677   -6.678  1.00 0.00 ? 92  ASN A HD22 3  
ATOM 4678  N N    . ASP A 1 73  ? -17.029 8.165   -3.065  1.00 1.00 ? 93  ASP A N    3  
ATOM 4679  C CA   . ASP A 1 73  ? -17.057 9.047   -1.876  1.00 1.00 ? 93  ASP A CA   3  
ATOM 4680  C C    . ASP A 1 73  ? -16.074 8.590   -0.767  1.00 1.00 ? 93  ASP A C    3  
ATOM 4681  O O    . ASP A 1 73  ? -16.455 8.128   0.310   1.00 1.00 ? 93  ASP A O    3  
ATOM 4682  C CB   . ASP A 1 73  ? -18.495 9.278   -1.356  1.00 1.00 ? 93  ASP A CB   3  
ATOM 4683  C CG   . ASP A 1 73  ? -18.608 10.464  -0.381  1.00 1.00 ? 93  ASP A CG   3  
ATOM 4684  O OD1  . ASP A 1 73  ? -17.959 11.502  -0.641  1.00 1.00 ? 93  ASP A OD1  3  
ATOM 4685  O OD2  . ASP A 1 73  ? -19.373 10.334  0.604   1.00 1.00 ? 93  ASP A OD2  3  
ATOM 4686  H H    . ASP A 1 73  ? -16.253 7.516   -3.142  1.00 1.00 ? 93  ASP A H    3  
ATOM 4687  H HA   . ASP A 1 73  ? -16.697 10.023  -2.210  1.00 1.00 ? 93  ASP A HA   3  
ATOM 4688  H HB2  . ASP A 1 73  ? -19.213 9.488   -2.149  1.00 0.00 ? 93  ASP A HB2  3  
ATOM 4689  H HB3  . ASP A 1 73  ? -18.898 8.363   -0.917  1.00 1.00 ? 93  ASP A HB3  3  
ATOM 4690  N N    . LEU A 1 74  ? -14.782 8.699   -1.096  1.00 1.00 ? 94  LEU A N    3  
ATOM 4691  C CA   . LEU A 1 74  ? -13.607 8.518   -0.232  1.00 1.00 ? 94  LEU A CA   3  
ATOM 4692  C C    . LEU A 1 74  ? -12.382 9.204   -0.883  1.00 1.00 ? 94  LEU A C    3  
ATOM 4693  O O    . LEU A 1 74  ? -12.285 9.157   -2.117  1.00 1.00 ? 94  LEU A O    3  
ATOM 4694  C CB   . LEU A 1 74  ? -13.383 7.020   0.070   1.00 1.00 ? 94  LEU A CB   3  
ATOM 4695  C CG   . LEU A 1 74  ? -13.299 5.991   -1.074  1.00 1.00 ? 94  LEU A CG   3  
ATOM 4696  C CD1  . LEU A 1 74  ? -12.065 5.121   -0.817  1.00 1.00 ? 94  LEU A CD1  3  
ATOM 4697  C CD2  . LEU A 1 74  ? -14.549 5.102   -1.145  1.00 1.00 ? 94  LEU A CD2  3  
ATOM 4698  H H    . LEU A 1 74  ? -14.597 8.998   -2.045  1.00 1.00 ? 94  LEU A H    3  
ATOM 4699  H HA   . LEU A 1 74  ? -13.810 9.032   0.701   1.00 1.00 ? 94  LEU A HA   3  
ATOM 4700  H HB2  . LEU A 1 74  ? -12.353 6.841   0.380   1.00 0.00 ? 94  LEU A HB2  3  
ATOM 4701  H HB3  . LEU A 1 74  ? -14.045 6.685   0.870   1.00 1.00 ? 94  LEU A HB3  3  
ATOM 4702  H HG   . LEU A 1 74  ? -13.170 6.498   -2.030  1.00 1.00 ? 94  LEU A HG   3  
ATOM 4703  H HD11 . LEU A 1 74  ? -12.151 4.617   0.147   1.00 1.00 ? 94  LEU A HD11 3  
ATOM 4704  H HD12 . LEU A 1 74  ? -11.976 4.371   -1.600  1.00 1.00 ? 94  LEU A HD12 3  
ATOM 4705  H HD13 . LEU A 1 74  ? -11.170 5.743   -0.830  1.00 1.00 ? 94  LEU A HD13 3  
ATOM 4706  H HD21 . LEU A 1 74  ? -14.682 4.553   -0.212  1.00 1.00 ? 94  LEU A HD21 3  
ATOM 4707  H HD22 . LEU A 1 74  ? -15.434 5.711   -1.327  1.00 1.00 ? 94  LEU A HD22 3  
ATOM 4708  H HD23 . LEU A 1 74  ? -14.446 4.387   -1.961  1.00 1.00 ? 94  LEU A HD23 3  
ATOM 4709  N N    . ARG A 1 75  ? -11.457 9.848   -0.121  1.00 1.00 ? 95  ARG A N    3  
ATOM 4710  C CA   . ARG A 1 75  ? -10.400 10.668  -0.789  1.00 1.00 ? 95  ARG A CA   3  
ATOM 4711  C C    . ARG A 1 75  ? -9.028  10.559  -0.134  1.00 1.00 ? 95  ARG A C    3  
ATOM 4712  O O    . ARG A 1 75  ? -8.868  11.002  1.003   1.00 1.00 ? 95  ARG A O    3  
ATOM 4713  C CB   . ARG A 1 75  ? -10.825 12.145  -0.830  1.00 1.00 ? 95  ARG A CB   3  
ATOM 4714  C CG   . ARG A 1 75  ? -11.921 12.459  -1.854  1.00 1.00 ? 95  ARG A CG   3  
ATOM 4715  C CD   . ARG A 1 75  ? -12.421 13.902  -1.703  1.00 1.00 ? 95  ARG A CD   3  
ATOM 4716  N NE   . ARG A 1 75  ? -11.345 14.891  -1.900  1.00 1.00 ? 95  ARG A NE   3  
ATOM 4717  C CZ   . ARG A 1 75  ? -11.493 16.136  -2.301  1.00 1.00 ? 95  ARG A CZ   3  
ATOM 4718  N NH1  . ARG A 1 75  ? -12.656 16.656  -2.554  1.00 1.00 ? 95  ARG A NH1  3  
ATOM 4719  N NH2  . ARG A 1 75  ? -10.460 16.907  -2.466  1.00 1.00 ? 95  ARG A NH2  3  
ATOM 4720  H H    . ARG A 1 75  ? -11.425 9.721   0.907   1.00 1.00 ? 95  ARG A H    3  
ATOM 4721  H HA   . ARG A 1 75  ? -10.284 10.346  -1.831  1.00 1.00 ? 95  ARG A HA   3  
ATOM 4722  H HB2  . ARG A 1 75  ? -11.236 12.425  0.140   1.00 0.00 ? 95  ARG A HB2  3  
ATOM 4723  H HB3  . ARG A 1 75  ? -9.955  12.761  -1.056  1.00 1.00 ? 95  ARG A HB3  3  
ATOM 4724  H HG2  . ARG A 1 75  ? -11.544 12.353  -2.871  1.00 0.00 ? 95  ARG A HG2  3  
ATOM 4725  H HG3  . ARG A 1 75  ? -12.767 11.785  -1.737  1.00 1.00 ? 95  ARG A HG3  3  
ATOM 4726  H HD2  . ARG A 1 75  ? -13.156 14.131  -2.476  1.00 0.00 ? 95  ARG A HD2  3  
ATOM 4727  H HD3  . ARG A 1 75  ? -12.888 14.040  -0.730  1.00 1.00 ? 95  ARG A HD3  3  
ATOM 4728  H HE   . ARG A 1 75  ? -10.409 14.582  -1.696  1.00 1.00 ? 95  ARG A HE   3  
ATOM 4729  H HH11 . ARG A 1 75  ? -13.509 16.089  -2.443  1.00 0.00 ? 95  ARG A HH11 3  
ATOM 4730  H HH12 . ARG A 1 75  ? -12.726 17.635  -2.866  1.00 0.00 ? 95  ARG A HH12 3  
ATOM 4731  H HH21 . ARG A 1 75  ? -9.514  16.544  -2.282  1.00 0.00 ? 95  ARG A HH21 3  
ATOM 4732  H HH22 . ARG A 1 75  ? -10.588 17.879  -2.780  1.00 0.00 ? 95  ARG A HH22 3  
ATOM 4733  N N    . PHE A 1 76  ? -8.036  10.060  -0.879  1.00 1.00 ? 96  PHE A N    3  
ATOM 4734  C CA   . PHE A 1 76  ? -6.689  9.793   -0.381  1.00 1.00 ? 96  PHE A CA   3  
ATOM 4735  C C    . PHE A 1 76  ? -5.714  10.952  -0.619  1.00 1.00 ? 96  PHE A C    3  
ATOM 4736  O O    . PHE A 1 76  ? -5.813  11.715  -1.589  1.00 1.00 ? 96  PHE A O    3  
ATOM 4737  C CB   . PHE A 1 76  ? -6.066  8.521   -0.982  1.00 1.00 ? 96  PHE A CB   3  
ATOM 4738  C CG   . PHE A 1 76  ? -6.613  7.741   -2.166  1.00 1.00 ? 96  PHE A CG   3  
ATOM 4739  C CD1  . PHE A 1 76  ? -7.951  7.280   -2.213  1.00 1.00 ? 96  PHE A CD1  3  
ATOM 4740  C CD2  . PHE A 1 76  ? -5.712  7.366   -3.189  1.00 1.00 ? 96  PHE A CD2  3  
ATOM 4741  C CE1  . PHE A 1 76  ? -8.384  6.466   -3.283  1.00 1.00 ? 96  PHE A CE1  3  
ATOM 4742  C CE2  . PHE A 1 76  ? -6.135  6.521   -4.236  1.00 1.00 ? 96  PHE A CE2  3  
ATOM 4743  C CZ   . PHE A 1 76  ? -7.476  6.081   -4.291  1.00 1.00 ? 96  PHE A CZ   3  
ATOM 4744  H H    . PHE A 1 76  ? -8.231  9.906   -1.867  1.00 1.00 ? 96  PHE A H    3  
ATOM 4745  H HA   . PHE A 1 76  ? -6.760  9.623   0.700   1.00 1.00 ? 96  PHE A HA   3  
ATOM 4746  H HB2  . PHE A 1 76  ? -5.307  8.730   -1.735  1.00 0.00 ? 96  PHE A HB2  3  
ATOM 4747  H HB3  . PHE A 1 76  ? -5.578  7.892   -0.240  1.00 1.00 ? 96  PHE A HB3  3  
ATOM 4748  H HD1  . PHE A 1 76  ? -8.651  7.527   -1.431  1.00 1.00 ? 96  PHE A HD1  3  
ATOM 4749  H HD2  . PHE A 1 76  ? -4.684  7.702   -3.156  1.00 1.00 ? 96  PHE A HD2  3  
ATOM 4750  H HE1  . PHE A 1 76  ? -9.412  6.131   -3.318  1.00 1.00 ? 96  PHE A HE1  3  
ATOM 4751  H HE2  . PHE A 1 76  ? -5.432  6.214   -4.995  1.00 1.00 ? 96  PHE A HE2  3  
ATOM 4752  H HZ   . PHE A 1 76  ? -7.803  5.448   -5.105  1.00 1.00 ? 96  PHE A HZ   3  
ATOM 4753  N N    . VAL A 1 77  ? -4.716  10.995  0.272   1.00 1.00 ? 97  VAL A N    3  
ATOM 4754  C CA   . VAL A 1 77  ? -3.511  11.845  0.262   1.00 1.00 ? 97  VAL A CA   3  
ATOM 4755  C C    . VAL A 1 77  ? -3.789  13.351  0.017   1.00 1.00 ? 97  VAL A C    3  
ATOM 4756  O O    . VAL A 1 77  ? -2.990  14.079  -0.579  1.00 1.00 ? 97  VAL A O    3  
ATOM 4757  C CB   . VAL A 1 77  ? -2.402  11.179  -0.617  1.00 1.00 ? 97  VAL A CB   3  
ATOM 4758  C CG1  . VAL A 1 77  ? -2.254  9.651   -0.407  1.00 1.00 ? 97  VAL A CG1  3  
ATOM 4759  C CG2  . VAL A 1 77  ? -2.597  11.343  -2.127  1.00 1.00 ? 97  VAL A CG2  3  
ATOM 4760  H H    . VAL A 1 77  ? -4.792  10.344  1.038   1.00 1.00 ? 97  VAL A H    3  
ATOM 4761  H HA   . VAL A 1 77  ? -3.141  11.820  1.288   1.00 1.00 ? 97  VAL A HA   3  
ATOM 4762  H HB   . VAL A 1 77  ? -1.455  11.651  -0.351  1.00 1.00 ? 97  VAL A HB   3  
ATOM 4763  H HG11 . VAL A 1 77  ? -2.311  9.394   0.645   1.00 1.00 ? 97  VAL A HG11 3  
ATOM 4764  H HG12 . VAL A 1 77  ? -3.058  9.107   -0.911  1.00 1.00 ? 97  VAL A HG12 3  
ATOM 4765  H HG13 . VAL A 1 77  ? -1.298  9.304   -0.808  1.00 1.00 ? 97  VAL A HG13 3  
ATOM 4766  H HG21 . VAL A 1 77  ? -2.629  12.389  -2.385  1.00 1.00 ? 97  VAL A HG21 3  
ATOM 4767  H HG22 . VAL A 1 77  ? -1.761  10.891  -2.663  1.00 1.00 ? 97  VAL A HG22 3  
ATOM 4768  H HG23 . VAL A 1 77  ? -3.519  10.868  -2.462  1.00 1.00 ? 97  VAL A HG23 3  
ATOM 4769  N N    . GLY A 1 78  ? -4.940  13.820  0.525   1.00 1.00 ? 98  GLY A N    3  
ATOM 4770  C CA   . GLY A 1 78  ? -5.601  15.129  0.410   1.00 1.00 ? 98  GLY A CA   3  
ATOM 4771  C C    . GLY A 1 78  ? -4.892  16.351  1.015   1.00 1.00 ? 98  GLY A C    3  
ATOM 4772  O O    . GLY A 1 78  ? -5.588  17.320  1.346   1.00 1.00 ? 98  GLY A O    3  
ATOM 4773  H H    . GLY A 1 78  ? -5.346  13.163  1.186   1.00 1.00 ? 98  GLY A H    3  
ATOM 4774  H HA2  . GLY A 1 78  ? -5.780  15.350  -0.637  1.00 1.00 ? 98  GLY A HA2  3  
ATOM 4775  H HA3  . GLY A 1 78  ? -6.574  15.044  0.892   1.00 1.00 ? 98  GLY A HA3  3  
ATOM 4776  N N    . ARG A 1 79  ? -3.550  16.322  1.139   1.00 1.00 ? 99  ARG A N    3  
ATOM 4777  C CA   . ARG A 1 79  ? -2.654  17.305  1.757   1.00 1.00 ? 99  ARG A CA   3  
ATOM 4778  C C    . ARG A 1 79  ? -1.217  17.194  1.203   1.00 1.00 ? 99  ARG A C    3  
ATOM 4779  O O    . ARG A 1 79  ? -0.618  16.120  1.075   1.00 1.00 ? 99  ARG A O    3  
ATOM 4780  C CB   . ARG A 1 79  ? -2.662  17.104  3.286   1.00 1.00 ? 99  ARG A CB   3  
ATOM 4781  C CG   . ARG A 1 79  ? -3.842  17.826  3.956   1.00 1.00 ? 99  ARG A CG   3  
ATOM 4782  C CD   . ARG A 1 79  ? -3.506  19.076  4.794   1.00 1.00 ? 99  ARG A CD   3  
ATOM 4783  N NE   . ARG A 1 79  ? -2.757  20.103  4.036   1.00 1.00 ? 99  ARG A NE   3  
ATOM 4784  C CZ   . ARG A 1 79  ? -1.507  20.507  4.241   1.00 1.00 ? 99  ARG A CZ   3  
ATOM 4785  N NH1  . ARG A 1 79  ? -0.736  20.072  5.200   1.00 1.00 ? 99  ARG A NH1  3  
ATOM 4786  N NH2  . ARG A 1 79  ? -0.957  21.379  3.450   1.00 1.00 ? 99  ARG A NH2  3  
ATOM 4787  H H    . ARG A 1 79  ? -3.067  15.579  0.645   1.00 1.00 ? 99  ARG A H    3  
ATOM 4788  H HA   . ARG A 1 79  ? -3.045  18.302  1.537   1.00 1.00 ? 99  ARG A HA   3  
ATOM 4789  H HB2  . ARG A 1 79  ? -2.854  16.069  3.565   1.00 0.00 ? 99  ARG A HB2  3  
ATOM 4790  H HB3  . ARG A 1 79  ? -1.708  17.379  3.743   1.00 1.00 ? 99  ARG A HB3  3  
ATOM 4791  H HG2  . ARG A 1 79  ? -4.510  18.204  3.181   1.00 0.00 ? 99  ARG A HG2  3  
ATOM 4792  H HG3  . ARG A 1 79  ? -4.372  17.119  4.593   1.00 1.00 ? 99  ARG A HG3  3  
ATOM 4793  H HD2  . ARG A 1 79  ? -4.423  19.595  5.072   1.00 0.00 ? 99  ARG A HD2  3  
ATOM 4794  H HD3  . ARG A 1 79  ? -2.974  18.785  5.700   1.00 1.00 ? 99  ARG A HD3  3  
ATOM 4795  H HE   . ARG A 1 79  ? -3.253  20.582  3.303   1.00 1.00 ? 99  ARG A HE   3  
ATOM 4796  H HH11 . ARG A 1 79  ? -1.087  19.366  5.863   1.00 0.00 ? 99  ARG A HH11 3  
ATOM 4797  H HH12 . ARG A 1 79  ? 0.224   20.434  5.294   1.00 0.00 ? 99  ARG A HH12 3  
ATOM 4798  H HH21 . ARG A 1 79  ? -1.489  21.763  2.658   1.00 0.00 ? 99  ARG A HH21 3  
ATOM 4799  H HH22 . ARG A 1 79  ? 0.013   21.686  3.617   1.00 0.00 ? 99  ARG A HH22 3  
ATOM 4800  N N    . SER A 1 80  ? -0.685  18.365  0.873   1.00 1.00 ? 100 SER A N    3  
ATOM 4801  C CA   . SER A 1 80  ? 0.711   18.672  0.492   1.00 1.00 ? 100 SER A CA   3  
ATOM 4802  C C    . SER A 1 80  ? 1.658   18.477  1.702   1.00 1.00 ? 100 SER A C    3  
ATOM 4803  O O    . SER A 1 80  ? 1.807   19.385  2.528   1.00 1.00 ? 100 SER A O    3  
ATOM 4804  C CB   . SER A 1 80  ? 0.811   20.091  -0.107  1.00 1.00 ? 100 SER A CB   3  
ATOM 4805  O OG   . SER A 1 80  ? 0.566   21.067  0.882   1.00 1.00 ? 100 SER A OG   3  
ATOM 4806  H H    . SER A 1 80  ? -1.395  19.072  0.881   1.00 1.00 ? 100 SER A H    3  
ATOM 4807  H HA   . SER A 1 80  ? 1.015   17.981  -0.295  1.00 1.00 ? 100 SER A HA   3  
ATOM 4808  H HB2  . SER A 1 80  ? 1.817   20.298  -0.472  1.00 0.00 ? 100 SER A HB2  3  
ATOM 4809  H HB3  . SER A 1 80  ? 0.126   20.217  -0.944  1.00 1.00 ? 100 SER A HB3  3  
ATOM 4810  H HG   . SER A 1 80  ? 1.111   20.778  1.637   1.00 1.00 ? 100 SER A HG   3  
ATOM 4811  N N    . GLY A 1 81  ? 2.227   17.268  1.812   1.00 1.00 ? 101 GLY A N    3  
ATOM 4812  C CA   . GLY A 1 81  ? 3.101   16.782  2.894   1.00 1.00 ? 101 GLY A CA   3  
ATOM 4813  C C    . GLY A 1 81  ? 4.468   16.271  2.399   1.00 1.00 ? 101 GLY A C    3  
ATOM 4814  O O    . GLY A 1 81  ? 5.132   16.935  1.603   1.00 1.00 ? 101 GLY A O    3  
ATOM 4815  H H    . GLY A 1 81  ? 2.013   16.613  1.078   1.00 1.00 ? 101 GLY A H    3  
ATOM 4816  H HA2  . GLY A 1 81  ? 3.282   17.585  3.613   1.00 1.00 ? 101 GLY A HA2  3  
ATOM 4817  H HA3  . GLY A 1 81  ? 2.579   15.979  3.414   1.00 1.00 ? 101 GLY A HA3  3  
ATOM 4818  N N    . ARG A 1 82  ? 4.893   15.096  2.892   1.00 1.00 ? 102 ARG A N    3  
ATOM 4819  C CA   . ARG A 1 82  ? 6.127   14.378  2.490   1.00 1.00 ? 102 ARG A CA   3  
ATOM 4820  C C    . ARG A 1 82  ? 6.067   13.874  1.027   1.00 1.00 ? 102 ARG A C    3  
ATOM 4821  O O    . ARG A 1 82  ? 5.000   13.835  0.407   1.00 1.00 ? 102 ARG A O    3  
ATOM 4822  C CB   . ARG A 1 82  ? 6.375   13.195  3.456   1.00 1.00 ? 102 ARG A CB   3  
ATOM 4823  C CG   . ARG A 1 82  ? 6.191   13.449  4.962   1.00 1.00 ? 102 ARG A CG   3  
ATOM 4824  C CD   . ARG A 1 82  ? 7.245   14.327  5.647   1.00 1.00 ? 102 ARG A CD   3  
ATOM 4825  N NE   . ARG A 1 82  ? 6.829   14.728  7.009   1.00 1.00 ? 102 ARG A NE   3  
ATOM 4826  C CZ   . ARG A 1 82  ? 6.956   14.015  8.124   1.00 1.00 ? 102 ARG A CZ   3  
ATOM 4827  N NH1  . ARG A 1 82  ? 7.549   12.860  8.196   1.00 1.00 ? 102 ARG A NH1  3  
ATOM 4828  N NH2  . ARG A 1 82  ? 6.456   14.408  9.255   1.00 1.00 ? 102 ARG A NH2  3  
ATOM 4829  H H    . ARG A 1 82  ? 4.280   14.615  3.532   1.00 1.00 ? 102 ARG A H    3  
ATOM 4830  H HA   . ARG A 1 82  ? 6.967   15.073  2.553   1.00 1.00 ? 102 ARG A HA   3  
ATOM 4831  H HB2  . ARG A 1 82  ? 5.599   12.437  3.356   1.00 0.00 ? 102 ARG A HB2  3  
ATOM 4832  H HB3  . ARG A 1 82  ? 7.337   12.717  3.254   1.00 1.00 ? 102 ARG A HB3  3  
ATOM 4833  H HG2  . ARG A 1 82  ? 5.261   13.997  5.108   1.00 0.00 ? 102 ARG A HG2  3  
ATOM 4834  H HG3  . ARG A 1 82  ? 6.152   12.486  5.470   1.00 1.00 ? 102 ARG A HG3  3  
ATOM 4835  H HD2  . ARG A 1 82  ? 8.173   13.779  5.813   1.00 0.00 ? 102 ARG A HD2  3  
ATOM 4836  H HD3  . ARG A 1 82  ? 7.486   15.204  5.043   1.00 1.00 ? 102 ARG A HD3  3  
ATOM 4837  H HE   . ARG A 1 82  ? 6.382   15.620  7.115   1.00 1.00 ? 102 ARG A HE   3  
ATOM 4838  H HH11 . ARG A 1 82  ? 7.960   12.439  7.350   1.00 0.00 ? 102 ARG A HH11 3  
ATOM 4839  H HH12 . ARG A 1 82  ? 7.607   12.367  9.097   1.00 0.00 ? 102 ARG A HH12 3  
ATOM 4840  H HH21 . ARG A 1 82  ? 5.939   15.298  9.309   1.00 0.00 ? 102 ARG A HH21 3  
ATOM 4841  H HH22 . ARG A 1 82  ? 6.573   13.830  10.099  1.00 0.00 ? 102 ARG A HH22 3  
ATOM 4842  N N    . GLY A 1 83  ? 7.209   13.422  0.485   1.00 1.00 ? 103 GLY A N    3  
ATOM 4843  C CA   . GLY A 1 83  ? 7.309   12.807  -0.848  1.00 1.00 ? 103 GLY A CA   3  
ATOM 4844  C C    . GLY A 1 83  ? 6.606   11.442  -0.879  1.00 1.00 ? 103 GLY A C    3  
ATOM 4845  O O    . GLY A 1 83  ? 5.435   11.332  -1.253  1.00 1.00 ? 103 GLY A O    3  
ATOM 4846  H H    . GLY A 1 83  ? 8.030   13.446  1.072   1.00 1.00 ? 103 GLY A H    3  
ATOM 4847  H HA2  . GLY A 1 83  ? 6.846   13.460  -1.586  1.00 1.00 ? 103 GLY A HA2  3  
ATOM 4848  H HA3  . GLY A 1 83  ? 8.361   12.684  -1.112  1.00 1.00 ? 103 GLY A HA3  3  
ATOM 4849  N N    . LYS A 1 84  ? 7.313   10.412  -0.388  1.00 1.00 ? 104 LYS A N    3  
ATOM 4850  C CA   . LYS A 1 84  ? 6.834   9.034   -0.211  1.00 1.00 ? 104 LYS A CA   3  
ATOM 4851  C C    . LYS A 1 84  ? 5.803   8.987   0.937   1.00 1.00 ? 104 LYS A C    3  
ATOM 4852  O O    . LYS A 1 84  ? 6.161   8.892   2.118   1.00 1.00 ? 104 LYS A O    3  
ATOM 4853  C CB   . LYS A 1 84  ? 8.035   8.094   0.031   1.00 1.00 ? 104 LYS A CB   3  
ATOM 4854  C CG   . LYS A 1 84  ? 8.787   7.640   -1.230  1.00 1.00 ? 104 LYS A CG   3  
ATOM 4855  C CD   . LYS A 1 84  ? 9.697   8.680   -1.896  1.00 1.00 ? 104 LYS A CD   3  
ATOM 4856  C CE   . LYS A 1 84  ? 10.961  8.013   -2.450  1.00 1.00 ? 104 LYS A CE   3  
ATOM 4857  N NZ   . LYS A 1 84  ? 11.974  7.758   -1.404  1.00 1.00 ? 104 LYS A NZ   3  
ATOM 4858  H H    . LYS A 1 84  ? 8.224   10.643  -0.021  1.00 1.00 ? 104 LYS A H    3  
ATOM 4859  H HA   . LYS A 1 84  ? 6.330   8.718   -1.130  1.00 1.00 ? 104 LYS A HA   3  
ATOM 4860  H HB2  . LYS A 1 84  ? 8.796   8.600   0.623   1.00 0.00 ? 104 LYS A HB2  3  
ATOM 4861  H HB3  . LYS A 1 84  ? 7.712   7.199   0.565   1.00 1.00 ? 104 LYS A HB3  3  
ATOM 4862  H HG2  . LYS A 1 84  ? 9.543   6.892   -0.991  1.00 0.00 ? 104 LYS A HG2  3  
ATOM 4863  H HG3  . LYS A 1 84  ? 8.108   7.201   -1.960  1.00 1.00 ? 104 LYS A HG3  3  
ATOM 4864  H HD2  . LYS A 1 84  ? 9.225   9.134   -2.768  1.00 0.00 ? 104 LYS A HD2  3  
ATOM 4865  H HD3  . LYS A 1 84  ? 9.954   9.494   -1.214  1.00 1.00 ? 104 LYS A HD3  3  
ATOM 4866  H HE2  . LYS A 1 84  ? 10.717  7.022   -2.832  1.00 0.00 ? 104 LYS A HE2  3  
ATOM 4867  H HE3  . LYS A 1 84  ? 11.373  8.618   -3.259  1.00 1.00 ? 104 LYS A HE3  3  
ATOM 4868  H HZ1  . LYS A 1 84  ? 11.781  6.855   -0.949  1.00 0.00 ? 104 LYS A HZ1  3  
ATOM 4869  H HZ2  . LYS A 1 84  ? 12.912  7.732   -1.832  1.00 0.00 ? 104 LYS A HZ2  3  
ATOM 4870  N N    . SER A 1 85  ? 4.514   9.074   0.588   1.00 1.00 ? 105 SER A N    3  
ATOM 4871  C CA   . SER A 1 85  ? 3.395   8.938   1.552   1.00 1.00 ? 105 SER A CA   3  
ATOM 4872  C C    . SER A 1 85  ? 2.394   7.848   1.118   1.00 1.00 ? 105 SER A C    3  
ATOM 4873  O O    . SER A 1 85  ? 1.583   8.074   0.218   1.00 1.00 ? 105 SER A O    3  
ATOM 4874  C CB   . SER A 1 85  ? 2.672   10.296  1.737   1.00 1.00 ? 105 SER A CB   3  
ATOM 4875  O OG   . SER A 1 85  ? 3.210   11.464  1.131   1.00 1.00 ? 105 SER A OG   3  
ATOM 4876  H H    . SER A 1 85  ? 4.311   9.196   -0.392  1.00 1.00 ? 105 SER A H    3  
ATOM 4877  H HA   . SER A 1 85  ? 3.793   8.682   2.528   1.00 1.00 ? 105 SER A HA   3  
ATOM 4878  H HB2  . SER A 1 85  ? 1.713   10.290  1.217   1.00 0.00 ? 105 SER A HB2  3  
ATOM 4879  H HB3  . SER A 1 85  ? 2.493   10.489  2.794   1.00 1.00 ? 105 SER A HB3  3  
ATOM 4880  H HG   . SER A 1 85  ? 3.903   11.199  0.504   1.00 1.00 ? 105 SER A HG   3  
ATOM 4881  N N    . PHE A 1 86  ? 2.365   6.702   1.828   1.00 1.00 ? 106 PHE A N    3  
ATOM 4882  C CA   . PHE A 1 86  ? 1.545   5.496   1.581   1.00 1.00 ? 106 PHE A CA   3  
ATOM 4883  C C    . PHE A 1 86  ? 0.945   4.833   2.858   1.00 1.00 ? 106 PHE A C    3  
ATOM 4884  O O    . PHE A 1 86  ? 1.620   4.014   3.479   1.00 1.00 ? 106 PHE A O    3  
ATOM 4885  C CB   . PHE A 1 86  ? 2.379   4.491   0.746   1.00 1.00 ? 106 PHE A CB   3  
ATOM 4886  C CG   . PHE A 1 86  ? 1.736   3.166   0.362   1.00 1.00 ? 106 PHE A CG   3  
ATOM 4887  C CD1  . PHE A 1 86  ? 1.809   2.053   1.236   1.00 1.00 ? 106 PHE A CD1  3  
ATOM 4888  C CD2  . PHE A 1 86  ? 1.068   3.020   -0.876  1.00 1.00 ? 106 PHE A CD2  3  
ATOM 4889  C CE1  . PHE A 1 86  ? 1.150   0.849   0.919   1.00 1.00 ? 106 PHE A CE1  3  
ATOM 4890  C CE2  . PHE A 1 86  ? 0.415   1.809   -1.199  1.00 1.00 ? 106 PHE A CE2  3  
ATOM 4891  C CZ   . PHE A 1 86  ? 0.441   0.731   -0.292  1.00 1.00 ? 106 PHE A CZ   3  
ATOM 4892  H H    . PHE A 1 86  ? 3.101   6.573   2.520   1.00 1.00 ? 106 PHE A H    3  
ATOM 4893  H HA   . PHE A 1 86  ? 0.704   5.783   0.953   1.00 1.00 ? 106 PHE A HA   3  
ATOM 4894  H HB2  . PHE A 1 86  ? 2.579   4.899   -0.246  1.00 0.00 ? 106 PHE A HB2  3  
ATOM 4895  H HB3  . PHE A 1 86  ? 3.329   4.288   1.235   1.00 1.00 ? 106 PHE A HB3  3  
ATOM 4896  H HD1  . PHE A 1 86  ? 2.343   2.117   2.172   1.00 1.00 ? 106 PHE A HD1  3  
ATOM 4897  H HD2  . PHE A 1 86  ? 1.028   3.836   -1.577  1.00 1.00 ? 106 PHE A HD2  3  
ATOM 4898  H HE1  . PHE A 1 86  ? 1.177   0.024   1.617   1.00 1.00 ? 106 PHE A HE1  3  
ATOM 4899  H HE2  . PHE A 1 86  ? -0.122  1.718   -2.132  1.00 1.00 ? 106 PHE A HE2  3  
ATOM 4900  H HZ   . PHE A 1 86  ? -0.083  -0.188  -0.510  1.00 1.00 ? 106 PHE A HZ   3  
ATOM 4901  N N    . THR A 1 87  ? -0.290  5.161   3.271   1.00 1.00 ? 107 THR A N    3  
ATOM 4902  C CA   . THR A 1 87  ? -1.052  4.431   4.337   1.00 1.00 ? 107 THR A CA   3  
ATOM 4903  C C    . THR A 1 87  ? -2.529  4.269   3.890   1.00 1.00 ? 107 THR A C    3  
ATOM 4904  O O    . THR A 1 87  ? -3.474  4.757   4.508   1.00 1.00 ? 107 THR A O    3  
ATOM 4905  C CB   . THR A 1 87  ? -0.831  4.983   5.778   1.00 1.00 ? 107 THR A CB   3  
ATOM 4906  O OG1  . THR A 1 87  ? 0.474   4.701   6.256   1.00 1.00 ? 107 THR A OG1  3  
ATOM 4907  C CG2  . THR A 1 87  ? -1.710  4.335   6.867   1.00 1.00 ? 107 THR A CG2  3  
ATOM 4908  H H    . THR A 1 87  ? -0.786  5.911   2.785   1.00 1.00 ? 107 THR A H    3  
ATOM 4909  H HA   . THR A 1 87  ? -0.671  3.412   4.368   1.00 1.00 ? 107 THR A HA   3  
ATOM 4910  H HB   . THR A 1 87  ? -0.978  6.062   5.788   1.00 1.00 ? 107 THR A HB   3  
ATOM 4911  H HG1  . THR A 1 87  ? 1.169   5.131   5.696   1.00 1.00 ? 107 THR A HG1  3  
ATOM 4912  H HG21 . THR A 1 87  ? -1.684  3.243   6.793   1.00 1.00 ? 107 THR A HG21 3  
ATOM 4913  H HG22 . THR A 1 87  ? -1.374  4.623   7.862   1.00 1.00 ? 107 THR A HG22 3  
ATOM 4914  H HG23 . THR A 1 87  ? -2.741  4.670   6.769   1.00 1.00 ? 107 THR A HG23 3  
ATOM 4915  N N    . LEU A 1 88  ? -2.723  3.578   2.753   1.00 1.00 ? 108 LEU A N    3  
ATOM 4916  C CA   . LEU A 1 88  ? -4.017  3.268   2.125   1.00 1.00 ? 108 LEU A CA   3  
ATOM 4917  C C    . LEU A 1 88  ? -4.499  1.894   2.646   1.00 1.00 ? 108 LEU A C    3  
ATOM 4918  O O    . LEU A 1 88  ? -4.040  0.862   2.148   1.00 1.00 ? 108 LEU A O    3  
ATOM 4919  C CB   . LEU A 1 88  ? -3.901  3.311   0.579   1.00 1.00 ? 108 LEU A CB   3  
ATOM 4920  C CG   . LEU A 1 88  ? -3.476  4.654   -0.066  1.00 1.00 ? 108 LEU A CG   3  
ATOM 4921  C CD1  . LEU A 1 88  ? -1.953  4.756   -0.206  1.00 1.00 ? 108 LEU A CD1  3  
ATOM 4922  C CD2  . LEU A 1 88  ? -4.071  4.810   -1.475  1.00 1.00 ? 108 LEU A CD2  3  
ATOM 4923  H H    . LEU A 1 88  ? -1.908  3.206   2.290   1.00 1.00 ? 108 LEU A H    3  
ATOM 4924  H HA   . LEU A 1 88  ? -4.746  4.021   2.415   1.00 1.00 ? 108 LEU A HA   3  
ATOM 4925  H HB2  . LEU A 1 88  ? -3.093  2.642   0.284   1.00 0.00 ? 108 LEU A HB2  3  
ATOM 4926  H HB3  . LEU A 1 88  ? -4.854  2.980   0.161   1.00 1.00 ? 108 LEU A HB3  3  
ATOM 4927  H HG   . LEU A 1 88  ? -3.825  5.485   0.546   1.00 1.00 ? 108 LEU A HG   3  
ATOM 4928  H HD11 . LEU A 1 88  ? -1.475  4.691   0.765   1.00 1.00 ? 108 LEU A HD11 3  
ATOM 4929  H HD12 . LEU A 1 88  ? -1.582  3.951   -0.840  1.00 1.00 ? 108 LEU A HD12 3  
ATOM 4930  H HD13 . LEU A 1 88  ? -1.692  5.718   -0.646  1.00 1.00 ? 108 LEU A HD13 3  
ATOM 4931  H HD21 . LEU A 1 88  ? -5.159  4.765   -1.437  1.00 1.00 ? 108 LEU A HD21 3  
ATOM 4932  H HD22 . LEU A 1 88  ? -3.784  5.774   -1.891  1.00 1.00 ? 108 LEU A HD22 3  
ATOM 4933  H HD23 . LEU A 1 88  ? -3.709  4.022   -2.135  1.00 1.00 ? 108 LEU A HD23 3  
ATOM 4934  N N    . THR A 1 89  ? -5.379  1.863   3.666   1.00 1.00 ? 109 THR A N    3  
ATOM 4935  C CA   . THR A 1 89  ? -5.766  0.591   4.353   1.00 1.00 ? 109 THR A CA   3  
ATOM 4936  C C    . THR A 1 89  ? -7.278  0.252   4.441   1.00 1.00 ? 109 THR A C    3  
ATOM 4937  O O    . THR A 1 89  ? -8.172  1.040   4.129   1.00 1.00 ? 109 THR A O    3  
ATOM 4938  C CB   . THR A 1 89  ? -5.071  0.445   5.730   1.00 1.00 ? 109 THR A CB   3  
ATOM 4939  O OG1  . THR A 1 89  ? -5.565  1.368   6.665   1.00 1.00 ? 109 THR A OG1  3  
ATOM 4940  C CG2  . THR A 1 89  ? -3.546  0.601   5.711   1.00 1.00 ? 109 THR A CG2  3  
ATOM 4941  H H    . THR A 1 89  ? -5.700  2.747   4.068   1.00 1.00 ? 109 THR A H    3  
ATOM 4942  H HA   . THR A 1 89  ? -5.363  -0.229  3.758   1.00 1.00 ? 109 THR A HA   3  
ATOM 4943  H HB   . THR A 1 89  ? -5.283  -0.544  6.128   1.00 1.00 ? 109 THR A HB   3  
ATOM 4944  H HG1  . THR A 1 89  ? -5.043  1.277   7.459   1.00 1.00 ? 109 THR A HG1  3  
ATOM 4945  H HG21 . THR A 1 89  ? -3.121  -0.082  4.972   1.00 1.00 ? 109 THR A HG21 3  
ATOM 4946  H HG22 . THR A 1 89  ? -3.267  1.621   5.452   1.00 1.00 ? 109 THR A HG22 3  
ATOM 4947  H HG23 . THR A 1 89  ? -3.124  0.354   6.687   1.00 1.00 ? 109 THR A HG23 3  
ATOM 4948  N N    . ILE A 1 90  ? -7.551  -0.997  4.848   1.00 1.00 ? 110 ILE A N    3  
ATOM 4949  C CA   . ILE A 1 90  ? -8.857  -1.603  5.140   1.00 1.00 ? 110 ILE A CA   3  
ATOM 4950  C C    . ILE A 1 90  ? -8.816  -2.128  6.592   1.00 1.00 ? 110 ILE A C    3  
ATOM 4951  O O    . ILE A 1 90  ? -8.034  -3.012  6.946   1.00 1.00 ? 110 ILE A O    3  
ATOM 4952  C CB   . ILE A 1 90  ? -9.273  -2.636  4.057   1.00 1.00 ? 110 ILE A CB   3  
ATOM 4953  C CG1  . ILE A 1 90  ? -10.611 -3.331  4.374   1.00 1.00 ? 110 ILE A CG1  3  
ATOM 4954  C CG2  . ILE A 1 90  ? -8.252  -3.747  3.773   1.00 1.00 ? 110 ILE A CG2  3  
ATOM 4955  C CD1  . ILE A 1 90  ? -11.847 -2.460  4.170   1.00 1.00 ? 110 ILE A CD1  3  
ATOM 4956  H H    . ILE A 1 90  ? -6.759  -1.608  5.044   1.00 1.00 ? 110 ILE A H    3  
ATOM 4957  H HA   . ILE A 1 90  ? -9.600  -0.810  5.091   1.00 1.00 ? 110 ILE A HA   3  
ATOM 4958  H HB   . ILE A 1 90  ? -9.398  -2.093  3.117   1.00 1.00 ? 110 ILE A HB   3  
ATOM 4959  H HG12 . ILE A 1 90  ? -10.849 -4.121  3.663   1.00 0.00 ? 110 ILE A HG12 3  
ATOM 4960  H HG13 . ILE A 1 90  ? -10.617 -3.795  5.361   1.00 1.00 ? 110 ILE A HG13 3  
ATOM 4961  H HG21 . ILE A 1 90  ? -8.042  -4.282  4.694   1.00 1.00 ? 110 ILE A HG21 3  
ATOM 4962  H HG22 . ILE A 1 90  ? -8.644  -4.445  3.029   1.00 1.00 ? 110 ILE A HG22 3  
ATOM 4963  H HG23 . ILE A 1 90  ? -7.332  -3.320  3.374   1.00 1.00 ? 110 ILE A HG23 3  
ATOM 4964  H HD11 . ILE A 1 90  ? -11.762 -1.918  3.231   1.00 1.00 ? 110 ILE A HD11 3  
ATOM 4965  H HD12 . ILE A 1 90  ? -12.714 -3.109  4.102   1.00 1.00 ? 110 ILE A HD12 3  
ATOM 4966  H HD13 . ILE A 1 90  ? -11.968 -1.765  5.001   1.00 1.00 ? 110 ILE A HD13 3  
ATOM 4967  N N    . THR A 1 91  ? -9.661  -1.533  7.439   1.00 1.00 ? 111 THR A N    3  
ATOM 4968  C CA   . THR A 1 91  ? -9.711  -1.680  8.914   1.00 1.00 ? 111 THR A CA   3  
ATOM 4969  C C    . THR A 1 91  ? -11.086 -2.142  9.442   1.00 1.00 ? 111 THR A C    3  
ATOM 4970  O O    . THR A 1 91  ? -12.036 -1.360  9.463   1.00 1.00 ? 111 THR A O    3  
ATOM 4971  C CB   . THR A 1 91  ? -9.291  -0.344  9.600   1.00 1.00 ? 111 THR A CB   3  
ATOM 4972  O OG1  . THR A 1 91  ? -9.964  0.789   9.065   1.00 1.00 ? 111 THR A OG1  3  
ATOM 4973  C CG2  . THR A 1 91  ? -7.791  -0.053  9.466   1.00 1.00 ? 111 THR A CG2  3  
ATOM 4974  H H    . THR A 1 91  ? -10.237 -0.785  7.050   1.00 1.00 ? 111 THR A H    3  
ATOM 4975  H HA   . THR A 1 91  ? -8.985  -2.436  9.214   1.00 1.00 ? 111 THR A HA   3  
ATOM 4976  H HB   . THR A 1 91  ? -9.524  -0.408  10.666  1.00 1.00 ? 111 THR A HB   3  
ATOM 4977  H HG1  . THR A 1 91  ? -10.775 0.466   8.617   1.00 1.00 ? 111 THR A HG1  3  
ATOM 4978  H HG21 . THR A 1 91  ? -7.206  -0.847  9.926   1.00 1.00 ? 111 THR A HG21 3  
ATOM 4979  H HG22 . THR A 1 91  ? -7.510  0.034   8.416   1.00 1.00 ? 111 THR A HG22 3  
ATOM 4980  H HG23 . THR A 1 91  ? -7.549  0.886   9.971   1.00 1.00 ? 111 THR A HG23 3  
ATOM 4981  N N    . VAL A 1 92  ? -11.231 -3.391  9.923   1.00 1.00 ? 112 VAL A N    3  
ATOM 4982  C CA   . VAL A 1 92  ? -12.511 -3.884  10.481  1.00 1.00 ? 112 VAL A CA   3  
ATOM 4983  C C    . VAL A 1 92  ? -12.814 -3.251  11.860  1.00 1.00 ? 112 VAL A C    3  
ATOM 4984  O O    . VAL A 1 92  ? -11.946 -2.969  12.685  1.00 1.00 ? 112 VAL A O    3  
ATOM 4985  C CB   . VAL A 1 92  ? -12.573 -5.435  10.487  1.00 1.00 ? 112 VAL A CB   3  
ATOM 4986  C CG1  . VAL A 1 92  ? -13.449 -6.098  11.566  1.00 1.00 ? 112 VAL A CG1  3  
ATOM 4987  C CG2  . VAL A 1 92  ? -12.993 -5.981  9.111   1.00 1.00 ? 112 VAL A CG2  3  
ATOM 4988  H H    . VAL A 1 92  ? -10.468 -4.061  9.842   1.00 1.00 ? 112 VAL A H    3  
ATOM 4989  H HA   . VAL A 1 92  ? -13.297 -3.543  9.811   1.00 1.00 ? 112 VAL A HA   3  
ATOM 4990  H HB   . VAL A 1 92  ? -11.573 -5.779  10.667  1.00 1.00 ? 112 VAL A HB   3  
ATOM 4991  H HG11 . VAL A 1 92  ? -13.121 -5.796  12.561  1.00 1.00 ? 112 VAL A HG11 3  
ATOM 4992  H HG12 . VAL A 1 92  ? -14.498 -5.835  11.425  1.00 1.00 ? 112 VAL A HG12 3  
ATOM 4993  H HG13 . VAL A 1 92  ? -13.347 -7.183  11.511  1.00 1.00 ? 112 VAL A HG13 3  
ATOM 4994  H HG21 . VAL A 1 92  ? -12.334 -5.591  8.333   1.00 1.00 ? 112 VAL A HG21 3  
ATOM 4995  H HG22 . VAL A 1 92  ? -12.918 -7.070  9.101   1.00 1.00 ? 112 VAL A HG22 3  
ATOM 4996  H HG23 . VAL A 1 92  ? -14.024 -5.705  8.891   1.00 1.00 ? 112 VAL A HG23 3  
ATOM 4997  N N    . PHE A 1 93  ? -14.119 -3.088  12.066  1.00 1.00 ? 113 PHE A N    3  
ATOM 4998  C CA   . PHE A 1 93  ? -14.884 -2.419  13.128  1.00 1.00 ? 113 PHE A CA   3  
ATOM 4999  C C    . PHE A 1 93  ? -15.736 -3.447  13.914  1.00 1.00 ? 113 PHE A C    3  
ATOM 5000  O O    . PHE A 1 93  ? -16.949 -3.302  14.084  1.00 1.00 ? 113 PHE A O    3  
ATOM 5001  C CB   . PHE A 1 93  ? -15.716 -1.329  12.414  1.00 1.00 ? 113 PHE A CB   3  
ATOM 5002  C CG   . PHE A 1 93  ? -16.053 -0.032  13.129  1.00 1.00 ? 113 PHE A CG   3  
ATOM 5003  C CD1  . PHE A 1 93  ? -17.070 0.022   14.112  1.00 1.00 ? 113 PHE A CD1  3  
ATOM 5004  C CD2  . PHE A 1 93  ? -15.423 1.162   12.714  1.00 1.00 ? 113 PHE A CD2  3  
ATOM 5005  C CE1  . PHE A 1 93  ? -17.436 1.262   14.688  1.00 1.00 ? 113 PHE A CE1  3  
ATOM 5006  C CE2  . PHE A 1 93  ? -15.790 2.402   13.287  1.00 1.00 ? 113 PHE A CE2  3  
ATOM 5007  C CZ   . PHE A 1 93  ? -16.792 2.453   14.282  1.00 1.00 ? 113 PHE A CZ   3  
ATOM 5008  H H    . PHE A 1 93  ? -14.660 -3.541  11.338  1.00 1.00 ? 113 PHE A H    3  
ATOM 5009  H HA   . PHE A 1 93  ? -14.202 -1.932  13.827  1.00 1.00 ? 113 PHE A HA   3  
ATOM 5010  H HB2  . PHE A 1 93  ? -15.143 -0.828  11.633  1.00 0.00 ? 113 PHE A HB2  3  
ATOM 5011  H HB3  . PHE A 1 93  ? -16.606 -1.742  11.944  1.00 1.00 ? 113 PHE A HB3  3  
ATOM 5012  H HD1  . PHE A 1 93  ? -17.590 -0.880  14.403  1.00 1.00 ? 113 PHE A HD1  3  
ATOM 5013  H HD2  . PHE A 1 93  ? -14.676 1.122   11.934  1.00 1.00 ? 113 PHE A HD2  3  
ATOM 5014  H HE1  . PHE A 1 93  ? -18.225 1.298   15.427  1.00 1.00 ? 113 PHE A HE1  3  
ATOM 5015  H HE2  . PHE A 1 93  ? -15.313 3.314   12.952  1.00 1.00 ? 113 PHE A HE2  3  
ATOM 5016  H HZ   . PHE A 1 93  ? -17.076 3.404   14.718  1.00 1.00 ? 113 PHE A HZ   3  
ATOM 5017  N N    . THR A 1 94  ? -15.130 -4.567  14.340  1.00 1.00 ? 114 THR A N    3  
ATOM 5018  C CA   . THR A 1 94  ? -15.771 -5.646  15.137  1.00 1.00 ? 114 THR A CA   3  
ATOM 5019  C C    . THR A 1 94  ? -14.744 -6.289  16.096  1.00 1.00 ? 114 THR A C    3  
ATOM 5020  O O    . THR A 1 94  ? -13.536 -6.103  15.933  1.00 1.00 ? 114 THR A O    3  
ATOM 5021  C CB   . THR A 1 94  ? -16.496 -6.646  14.195  1.00 1.00 ? 114 THR A CB   3  
ATOM 5022  O OG1  . THR A 1 94  ? -17.496 -5.939  13.489  1.00 1.00 ? 114 THR A OG1  3  
ATOM 5023  C CG2  . THR A 1 94  ? -17.252 -7.806  14.867  1.00 1.00 ? 114 THR A CG2  3  
ATOM 5024  H H    . THR A 1 94  ? -14.139 -4.668  14.129  1.00 1.00 ? 114 THR A H    3  
ATOM 5025  H HA   . THR A 1 94  ? -16.539 -5.202  15.772  1.00 1.00 ? 114 THR A HA   3  
ATOM 5026  H HB   . THR A 1 94  ? -15.777 -7.054  13.480  1.00 1.00 ? 114 THR A HB   3  
ATOM 5027  H HG1  . THR A 1 94  ? -17.359 -4.984  13.632  1.00 1.00 ? 114 THR A HG1  3  
ATOM 5028  H HG21 . THR A 1 94  ? -17.992 -7.426  15.575  1.00 1.00 ? 114 THR A HG21 3  
ATOM 5029  H HG22 . THR A 1 94  ? -17.776 -8.390  14.105  1.00 1.00 ? 114 THR A HG22 3  
ATOM 5030  H HG23 . THR A 1 94  ? -16.564 -8.478  15.373  1.00 1.00 ? 114 THR A HG23 3  
ATOM 5031  N N    . ASN A 1 95  ? -15.223 -7.018  17.120  1.00 1.00 ? 115 ASN A N    3  
ATOM 5032  C CA   . ASN A 1 95  ? -14.435 -7.599  18.221  1.00 1.00 ? 115 ASN A CA   3  
ATOM 5033  C C    . ASN A 1 95  ? -13.105 -8.283  17.791  1.00 1.00 ? 115 ASN A C    3  
ATOM 5034  O O    . ASN A 1 95  ? -12.118 -8.099  18.504  1.00 1.00 ? 115 ASN A O    3  
ATOM 5035  C CB   . ASN A 1 95  ? -15.374 -8.470  19.072  1.00 1.00 ? 115 ASN A CB   3  
ATOM 5036  C CG   . ASN A 1 95  ? -15.472 -8.042  20.533  1.00 1.00 ? 115 ASN A CG   3  
ATOM 5037  O OD1  . ASN A 1 95  ? -15.796 -6.914  20.863  1.00 1.00 ? 115 ASN A OD1  3  
ATOM 5038  N ND2  . ASN A 1 95  ? -15.201 -8.922  21.463  1.00 1.00 ? 115 ASN A ND2  3  
ATOM 5039  H H    . ASN A 1 95  ? -16.222 -7.132  17.163  1.00 1.00 ? 115 ASN A H    3  
ATOM 5040  H HA   . ASN A 1 95  ? -14.125 -6.749  18.833  1.00 1.00 ? 115 ASN A HA   3  
ATOM 5041  H HB2  . ASN A 1 95  ? -16.421 -8.348  18.797  1.00 0.00 ? 115 ASN A HB2  3  
ATOM 5042  H HB3  . ASN A 1 95  ? -15.157 -9.533  18.977  1.00 1.00 ? 115 ASN A HB3  3  
ATOM 5043  H HD21 . ASN A 1 95  ? -14.930 -9.880  21.200  1.00 0.00 ? 115 ASN A HD21 3  
ATOM 5044  H HD22 . ASN A 1 95  ? -15.259 -8.657  22.457  1.00 0.00 ? 115 ASN A HD22 3  
ATOM 5045  N N    . PRO A 1 96  ? -13.062 -9.077  16.692  1.00 1.00 ? 116 PRO A N    3  
ATOM 5046  C CA   . PRO A 1 96  ? -11.837 -9.582  16.066  1.00 1.00 ? 116 PRO A CA   3  
ATOM 5047  C C    . PRO A 1 96  ? -11.368 -8.521  15.022  1.00 1.00 ? 116 PRO A C    3  
ATOM 5048  O O    . PRO A 1 96  ? -11.925 -8.480  13.919  1.00 1.00 ? 116 PRO A O    3  
ATOM 5049  C CB   . PRO A 1 96  ? -12.230 -10.911 15.403  1.00 1.00 ? 116 PRO A CB   3  
ATOM 5050  C CG   . PRO A 1 96  ? -13.707 -10.712 15.046  1.00 1.00 ? 116 PRO A CG   3  
ATOM 5051  C CD   . PRO A 1 96  ? -14.223 -9.689  16.059  1.00 1.00 ? 116 PRO A CD   3  
ATOM 5052  H HA   . PRO A 1 96  ? -11.058 -9.767  16.810  1.00 1.00 ? 116 PRO A HA   3  
ATOM 5053  H HB2  . PRO A 1 96  ? -11.623 -11.100 14.517  1.00 0.00 ? 116 PRO A HB2  3  
ATOM 5054  H HB3  . PRO A 1 96  ? -12.141 -11.724 16.128  1.00 1.00 ? 116 PRO A HB3  3  
ATOM 5055  H HG2  . PRO A 1 96  ? -13.818 -10.344 14.026  1.00 0.00 ? 116 PRO A HG2  3  
ATOM 5056  H HG3  . PRO A 1 96  ? -14.259 -11.649 15.124  1.00 1.00 ? 116 PRO A HG3  3  
ATOM 5057  H HD2  . PRO A 1 96  ? -14.825 -8.918  15.578  1.00 0.00 ? 116 PRO A HD2  3  
ATOM 5058  H HD3  . PRO A 1 96  ? -14.822 -10.199 16.810  1.00 1.00 ? 116 PRO A HD3  3  
ATOM 5059  N N    . PRO A 1 97  ? -10.392 -7.631  15.333  1.00 1.00 ? 117 PRO A N    3  
ATOM 5060  C CA   . PRO A 1 97  ? -9.991  -6.527  14.444  1.00 1.00 ? 117 PRO A CA   3  
ATOM 5061  C C    . PRO A 1 97  ? -9.256  -7.045  13.195  1.00 1.00 ? 117 PRO A C    3  
ATOM 5062  O O    . PRO A 1 97  ? -8.186  -7.652  13.290  1.00 1.00 ? 117 PRO A O    3  
ATOM 5063  C CB   . PRO A 1 97  ? -9.099  -5.600  15.277  1.00 1.00 ? 117 PRO A CB   3  
ATOM 5064  C CG   . PRO A 1 97  ? -8.506  -6.533  16.331  1.00 1.00 ? 117 PRO A CG   3  
ATOM 5065  C CD   . PRO A 1 97  ? -9.545  -7.639  16.521  1.00 1.00 ? 117 PRO A CD   3  
ATOM 5066  H HA   . PRO A 1 97  ? -10.887 -5.977  14.145  1.00 1.00 ? 117 PRO A HA   3  
ATOM 5067  H HB2  . PRO A 1 97  ? -8.326  -5.143  14.659  1.00 0.00 ? 117 PRO A HB2  3  
ATOM 5068  H HB3  . PRO A 1 97  ? -9.723  -4.844  15.763  1.00 1.00 ? 117 PRO A HB3  3  
ATOM 5069  H HG2  . PRO A 1 97  ? -7.558  -6.951  15.994  1.00 0.00 ? 117 PRO A HG2  3  
ATOM 5070  H HG3  . PRO A 1 97  ? -8.324  -6.001  17.265  1.00 1.00 ? 117 PRO A HG3  3  
ATOM 5071  H HD2  . PRO A 1 97  ? -9.080  -8.617  16.643  1.00 0.00 ? 117 PRO A HD2  3  
ATOM 5072  H HD3  . PRO A 1 97  ? -10.140 -7.419  17.406  1.00 1.00 ? 117 PRO A HD3  3  
ATOM 5073  N N    . GLN A 1 98  ? -9.827  -6.794  12.010  1.00 1.00 ? 118 GLN A N    3  
ATOM 5074  C CA   . GLN A 1 98  ? -9.310  -7.306  10.727  1.00 1.00 ? 118 GLN A CA   3  
ATOM 5075  C C    . GLN A 1 98  ? -8.715  -6.169  9.884   1.00 1.00 ? 118 GLN A C    3  
ATOM 5076  O O    . GLN A 1 98  ? -9.430  -5.428  9.209   1.00 1.00 ? 118 GLN A O    3  
ATOM 5077  C CB   . GLN A 1 98  ? -10.397 -8.083  9.972   1.00 1.00 ? 118 GLN A CB   3  
ATOM 5078  C CG   . GLN A 1 98  ? -10.692 -9.462  10.572  1.00 1.00 ? 118 GLN A CG   3  
ATOM 5079  C CD   . GLN A 1 98  ? -11.790 -10.174 9.800   1.00 1.00 ? 118 GLN A CD   3  
ATOM 5080  O OE1  . GLN A 1 98  ? -12.974 -9.917  9.937   1.00 1.00 ? 118 GLN A OE1  3  
ATOM 5081  N NE2  . GLN A 1 98  ? -11.437 -11.083 8.927   1.00 1.00 ? 118 GLN A NE2  3  
ATOM 5082  H H    . GLN A 1 98  ? -10.680 -6.233  12.011  1.00 1.00 ? 118 GLN A H    3  
ATOM 5083  H HA   . GLN A 1 98  ? -8.508  -8.024  10.919  1.00 1.00 ? 118 GLN A HA   3  
ATOM 5084  H HB2  . GLN A 1 98  ? -11.346 -7.550  10.034  1.00 0.00 ? 118 GLN A HB2  3  
ATOM 5085  H HB3  . GLN A 1 98  ? -10.116 -8.189  8.920   1.00 1.00 ? 118 GLN A HB3  3  
ATOM 5086  H HG2  . GLN A 1 98  ? -9.815  -10.106 10.515  1.00 0.00 ? 118 GLN A HG2  3  
ATOM 5087  H HG3  . GLN A 1 98  ? -10.980 -9.376  11.617  1.00 1.00 ? 118 GLN A HG3  3  
ATOM 5088  H HE21 . GLN A 1 98  ? -10.439 -11.296 8.780   1.00 0.00 ? 118 GLN A HE21 3  
ATOM 5089  H HE22 . GLN A 1 98  ? -12.155 -11.586 8.386   1.00 0.00 ? 118 GLN A HE22 3  
ATOM 5090  N N    . VAL A 1 99  ? -7.390  -6.022  9.969   1.00 1.00 ? 119 VAL A N    3  
ATOM 5091  C CA   . VAL A 1 99  ? -6.572  -4.970  9.338   1.00 1.00 ? 119 VAL A CA   3  
ATOM 5092  C C    . VAL A 1 99  ? -5.731  -5.513  8.164   1.00 1.00 ? 119 VAL A C    3  
ATOM 5093  O O    . VAL A 1 99  ? -4.944  -6.445  8.330   1.00 1.00 ? 119 VAL A O    3  
ATOM 5094  C CB   . VAL A 1 99  ? -5.731  -4.192  10.388  1.00 1.00 ? 119 VAL A CB   3  
ATOM 5095  C CG1  . VAL A 1 99  ? -6.662  -3.496  11.406  1.00 1.00 ? 119 VAL A CG1  3  
ATOM 5096  C CG2  . VAL A 1 99  ? -4.697  -5.031  11.168  1.00 1.00 ? 119 VAL A CG2  3  
ATOM 5097  H H    . VAL A 1 99  ? -6.944  -6.644  10.622  1.00 1.00 ? 119 VAL A H    3  
ATOM 5098  H HA   . VAL A 1 99  ? -7.261  -4.235  8.916   1.00 1.00 ? 119 VAL A HA   3  
ATOM 5099  H HB   . VAL A 1 99  ? -5.191  -3.409  9.855   1.00 1.00 ? 119 VAL A HB   3  
ATOM 5100  H HG11 . VAL A 1 99  ? -7.418  -2.913  10.887  1.00 1.00 ? 119 VAL A HG11 3  
ATOM 5101  H HG12 . VAL A 1 99  ? -7.168  -4.240  12.023  1.00 1.00 ? 119 VAL A HG12 3  
ATOM 5102  H HG13 . VAL A 1 99  ? -6.097  -2.829  12.056  1.00 1.00 ? 119 VAL A HG13 3  
ATOM 5103  H HG21 . VAL A 1 99  ? -3.978  -5.478  10.481  1.00 1.00 ? 119 VAL A HG21 3  
ATOM 5104  H HG22 . VAL A 1 99  ? -4.146  -4.397  11.865  1.00 1.00 ? 119 VAL A HG22 3  
ATOM 5105  H HG23 . VAL A 1 99  ? -5.198  -5.822  11.732  1.00 1.00 ? 119 VAL A HG23 3  
ATOM 5106  N N    . ALA A 1 100 ? -5.921  -4.929  6.973   1.00 1.00 ? 120 ALA A N    3  
ATOM 5107  C CA   . ALA A 1 100 ? -5.202  -5.192  5.711   1.00 1.00 ? 120 ALA A CA   3  
ATOM 5108  C C    . ALA A 1 100 ? -4.951  -3.892  4.891   1.00 1.00 ? 120 ALA A C    3  
ATOM 5109  O O    . ALA A 1 100 ? -5.455  -2.818  5.227   1.00 1.00 ? 120 ALA A O    3  
ATOM 5110  C CB   . ALA A 1 100 ? -5.888  -6.336  4.936   1.00 1.00 ? 120 ALA A CB   3  
ATOM 5111  H H    . ALA A 1 100 ? -6.619  -4.186  6.945   1.00 1.00 ? 120 ALA A H    3  
ATOM 5112  H HA   . ALA A 1 100 ? -4.209  -5.561  5.988   1.00 1.00 ? 120 ALA A HA   3  
ATOM 5113  H HB1  . ALA A 1 100 ? -5.910  -7.233  5.553   1.00 1.00 ? 120 ALA A HB1  3  
ATOM 5114  H HB2  . ALA A 1 100 ? -6.909  -6.089  4.655   1.00 1.00 ? 120 ALA A HB2  3  
ATOM 5115  H HB3  . ALA A 1 100 ? -5.325  -6.566  4.033   1.00 1.00 ? 120 ALA A HB3  3  
ATOM 5116  N N    . THR A 1 101 ? -4.107  -3.942  3.845   1.00 1.00 ? 121 THR A N    3  
ATOM 5117  C CA   . THR A 1 101 ? -3.630  -2.768  3.052   1.00 1.00 ? 121 THR A CA   3  
ATOM 5118  C C    . THR A 1 101 ? -4.059  -2.816  1.571   1.00 1.00 ? 121 THR A C    3  
ATOM 5119  O O    . THR A 1 101 ? -4.107  -3.894  0.971   1.00 1.00 ? 121 THR A O    3  
ATOM 5120  C CB   . THR A 1 101 ? -2.092  -2.633  3.166   1.00 1.00 ? 121 THR A CB   3  
ATOM 5121  O OG1  . THR A 1 101 ? -1.742  -2.465  4.525   1.00 1.00 ? 121 THR A OG1  3  
ATOM 5122  C CG2  . THR A 1 101 ? -1.469  -1.445  2.423   1.00 1.00 ? 121 THR A CG2  3  
ATOM 5123  H H    . THR A 1 101 ? -3.811  -4.863  3.549   1.00 1.00 ? 121 THR A H    3  
ATOM 5124  H HA   . THR A 1 101 ? -4.047  -1.858  3.481   1.00 1.00 ? 121 THR A HA   3  
ATOM 5125  H HB   . THR A 1 101 ? -1.632  -3.551  2.797   1.00 1.00 ? 121 THR A HB   3  
ATOM 5126  H HG1  . THR A 1 101 ? -2.209  -3.136  5.027   1.00 1.00 ? 121 THR A HG1  3  
ATOM 5127  H HG21 . THR A 1 101 ? -1.889  -0.501  2.772   1.00 1.00 ? 121 THR A HG21 3  
ATOM 5128  H HG22 . THR A 1 101 ? -0.391  -1.440  2.591   1.00 1.00 ? 121 THR A HG22 3  
ATOM 5129  H HG23 . THR A 1 101 ? -1.638  -1.540  1.349   1.00 1.00 ? 121 THR A HG23 3  
ATOM 5130  N N    . TYR A 1 102 ? -4.335  -1.655  0.956   1.00 1.00 ? 122 TYR A N    3  
ATOM 5131  C CA   . TYR A 1 102 ? -4.585  -1.502  -0.489  1.00 1.00 ? 122 TYR A CA   3  
ATOM 5132  C C    . TYR A 1 102 ? -3.219  -1.293  -1.178  1.00 1.00 ? 122 TYR A C    3  
ATOM 5133  O O    . TYR A 1 102 ? -2.543  -0.291  -0.926  1.00 1.00 ? 122 TYR A O    3  
ATOM 5134  C CB   . TYR A 1 102 ? -5.531  -0.307  -0.752  1.00 1.00 ? 122 TYR A CB   3  
ATOM 5135  C CG   . TYR A 1 102 ? -5.599  0.170   -2.197  1.00 1.00 ? 122 TYR A CG   3  
ATOM 5136  C CD1  . TYR A 1 102 ? -4.687  1.152   -2.661  1.00 1.00 ? 122 TYR A CD1  3  
ATOM 5137  C CD2  . TYR A 1 102 ? -6.546  -0.383  -3.083  1.00 1.00 ? 122 TYR A CD2  3  
ATOM 5138  C CE1  . TYR A 1 102 ? -4.708  1.569   -4.008  1.00 1.00 ? 122 TYR A CE1  3  
ATOM 5139  C CE2  . TYR A 1 102 ? -6.576  0.030   -4.435  1.00 1.00 ? 122 TYR A CE2  3  
ATOM 5140  C CZ   . TYR A 1 102 ? -5.656  1.001   -4.899  1.00 1.00 ? 122 TYR A CZ   3  
ATOM 5141  O OH   . TYR A 1 102 ? -5.634  1.357   -6.208  1.00 1.00 ? 122 TYR A OH   3  
ATOM 5142  H H    . TYR A 1 102 ? -4.229  -0.788  1.479   1.00 1.00 ? 122 TYR A H    3  
ATOM 5143  H HA   . TYR A 1 102 ? -5.069  -2.397  -0.881  1.00 1.00 ? 122 TYR A HA   3  
ATOM 5144  H HB2  . TYR A 1 102 ? -6.568  -0.581  -0.553  1.00 0.00 ? 122 TYR A HB2  3  
ATOM 5145  H HB3  . TYR A 1 102 ? -5.276  0.540   -0.112  1.00 1.00 ? 122 TYR A HB3  3  
ATOM 5146  H HD1  . TYR A 1 102 ? -3.963  1.572   -1.977  1.00 1.00 ? 122 TYR A HD1  3  
ATOM 5147  H HD2  . TYR A 1 102 ? -7.250  -1.126  -2.735  1.00 1.00 ? 122 TYR A HD2  3  
ATOM 5148  H HE1  . TYR A 1 102 ? -4.008  2.319   -4.355  1.00 1.00 ? 122 TYR A HE1  3  
ATOM 5149  H HE2  . TYR A 1 102 ? -7.297  -0.390  -5.120  1.00 1.00 ? 122 TYR A HE2  3  
ATOM 5150  H HH   . TYR A 1 102 ? -5.453  2.291   -6.318  1.00 1.00 ? 122 TYR A HH   3  
ATOM 5151  N N    . HIS A 1 103 ? -2.823  -2.247  -2.043  1.00 1.00 ? 123 HIS A N    3  
ATOM 5152  C CA   . HIS A 1 103 ? -1.505  -2.346  -2.711  1.00 1.00 ? 123 HIS A CA   3  
ATOM 5153  C C    . HIS A 1 103 ? -0.358  -2.817  -1.777  1.00 1.00 ? 123 HIS A C    3  
ATOM 5154  O O    . HIS A 1 103 ? -0.476  -2.866  -0.557  1.00 1.00 ? 123 HIS A O    3  
ATOM 5155  C CB   . HIS A 1 103 ? -1.157  -0.979  -3.346  1.00 1.00 ? 123 HIS A CB   3  
ATOM 5156  C CG   . HIS A 1 103 ? -1.325  -0.797  -4.824  1.00 1.00 ? 123 HIS A CG   3  
ATOM 5157  N ND1  . HIS A 1 103 ? -2.399  -0.175  -5.417  1.00 1.00 ? 123 HIS A ND1  3  
ATOM 5158  C CD2  . HIS A 1 103 ? -0.402  -1.090  -5.787  1.00 1.00 ? 123 HIS A CD2  3  
ATOM 5159  C CE1  . HIS A 1 103 ? -2.131  -0.073  -6.734  1.00 1.00 ? 123 HIS A CE1  3  
ATOM 5160  N NE2  . HIS A 1 103 ? -0.926  -0.636  -6.988  1.00 1.00 ? 123 HIS A NE2  3  
ATOM 5161  H H    . HIS A 1 103 ? -3.470  -3.015  -2.170  1.00 1.00 ? 123 HIS A H    3  
ATOM 5162  H HA   . HIS A 1 103 ? -1.599  -3.093  -3.498  1.00 1.00 ? 123 HIS A HA   3  
ATOM 5163  H HB2  . HIS A 1 103 ? -1.965  -0.284  -3.121  1.00 0.00 ? 123 HIS A HB2  3  
ATOM 5164  H HB3  . HIS A 1 103 ? -0.228  -0.533  -2.984  1.00 1.00 ? 123 HIS A HB3  3  
ATOM 5165  H HD1  . HIS A 1 103 ? -3.223  0.139   -4.919  1.00 1.00 ? 123 HIS A HD1  3  
ATOM 5166  H HD2  . HIS A 1 103 ? 0.561   -1.552  -5.620  1.00 1.00 ? 123 HIS A HD2  3  
ATOM 5167  H HE1  . HIS A 1 103 ? -2.777  0.390   -7.476  1.00 1.00 ? 123 HIS A HE1  3  
ATOM 5168  H HE2  . HIS A 1 103 ? -0.492  -0.706  -7.900  1.00 1.00 ? 123 HIS A HE2  3  
ATOM 5169  N N    . ARG A 1 104 ? 0.796   -3.095  -2.403  1.00 1.00 ? 124 ARG A N    3  
ATOM 5170  C CA   . ARG A 1 104 ? 2.117   -3.405  -1.799  1.00 1.00 ? 124 ARG A CA   3  
ATOM 5171  C C    . ARG A 1 104 ? 3.291   -2.635  -2.458  1.00 1.00 ? 124 ARG A C    3  
ATOM 5172  O O    . ARG A 1 104 ? 4.438   -3.076  -2.430  1.00 1.00 ? 124 ARG A O    3  
ATOM 5173  C CB   . ARG A 1 104 ? 2.324   -4.935  -1.728  1.00 1.00 ? 124 ARG A CB   3  
ATOM 5174  C CG   . ARG A 1 104 ? 2.591   -5.650  -3.059  1.00 1.00 ? 124 ARG A CG   3  
ATOM 5175  C CD   . ARG A 1 104 ? 1.828   -6.973  -3.148  1.00 1.00 ? 124 ARG A CD   3  
ATOM 5176  N NE   . ARG A 1 104 ? 2.257   -7.822  -4.277  1.00 1.00 ? 124 ARG A NE   3  
ATOM 5177  C CZ   . ARG A 1 104 ? 3.121   -8.820  -4.240  1.00 1.00 ? 124 ARG A CZ   3  
ATOM 5178  N NH1  . ARG A 1 104 ? 3.686   -9.228  -3.145  1.00 1.00 ? 124 ARG A NH1  3  
ATOM 5179  N NH2  . ARG A 1 104 ? 3.438   -9.466  -5.322  1.00 1.00 ? 124 ARG A NH2  3  
ATOM 5180  H H    . ARG A 1 104 ? 0.720   -3.101  -3.407  1.00 1.00 ? 124 ARG A H    3  
ATOM 5181  H HA   . ARG A 1 104 ? 2.111   -3.052  -0.765  1.00 1.00 ? 124 ARG A HA   3  
ATOM 5182  H HB2  . ARG A 1 104 ? 3.259   -5.149  -1.209  1.00 0.00 ? 124 ARG A HB2  3  
ATOM 5183  H HB3  . ARG A 1 104 ? 1.489   -5.387  -1.183  1.00 1.00 ? 124 ARG A HB3  3  
ATOM 5184  H HG2  . ARG A 1 104 ? 2.267   -4.987  -3.860  1.00 0.00 ? 124 ARG A HG2  3  
ATOM 5185  H HG3  . ARG A 1 104 ? 3.662   -5.848  -3.117  1.00 1.00 ? 124 ARG A HG3  3  
ATOM 5186  H HD2  . ARG A 1 104 ? 2.029   -7.569  -2.258  1.00 0.00 ? 124 ARG A HD2  3  
ATOM 5187  H HD3  . ARG A 1 104 ? 0.760   -6.772  -3.217  1.00 1.00 ? 124 ARG A HD3  3  
ATOM 5188  H HE   . ARG A 1 104 ? 1.752   -7.734  -5.141  1.00 1.00 ? 124 ARG A HE   3  
ATOM 5189  H HH11 . ARG A 1 104 ? 3.467   -8.768  -2.250  1.00 0.00 ? 124 ARG A HH11 3  
ATOM 5190  H HH12 . ARG A 1 104 ? 4.353   -10.011 -3.171  1.00 0.00 ? 124 ARG A HH12 3  
ATOM 5191  H HH21 . ARG A 1 104 ? 3.014   -9.202  -6.222  1.00 0.00 ? 124 ARG A HH21 3  
ATOM 5192  H HH22 . ARG A 1 104 ? 4.113   -10.243 -5.279  1.00 0.00 ? 124 ARG A HH22 3  
ATOM 5193  N N    . ALA A 1 105 ? 2.984   -1.487  -3.083  1.00 1.00 ? 125 ALA A N    3  
ATOM 5194  C CA   . ALA A 1 105 ? 3.886   -0.652  -3.881  1.00 1.00 ? 125 ALA A CA   3  
ATOM 5195  C C    . ALA A 1 105 ? 3.644   0.843   -3.577  1.00 1.00 ? 125 ALA A C    3  
ATOM 5196  O O    . ALA A 1 105 ? 2.542   1.358   -3.784  1.00 1.00 ? 125 ALA A O    3  
ATOM 5197  C CB   . ALA A 1 105 ? 3.698   -1.003  -5.371  1.00 1.00 ? 125 ALA A CB   3  
ATOM 5198  H H    . ALA A 1 105 ? 2.043   -1.155  -2.953  1.00 1.00 ? 125 ALA A H    3  
ATOM 5199  H HA   . ALA A 1 105 ? 4.918   -0.901  -3.622  1.00 1.00 ? 125 ALA A HA   3  
ATOM 5200  H HB1  . ALA A 1 105 ? 3.787   -2.081  -5.519  1.00 1.00 ? 125 ALA A HB1  3  
ATOM 5201  H HB2  . ALA A 1 105 ? 2.722   -0.667  -5.722  1.00 1.00 ? 125 ALA A HB2  3  
ATOM 5202  H HB3  . ALA A 1 105 ? 4.471   -0.517  -5.964  1.00 1.00 ? 125 ALA A HB3  3  
ATOM 5203  N N    . ILE A 1 106 ? 4.685   1.529   -3.080  1.00 1.00 ? 126 ILE A N    3  
ATOM 5204  C CA   . ILE A 1 106 ? 4.739   2.978   -2.802  1.00 1.00 ? 126 ILE A CA   3  
ATOM 5205  C C    . ILE A 1 106 ? 4.616   3.791   -4.116  1.00 1.00 ? 126 ILE A C    3  
ATOM 5206  O O    . ILE A 1 106 ? 5.608   4.144   -4.757  1.00 1.00 ? 126 ILE A O    3  
ATOM 5207  C CB   . ILE A 1 106 ? 5.969   3.352   -1.913  1.00 1.00 ? 126 ILE A CB   3  
ATOM 5208  C CG1  . ILE A 1 106 ? 6.186   4.877   -1.753  1.00 1.00 ? 126 ILE A CG1  3  
ATOM 5209  C CG2  . ILE A 1 106 ? 7.312   2.730   -2.366  1.00 1.00 ? 126 ILE A CG2  3  
ATOM 5210  C CD1  . ILE A 1 106 ? 5.018   5.660   -1.153  1.00 1.00 ? 126 ILE A CD1  3  
ATOM 5211  H H    . ILE A 1 106 ? 5.546   1.016   -2.963  1.00 1.00 ? 126 ILE A H    3  
ATOM 5212  H HA   . ILE A 1 106 ? 3.857   3.216   -2.202  1.00 1.00 ? 126 ILE A HA   3  
ATOM 5213  H HB   . ILE A 1 106 ? 5.766   2.958   -0.915  1.00 1.00 ? 126 ILE A HB   3  
ATOM 5214  H HG12 . ILE A 1 106 ? 6.958   5.089   -1.013  1.00 0.00 ? 126 ILE A HG12 3  
ATOM 5215  H HG13 . ILE A 1 106 ? 6.494   5.333   -2.693  1.00 1.00 ? 126 ILE A HG13 3  
ATOM 5216  H HG21 . ILE A 1 106 ? 7.556   3.035   -3.385  1.00 1.00 ? 126 ILE A HG21 3  
ATOM 5217  H HG22 . ILE A 1 106 ? 8.117   3.053   -1.703  1.00 1.00 ? 126 ILE A HG22 3  
ATOM 5218  H HG23 . ILE A 1 106 ? 7.265   1.642   -2.320  1.00 1.00 ? 126 ILE A HG23 3  
ATOM 5219  H HD11 . ILE A 1 106 ? 4.123   5.527   -1.758  1.00 1.00 ? 126 ILE A HD11 3  
ATOM 5220  H HD12 . ILE A 1 106 ? 4.838   5.316   -0.140  1.00 1.00 ? 126 ILE A HD12 3  
ATOM 5221  H HD13 . ILE A 1 106 ? 5.265   6.718   -1.126  1.00 1.00 ? 126 ILE A HD13 3  
ATOM 5222  N N    . LYS A 1 107 ? 3.364   4.063   -4.522  1.00 1.00 ? 127 LYS A N    3  
ATOM 5223  C CA   . LYS A 1 107 ? 2.965   4.721   -5.779  1.00 1.00 ? 127 LYS A CA   3  
ATOM 5224  C C    . LYS A 1 107 ? 2.038   5.930   -5.520  1.00 1.00 ? 127 LYS A C    3  
ATOM 5225  O O    . LYS A 1 107 ? 0.820   5.819   -5.645  1.00 1.00 ? 127 LYS A O    3  
ATOM 5226  C CB   . LYS A 1 107 ? 2.328   3.656   -6.697  1.00 1.00 ? 127 LYS A CB   3  
ATOM 5227  C CG   . LYS A 1 107 ? 3.279   2.591   -7.256  1.00 1.00 ? 127 LYS A CG   3  
ATOM 5228  C CD   . LYS A 1 107 ? 3.777   2.987   -8.654  1.00 1.00 ? 127 LYS A CD   3  
ATOM 5229  C CE   . LYS A 1 107 ? 4.156   1.807   -9.548  1.00 1.00 ? 127 LYS A CE   3  
ATOM 5230  N NZ   . LYS A 1 107 ? 2.973   1.150   -10.138 1.00 1.00 ? 127 LYS A NZ   3  
ATOM 5231  H H    . LYS A 1 107 ? 2.647   3.567   -4.003  1.00 1.00 ? 127 LYS A H    3  
ATOM 5232  H HA   . LYS A 1 107 ? 3.855   5.106   -6.282  1.00 1.00 ? 127 LYS A HA   3  
ATOM 5233  H HB2  . LYS A 1 107 ? 1.657   2.999   -6.144  1.00 0.00 ? 127 LYS A HB2  3  
ATOM 5234  H HB3  . LYS A 1 107 ? 1.746   4.112   -7.496  1.00 1.00 ? 127 LYS A HB3  3  
ATOM 5235  H HG2  . LYS A 1 107 ? 4.137   2.516   -6.588  1.00 0.00 ? 127 LYS A HG2  3  
ATOM 5236  H HG3  . LYS A 1 107 ? 2.742   1.645   -7.302  1.00 1.00 ? 127 LYS A HG3  3  
ATOM 5237  H HD2  . LYS A 1 107 ? 2.976   3.491   -9.194  1.00 0.00 ? 127 LYS A HD2  3  
ATOM 5238  H HD3  . LYS A 1 107 ? 4.630   3.658   -8.558  1.00 1.00 ? 127 LYS A HD3  3  
ATOM 5239  H HE2  . LYS A 1 107 ? 4.693   2.143   -10.436 1.00 0.00 ? 127 LYS A HE2  3  
ATOM 5240  H HE3  . LYS A 1 107 ? 4.798   1.100   -9.017  1.00 1.00 ? 127 LYS A HE3  3  
ATOM 5241  H HZ1  . LYS A 1 107 ? 2.726   1.617   -11.022 1.00 0.00 ? 127 LYS A HZ1  3  
ATOM 5242  H HZ2  . LYS A 1 107 ? 3.187   0.160   -10.322 1.00 0.00 ? 127 LYS A HZ2  3  
ATOM 5243  N N    . ILE A 1 108 ? 2.618   7.092   -5.173  1.00 1.00 ? 128 ILE A N    3  
ATOM 5244  C CA   . ILE A 1 108 ? 1.939   8.402   -5.003  1.00 1.00 ? 128 ILE A CA   3  
ATOM 5245  C C    . ILE A 1 108 ? 2.789   9.525   -5.642  1.00 1.00 ? 128 ILE A C    3  
ATOM 5246  O O    . ILE A 1 108 ? 3.934   9.742   -5.248  1.00 1.00 ? 128 ILE A O    3  
ATOM 5247  C CB   . ILE A 1 108 ? 1.604   8.698   -3.513  1.00 1.00 ? 128 ILE A CB   3  
ATOM 5248  C CG1  . ILE A 1 108 ? 0.566   7.723   -2.913  1.00 1.00 ? 128 ILE A CG1  3  
ATOM 5249  C CG2  . ILE A 1 108 ? 1.001   10.105  -3.322  1.00 1.00 ? 128 ILE A CG2  3  
ATOM 5250  C CD1  . ILE A 1 108 ? 1.074   6.398   -2.330  1.00 1.00 ? 128 ILE A CD1  3  
ATOM 5251  H H    . ILE A 1 108 ? 3.615   7.062   -5.012  1.00 1.00 ? 128 ILE A H    3  
ATOM 5252  H HA   . ILE A 1 108 ? 0.987   8.361   -5.537  1.00 1.00 ? 128 ILE A HA   3  
ATOM 5253  H HB   . ILE A 1 108 ? 2.521   8.650   -2.920  1.00 1.00 ? 128 ILE A HB   3  
ATOM 5254  H HG12 . ILE A 1 108 ? 0.160   8.083   -1.968  1.00 0.00 ? 128 ILE A HG12 3  
ATOM 5255  H HG13 . ILE A 1 108 ? -0.287  7.565   -3.577  1.00 1.00 ? 128 ILE A HG13 3  
ATOM 5256  H HG21 . ILE A 1 108 ? 0.108   10.226  -3.937  1.00 1.00 ? 128 ILE A HG21 3  
ATOM 5257  H HG22 . ILE A 1 108 ? 0.733   10.260  -2.273  1.00 1.00 ? 128 ILE A HG22 3  
ATOM 5258  H HG23 . ILE A 1 108 ? 1.726   10.876  -3.589  1.00 1.00 ? 128 ILE A HG23 3  
ATOM 5259  H HD11 . ILE A 1 108 ? 2.050   6.531   -1.867  1.00 1.00 ? 128 ILE A HD11 3  
ATOM 5260  H HD12 . ILE A 1 108 ? 0.370   6.061   -1.572  1.00 1.00 ? 128 ILE A HD12 3  
ATOM 5261  H HD13 . ILE A 1 108 ? 1.138   5.634   -3.098  1.00 1.00 ? 128 ILE A HD13 3  
ATOM 5262  N N    . THR A 1 109 ? 2.230   10.221  -6.645  1.00 1.00 ? 129 THR A N    3  
ATOM 5263  C CA   . THR A 1 109 ? 2.895   11.293  -7.434  1.00 1.00 ? 129 THR A CA   3  
ATOM 5264  C C    . THR A 1 109 ? 2.826   12.635  -6.680  1.00 1.00 ? 129 THR A C    3  
ATOM 5265  O O    . THR A 1 109 ? 1.735   13.114  -6.359  1.00 1.00 ? 129 THR A O    3  
ATOM 5266  C CB   . THR A 1 109 ? 2.267   11.457  -8.841  1.00 1.00 ? 129 THR A CB   3  
ATOM 5267  O OG1  . THR A 1 109 ? 2.137   10.209  -9.493  1.00 1.00 ? 129 THR A OG1  3  
ATOM 5268  C CG2  . THR A 1 109 ? 3.089   12.381  -9.746  1.00 1.00 ? 129 THR A CG2  3  
ATOM 5269  H H    . THR A 1 109 ? 1.281   9.963   -6.908  1.00 1.00 ? 129 THR A H    3  
ATOM 5270  H HA   . THR A 1 109 ? 3.939   11.011  -7.585  1.00 1.00 ? 129 THR A HA   3  
ATOM 5271  H HB   . THR A 1 109 ? 1.268   11.883  -8.739  1.00 1.00 ? 129 THR A HB   3  
ATOM 5272  H HG1  . THR A 1 109 ? 1.359   9.776   -9.072  1.00 1.00 ? 129 THR A HG1  3  
ATOM 5273  H HG21 . THR A 1 109 ? 4.100   11.995  -9.872  1.00 1.00 ? 129 THR A HG21 3  
ATOM 5274  H HG22 . THR A 1 109 ? 2.623   12.470  -10.730 1.00 1.00 ? 129 THR A HG22 3  
ATOM 5275  H HG23 . THR A 1 109 ? 3.141   13.384  -9.317  1.00 1.00 ? 129 THR A HG23 3  
ATOM 5276  N N    . VAL A 1 110 ? 3.986   13.258  -6.420  1.00 1.00 ? 130 VAL A N    3  
ATOM 5277  C CA   . VAL A 1 110 ? 4.124   14.462  -5.557  1.00 1.00 ? 130 VAL A CA   3  
ATOM 5278  C C    . VAL A 1 110 ? 3.618   15.772  -6.204  1.00 1.00 ? 130 VAL A C    3  
ATOM 5279  O O    . VAL A 1 110 ? 3.016   16.594  -5.511  1.00 1.00 ? 130 VAL A O    3  
ATOM 5280  C CB   . VAL A 1 110 ? 5.565   14.585  -4.991  1.00 1.00 ? 130 VAL A CB   3  
ATOM 5281  C CG1  . VAL A 1 110 ? 5.704   15.792  -4.040  1.00 1.00 ? 130 VAL A CG1  3  
ATOM 5282  C CG2  . VAL A 1 110 ? 5.962   13.329  -4.184  1.00 1.00 ? 130 VAL A CG2  3  
ATOM 5283  H H    . VAL A 1 110 ? 4.827   12.829  -6.779  1.00 1.00 ? 130 VAL A H    3  
ATOM 5284  H HA   . VAL A 1 110 ? 3.468   14.305  -4.704  1.00 1.00 ? 130 VAL A HA   3  
ATOM 5285  H HB   . VAL A 1 110 ? 6.277   14.704  -5.811  1.00 1.00 ? 130 VAL A HB   3  
ATOM 5286  H HG11 . VAL A 1 110 ? 4.942   15.754  -3.262  1.00 1.00 ? 130 VAL A HG11 3  
ATOM 5287  H HG12 . VAL A 1 110 ? 6.689   15.804  -3.572  1.00 1.00 ? 130 VAL A HG12 3  
ATOM 5288  H HG13 . VAL A 1 110 ? 5.589   16.722  -4.595  1.00 1.00 ? 130 VAL A HG13 3  
ATOM 5289  H HG21 . VAL A 1 110 ? 5.891   12.423  -4.788  1.00 1.00 ? 130 VAL A HG21 3  
ATOM 5290  H HG22 . VAL A 1 110 ? 6.998   13.421  -3.854  1.00 1.00 ? 130 VAL A HG22 3  
ATOM 5291  H HG23 . VAL A 1 110 ? 5.304   13.220  -3.323  1.00 1.00 ? 130 VAL A HG23 3  
ATOM 5292  N N    . ASP A 1 111 ? 3.805   15.914  -7.521  1.00 1.00 ? 131 ASP A N    3  
ATOM 5293  C CA   . ASP A 1 111 ? 3.374   16.959  -8.466  1.00 1.00 ? 131 ASP A CA   3  
ATOM 5294  C C    . ASP A 1 111 ? 1.894   17.386  -8.300  1.00 1.00 ? 131 ASP A C    3  
ATOM 5295  O O    . ASP A 1 111 ? 1.589   18.578  -8.333  1.00 1.00 ? 131 ASP A O    3  
ATOM 5296  C CB   . ASP A 1 111 ? 3.644   16.441  -9.913  1.00 1.00 ? 131 ASP A CB   3  
ATOM 5297  C CG   . ASP A 1 111 ? 4.870   15.536  -10.185 1.00 1.00 ? 131 ASP A CG   3  
ATOM 5298  O OD1  . ASP A 1 111 ? 5.733   15.408  -9.284  1.00 1.00 ? 131 ASP A OD1  3  
ATOM 5299  O OD2  . ASP A 1 111 ? 4.862   14.871  -11.242 1.00 1.00 ? 131 ASP A OD2  3  
ATOM 5300  H H    . ASP A 1 111 ? 4.514   15.313  -7.943  1.00 1.00 ? 131 ASP A H    3  
ATOM 5301  H HA   . ASP A 1 111 ? 3.990   17.846  -8.291  1.00 1.00 ? 131 ASP A HA   3  
ATOM 5302  H HB2  . ASP A 1 111 ? 2.773   15.857  -10.209 1.00 0.00 ? 131 ASP A HB2  3  
ATOM 5303  H HB3  . ASP A 1 111 ? 3.602   17.251  -10.643 1.00 1.00 ? 131 ASP A HB3  3  
ATOM 5304  N N    . GLY A 1 112 ? 0.983   16.423  -8.058  1.00 1.00 ? 132 GLY A N    3  
ATOM 5305  C CA   . GLY A 1 112 ? -0.448  16.646  -7.803  1.00 1.00 ? 132 GLY A CA   3  
ATOM 5306  C C    . GLY A 1 112 ? -1.260  17.183  -9.008  1.00 1.00 ? 132 GLY A C    3  
ATOM 5307  O O    . GLY A 1 112 ? -0.908  16.940  -10.166 1.00 1.00 ? 132 GLY A O    3  
ATOM 5308  H H    . GLY A 1 112 ? 1.349   15.483  -8.026  1.00 1.00 ? 132 GLY A H    3  
ATOM 5309  H HA2  . GLY A 1 112 ? -0.904  15.710  -7.475  1.00 1.00 ? 132 GLY A HA2  3  
ATOM 5310  H HA3  . GLY A 1 112 ? -0.532  17.357  -6.980  1.00 1.00 ? 132 GLY A HA3  3  
ATOM 5311  N N    . PRO A 1 113 ? -2.391  17.882  -8.757  1.00 1.00 ? 133 PRO A N    3  
ATOM 5312  C CA   . PRO A 1 113 ? -3.219  18.535  -9.780  1.00 1.00 ? 133 PRO A CA   3  
ATOM 5313  C C    . PRO A 1 113 ? -2.541  19.768  -10.428 1.00 1.00 ? 133 PRO A C    3  
ATOM 5314  O O    . PRO A 1 113 ? -2.899  20.913  -10.124 1.00 1.00 ? 133 PRO A O    3  
ATOM 5315  C CB   . PRO A 1 113 ? -4.550  18.862  -9.087  1.00 1.00 ? 133 PRO A CB   3  
ATOM 5316  C CG   . PRO A 1 113 ? -4.156  19.017  -7.618  1.00 1.00 ? 133 PRO A CG   3  
ATOM 5317  C CD   . PRO A 1 113 ? -2.995  18.044  -7.444  1.00 1.00 ? 133 PRO A CD   3  
ATOM 5318  H HA   . PRO A 1 113 ? -3.427  17.823  -10.581 1.00 1.00 ? 133 PRO A HA   3  
ATOM 5319  H HB2  . PRO A 1 113 ? -4.986  19.777  -9.487  1.00 0.00 ? 133 PRO A HB2  3  
ATOM 5320  H HB3  . PRO A 1 113 ? -5.227  18.013  -9.183  1.00 1.00 ? 133 PRO A HB3  3  
ATOM 5321  H HG2  . PRO A 1 113 ? -3.871  20.044  -7.387  1.00 0.00 ? 133 PRO A HG2  3  
ATOM 5322  H HG3  . PRO A 1 113 ? -4.979  18.748  -6.953  1.00 1.00 ? 133 PRO A HG3  3  
ATOM 5323  H HD2  . PRO A 1 113 ? -2.219  18.381  -6.758  1.00 0.00 ? 133 PRO A HD2  3  
ATOM 5324  H HD3  . PRO A 1 113 ? -3.394  17.077  -7.138  1.00 1.00 ? 133 PRO A HD3  3  
ATOM 5325  N N    . ARG A 1 114 ? -1.596  19.487  -11.354 1.00 1.00 ? 134 ARG A N    3  
ATOM 5326  C CA   . ARG A 1 114 ? -0.824  20.373  -12.265 1.00 1.00 ? 134 ARG A CA   3  
ATOM 5327  C C    . ARG A 1 114 ? 0.611   19.858  -12.493 1.00 1.00 ? 134 ARG A C    3  
ATOM 5328  O O    . ARG A 1 114 ? 1.488   20.089  -11.662 1.00 1.00 ? 134 ARG A O    3  
ATOM 5329  C CB   . ARG A 1 114 ? -0.809  21.849  -11.809 1.00 1.00 ? 134 ARG A CB   3  
ATOM 5330  C CG   . ARG A 1 114 ? -0.150  22.807  -12.812 1.00 1.00 ? 134 ARG A CG   3  
ATOM 5331  C CD   . ARG A 1 114 ? 0.293   24.128  -12.163 1.00 1.00 ? 134 ARG A CD   3  
ATOM 5332  N NE   . ARG A 1 114 ? -0.835  24.879  -11.577 1.00 1.00 ? 134 ARG A NE   3  
ATOM 5333  C CZ   . ARG A 1 114 ? -1.666  25.712  -12.176 1.00 1.00 ? 134 ARG A CZ   3  
ATOM 5334  N NH1  . ARG A 1 114 ? -1.567  26.042  -13.434 1.00 1.00 ? 134 ARG A NH1  3  
ATOM 5335  N NH2  . ARG A 1 114 ? -2.641  26.249  -11.507 1.00 1.00 ? 134 ARG A NH2  3  
ATOM 5336  H H    . ARG A 1 114 ? -1.325  18.501  -11.343 1.00 1.00 ? 134 ARG A H    3  
ATOM 5337  H HA   . ARG A 1 114 ? -1.322  20.366  -13.233 1.00 1.00 ? 134 ARG A HA   3  
ATOM 5338  H HB2  . ARG A 1 114 ? -1.831  22.221  -11.740 1.00 0.00 ? 134 ARG A HB2  3  
ATOM 5339  H HB3  . ARG A 1 114 ? -0.330  21.927  -10.834 1.00 1.00 ? 134 ARG A HB3  3  
ATOM 5340  H HG2  . ARG A 1 114 ? 0.775   22.379  -13.199 1.00 0.00 ? 134 ARG A HG2  3  
ATOM 5341  H HG3  . ARG A 1 114 ? -0.816  23.000  -13.652 1.00 1.00 ? 134 ARG A HG3  3  
ATOM 5342  H HD2  . ARG A 1 114 ? 0.914   23.945  -11.285 1.00 0.00 ? 134 ARG A HD2  3  
ATOM 5343  H HD3  . ARG A 1 114 ? 0.872   24.733  -12.860 1.00 1.00 ? 134 ARG A HD3  3  
ATOM 5344  H HE   . ARG A 1 114 ? -1.096  24.626  -10.642 1.00 1.00 ? 134 ARG A HE   3  
ATOM 5345  H HH11 . ARG A 1 114 ? -0.811  25.646  -14.011 1.00 0.00 ? 134 ARG A HH11 3  
ATOM 5346  H HH12 . ARG A 1 114 ? -2.243  26.697  -13.849 1.00 0.00 ? 134 ARG A HH12 3  
ATOM 5347  H HH21 . ARG A 1 114 ? -2.766  26.025  -10.510 1.00 0.00 ? 134 ARG A HH21 3  
ATOM 5348  H HH22 . ARG A 1 114 ? -3.290  26.899  -11.975 1.00 0.00 ? 134 ARG A HH22 3  
ATOM 5349  N N    . GLU A 1 115 ? 0.823   19.136  -13.602 1.00 1.00 ? 135 GLU A N    3  
ATOM 5350  C CA   . GLU A 1 115 ? 2.164   18.725  -14.091 1.00 1.00 ? 135 GLU A CA   3  
ATOM 5351  C C    . GLU A 1 115 ? 2.976   19.883  -14.732 1.00 1.00 ? 135 GLU A C    3  
ATOM 5352  O O    . GLU A 1 115 ? 2.361   20.867  -15.212 1.00 1.00 ? 135 GLU A O    3  
ATOM 5353  C CB   . GLU A 1 115 ? 2.070   17.452  -14.961 1.00 1.00 ? 135 GLU A CB   3  
ATOM 5354  C CG   . GLU A 1 115 ? 1.284   17.484  -16.284 1.00 1.00 ? 135 GLU A CG   3  
ATOM 5355  C CD   . GLU A 1 115 ? 2.113   17.222  -17.557 1.00 1.00 ? 135 GLU A CD   3  
ATOM 5356  O OE1  . GLU A 1 115 ? 2.728   16.133  -17.629 1.00 1.00 ? 135 GLU A OE1  3  
ATOM 5357  O OE2  . GLU A 1 115 ? 2.064   18.058  -18.486 1.00 1.00 ? 135 GLU A OE2  3  
ATOM 5358  O OXT  . GLU A 1 115 ? 4.220   19.791  -14.645 1.00 1.00 ? 135 GLU A OXT  3  
ATOM 5359  H H    . GLU A 1 115 ? 0.055   19.020  -14.240 1.00 1.00 ? 135 GLU A H    3  
ATOM 5360  H HA   . GLU A 1 115 ? 2.769   18.444  -13.228 1.00 1.00 ? 135 GLU A HA   3  
ATOM 5361  H HB2  . GLU A 1 115 ? 3.049   17.212  -15.374 1.00 0.00 ? 135 GLU A HB2  3  
ATOM 5362  H HB3  . GLU A 1 115 ? 1.722   16.610  -14.353 1.00 1.00 ? 135 GLU A HB3  3  
ATOM 5363  H HG2  . GLU A 1 115 ? 0.739   16.545  -16.382 1.00 0.00 ? 135 GLU A HG2  3  
ATOM 5364  H HG3  . GLU A 1 115 ? 0.559   18.300  -16.355 1.00 1.00 ? 135 GLU A HG3  3  
ATOM 5365  N N    . GLU A 1 1   ? -9.556  -10.752 -11.344 1.00 1.00 ? 21  GLU A N    4  
ATOM 5366  C CA   . GLU A 1 1   ? -9.680  -10.379 -9.912  1.00 1.00 ? 21  GLU A CA   4  
ATOM 5367  C C    . GLU A 1 1   ? -10.364 -8.997  -9.810  1.00 1.00 ? 21  GLU A C    4  
ATOM 5368  O O    . GLU A 1 1   ? -11.228 -8.706  -10.637 1.00 1.00 ? 21  GLU A O    4  
ATOM 5369  C CB   . GLU A 1 1   ? -8.335  -10.537 -9.155  1.00 1.00 ? 21  GLU A CB   4  
ATOM 5370  C CG   . GLU A 1 1   ? -7.218  -9.507  -9.397  1.00 1.00 ? 21  GLU A CG   4  
ATOM 5371  C CD   . GLU A 1 1   ? -6.585  -9.599  -10.786 1.00 1.00 ? 21  GLU A CD   4  
ATOM 5372  O OE1  . GLU A 1 1   ? -7.343  -9.346  -11.754 1.00 1.00 ? 21  GLU A OE1  4  
ATOM 5373  O OE2  . GLU A 1 1   ? -5.392  -9.946  -10.851 1.00 1.00 ? 21  GLU A OE2  4  
ATOM 5374  H H1   . GLU A 1 1   ? -10.395 -11.273 -11.638 1.00 0.00 ? 21  GLU A H1   4  
ATOM 5375  H H2   . GLU A 1 1   ? -9.464  -9.899  -11.916 1.00 0.00 ? 21  GLU A H2   4  
ATOM 5376  H HA   . GLU A 1 1   ? -10.375 -11.075 -9.440  1.00 1.00 ? 21  GLU A HA   4  
ATOM 5377  H HB2  . GLU A 1 1   ? -8.466  -10.333 -8.091  1.00 0.00 ? 21  GLU A HB2  4  
ATOM 5378  H HB3  . GLU A 1 1   ? -7.948  -11.552 -9.264  1.00 1.00 ? 21  GLU A HB3  4  
ATOM 5379  H HG2  . GLU A 1 1   ? -7.628  -8.497  -9.378  1.00 0.00 ? 21  GLU A HG2  4  
ATOM 5380  H HG3  . GLU A 1 1   ? -6.453  -9.592  -8.622  1.00 1.00 ? 21  GLU A HG3  4  
ATOM 5381  N N    . LEU A 1 2   ? -10.006 -8.157  -8.831  1.00 1.00 ? 22  LEU A N    4  
ATOM 5382  C CA   . LEU A 1 2   ? -10.253 -6.719  -8.777  1.00 1.00 ? 22  LEU A CA   4  
ATOM 5383  C C    . LEU A 1 2   ? -8.984  -6.136  -8.110  1.00 1.00 ? 22  LEU A C    4  
ATOM 5384  O O    . LEU A 1 2   ? -7.997  -6.878  -7.965  1.00 1.00 ? 22  LEU A O    4  
ATOM 5385  C CB   . LEU A 1 2   ? -11.620 -6.479  -8.104  1.00 1.00 ? 22  LEU A CB   4  
ATOM 5386  C CG   . LEU A 1 2   ? -12.281 -5.101  -8.308  1.00 1.00 ? 22  LEU A CG   4  
ATOM 5387  C CD1  . LEU A 1 2   ? -12.994 -5.014  -9.665  1.00 1.00 ? 22  LEU A CD1  4  
ATOM 5388  C CD2  . LEU A 1 2   ? -13.273 -4.806  -7.177  1.00 1.00 ? 22  LEU A CD2  4  
ATOM 5389  H H    . LEU A 1 2   ? -9.229  -8.322  -8.158  1.00 1.00 ? 22  LEU A H    4  
ATOM 5390  H HA   . LEU A 1 2   ? -10.299 -6.340  -9.800  1.00 1.00 ? 22  LEU A HA   4  
ATOM 5391  H HB2  . LEU A 1 2   ? -12.410 -7.048  -8.595  1.00 0.00 ? 22  LEU A HB2  4  
ATOM 5392  H HB3  . LEU A 1 2   ? -11.603 -6.777  -7.061  1.00 1.00 ? 22  LEU A HB3  4  
ATOM 5393  H HG   . LEU A 1 2   ? -11.508 -4.337  -8.294  1.00 1.00 ? 22  LEU A HG   4  
ATOM 5394  H HD11 . LEU A 1 2   ? -13.778 -5.769  -9.733  1.00 1.00 ? 22  LEU A HD11 4  
ATOM 5395  H HD12 . LEU A 1 2   ? -13.439 -4.025  -9.773  1.00 1.00 ? 22  LEU A HD12 4  
ATOM 5396  H HD13 . LEU A 1 2   ? -12.282 -5.157  -10.477 1.00 1.00 ? 22  LEU A HD13 4  
ATOM 5397  H HD21 . LEU A 1 2   ? -12.769 -4.883  -6.214  1.00 1.00 ? 22  LEU A HD21 4  
ATOM 5398  H HD22 . LEU A 1 2   ? -13.662 -3.792  -7.274  1.00 1.00 ? 22  LEU A HD22 4  
ATOM 5399  H HD23 . LEU A 1 2   ? -14.098 -5.518  -7.203  1.00 1.00 ? 22  LEU A HD23 4  
ATOM 5400  N N    . VAL A 1 3   ? -8.882  -4.839  -7.791  1.00 1.00 ? 23  VAL A N    4  
ATOM 5401  C CA   . VAL A 1 3   ? -7.692  -4.373  -7.047  1.00 1.00 ? 23  VAL A CA   4  
ATOM 5402  C C    . VAL A 1 3   ? -7.743  -4.920  -5.594  1.00 1.00 ? 23  VAL A C    4  
ATOM 5403  O O    . VAL A 1 3   ? -8.101  -4.197  -4.657  1.00 1.00 ? 23  VAL A O    4  
ATOM 5404  C CB   . VAL A 1 3   ? -7.430  -2.845  -7.137  1.00 1.00 ? 23  VAL A CB   4  
ATOM 5405  C CG1  . VAL A 1 3   ? -5.967  -2.587  -6.772  1.00 1.00 ? 23  VAL A CG1  4  
ATOM 5406  C CG2  . VAL A 1 3   ? -7.661  -2.225  -8.533  1.00 1.00 ? 23  VAL A CG2  4  
ATOM 5407  H H    . VAL A 1 3   ? -9.687  -4.217  -7.799  1.00 1.00 ? 23  VAL A H    4  
ATOM 5408  H HA   . VAL A 1 3   ? -6.822  -4.832  -7.520  1.00 1.00 ? 23  VAL A HA   4  
ATOM 5409  H HB   . VAL A 1 3   ? -8.049  -2.310  -6.421  1.00 1.00 ? 23  VAL A HB   4  
ATOM 5410  H HG11 . VAL A 1 3   ? -5.773  -2.977  -5.773  1.00 1.00 ? 23  VAL A HG11 4  
ATOM 5411  H HG12 . VAL A 1 3   ? -5.295  -3.064  -7.486  1.00 1.00 ? 23  VAL A HG12 4  
ATOM 5412  H HG13 . VAL A 1 3   ? -5.791  -1.514  -6.777  1.00 1.00 ? 23  VAL A HG13 4  
ATOM 5413  H HG21 . VAL A 1 3   ? -7.041  -2.722  -9.282  1.00 1.00 ? 23  VAL A HG21 4  
ATOM 5414  H HG22 . VAL A 1 3   ? -8.708  -2.320  -8.814  1.00 1.00 ? 23  VAL A HG22 4  
ATOM 5415  H HG23 . VAL A 1 3   ? -7.416  -1.158  -8.515  1.00 1.00 ? 23  VAL A HG23 4  
ATOM 5416  N N    . ARG A 1 4   ? -7.451  -6.236  -5.430  1.00 1.00 ? 24  ARG A N    4  
ATOM 5417  C CA   . ARG A 1 4   ? -7.251  -6.916  -4.121  1.00 1.00 ? 24  ARG A CA   4  
ATOM 5418  C C    . ARG A 1 4   ? -6.298  -6.135  -3.173  1.00 1.00 ? 24  ARG A C    4  
ATOM 5419  O O    . ARG A 1 4   ? -5.333  -5.511  -3.624  1.00 1.00 ? 24  ARG A O    4  
ATOM 5420  C CB   . ARG A 1 4   ? -6.689  -8.338  -4.295  1.00 1.00 ? 24  ARG A CB   4  
ATOM 5421  C CG   . ARG A 1 4   ? -7.423  -9.285  -5.251  1.00 1.00 ? 24  ARG A CG   4  
ATOM 5422  C CD   . ARG A 1 4   ? -6.650  -10.597 -5.436  1.00 1.00 ? 24  ARG A CD   4  
ATOM 5423  N NE   . ARG A 1 4   ? -5.443  -10.427 -6.268  1.00 1.00 ? 24  ARG A NE   4  
ATOM 5424  C CZ   . ARG A 1 4   ? -4.233  -10.076 -5.863  1.00 1.00 ? 24  ARG A CZ   4  
ATOM 5425  N NH1  . ARG A 1 4   ? -3.922  -9.862  -4.613  1.00 1.00 ? 24  ARG A NH1  4  
ATOM 5426  N NH2  . ARG A 1 4   ? -3.278  -9.917  -6.732  1.00 1.00 ? 24  ARG A NH2  4  
ATOM 5427  H H    . ARG A 1 4   ? -7.600  -6.816  -6.290  1.00 1.00 ? 24  ARG A H    4  
ATOM 5428  H HA   . ARG A 1 4   ? -8.215  -7.008  -3.629  1.00 1.00 ? 24  ARG A HA   4  
ATOM 5429  H HB2  . ARG A 1 4   ? -5.702  -8.283  -4.756  1.00 0.00 ? 24  ARG A HB2  4  
ATOM 5430  H HB3  . ARG A 1 4   ? -6.611  -8.816  -3.319  1.00 1.00 ? 24  ARG A HB3  4  
ATOM 5431  H HG2  . ARG A 1 4   ? -8.401  -9.553  -4.851  1.00 0.00 ? 24  ARG A HG2  4  
ATOM 5432  H HG3  . ARG A 1 4   ? -7.567  -8.814  -6.223  1.00 1.00 ? 24  ARG A HG3  4  
ATOM 5433  H HD2  . ARG A 1 4   ? -6.281  -10.948 -4.473  1.00 0.00 ? 24  ARG A HD2  4  
ATOM 5434  H HD3  . ARG A 1 4   ? -7.309  -11.357 -5.866  1.00 1.00 ? 24  ARG A HD3  4  
ATOM 5435  H HE   . ARG A 1 4   ? -5.542  -10.556 -7.260  1.00 1.00 ? 24  ARG A HE   4  
ATOM 5436  H HH11 . ARG A 1 4   ? -4.638  -9.963  -3.878  1.00 0.00 ? 24  ARG A HH11 4  
ATOM 5437  H HH12 . ARG A 1 4   ? -2.961  -9.591  -4.360  1.00 0.00 ? 24  ARG A HH12 4  
ATOM 5438  H HH21 . ARG A 1 4   ? -3.464  -10.063 -7.734  1.00 0.00 ? 24  ARG A HH21 4  
ATOM 5439  H HH22 . ARG A 1 4   ? -2.336  -9.644  -6.417  1.00 0.00 ? 24  ARG A HH22 4  
ATOM 5440  N N    . THR A 1 5   ? -6.544  -6.221  -1.855  1.00 1.00 ? 25  THR A N    4  
ATOM 5441  C CA   . THR A 1 5   ? -5.699  -5.671  -0.767  1.00 1.00 ? 25  THR A CA   4  
ATOM 5442  C C    . THR A 1 5   ? -4.587  -6.677  -0.364  1.00 1.00 ? 25  THR A C    4  
ATOM 5443  O O    . THR A 1 5   ? -4.194  -7.525  -1.169  1.00 1.00 ? 25  THR A O    4  
ATOM 5444  C CB   . THR A 1 5   ? -6.602  -5.187  0.404   1.00 1.00 ? 25  THR A CB   4  
ATOM 5445  O OG1  . THR A 1 5   ? -5.834  -4.418  1.301   1.00 1.00 ? 25  THR A OG1  4  
ATOM 5446  C CG2  . THR A 1 5   ? -7.275  -6.278  1.242   1.00 1.00 ? 25  THR A CG2  4  
ATOM 5447  H H    . THR A 1 5   ? -7.321  -6.818  -1.571  1.00 1.00 ? 25  THR A H    4  
ATOM 5448  H HA   . THR A 1 5   ? -5.185  -4.790  -1.155  1.00 1.00 ? 25  THR A HA   4  
ATOM 5449  H HB   . THR A 1 5   ? -7.383  -4.544  -0.010  1.00 1.00 ? 25  THR A HB   4  
ATOM 5450  H HG1  . THR A 1 5   ? -6.398  -4.173  2.045   1.00 1.00 ? 25  THR A HG1  4  
ATOM 5451  H HG21 . THR A 1 5   ? -7.862  -6.933  0.616   1.00 1.00 ? 25  THR A HG21 4  
ATOM 5452  H HG22 . THR A 1 5   ? -6.540  -6.896  1.745   1.00 1.00 ? 25  THR A HG22 4  
ATOM 5453  H HG23 . THR A 1 5   ? -7.934  -5.824  1.981   1.00 1.00 ? 25  THR A HG23 4  
ATOM 5454  N N    . ASP A 1 6   ? -4.079  -6.612  0.878   1.00 1.00 ? 26  ASP A N    4  
ATOM 5455  C CA   . ASP A 1 6   ? -3.141  -7.564  1.509   1.00 1.00 ? 26  ASP A CA   4  
ATOM 5456  C C    . ASP A 1 6   ? -3.513  -9.065  1.356   1.00 1.00 ? 26  ASP A C    4  
ATOM 5457  O O    . ASP A 1 6   ? -2.660  -9.932  1.543   1.00 1.00 ? 26  ASP A O    4  
ATOM 5458  C CB   . ASP A 1 6   ? -3.072  -7.212  3.011   1.00 1.00 ? 26  ASP A CB   4  
ATOM 5459  C CG   . ASP A 1 6   ? -1.785  -6.558  3.515   1.00 1.00 ? 26  ASP A CG   4  
ATOM 5460  O OD1  . ASP A 1 6   ? -0.692  -6.905  3.017   1.00 1.00 ? 26  ASP A OD1  4  
ATOM 5461  O OD2  . ASP A 1 6   ? -1.937  -5.722  4.439   1.00 1.00 ? 26  ASP A OD2  4  
ATOM 5462  H H    . ASP A 1 6   ? -4.404  -5.820  1.427   1.00 1.00 ? 26  ASP A H    4  
ATOM 5463  H HA   . ASP A 1 6   ? -2.156  -7.425  1.060   1.00 1.00 ? 26  ASP A HA   4  
ATOM 5464  H HB2  . ASP A 1 6   ? -3.881  -6.514  3.224   1.00 0.00 ? 26  ASP A HB2  4  
ATOM 5465  H HB3  . ASP A 1 6   ? -3.332  -8.059  3.650   1.00 1.00 ? 26  ASP A HB3  4  
ATOM 5466  N N    . SER A 1 7   ? -4.778  -9.377  1.027   1.00 1.00 ? 27  SER A N    4  
ATOM 5467  C CA   . SER A 1 7   ? -5.324  -10.730 0.868   1.00 1.00 ? 27  SER A CA   4  
ATOM 5468  C C    . SER A 1 7   ? -6.365  -10.801 -0.268  1.00 1.00 ? 27  SER A C    4  
ATOM 5469  O O    . SER A 1 7   ? -7.232  -9.918  -0.339  1.00 1.00 ? 27  SER A O    4  
ATOM 5470  C CB   . SER A 1 7   ? -5.959  -11.181 2.185   1.00 1.00 ? 27  SER A CB   4  
ATOM 5471  O OG   . SER A 1 7   ? -6.388  -12.524 2.101   1.00 1.00 ? 27  SER A OG   4  
ATOM 5472  H H    . SER A 1 7   ? -5.372  -8.596  0.766   1.00 1.00 ? 27  SER A H    4  
ATOM 5473  H HA   . SER A 1 7   ? -4.495  -11.403 0.654   1.00 1.00 ? 27  SER A HA   4  
ATOM 5474  H HB2  . SER A 1 7   ? -5.230  -11.131 2.993   1.00 0.00 ? 27  SER A HB2  4  
ATOM 5475  H HB3  . SER A 1 7   ? -6.805  -10.538 2.438   1.00 1.00 ? 27  SER A HB3  4  
ATOM 5476  H HG   . SER A 1 7   ? -5.858  -13.046 2.712   1.00 1.00 ? 27  SER A HG   4  
ATOM 5477  N N    . PRO A 1 8   ? -6.342  -11.854 -1.126  1.00 1.00 ? 28  PRO A N    4  
ATOM 5478  C CA   . PRO A 1 8   ? -7.322  -12.051 -2.201  1.00 1.00 ? 28  PRO A CA   4  
ATOM 5479  C C    . PRO A 1 8   ? -8.808  -12.034 -1.793  1.00 1.00 ? 28  PRO A C    4  
ATOM 5480  O O    . PRO A 1 8   ? -9.642  -11.784 -2.660  1.00 1.00 ? 28  PRO A O    4  
ATOM 5481  C CB   . PRO A 1 8   ? -6.983  -13.381 -2.877  1.00 1.00 ? 28  PRO A CB   4  
ATOM 5482  C CG   . PRO A 1 8   ? -5.676  -13.883 -2.269  1.00 1.00 ? 28  PRO A CG   4  
ATOM 5483  C CD   . PRO A 1 8   ? -5.332  -12.908 -1.146  1.00 1.00 ? 28  PRO A CD   4  
ATOM 5484  H HA   . PRO A 1 8   ? -7.179  -11.249 -2.923  1.00 1.00 ? 28  PRO A HA   4  
ATOM 5485  H HB2  . PRO A 1 8   ? -7.807  -14.068 -2.676  1.00 0.00 ? 28  PRO A HB2  4  
ATOM 5486  H HB3  . PRO A 1 8   ? -6.884  -13.253 -3.955  1.00 1.00 ? 28  PRO A HB3  4  
ATOM 5487  H HG2  . PRO A 1 8   ? -5.796  -14.897 -1.887  1.00 0.00 ? 28  PRO A HG2  4  
ATOM 5488  H HG3  . PRO A 1 8   ? -4.885  -13.888 -3.017  1.00 1.00 ? 28  PRO A HG3  4  
ATOM 5489  H HD2  . PRO A 1 8   ? -5.316  -13.428 -0.189  1.00 0.00 ? 28  PRO A HD2  4  
ATOM 5490  H HD3  . PRO A 1 8   ? -4.347  -12.477 -1.330  1.00 1.00 ? 28  PRO A HD3  4  
ATOM 5491  N N    . ASN A 1 9   ? -9.143  -12.246 -0.507  1.00 1.00 ? 29  ASN A N    4  
ATOM 5492  C CA   . ASN A 1 9   ? -10.512 -12.171 0.016   1.00 1.00 ? 29  ASN A CA   4  
ATOM 5493  C C    . ASN A 1 9   ? -11.144 -10.745 -0.022  1.00 1.00 ? 29  ASN A C    4  
ATOM 5494  O O    . ASN A 1 9   ? -12.371 -10.623 -0.067  1.00 1.00 ? 29  ASN A O    4  
ATOM 5495  C CB   . ASN A 1 9   ? -10.524 -12.788 1.434   1.00 1.00 ? 29  ASN A CB   4  
ATOM 5496  C CG   . ASN A 1 9   ? -10.259 -14.294 1.480   1.00 1.00 ? 29  ASN A CG   4  
ATOM 5497  O OD1  . ASN A 1 9   ? -10.696 -15.084 0.660   1.00 1.00 ? 29  ASN A OD1  4  
ATOM 5498  N ND2  . ASN A 1 9   ? -9.532  -14.770 2.461   1.00 1.00 ? 29  ASN A ND2  4  
ATOM 5499  H H    . ASN A 1 9   ? -8.403  -12.420 0.158   1.00 1.00 ? 29  ASN A H    4  
ATOM 5500  H HA   . ASN A 1 9   ? -11.141 -12.797 -0.620  1.00 1.00 ? 29  ASN A HA   4  
ATOM 5501  H HB2  . ASN A 1 9   ? -9.753  -12.325 2.051   1.00 0.00 ? 29  ASN A HB2  4  
ATOM 5502  H HB3  . ASN A 1 9   ? -11.491 -12.629 1.904   1.00 1.00 ? 29  ASN A HB3  4  
ATOM 5503  H HD21 . ASN A 1 9   ? -9.154  -14.136 3.178   1.00 0.00 ? 29  ASN A HD21 4  
ATOM 5504  H HD22 . ASN A 1 9   ? -9.339  -15.781 2.514   1.00 0.00 ? 29  ASN A HD22 4  
ATOM 5505  N N    . PHE A 1 10  ? -10.340 -9.666  -0.049  1.00 1.00 ? 30  PHE A N    4  
ATOM 5506  C CA   . PHE A 1 10  ? -10.803 -8.265  0.023   1.00 1.00 ? 30  PHE A CA   4  
ATOM 5507  C C    . PHE A 1 10  ? -10.281 -7.430  -1.161  1.00 1.00 ? 30  PHE A C    4  
ATOM 5508  O O    . PHE A 1 10  ? -9.072  -7.374  -1.403  1.00 1.00 ? 30  PHE A O    4  
ATOM 5509  C CB   . PHE A 1 10  ? -10.405 -7.672  1.385   1.00 1.00 ? 30  PHE A CB   4  
ATOM 5510  C CG   . PHE A 1 10  ? -11.029 -8.363  2.587   1.00 1.00 ? 30  PHE A CG   4  
ATOM 5511  C CD1  . PHE A 1 10  ? -12.309 -7.975  3.050   1.00 1.00 ? 30  PHE A CD1  4  
ATOM 5512  C CD2  . PHE A 1 10  ? -10.347 -9.428  3.216   1.00 1.00 ? 30  PHE A CD2  4  
ATOM 5513  C CE1  . PHE A 1 10  ? -12.900 -8.651  4.139   1.00 1.00 ? 30  PHE A CE1  4  
ATOM 5514  C CE2  . PHE A 1 10  ? -10.943 -10.111 4.300   1.00 1.00 ? 30  PHE A CE2  4  
ATOM 5515  C CZ   . PHE A 1 10  ? -12.219 -9.722  4.760   1.00 1.00 ? 30  PHE A CZ   4  
ATOM 5516  H H    . PHE A 1 10  ? -9.338  -9.835  -0.074  1.00 1.00 ? 30  PHE A H    4  
ATOM 5517  H HA   . PHE A 1 10  ? -11.894 -8.242  -0.023  1.00 1.00 ? 30  PHE A HA   4  
ATOM 5518  H HB2  . PHE A 1 10  ? -9.338  -7.807  1.564   1.00 0.00 ? 30  PHE A HB2  4  
ATOM 5519  H HB3  . PHE A 1 10  ? -10.629 -6.600  1.417   1.00 1.00 ? 30  PHE A HB3  4  
ATOM 5520  H HD1  . PHE A 1 10  ? -12.836 -7.166  2.570   1.00 1.00 ? 30  PHE A HD1  4  
ATOM 5521  H HD2  . PHE A 1 10  ? -9.372  -9.734  2.859   1.00 1.00 ? 30  PHE A HD2  4  
ATOM 5522  H HE1  . PHE A 1 10  ? -13.873 -8.344  4.493   1.00 1.00 ? 30  PHE A HE1  4  
ATOM 5523  H HE2  . PHE A 1 10  ? -10.424 -10.931 4.775   1.00 1.00 ? 30  PHE A HE2  4  
ATOM 5524  H HZ   . PHE A 1 10  ? -12.673 -10.246 5.590   1.00 1.00 ? 30  PHE A HZ   4  
ATOM 5525  N N    . LEU A 1 11  ? -11.193 -6.795  -1.920  1.00 1.00 ? 31  LEU A N    4  
ATOM 5526  C CA   . LEU A 1 11  ? -10.878 -6.101  -3.179  1.00 1.00 ? 31  LEU A CA   4  
ATOM 5527  C C    . LEU A 1 11  ? -11.601 -4.755  -3.394  1.00 1.00 ? 31  LEU A C    4  
ATOM 5528  O O    . LEU A 1 11  ? -12.706 -4.521  -2.902  1.00 1.00 ? 31  LEU A O    4  
ATOM 5529  C CB   . LEU A 1 11  ? -11.136 -7.046  -4.379  1.00 1.00 ? 31  LEU A CB   4  
ATOM 5530  C CG   . LEU A 1 11  ? -10.857 -8.573  -4.279  1.00 1.00 ? 31  LEU A CG   4  
ATOM 5531  C CD1  . LEU A 1 11  ? -11.993 -9.387  -3.631  1.00 1.00 ? 31  LEU A CD1  4  
ATOM 5532  C CD2  . LEU A 1 11  ? -10.654 -9.169  -5.682  1.00 1.00 ? 31  LEU A CD2  4  
ATOM 5533  H H    . LEU A 1 11  ? -12.179 -6.899  -1.674  1.00 1.00 ? 31  LEU A H    4  
ATOM 5534  H HA   . LEU A 1 11  ? -9.816  -5.858  -3.163  1.00 1.00 ? 31  LEU A HA   4  
ATOM 5535  H HB2  . LEU A 1 11  ? -12.212 -7.011  -4.549  1.00 0.00 ? 31  LEU A HB2  4  
ATOM 5536  H HB3  . LEU A 1 11  ? -10.558 -6.632  -5.203  1.00 1.00 ? 31  LEU A HB3  4  
ATOM 5537  H HG   . LEU A 1 11  ? -9.937  -8.729  -3.713  1.00 1.00 ? 31  LEU A HG   4  
ATOM 5538  H HD11 . LEU A 1 11  ? -12.246 -9.009  -2.645  1.00 1.00 ? 31  LEU A HD11 4  
ATOM 5539  H HD12 . LEU A 1 11  ? -12.884 -9.366  -4.256  1.00 1.00 ? 31  LEU A HD12 4  
ATOM 5540  H HD13 . LEU A 1 11  ? -11.680 -10.424 -3.515  1.00 1.00 ? 31  LEU A HD13 4  
ATOM 5541  H HD21 . LEU A 1 11  ? -9.862  -8.632  -6.193  1.00 1.00 ? 31  LEU A HD21 4  
ATOM 5542  H HD22 . LEU A 1 11  ? -10.373 -10.220 -5.600  1.00 1.00 ? 31  LEU A HD22 4  
ATOM 5543  H HD23 . LEU A 1 11  ? -11.572 -9.087  -6.266  1.00 1.00 ? 31  LEU A HD23 4  
ATOM 5544  N N    . CYS A 1 12  ? -10.984 -3.880  -4.203  1.00 1.00 ? 32  CYS A N    4  
ATOM 5545  C CA   . CYS A 1 12  ? -11.471 -2.537  -4.553  1.00 1.00 ? 32  CYS A CA   4  
ATOM 5546  C C    . CYS A 1 12  ? -11.210 -2.138  -6.023  1.00 1.00 ? 32  CYS A C    4  
ATOM 5547  O O    . CYS A 1 12  ? -10.430 -2.771  -6.731  1.00 1.00 ? 32  CYS A O    4  
ATOM 5548  C CB   . CYS A 1 12  ? -10.865 -1.522  -3.559  1.00 1.00 ? 32  CYS A CB   4  
ATOM 5549  S SG   . CYS A 1 12  ? -9.077  -1.248  -3.785  1.00 1.00 ? 32  CYS A SG   4  
ATOM 5550  H H    . CYS A 1 12  ? -10.074 -4.129  -4.584  1.00 1.00 ? 32  CYS A H    4  
ATOM 5551  H HA   . CYS A 1 12  ? -12.550 -2.516  -4.419  1.00 1.00 ? 32  CYS A HA   4  
ATOM 5552  H HB2  . CYS A 1 12  ? -11.297 -0.534  -3.717  1.00 0.00 ? 32  CYS A HB2  4  
ATOM 5553  H HB3  . CYS A 1 12  ? -11.066 -1.832  -2.534  1.00 1.00 ? 32  CYS A HB3  4  
ATOM 5554  H HG   . CYS A 1 12  ? -8.702  -2.529  -3.963  1.00 1.00 ? 32  CYS A HG   4  
ATOM 5555  N N    . SER A 1 13  ? -11.886 -1.091  -6.506  1.00 1.00 ? 33  SER A N    4  
ATOM 5556  C CA   . SER A 1 13  ? -11.684 -0.438  -7.802  1.00 1.00 ? 33  SER A CA   4  
ATOM 5557  C C    . SER A 1 13  ? -12.029 1.056   -7.680  1.00 1.00 ? 33  SER A C    4  
ATOM 5558  O O    . SER A 1 13  ? -13.195 1.447   -7.509  1.00 1.00 ? 33  SER A O    4  
ATOM 5559  C CB   . SER A 1 13  ? -12.456 -1.159  -8.909  1.00 1.00 ? 33  SER A CB   4  
ATOM 5560  O OG   . SER A 1 13  ? -12.274 -0.527  -10.161 1.00 1.00 ? 33  SER A OG   4  
ATOM 5561  H H    . SER A 1 13  ? -12.716 -0.805  -5.987  1.00 1.00 ? 33  SER A H    4  
ATOM 5562  H HA   . SER A 1 13  ? -10.628 -0.529  -8.059  1.00 1.00 ? 33  SER A HA   4  
ATOM 5563  H HB2  . SER A 1 13  ? -12.075 -2.171  -9.046  1.00 0.00 ? 33  SER A HB2  4  
ATOM 5564  H HB3  . SER A 1 13  ? -13.508 -1.221  -8.662  1.00 1.00 ? 33  SER A HB3  4  
ATOM 5565  H HG   . SER A 1 13  ? -11.388 -0.706  -10.481 1.00 1.00 ? 33  SER A HG   4  
ATOM 5566  N N    . VAL A 1 14  ? -10.941 1.841   -7.657  1.00 1.00 ? 34  VAL A N    4  
ATOM 5567  C CA   . VAL A 1 14  ? -10.771 3.307   -7.623  1.00 1.00 ? 34  VAL A CA   4  
ATOM 5568  C C    . VAL A 1 14  ? -9.374  3.703   -8.184  1.00 1.00 ? 34  VAL A C    4  
ATOM 5569  O O    . VAL A 1 14  ? -8.523  2.837   -8.407  1.00 1.00 ? 34  VAL A O    4  
ATOM 5570  C CB   . VAL A 1 14  ? -11.046 3.857   -6.196  1.00 1.00 ? 34  VAL A CB   4  
ATOM 5571  C CG1  . VAL A 1 14  ? -9.861  3.729   -5.221  1.00 1.00 ? 34  VAL A CG1  4  
ATOM 5572  C CG2  . VAL A 1 14  ? -11.553 5.308   -6.230  1.00 1.00 ? 34  VAL A CG2  4  
ATOM 5573  H H    . VAL A 1 14  ? -10.059 1.353   -7.766  1.00 1.00 ? 34  VAL A H    4  
ATOM 5574  H HA   . VAL A 1 14  ? -11.519 3.724   -8.296  1.00 1.00 ? 34  VAL A HA   4  
ATOM 5575  H HB   . VAL A 1 14  ? -11.868 3.278   -5.777  1.00 1.00 ? 34  VAL A HB   4  
ATOM 5576  H HG11 . VAL A 1 14  ? -9.548  2.687   -5.152  1.00 1.00 ? 34  VAL A HG11 4  
ATOM 5577  H HG12 . VAL A 1 14  ? -9.017  4.336   -5.548  1.00 1.00 ? 34  VAL A HG12 4  
ATOM 5578  H HG13 . VAL A 1 14  ? -10.160 4.071   -4.231  1.00 1.00 ? 34  VAL A HG13 4  
ATOM 5579  H HG21 . VAL A 1 14  ? -12.389 5.400   -6.924  1.00 1.00 ? 34  VAL A HG21 4  
ATOM 5580  H HG22 . VAL A 1 14  ? -11.919 5.570   -5.239  1.00 1.00 ? 34  VAL A HG22 4  
ATOM 5581  H HG23 . VAL A 1 14  ? -10.759 5.999   -6.507  1.00 1.00 ? 34  VAL A HG23 4  
ATOM 5582  N N    . LEU A 1 15  ? -9.150  4.996   -8.458  1.00 1.00 ? 35  LEU A N    4  
ATOM 5583  C CA   . LEU A 1 15  ? -7.885  5.613   -8.899  1.00 1.00 ? 35  LEU A CA   4  
ATOM 5584  C C    . LEU A 1 15  ? -6.635  5.333   -7.988  1.00 1.00 ? 35  LEU A C    4  
ATOM 5585  O O    . LEU A 1 15  ? -6.787  4.896   -6.842  1.00 1.00 ? 35  LEU A O    4  
ATOM 5586  C CB   . LEU A 1 15  ? -8.209  7.116   -9.014  1.00 1.00 ? 35  LEU A CB   4  
ATOM 5587  C CG   . LEU A 1 15  ? -7.997  7.883   -10.338 1.00 1.00 ? 35  LEU A CG   4  
ATOM 5588  C CD1  . LEU A 1 15  ? -8.595  7.184   -11.567 1.00 1.00 ? 35  LEU A CD1  4  
ATOM 5589  C CD2  . LEU A 1 15  ? -8.640  9.267   -10.180 1.00 1.00 ? 35  LEU A CD2  4  
ATOM 5590  H H    . LEU A 1 15  ? -9.905  5.632   -8.265  1.00 1.00 ? 35  LEU A H    4  
ATOM 5591  H HA   . LEU A 1 15  ? -7.659  5.209   -9.884  1.00 1.00 ? 35  LEU A HA   4  
ATOM 5592  H HB2  . LEU A 1 15  ? -9.284  7.291   -9.063  1.00 0.00 ? 35  LEU A HB2  4  
ATOM 5593  H HB3  . LEU A 1 15  ? -7.828  7.676   -8.158  1.00 1.00 ? 35  LEU A HB3  4  
ATOM 5594  H HG   . LEU A 1 15  ? -6.932  8.026   -10.509 1.00 1.00 ? 35  LEU A HG   4  
ATOM 5595  H HD11 . LEU A 1 15  ? -9.640  6.948   -11.400 1.00 1.00 ? 35  LEU A HD11 4  
ATOM 5596  H HD12 . LEU A 1 15  ? -8.516  7.829   -12.441 1.00 1.00 ? 35  LEU A HD12 4  
ATOM 5597  H HD13 . LEU A 1 15  ? -8.054  6.263   -11.780 1.00 1.00 ? 35  LEU A HD13 4  
ATOM 5598  H HD21 . LEU A 1 15  ? -9.703  9.166   -9.950  1.00 1.00 ? 35  LEU A HD21 4  
ATOM 5599  H HD22 . LEU A 1 15  ? -8.130  9.772   -9.364  1.00 1.00 ? 35  LEU A HD22 4  
ATOM 5600  H HD23 . LEU A 1 15  ? -8.514  9.849   -11.091 1.00 1.00 ? 35  LEU A HD23 4  
ATOM 5601  N N    . PRO A 1 16  ? -5.389  5.600   -8.466  1.00 1.00 ? 36  PRO A N    4  
ATOM 5602  C CA   . PRO A 1 16  ? -4.129  5.314   -7.752  1.00 1.00 ? 36  PRO A CA   4  
ATOM 5603  C C    . PRO A 1 16  ? -3.966  6.104   -6.438  1.00 1.00 ? 36  PRO A C    4  
ATOM 5604  O O    . PRO A 1 16  ? -4.352  7.265   -6.355  1.00 1.00 ? 36  PRO A O    4  
ATOM 5605  C CB   . PRO A 1 16  ? -2.991  5.675   -8.717  1.00 1.00 ? 36  PRO A CB   4  
ATOM 5606  C CG   . PRO A 1 16  ? -3.639  6.688   -9.661  1.00 1.00 ? 36  PRO A CG   4  
ATOM 5607  C CD   . PRO A 1 16  ? -5.099  6.250   -9.734  1.00 1.00 ? 36  PRO A CD   4  
ATOM 5608  H HA   . PRO A 1 16  ? -4.080  4.245   -7.534  1.00 1.00 ? 36  PRO A HA   4  
ATOM 5609  H HB2  . PRO A 1 16  ? -2.146  6.106   -8.180  1.00 0.00 ? 36  PRO A HB2  4  
ATOM 5610  H HB3  . PRO A 1 16  ? -2.692  4.794   -9.284  1.00 1.00 ? 36  PRO A HB3  4  
ATOM 5611  H HG2  . PRO A 1 16  ? -3.554  7.706   -9.280  1.00 0.00 ? 36  PRO A HG2  4  
ATOM 5612  H HG3  . PRO A 1 16  ? -3.174  6.673   -10.647 1.00 1.00 ? 36  PRO A HG3  4  
ATOM 5613  H HD2  . PRO A 1 16  ? -5.770  7.097   -9.878  1.00 0.00 ? 36  PRO A HD2  4  
ATOM 5614  H HD3  . PRO A 1 16  ? -5.234  5.543   -10.554 1.00 1.00 ? 36  PRO A HD3  4  
ATOM 5615  N N    . THR A 1 17  ? -3.325  5.501   -5.425  1.00 1.00 ? 37  THR A N    4  
ATOM 5616  C CA   . THR A 1 17  ? -3.129  6.034   -4.043  1.00 1.00 ? 37  THR A CA   4  
ATOM 5617  C C    . THR A 1 17  ? -2.206  7.268   -3.912  1.00 1.00 ? 37  THR A C    4  
ATOM 5618  O O    . THR A 1 17  ? -2.336  8.018   -2.944  1.00 1.00 ? 37  THR A O    4  
ATOM 5619  C CB   . THR A 1 17  ? -2.562  4.937   -3.112  1.00 1.00 ? 37  THR A CB   4  
ATOM 5620  O OG1  . THR A 1 17  ? -1.368  4.415   -3.660  1.00 1.00 ? 37  THR A OG1  4  
ATOM 5621  C CG2  . THR A 1 17  ? -3.511  3.755   -2.889  1.00 1.00 ? 37  THR A CG2  4  
ATOM 5622  H H    . THR A 1 17  ? -2.970  4.570   -5.577  1.00 1.00 ? 37  THR A H    4  
ATOM 5623  H HA   . THR A 1 17  ? -4.102  6.336   -3.652  1.00 1.00 ? 37  THR A HA   4  
ATOM 5624  H HB   . THR A 1 17  ? -2.344  5.375   -2.137  1.00 1.00 ? 37  THR A HB   4  
ATOM 5625  H HG1  . THR A 1 17  ? -0.956  3.862   -2.992  1.00 1.00 ? 37  THR A HG1  4  
ATOM 5626  H HG21 . THR A 1 17  ? -4.457  4.116   -2.483  1.00 1.00 ? 37  THR A HG21 4  
ATOM 5627  H HG22 . THR A 1 17  ? -3.705  3.236   -3.828  1.00 1.00 ? 37  THR A HG22 4  
ATOM 5628  H HG23 . THR A 1 17  ? -3.072  3.053   -2.179  1.00 1.00 ? 37  THR A HG23 4  
ATOM 5629  N N    . HIS A 1 18  ? -1.288  7.487   -4.867  1.00 1.00 ? 38  HIS A N    4  
ATOM 5630  C CA   . HIS A 1 18  ? -0.307  8.591   -4.942  1.00 1.00 ? 38  HIS A CA   4  
ATOM 5631  C C    . HIS A 1 18  ? -0.652  9.492   -6.144  1.00 1.00 ? 38  HIS A C    4  
ATOM 5632  O O    . HIS A 1 18  ? -0.027  9.457   -7.197  1.00 1.00 ? 38  HIS A O    4  
ATOM 5633  C CB   . HIS A 1 18  ? 1.104   7.972   -4.973  1.00 1.00 ? 38  HIS A CB   4  
ATOM 5634  C CG   . HIS A 1 18  ? 2.314   8.839   -4.693  1.00 1.00 ? 38  HIS A CG   4  
ATOM 5635  N ND1  . HIS A 1 18  ? 2.426   10.221  -4.735  1.00 1.00 ? 38  HIS A ND1  4  
ATOM 5636  C CD2  . HIS A 1 18  ? 3.538   8.338   -4.345  1.00 1.00 ? 38  HIS A CD2  4  
ATOM 5637  C CE1  . HIS A 1 18  ? 3.697   10.534  -4.405  1.00 1.00 ? 38  HIS A CE1  4  
ATOM 5638  N NE2  . HIS A 1 18  ? 4.381   9.409   -4.121  1.00 1.00 ? 38  HIS A NE2  4  
ATOM 5639  H H    . HIS A 1 18  ? -1.281  6.784   -5.590  1.00 1.00 ? 38  HIS A H    4  
ATOM 5640  H HA   . HIS A 1 18  ? -0.376  9.195   -4.033  1.00 1.00 ? 38  HIS A HA   4  
ATOM 5641  H HB2  . HIS A 1 18  ? 1.271   7.322   -4.115  1.00 0.00 ? 38  HIS A HB2  4  
ATOM 5642  H HB3  . HIS A 1 18  ? 1.255   7.372   -5.871  1.00 1.00 ? 38  HIS A HB3  4  
ATOM 5643  H HD1  . HIS A 1 18  ? 1.719   10.914  -4.958  1.00 1.00 ? 38  HIS A HD1  4  
ATOM 5644  H HD2  . HIS A 1 18  ? 3.789   7.289   -4.263  1.00 1.00 ? 38  HIS A HD2  4  
ATOM 5645  H HE1  . HIS A 1 18  ? 4.091   11.544  -4.353  1.00 1.00 ? 38  HIS A HE1  4  
ATOM 5646  H HE2  . HIS A 1 18  ? 5.317   9.363   -3.729  1.00 1.00 ? 38  HIS A HE2  4  
ATOM 5647  N N    . TRP A 1 19  ? -1.666  10.328  -5.958  1.00 1.00 ? 39  TRP A N    4  
ATOM 5648  C CA   . TRP A 1 19  ? -2.362  11.191  -6.919  1.00 1.00 ? 39  TRP A CA   4  
ATOM 5649  C C    . TRP A 1 19  ? -3.034  12.386  -6.195  1.00 1.00 ? 39  TRP A C    4  
ATOM 5650  O O    . TRP A 1 19  ? -3.164  12.369  -4.963  1.00 1.00 ? 39  TRP A O    4  
ATOM 5651  C CB   . TRP A 1 19  ? -3.338  10.328  -7.748  1.00 1.00 ? 39  TRP A CB   4  
ATOM 5652  C CG   . TRP A 1 19  ? -4.505  10.980  -8.422  1.00 1.00 ? 39  TRP A CG   4  
ATOM 5653  C CD1  . TRP A 1 19  ? -5.730  11.140  -7.870  1.00 1.00 ? 39  TRP A CD1  4  
ATOM 5654  C CD2  . TRP A 1 19  ? -4.565  11.624  -9.729  1.00 1.00 ? 39  TRP A CD2  4  
ATOM 5655  N NE1  . TRP A 1 19  ? -6.542  11.842  -8.732  1.00 1.00 ? 39  TRP A NE1  4  
ATOM 5656  C CE2  . TRP A 1 19  ? -5.886  12.144  -9.908  1.00 1.00 ? 39  TRP A CE2  4  
ATOM 5657  C CE3  . TRP A 1 19  ? -3.623  11.864  -10.760 1.00 1.00 ? 39  TRP A CE3  4  
ATOM 5658  C CZ2  . TRP A 1 19  ? -6.265  12.834  -11.074 1.00 1.00 ? 39  TRP A CZ2  4  
ATOM 5659  C CZ3  . TRP A 1 19  ? -3.986  12.567  -11.928 1.00 1.00 ? 39  TRP A CZ3  4  
ATOM 5660  C CH2  . TRP A 1 19  ? -5.306  13.044  -12.089 1.00 1.00 ? 39  TRP A CH2  4  
ATOM 5661  H H    . TRP A 1 19  ? -1.906  10.476  -4.999  1.00 1.00 ? 39  TRP A H    4  
ATOM 5662  H HA   . TRP A 1 19  ? -1.648  11.580  -7.623  1.00 1.00 ? 39  TRP A HA   4  
ATOM 5663  H HB2  . TRP A 1 19  ? -2.903  9.972   -8.683  1.00 0.00 ? 39  TRP A HB2  4  
ATOM 5664  H HB3  . TRP A 1 19  ? -3.670  9.438   -7.221  1.00 1.00 ? 39  TRP A HB3  4  
ATOM 5665  H HD1  . TRP A 1 19  ? -6.020  10.823  -6.877  1.00 1.00 ? 39  TRP A HD1  4  
ATOM 5666  H HE1  . TRP A 1 19  ? -7.452  12.177  -8.430  1.00 1.00 ? 39  TRP A HE1  4  
ATOM 5667  H HE3  . TRP A 1 19  ? -2.609  11.523  -10.623 1.00 1.00 ? 39  TRP A HE3  4  
ATOM 5668  H HZ2  . TRP A 1 19  ? -7.271  13.212  -11.175 1.00 1.00 ? 39  TRP A HZ2  4  
ATOM 5669  H HZ3  . TRP A 1 19  ? -3.248  12.764  -12.692 1.00 1.00 ? 39  TRP A HZ3  4  
ATOM 5670  H HH2  . TRP A 1 19  ? -5.576  13.590  -12.982 1.00 1.00 ? 39  TRP A HH2  4  
ATOM 5671  N N    . ARG A 1 20  ? -3.462  13.428  -6.931  1.00 1.00 ? 40  ARG A N    4  
ATOM 5672  C CA   . ARG A 1 20  ? -4.228  14.574  -6.387  1.00 1.00 ? 40  ARG A CA   4  
ATOM 5673  C C    . ARG A 1 20  ? -5.637  14.126  -5.944  1.00 1.00 ? 40  ARG A C    4  
ATOM 5674  O O    . ARG A 1 20  ? -6.541  14.048  -6.781  1.00 1.00 ? 40  ARG A O    4  
ATOM 5675  C CB   . ARG A 1 20  ? -4.301  15.685  -7.460  1.00 1.00 ? 40  ARG A CB   4  
ATOM 5676  C CG   . ARG A 1 20  ? -5.230  16.830  -7.034  1.00 1.00 ? 40  ARG A CG   4  
ATOM 5677  C CD   . ARG A 1 20  ? -5.527  17.848  -8.133  1.00 1.00 ? 40  ARG A CD   4  
ATOM 5678  N NE   . ARG A 1 20  ? -6.970  17.946  -8.420  1.00 1.00 ? 40  ARG A NE   4  
ATOM 5679  C CZ   . ARG A 1 20  ? -7.811  18.833  -7.909  1.00 1.00 ? 40  ARG A CZ   4  
ATOM 5680  N NH1  . ARG A 1 20  ? -7.445  19.816  -7.139  1.00 1.00 ? 40  ARG A NH1  4  
ATOM 5681  N NH2  . ARG A 1 20  ? -9.090  18.775  -8.141  1.00 1.00 ? 40  ARG A NH2  4  
ATOM 5682  H H    . ARG A 1 20  ? -3.316  13.382  -7.931  1.00 1.00 ? 40  ARG A H    4  
ATOM 5683  H HA   . ARG A 1 20  ? -3.693  14.975  -5.523  1.00 1.00 ? 40  ARG A HA   4  
ATOM 5684  H HB2  . ARG A 1 20  ? -3.308  16.106  -7.618  1.00 0.00 ? 40  ARG A HB2  4  
ATOM 5685  H HB3  . ARG A 1 20  ? -4.669  15.263  -8.397  1.00 1.00 ? 40  ARG A HB3  4  
ATOM 5686  H HG2  . ARG A 1 20  ? -6.233  16.465  -6.810  1.00 0.00 ? 40  ARG A HG2  4  
ATOM 5687  H HG3  . ARG A 1 20  ? -4.859  17.332  -6.145  1.00 1.00 ? 40  ARG A HG3  4  
ATOM 5688  H HD2  . ARG A 1 20  ? -5.301  18.866  -7.816  1.00 0.00 ? 40  ARG A HD2  4  
ATOM 5689  H HD3  . ARG A 1 20  ? -4.941  17.659  -9.033  1.00 1.00 ? 40  ARG A HD3  4  
ATOM 5690  H HE   . ARG A 1 20  ? -7.369  17.240  -9.008  1.00 1.00 ? 40  ARG A HE   4  
ATOM 5691  H HH11 . ARG A 1 20  ? -6.451  19.936  -6.894  1.00 0.00 ? 40  ARG A HH11 4  
ATOM 5692  H HH12 . ARG A 1 20  ? -8.148  20.474  -6.772  1.00 0.00 ? 40  ARG A HH12 4  
ATOM 5693  H HH21 . ARG A 1 20  ? -9.472  18.025  -8.736  1.00 0.00 ? 40  ARG A HH21 4  
ATOM 5694  H HH22 . ARG A 1 20  ? -9.721  19.478  -7.731  1.00 0.00 ? 40  ARG A HH22 4  
ATOM 5695  N N    . CYS A 1 21  ? -5.832  13.943  -4.629  1.00 1.00 ? 41  CYS A N    4  
ATOM 5696  C CA   . CYS A 1 21  ? -7.034  13.423  -3.938  1.00 1.00 ? 41  CYS A CA   4  
ATOM 5697  C C    . CYS A 1 21  ? -8.117  12.835  -4.872  1.00 1.00 ? 41  CYS A C    4  
ATOM 5698  O O    . CYS A 1 21  ? -7.905  11.769  -5.433  1.00 1.00 ? 41  CYS A O    4  
ATOM 5699  C CB   . CYS A 1 21  ? -7.531  14.477  -2.911  1.00 1.00 ? 41  CYS A CB   4  
ATOM 5700  S SG   . CYS A 1 21  ? -8.078  16.055  -3.640  1.00 1.00 ? 41  CYS A SG   4  
ATOM 5701  H H    . CYS A 1 21  ? -5.009  14.042  -4.050  1.00 1.00 ? 41  CYS A H    4  
ATOM 5702  H HA   . CYS A 1 21  ? -6.697  12.556  -3.373  1.00 1.00 ? 41  CYS A HA   4  
ATOM 5703  H HB2  . CYS A 1 21  ? -8.400  14.092  -2.378  1.00 0.00 ? 41  CYS A HB2  4  
ATOM 5704  H HB3  . CYS A 1 21  ? -6.741  14.696  -2.195  1.00 1.00 ? 41  CYS A HB3  4  
ATOM 5705  H HG   . CYS A 1 21  ? -8.467  16.636  -2.500  1.00 1.00 ? 41  CYS A HG   4  
ATOM 5706  N N    . ASN A 1 22  ? -9.232  13.556  -5.028  1.00 1.00 ? 42  ASN A N    4  
ATOM 5707  C CA   . ASN A 1 22  ? -10.376 13.429  -5.941  1.00 1.00 ? 42  ASN A CA   4  
ATOM 5708  C C    . ASN A 1 22  ? -11.500 14.412  -5.549  1.00 1.00 ? 42  ASN A C    4  
ATOM 5709  O O    . ASN A 1 22  ? -11.869 15.252  -6.367  1.00 1.00 ? 42  ASN A O    4  
ATOM 5710  C CB   . ASN A 1 22  ? -10.831 11.961  -6.119  1.00 1.00 ? 42  ASN A CB   4  
ATOM 5711  C CG   . ASN A 1 22  ? -10.046 11.160  -7.167  1.00 1.00 ? 42  ASN A CG   4  
ATOM 5712  O OD1  . ASN A 1 22  ? -9.759  9.985   -7.016  1.00 1.00 ? 42  ASN A OD1  4  
ATOM 5713  N ND2  . ASN A 1 22  ? -9.708  11.723  -8.312  1.00 1.00 ? 42  ASN A ND2  4  
ATOM 5714  H H    . ASN A 1 22  ? -9.188  14.363  -4.423  1.00 1.00 ? 42  ASN A H    4  
ATOM 5715  H HA   . ASN A 1 22  ? -10.022 13.800  -6.902  1.00 1.00 ? 42  ASN A HA   4  
ATOM 5716  H HB2  . ASN A 1 22  ? -10.638 11.368  -5.225  1.00 0.00 ? 42  ASN A HB2  4  
ATOM 5717  H HB3  . ASN A 1 22  ? -11.898 11.893  -6.327  1.00 1.00 ? 42  ASN A HB3  4  
ATOM 5718  H HD21 . ASN A 1 22  ? -9.971  12.701  -8.502  1.00 0.00 ? 42  ASN A HD21 4  
ATOM 5719  H HD22 . ASN A 1 22  ? -9.182  11.185  -9.015  1.00 0.00 ? 42  ASN A HD22 4  
ATOM 5720  N N    . LYS A 1 23  ? -12.009 14.349  -4.304  1.00 1.00 ? 43  LYS A N    4  
ATOM 5721  C CA   . LYS A 1 23  ? -12.966 15.288  -3.671  1.00 1.00 ? 43  LYS A CA   4  
ATOM 5722  C C    . LYS A 1 23  ? -14.410 15.292  -4.227  1.00 1.00 ? 43  LYS A C    4  
ATOM 5723  O O    . LYS A 1 23  ? -15.217 16.067  -3.716  1.00 1.00 ? 43  LYS A O    4  
ATOM 5724  C CB   . LYS A 1 23  ? -12.311 16.689  -3.666  1.00 1.00 ? 43  LYS A CB   4  
ATOM 5725  C CG   . LYS A 1 23  ? -12.471 17.639  -2.468  1.00 1.00 ? 43  LYS A CG   4  
ATOM 5726  C CD   . LYS A 1 23  ? -13.824 18.347  -2.315  1.00 1.00 ? 43  LYS A CD   4  
ATOM 5727  C CE   . LYS A 1 23  ? -14.300 19.120  -3.547  1.00 1.00 ? 43  LYS A CE   4  
ATOM 5728  N NZ   . LYS A 1 23  ? -15.692 18.738  -3.860  1.00 1.00 ? 43  LYS A NZ   4  
ATOM 5729  H H    . LYS A 1 23  ? -11.736 13.527  -3.761  1.00 1.00 ? 43  LYS A H    4  
ATOM 5730  H HA   . LYS A 1 23  ? -13.080 14.968  -2.631  1.00 1.00 ? 43  LYS A HA   4  
ATOM 5731  H HB2  . LYS A 1 23  ? -11.240 16.646  -3.467  1.00 0.00 ? 43  LYS A HB2  4  
ATOM 5732  H HB3  . LYS A 1 23  ? -12.426 17.204  -4.620  1.00 1.00 ? 43  LYS A HB3  4  
ATOM 5733  H HG2  . LYS A 1 23  ? -12.392 17.057  -1.550  1.00 0.00 ? 43  LYS A HG2  4  
ATOM 5734  H HG3  . LYS A 1 23  ? -11.680 18.390  -2.510  1.00 1.00 ? 43  LYS A HG3  4  
ATOM 5735  H HD2  . LYS A 1 23  ? -14.610 17.607  -2.166  1.00 0.00 ? 43  LYS A HD2  4  
ATOM 5736  H HD3  . LYS A 1 23  ? -13.791 19.018  -1.451  1.00 1.00 ? 43  LYS A HD3  4  
ATOM 5737  H HE2  . LYS A 1 23  ? -14.275 20.191  -3.340  1.00 0.00 ? 43  LYS A HE2  4  
ATOM 5738  H HE3  . LYS A 1 23  ? -13.647 18.900  -4.393  1.00 1.00 ? 43  LYS A HE3  4  
ATOM 5739  H HZ1  . LYS A 1 23  ? -15.732 17.731  -4.069  1.00 0.00 ? 43  LYS A HZ1  4  
ATOM 5740  H HZ2  . LYS A 1 23  ? -16.296 18.945  -3.052  1.00 0.00 ? 43  LYS A HZ2  4  
ATOM 5741  N N    . THR A 1 24  ? -14.717 14.476  -5.258  1.00 1.00 ? 44  THR A N    4  
ATOM 5742  C CA   . THR A 1 24  ? -16.020 14.136  -5.905  1.00 1.00 ? 44  THR A CA   4  
ATOM 5743  C C    . THR A 1 24  ? -15.920 13.967  -7.443  1.00 1.00 ? 44  THR A C    4  
ATOM 5744  O O    . THR A 1 24  ? -15.779 14.942  -8.178  1.00 1.00 ? 44  THR A O    4  
ATOM 5745  C CB   . THR A 1 24  ? -17.238 14.987  -5.440  1.00 1.00 ? 44  THR A CB   4  
ATOM 5746  O OG1  . THR A 1 24  ? -18.464 14.303  -5.603  1.00 1.00 ? 44  THR A OG1  4  
ATOM 5747  C CG2  . THR A 1 24  ? -17.320 16.391  -6.065  1.00 1.00 ? 44  THR A CG2  4  
ATOM 5748  H H    . THR A 1 24  ? -13.892 14.009  -5.606  1.00 1.00 ? 44  THR A H    4  
ATOM 5749  H HA   . THR A 1 24  ? -16.238 13.142  -5.531  1.00 1.00 ? 44  THR A HA   4  
ATOM 5750  H HB   . THR A 1 24  ? -17.179 15.107  -4.361  1.00 1.00 ? 44  THR A HB   4  
ATOM 5751  H HG1  . THR A 1 24  ? -18.782 14.117  -4.670  1.00 1.00 ? 44  THR A HG1  4  
ATOM 5752  H HG21 . THR A 1 24  ? -16.353 16.888  -5.974  1.00 1.00 ? 44  THR A HG21 4  
ATOM 5753  H HG22 . THR A 1 24  ? -17.576 16.333  -7.122  1.00 1.00 ? 44  THR A HG22 4  
ATOM 5754  H HG23 . THR A 1 24  ? -18.076 16.985  -5.558  1.00 1.00 ? 44  THR A HG23 4  
ATOM 5755  N N    . LEU A 1 25  ? -15.917 12.710  -7.928  1.00 1.00 ? 45  LEU A N    4  
ATOM 5756  C CA   . LEU A 1 25  ? -16.009 12.296  -9.350  1.00 1.00 ? 45  LEU A CA   4  
ATOM 5757  C C    . LEU A 1 25  ? -16.499 10.821  -9.500  1.00 1.00 ? 45  LEU A C    4  
ATOM 5758  O O    . LEU A 1 25  ? -16.230 10.003  -8.613  1.00 1.00 ? 45  LEU A O    4  
ATOM 5759  C CB   . LEU A 1 25  ? -14.709 12.556  -10.162 1.00 1.00 ? 45  LEU A CB   4  
ATOM 5760  C CG   . LEU A 1 25  ? -13.289 12.328  -9.593  1.00 1.00 ? 45  LEU A CG   4  
ATOM 5761  C CD1  . LEU A 1 25  ? -12.356 11.774  -10.687 1.00 1.00 ? 45  LEU A CD1  4  
ATOM 5762  C CD2  . LEU A 1 25  ? -12.669 13.624  -9.054  1.00 1.00 ? 45  LEU A CD2  4  
ATOM 5763  H H    . LEU A 1 25  ? -16.013 11.958  -7.262  1.00 1.00 ? 45  LEU A H    4  
ATOM 5764  H HA   . LEU A 1 25  ? -16.783 12.923  -9.793  1.00 1.00 ? 45  LEU A HA   4  
ATOM 5765  H HB2  . LEU A 1 25  ? -14.540 11.761  -10.889 1.00 0.00 ? 45  LEU A HB2  4  
ATOM 5766  H HB3  . LEU A 1 25  ? -14.772 13.500  -10.703 1.00 1.00 ? 45  LEU A HB3  4  
ATOM 5767  H HG   . LEU A 1 25  ? -13.343 11.607  -8.782  1.00 1.00 ? 45  LEU A HG   4  
ATOM 5768  H HD11 . LEU A 1 25  ? -12.794 10.890  -11.147 1.00 1.00 ? 45  LEU A HD11 4  
ATOM 5769  H HD12 . LEU A 1 25  ? -12.181 12.519  -11.461 1.00 1.00 ? 45  LEU A HD12 4  
ATOM 5770  H HD13 . LEU A 1 25  ? -11.399 11.484  -10.258 1.00 1.00 ? 45  LEU A HD13 4  
ATOM 5771  H HD21 . LEU A 1 25  ? -12.613 14.376  -9.841  1.00 1.00 ? 45  LEU A HD21 4  
ATOM 5772  H HD22 . LEU A 1 25  ? -13.272 14.016  -8.238  1.00 1.00 ? 45  LEU A HD22 4  
ATOM 5773  H HD23 . LEU A 1 25  ? -11.671 13.445  -8.674  1.00 1.00 ? 45  LEU A HD23 4  
ATOM 5774  N N    . PRO A 1 26  ? -17.192 10.440  -10.606 1.00 1.00 ? 46  PRO A N    4  
ATOM 5775  C CA   . PRO A 1 26  ? -17.803 9.104   -10.825 1.00 1.00 ? 46  PRO A CA   4  
ATOM 5776  C C    . PRO A 1 26  ? -16.801 7.971   -11.183 1.00 1.00 ? 46  PRO A C    4  
ATOM 5777  O O    . PRO A 1 26  ? -17.119 7.074   -11.960 1.00 1.00 ? 46  PRO A O    4  
ATOM 5778  C CB   . PRO A 1 26  ? -18.824 9.313   -11.958 1.00 1.00 ? 46  PRO A CB   4  
ATOM 5779  C CG   . PRO A 1 26  ? -18.207 10.443  -12.777 1.00 1.00 ? 46  PRO A CG   4  
ATOM 5780  C CD   . PRO A 1 26  ? -17.476 11.305  -11.748 1.00 1.00 ? 46  PRO A CD   4  
ATOM 5781  H HA   . PRO A 1 26  ? -18.343 8.794   -9.926  1.00 1.00 ? 46  PRO A HA   4  
ATOM 5782  H HB2  . PRO A 1 26  ? -18.947 8.404   -12.547 1.00 0.00 ? 46  PRO A HB2  4  
ATOM 5783  H HB3  . PRO A 1 26  ? -19.783 9.635   -11.544 1.00 1.00 ? 46  PRO A HB3  4  
ATOM 5784  H HG2  . PRO A 1 26  ? -17.515 10.054  -13.524 1.00 0.00 ? 46  PRO A HG2  4  
ATOM 5785  H HG3  . PRO A 1 26  ? -18.974 11.013  -13.300 1.00 1.00 ? 46  PRO A HG3  4  
ATOM 5786  H HD2  . PRO A 1 26  ? -16.544 11.718  -12.136 1.00 0.00 ? 46  PRO A HD2  4  
ATOM 5787  H HD3  . PRO A 1 26  ? -18.129 12.121  -11.435 1.00 1.00 ? 46  PRO A HD3  4  
ATOM 5788  N N    . ILE A 1 27  ? -15.596 8.002   -10.593 1.00 1.00 ? 47  ILE A N    4  
ATOM 5789  C CA   . ILE A 1 27  ? -14.388 7.186   -10.862 1.00 1.00 ? 47  ILE A CA   4  
ATOM 5790  C C    . ILE A 1 27  ? -14.647 5.719   -11.263 1.00 1.00 ? 47  ILE A C    4  
ATOM 5791  O O    . ILE A 1 27  ? -14.359 5.328   -12.392 1.00 1.00 ? 47  ILE A O    4  
ATOM 5792  C CB   . ILE A 1 27  ? -13.393 7.272   -9.668  1.00 1.00 ? 47  ILE A CB   4  
ATOM 5793  C CG1  . ILE A 1 27  ? -12.972 8.716   -9.314  1.00 1.00 ? 47  ILE A CG1  4  
ATOM 5794  C CG2  . ILE A 1 27  ? -12.107 6.475   -9.965  1.00 1.00 ? 47  ILE A CG2  4  
ATOM 5795  C CD1  . ILE A 1 27  ? -12.641 8.882   -7.831  1.00 1.00 ? 47  ILE A CD1  4  
ATOM 5796  H H    . ILE A 1 27  ? -15.526 8.730   -9.887  1.00 1.00 ? 47  ILE A H    4  
ATOM 5797  H HA   . ILE A 1 27  ? -13.897 7.644   -11.722 1.00 1.00 ? 47  ILE A HA   4  
ATOM 5798  H HB   . ILE A 1 27  ? -13.878 6.827   -8.795  1.00 1.00 ? 47  ILE A HB   4  
ATOM 5799  H HG12 . ILE A 1 27  ? -12.077 9.011   -9.860  1.00 0.00 ? 47  ILE A HG12 4  
ATOM 5800  H HG13 . ILE A 1 27  ? -13.757 9.426   -9.561  1.00 1.00 ? 47  ILE A HG13 4  
ATOM 5801  H HG21 . ILE A 1 27  ? -11.719 6.786   -10.931 1.00 1.00 ? 47  ILE A HG21 4  
ATOM 5802  H HG22 . ILE A 1 27  ? -11.356 6.653   -9.198  1.00 1.00 ? 47  ILE A HG22 4  
ATOM 5803  H HG23 . ILE A 1 27  ? -12.312 5.406   -10.000 1.00 1.00 ? 47  ILE A HG23 4  
ATOM 5804  H HD11 . ILE A 1 27  ? -11.818 8.226   -7.548  1.00 1.00 ? 47  ILE A HD11 4  
ATOM 5805  H HD12 . ILE A 1 27  ? -12.356 9.911   -7.639  1.00 1.00 ? 47  ILE A HD12 4  
ATOM 5806  H HD13 . ILE A 1 27  ? -13.525 8.653   -7.240  1.00 1.00 ? 47  ILE A HD13 4  
ATOM 5807  N N    . ALA A 1 28  ? -15.087 4.908   -10.291 1.00 1.00 ? 48  ALA A N    4  
ATOM 5808  C CA   . ALA A 1 28  ? -15.269 3.452   -10.383 1.00 1.00 ? 48  ALA A CA   4  
ATOM 5809  C C    . ALA A 1 28  ? -16.155 2.872   -9.258  1.00 1.00 ? 48  ALA A C    4  
ATOM 5810  O O    . ALA A 1 28  ? -16.842 1.884   -9.514  1.00 1.00 ? 48  ALA A O    4  
ATOM 5811  C CB   . ALA A 1 28  ? -13.886 2.774   -10.397 1.00 1.00 ? 48  ALA A CB   4  
ATOM 5812  H H    . ALA A 1 28  ? -15.332 5.381   -9.438  1.00 1.00 ? 48  ALA A H    4  
ATOM 5813  H HA   . ALA A 1 28  ? -15.766 3.227   -11.330 1.00 1.00 ? 48  ALA A HA   4  
ATOM 5814  H HB1  . ALA A 1 28  ? -13.335 3.019   -9.489  1.00 1.00 ? 48  ALA A HB1  4  
ATOM 5815  H HB2  . ALA A 1 28  ? -14.003 1.692   -10.464 1.00 1.00 ? 48  ALA A HB2  4  
ATOM 5816  H HB3  . ALA A 1 28  ? -13.309 3.106   -11.261 1.00 1.00 ? 48  ALA A HB3  4  
ATOM 5817  N N    . PHE A 1 29  ? -16.166 3.464   -8.041  1.00 1.00 ? 49  PHE A N    4  
ATOM 5818  C CA   . PHE A 1 29  ? -17.060 3.132   -6.924  1.00 1.00 ? 49  PHE A CA   4  
ATOM 5819  C C    . PHE A 1 29  ? -17.357 1.646   -6.627  1.00 1.00 ? 49  PHE A C    4  
ATOM 5820  O O    . PHE A 1 29  ? -18.475 1.323   -6.218  1.00 1.00 ? 49  PHE A O    4  
ATOM 5821  C CB   . PHE A 1 29  ? -18.312 4.044   -6.936  1.00 1.00 ? 49  PHE A CB   4  
ATOM 5822  C CG   . PHE A 1 29  ? -19.030 4.277   -8.258  1.00 1.00 ? 49  PHE A CG   4  
ATOM 5823  C CD1  . PHE A 1 29  ? -19.627 3.195   -8.942  1.00 1.00 ? 49  PHE A CD1  4  
ATOM 5824  C CD2  . PHE A 1 29  ? -19.085 5.576   -8.820  1.00 1.00 ? 49  PHE A CD2  4  
ATOM 5825  C CE1  . PHE A 1 29  ? -20.256 3.405   -10.189 1.00 1.00 ? 49  PHE A CE1  4  
ATOM 5826  C CE2  . PHE A 1 29  ? -19.722 5.784   -10.063 1.00 1.00 ? 49  PHE A CE2  4  
ATOM 5827  C CZ   . PHE A 1 29  ? -20.302 4.698   -10.752 1.00 1.00 ? 49  PHE A CZ   4  
ATOM 5828  H H    . PHE A 1 29  ? -15.558 4.245   -7.814  1.00 1.00 ? 49  PHE A H    4  
ATOM 5829  H HA   . PHE A 1 29  ? -16.493 3.414   -6.056  1.00 1.00 ? 49  PHE A HA   4  
ATOM 5830  H HB2  . PHE A 1 29  ? -19.121 3.563   -6.387  1.00 0.00 ? 49  PHE A HB2  4  
ATOM 5831  H HB3  . PHE A 1 29  ? -18.076 4.995   -6.466  1.00 1.00 ? 49  PHE A HB3  4  
ATOM 5832  H HD1  . PHE A 1 29  ? -19.576 2.199   -8.529  1.00 1.00 ? 49  PHE A HD1  4  
ATOM 5833  H HD2  . PHE A 1 29  ? -18.636 6.415   -8.308  1.00 1.00 ? 49  PHE A HD2  4  
ATOM 5834  H HE1  . PHE A 1 29  ? -20.690 2.571   -10.719 1.00 1.00 ? 49  PHE A HE1  4  
ATOM 5835  H HE2  . PHE A 1 29  ? -19.761 6.770   -10.499 1.00 1.00 ? 49  PHE A HE2  4  
ATOM 5836  H HZ   . PHE A 1 29  ? -20.776 4.858   -11.711 1.00 1.00 ? 49  PHE A HZ   4  
ATOM 5837  N N    . LYS A 1 30  ? -16.354 0.748   -6.737  1.00 1.00 ? 50  LYS A N    4  
ATOM 5838  C CA   . LYS A 1 30  ? -16.568 -0.708  -6.604  1.00 1.00 ? 50  LYS A CA   4  
ATOM 5839  C C    . LYS A 1 30  ? -15.641 -1.335  -5.554  1.00 1.00 ? 50  LYS A C    4  
ATOM 5840  O O    . LYS A 1 30  ? -14.458 -1.526  -5.814  1.00 1.00 ? 50  LYS A O    4  
ATOM 5841  C CB   . LYS A 1 30  ? -16.406 -1.284  -8.023  1.00 1.00 ? 50  LYS A CB   4  
ATOM 5842  C CG   . LYS A 1 30  ? -16.557 -2.799  -8.205  1.00 1.00 ? 50  LYS A CG   4  
ATOM 5843  C CD   . LYS A 1 30  ? -16.552 -3.102  -9.710  1.00 1.00 ? 50  LYS A CD   4  
ATOM 5844  C CE   . LYS A 1 30  ? -16.689 -4.588  -10.034 1.00 1.00 ? 50  LYS A CE   4  
ATOM 5845  N NZ   . LYS A 1 30  ? -16.768 -4.792  -11.496 1.00 1.00 ? 50  LYS A NZ   4  
ATOM 5846  H H    . LYS A 1 30  ? -15.435 1.064   -7.052  1.00 1.00 ? 50  LYS A H    4  
ATOM 5847  H HA   . LYS A 1 30  ? -17.600 -0.907  -6.307  1.00 1.00 ? 50  LYS A HA   4  
ATOM 5848  H HB2  . LYS A 1 30  ? -17.228 -0.965  -8.663  1.00 0.00 ? 50  LYS A HB2  4  
ATOM 5849  H HB3  . LYS A 1 30  ? -15.475 -0.947  -8.469  1.00 1.00 ? 50  LYS A HB3  4  
ATOM 5850  H HG2  . LYS A 1 30  ? -15.732 -3.307  -7.706  1.00 0.00 ? 50  LYS A HG2  4  
ATOM 5851  H HG3  . LYS A 1 30  ? -17.503 -3.124  -7.769  1.00 1.00 ? 50  LYS A HG3  4  
ATOM 5852  H HD2  . LYS A 1 30  ? -17.414 -2.631  -10.182 1.00 0.00 ? 50  LYS A HD2  4  
ATOM 5853  H HD3  . LYS A 1 30  ? -15.635 -2.714  -10.160 1.00 1.00 ? 50  LYS A HD3  4  
ATOM 5854  H HE2  . LYS A 1 30  ? -15.801 -5.125  -9.700  1.00 0.00 ? 50  LYS A HE2  4  
ATOM 5855  H HE3  . LYS A 1 30  ? -17.564 -4.999  -9.530  1.00 1.00 ? 50  LYS A HE3  4  
ATOM 5856  H HZ1  . LYS A 1 30  ? -17.574 -5.396  -11.717 1.00 0.00 ? 50  LYS A HZ1  4  
ATOM 5857  H HZ2  . LYS A 1 30  ? -16.883 -3.882  -11.965 1.00 0.00 ? 50  LYS A HZ2  4  
ATOM 5858  N N    . VAL A 1 31  ? -16.180 -1.713  -4.385  1.00 1.00 ? 51  VAL A N    4  
ATOM 5859  C CA   . VAL A 1 31  ? -15.446 -2.384  -3.281  1.00 1.00 ? 51  VAL A CA   4  
ATOM 5860  C C    . VAL A 1 31  ? -16.221 -3.614  -2.782  1.00 1.00 ? 51  VAL A C    4  
ATOM 5861  O O    . VAL A 1 31  ? -17.415 -3.514  -2.484  1.00 1.00 ? 51  VAL A O    4  
ATOM 5862  C CB   . VAL A 1 31  ? -15.126 -1.418  -2.114  1.00 1.00 ? 51  VAL A CB   4  
ATOM 5863  C CG1  . VAL A 1 31  ? -14.207 -2.062  -1.062  1.00 1.00 ? 51  VAL A CG1  4  
ATOM 5864  C CG2  . VAL A 1 31  ? -14.466 -0.109  -2.579  1.00 1.00 ? 51  VAL A CG2  4  
ATOM 5865  H H    . VAL A 1 31  ? -17.111 -1.365  -4.160  1.00 1.00 ? 51  VAL A H    4  
ATOM 5866  H HA   . VAL A 1 31  ? -14.495 -2.738  -3.673  1.00 1.00 ? 51  VAL A HA   4  
ATOM 5867  H HB   . VAL A 1 31  ? -16.060 -1.163  -1.631  1.00 1.00 ? 51  VAL A HB   4  
ATOM 5868  H HG11 . VAL A 1 31  ? -14.629 -2.999  -0.704  1.00 1.00 ? 51  VAL A HG11 4  
ATOM 5869  H HG12 . VAL A 1 31  ? -13.224 -2.268  -1.487  1.00 1.00 ? 51  VAL A HG12 4  
ATOM 5870  H HG13 . VAL A 1 31  ? -14.092 -1.396  -0.206  1.00 1.00 ? 51  VAL A HG13 4  
ATOM 5871  H HG21 . VAL A 1 31  ? -13.539 -0.334  -3.106  1.00 1.00 ? 51  VAL A HG21 4  
ATOM 5872  H HG22 . VAL A 1 31  ? -15.136 0.433   -3.247  1.00 1.00 ? 51  VAL A HG22 4  
ATOM 5873  H HG23 . VAL A 1 31  ? -14.255 0.534   -1.725  1.00 1.00 ? 51  VAL A HG23 4  
ATOM 5874  N N    . VAL A 1 32  ? -15.522 -4.761  -2.715  1.00 1.00 ? 52  VAL A N    4  
ATOM 5875  C CA   . VAL A 1 32  ? -16.054 -6.104  -2.406  1.00 1.00 ? 52  VAL A CA   4  
ATOM 5876  C C    . VAL A 1 32  ? -15.219 -6.912  -1.392  1.00 1.00 ? 52  VAL A C    4  
ATOM 5877  O O    . VAL A 1 32  ? -13.984 -6.883  -1.384  1.00 1.00 ? 52  VAL A O    4  
ATOM 5878  C CB   . VAL A 1 32  ? -16.290 -6.953  -3.688  1.00 1.00 ? 52  VAL A CB   4  
ATOM 5879  C CG1  . VAL A 1 32  ? -17.393 -6.377  -4.598  1.00 1.00 ? 52  VAL A CG1  4  
ATOM 5880  C CG2  . VAL A 1 32  ? -15.017 -7.170  -4.528  1.00 1.00 ? 52  VAL A CG2  4  
ATOM 5881  H H    . VAL A 1 32  ? -14.520 -4.699  -2.898  1.00 1.00 ? 52  VAL A H    4  
ATOM 5882  H HA   . VAL A 1 32  ? -17.026 -5.948  -1.948  1.00 1.00 ? 52  VAL A HA   4  
ATOM 5883  H HB   . VAL A 1 32  ? -16.638 -7.938  -3.371  1.00 1.00 ? 52  VAL A HB   4  
ATOM 5884  H HG11 . VAL A 1 32  ? -18.310 -6.228  -4.030  1.00 1.00 ? 52  VAL A HG11 4  
ATOM 5885  H HG12 . VAL A 1 32  ? -17.081 -5.421  -5.018  1.00 1.00 ? 52  VAL A HG12 4  
ATOM 5886  H HG13 . VAL A 1 32  ? -17.599 -7.071  -5.415  1.00 1.00 ? 52  VAL A HG13 4  
ATOM 5887  H HG21 . VAL A 1 32  ? -14.231 -7.593  -3.906  1.00 1.00 ? 52  VAL A HG21 4  
ATOM 5888  H HG22 . VAL A 1 32  ? -15.217 -7.857  -5.351  1.00 1.00 ? 52  VAL A HG22 4  
ATOM 5889  H HG23 . VAL A 1 32  ? -14.661 -6.221  -4.929  1.00 1.00 ? 52  VAL A HG23 4  
ATOM 5890  N N    . ALA A 1 33  ? -15.927 -7.698  -0.570  1.00 1.00 ? 53  ALA A N    4  
ATOM 5891  C CA   . ALA A 1 33  ? -15.416 -8.694  0.381   1.00 1.00 ? 53  ALA A CA   4  
ATOM 5892  C C    . ALA A 1 33  ? -15.977 -10.081 0.002   1.00 1.00 ? 53  ALA A C    4  
ATOM 5893  O O    . ALA A 1 33  ? -17.184 -10.309 0.094   1.00 1.00 ? 53  ALA A O    4  
ATOM 5894  C CB   . ALA A 1 33  ? -15.774 -8.291  1.823   1.00 1.00 ? 53  ALA A CB   4  
ATOM 5895  H H    . ALA A 1 33  ? -16.930 -7.638  -0.655  1.00 1.00 ? 53  ALA A H    4  
ATOM 5896  H HA   . ALA A 1 33  ? -14.324 -8.727  0.315   1.00 1.00 ? 53  ALA A HA   4  
ATOM 5897  H HB1  . ALA A 1 33  ? -16.855 -8.199  1.945   1.00 1.00 ? 53  ALA A HB1  4  
ATOM 5898  H HB2  . ALA A 1 33  ? -15.411 -9.049  2.516   1.00 1.00 ? 53  ALA A HB2  4  
ATOM 5899  H HB3  . ALA A 1 33  ? -15.303 -7.347  2.083   1.00 1.00 ? 53  ALA A HB3  4  
ATOM 5900  N N    . LEU A 1 34  ? -15.107 -11.000 -0.434  1.00 1.00 ? 54  LEU A N    4  
ATOM 5901  C CA   . LEU A 1 34  ? -15.447 -12.376 -0.828  1.00 1.00 ? 54  LEU A CA   4  
ATOM 5902  C C    . LEU A 1 34  ? -14.587 -13.368 -0.019  1.00 1.00 ? 54  LEU A C    4  
ATOM 5903  O O    . LEU A 1 34  ? -13.376 -13.442 -0.201  1.00 1.00 ? 54  LEU A O    4  
ATOM 5904  C CB   . LEU A 1 34  ? -15.299 -12.477 -2.362  1.00 1.00 ? 54  LEU A CB   4  
ATOM 5905  C CG   . LEU A 1 34  ? -15.540 -13.836 -3.053  1.00 1.00 ? 54  LEU A CG   4  
ATOM 5906  C CD1  . LEU A 1 34  ? -16.249 -13.580 -4.388  1.00 1.00 ? 54  LEU A CD1  4  
ATOM 5907  C CD2  . LEU A 1 34  ? -14.234 -14.604 -3.316  1.00 1.00 ? 54  LEU A CD2  4  
ATOM 5908  H H    . LEU A 1 34  ? -14.117 -10.745 -0.448  1.00 1.00 ? 54  LEU A H    4  
ATOM 5909  H HA   . LEU A 1 34  ? -16.495 -12.568 -0.595  1.00 1.00 ? 54  LEU A HA   4  
ATOM 5910  H HB2  . LEU A 1 34  ? -16.128 -12.016 -2.897  1.00 0.00 ? 54  LEU A HB2  4  
ATOM 5911  H HB3  . LEU A 1 34  ? -14.394 -11.990 -2.733  1.00 1.00 ? 54  LEU A HB3  4  
ATOM 5912  H HG   . LEU A 1 34  ? -16.191 -14.452 -2.430  1.00 1.00 ? 54  LEU A HG   4  
ATOM 5913  H HD11 . LEU A 1 34  ? -17.191 -13.059 -4.211  1.00 1.00 ? 54  LEU A HD11 4  
ATOM 5914  H HD12 . LEU A 1 34  ? -15.620 -12.971 -5.039  1.00 1.00 ? 54  LEU A HD12 4  
ATOM 5915  H HD13 . LEU A 1 34  ? -16.469 -14.527 -4.880  1.00 1.00 ? 54  LEU A HD13 4  
ATOM 5916  H HD21 . LEU A 1 34  ? -13.571 -14.019 -3.954  1.00 1.00 ? 54  LEU A HD21 4  
ATOM 5917  H HD22 . LEU A 1 34  ? -13.721 -14.808 -2.376  1.00 1.00 ? 54  LEU A HD22 4  
ATOM 5918  H HD23 . LEU A 1 34  ? -14.450 -15.552 -3.807  1.00 1.00 ? 54  LEU A HD23 4  
ATOM 5919  N N    . GLY A 1 35  ? -15.232 -14.136 0.872   1.00 1.00 ? 55  GLY A N    4  
ATOM 5920  C CA   . GLY A 1 35  ? -14.582 -15.058 1.816   1.00 1.00 ? 55  GLY A CA   4  
ATOM 5921  C C    . GLY A 1 35  ? -15.149 -15.028 3.246   1.00 1.00 ? 55  GLY A C    4  
ATOM 5922  O O    . GLY A 1 35  ? -15.670 -16.041 3.701   1.00 1.00 ? 55  GLY A O    4  
ATOM 5923  H H    . GLY A 1 35  ? -16.233 -14.037 0.928   1.00 1.00 ? 55  GLY A H    4  
ATOM 5924  H HA2  . GLY A 1 35  ? -14.673 -16.073 1.431   1.00 1.00 ? 55  GLY A HA2  4  
ATOM 5925  H HA3  . GLY A 1 35  ? -13.514 -14.849 1.876   1.00 1.00 ? 55  GLY A HA3  4  
ATOM 5926  N N    . ASP A 1 36  ? -15.071 -13.871 3.937   1.00 1.00 ? 56  ASP A N    4  
ATOM 5927  C CA   . ASP A 1 36  ? -15.389 -13.711 5.375   1.00 1.00 ? 56  ASP A CA   4  
ATOM 5928  C C    . ASP A 1 36  ? -16.622 -12.842 5.761   1.00 1.00 ? 56  ASP A C    4  
ATOM 5929  O O    . ASP A 1 36  ? -17.112 -13.001 6.877   1.00 1.00 ? 56  ASP A O    4  
ATOM 5930  C CB   . ASP A 1 36  ? -14.090 -13.203 6.041   1.00 1.00 ? 56  ASP A CB   4  
ATOM 5931  C CG   . ASP A 1 36  ? -13.269 -14.270 6.781   1.00 1.00 ? 56  ASP A CG   4  
ATOM 5932  O OD1  . ASP A 1 36  ? -12.455 -14.937 6.107   1.00 1.00 ? 56  ASP A OD1  4  
ATOM 5933  O OD2  . ASP A 1 36  ? -13.435 -14.373 8.016   1.00 1.00 ? 56  ASP A OD2  4  
ATOM 5934  H H    . ASP A 1 36  ? -14.582 -13.120 3.476   1.00 1.00 ? 56  ASP A H    4  
ATOM 5935  H HA   . ASP A 1 36  ? -15.605 -14.700 5.782   1.00 1.00 ? 56  ASP A HA   4  
ATOM 5936  H HB2  . ASP A 1 36  ? -13.452 -12.786 5.263   1.00 0.00 ? 56  ASP A HB2  4  
ATOM 5937  H HB3  . ASP A 1 36  ? -14.241 -12.315 6.660   1.00 1.00 ? 56  ASP A HB3  4  
ATOM 5938  N N    . VAL A 1 37  ? -17.148 -11.957 4.885   1.00 1.00 ? 57  VAL A N    4  
ATOM 5939  C CA   . VAL A 1 37  ? -18.322 -11.050 5.109   1.00 1.00 ? 57  VAL A CA   4  
ATOM 5940  C C    . VAL A 1 37  ? -18.329 -10.316 6.494   1.00 1.00 ? 57  VAL A C    4  
ATOM 5941  O O    . VAL A 1 37  ? -19.272 -10.466 7.273   1.00 1.00 ? 57  VAL A O    4  
ATOM 5942  C CB   . VAL A 1 37  ? -19.654 -11.796 4.728   1.00 1.00 ? 57  VAL A CB   4  
ATOM 5943  C CG1  . VAL A 1 37  ? -20.990 -11.109 5.104   1.00 1.00 ? 57  VAL A CG1  4  
ATOM 5944  C CG2  . VAL A 1 37  ? -19.682 -12.069 3.205   1.00 1.00 ? 57  VAL A CG2  4  
ATOM 5945  H H    . VAL A 1 37  ? -16.685 -11.911 3.989   1.00 1.00 ? 57  VAL A H    4  
ATOM 5946  H HA   . VAL A 1 37  ? -18.230 -10.231 4.389   1.00 1.00 ? 57  VAL A HA   4  
ATOM 5947  H HB   . VAL A 1 37  ? -19.653 -12.766 5.226   1.00 1.00 ? 57  VAL A HB   4  
ATOM 5948  H HG11 . VAL A 1 37  ? -20.916 -10.034 4.985   1.00 1.00 ? 57  VAL A HG11 4  
ATOM 5949  H HG12 . VAL A 1 37  ? -21.822 -11.493 4.517   1.00 1.00 ? 57  VAL A HG12 4  
ATOM 5950  H HG13 . VAL A 1 37  ? -21.235 -11.317 6.145   1.00 1.00 ? 57  VAL A HG13 4  
ATOM 5951  H HG21 . VAL A 1 37  ? -18.838 -12.692 2.915   1.00 1.00 ? 57  VAL A HG21 4  
ATOM 5952  H HG22 . VAL A 1 37  ? -20.595 -12.599 2.931   1.00 1.00 ? 57  VAL A HG22 4  
ATOM 5953  H HG23 . VAL A 1 37  ? -19.640 -11.135 2.645   1.00 1.00 ? 57  VAL A HG23 4  
ATOM 5954  N N    . PRO A 1 38  ? -17.304 -9.494  6.844   1.00 1.00 ? 58  PRO A N    4  
ATOM 5955  C CA   . PRO A 1 38  ? -17.293 -8.686  8.073   1.00 1.00 ? 58  PRO A CA   4  
ATOM 5956  C C    . PRO A 1 38  ? -17.945 -7.292  7.901   1.00 1.00 ? 58  PRO A C    4  
ATOM 5957  O O    . PRO A 1 38  ? -17.381 -6.399  7.246   1.00 1.00 ? 58  PRO A O    4  
ATOM 5958  C CB   . PRO A 1 38  ? -15.821 -8.568  8.454   1.00 1.00 ? 58  PRO A CB   4  
ATOM 5959  C CG   . PRO A 1 38  ? -15.107 -8.570  7.103   1.00 1.00 ? 58  PRO A CG   4  
ATOM 5960  C CD   . PRO A 1 38  ? -16.029 -9.333  6.151   1.00 1.00 ? 58  PRO A CD   4  
ATOM 5961  H HA   . PRO A 1 38  ? -17.804 -9.219  8.878   1.00 1.00 ? 58  PRO A HA   4  
ATOM 5962  H HB2  . PRO A 1 38  ? -15.634 -7.649  9.009   1.00 0.00 ? 58  PRO A HB2  4  
ATOM 5963  H HB3  . PRO A 1 38  ? -15.522 -9.449  9.026   1.00 1.00 ? 58  PRO A HB3  4  
ATOM 5964  H HG2  . PRO A 1 38  ? -14.950 -7.550  6.753   1.00 0.00 ? 58  PRO A HG2  4  
ATOM 5965  H HG3  . PRO A 1 38  ? -14.136 -9.060  7.186   1.00 1.00 ? 58  PRO A HG3  4  
ATOM 5966  H HD2  . PRO A 1 38  ? -16.173 -8.819  5.200   1.00 0.00 ? 58  PRO A HD2  4  
ATOM 5967  H HD3  . PRO A 1 38  ? -15.578 -10.303 5.952   1.00 1.00 ? 58  PRO A HD3  4  
ATOM 5968  N N    . ASP A 1 39  ? -19.127 -7.078  8.504   1.00 1.00 ? 59  ASP A N    4  
ATOM 5969  C CA   . ASP A 1 39  ? -19.780 -5.758  8.553   1.00 1.00 ? 59  ASP A CA   4  
ATOM 5970  C C    . ASP A 1 39  ? -18.906 -4.723  9.297   1.00 1.00 ? 59  ASP A C    4  
ATOM 5971  O O    . ASP A 1 39  ? -18.326 -5.007  10.349  1.00 1.00 ? 59  ASP A O    4  
ATOM 5972  C CB   . ASP A 1 39  ? -21.225 -5.850  9.077   1.00 1.00 ? 59  ASP A CB   4  
ATOM 5973  C CG   . ASP A 1 39  ? -21.402 -6.034  10.585  1.00 1.00 ? 59  ASP A CG   4  
ATOM 5974  O OD1  . ASP A 1 39  ? -21.162 -7.159  11.068  1.00 1.00 ? 59  ASP A OD1  4  
ATOM 5975  O OD2  . ASP A 1 39  ? -21.830 -5.034  11.207  1.00 1.00 ? 59  ASP A OD2  4  
ATOM 5976  H H    . ASP A 1 39  ? -19.556 -7.826  9.034   1.00 1.00 ? 59  ASP A H    4  
ATOM 5977  H HA   . ASP A 1 39  ? -19.856 -5.421  7.519   1.00 1.00 ? 59  ASP A HA   4  
ATOM 5978  H HB2  . ASP A 1 39  ? -21.733 -4.924  8.813   1.00 0.00 ? 59  ASP A HB2  4  
ATOM 5979  H HB3  . ASP A 1 39  ? -21.802 -6.595  8.527   1.00 1.00 ? 59  ASP A HB3  4  
ATOM 5980  N N    . GLY A 1 40  ? -18.781 -3.516  8.726   1.00 1.00 ? 60  GLY A N    4  
ATOM 5981  C CA   . GLY A 1 40  ? -17.833 -2.507  9.199   1.00 1.00 ? 60  GLY A CA   4  
ATOM 5982  C C    . GLY A 1 40  ? -16.422 -2.734  8.630   1.00 1.00 ? 60  GLY A C    4  
ATOM 5983  O O    . GLY A 1 40  ? -15.437 -2.438  9.308   1.00 1.00 ? 60  GLY A O    4  
ATOM 5984  H H    . GLY A 1 40  ? -19.181 -3.365  7.797   1.00 1.00 ? 60  GLY A H    4  
ATOM 5985  H HA2  . GLY A 1 40  ? -18.173 -1.521  8.884   1.00 1.00 ? 60  GLY A HA2  4  
ATOM 5986  H HA3  . GLY A 1 40  ? -17.792 -2.519  10.291  1.00 1.00 ? 60  GLY A HA3  4  
ATOM 5987  N N    . THR A 1 41  ? -16.308 -3.274  7.398   1.00 1.00 ? 61  THR A N    4  
ATOM 5988  C CA   . THR A 1 41  ? -15.033 -3.362  6.648   1.00 1.00 ? 61  THR A CA   4  
ATOM 5989  C C    . THR A 1 41  ? -14.682 -1.920  6.220   1.00 1.00 ? 61  THR A C    4  
ATOM 5990  O O    . THR A 1 41  ? -14.979 -1.501  5.098   1.00 1.00 ? 61  THR A O    4  
ATOM 5991  C CB   . THR A 1 41  ? -15.097 -4.354  5.457   1.00 1.00 ? 61  THR A CB   4  
ATOM 5992  O OG1  . THR A 1 41  ? -15.342 -5.684  5.858   1.00 1.00 ? 61  THR A OG1  4  
ATOM 5993  C CG2  . THR A 1 41  ? -13.759 -4.425  4.707   1.00 1.00 ? 61  THR A CG2  4  
ATOM 5994  H H    . THR A 1 41  ? -17.178 -3.550  6.951   1.00 1.00 ? 61  THR A H    4  
ATOM 5995  H HA   . THR A 1 41  ? -14.250 -3.717  7.318   1.00 1.00 ? 61  THR A HA   4  
ATOM 5996  H HB   . THR A 1 41  ? -15.879 -4.048  4.767   1.00 1.00 ? 61  THR A HB   4  
ATOM 5997  H HG1  . THR A 1 41  ? -16.167 -5.784  6.391   1.00 1.00 ? 61  THR A HG1  4  
ATOM 5998  H HG21 . THR A 1 41  ? -12.941 -4.587  5.409   1.00 1.00 ? 61  THR A HG21 4  
ATOM 5999  H HG22 . THR A 1 41  ? -13.753 -5.253  3.999   1.00 1.00 ? 61  THR A HG22 4  
ATOM 6000  H HG23 . THR A 1 41  ? -13.595 -3.500  4.154   1.00 1.00 ? 61  THR A HG23 4  
ATOM 6001  N N    . LEU A 1 42  ? -14.160 -1.134  7.177   1.00 1.00 ? 62  LEU A N    4  
ATOM 6002  C CA   . LEU A 1 42  ? -13.899 0.299   7.116   1.00 1.00 ? 62  LEU A CA   4  
ATOM 6003  C C    . LEU A 1 42  ? -12.607 0.611   6.342   1.00 1.00 ? 62  LEU A C    4  
ATOM 6004  O O    . LEU A 1 42  ? -11.493 0.387   6.805   1.00 1.00 ? 62  LEU A O    4  
ATOM 6005  C CB   . LEU A 1 42  ? -13.911 0.865   8.551   1.00 1.00 ? 62  LEU A CB   4  
ATOM 6006  C CG   . LEU A 1 42  ? -14.310 2.342   8.737   1.00 1.00 ? 62  LEU A CG   4  
ATOM 6007  C CD1  . LEU A 1 42  ? -14.676 2.583   10.208  1.00 1.00 ? 62  LEU A CD1  4  
ATOM 6008  C CD2  . LEU A 1 42  ? -13.190 3.309   8.330   1.00 1.00 ? 62  LEU A CD2  4  
ATOM 6009  H H    . LEU A 1 42  ? -13.983 -1.562  8.087   1.00 1.00 ? 62  LEU A H    4  
ATOM 6010  H HA   . LEU A 1 42  ? -14.744 0.748   6.599   1.00 1.00 ? 62  LEU A HA   4  
ATOM 6011  H HB2  . LEU A 1 42  ? -14.725 0.449   9.145   1.00 0.00 ? 62  LEU A HB2  4  
ATOM 6012  H HB3  . LEU A 1 42  ? -12.985 0.645   9.083   1.00 1.00 ? 62  LEU A HB3  4  
ATOM 6013  H HG   . LEU A 1 42  ? -15.192 2.552   8.130   1.00 1.00 ? 62  LEU A HG   4  
ATOM 6014  H HD11 . LEU A 1 42  ? -15.489 1.919   10.504  1.00 1.00 ? 62  LEU A HD11 4  
ATOM 6015  H HD12 . LEU A 1 42  ? -13.816 2.394   10.852  1.00 1.00 ? 62  LEU A HD12 4  
ATOM 6016  H HD13 . LEU A 1 42  ? -15.004 3.613   10.345  1.00 1.00 ? 62  LEU A HD13 4  
ATOM 6017  H HD21 . LEU A 1 42  ? -12.287 3.101   8.902   1.00 1.00 ? 62  LEU A HD21 4  
ATOM 6018  H HD22 . LEU A 1 42  ? -12.974 3.215   7.267   1.00 1.00 ? 62  LEU A HD22 4  
ATOM 6019  H HD23 . LEU A 1 42  ? -13.498 4.338   8.517   1.00 1.00 ? 62  LEU A HD23 4  
ATOM 6020  N N    . VAL A 1 43  ? -12.756 1.249   5.182   1.00 1.00 ? 63  VAL A N    4  
ATOM 6021  C CA   . VAL A 1 43  ? -11.684 1.588   4.248   1.00 1.00 ? 63  VAL A CA   4  
ATOM 6022  C C    . VAL A 1 43  ? -11.205 2.979   4.665   1.00 1.00 ? 63  VAL A C    4  
ATOM 6023  O O    . VAL A 1 43  ? -11.885 3.985   4.452   1.00 1.00 ? 63  VAL A O    4  
ATOM 6024  C CB   . VAL A 1 43  ? -12.215 1.620   2.788   1.00 1.00 ? 63  VAL A CB   4  
ATOM 6025  C CG1  . VAL A 1 43  ? -11.137 2.090   1.795   1.00 1.00 ? 63  VAL A CG1  4  
ATOM 6026  C CG2  . VAL A 1 43  ? -12.741 0.245   2.334   1.00 1.00 ? 63  VAL A CG2  4  
ATOM 6027  H H    . VAL A 1 43  ? -13.700 1.527   4.949   1.00 1.00 ? 63  VAL A H    4  
ATOM 6028  H HA   . VAL A 1 43  ? -10.877 0.865   4.308   1.00 1.00 ? 63  VAL A HA   4  
ATOM 6029  H HB   . VAL A 1 43  ? -13.052 2.320   2.728   1.00 1.00 ? 63  VAL A HB   4  
ATOM 6030  H HG11 . VAL A 1 43  ? -10.244 1.473   1.867   1.00 1.00 ? 63  VAL A HG11 4  
ATOM 6031  H HG12 . VAL A 1 43  ? -11.530 2.037   0.780   1.00 1.00 ? 63  VAL A HG12 4  
ATOM 6032  H HG13 . VAL A 1 43  ? -10.869 3.131   1.992   1.00 1.00 ? 63  VAL A HG13 4  
ATOM 6033  H HG21 . VAL A 1 43  ? -13.534 -0.097  3.000   1.00 1.00 ? 63  VAL A HG21 4  
ATOM 6034  H HG22 . VAL A 1 43  ? -13.154 0.321   1.325   1.00 1.00 ? 63  VAL A HG22 4  
ATOM 6035  H HG23 . VAL A 1 43  ? -11.938 -0.489  2.334   1.00 1.00 ? 63  VAL A HG23 4  
ATOM 6036  N N    . THR A 1 44  ? -9.995  2.981   5.260   1.00 1.00 ? 64  THR A N    4  
ATOM 6037  C CA   . THR A 1 44  ? -9.274  4.204   5.664   1.00 1.00 ? 64  THR A CA   4  
ATOM 6038  C C    . THR A 1 44  ? -8.112  4.478   4.690   1.00 1.00 ? 64  THR A C    4  
ATOM 6039  O O    . THR A 1 44  ? -7.161  3.701   4.570   1.00 1.00 ? 64  THR A O    4  
ATOM 6040  C CB   . THR A 1 44  ? -8.762  4.115   7.120   1.00 1.00 ? 64  THR A CB   4  
ATOM 6041  O OG1  . THR A 1 44  ? -9.820  3.816   8.007   1.00 1.00 ? 64  THR A OG1  4  
ATOM 6042  C CG2  . THR A 1 44  ? -8.151  5.432   7.615   1.00 1.00 ? 64  THR A CG2  4  
ATOM 6043  H H    . THR A 1 44  ? -9.606  2.073   5.552   1.00 1.00 ? 64  THR A H    4  
ATOM 6044  H HA   . THR A 1 44  ? -9.966  5.047   5.631   1.00 1.00 ? 64  THR A HA   4  
ATOM 6045  H HB   . THR A 1 44  ? -8.011  3.330   7.204   1.00 1.00 ? 64  THR A HB   4  
ATOM 6046  H HG1  . THR A 1 44  ? -10.020 2.879   7.921   1.00 1.00 ? 64  THR A HG1  4  
ATOM 6047  H HG21 . THR A 1 44  ? -7.323  5.727   6.972   1.00 1.00 ? 64  THR A HG21 4  
ATOM 6048  H HG22 . THR A 1 44  ? -8.898  6.227   7.626   1.00 1.00 ? 64  THR A HG22 4  
ATOM 6049  H HG23 . THR A 1 44  ? -7.761  5.294   8.628   1.00 1.00 ? 64  THR A HG23 4  
ATOM 6050  N N    . VAL A 1 45  ? -8.148  5.639   4.020   1.00 1.00 ? 65  VAL A N    4  
ATOM 6051  C CA   . VAL A 1 45  ? -7.099  6.057   3.064   1.00 1.00 ? 65  VAL A CA   4  
ATOM 6052  C C    . VAL A 1 45  ? -6.130  6.988   3.787   1.00 1.00 ? 65  VAL A C    4  
ATOM 6053  O O    . VAL A 1 45  ? -6.508  8.065   4.248   1.00 1.00 ? 65  VAL A O    4  
ATOM 6054  C CB   . VAL A 1 45  ? -7.618  6.640   1.717   1.00 1.00 ? 65  VAL A CB   4  
ATOM 6055  C CG1  . VAL A 1 45  ? -8.869  5.894   1.213   1.00 1.00 ? 65  VAL A CG1  4  
ATOM 6056  C CG2  . VAL A 1 45  ? -7.874  8.155   1.686   1.00 1.00 ? 65  VAL A CG2  4  
ATOM 6057  H H    . VAL A 1 45  ? -8.950  6.231   4.172   1.00 1.00 ? 65  VAL A H    4  
ATOM 6058  H HA   . VAL A 1 45  ? -6.547  5.163   2.784   1.00 1.00 ? 65  VAL A HA   4  
ATOM 6059  H HB   . VAL A 1 45  ? -6.829  6.472   0.982   1.00 1.00 ? 65  VAL A HB   4  
ATOM 6060  H HG11 . VAL A 1 45  ? -8.739  4.815   1.282   1.00 1.00 ? 65  VAL A HG11 4  
ATOM 6061  H HG12 . VAL A 1 45  ? -9.711  6.151   1.843   1.00 1.00 ? 65  VAL A HG12 4  
ATOM 6062  H HG13 . VAL A 1 45  ? -9.084  6.156   0.177   1.00 1.00 ? 65  VAL A HG13 4  
ATOM 6063  H HG21 . VAL A 1 45  ? -8.555  8.430   2.474   1.00 1.00 ? 65  VAL A HG21 4  
ATOM 6064  H HG22 . VAL A 1 45  ? -6.946  8.700   1.850   1.00 1.00 ? 65  VAL A HG22 4  
ATOM 6065  H HG23 . VAL A 1 45  ? -8.277  8.453   0.722   1.00 1.00 ? 65  VAL A HG23 4  
ATOM 6066  N N    . MET A 1 46  ? -4.875  6.541   3.906   1.00 1.00 ? 66  MET A N    4  
ATOM 6067  C CA   . MET A 1 46  ? -3.821  7.281   4.594   1.00 1.00 ? 66  MET A CA   4  
ATOM 6068  C C    . MET A 1 46  ? -2.607  7.476   3.674   1.00 1.00 ? 66  MET A C    4  
ATOM 6069  O O    . MET A 1 46  ? -1.596  6.781   3.787   1.00 1.00 ? 66  MET A O    4  
ATOM 6070  C CB   . MET A 1 46  ? -3.446  6.593   5.916   1.00 1.00 ? 66  MET A CB   4  
ATOM 6071  C CG   . MET A 1 46  ? -4.543  5.869   6.708   1.00 1.00 ? 66  MET A CG   4  
ATOM 6072  S SD   . MET A 1 46  ? -4.755  6.361   8.444   1.00 1.00 ? 66  MET A SD   4  
ATOM 6073  C CE   . MET A 1 46  ? -5.393  8.044   8.221   1.00 1.00 ? 66  MET A CE   4  
ATOM 6074  H H    . MET A 1 46  ? -4.677  5.563   3.688   1.00 1.00 ? 66  MET A H    4  
ATOM 6075  H HA   . MET A 1 46  ? -4.190  8.274   4.860   1.00 1.00 ? 66  MET A HA   4  
ATOM 6076  H HB2  . MET A 1 46  ? -2.695  5.838   5.685   1.00 0.00 ? 66  MET A HB2  4  
ATOM 6077  H HB3  . MET A 1 46  ? -3.011  7.355   6.546   1.00 1.00 ? 66  MET A HB3  4  
ATOM 6078  H HG2  . MET A 1 46  ? -5.493  6.061   6.209   1.00 0.00 ? 66  MET A HG2  4  
ATOM 6079  H HG3  . MET A 1 46  ? -4.345  4.800   6.662   1.00 1.00 ? 66  MET A HG3  4  
ATOM 6080  H HE1  . MET A 1 46  ? -6.264  8.027   7.565   1.00 1.00 ? 66  MET A HE1  4  
ATOM 6081  H HE2  . MET A 1 46  ? -5.685  8.447   9.192   1.00 1.00 ? 66  MET A HE2  4  
ATOM 6082  H HE3  . MET A 1 46  ? -4.625  8.684   7.785   1.00 1.00 ? 66  MET A HE3  4  
ATOM 6083  N N    . ALA A 1 47  ? -2.647  8.471   2.780   1.00 1.00 ? 67  ALA A N    4  
ATOM 6084  C CA   . ALA A 1 47  ? -1.538  8.723   1.861   1.00 1.00 ? 67  ALA A CA   4  
ATOM 6085  C C    . ALA A 1 47  ? -0.678  9.840   2.481   1.00 1.00 ? 67  ALA A C    4  
ATOM 6086  O O    . ALA A 1 47  ? -1.110  10.982  2.575   1.00 1.00 ? 67  ALA A O    4  
ATOM 6087  C CB   . ALA A 1 47  ? -2.106  9.014   0.461   1.00 1.00 ? 67  ALA A CB   4  
ATOM 6088  H H    . ALA A 1 47  ? -3.426  9.115   2.737   1.00 1.00 ? 67  ALA A H    4  
ATOM 6089  H HA   . ALA A 1 47  ? -0.925  7.831   1.760   1.00 1.00 ? 67  ALA A HA   4  
ATOM 6090  H HB1  . ALA A 1 47  ? -2.928  9.726   0.510   1.00 1.00 ? 67  ALA A HB1  4  
ATOM 6091  H HB2  . ALA A 1 47  ? -1.322  9.410   -0.189  1.00 1.00 ? 67  ALA A HB2  4  
ATOM 6092  H HB3  . ALA A 1 47  ? -2.489  8.093   0.018   1.00 1.00 ? 67  ALA A HB3  4  
ATOM 6093  N N    . GLY A 1 48  ? 0.510   9.472   2.986   1.00 1.00 ? 68  GLY A N    4  
ATOM 6094  C CA   . GLY A 1 48  ? 1.482   10.316  3.700   1.00 1.00 ? 68  GLY A CA   4  
ATOM 6095  C C    . GLY A 1 48  ? 1.656   11.747  3.156   1.00 1.00 ? 68  GLY A C    4  
ATOM 6096  O O    . GLY A 1 48  ? 1.847   11.939  1.953   1.00 1.00 ? 68  GLY A O    4  
ATOM 6097  H H    . GLY A 1 48  ? 0.729   8.496   2.828   1.00 1.00 ? 68  GLY A H    4  
ATOM 6098  H HA2  . GLY A 1 48  ? 1.167   10.361  4.742   1.00 1.00 ? 68  GLY A HA2  4  
ATOM 6099  H HA3  . GLY A 1 48  ? 2.459   9.836   3.669   1.00 1.00 ? 68  GLY A HA3  4  
ATOM 6100  N N    . ASN A 1 49  ? 1.621   12.712  4.094   1.00 1.00 ? 69  ASN A N    4  
ATOM 6101  C CA   . ASN A 1 49  ? 1.844   14.173  4.015   1.00 1.00 ? 69  ASN A CA   4  
ATOM 6102  C C    . ASN A 1 49  ? 1.490   14.984  5.303   1.00 1.00 ? 69  ASN A C    4  
ATOM 6103  O O    . ASN A 1 49  ? 1.964   16.111  5.411   1.00 1.00 ? 69  ASN A O    4  
ATOM 6104  C CB   . ASN A 1 49  ? 1.178   14.781  2.762   1.00 1.00 ? 69  ASN A CB   4  
ATOM 6105  C CG   . ASN A 1 49  ? 2.140   15.016  1.607   1.00 1.00 ? 69  ASN A CG   4  
ATOM 6106  O OD1  . ASN A 1 49  ? 2.986   15.895  1.590   1.00 1.00 ? 69  ASN A OD1  4  
ATOM 6107  N ND2  . ASN A 1 49  ? 1.992   14.275  0.542   1.00 1.00 ? 69  ASN A ND2  4  
ATOM 6108  H H    . ASN A 1 49  ? 1.495   12.339  5.016   1.00 1.00 ? 69  ASN A H    4  
ATOM 6109  H HA   . ASN A 1 49  ? 2.920   14.305  3.916   1.00 1.00 ? 69  ASN A HA   4  
ATOM 6110  H HB2  . ASN A 1 49  ? 0.423   14.112  2.347   1.00 0.00 ? 69  ASN A HB2  4  
ATOM 6111  H HB3  . ASN A 1 49  ? 0.685   15.727  2.990   1.00 1.00 ? 69  ASN A HB3  4  
ATOM 6112  H HD21 . ASN A 1 49  ? 1.246   13.566  0.508   1.00 0.00 ? 69  ASN A HD21 4  
ATOM 6113  H HD22 . ASN A 1 49  ? 2.622   14.399  -0.264  1.00 0.00 ? 69  ASN A HD22 4  
ATOM 6114  N N    . ASP A 1 50  ? 0.735   14.443  6.288   1.00 1.00 ? 70  ASP A N    4  
ATOM 6115  C CA   . ASP A 1 50  ? 0.492   15.081  7.611   1.00 1.00 ? 70  ASP A CA   4  
ATOM 6116  C C    . ASP A 1 50  ? 1.812   15.375  8.391   1.00 1.00 ? 70  ASP A C    4  
ATOM 6117  O O    . ASP A 1 50  ? 1.893   16.392  9.079   1.00 1.00 ? 70  ASP A O    4  
ATOM 6118  C CB   . ASP A 1 50  ? -0.434  14.174  8.461   1.00 1.00 ? 70  ASP A CB   4  
ATOM 6119  C CG   . ASP A 1 50  ? -1.958  14.332  8.288   1.00 1.00 ? 70  ASP A CG   4  
ATOM 6120  O OD1  . ASP A 1 50  ? -2.416  14.814  7.231   1.00 1.00 ? 70  ASP A OD1  4  
ATOM 6121  O OD2  . ASP A 1 50  ? -2.686  13.860  9.189   1.00 1.00 ? 70  ASP A OD2  4  
ATOM 6122  H H    . ASP A 1 50  ? 0.221   13.597  6.100   1.00 1.00 ? 70  ASP A H    4  
ATOM 6123  H HA   . ASP A 1 50  ? -0.010  16.040  7.451   1.00 1.00 ? 70  ASP A HA   4  
ATOM 6124  H HB2  . ASP A 1 50  ? -0.201  13.141  8.204   1.00 0.00 ? 70  ASP A HB2  4  
ATOM 6125  H HB3  . ASP A 1 50  ? -0.189  14.269  9.522   1.00 1.00 ? 70  ASP A HB3  4  
ATOM 6126  N N    . GLU A 1 51  ? 2.808   14.468  8.253   1.00 1.00 ? 71  GLU A N    4  
ATOM 6127  C CA   . GLU A 1 51  ? 4.230   14.448  8.706   1.00 1.00 ? 71  GLU A CA   4  
ATOM 6128  C C    . GLU A 1 51  ? 4.808   13.033  9.042   1.00 1.00 ? 71  GLU A C    4  
ATOM 6129  O O    . GLU A 1 51  ? 5.691   12.920  9.891   1.00 1.00 ? 71  GLU A O    4  
ATOM 6130  C CB   . GLU A 1 51  ? 4.520   15.507  9.802   1.00 1.00 ? 71  GLU A CB   4  
ATOM 6131  C CG   . GLU A 1 51  ? 5.961   16.061  9.864   1.00 1.00 ? 71  GLU A CG   4  
ATOM 6132  C CD   . GLU A 1 51  ? 6.126   17.429  9.200   1.00 1.00 ? 71  GLU A CD   4  
ATOM 6133  O OE1  . GLU A 1 51  ? 5.327   17.778  8.300   1.00 1.00 ? 71  GLU A OE1  4  
ATOM 6134  O OE2  . GLU A 1 51  ? 7.073   18.161  9.555   1.00 1.00 ? 71  GLU A OE2  4  
ATOM 6135  H H    . GLU A 1 51  ? 2.486   13.706  7.687   1.00 1.00 ? 71  GLU A H    4  
ATOM 6136  H HA   . GLU A 1 51  ? 4.798   14.784  7.839   1.00 1.00 ? 71  GLU A HA   4  
ATOM 6137  H HB2  . GLU A 1 51  ? 3.862   16.358  9.625   1.00 0.00 ? 71  GLU A HB2  4  
ATOM 6138  H HB3  . GLU A 1 51  ? 4.199   15.156  10.782  1.00 1.00 ? 71  GLU A HB3  4  
ATOM 6139  H HG2  . GLU A 1 51  ? 6.337   16.197  10.879  1.00 0.00 ? 71  GLU A HG2  4  
ATOM 6140  H HG3  . GLU A 1 51  ? 6.690   15.345  9.471   1.00 1.00 ? 71  GLU A HG3  4  
ATOM 6141  N N    . ASN A 1 52  ? 4.342   11.937  8.394   1.00 1.00 ? 72  ASN A N    4  
ATOM 6142  C CA   . ASN A 1 52  ? 4.900   10.571  8.559   1.00 1.00 ? 72  ASN A CA   4  
ATOM 6143  C C    . ASN A 1 52  ? 4.617   9.623   7.352   1.00 1.00 ? 72  ASN A C    4  
ATOM 6144  O O    . ASN A 1 52  ? 5.268   9.737   6.316   1.00 1.00 ? 72  ASN A O    4  
ATOM 6145  C CB   . ASN A 1 52  ? 4.467   10.023  9.948   1.00 1.00 ? 72  ASN A CB   4  
ATOM 6146  C CG   . ASN A 1 52  ? 5.410   9.021   10.618  1.00 1.00 ? 72  ASN A CG   4  
ATOM 6147  O OD1  . ASN A 1 52  ? 6.538   8.792   10.218  1.00 1.00 ? 72  ASN A OD1  4  
ATOM 6148  N ND2  . ASN A 1 52  ? 4.986   8.356   11.671  1.00 1.00 ? 72  ASN A ND2  4  
ATOM 6149  H H    . ASN A 1 52  ? 3.671   12.086  7.658   1.00 1.00 ? 72  ASN A H    4  
ATOM 6150  H HA   . ASN A 1 52  ? 5.987   10.674  8.586   1.00 1.00 ? 72  ASN A HA   4  
ATOM 6151  H HB2  . ASN A 1 52  ? 4.630   10.803  10.691  1.00 0.00 ? 72  ASN A HB2  4  
ATOM 6152  H HB3  . ASN A 1 52  ? 3.423   9.728   9.999   1.00 1.00 ? 72  ASN A HB3  4  
ATOM 6153  H HD21 . ASN A 1 52  ? 4.035   8.514   12.031  1.00 0.00 ? 72  ASN A HD21 4  
ATOM 6154  H HD22 . ASN A 1 52  ? 5.606   7.678   12.136  1.00 0.00 ? 72  ASN A HD22 4  
ATOM 6155  N N    . TYR A 1 53  ? 3.640   8.707   7.478   1.00 1.00 ? 73  TYR A N    4  
ATOM 6156  C CA   . TYR A 1 53  ? 3.236   7.640   6.529   1.00 1.00 ? 73  TYR A CA   4  
ATOM 6157  C C    . TYR A 1 53  ? 1.699   7.536   6.330   1.00 1.00 ? 73  TYR A C    4  
ATOM 6158  O O    . TYR A 1 53  ? 1.190   6.517   5.851   1.00 1.00 ? 73  TYR A O    4  
ATOM 6159  C CB   . TYR A 1 53  ? 3.828   6.294   7.025   1.00 1.00 ? 73  TYR A CB   4  
ATOM 6160  C CG   . TYR A 1 53  ? 3.290   5.712   8.334   1.00 1.00 ? 73  TYR A CG   4  
ATOM 6161  C CD1  . TYR A 1 53  ? 2.135   4.891   8.324   1.00 1.00 ? 73  TYR A CD1  4  
ATOM 6162  C CD2  . TYR A 1 53  ? 3.958   5.956   9.558   1.00 1.00 ? 73  TYR A CD2  4  
ATOM 6163  C CE1  . TYR A 1 53  ? 1.612   4.372   9.529   1.00 1.00 ? 73  TYR A CE1  4  
ATOM 6164  C CE2  . TYR A 1 53  ? 3.453   5.417   10.768  1.00 1.00 ? 73  TYR A CE2  4  
ATOM 6165  C CZ   . TYR A 1 53  ? 2.270   4.638   10.757  1.00 1.00 ? 73  TYR A CZ   4  
ATOM 6166  O OH   . TYR A 1 53  ? 1.765   4.141   11.918  1.00 1.00 ? 73  TYR A OH   4  
ATOM 6167  H H    . TYR A 1 53  ? 3.199   8.686   8.384   1.00 1.00 ? 73  TYR A H    4  
ATOM 6168  H HA   . TYR A 1 53  ? 3.667   7.841   5.549   1.00 1.00 ? 73  TYR A HA   4  
ATOM 6169  H HB2  . TYR A 1 53  ? 3.523   5.472   6.378   1.00 0.00 ? 73  TYR A HB2  4  
ATOM 6170  H HB3  . TYR A 1 53  ? 4.920   6.328   7.036   1.00 1.00 ? 73  TYR A HB3  4  
ATOM 6171  H HD1  . TYR A 1 53  ? 1.649   4.638   7.398   1.00 1.00 ? 73  TYR A HD1  4  
ATOM 6172  H HD2  . TYR A 1 53  ? 4.861   6.543   9.569   1.00 1.00 ? 73  TYR A HD2  4  
ATOM 6173  H HE1  . TYR A 1 53  ? 0.719   3.763   9.505   1.00 1.00 ? 73  TYR A HE1  4  
ATOM 6174  H HE2  . TYR A 1 53  ? 3.950   5.590   11.709  1.00 1.00 ? 73  TYR A HE2  4  
ATOM 6175  H HH   . TYR A 1 53  ? 0.924   3.711   11.772  1.00 1.00 ? 73  TYR A HH   4  
ATOM 6176  N N    . SER A 1 54  ? 0.922   8.560   6.729   1.00 1.00 ? 74  SER A N    4  
ATOM 6177  C CA   . SER A 1 54  ? -0.537  8.554   6.821   1.00 1.00 ? 74  SER A CA   4  
ATOM 6178  C C    . SER A 1 54  ? -1.068  9.976   7.040   1.00 1.00 ? 74  SER A C    4  
ATOM 6179  O O    . SER A 1 54  ? -0.799  10.586  8.073   1.00 1.00 ? 74  SER A O    4  
ATOM 6180  C CB   . SER A 1 54  ? -0.932  7.665   8.018   1.00 1.00 ? 74  SER A CB   4  
ATOM 6181  O OG   . SER A 1 54  ? -0.819  6.306   7.641   1.00 1.00 ? 74  SER A OG   4  
ATOM 6182  H H    . SER A 1 54  ? 1.331   9.449   6.954   1.00 1.00 ? 74  SER A H    4  
ATOM 6183  H HA   . SER A 1 54  ? -0.958  8.140   5.904   1.00 1.00 ? 74  SER A HA   4  
ATOM 6184  H HB2  . SER A 1 54  ? -0.268  7.827   8.867   1.00 0.00 ? 74  SER A HB2  4  
ATOM 6185  H HB3  . SER A 1 54  ? -1.952  7.877   8.349   1.00 1.00 ? 74  SER A HB3  4  
ATOM 6186  H HG   . SER A 1 54  ? -0.115  6.255   6.966   1.00 1.00 ? 74  SER A HG   4  
ATOM 6187  N N    . ALA A 1 55  ? -1.760  10.507  6.029   1.00 1.00 ? 75  ALA A N    4  
ATOM 6188  C CA   . ALA A 1 55  ? -2.455  11.809  6.053   1.00 1.00 ? 75  ALA A CA   4  
ATOM 6189  C C    . ALA A 1 55  ? -4.006  11.761  6.040   1.00 1.00 ? 75  ALA A C    4  
ATOM 6190  O O    . ALA A 1 55  ? -4.614  10.749  5.687   1.00 1.00 ? 75  ALA A O    4  
ATOM 6191  C CB   . ALA A 1 55  ? -1.928  12.681  4.901   1.00 1.00 ? 75  ALA A CB   4  
ATOM 6192  H H    . ALA A 1 55  ? -1.664  9.998   5.169   1.00 1.00 ? 75  ALA A H    4  
ATOM 6193  H HA   . ALA A 1 55  ? -2.186  12.288  6.989   1.00 1.00 ? 75  ALA A HA   4  
ATOM 6194  H HB1  . ALA A 1 55  ? -0.856  12.562  4.794   1.00 1.00 ? 75  ALA A HB1  4  
ATOM 6195  H HB2  . ALA A 1 55  ? -2.425  12.412  3.971   1.00 1.00 ? 75  ALA A HB2  4  
ATOM 6196  H HB3  . ALA A 1 55  ? -2.139  13.733  5.082   1.00 1.00 ? 75  ALA A HB3  4  
ATOM 6197  N N    . GLU A 1 56  ? -4.629  12.896  6.393   1.00 1.00 ? 76  GLU A N    4  
ATOM 6198  C CA   . GLU A 1 56  ? -6.089  13.130  6.414   1.00 1.00 ? 76  GLU A CA   4  
ATOM 6199  C C    . GLU A 1 56  ? -6.805  13.016  5.027   1.00 1.00 ? 76  GLU A C    4  
ATOM 6200  O O    . GLU A 1 56  ? -6.187  13.215  3.971   1.00 1.00 ? 76  GLU A O    4  
ATOM 6201  C CB   . GLU A 1 56  ? -6.287  14.509  7.077   1.00 1.00 ? 76  GLU A CB   4  
ATOM 6202  C CG   . GLU A 1 56  ? -7.013  14.425  8.426   1.00 1.00 ? 76  GLU A CG   4  
ATOM 6203  C CD   . GLU A 1 56  ? -8.532  14.333  8.248   1.00 1.00 ? 76  GLU A CD   4  
ATOM 6204  O OE1  . GLU A 1 56  ? -8.985  13.421  7.519   1.00 1.00 ? 76  GLU A OE1  4  
ATOM 6205  O OE2  . GLU A 1 56  ? -9.259  15.206  8.776   1.00 1.00 ? 76  GLU A OE2  4  
ATOM 6206  H H    . GLU A 1 56  ? -4.011  13.650  6.705   1.00 1.00 ? 76  GLU A H    4  
ATOM 6207  H HA   . GLU A 1 56  ? -6.530  12.362  7.058   1.00 1.00 ? 76  GLU A HA   4  
ATOM 6208  H HB2  . GLU A 1 56  ? -5.348  15.023  7.277   1.00 0.00 ? 76  GLU A HB2  4  
ATOM 6209  H HB3  . GLU A 1 56  ? -6.760  15.235  6.413   1.00 1.00 ? 76  GLU A HB3  4  
ATOM 6210  H HG2  . GLU A 1 56  ? -6.702  13.550  8.996   1.00 0.00 ? 76  GLU A HG2  4  
ATOM 6211  H HG3  . GLU A 1 56  ? -6.736  15.276  9.052   1.00 1.00 ? 76  GLU A HG3  4  
ATOM 6212  N N    . LEU A 1 57  ? -8.128  12.741  5.007   1.00 1.00 ? 77  LEU A N    4  
ATOM 6213  C CA   . LEU A 1 57  ? -8.971  12.483  3.841   1.00 1.00 ? 77  LEU A CA   4  
ATOM 6214  C C    . LEU A 1 57  ? -10.273 13.327  3.854   1.00 1.00 ? 77  LEU A C    4  
ATOM 6215  O O    . LEU A 1 57  ? -10.616 13.930  4.868   1.00 1.00 ? 77  LEU A O    4  
ATOM 6216  C CB   . LEU A 1 57  ? -9.213  10.955  3.770   1.00 1.00 ? 77  LEU A CB   4  
ATOM 6217  C CG   . LEU A 1 57  ? -10.412 10.295  4.486   1.00 1.00 ? 77  LEU A CG   4  
ATOM 6218  C CD1  . LEU A 1 57  ? -10.318 8.763   4.420   1.00 1.00 ? 77  LEU A CD1  4  
ATOM 6219  C CD2  . LEU A 1 57  ? -10.527 10.694  5.954   1.00 1.00 ? 77  LEU A CD2  4  
ATOM 6220  H H    . LEU A 1 57  ? -8.704  12.682  5.851   1.00 1.00 ? 77  LEU A H    4  
ATOM 6221  H HA   . LEU A 1 57  ? -8.410  12.778  2.958   1.00 1.00 ? 77  LEU A HA   4  
ATOM 6222  H HB2  . LEU A 1 57  ? -9.595  10.665  2.792   1.00 0.00 ? 77  LEU A HB2  4  
ATOM 6223  H HB3  . LEU A 1 57  ? -8.287  10.405  3.945   1.00 1.00 ? 77  LEU A HB3  4  
ATOM 6224  H HG   . LEU A 1 57  ? -11.327 10.604  3.971   1.00 1.00 ? 77  LEU A HG   4  
ATOM 6225  H HD11 . LEU A 1 57  ? -9.362  8.431   4.830   1.00 1.00 ? 77  LEU A HD11 4  
ATOM 6226  H HD12 . LEU A 1 57  ? -11.113 8.305   4.998   1.00 1.00 ? 77  LEU A HD12 4  
ATOM 6227  H HD13 . LEU A 1 57  ? -10.412 8.406   3.408   1.00 1.00 ? 77  LEU A HD13 4  
ATOM 6228  H HD21 . LEU A 1 57  ? -9.600  10.456  6.478   1.00 1.00 ? 77  LEU A HD21 4  
ATOM 6229  H HD22 . LEU A 1 57  ? -10.719 11.757  6.064   1.00 1.00 ? 77  LEU A HD22 4  
ATOM 6230  H HD23 . LEU A 1 57  ? -11.350 10.165  6.433   1.00 1.00 ? 77  LEU A HD23 4  
ATOM 6231  N N    . ARG A 1 58  ? -11.029 13.397  2.744   1.00 1.00 ? 78  ARG A N    4  
ATOM 6232  C CA   . ARG A 1 58  ? -12.377 14.038  2.710   1.00 1.00 ? 78  ARG A CA   4  
ATOM 6233  C C    . ARG A 1 58  ? -13.407 13.134  2.041   1.00 1.00 ? 78  ARG A C    4  
ATOM 6234  O O    . ARG A 1 58  ? -13.531 13.111  0.823   1.00 1.00 ? 78  ARG A O    4  
ATOM 6235  C CB   . ARG A 1 58  ? -12.326 15.475  2.145   1.00 1.00 ? 78  ARG A CB   4  
ATOM 6236  C CG   . ARG A 1 58  ? -12.809 16.559  3.128   1.00 1.00 ? 78  ARG A CG   4  
ATOM 6237  C CD   . ARG A 1 58  ? -11.735 16.702  4.209   1.00 1.00 ? 78  ARG A CD   4  
ATOM 6238  N NE   . ARG A 1 58  ? -12.186 17.200  5.523   1.00 1.00 ? 78  ARG A NE   4  
ATOM 6239  C CZ   . ARG A 1 58  ? -11.671 16.800  6.680   1.00 1.00 ? 78  ARG A CZ   4  
ATOM 6240  N NH1  . ARG A 1 58  ? -10.894 15.773  6.787   1.00 1.00 ? 78  ARG A NH1  4  
ATOM 6241  N NH2  . ARG A 1 58  ? -11.895 17.417  7.802   1.00 1.00 ? 78  ARG A NH2  4  
ATOM 6242  H H    . ARG A 1 58  ? -10.657 12.901  1.936   1.00 1.00 ? 78  ARG A H    4  
ATOM 6243  H HA   . ARG A 1 58  ? -12.724 14.139  3.742   1.00 1.00 ? 78  ARG A HA   4  
ATOM 6244  H HB2  . ARG A 1 58  ? -11.307 15.804  1.943   1.00 0.00 ? 78  ARG A HB2  4  
ATOM 6245  H HB3  . ARG A 1 58  ? -12.875 15.570  1.206   1.00 1.00 ? 78  ARG A HB3  4  
ATOM 6246  H HG2  . ARG A 1 58  ? -12.914 17.513  2.612   1.00 0.00 ? 78  ARG A HG2  4  
ATOM 6247  H HG3  . ARG A 1 58  ? -13.777 16.278  3.551   1.00 1.00 ? 78  ARG A HG3  4  
ATOM 6248  H HD2  . ARG A 1 58  ? -11.373 15.724  4.528   1.00 0.00 ? 78  ARG A HD2  4  
ATOM 6249  H HD3  . ARG A 1 58  ? -10.886 17.271  3.839   1.00 1.00 ? 78  ARG A HD3  4  
ATOM 6250  H HE   . ARG A 1 58  ? -12.771 18.011  5.565   1.00 1.00 ? 78  ARG A HE   4  
ATOM 6251  H HH11 . ARG A 1 58  ? -10.649 15.224  5.950   1.00 0.00 ? 78  ARG A HH11 4  
ATOM 6252  H HH12 . ARG A 1 58  ? -10.521 15.503  7.708   1.00 0.00 ? 78  ARG A HH12 4  
ATOM 6253  H HH21 . ARG A 1 58  ? -12.494 18.255  7.818   1.00 0.00 ? 78  ARG A HH21 4  
ATOM 6254  H HH22 . ARG A 1 58  ? -11.474 17.068  8.674   1.00 0.00 ? 78  ARG A HH22 4  
ATOM 6255  N N    . ASN A 1 59  ? -14.083 12.328  2.869   1.00 1.00 ? 79  ASN A N    4  
ATOM 6256  C CA   . ASN A 1 59  ? -15.012 11.283  2.461   1.00 1.00 ? 79  ASN A CA   4  
ATOM 6257  C C    . ASN A 1 59  ? -14.319 10.105  1.739   1.00 1.00 ? 79  ASN A C    4  
ATOM 6258  O O    . ASN A 1 59  ? -15.035 9.272   1.186   1.00 1.00 ? 79  ASN A O    4  
ATOM 6259  C CB   . ASN A 1 59  ? -16.232 11.907  1.736   1.00 1.00 ? 79  ASN A CB   4  
ATOM 6260  C CG   . ASN A 1 59  ? -17.590 11.246  2.003   1.00 1.00 ? 79  ASN A CG   4  
ATOM 6261  O OD1  . ASN A 1 59  ? -17.783 10.464  2.924   1.00 1.00 ? 79  ASN A OD1  4  
ATOM 6262  N ND2  . ASN A 1 59  ? -18.608 11.586  1.243   1.00 1.00 ? 79  ASN A ND2  4  
ATOM 6263  H H    . ASN A 1 59  ? -13.827 12.331  3.843   1.00 1.00 ? 79  ASN A H    4  
ATOM 6264  H HA   . ASN A 1 59  ? -15.388 10.847  3.387   1.00 1.00 ? 79  ASN A HA   4  
ATOM 6265  H HB2  . ASN A 1 59  ? -16.428 12.915  2.103   1.00 0.00 ? 79  ASN A HB2  4  
ATOM 6266  H HB3  . ASN A 1 59  ? -16.056 11.967  0.662   1.00 1.00 ? 79  ASN A HB3  4  
ATOM 6267  H HD21 . ASN A 1 59  ? -18.483 12.280  0.492   1.00 0.00 ? 79  ASN A HD21 4  
ATOM 6268  H HD22 . ASN A 1 59  ? -19.532 11.157  1.400   1.00 0.00 ? 79  ASN A HD22 4  
ATOM 6269  N N    . ALA A 1 60  ? -12.952 9.972   1.756   1.00 1.00 ? 80  ALA A N    4  
ATOM 6270  C CA   . ALA A 1 60  ? -12.353 8.698   1.245   1.00 1.00 ? 80  ALA A CA   4  
ATOM 6271  C C    . ALA A 1 60  ? -12.528 7.516   2.242   1.00 1.00 ? 80  ALA A C    4  
ATOM 6272  O O    . ALA A 1 60  ? -12.066 6.399   2.024   1.00 1.00 ? 80  ALA A O    4  
ATOM 6273  C CB   . ALA A 1 60  ? -10.914 8.886   0.768   1.00 1.00 ? 80  ALA A CB   4  
ATOM 6274  H H    . ALA A 1 60  ? -12.351 10.593  2.330   1.00 1.00 ? 80  ALA A H    4  
ATOM 6275  H HA   . ALA A 1 60  ? -12.914 8.374   0.374   1.00 1.00 ? 80  ALA A HA   4  
ATOM 6276  H HB1  . ALA A 1 60  ? -10.346 9.478   1.476   1.00 1.00 ? 80  ALA A HB1  4  
ATOM 6277  H HB2  . ALA A 1 60  ? -10.462 7.913   0.640   1.00 1.00 ? 80  ALA A HB2  4  
ATOM 6278  H HB3  . ALA A 1 60  ? -10.870 9.334   -0.212  1.00 1.00 ? 80  ALA A HB3  4  
ATOM 6279  N N    . THR A 1 61  ? -13.304 7.787   3.289   1.00 1.00 ? 81  THR A N    4  
ATOM 6280  C CA   . THR A 1 61  ? -13.662 6.949   4.447   1.00 1.00 ? 81  THR A CA   4  
ATOM 6281  C C    . THR A 1 61  ? -15.016 6.297   4.125   1.00 1.00 ? 81  THR A C    4  
ATOM 6282  O O    . THR A 1 61  ? -16.048 6.964   4.061   1.00 1.00 ? 81  THR A O    4  
ATOM 6283  C CB   . THR A 1 61  ? -13.738 7.777   5.772   1.00 1.00 ? 81  THR A CB   4  
ATOM 6284  O OG1  . THR A 1 61  ? -14.612 7.189   6.712   1.00 1.00 ? 81  THR A OG1  4  
ATOM 6285  C CG2  . THR A 1 61  ? -14.178 9.249   5.637   1.00 1.00 ? 81  THR A CG2  4  
ATOM 6286  H H    . THR A 1 61  ? -13.558 8.769   3.192   1.00 1.00 ? 81  THR A H    4  
ATOM 6287  H HA   . THR A 1 61  ? -12.899 6.182   4.589   1.00 1.00 ? 81  THR A HA   4  
ATOM 6288  H HB   . THR A 1 61  ? -12.746 7.776   6.222   1.00 1.00 ? 81  THR A HB   4  
ATOM 6289  H HG1  . THR A 1 61  ? -15.511 7.304   6.378   1.00 1.00 ? 81  THR A HG1  4  
ATOM 6290  H HG21 . THR A 1 61  ? -15.167 9.325   5.183   1.00 1.00 ? 81  THR A HG21 4  
ATOM 6291  H HG22 . THR A 1 61  ? -14.201 9.722   6.623   1.00 1.00 ? 81  THR A HG22 4  
ATOM 6292  H HG23 . THR A 1 61  ? -13.458 9.801   5.033   1.00 1.00 ? 81  THR A HG23 4  
ATOM 6293  N N    . ALA A 1 62  ? -14.996 4.970   3.963   1.00 1.00 ? 82  ALA A N    4  
ATOM 6294  C CA   . ALA A 1 62  ? -16.113 4.129   3.565   1.00 1.00 ? 82  ALA A CA   4  
ATOM 6295  C C    . ALA A 1 62  ? -16.117 2.832   4.400   1.00 1.00 ? 82  ALA A C    4  
ATOM 6296  O O    . ALA A 1 62  ? -15.124 2.457   5.009   1.00 1.00 ? 82  ALA A O    4  
ATOM 6297  C CB   . ALA A 1 62  ? -16.009 3.880   2.047   1.00 1.00 ? 82  ALA A CB   4  
ATOM 6298  H H    . ALA A 1 62  ? -14.154 4.439   4.144   1.00 1.00 ? 82  ALA A H    4  
ATOM 6299  H HA   . ALA A 1 62  ? -17.044 4.663   3.767   1.00 1.00 ? 82  ALA A HA   4  
ATOM 6300  H HB1  . ALA A 1 62  ? -16.047 4.834   1.518   1.00 1.00 ? 82  ALA A HB1  4  
ATOM 6301  H HB2  . ALA A 1 62  ? -15.072 3.380   1.801   1.00 1.00 ? 82  ALA A HB2  4  
ATOM 6302  H HB3  . ALA A 1 62  ? -16.845 3.270   1.705   1.00 1.00 ? 82  ALA A HB3  4  
ATOM 6303  N N    . ALA A 1 63  ? -17.265 2.164   4.457   1.00 1.00 ? 83  ALA A N    4  
ATOM 6304  C CA   . ALA A 1 63  ? -17.464 0.842   5.082   1.00 1.00 ? 83  ALA A CA   4  
ATOM 6305  C C    . ALA A 1 63  ? -18.334 -0.123  4.249   1.00 1.00 ? 83  ALA A C    4  
ATOM 6306  O O    . ALA A 1 63  ? -19.291 0.295   3.595   1.00 1.00 ? 83  ALA A O    4  
ATOM 6307  C CB   . ALA A 1 63  ? -18.002 1.022   6.513   1.00 1.00 ? 83  ALA A CB   4  
ATOM 6308  H H    . ALA A 1 63  ? -17.965 2.612   3.903   1.00 1.00 ? 83  ALA A H    4  
ATOM 6309  H HA   . ALA A 1 63  ? -16.484 0.376   5.173   1.00 1.00 ? 83  ALA A HA   4  
ATOM 6310  H HB1  . ALA A 1 63  ? -17.330 1.665   7.087   1.00 1.00 ? 83  ALA A HB1  4  
ATOM 6311  H HB2  . ALA A 1 63  ? -18.995 1.471   6.498   1.00 1.00 ? 83  ALA A HB2  4  
ATOM 6312  H HB3  . ALA A 1 63  ? -18.056 0.053   7.012   1.00 1.00 ? 83  ALA A HB3  4  
ATOM 6313  N N    . MET A 1 64  ? -18.028 -1.428  4.342   1.00 1.00 ? 84  MET A N    4  
ATOM 6314  C CA   . MET A 1 64  ? -18.799 -2.542  3.768   1.00 1.00 ? 84  MET A CA   4  
ATOM 6315  C C    . MET A 1 64  ? -19.644 -3.205  4.865   1.00 1.00 ? 84  MET A C    4  
ATOM 6316  O O    . MET A 1 64  ? -19.256 -3.218  6.039   1.00 1.00 ? 84  MET A O    4  
ATOM 6317  C CB   . MET A 1 64  ? -17.854 -3.589  3.146   1.00 1.00 ? 84  MET A CB   4  
ATOM 6318  C CG   . MET A 1 64  ? -17.355 -3.170  1.765   1.00 1.00 ? 84  MET A CG   4  
ATOM 6319  S SD   . MET A 1 64  ? -16.719 -4.484  0.700   1.00 1.00 ? 84  MET A SD   4  
ATOM 6320  C CE   . MET A 1 64  ? -15.094 -4.711  1.463   1.00 1.00 ? 84  MET A CE   4  
ATOM 6321  H H    . MET A 1 64  ? -17.322 -1.686  5.020   1.00 1.00 ? 84  MET A H    4  
ATOM 6322  H HA   . MET A 1 64  ? -19.472 -2.167  2.989   1.00 1.00 ? 84  MET A HA   4  
ATOM 6323  H HB2  . MET A 1 64  ? -16.969 -3.760  3.758   1.00 0.00 ? 84  MET A HB2  4  
ATOM 6324  H HB3  . MET A 1 64  ? -18.360 -4.553  3.054   1.00 1.00 ? 84  MET A HB3  4  
ATOM 6325  H HG2  . MET A 1 64  ? -18.189 -2.711  1.236   1.00 0.00 ? 84  MET A HG2  4  
ATOM 6326  H HG3  . MET A 1 64  ? -16.612 -2.377  1.864   1.00 1.00 ? 84  MET A HG3  4  
ATOM 6327  H HE1  . MET A 1 64  ? -14.573 -3.756  1.531   1.00 1.00 ? 84  MET A HE1  4  
ATOM 6328  H HE2  . MET A 1 64  ? -15.241 -5.119  2.459   1.00 1.00 ? 84  MET A HE2  4  
ATOM 6329  H HE3  . MET A 1 64  ? -14.500 -5.402  0.866   1.00 1.00 ? 84  MET A HE3  4  
ATOM 6330  N N    . LYS A 1 65  ? -20.781 -3.789  4.457   1.00 1.00 ? 85  LYS A N    4  
ATOM 6331  C CA   . LYS A 1 65  ? -21.786 -4.412  5.337   1.00 1.00 ? 85  LYS A CA   4  
ATOM 6332  C C    . LYS A 1 65  ? -21.761 -5.916  5.072   1.00 1.00 ? 85  LYS A C    4  
ATOM 6333  O O    . LYS A 1 65  ? -21.083 -6.635  5.795   1.00 1.00 ? 85  LYS A O    4  
ATOM 6334  C CB   . LYS A 1 65  ? -23.140 -3.689  5.175   1.00 1.00 ? 85  LYS A CB   4  
ATOM 6335  C CG   . LYS A 1 65  ? -23.042 -2.272  5.770   1.00 1.00 ? 85  LYS A CG   4  
ATOM 6336  C CD   . LYS A 1 65  ? -24.326 -1.436  5.727   1.00 1.00 ? 85  LYS A CD   4  
ATOM 6337  C CE   . LYS A 1 65  ? -24.129 -0.179  6.581   1.00 1.00 ? 85  LYS A CE   4  
ATOM 6338  N NZ   . LYS A 1 65  ? -23.309 0.841   5.890   1.00 1.00 ? 85  LYS A NZ   4  
ATOM 6339  H H    . LYS A 1 65  ? -20.957 -3.793  3.461   1.00 1.00 ? 85  LYS A H    4  
ATOM 6340  H HA   . LYS A 1 65  ? -21.483 -4.299  6.383   1.00 1.00 ? 85  LYS A HA   4  
ATOM 6341  H HB2  . LYS A 1 65  ? -23.395 -3.620  4.118   1.00 0.00 ? 85  LYS A HB2  4  
ATOM 6342  H HB3  . LYS A 1 65  ? -23.919 -4.248  5.697   1.00 1.00 ? 85  LYS A HB3  4  
ATOM 6343  H HG2  . LYS A 1 65  ? -22.824 -2.331  6.835   1.00 0.00 ? 85  LYS A HG2  4  
ATOM 6344  H HG3  . LYS A 1 65  ? -22.245 -1.715  5.274   1.00 1.00 ? 85  LYS A HG3  4  
ATOM 6345  H HD2  . LYS A 1 65  ? -24.550 -1.167  4.696   1.00 0.00 ? 85  LYS A HD2  4  
ATOM 6346  H HD3  . LYS A 1 65  ? -25.152 -2.016  6.139   1.00 1.00 ? 85  LYS A HD3  4  
ATOM 6347  H HE2  . LYS A 1 65  ? -25.095 0.296   6.747   1.00 0.00 ? 85  LYS A HE2  4  
ATOM 6348  H HE3  . LYS A 1 65  ? -23.687 -0.462  7.540   1.00 1.00 ? 85  LYS A HE3  4  
ATOM 6349  H HZ1  . LYS A 1 65  ? -23.647 0.957   4.924   1.00 0.00 ? 85  LYS A HZ1  4  
ATOM 6350  H HZ2  . LYS A 1 65  ? -23.384 1.739   6.390   1.00 0.00 ? 85  LYS A HZ2  4  
ATOM 6351  N N    . ASN A 1 66  ? -22.413 -6.381  3.997   1.00 1.00 ? 86  ASN A N    4  
ATOM 6352  C CA   . ASN A 1 66  ? -22.276 -7.766  3.541   1.00 1.00 ? 86  ASN A CA   4  
ATOM 6353  C C    . ASN A 1 66  ? -20.961 -7.934  2.743   1.00 1.00 ? 86  ASN A C    4  
ATOM 6354  O O    . ASN A 1 66  ? -20.089 -8.700  3.130   1.00 1.00 ? 86  ASN A O    4  
ATOM 6355  C CB   . ASN A 1 66  ? -23.536 -8.161  2.750   1.00 1.00 ? 86  ASN A CB   4  
ATOM 6356  C CG   . ASN A 1 66  ? -23.812 -9.658  2.690   1.00 1.00 ? 86  ASN A CG   4  
ATOM 6357  O OD1  . ASN A 1 66  ? -24.835 -10.134 3.139   1.00 1.00 ? 86  ASN A OD1  4  
ATOM 6358  N ND2  . ASN A 1 66  ? -22.947 -10.459 2.108   1.00 1.00 ? 86  ASN A ND2  4  
ATOM 6359  H H    . ASN A 1 66  ? -22.967 -5.731  3.464   1.00 1.00 ? 86  ASN A H    4  
ATOM 6360  H HA   . ASN A 1 66  ? -22.222 -8.414  4.421   1.00 1.00 ? 86  ASN A HA   4  
ATOM 6361  H HB2  . ASN A 1 66  ? -24.456 -7.832  3.231   1.00 0.00 ? 86  ASN A HB2  4  
ATOM 6362  H HB3  . ASN A 1 66  ? -23.554 -7.738  1.749   1.00 1.00 ? 86  ASN A HB3  4  
ATOM 6363  H HD21 . ASN A 1 66  ? -22.085 -10.075 1.695   1.00 0.00 ? 86  ASN A HD21 4  
ATOM 6364  H HD22 . ASN A 1 66  ? -23.129 -11.472 2.066   1.00 0.00 ? 86  ASN A HD22 4  
ATOM 6365  N N    . GLN A 1 67  ? -20.840 -7.218  1.616   1.00 1.00 ? 87  GLN A N    4  
ATOM 6366  C CA   . GLN A 1 67  ? -19.737 -7.313  0.639   1.00 1.00 ? 87  GLN A CA   4  
ATOM 6367  C C    . GLN A 1 67  ? -19.737 -6.197  -0.439  1.00 1.00 ? 87  GLN A C    4  
ATOM 6368  O O    . GLN A 1 67  ? -19.238 -6.416  -1.544  1.00 1.00 ? 87  GLN A O    4  
ATOM 6369  C CB   . GLN A 1 67  ? -19.731 -8.729  0.009   1.00 1.00 ? 87  GLN A CB   4  
ATOM 6370  C CG   . GLN A 1 67  ? -20.912 -9.140  -0.884  1.00 1.00 ? 87  GLN A CG   4  
ATOM 6371  C CD   . GLN A 1 67  ? -20.475 -9.545  -2.292  1.00 1.00 ? 87  GLN A CD   4  
ATOM 6372  O OE1  . GLN A 1 67  ? -20.780 -10.615 -2.785  1.00 1.00 ? 87  GLN A OE1  4  
ATOM 6373  N NE2  . GLN A 1 67  ? -19.768 -8.696  -3.009  1.00 1.00 ? 87  GLN A NE2  4  
ATOM 6374  H H    . GLN A 1 67  ? -21.592 -6.569  1.444   1.00 1.00 ? 87  GLN A H    4  
ATOM 6375  H HA   . GLN A 1 67  ? -18.799 -7.199  1.183   1.00 1.00 ? 87  GLN A HA   4  
ATOM 6376  H HB2  . GLN A 1 67  ? -18.959 -8.827  -0.754  1.00 0.00 ? 87  GLN A HB2  4  
ATOM 6377  H HB3  . GLN A 1 67  ? -19.548 -9.500  0.755   1.00 1.00 ? 87  GLN A HB3  4  
ATOM 6378  H HG2  . GLN A 1 67  ? -21.406 -10.043 -0.523  1.00 0.00 ? 87  GLN A HG2  4  
ATOM 6379  H HG3  . GLN A 1 67  ? -21.678 -8.366  -0.937  1.00 1.00 ? 87  GLN A HG3  4  
ATOM 6380  H HE21 . GLN A 1 67  ? -19.518 -7.777  -2.619  1.00 0.00 ? 87  GLN A HE21 4  
ATOM 6381  H HE22 . GLN A 1 67  ? -19.466 -8.952  -3.959  1.00 0.00 ? 87  GLN A HE22 4  
ATOM 6382  N N    . VAL A 1 68  ? -20.374 -5.043  -0.165  1.00 1.00 ? 88  VAL A N    4  
ATOM 6383  C CA   . VAL A 1 68  ? -20.530 -3.888  -1.084  1.00 1.00 ? 88  VAL A CA   4  
ATOM 6384  C C    . VAL A 1 68  ? -20.220 -2.539  -0.407  1.00 1.00 ? 88  VAL A C    4  
ATOM 6385  O O    . VAL A 1 68  ? -20.907 -2.172  0.550   1.00 1.00 ? 88  VAL A O    4  
ATOM 6386  C CB   . VAL A 1 68  ? -21.945 -3.861  -1.743  1.00 1.00 ? 88  VAL A CB   4  
ATOM 6387  C CG1  . VAL A 1 68  ? -22.191 -2.611  -2.622  1.00 1.00 ? 88  VAL A CG1  4  
ATOM 6388  C CG2  . VAL A 1 68  ? -22.190 -5.096  -2.633  1.00 1.00 ? 88  VAL A CG2  4  
ATOM 6389  H H    . VAL A 1 68  ? -20.703 -4.923  0.782   1.00 1.00 ? 88  VAL A H    4  
ATOM 6390  H HA   . VAL A 1 68  ? -19.815 -4.014  -1.903  1.00 1.00 ? 88  VAL A HA   4  
ATOM 6391  H HB   . VAL A 1 68  ? -22.701 -3.859  -0.958  1.00 1.00 ? 88  VAL A HB   4  
ATOM 6392  H HG11 . VAL A 1 68  ? -21.418 -2.532  -3.391  1.00 1.00 ? 88  VAL A HG11 4  
ATOM 6393  H HG12 . VAL A 1 68  ? -23.166 -2.678  -3.106  1.00 1.00 ? 88  VAL A HG12 4  
ATOM 6394  H HG13 . VAL A 1 68  ? -22.188 -1.708  -2.013  1.00 1.00 ? 88  VAL A HG13 4  
ATOM 6395  H HG21 . VAL A 1 68  ? -21.443 -5.141  -3.429  1.00 1.00 ? 88  VAL A HG21 4  
ATOM 6396  H HG22 . VAL A 1 68  ? -22.132 -6.009  -2.041  1.00 1.00 ? 88  VAL A HG22 4  
ATOM 6397  H HG23 . VAL A 1 68  ? -23.184 -5.054  -3.082  1.00 1.00 ? 88  VAL A HG23 4  
ATOM 6398  N N    . ALA A 1 69  ? -19.225 -1.800  -0.915  1.00 1.00 ? 89  ALA A N    4  
ATOM 6399  C CA   . ALA A 1 69  ? -18.940 -0.396  -0.576  1.00 1.00 ? 89  ALA A CA   4  
ATOM 6400  C C    . ALA A 1 69  ? -18.657 0.404   -1.865  1.00 1.00 ? 89  ALA A C    4  
ATOM 6401  O O    . ALA A 1 69  ? -18.070 -0.109  -2.831  1.00 1.00 ? 89  ALA A O    4  
ATOM 6402  C CB   . ALA A 1 69  ? -17.860 -0.235  0.500   1.00 1.00 ? 89  ALA A CB   4  
ATOM 6403  H H    . ALA A 1 69  ? -18.642 -2.235  -1.631  1.00 1.00 ? 89  ALA A H    4  
ATOM 6404  H HA   . ALA A 1 69  ? -19.856 0.021   -0.151  1.00 1.00 ? 89  ALA A HA   4  
ATOM 6405  H HB1  . ALA A 1 69  ? -16.925 -0.707  0.213   1.00 1.00 ? 89  ALA A HB1  4  
ATOM 6406  H HB2  . ALA A 1 69  ? -17.680 0.824   0.690   1.00 1.00 ? 89  ALA A HB2  4  
ATOM 6407  H HB3  . ALA A 1 69  ? -18.212 -0.685  1.421   1.00 1.00 ? 89  ALA A HB3  4  
ATOM 6408  N N    . ARG A 1 70  ? -19.104 1.670   -1.891  1.00 1.00 ? 90  ARG A N    4  
ATOM 6409  C CA   . ARG A 1 70  ? -19.063 2.529   -3.087  1.00 1.00 ? 90  ARG A CA   4  
ATOM 6410  C C    . ARG A 1 70  ? -17.954 3.573   -2.915  1.00 1.00 ? 90  ARG A C    4  
ATOM 6411  O O    . ARG A 1 70  ? -18.108 4.563   -2.198  1.00 1.00 ? 90  ARG A O    4  
ATOM 6412  C CB   . ARG A 1 70  ? -20.459 3.146   -3.340  1.00 1.00 ? 90  ARG A CB   4  
ATOM 6413  C CG   . ARG A 1 70  ? -21.594 2.110   -3.393  1.00 1.00 ? 90  ARG A CG   4  
ATOM 6414  C CD   . ARG A 1 70  ? -22.962 2.703   -3.754  1.00 1.00 ? 90  ARG A CD   4  
ATOM 6415  N NE   . ARG A 1 70  ? -24.082 1.775   -3.479  1.00 1.00 ? 90  ARG A NE   4  
ATOM 6416  C CZ   . ARG A 1 70  ? -24.280 0.549   -3.934  1.00 1.00 ? 90  ARG A CZ   4  
ATOM 6417  N NH1  . ARG A 1 70  ? -23.486 -0.012  -4.805  1.00 1.00 ? 90  ARG A NH1  4  
ATOM 6418  N NH2  . ARG A 1 70  ? -25.298 -0.137  -3.493  1.00 1.00 ? 90  ARG A NH2  4  
ATOM 6419  H H    . ARG A 1 70  ? -19.534 2.037   -1.054  1.00 1.00 ? 90  ARG A H    4  
ATOM 6420  H HA   . ARG A 1 70  ? -18.837 1.922   -3.962  1.00 1.00 ? 90  ARG A HA   4  
ATOM 6421  H HB2  . ARG A 1 70  ? -20.712 3.809   -2.512  1.00 0.00 ? 90  ARG A HB2  4  
ATOM 6422  H HB3  . ARG A 1 70  ? -20.437 3.713   -4.272  1.00 1.00 ? 90  ARG A HB3  4  
ATOM 6423  H HG2  . ARG A 1 70  ? -21.389 1.373   -4.170  1.00 0.00 ? 90  ARG A HG2  4  
ATOM 6424  H HG3  . ARG A 1 70  ? -21.679 1.598   -2.432  1.00 1.00 ? 90  ARG A HG3  4  
ATOM 6425  H HD2  . ARG A 1 70  ? -23.180 3.575   -3.137  1.00 0.00 ? 90  ARG A HD2  4  
ATOM 6426  H HD3  . ARG A 1 70  ? -22.985 3.014   -4.804  1.00 1.00 ? 90  ARG A HD3  4  
ATOM 6427  H HE   . ARG A 1 70  ? -24.779 2.100   -2.837  1.00 1.00 ? 90  ARG A HE   4  
ATOM 6428  H HH11 . ARG A 1 70  ? -22.669 0.502   -5.165  1.00 0.00 ? 90  ARG A HH11 4  
ATOM 6429  H HH12 . ARG A 1 70  ? -23.677 -0.969  -5.134  1.00 0.00 ? 90  ARG A HH12 4  
ATOM 6430  H HH21 . ARG A 1 70  ? -25.937 0.278   -2.799  1.00 0.00 ? 90  ARG A HH21 4  
ATOM 6431  H HH22 . ARG A 1 70  ? -25.464 -1.092  -3.839  1.00 0.00 ? 90  ARG A HH22 4  
ATOM 6432  N N    . PHE A 1 71  ? -16.851 3.371   -3.644  1.00 1.00 ? 91  PHE A N    4  
ATOM 6433  C CA   . PHE A 1 71  ? -15.691 4.270   -3.725  1.00 1.00 ? 91  PHE A CA   4  
ATOM 6434  C C    . PHE A 1 71  ? -15.956 5.475   -4.665  1.00 1.00 ? 91  PHE A C    4  
ATOM 6435  O O    . PHE A 1 71  ? -15.472 5.555   -5.804  1.00 1.00 ? 91  PHE A O    4  
ATOM 6436  C CB   . PHE A 1 71  ? -14.435 3.438   -4.052  1.00 1.00 ? 91  PHE A CB   4  
ATOM 6437  C CG   . PHE A 1 71  ? -13.223 3.470   -3.120  1.00 1.00 ? 91  PHE A CG   4  
ATOM 6438  C CD1  . PHE A 1 71  ? -12.997 4.521   -2.194  1.00 1.00 ? 91  PHE A CD1  4  
ATOM 6439  C CD2  . PHE A 1 71  ? -12.300 2.399   -3.185  1.00 1.00 ? 91  PHE A CD2  4  
ATOM 6440  C CE1  . PHE A 1 71  ? -11.870 4.491   -1.343  1.00 1.00 ? 91  PHE A CE1  4  
ATOM 6441  C CE2  . PHE A 1 71  ? -11.168 2.374   -2.342  1.00 1.00 ? 91  PHE A CE2  4  
ATOM 6442  C CZ   . PHE A 1 71  ? -10.949 3.425   -1.427  1.00 1.00 ? 91  PHE A CZ   4  
ATOM 6443  H H    . PHE A 1 71  ? -16.805 2.488   -4.131  1.00 1.00 ? 91  PHE A H    4  
ATOM 6444  H HA   . PHE A 1 71  ? -15.557 4.679   -2.725  1.00 1.00 ? 91  PHE A HA   4  
ATOM 6445  H HB2  . PHE A 1 71  ? -14.541 2.379   -3.816  1.00 0.00 ? 91  PHE A HB2  4  
ATOM 6446  H HB3  . PHE A 1 71  ? -14.154 3.469   -5.106  1.00 1.00 ? 91  PHE A HB3  4  
ATOM 6447  H HD1  . PHE A 1 71  ? -13.666 5.364   -2.118  1.00 1.00 ? 91  PHE A HD1  4  
ATOM 6448  H HD2  . PHE A 1 71  ? -12.448 1.601   -3.898  1.00 1.00 ? 91  PHE A HD2  4  
ATOM 6449  H HE1  . PHE A 1 71  ? -11.712 5.286   -0.625  1.00 1.00 ? 91  PHE A HE1  4  
ATOM 6450  H HE2  . PHE A 1 71  ? -10.465 1.556   -2.404  1.00 1.00 ? 91  PHE A HE2  4  
ATOM 6451  H HZ   . PHE A 1 71  ? -10.084 3.412   -0.779  1.00 1.00 ? 91  PHE A HZ   4  
ATOM 6452  N N    . ASN A 1 72  ? -16.792 6.383   -4.145  1.00 1.00 ? 92  ASN A N    4  
ATOM 6453  C CA   . ASN A 1 72  ? -17.159 7.710   -4.659  1.00 1.00 ? 92  ASN A CA   4  
ATOM 6454  C C    . ASN A 1 72  ? -16.816 8.809   -3.621  1.00 1.00 ? 92  ASN A C    4  
ATOM 6455  O O    . ASN A 1 72  ? -16.431 8.516   -2.490  1.00 1.00 ? 92  ASN A O    4  
ATOM 6456  C CB   . ASN A 1 72  ? -18.651 7.723   -5.069  1.00 1.00 ? 92  ASN A CB   4  
ATOM 6457  C CG   . ASN A 1 72  ? -19.657 7.598   -3.928  1.00 1.00 ? 92  ASN A CG   4  
ATOM 6458  O OD1  . ASN A 1 72  ? -19.750 8.426   -3.044  1.00 1.00 ? 92  ASN A OD1  4  
ATOM 6459  N ND2  . ASN A 1 72  ? -20.480 6.574   -3.902  1.00 1.00 ? 92  ASN A ND2  4  
ATOM 6460  H H    . ASN A 1 72  ? -17.140 6.165   -3.213  1.00 1.00 ? 92  ASN A H    4  
ATOM 6461  H HA   . ASN A 1 72  ? -16.562 7.923   -5.550  1.00 1.00 ? 92  ASN A HA   4  
ATOM 6462  H HB2  . ASN A 1 72  ? -18.969 8.702   -5.428  1.00 0.00 ? 92  ASN A HB2  4  
ATOM 6463  H HB3  . ASN A 1 72  ? -18.862 7.015   -5.865  1.00 1.00 ? 92  ASN A HB3  4  
ATOM 6464  H HD21 . ASN A 1 72  ? -20.442 5.866   -4.648  1.00 0.00 ? 92  ASN A HD21 4  
ATOM 6465  H HD22 . ASN A 1 72  ? -21.163 6.482   -3.137  1.00 0.00 ? 92  ASN A HD22 4  
ATOM 6466  N N    . ASP A 1 73  ? -16.934 10.080  -4.028  1.00 1.00 ? 93  ASP A N    4  
ATOM 6467  C CA   . ASP A 1 73  ? -16.778 11.342  -3.273  1.00 1.00 ? 93  ASP A CA   4  
ATOM 6468  C C    . ASP A 1 73  ? -15.400 11.632  -2.614  1.00 1.00 ? 93  ASP A C    4  
ATOM 6469  O O    . ASP A 1 73  ? -15.045 12.786  -2.375  1.00 1.00 ? 93  ASP A O    4  
ATOM 6470  C CB   . ASP A 1 73  ? -17.964 11.451  -2.310  1.00 1.00 ? 93  ASP A CB   4  
ATOM 6471  C CG   . ASP A 1 73  ? -18.512 12.878  -2.164  1.00 1.00 ? 93  ASP A CG   4  
ATOM 6472  O OD1  . ASP A 1 73  ? -18.741 13.541  -3.207  1.00 1.00 ? 93  ASP A OD1  4  
ATOM 6473  O OD2  . ASP A 1 73  ? -18.724 13.252  -0.980  1.00 1.00 ? 93  ASP A OD2  4  
ATOM 6474  H H    . ASP A 1 73  ? -17.236 10.184  -4.972  1.00 1.00 ? 93  ASP A H    4  
ATOM 6475  H HA   . ASP A 1 73  ? -16.924 12.137  -3.990  1.00 1.00 ? 93  ASP A HA   4  
ATOM 6476  H HB2  . ASP A 1 73  ? -18.824 10.850  -2.603  1.00 0.00 ? 93  ASP A HB2  4  
ATOM 6477  H HB3  . ASP A 1 73  ? -17.736 10.983  -1.347  1.00 1.00 ? 93  ASP A HB3  4  
ATOM 6478  N N    . LEU A 1 74  ? -14.627 10.562  -2.424  1.00 1.00 ? 94  LEU A N    4  
ATOM 6479  C CA   . LEU A 1 74  ? -13.367 10.354  -1.715  1.00 1.00 ? 94  LEU A CA   4  
ATOM 6480  C C    . LEU A 1 74  ? -12.260 11.405  -1.861  1.00 1.00 ? 94  LEU A C    4  
ATOM 6481  O O    . LEU A 1 74  ? -12.061 11.945  -2.957  1.00 1.00 ? 94  LEU A O    4  
ATOM 6482  C CB   . LEU A 1 74  ? -12.835 8.951   -2.076  1.00 1.00 ? 94  LEU A CB   4  
ATOM 6483  C CG   . LEU A 1 74  ? -12.286 8.643   -3.487  1.00 1.00 ? 94  LEU A CG   4  
ATOM 6484  C CD1  . LEU A 1 74  ? -11.145 7.625   -3.356  1.00 1.00 ? 94  LEU A CD1  4  
ATOM 6485  C CD2  . LEU A 1 74  ? -13.379 8.067   -4.395  1.00 1.00 ? 94  LEU A CD2  4  
ATOM 6486  H H    . LEU A 1 74  ? -15.158 9.731   -2.677  1.00 1.00 ? 94  LEU A H    4  
ATOM 6487  H HA   . LEU A 1 74  ? -13.642 10.341  -0.671  1.00 1.00 ? 94  LEU A HA   4  
ATOM 6488  H HB2  . LEU A 1 74  ? -11.866 8.766   -1.615  1.00 0.00 ? 94  LEU A HB2  4  
ATOM 6489  H HB3  . LEU A 1 74  ? -13.516 8.171   -1.738  1.00 1.00 ? 94  LEU A HB3  4  
ATOM 6490  H HG   . LEU A 1 74  ? -11.877 9.541   -3.951  1.00 1.00 ? 94  LEU A HG   4  
ATOM 6491  H HD11 . LEU A 1 74  ? -10.382 8.004   -2.678  1.00 1.00 ? 94  LEU A HD11 4  
ATOM 6492  H HD12 . LEU A 1 74  ? -11.518 6.679   -2.973  1.00 1.00 ? 94  LEU A HD12 4  
ATOM 6493  H HD13 . LEU A 1 74  ? -10.687 7.454   -4.333  1.00 1.00 ? 94  LEU A HD13 4  
ATOM 6494  H HD21 . LEU A 1 74  ? -13.881 7.238   -3.899  1.00 1.00 ? 94  LEU A HD21 4  
ATOM 6495  H HD22 . LEU A 1 74  ? -14.101 8.846   -4.637  1.00 1.00 ? 94  LEU A HD22 4  
ATOM 6496  H HD23 . LEU A 1 74  ? -12.938 7.698   -5.320  1.00 1.00 ? 94  LEU A HD23 4  
ATOM 6497  N N    . ARG A 1 75  ? -11.464 11.617  -0.780  1.00 1.00 ? 95  ARG A N    4  
ATOM 6498  C CA   . ARG A 1 75  ? -10.247 12.464  -0.928  1.00 1.00 ? 95  ARG A CA   4  
ATOM 6499  C C    . ARG A 1 75  ? -9.076  11.883  -0.146  1.00 1.00 ? 95  ARG A C    4  
ATOM 6500  O O    . ARG A 1 75  ? -9.235  11.639  1.040   1.00 1.00 ? 95  ARG A O    4  
ATOM 6501  C CB   . ARG A 1 75  ? -10.519 13.969  -0.665  1.00 1.00 ? 95  ARG A CB   4  
ATOM 6502  C CG   . ARG A 1 75  ? -9.523  14.734  0.221   1.00 1.00 ? 95  ARG A CG   4  
ATOM 6503  C CD   . ARG A 1 75  ? -9.721  16.253  0.241   1.00 1.00 ? 95  ARG A CD   4  
ATOM 6504  N NE   . ARG A 1 75  ? -9.024  16.850  1.403   1.00 1.00 ? 95  ARG A NE   4  
ATOM 6505  C CZ   . ARG A 1 75  ? -9.155  18.062  1.905   1.00 1.00 ? 95  ARG A CZ   4  
ATOM 6506  N NH1  . ARG A 1 75  ? -9.983  18.941  1.418   1.00 1.00 ? 95  ARG A NH1  4  
ATOM 6507  N NH2  . ARG A 1 75  ? -8.417  18.430  2.907   1.00 1.00 ? 95  ARG A NH2  4  
ATOM 6508  H H    . ARG A 1 75  ? -11.633 11.076  0.117   1.00 1.00 ? 95  ARG A H    4  
ATOM 6509  H HA   . ARG A 1 75  ? -9.946  12.419  -1.977  1.00 1.00 ? 95  ARG A HA   4  
ATOM 6510  H HB2  . ARG A 1 75  ? -10.315 14.595  -1.533  1.00 0.00 ? 95  ARG A HB2  4  
ATOM 6511  H HB3  . ARG A 1 75  ? -11.553 14.172  -0.389  1.00 1.00 ? 95  ARG A HB3  4  
ATOM 6512  H HG2  . ARG A 1 75  ? -9.634  14.422  1.259   1.00 0.00 ? 95  ARG A HG2  4  
ATOM 6513  H HG3  . ARG A 1 75  ? -8.506  14.529  -0.105  1.00 1.00 ? 95  ARG A HG3  4  
ATOM 6514  H HD2  . ARG A 1 75  ? -9.290  16.695  -0.656  1.00 0.00 ? 95  ARG A HD2  4  
ATOM 6515  H HD3  . ARG A 1 75  ? -10.786 16.487  0.278   1.00 1.00 ? 95  ARG A HD3  4  
ATOM 6516  H HE   . ARG A 1 75  ? -8.429  16.248  1.950   1.00 1.00 ? 95  ARG A HE   4  
ATOM 6517  H HH11 . ARG A 1 75  ? -10.570 18.702  0.607   1.00 0.00 ? 95  ARG A HH11 4  
ATOM 6518  H HH12 . ARG A 1 75  ? -10.050 19.876  1.844   1.00 0.00 ? 95  ARG A HH12 4  
ATOM 6519  H HH21 . ARG A 1 75  ? -7.730  17.777  3.308   1.00 0.00 ? 95  ARG A HH21 4  
ATOM 6520  H HH22 . ARG A 1 75  ? -8.518  19.377  3.300   1.00 0.00 ? 95  ARG A HH22 4  
ATOM 6521  N N    . PHE A 1 76  ? -7.919  11.728  -0.798  1.00 1.00 ? 96  PHE A N    4  
ATOM 6522  C CA   . PHE A 1 76  ? -6.641  11.271  -0.210  1.00 1.00 ? 96  PHE A CA   4  
ATOM 6523  C C    . PHE A 1 76  ? -5.536  12.322  -0.361  1.00 1.00 ? 96  PHE A C    4  
ATOM 6524  O O    . PHE A 1 76  ? -5.381  12.905  -1.431  1.00 1.00 ? 96  PHE A O    4  
ATOM 6525  C CB   . PHE A 1 76  ? -6.154  9.947   -0.828  1.00 1.00 ? 96  PHE A CB   4  
ATOM 6526  C CG   . PHE A 1 76  ? -6.333  9.679   -2.303  1.00 1.00 ? 96  PHE A CG   4  
ATOM 6527  C CD1  . PHE A 1 76  ? -7.572  9.214   -2.804  1.00 1.00 ? 96  PHE A CD1  4  
ATOM 6528  C CD2  . PHE A 1 76  ? -5.223  9.809   -3.164  1.00 1.00 ? 96  PHE A CD2  4  
ATOM 6529  C CE1  . PHE A 1 76  ? -7.698  8.878   -4.169  1.00 1.00 ? 96  PHE A CE1  4  
ATOM 6530  C CE2  . PHE A 1 76  ? -5.352  9.468   -4.523  1.00 1.00 ? 96  PHE A CE2  4  
ATOM 6531  C CZ   . PHE A 1 76  ? -6.583  8.991   -5.024  1.00 1.00 ? 96  PHE A CZ   4  
ATOM 6532  H H    . PHE A 1 76  ? -7.931  12.033  -1.765  1.00 1.00 ? 96  PHE A H    4  
ATOM 6533  H HA   . PHE A 1 76  ? -6.788  11.093  0.858   1.00 1.00 ? 96  PHE A HA   4  
ATOM 6534  H HB2  . PHE A 1 76  ? -5.069  9.884   -0.916  1.00 0.00 ? 96  PHE A HB2  4  
ATOM 6535  H HB3  . PHE A 1 76  ? -6.445  9.077   -0.258  1.00 1.00 ? 96  PHE A HB3  4  
ATOM 6536  H HD1  . PHE A 1 76  ? -8.416  9.098   -2.142  1.00 1.00 ? 96  PHE A HD1  4  
ATOM 6537  H HD2  . PHE A 1 76  ? -4.269  10.143  -2.784  1.00 1.00 ? 96  PHE A HD2  4  
ATOM 6538  H HE1  . PHE A 1 76  ? -8.640  8.540   -4.574  1.00 1.00 ? 96  PHE A HE1  4  
ATOM 6539  H HE2  . PHE A 1 76  ? -4.497  9.553   -5.172  1.00 1.00 ? 96  PHE A HE2  4  
ATOM 6540  H HZ   . PHE A 1 76  ? -6.677  8.719   -6.068  1.00 1.00 ? 96  PHE A HZ   4  
ATOM 6541  N N    . VAL A 1 77  ? -4.754  12.563  0.704   1.00 1.00 ? 97  VAL A N    4  
ATOM 6542  C CA   . VAL A 1 77  ? -3.607  13.503  0.723   1.00 1.00 ? 97  VAL A CA   4  
ATOM 6543  C C    . VAL A 1 77  ? -3.942  14.936  0.216   1.00 1.00 ? 97  VAL A C    4  
ATOM 6544  O O    . VAL A 1 77  ? -3.100  15.666  -0.310  1.00 1.00 ? 97  VAL A O    4  
ATOM 6545  C CB   . VAL A 1 77  ? -2.348  12.810  0.118   1.00 1.00 ? 97  VAL A CB   4  
ATOM 6546  C CG1  . VAL A 1 77  ? -2.271  12.681  -1.417  1.00 1.00 ? 97  VAL A CG1  4  
ATOM 6547  C CG2  . VAL A 1 77  ? -1.052  13.413  0.653   1.00 1.00 ? 97  VAL A CG2  4  
ATOM 6548  H H    . VAL A 1 77  ? -4.962  12.076  1.567   1.00 1.00 ? 97  VAL A H    4  
ATOM 6549  H HA   . VAL A 1 77  ? -3.376  13.649  1.778   1.00 1.00 ? 97  VAL A HA   4  
ATOM 6550  H HB   . VAL A 1 77  ? -2.349  11.794  0.498   1.00 1.00 ? 97  VAL A HB   4  
ATOM 6551  H HG11 . VAL A 1 77  ? -2.344  13.661  -1.887  1.00 1.00 ? 97  VAL A HG11 4  
ATOM 6552  H HG12 . VAL A 1 77  ? -1.327  12.219  -1.708  1.00 1.00 ? 97  VAL A HG12 4  
ATOM 6553  H HG13 . VAL A 1 77  ? -3.067  12.042  -1.787  1.00 1.00 ? 97  VAL A HG13 4  
ATOM 6554  H HG21 . VAL A 1 77  ? -1.080  13.448  1.742   1.00 1.00 ? 97  VAL A HG21 4  
ATOM 6555  H HG22 . VAL A 1 77  ? -0.223  12.770  0.361   1.00 1.00 ? 97  VAL A HG22 4  
ATOM 6556  H HG23 . VAL A 1 77  ? -0.907  14.417  0.261   1.00 1.00 ? 97  VAL A HG23 4  
ATOM 6557  N N    . GLY A 1 78  ? -5.206  15.356  0.411   1.00 1.00 ? 98  GLY A N    4  
ATOM 6558  C CA   . GLY A 1 78  ? -5.809  16.636  0.006   1.00 1.00 ? 98  GLY A CA   4  
ATOM 6559  C C    . GLY A 1 78  ? -5.287  17.837  0.811   1.00 1.00 ? 98  GLY A C    4  
ATOM 6560  O O    . GLY A 1 78  ? -6.010  18.371  1.656   1.00 1.00 ? 98  GLY A O    4  
ATOM 6561  H H    . GLY A 1 78  ? -5.787  14.658  0.854   1.00 1.00 ? 98  GLY A H    4  
ATOM 6562  H HA2  . GLY A 1 78  ? -5.614  16.817  -1.051  1.00 1.00 ? 98  GLY A HA2  4  
ATOM 6563  H HA3  . GLY A 1 78  ? -6.886  16.566  0.122   1.00 1.00 ? 98  GLY A HA3  4  
ATOM 6564  N N    . ARG A 1 79  ? -4.025  18.189  0.511   1.00 1.00 ? 99  ARG A N    4  
ATOM 6565  C CA   . ARG A 1 79  ? -3.070  19.193  1.043   1.00 1.00 ? 99  ARG A CA   4  
ATOM 6566  C C    . ARG A 1 79  ? -1.696  18.521  1.281   1.00 1.00 ? 99  ARG A C    4  
ATOM 6567  O O    . ARG A 1 79  ? -1.409  18.076  2.392   1.00 1.00 ? 99  ARG A O    4  
ATOM 6568  C CB   . ARG A 1 79  ? -3.579  19.934  2.307   1.00 1.00 ? 99  ARG A CB   4  
ATOM 6569  C CG   . ARG A 1 79  ? -4.374  21.210  1.982   1.00 1.00 ? 99  ARG A CG   4  
ATOM 6570  C CD   . ARG A 1 79  ? -4.163  22.310  3.038   1.00 1.00 ? 99  ARG A CD   4  
ATOM 6571  N NE   . ARG A 1 79  ? -5.408  22.873  3.595   1.00 1.00 ? 99  ARG A NE   4  
ATOM 6572  C CZ   . ARG A 1 79  ? -6.138  22.372  4.571   1.00 1.00 ? 99  ARG A CZ   4  
ATOM 6573  N NH1  . ARG A 1 79  ? -5.980  21.158  5.022   1.00 1.00 ? 99  ARG A NH1  4  
ATOM 6574  N NH2  . ARG A 1 79  ? -7.050  23.120  5.123   1.00 1.00 ? 99  ARG A NH2  4  
ATOM 6575  H H    . ARG A 1 79  ? -3.617  17.481  -0.102  1.00 1.00 ? 99  ARG A H    4  
ATOM 6576  H HA   . ARG A 1 79  ? -2.919  19.953  0.277   1.00 1.00 ? 99  ARG A HA   4  
ATOM 6577  H HB2  . ARG A 1 79  ? -4.281  19.308  2.857   1.00 0.00 ? 99  ARG A HB2  4  
ATOM 6578  H HB3  . ARG A 1 79  ? -2.741  20.181  2.966   1.00 1.00 ? 99  ARG A HB3  4  
ATOM 6579  H HG2  . ARG A 1 79  ? -3.997  21.645  1.056   1.00 0.00 ? 99  ARG A HG2  4  
ATOM 6580  H HG3  . ARG A 1 79  ? -5.429  20.959  1.866   1.00 1.00 ? 99  ARG A HG3  4  
ATOM 6581  H HD2  . ARG A 1 79  ? -3.672  21.900  3.919   1.00 0.00 ? 99  ARG A HD2  4  
ATOM 6582  H HD3  . ARG A 1 79  ? -3.538  23.110  2.632   1.00 1.00 ? 99  ARG A HD3  4  
ATOM 6583  H HE   . ARG A 1 79  ? -5.679  23.786  3.276   1.00 1.00 ? 99  ARG A HE   4  
ATOM 6584  H HH11 . ARG A 1 79  ? -5.259  20.546  4.613   1.00 0.00 ? 99  ARG A HH11 4  
ATOM 6585  H HH12 . ARG A 1 79  ? -6.577  20.811  5.787   1.00 0.00 ? 99  ARG A HH12 4  
ATOM 6586  H HH21 . ARG A 1 79  ? -7.192  24.086  4.795   1.00 0.00 ? 99  ARG A HH21 4  
ATOM 6587  H HH22 . ARG A 1 79  ? -7.630  22.745  5.888   1.00 0.00 ? 99  ARG A HH22 4  
ATOM 6588  N N    . SER A 1 80  ? -0.852  18.414  0.237   1.00 1.00 ? 100 SER A N    4  
ATOM 6589  C CA   . SER A 1 80  ? 0.548   17.945  0.374   1.00 1.00 ? 100 SER A CA   4  
ATOM 6590  C C    . SER A 1 80  ? 1.500   19.042  0.915   1.00 1.00 ? 100 SER A C    4  
ATOM 6591  O O    . SER A 1 80  ? 1.198   20.234  0.849   1.00 1.00 ? 100 SER A O    4  
ATOM 6592  C CB   . SER A 1 80  ? 1.081   17.372  -0.952  1.00 1.00 ? 100 SER A CB   4  
ATOM 6593  O OG   . SER A 1 80  ? 0.618   16.052  -1.174  1.00 1.00 ? 100 SER A OG   4  
ATOM 6594  H H    . SER A 1 80  ? -1.160  18.739  -0.666  1.00 1.00 ? 100 SER A H    4  
ATOM 6595  H HA   . SER A 1 80  ? 0.551   17.140  1.102   1.00 1.00 ? 100 SER A HA   4  
ATOM 6596  H HB2  . SER A 1 80  ? 0.751   17.979  -1.795  1.00 0.00 ? 100 SER A HB2  4  
ATOM 6597  H HB3  . SER A 1 80  ? 2.170   17.352  -0.954  1.00 1.00 ? 100 SER A HB3  4  
ATOM 6598  H HG   . SER A 1 80  ? 1.016   15.443  -0.523  1.00 1.00 ? 100 SER A HG   4  
ATOM 6599  N N    . GLY A 1 81  ? 2.674   18.624  1.418   1.00 1.00 ? 101 GLY A N    4  
ATOM 6600  C CA   . GLY A 1 81  ? 3.758   19.490  1.918   1.00 1.00 ? 101 GLY A CA   4  
ATOM 6601  C C    . GLY A 1 81  ? 5.160   18.856  2.085   1.00 1.00 ? 101 GLY A C    4  
ATOM 6602  O O    . GLY A 1 81  ? 6.140   19.600  2.040   1.00 1.00 ? 101 GLY A O    4  
ATOM 6603  H H    . GLY A 1 81  ? 2.801   17.616  1.459   1.00 1.00 ? 101 GLY A H    4  
ATOM 6604  H HA2  . GLY A 1 81  ? 3.863   20.350  1.253   1.00 1.00 ? 101 GLY A HA2  4  
ATOM 6605  H HA3  . GLY A 1 81  ? 3.460   19.883  2.890   1.00 1.00 ? 101 GLY A HA3  4  
ATOM 6606  N N    . ARG A 1 82  ? 5.267   17.519  2.251   1.00 1.00 ? 102 ARG A N    4  
ATOM 6607  C CA   . ARG A 1 82  ? 6.486   16.668  2.386   1.00 1.00 ? 102 ARG A CA   4  
ATOM 6608  C C    . ARG A 1 82  ? 6.137   15.225  2.813   1.00 1.00 ? 102 ARG A C    4  
ATOM 6609  O O    . ARG A 1 82  ? 5.163   14.991  3.524   1.00 1.00 ? 102 ARG A O    4  
ATOM 6610  C CB   . ARG A 1 82  ? 7.523   17.265  3.366   1.00 1.00 ? 102 ARG A CB   4  
ATOM 6611  C CG   . ARG A 1 82  ? 6.944   17.604  4.744   1.00 1.00 ? 102 ARG A CG   4  
ATOM 6612  C CD   . ARG A 1 82  ? 7.441   18.930  5.328   1.00 1.00 ? 102 ARG A CD   4  
ATOM 6613  N NE   . ARG A 1 82  ? 6.642   19.277  6.507   1.00 1.00 ? 102 ARG A NE   4  
ATOM 6614  C CZ   . ARG A 1 82  ? 6.202   20.430  6.952   1.00 1.00 ? 102 ARG A CZ   4  
ATOM 6615  N NH1  . ARG A 1 82  ? 6.526   21.571  6.419   1.00 1.00 ? 102 ARG A NH1  4  
ATOM 6616  N NH2  . ARG A 1 82  ? 5.395   20.426  7.967   1.00 1.00 ? 102 ARG A NH2  4  
ATOM 6617  H H    . ARG A 1 82  ? 4.386   17.008  2.286   1.00 1.00 ? 102 ARG A H    4  
ATOM 6618  H HA   . ARG A 1 82  ? 6.958   16.612  1.408   1.00 1.00 ? 102 ARG A HA   4  
ATOM 6619  H HB2  . ARG A 1 82  ? 8.273   16.521  3.634   1.00 0.00 ? 102 ARG A HB2  4  
ATOM 6620  H HB3  . ARG A 1 82  ? 8.034   18.117  2.915   1.00 1.00 ? 102 ARG A HB3  4  
ATOM 6621  H HG2  . ARG A 1 82  ? 5.869   17.772  4.670   1.00 0.00 ? 102 ARG A HG2  4  
ATOM 6622  H HG3  . ARG A 1 82  ? 7.123   16.784  5.439   1.00 1.00 ? 102 ARG A HG3  4  
ATOM 6623  H HD2  . ARG A 1 82  ? 8.488   18.822  5.612   1.00 0.00 ? 102 ARG A HD2  4  
ATOM 6624  H HD3  . ARG A 1 82  ? 7.340   19.710  4.571   1.00 1.00 ? 102 ARG A HD3  4  
ATOM 6625  H HE   . ARG A 1 82  ? 6.293   18.518  7.100   1.00 1.00 ? 102 ARG A HE   4  
ATOM 6626  H HH11 . ARG A 1 82  ? 7.157   21.597  5.604   1.00 0.00 ? 102 ARG A HH11 4  
ATOM 6627  H HH12 . ARG A 1 82  ? 6.152   22.447  6.809   1.00 0.00 ? 102 ARG A HH12 4  
ATOM 6628  H HH21 . ARG A 1 82  ? 5.116   19.536  8.399   1.00 0.00 ? 102 ARG A HH21 4  
ATOM 6629  H HH22 . ARG A 1 82  ? 5.033   21.316  8.340   1.00 0.00 ? 102 ARG A HH22 4  
ATOM 6630  N N    . GLY A 1 83  ? 6.965   14.256  2.393   1.00 1.00 ? 103 GLY A N    4  
ATOM 6631  C CA   . GLY A 1 83  ? 6.798   12.816  2.669   1.00 1.00 ? 103 GLY A CA   4  
ATOM 6632  C C    . GLY A 1 83  ? 5.622   12.140  1.941   1.00 1.00 ? 103 GLY A C    4  
ATOM 6633  O O    . GLY A 1 83  ? 4.820   11.461  2.578   1.00 1.00 ? 103 GLY A O    4  
ATOM 6634  H H    . GLY A 1 83  ? 7.797   14.566  1.917   1.00 1.00 ? 103 GLY A H    4  
ATOM 6635  H HA2  . GLY A 1 83  ? 7.714   12.294  2.390   1.00 1.00 ? 103 GLY A HA2  4  
ATOM 6636  H HA3  . GLY A 1 83  ? 6.658   12.673  3.742   1.00 1.00 ? 103 GLY A HA3  4  
ATOM 6637  N N    . LYS A 1 84  ? 5.552   12.277  0.602   1.00 1.00 ? 104 LYS A N    4  
ATOM 6638  C CA   . LYS A 1 84  ? 4.484   11.748  -0.273  1.00 1.00 ? 104 LYS A CA   4  
ATOM 6639  C C    . LYS A 1 84  ? 4.505   10.193  -0.353  1.00 1.00 ? 104 LYS A C    4  
ATOM 6640  O O    . LYS A 1 84  ? 5.188   9.604   -1.194  1.00 1.00 ? 104 LYS A O    4  
ATOM 6641  C CB   . LYS A 1 84  ? 4.592   12.375  -1.680  1.00 1.00 ? 104 LYS A CB   4  
ATOM 6642  C CG   . LYS A 1 84  ? 4.675   13.904  -1.822  1.00 1.00 ? 104 LYS A CG   4  
ATOM 6643  C CD   . LYS A 1 84  ? 6.036   14.595  -1.664  1.00 1.00 ? 104 LYS A CD   4  
ATOM 6644  C CE   . LYS A 1 84  ? 6.005   15.754  -2.655  1.00 1.00 ? 104 LYS A CE   4  
ATOM 6645  N NZ   . LYS A 1 84  ? 7.086   16.743  -2.492  1.00 1.00 ? 104 LYS A NZ   4  
ATOM 6646  H H    . LYS A 1 84  ? 6.235   12.886  0.181   1.00 1.00 ? 104 LYS A H    4  
ATOM 6647  H HA   . LYS A 1 84  ? 3.518   12.039  0.140   1.00 1.00 ? 104 LYS A HA   4  
ATOM 6648  H HB2  . LYS A 1 84  ? 5.514   12.006  -2.130  1.00 0.00 ? 104 LYS A HB2  4  
ATOM 6649  H HB3  . LYS A 1 84  ? 3.718   12.058  -2.245  1.00 1.00 ? 104 LYS A HB3  4  
ATOM 6650  H HG2  . LYS A 1 84  ? 4.549   14.236  -2.853  1.00 0.00 ? 104 LYS A HG2  4  
ATOM 6651  H HG3  . LYS A 1 84  ? 3.913   14.418  -1.244  1.00 1.00 ? 104 LYS A HG3  4  
ATOM 6652  H HD2  . LYS A 1 84  ? 6.188   14.901  -0.629  1.00 0.00 ? 104 LYS A HD2  4  
ATOM 6653  H HD3  . LYS A 1 84  ? 6.842   13.915  -1.948  1.00 1.00 ? 104 LYS A HD3  4  
ATOM 6654  H HE2  . LYS A 1 84  ? 6.200   15.399  -3.668  1.00 0.00 ? 104 LYS A HE2  4  
ATOM 6655  H HE3  . LYS A 1 84  ? 5.025   16.243  -2.646  1.00 1.00 ? 104 LYS A HE3  4  
ATOM 6656  H HZ1  . LYS A 1 84  ? 7.165   17.311  -3.348  1.00 0.00 ? 104 LYS A HZ1  4  
ATOM 6657  H HZ2  . LYS A 1 84  ? 6.874   17.356  -1.691  1.00 0.00 ? 104 LYS A HZ2  4  
ATOM 6658  N N    . SER A 1 85  ? 3.727   9.554   0.534   1.00 1.00 ? 105 SER A N    4  
ATOM 6659  C CA   . SER A 1 85  ? 3.589   8.095   0.804   1.00 1.00 ? 105 SER A CA   4  
ATOM 6660  C C    . SER A 1 85  ? 2.146   7.560   0.645   1.00 1.00 ? 105 SER A C    4  
ATOM 6661  O O    . SER A 1 85  ? 1.214   8.350   0.557   1.00 1.00 ? 105 SER A O    4  
ATOM 6662  C CB   . SER A 1 85  ? 4.173   7.737   2.179   1.00 1.00 ? 105 SER A CB   4  
ATOM 6663  O OG   . SER A 1 85  ? 4.443   6.348   2.223   1.00 1.00 ? 105 SER A OG   4  
ATOM 6664  H H    . SER A 1 85  ? 3.223   10.180  1.158   1.00 1.00 ? 105 SER A H    4  
ATOM 6665  H HA   . SER A 1 85  ? 4.202   7.578   0.064   1.00 1.00 ? 105 SER A HA   4  
ATOM 6666  H HB2  . SER A 1 85  ? 5.108   8.269   2.357   1.00 0.00 ? 105 SER A HB2  4  
ATOM 6667  H HB3  . SER A 1 85  ? 3.478   8.002   2.981   1.00 1.00 ? 105 SER A HB3  4  
ATOM 6668  H HG   . SER A 1 85  ? 5.394   6.221   2.296   1.00 1.00 ? 105 SER A HG   4  
ATOM 6669  N N    . PHE A 1 86  ? 1.940   6.240   0.476   1.00 1.00 ? 106 PHE A N    4  
ATOM 6670  C CA   . PHE A 1 86  ? 0.615   5.612   0.250   1.00 1.00 ? 106 PHE A CA   4  
ATOM 6671  C C    . PHE A 1 86  ? 0.255   4.426   1.185   1.00 1.00 ? 106 PHE A C    4  
ATOM 6672  O O    . PHE A 1 86  ? 0.493   3.264   0.850   1.00 1.00 ? 106 PHE A O    4  
ATOM 6673  C CB   . PHE A 1 86  ? 0.420   5.292   -1.243  1.00 1.00 ? 106 PHE A CB   4  
ATOM 6674  C CG   . PHE A 1 86  ? 1.488   4.493   -1.976  1.00 1.00 ? 106 PHE A CG   4  
ATOM 6675  C CD1  . PHE A 1 86  ? 2.574   5.163   -2.583  1.00 1.00 ? 106 PHE A CD1  4  
ATOM 6676  C CD2  . PHE A 1 86  ? 1.373   3.089   -2.100  1.00 1.00 ? 106 PHE A CD2  4  
ATOM 6677  C CE1  . PHE A 1 86  ? 3.545   4.434   -3.306  1.00 1.00 ? 106 PHE A CE1  4  
ATOM 6678  C CE2  . PHE A 1 86  ? 2.340   2.360   -2.828  1.00 1.00 ? 106 PHE A CE2  4  
ATOM 6679  C CZ   . PHE A 1 86  ? 3.423   3.034   -3.431  1.00 1.00 ? 106 PHE A CZ   4  
ATOM 6680  H H    . PHE A 1 86  ? 2.747   5.638   0.584   1.00 1.00 ? 106 PHE A H    4  
ATOM 6681  H HA   . PHE A 1 86  ? -0.149  6.360   0.456   1.00 1.00 ? 106 PHE A HA   4  
ATOM 6682  H HB2  . PHE A 1 86  ? -0.401  4.586   -1.374  1.00 0.00 ? 106 PHE A HB2  4  
ATOM 6683  H HB3  . PHE A 1 86  ? 0.191   6.204   -1.797  1.00 1.00 ? 106 PHE A HB3  4  
ATOM 6684  H HD1  . PHE A 1 86  ? 2.657   6.237   -2.484  1.00 1.00 ? 106 PHE A HD1  4  
ATOM 6685  H HD2  . PHE A 1 86  ? 0.557   2.566   -1.619  1.00 1.00 ? 106 PHE A HD2  4  
ATOM 6686  H HE1  . PHE A 1 86  ? 4.385   4.938   -3.760  1.00 1.00 ? 106 PHE A HE1  4  
ATOM 6687  H HE2  . PHE A 1 86  ? 2.263   1.287   -2.918  1.00 1.00 ? 106 PHE A HE2  4  
ATOM 6688  H HZ   . PHE A 1 86  ? 4.168   2.477   -3.983  1.00 1.00 ? 106 PHE A HZ   4  
ATOM 6689  N N    . THR A 1 87  ? -0.387  4.713   2.336   1.00 1.00 ? 107 THR A N    4  
ATOM 6690  C CA   . THR A 1 87  ? -0.949  3.720   3.292   1.00 1.00 ? 107 THR A CA   4  
ATOM 6691  C C    . THR A 1 87  ? -2.482  3.604   3.117   1.00 1.00 ? 107 THR A C    4  
ATOM 6692  O O    . THR A 1 87  ? -3.270  4.146   3.898   1.00 1.00 ? 107 THR A O    4  
ATOM 6693  C CB   . THR A 1 87  ? -0.556  4.008   4.767   1.00 1.00 ? 107 THR A CB   4  
ATOM 6694  O OG1  . THR A 1 87  ? 0.839   4.178   4.893   1.00 1.00 ? 107 THR A OG1  4  
ATOM 6695  C CG2  . THR A 1 87  ? -0.948  2.871   5.721   1.00 1.00 ? 107 THR A CG2  4  
ATOM 6696  H H    . THR A 1 87  ? -0.519  5.688   2.602   1.00 1.00 ? 107 THR A H    4  
ATOM 6697  H HA   . THR A 1 87  ? -0.519  2.745   3.062   1.00 1.00 ? 107 THR A HA   4  
ATOM 6698  H HB   . THR A 1 87  ? -1.042  4.913   5.119   1.00 1.00 ? 107 THR A HB   4  
ATOM 6699  H HG1  . THR A 1 87  ? 0.992   5.094   5.227   1.00 1.00 ? 107 THR A HG1  4  
ATOM 6700  H HG21 . THR A 1 87  ? -0.517  1.927   5.386   1.00 1.00 ? 107 THR A HG21 4  
ATOM 6701  H HG22 . THR A 1 87  ? -0.593  3.090   6.729   1.00 1.00 ? 107 THR A HG22 4  
ATOM 6702  H HG23 . THR A 1 87  ? -2.033  2.776   5.765   1.00 1.00 ? 107 THR A HG23 4  
ATOM 6703  N N    . LEU A 1 88  ? -2.937  2.891   2.072   1.00 1.00 ? 108 LEU A N    4  
ATOM 6704  C CA   . LEU A 1 88  ? -4.354  2.559   1.839   1.00 1.00 ? 108 LEU A CA   4  
ATOM 6705  C C    . LEU A 1 88  ? -4.736  1.328   2.692   1.00 1.00 ? 108 LEU A C    4  
ATOM 6706  O O    . LEU A 1 88  ? -4.525  0.190   2.264   1.00 1.00 ? 108 LEU A O    4  
ATOM 6707  C CB   . LEU A 1 88  ? -4.572  2.368   0.322   1.00 1.00 ? 108 LEU A CB   4  
ATOM 6708  C CG   . LEU A 1 88  ? -5.999  2.483   -0.254  1.00 1.00 ? 108 LEU A CG   4  
ATOM 6709  C CD1  . LEU A 1 88  ? -6.999  1.490   0.358   1.00 1.00 ? 108 LEU A CD1  4  
ATOM 6710  C CD2  . LEU A 1 88  ? -6.531  3.902   -0.121  1.00 1.00 ? 108 LEU A CD2  4  
ATOM 6711  H H    . LEU A 1 88  ? -2.252  2.467   1.460   1.00 1.00 ? 108 LEU A H    4  
ATOM 6712  H HA   . LEU A 1 88  ? -4.963  3.404   2.166   1.00 1.00 ? 108 LEU A HA   4  
ATOM 6713  H HB2  . LEU A 1 88  ? -4.138  3.199   -0.233  1.00 0.00 ? 108 LEU A HB2  4  
ATOM 6714  H HB3  . LEU A 1 88  ? -4.103  1.446   -0.017  1.00 1.00 ? 108 LEU A HB3  4  
ATOM 6715  H HG   . LEU A 1 88  ? -5.934  2.291   -1.322  1.00 1.00 ? 108 LEU A HG   4  
ATOM 6716  H HD11 . LEU A 1 88  ? -6.593  0.478   0.327   1.00 1.00 ? 108 LEU A HD11 4  
ATOM 6717  H HD12 . LEU A 1 88  ? -7.215  1.747   1.397   1.00 1.00 ? 108 LEU A HD12 4  
ATOM 6718  H HD13 . LEU A 1 88  ? -7.932  1.509   -0.206  1.00 1.00 ? 108 LEU A HD13 4  
ATOM 6719  H HD21 . LEU A 1 88  ? -5.828  4.619   -0.540  1.00 1.00 ? 108 LEU A HD21 4  
ATOM 6720  H HD22 . LEU A 1 88  ? -7.481  3.991   -0.650  1.00 1.00 ? 108 LEU A HD22 4  
ATOM 6721  H HD23 . LEU A 1 88  ? -6.680  4.116   0.930   1.00 1.00 ? 108 LEU A HD23 4  
ATOM 6722  N N    . THR A 1 89  ? -5.261  1.556   3.911   1.00 1.00 ? 109 THR A N    4  
ATOM 6723  C CA   . THR A 1 89  ? -5.515  0.496   4.918   1.00 1.00 ? 109 THR A CA   4  
ATOM 6724  C C    . THR A 1 89  ? -6.996  0.297   5.298   1.00 1.00 ? 109 THR A C    4  
ATOM 6725  O O    . THR A 1 89  ? -7.692  1.210   5.748   1.00 1.00 ? 109 THR A O    4  
ATOM 6726  C CB   . THR A 1 89  ? -4.588  0.652   6.141   1.00 1.00 ? 109 THR A CB   4  
ATOM 6727  O OG1  . THR A 1 89  ? -4.501  -0.587  6.808   1.00 1.00 ? 109 THR A OG1  4  
ATOM 6728  C CG2  . THR A 1 89  ? -4.986  1.733   7.153   1.00 1.00 ? 109 THR A CG2  4  
ATOM 6729  H H    . THR A 1 89  ? -5.464  2.525   4.163   1.00 1.00 ? 109 THR A H    4  
ATOM 6730  H HA   . THR A 1 89  ? -5.201  -0.441  4.464   1.00 1.00 ? 109 THR A HA   4  
ATOM 6731  H HB   . THR A 1 89  ? -3.586  0.890   5.781   1.00 1.00 ? 109 THR A HB   4  
ATOM 6732  H HG1  . THR A 1 89  ? -3.799  -1.111  6.350   1.00 1.00 ? 109 THR A HG1  4  
ATOM 6733  H HG21 . THR A 1 89  ? -5.143  2.679   6.636   1.00 1.00 ? 109 THR A HG21 4  
ATOM 6734  H HG22 . THR A 1 89  ? -5.902  1.454   7.673   1.00 1.00 ? 109 THR A HG22 4  
ATOM 6735  H HG23 . THR A 1 89  ? -4.190  1.855   7.889   1.00 1.00 ? 109 THR A HG23 4  
ATOM 6736  N N    . ILE A 1 90  ? -7.502  -0.928  5.102   1.00 1.00 ? 110 ILE A N    4  
ATOM 6737  C CA   . ILE A 1 90  ? -8.895  -1.314  5.356   1.00 1.00 ? 110 ILE A CA   4  
ATOM 6738  C C    . ILE A 1 90  ? -8.974  -2.022  6.714   1.00 1.00 ? 110 ILE A C    4  
ATOM 6739  O O    . ILE A 1 90  ? -8.428  -3.113  6.883   1.00 1.00 ? 110 ILE A O    4  
ATOM 6740  C CB   . ILE A 1 90  ? -9.461  -2.182  4.205   1.00 1.00 ? 110 ILE A CB   4  
ATOM 6741  C CG1  . ILE A 1 90  ? -9.359  -1.503  2.819   1.00 1.00 ? 110 ILE A CG1  4  
ATOM 6742  C CG2  . ILE A 1 90  ? -10.954 -2.482  4.433   1.00 1.00 ? 110 ILE A CG2  4  
ATOM 6743  C CD1  . ILE A 1 90  ? -8.096  -1.800  2.004   1.00 1.00 ? 110 ILE A CD1  4  
ATOM 6744  H H    . ILE A 1 90  ? -6.880  -1.678  4.804   1.00 1.00 ? 110 ILE A H    4  
ATOM 6745  H HA   . ILE A 1 90  ? -9.501  -0.411  5.398   1.00 1.00 ? 110 ILE A HA   4  
ATOM 6746  H HB   . ILE A 1 90  ? -8.931  -3.139  4.177   1.00 1.00 ? 110 ILE A HB   4  
ATOM 6747  H HG12 . ILE A 1 90  ? -10.101 -1.903  2.128   1.00 0.00 ? 110 ILE A HG12 4  
ATOM 6748  H HG13 . ILE A 1 90  ? -9.523  -0.428  2.894   1.00 1.00 ? 110 ILE A HG13 4  
ATOM 6749  H HG21 . ILE A 1 90  ? -11.533 -1.560  4.502   1.00 1.00 ? 110 ILE A HG21 4  
ATOM 6750  H HG22 . ILE A 1 90  ? -11.337 -3.081  3.604   1.00 1.00 ? 110 ILE A HG22 4  
ATOM 6751  H HG23 . ILE A 1 90  ? -11.089 -3.051  5.355   1.00 1.00 ? 110 ILE A HG23 4  
ATOM 6752  H HD11 . ILE A 1 90  ? -7.952  -2.877  1.939   1.00 1.00 ? 110 ILE A HD11 4  
ATOM 6753  H HD12 . ILE A 1 90  ? -8.218  -1.396  0.998   1.00 1.00 ? 110 ILE A HD12 4  
ATOM 6754  H HD13 . ILE A 1 90  ? -7.223  -1.338  2.465   1.00 1.00 ? 110 ILE A HD13 4  
ATOM 6755  N N    . THR A 1 91  ? -9.670  -1.384  7.659   1.00 1.00 ? 111 THR A N    4  
ATOM 6756  C CA   . THR A 1 91  ? -9.894  -1.828  9.057   1.00 1.00 ? 111 THR A CA   4  
ATOM 6757  C C    . THR A 1 91  ? -11.288 -2.462  9.278   1.00 1.00 ? 111 THR A C    4  
ATOM 6758  O O    . THR A 1 91  ? -12.291 -1.751  9.287   1.00 1.00 ? 111 THR A O    4  
ATOM 6759  C CB   . THR A 1 91  ? -9.717  -0.648  10.053  1.00 1.00 ? 111 THR A CB   4  
ATOM 6760  O OG1  . THR A 1 91  ? -8.485  0.019   9.867   1.00 1.00 ? 111 THR A OG1  4  
ATOM 6761  C CG2  . THR A 1 91  ? -9.733  -1.097  11.523  1.00 1.00 ? 111 THR A CG2  4  
ATOM 6762  H H    . THR A 1 91  ? -10.029 -0.461  7.351   1.00 1.00 ? 111 THR A H    4  
ATOM 6763  H HA   . THR A 1 91  ? -9.137  -2.570  9.306   1.00 1.00 ? 111 THR A HA   4  
ATOM 6764  H HB   . THR A 1 91  ? -10.519 0.076   9.897   1.00 1.00 ? 111 THR A HB   4  
ATOM 6765  H HG1  . THR A 1 91  ? -7.781  -0.567  10.150  1.00 1.00 ? 111 THR A HG1  4  
ATOM 6766  H HG21 . THR A 1 91  ? -10.674 -1.594  11.761  1.00 1.00 ? 111 THR A HG21 4  
ATOM 6767  H HG22 . THR A 1 91  ? -8.909  -1.782  11.729  1.00 1.00 ? 111 THR A HG22 4  
ATOM 6768  H HG23 . THR A 1 91  ? -9.646  -0.225  12.175  1.00 1.00 ? 111 THR A HG23 4  
ATOM 6769  N N    . VAL A 1 92  ? -11.389 -3.784  9.500   1.00 1.00 ? 112 VAL A N    4  
ATOM 6770  C CA   . VAL A 1 92  ? -12.642 -4.464  9.915   1.00 1.00 ? 112 VAL A CA   4  
ATOM 6771  C C    . VAL A 1 92  ? -12.877 -4.183  11.411  1.00 1.00 ? 112 VAL A C    4  
ATOM 6772  O O    . VAL A 1 92  ? -12.251 -4.757  12.296  1.00 1.00 ? 112 VAL A O    4  
ATOM 6773  C CB   . VAL A 1 92  ? -12.666 -5.972  9.598   1.00 1.00 ? 112 VAL A CB   4  
ATOM 6774  C CG1  . VAL A 1 92  ? -13.843 -6.728  10.227  1.00 1.00 ? 112 VAL A CG1  4  
ATOM 6775  C CG2  . VAL A 1 92  ? -12.689 -6.225  8.081   1.00 1.00 ? 112 VAL A CG2  4  
ATOM 6776  H H    . VAL A 1 92  ? -10.565 -4.375  9.403   1.00 1.00 ? 112 VAL A H    4  
ATOM 6777  H HA   . VAL A 1 92  ? -13.468 -4.034  9.350   1.00 1.00 ? 112 VAL A HA   4  
ATOM 6778  H HB   . VAL A 1 92  ? -11.775 -6.398  10.020  1.00 1.00 ? 112 VAL A HB   4  
ATOM 6779  H HG11 . VAL A 1 92  ? -14.796 -6.326  9.884   1.00 1.00 ? 112 VAL A HG11 4  
ATOM 6780  H HG12 . VAL A 1 92  ? -13.774 -7.788  9.982   1.00 1.00 ? 112 VAL A HG12 4  
ATOM 6781  H HG13 . VAL A 1 92  ? -13.797 -6.659  11.310  1.00 1.00 ? 112 VAL A HG13 4  
ATOM 6782  H HG21 . VAL A 1 92  ? -11.894 -5.671  7.582   1.00 1.00 ? 112 VAL A HG21 4  
ATOM 6783  H HG22 . VAL A 1 92  ? -12.550 -7.283  7.867   1.00 1.00 ? 112 VAL A HG22 4  
ATOM 6784  H HG23 . VAL A 1 92  ? -13.644 -5.909  7.673   1.00 1.00 ? 112 VAL A HG23 4  
ATOM 6785  N N    . PHE A 1 93  ? -13.810 -3.267  11.622  1.00 1.00 ? 113 PHE A N    4  
ATOM 6786  C CA   . PHE A 1 93  ? -14.363 -2.601  12.811  1.00 1.00 ? 113 PHE A CA   4  
ATOM 6787  C C    . PHE A 1 93  ? -14.987 -3.508  13.908  1.00 1.00 ? 113 PHE A C    4  
ATOM 6788  O O    . PHE A 1 93  ? -15.537 -2.985  14.877  1.00 1.00 ? 113 PHE A O    4  
ATOM 6789  C CB   . PHE A 1 93  ? -15.408 -1.633  12.222  1.00 1.00 ? 113 PHE A CB   4  
ATOM 6790  C CG   . PHE A 1 93  ? -15.907 -0.425  13.002  1.00 1.00 ? 113 PHE A CG   4  
ATOM 6791  C CD1  . PHE A 1 93  ? -14.998 0.524   13.527  1.00 1.00 ? 113 PHE A CD1  4  
ATOM 6792  C CD2  . PHE A 1 93  ? -17.300 -0.187  13.110  1.00 1.00 ? 113 PHE A CD2  4  
ATOM 6793  C CE1  . PHE A 1 93  ? -15.479 1.692   14.160  1.00 1.00 ? 113 PHE A CE1  4  
ATOM 6794  C CE2  . PHE A 1 93  ? -17.780 0.983   13.737  1.00 1.00 ? 113 PHE A CE2  4  
ATOM 6795  C CZ   . PHE A 1 93  ? -16.869 1.923   14.264  1.00 1.00 ? 113 PHE A CZ   4  
ATOM 6796  H H    . PHE A 1 93  ? -14.132 -2.947  10.727  1.00 1.00 ? 113 PHE A H    4  
ATOM 6797  H HA   . PHE A 1 93  ? -13.575 -2.018  13.280  1.00 1.00 ? 113 PHE A HA   4  
ATOM 6798  H HB2  . PHE A 1 93  ? -14.954 -1.037  11.432  1.00 0.00 ? 113 PHE A HB2  4  
ATOM 6799  H HB3  . PHE A 1 93  ? -16.244 -2.198  11.810  1.00 1.00 ? 113 PHE A HB3  4  
ATOM 6800  H HD1  . PHE A 1 93  ? -13.934 0.367   13.431  1.00 1.00 ? 113 PHE A HD1  4  
ATOM 6801  H HD2  . PHE A 1 93  ? -18.004 -0.894  12.696  1.00 1.00 ? 113 PHE A HD2  4  
ATOM 6802  H HE1  . PHE A 1 93  ? -14.784 2.414   14.561  1.00 1.00 ? 113 PHE A HE1  4  
ATOM 6803  H HE2  . PHE A 1 93  ? -18.843 1.160   13.809  1.00 1.00 ? 113 PHE A HE2  4  
ATOM 6804  H HZ   . PHE A 1 93  ? -17.235 2.818   14.747  1.00 1.00 ? 113 PHE A HZ   4  
ATOM 6805  N N    . THR A 1 94  ? -14.929 -4.843  13.762  1.00 1.00 ? 114 THR A N    4  
ATOM 6806  C CA   . THR A 1 94  ? -15.524 -5.868  14.662  1.00 1.00 ? 114 THR A CA   4  
ATOM 6807  C C    . THR A 1 94  ? -14.639 -6.227  15.880  1.00 1.00 ? 114 THR A C    4  
ATOM 6808  O O    . THR A 1 94  ? -13.524 -5.720  15.995  1.00 1.00 ? 114 THR A O    4  
ATOM 6809  C CB   . THR A 1 94  ? -15.882 -7.153  13.871  1.00 1.00 ? 114 THR A CB   4  
ATOM 6810  O OG1  . THR A 1 94  ? -14.758 -7.827  13.330  1.00 1.00 ? 114 THR A OG1  4  
ATOM 6811  C CG2  . THR A 1 94  ? -16.853 -6.900  12.709  1.00 1.00 ? 114 THR A CG2  4  
ATOM 6812  H H    . THR A 1 94  ? -14.350 -5.165  12.998  1.00 1.00 ? 114 THR A H    4  
ATOM 6813  H HA   . THR A 1 94  ? -16.454 -5.462  15.060  1.00 1.00 ? 114 THR A HA   4  
ATOM 6814  H HB   . THR A 1 94  ? -16.381 -7.841  14.559  1.00 1.00 ? 114 THR A HB   4  
ATOM 6815  H HG1  . THR A 1 94  ? -13.913 -7.585  13.753  1.00 1.00 ? 114 THR A HG1  4  
ATOM 6816  H HG21 . THR A 1 94  ? -17.768 -6.430  13.073  1.00 1.00 ? 114 THR A HG21 4  
ATOM 6817  H HG22 . THR A 1 94  ? -16.401 -6.253  11.956  1.00 1.00 ? 114 THR A HG22 4  
ATOM 6818  H HG23 . THR A 1 94  ? -17.122 -7.848  12.237  1.00 1.00 ? 114 THR A HG23 4  
ATOM 6819  N N    . ASN A 1 95  ? -15.107 -7.128  16.778  1.00 1.00 ? 115 ASN A N    4  
ATOM 6820  C CA   . ASN A 1 95  ? -14.312 -7.701  17.893  1.00 1.00 ? 115 ASN A CA   4  
ATOM 6821  C C    . ASN A 1 95  ? -12.907 -8.115  17.379  1.00 1.00 ? 115 ASN A C    4  
ATOM 6822  O O    . ASN A 1 95  ? -11.917 -7.664  17.955  1.00 1.00 ? 115 ASN A O    4  
ATOM 6823  C CB   . ASN A 1 95  ? -15.046 -8.882  18.571  1.00 1.00 ? 115 ASN A CB   4  
ATOM 6824  C CG   . ASN A 1 95  ? -16.327 -8.558  19.333  1.00 1.00 ? 115 ASN A CG   4  
ATOM 6825  O OD1  . ASN A 1 95  ? -16.865 -7.466  19.323  1.00 1.00 ? 115 ASN A OD1  4  
ATOM 6826  N ND2  . ASN A 1 95  ? -16.877 -9.523  20.035  1.00 1.00 ? 115 ASN A ND2  4  
ATOM 6827  H H    . ASN A 1 95  ? -16.048 -7.470  16.669  1.00 1.00 ? 115 ASN A H    4  
ATOM 6828  H HA   . ASN A 1 95  ? -14.159 -6.913  18.636  1.00 1.00 ? 115 ASN A HA   4  
ATOM 6829  H HB2  . ASN A 1 95  ? -15.369 -9.584  17.803  1.00 0.00 ? 115 ASN A HB2  4  
ATOM 6830  H HB3  . ASN A 1 95  ? -14.360 -9.373  19.263  1.00 1.00 ? 115 ASN A HB3  4  
ATOM 6831  H HD21 . ASN A 1 95  ? -16.442 -10.456 20.056  1.00 0.00 ? 115 ASN A HD21 4  
ATOM 6832  H HD22 . ASN A 1 95  ? -17.743 -9.347  20.563  1.00 0.00 ? 115 ASN A HD22 4  
ATOM 6833  N N    . PRO A 1 96  ? -12.805 -8.960  16.322  1.00 1.00 ? 116 PRO A N    4  
ATOM 6834  C CA   . PRO A 1 96  ? -11.555 -9.215  15.612  1.00 1.00 ? 116 PRO A CA   4  
ATOM 6835  C C    . PRO A 1 96  ? -11.247 -7.977  14.722  1.00 1.00 ? 116 PRO A C    4  
ATOM 6836  O O    . PRO A 1 96  ? -12.052 -7.665  13.829  1.00 1.00 ? 116 PRO A O    4  
ATOM 6837  C CB   . PRO A 1 96  ? -11.780 -10.470 14.760  1.00 1.00 ? 116 PRO A CB   4  
ATOM 6838  C CG   . PRO A 1 96  ? -13.294 -10.497 14.544  1.00 1.00 ? 116 PRO A CG   4  
ATOM 6839  C CD   . PRO A 1 96  ? -13.876 -9.784  15.765  1.00 1.00 ? 116 PRO A CD   4  
ATOM 6840  H HA   . PRO A 1 96  ? -10.749 -9.410  16.318  1.00 1.00 ? 116 PRO A HA   4  
ATOM 6841  H HB2  . PRO A 1 96  ? -11.241 -10.400 13.815  1.00 0.00 ? 116 PRO A HB2  4  
ATOM 6842  H HB3  . PRO A 1 96  ? -11.485 -11.353 15.333  1.00 1.00 ? 116 PRO A HB3  4  
ATOM 6843  H HG2  . PRO A 1 96  ? -13.574 -9.975  13.628  1.00 0.00 ? 116 PRO A HG2  4  
ATOM 6844  H HG3  . PRO A 1 96  ? -13.667 -11.520 14.467  1.00 1.00 ? 116 PRO A HG3  4  
ATOM 6845  H HD2  . PRO A 1 96  ? -14.724 -9.147  15.519  1.00 0.00 ? 116 PRO A HD2  4  
ATOM 6846  H HD3  . PRO A 1 96  ? -14.173 -10.529 16.506  1.00 1.00 ? 116 PRO A HD3  4  
ATOM 6847  N N    . PRO A 1 97  ? -10.127 -7.244  14.959  1.00 1.00 ? 117 PRO A N    4  
ATOM 6848  C CA   . PRO A 1 97  ? -9.662  -6.143  14.109  1.00 1.00 ? 117 PRO A CA   4  
ATOM 6849  C C    . PRO A 1 97  ? -9.061  -6.737  12.820  1.00 1.00 ? 117 PRO A C    4  
ATOM 6850  O O    . PRO A 1 97  ? -7.872  -7.097  12.801  1.00 1.00 ? 117 PRO A O    4  
ATOM 6851  C CB   . PRO A 1 97  ? -8.616  -5.377  14.936  1.00 1.00 ? 117 PRO A CB   4  
ATOM 6852  C CG   . PRO A 1 97  ? -8.031  -6.464  15.838  1.00 1.00 ? 117 PRO A CG   4  
ATOM 6853  C CD   . PRO A 1 97  ? -9.154  -7.483  16.021  1.00 1.00 ? 117 PRO A CD   4  
ATOM 6854  H HA   . PRO A 1 97  ? -10.494 -5.474  13.872  1.00 1.00 ? 117 PRO A HA   4  
ATOM 6855  H HB2  . PRO A 1 97  ? -7.858  -4.929  14.295  1.00 0.00 ? 117 PRO A HB2  4  
ATOM 6856  H HB3  . PRO A 1 97  ? -9.120  -4.623  15.545  1.00 1.00 ? 117 PRO A HB3  4  
ATOM 6857  H HG2  . PRO A 1 97  ? -7.167  -6.943  15.378  1.00 0.00 ? 117 PRO A HG2  4  
ATOM 6858  H HG3  . PRO A 1 97  ? -7.706  -6.058  16.794  1.00 1.00 ? 117 PRO A HG3  4  
ATOM 6859  H HD2  . PRO A 1 97  ? -8.786  -8.508  15.956  1.00 0.00 ? 117 PRO A HD2  4  
ATOM 6860  H HD3  . PRO A 1 97  ? -9.626  -7.333  16.992  1.00 1.00 ? 117 PRO A HD3  4  
ATOM 6861  N N    . GLN A 1 98  ? -9.853  -6.853  11.740  1.00 1.00 ? 118 GLN A N    4  
ATOM 6862  C CA   . GLN A 1 98  ? -9.400  -7.563  10.524  1.00 1.00 ? 118 GLN A CA   4  
ATOM 6863  C C    . GLN A 1 98  ? -8.901  -6.476  9.568   1.00 1.00 ? 118 GLN A C    4  
ATOM 6864  O O    . GLN A 1 98  ? -9.664  -5.818  8.855   1.00 1.00 ? 118 GLN A O    4  
ATOM 6865  C CB   . GLN A 1 98  ? -10.483 -8.527  9.983   1.00 1.00 ? 118 GLN A CB   4  
ATOM 6866  C CG   . GLN A 1 98  ? -10.176 -10.031 10.127  1.00 1.00 ? 118 GLN A CG   4  
ATOM 6867  C CD   . GLN A 1 98  ? -11.385 -10.898 10.503  1.00 1.00 ? 118 GLN A CD   4  
ATOM 6868  O OE1  . GLN A 1 98  ? -11.421 -11.539 11.538  1.00 1.00 ? 118 GLN A OE1  4  
ATOM 6869  N NE2  . GLN A 1 98  ? -12.405 -10.996 9.678   1.00 1.00 ? 118 GLN A NE2  4  
ATOM 6870  H H    . GLN A 1 98  ? -10.754 -6.354  11.724  1.00 1.00 ? 118 GLN A H    4  
ATOM 6871  H HA   . GLN A 1 98  ? -8.546  -8.189  10.783  1.00 1.00 ? 118 GLN A HA   4  
ATOM 6872  H HB2  . GLN A 1 98  ? -11.408 -8.420  10.548  1.00 0.00 ? 118 GLN A HB2  4  
ATOM 6873  H HB3  . GLN A 1 98  ? -10.696 -8.315  8.932   1.00 1.00 ? 118 GLN A HB3  4  
ATOM 6874  H HG2  . GLN A 1 98  ? -9.858  -10.460 9.176   1.00 0.00 ? 118 GLN A HG2  4  
ATOM 6875  H HG3  . GLN A 1 98  ? -9.379  -10.203 10.852  1.00 1.00 ? 118 GLN A HG3  4  
ATOM 6876  H HE21 . GLN A 1 98  ? -12.391 -10.492 8.780   1.00 0.00 ? 118 GLN A HE21 4  
ATOM 6877  H HE22 . GLN A 1 98  ? -13.217 -11.578 9.930   1.00 0.00 ? 118 GLN A HE22 4  
ATOM 6878  N N    . VAL A 1 99  ? -7.600  -6.214  9.657   1.00 1.00 ? 119 VAL A N    4  
ATOM 6879  C CA   . VAL A 1 99  ? -6.903  -5.098  8.996   1.00 1.00 ? 119 VAL A CA   4  
ATOM 6880  C C    . VAL A 1 99  ? -6.015  -5.572  7.841   1.00 1.00 ? 119 VAL A C    4  
ATOM 6881  O O    . VAL A 1 99  ? -5.153  -6.433  8.021   1.00 1.00 ? 119 VAL A O    4  
ATOM 6882  C CB   . VAL A 1 99  ? -6.187  -4.181  10.017  1.00 1.00 ? 119 VAL A CB   4  
ATOM 6883  C CG1  . VAL A 1 99  ? -5.045  -4.863  10.794  1.00 1.00 ? 119 VAL A CG1  4  
ATOM 6884  C CG2  . VAL A 1 99  ? -5.688  -2.895  9.332   1.00 1.00 ? 119 VAL A CG2  4  
ATOM 6885  H H    . VAL A 1 99  ? -7.065  -6.855  10.231  1.00 1.00 ? 119 VAL A H    4  
ATOM 6886  H HA   . VAL A 1 99  ? -7.678  -4.475  8.568   1.00 1.00 ? 119 VAL A HA   4  
ATOM 6887  H HB   . VAL A 1 99  ? -6.934  -3.872  10.754  1.00 1.00 ? 119 VAL A HB   4  
ATOM 6888  H HG11 . VAL A 1 99  ? -5.421  -5.747  11.310  1.00 1.00 ? 119 VAL A HG11 4  
ATOM 6889  H HG12 . VAL A 1 99  ? -4.243  -5.159  10.117  1.00 1.00 ? 119 VAL A HG12 4  
ATOM 6890  H HG13 . VAL A 1 99  ? -4.644  -4.180  11.542  1.00 1.00 ? 119 VAL A HG13 4  
ATOM 6891  H HG21 . VAL A 1 99  ? -6.512  -2.401  8.817   1.00 1.00 ? 119 VAL A HG21 4  
ATOM 6892  H HG22 . VAL A 1 99  ? -5.282  -2.206  10.070  1.00 1.00 ? 119 VAL A HG22 4  
ATOM 6893  H HG23 . VAL A 1 99  ? -4.912  -3.126  8.604   1.00 1.00 ? 119 VAL A HG23 4  
ATOM 6894  N N    . ALA A 1 100 ? -6.245  -5.006  6.649   1.00 1.00 ? 120 ALA A N    4  
ATOM 6895  C CA   . ALA A 1 100 ? -5.526  -5.325  5.410   1.00 1.00 ? 120 ALA A CA   4  
ATOM 6896  C C    . ALA A 1 100 ? -5.218  -4.056  4.586   1.00 1.00 ? 120 ALA A C    4  
ATOM 6897  O O    . ALA A 1 100 ? -6.109  -3.248  4.299   1.00 1.00 ? 120 ALA A O    4  
ATOM 6898  C CB   . ALA A 1 100 ? -6.347  -6.358  4.628   1.00 1.00 ? 120 ALA A CB   4  
ATOM 6899  H H    . ALA A 1 100 ? -7.006  -4.328  6.598   1.00 1.00 ? 120 ALA A H    4  
ATOM 6900  H HA   . ALA A 1 100 ? -4.573  -5.793  5.671   1.00 1.00 ? 120 ALA A HA   4  
ATOM 6901  H HB1  . ALA A 1 100 ? -6.501  -7.252  5.233   1.00 1.00 ? 120 ALA A HB1  4  
ATOM 6902  H HB2  . ALA A 1 100 ? -7.317  -5.942  4.349   1.00 1.00 ? 120 ALA A HB2  4  
ATOM 6903  H HB3  . ALA A 1 100 ? -5.794  -6.644  3.739   1.00 1.00 ? 120 ALA A HB3  4  
ATOM 6904  N N    . THR A 1 101 ? -3.958  -3.899  4.167   1.00 1.00 ? 121 THR A N    4  
ATOM 6905  C CA   . THR A 1 101 ? -3.394  -2.708  3.498   1.00 1.00 ? 121 THR A CA   4  
ATOM 6906  C C    . THR A 1 101 ? -3.006  -3.024  2.047   1.00 1.00 ? 121 THR A C    4  
ATOM 6907  O O    . THR A 1 101 ? -2.445  -4.074  1.741   1.00 1.00 ? 121 THR A O    4  
ATOM 6908  C CB   . THR A 1 101 ? -2.181  -2.162  4.288   1.00 1.00 ? 121 THR A CB   4  
ATOM 6909  O OG1  . THR A 1 101 ? -2.549  -1.841  5.618   1.00 1.00 ? 121 THR A OG1  4  
ATOM 6910  C CG2  . THR A 1 101 ? -1.559  -0.879  3.720   1.00 1.00 ? 121 THR A CG2  4  
ATOM 6911  H H    . THR A 1 101 ? -3.289  -4.655  4.348   1.00 1.00 ? 121 THR A H    4  
ATOM 6912  H HA   . THR A 1 101 ? -4.152  -1.932  3.485   1.00 1.00 ? 121 THR A HA   4  
ATOM 6913  H HB   . THR A 1 101 ? -1.409  -2.933  4.323   1.00 1.00 ? 121 THR A HB   4  
ATOM 6914  H HG1  . THR A 1 101 ? -1.820  -2.138  6.172   1.00 1.00 ? 121 THR A HG1  4  
ATOM 6915  H HG21 . THR A 1 101 ? -2.290  -0.073  3.702   1.00 1.00 ? 121 THR A HG21 4  
ATOM 6916  H HG22 . THR A 1 101 ? -0.715  -0.569  4.337   1.00 1.00 ? 121 THR A HG22 4  
ATOM 6917  H HG23 . THR A 1 101 ? -1.187  -1.051  2.706   1.00 1.00 ? 121 THR A HG23 4  
ATOM 6918  N N    . TYR A 1 102 ? -3.275  -2.076  1.144   1.00 1.00 ? 122 TYR A N    4  
ATOM 6919  C CA   . TYR A 1 102 ? -3.061  -2.186  -0.303  1.00 1.00 ? 122 TYR A CA   4  
ATOM 6920  C C    . TYR A 1 102 ? -2.047  -1.132  -0.818  1.00 1.00 ? 122 TYR A C    4  
ATOM 6921  O O    . TYR A 1 102 ? -2.051  0.025   -0.391  1.00 1.00 ? 122 TYR A O    4  
ATOM 6922  C CB   . TYR A 1 102 ? -4.432  -2.163  -1.005  1.00 1.00 ? 122 TYR A CB   4  
ATOM 6923  C CG   . TYR A 1 102 ? -4.470  -1.509  -2.365  1.00 1.00 ? 122 TYR A CG   4  
ATOM 6924  C CD1  . TYR A 1 102 ? -3.929  -2.170  -3.485  1.00 1.00 ? 122 TYR A CD1  4  
ATOM 6925  C CD2  . TYR A 1 102 ? -4.993  -0.206  -2.489  1.00 1.00 ? 122 TYR A CD2  4  
ATOM 6926  C CE1  . TYR A 1 102 ? -3.891  -1.498  -4.726  1.00 1.00 ? 122 TYR A CE1  4  
ATOM 6927  C CE2  . TYR A 1 102 ? -4.980  0.461   -3.730  1.00 1.00 ? 122 TYR A CE2  4  
ATOM 6928  C CZ   . TYR A 1 102 ? -4.412  -0.182  -4.853  1.00 1.00 ? 122 TYR A CZ   4  
ATOM 6929  O OH   . TYR A 1 102 ? -4.377  0.476   -6.040  1.00 1.00 ? 122 TYR A OH   4  
ATOM 6930  H H    . TYR A 1 102 ? -3.729  -1.231  1.485   1.00 1.00 ? 122 TYR A H    4  
ATOM 6931  H HA   . TYR A 1 102 ? -2.639  -3.169  -0.513  1.00 1.00 ? 122 TYR A HA   4  
ATOM 6932  H HB2  . TYR A 1 102 ? -4.765  -3.157  -1.305  1.00 0.00 ? 122 TYR A HB2  4  
ATOM 6933  H HB3  . TYR A 1 102 ? -5.223  -1.755  -0.368  1.00 1.00 ? 122 TYR A HB3  4  
ATOM 6934  H HD1  . TYR A 1 102 ? -3.561  -3.184  -3.399  1.00 1.00 ? 122 TYR A HD1  4  
ATOM 6935  H HD2  . TYR A 1 102 ? -5.403  0.265   -1.618  1.00 1.00 ? 122 TYR A HD2  4  
ATOM 6936  H HE1  . TYR A 1 102 ? -3.526  -2.013  -5.592  1.00 1.00 ? 122 TYR A HE1  4  
ATOM 6937  H HE2  . TYR A 1 102 ? -5.405  1.452   -3.815  1.00 1.00 ? 122 TYR A HE2  4  
ATOM 6938  H HH   . TYR A 1 102 ? -4.847  1.306   -5.969  1.00 1.00 ? 122 TYR A HH   4  
ATOM 6939  N N    . HIS A 1 103 ? -1.166  -1.550  -1.748  1.00 1.00 ? 123 HIS A N    4  
ATOM 6940  C CA   . HIS A 1 103 ? -0.042  -0.749  -2.280  1.00 1.00 ? 123 HIS A CA   4  
ATOM 6941  C C    . HIS A 1 103 ? 0.400   -1.118  -3.721  1.00 1.00 ? 123 HIS A C    4  
ATOM 6942  O O    . HIS A 1 103 ? 1.528   -1.553  -3.952  1.00 1.00 ? 123 HIS A O    4  
ATOM 6943  C CB   . HIS A 1 103 ? 1.116   -0.770  -1.250  1.00 1.00 ? 123 HIS A CB   4  
ATOM 6944  C CG   . HIS A 1 103 ? 1.941   -2.032  -1.073  1.00 1.00 ? 123 HIS A CG   4  
ATOM 6945  N ND1  . HIS A 1 103 ? 3.287   -2.042  -0.775  1.00 1.00 ? 123 HIS A ND1  4  
ATOM 6946  C CD2  . HIS A 1 103 ? 1.519   -3.333  -1.152  1.00 1.00 ? 123 HIS A CD2  4  
ATOM 6947  C CE1  . HIS A 1 103 ? 3.671   -3.330  -0.645  1.00 1.00 ? 123 HIS A CE1  4  
ATOM 6948  N NE2  . HIS A 1 103 ? 2.614   -4.136  -0.885  1.00 1.00 ? 123 HIS A NE2  4  
ATOM 6949  H H    . HIS A 1 103 ? -1.271  -2.508  -2.043  1.00 1.00 ? 123 HIS A H    4  
ATOM 6950  H HA   . HIS A 1 103 ? -0.378  0.289   -2.336  1.00 1.00 ? 123 HIS A HA   4  
ATOM 6951  H HB2  . HIS A 1 103 ? 1.944   -0.145  -1.583  1.00 0.00 ? 123 HIS A HB2  4  
ATOM 6952  H HB3  . HIS A 1 103 ? 0.781   -0.397  -0.278  1.00 1.00 ? 123 HIS A HB3  4  
ATOM 6953  H HD1  . HIS A 1 103 ? 3.852   -1.209  -0.673  1.00 1.00 ? 123 HIS A HD1  4  
ATOM 6954  H HD2  . HIS A 1 103 ? 0.520   -3.675  -1.371  1.00 1.00 ? 123 HIS A HD2  4  
ATOM 6955  H HE1  . HIS A 1 103 ? 4.668   -3.668  -0.372  1.00 1.00 ? 123 HIS A HE1  4  
ATOM 6956  H HE2  . HIS A 1 103 ? 2.600   -5.150  -0.855  1.00 1.00 ? 123 HIS A HE2  4  
ATOM 6957  N N    . ARG A 1 104 ? -0.489  -0.922  -4.711  1.00 1.00 ? 124 ARG A N    4  
ATOM 6958  C CA   . ARG A 1 104 ? -0.307  -1.313  -6.131  1.00 1.00 ? 124 ARG A CA   4  
ATOM 6959  C C    . ARG A 1 104 ? 0.892   -0.709  -6.899  1.00 1.00 ? 124 ARG A C    4  
ATOM 6960  O O    . ARG A 1 104 ? 1.361   -1.360  -7.827  1.00 1.00 ? 124 ARG A O    4  
ATOM 6961  C CB   . ARG A 1 104 ? -1.616  -1.013  -6.880  1.00 1.00 ? 124 ARG A CB   4  
ATOM 6962  C CG   . ARG A 1 104 ? -1.900  -1.851  -8.127  1.00 1.00 ? 124 ARG A CG   4  
ATOM 6963  C CD   . ARG A 1 104 ? -2.078  -3.347  -7.857  1.00 1.00 ? 124 ARG A CD   4  
ATOM 6964  N NE   . ARG A 1 104 ? -2.367  -4.073  -9.107  1.00 1.00 ? 124 ARG A NE   4  
ATOM 6965  C CZ   . ARG A 1 104 ? -1.472  -4.606  -9.918  1.00 1.00 ? 124 ARG A CZ   4  
ATOM 6966  N NH1  . ARG A 1 104 ? -0.186  -4.505  -9.725  1.00 1.00 ? 124 ARG A NH1  4  
ATOM 6967  N NH2  . ARG A 1 104 ? -1.838  -5.270  -10.976 1.00 1.00 ? 124 ARG A NH2  4  
ATOM 6968  H H    . ARG A 1 104 ? -1.400  -0.584  -4.427  1.00 1.00 ? 124 ARG A H    4  
ATOM 6969  H HA   . ARG A 1 104 ? -0.140  -2.391  -6.149  1.00 1.00 ? 124 ARG A HA   4  
ATOM 6970  H HB2  . ARG A 1 104 ? -2.486  -1.291  -6.285  1.00 0.00 ? 124 ARG A HB2  4  
ATOM 6971  H HB3  . ARG A 1 104 ? -1.704  0.049   -7.115  1.00 1.00 ? 124 ARG A HB3  4  
ATOM 6972  H HG2  . ARG A 1 104 ? -2.847  -1.539  -8.569  1.00 0.00 ? 124 ARG A HG2  4  
ATOM 6973  H HG3  . ARG A 1 104 ? -1.101  -1.710  -8.852  1.00 1.00 ? 124 ARG A HG3  4  
ATOM 6974  H HD2  . ARG A 1 104 ? -1.159  -3.808  -7.496  1.00 0.00 ? 124 ARG A HD2  4  
ATOM 6975  H HD3  . ARG A 1 104 ? -2.846  -3.538  -7.104  1.00 1.00 ? 124 ARG A HD3  4  
ATOM 6976  H HE   . ARG A 1 104 ? -3.330  -4.183  -9.371  1.00 1.00 ? 124 ARG A HE   4  
ATOM 6977  H HH11 . ARG A 1 104 ? 0.173   -3.989  -8.909  1.00 0.00 ? 124 ARG A HH11 4  
ATOM 6978  H HH12 . ARG A 1 104 ? 0.470   -4.939  -10.389 1.00 0.00 ? 124 ARG A HH12 4  
ATOM 6979  H HH21 . ARG A 1 104 ? -2.840  -5.386  -11.190 1.00 0.00 ? 124 ARG A HH21 4  
ATOM 6980  H HH22 . ARG A 1 104 ? -1.127  -5.681  -11.600 1.00 0.00 ? 124 ARG A HH22 4  
ATOM 6981  N N    . ALA A 1 105 ? 1.354   0.494   -6.514  1.00 1.00 ? 125 ALA A N    4  
ATOM 6982  C CA   . ALA A 1 105 ? 2.435   1.298   -7.121  1.00 1.00 ? 125 ALA A CA   4  
ATOM 6983  C C    . ALA A 1 105 ? 2.295   1.524   -8.658  1.00 1.00 ? 125 ALA A C    4  
ATOM 6984  O O    . ALA A 1 105 ? 2.919   0.829   -9.458  1.00 1.00 ? 125 ALA A O    4  
ATOM 6985  C CB   . ALA A 1 105 ? 3.794   0.724   -6.671  1.00 1.00 ? 125 ALA A CB   4  
ATOM 6986  H H    . ALA A 1 105 ? 0.889   0.873   -5.706  1.00 1.00 ? 125 ALA A H    4  
ATOM 6987  H HA   . ALA A 1 105 ? 2.374   2.287   -6.666  1.00 1.00 ? 125 ALA A HA   4  
ATOM 6988  H HB1  . ALA A 1 105 ? 3.828   0.629   -5.584  1.00 1.00 ? 125 ALA A HB1  4  
ATOM 6989  H HB2  . ALA A 1 105 ? 3.952   -0.261  -7.117  1.00 1.00 ? 125 ALA A HB2  4  
ATOM 6990  H HB3  . ALA A 1 105 ? 4.602   1.384   -6.990  1.00 1.00 ? 125 ALA A HB3  4  
ATOM 6991  N N    . ILE A 1 106 ? 1.478   2.520   -9.059  1.00 1.00 ? 126 ILE A N    4  
ATOM 6992  C CA   . ILE A 1 106 ? 1.140   2.866   -10.465 1.00 1.00 ? 126 ILE A CA   4  
ATOM 6993  C C    . ILE A 1 106 ? 1.604   4.303   -10.803 1.00 1.00 ? 126 ILE A C    4  
ATOM 6994  O O    . ILE A 1 106 ? 2.730   4.490   -11.257 1.00 1.00 ? 126 ILE A O    4  
ATOM 6995  C CB   . ILE A 1 106 ? -0.368  2.599   -10.760 1.00 1.00 ? 126 ILE A CB   4  
ATOM 6996  C CG1  . ILE A 1 106 ? -0.788  1.148   -10.422 1.00 1.00 ? 126 ILE A CG1  4  
ATOM 6997  C CG2  . ILE A 1 106 ? -0.782  2.971   -12.205 1.00 1.00 ? 126 ILE A CG2  4  
ATOM 6998  C CD1  . ILE A 1 106 ? -0.190  0.026   -11.283 1.00 1.00 ? 126 ILE A CD1  4  
ATOM 6999  H H    . ILE A 1 106 ? 1.024   3.045   -8.328  1.00 1.00 ? 126 ILE A H    4  
ATOM 7000  H HA   . ILE A 1 106 ? 1.712   2.218   -11.129 1.00 1.00 ? 126 ILE A HA   4  
ATOM 7001  H HB   . ILE A 1 106 ? -0.947  3.240   -10.092 1.00 1.00 ? 126 ILE A HB   4  
ATOM 7002  H HG12 . ILE A 1 106 ? -0.400  0.864   -9.444  1.00 0.00 ? 126 ILE A HG12 4  
ATOM 7003  H HG13 . ILE A 1 106 ? -1.877  1.066   -10.408 1.00 1.00 ? 126 ILE A HG13 4  
ATOM 7004  H HG21 . ILE A 1 106 ? -0.168  2.434   -12.931 1.00 1.00 ? 126 ILE A HG21 4  
ATOM 7005  H HG22 . ILE A 1 106 ? -1.831  2.724   -12.369 1.00 1.00 ? 126 ILE A HG22 4  
ATOM 7006  H HG23 . ILE A 1 106 ? -0.668  4.038   -12.391 1.00 1.00 ? 126 ILE A HG23 4  
ATOM 7007  H HD11 . ILE A 1 106 ? 0.898   0.046   -11.230 1.00 1.00 ? 126 ILE A HD11 4  
ATOM 7008  H HD12 . ILE A 1 106 ? -0.538  -0.937  -10.913 1.00 1.00 ? 126 ILE A HD12 4  
ATOM 7009  H HD13 . ILE A 1 106 ? -0.509  0.136   -12.320 1.00 1.00 ? 126 ILE A HD13 4  
ATOM 7010  N N    . LYS A 1 107 ? 0.747   5.314   -10.573 1.00 1.00 ? 127 LYS A N    4  
ATOM 7011  C CA   . LYS A 1 107 ? 1.037   6.752   -10.685 1.00 1.00 ? 127 LYS A CA   4  
ATOM 7012  C C    . LYS A 1 107 ? 1.589   7.302   -9.360  1.00 1.00 ? 127 LYS A C    4  
ATOM 7013  O O    . LYS A 1 107 ? 1.278   6.778   -8.287  1.00 1.00 ? 127 LYS A O    4  
ATOM 7014  C CB   . LYS A 1 107 ? -0.276  7.449   -11.065 1.00 1.00 ? 127 LYS A CB   4  
ATOM 7015  C CG   . LYS A 1 107 ? -0.170  8.683   -11.966 1.00 1.00 ? 127 LYS A CG   4  
ATOM 7016  C CD   . LYS A 1 107 ? -1.573  8.900   -12.543 1.00 1.00 ? 127 LYS A CD   4  
ATOM 7017  C CE   . LYS A 1 107 ? -1.593  9.800   -13.776 1.00 1.00 ? 127 LYS A CE   4  
ATOM 7018  N NZ   . LYS A 1 107 ? -2.846  9.604   -14.533 1.00 1.00 ? 127 LYS A NZ   4  
ATOM 7019  H H    . LYS A 1 107 ? -0.160  5.059   -10.215 1.00 1.00 ? 127 LYS A H    4  
ATOM 7020  H HA   . LYS A 1 107 ? 1.782   6.898   -11.470 1.00 1.00 ? 127 LYS A HA   4  
ATOM 7021  H HB2  . LYS A 1 107 ? -0.878  6.827   -11.728 1.00 0.00 ? 127 LYS A HB2  4  
ATOM 7022  H HB3  . LYS A 1 107 ? -0.879  7.669   -10.181 1.00 1.00 ? 127 LYS A HB3  4  
ATOM 7023  H HG2  . LYS A 1 107 ? 0.182   9.532   -11.380 1.00 0.00 ? 127 LYS A HG2  4  
ATOM 7024  H HG3  . LYS A 1 107 ? 0.536   8.483   -12.777 1.00 1.00 ? 127 LYS A HG3  4  
ATOM 7025  H HD2  . LYS A 1 107 ? -1.978  7.958   -12.913 1.00 0.00 ? 127 LYS A HD2  4  
ATOM 7026  H HD3  . LYS A 1 107 ? -2.242  9.292   -11.772 1.00 1.00 ? 127 LYS A HD3  4  
ATOM 7027  H HE2  . LYS A 1 107 ? -1.557  10.844  -13.462 1.00 0.00 ? 127 LYS A HE2  4  
ATOM 7028  H HE3  . LYS A 1 107 ? -0.728  9.576   -14.402 1.00 1.00 ? 127 LYS A HE3  4  
ATOM 7029  H HZ1  . LYS A 1 107 ? -3.088  8.603   -14.543 1.00 0.00 ? 127 LYS A HZ1  4  
ATOM 7030  H HZ2  . LYS A 1 107 ? -3.605  10.136  -14.086 1.00 0.00 ? 127 LYS A HZ2  4  
ATOM 7031  N N    . ILE A 1 108 ? 2.373   8.383   -9.451  1.00 1.00 ? 128 ILE A N    4  
ATOM 7032  C CA   . ILE A 1 108 ? 2.884   9.149   -8.298  1.00 1.00 ? 128 ILE A CA   4  
ATOM 7033  C C    . ILE A 1 108 ? 2.744   10.671  -8.538  1.00 1.00 ? 128 ILE A C    4  
ATOM 7034  O O    . ILE A 1 108 ? 3.397   11.211  -9.430  1.00 1.00 ? 128 ILE A O    4  
ATOM 7035  C CB   . ILE A 1 108 ? 4.329   8.724   -7.877  1.00 1.00 ? 128 ILE A CB   4  
ATOM 7036  C CG1  . ILE A 1 108 ? 5.485   9.015   -8.869  1.00 1.00 ? 128 ILE A CG1  4  
ATOM 7037  C CG2  . ILE A 1 108 ? 4.425   7.221   -7.530  1.00 1.00 ? 128 ILE A CG2  4  
ATOM 7038  C CD1  . ILE A 1 108 ? 6.659   9.821   -8.288  1.00 1.00 ? 128 ILE A CD1  4  
ATOM 7039  H H    . ILE A 1 108 ? 2.588   8.711   -10.378 1.00 1.00 ? 128 ILE A H    4  
ATOM 7040  H HA   . ILE A 1 108 ? 2.266   8.900   -7.439  1.00 1.00 ? 128 ILE A HA   4  
ATOM 7041  H HB   . ILE A 1 108 ? 4.540   9.264   -6.954  1.00 1.00 ? 128 ILE A HB   4  
ATOM 7042  H HG12 . ILE A 1 108 ? 6.050   8.125   -9.141  1.00 0.00 ? 128 ILE A HG12 4  
ATOM 7043  H HG13 . ILE A 1 108 ? 5.144   9.445   -9.808  1.00 1.00 ? 128 ILE A HG13 4  
ATOM 7044  H HG21 . ILE A 1 108 ? 3.628   6.933   -6.847  1.00 1.00 ? 128 ILE A HG21 4  
ATOM 7045  H HG22 . ILE A 1 108 ? 4.333   6.614   -8.434  1.00 1.00 ? 128 ILE A HG22 4  
ATOM 7046  H HG23 . ILE A 1 108 ? 5.385   6.995   -7.061  1.00 1.00 ? 128 ILE A HG23 4  
ATOM 7047  H HD11 . ILE A 1 108 ? 7.085   9.297   -7.430  1.00 1.00 ? 128 ILE A HD11 4  
ATOM 7048  H HD12 . ILE A 1 108 ? 7.437   9.938   -9.045  1.00 1.00 ? 128 ILE A HD12 4  
ATOM 7049  H HD13 . ILE A 1 108 ? 6.318   10.810  -7.972  1.00 1.00 ? 128 ILE A HD13 4  
ATOM 7050  N N    . THR A 1 109 ? 1.891   11.376  -7.771  1.00 1.00 ? 129 THR A N    4  
ATOM 7051  C CA   . THR A 1 109 ? 1.830   12.867  -7.790  1.00 1.00 ? 129 THR A CA   4  
ATOM 7052  C C    . THR A 1 109 ? 2.796   13.467  -6.753  1.00 1.00 ? 129 THR A C    4  
ATOM 7053  O O    . THR A 1 109 ? 2.751   13.080  -5.578  1.00 1.00 ? 129 THR A O    4  
ATOM 7054  C CB   . THR A 1 109 ? 0.396   13.388  -7.592  1.00 1.00 ? 129 THR A CB   4  
ATOM 7055  O OG1  . THR A 1 109 ? -0.283  12.995  -8.761  1.00 1.00 ? 129 THR A OG1  4  
ATOM 7056  C CG2  . THR A 1 109 ? 0.235   14.903  -7.481  1.00 1.00 ? 129 THR A CG2  4  
ATOM 7057  H H    . THR A 1 109 ? 1.163   10.853  -7.257  1.00 1.00 ? 129 THR A H    4  
ATOM 7058  H HA   . THR A 1 109 ? 2.154   13.220  -8.770  1.00 1.00 ? 129 THR A HA   4  
ATOM 7059  H HB   . THR A 1 109 ? -0.054  12.917  -6.712  1.00 1.00 ? 129 THR A HB   4  
ATOM 7060  H HG1  . THR A 1 109 ? 0.297   12.362  -9.194  1.00 1.00 ? 129 THR A HG1  4  
ATOM 7061  H HG21 . THR A 1 109 ? 0.738   15.404  -8.306  1.00 1.00 ? 129 THR A HG21 4  
ATOM 7062  H HG22 . THR A 1 109 ? -0.822  15.177  -7.497  1.00 1.00 ? 129 THR A HG22 4  
ATOM 7063  H HG23 . THR A 1 109 ? 0.660   15.238  -6.534  1.00 1.00 ? 129 THR A HG23 4  
ATOM 7064  N N    . VAL A 1 110 ? 3.680   14.379  -7.197  1.00 1.00 ? 130 VAL A N    4  
ATOM 7065  C CA   . VAL A 1 110 ? 4.671   15.129  -6.377  1.00 1.00 ? 130 VAL A CA   4  
ATOM 7066  C C    . VAL A 1 110 ? 4.194   16.506  -5.849  1.00 1.00 ? 130 VAL A C    4  
ATOM 7067  O O    . VAL A 1 110 ? 4.541   16.900  -4.742  1.00 1.00 ? 130 VAL A O    4  
ATOM 7068  C CB   . VAL A 1 110 ? 6.053   15.183  -7.089  1.00 1.00 ? 130 VAL A CB   4  
ATOM 7069  C CG1  . VAL A 1 110 ? 6.096   16.011  -8.388  1.00 1.00 ? 130 VAL A CG1  4  
ATOM 7070  C CG2  . VAL A 1 110 ? 7.159   15.672  -6.134  1.00 1.00 ? 130 VAL A CG2  4  
ATOM 7071  H H    . VAL A 1 110 ? 3.600   14.633  -8.178  1.00 1.00 ? 130 VAL A H    4  
ATOM 7072  H HA   . VAL A 1 110 ? 4.833   14.531  -5.481  1.00 1.00 ? 130 VAL A HA   4  
ATOM 7073  H HB   . VAL A 1 110 ? 6.318   14.158  -7.361  1.00 1.00 ? 130 VAL A HB   4  
ATOM 7074  H HG11 . VAL A 1 110 ? 5.346   15.657  -9.094  1.00 1.00 ? 130 VAL A HG11 4  
ATOM 7075  H HG12 . VAL A 1 110 ? 5.925   17.070  -8.184  1.00 1.00 ? 130 VAL A HG12 4  
ATOM 7076  H HG13 . VAL A 1 110 ? 7.074   15.908  -8.860  1.00 1.00 ? 130 VAL A HG13 4  
ATOM 7077  H HG21 . VAL A 1 110 ? 7.166   15.056  -5.235  1.00 1.00 ? 130 VAL A HG21 4  
ATOM 7078  H HG22 . VAL A 1 110 ? 8.134   15.590  -6.616  1.00 1.00 ? 130 VAL A HG22 4  
ATOM 7079  H HG23 . VAL A 1 110 ? 6.993   16.714  -5.860  1.00 1.00 ? 130 VAL A HG23 4  
ATOM 7080  N N    . ASP A 1 111 ? 3.403   17.233  -6.637  1.00 1.00 ? 131 ASP A N    4  
ATOM 7081  C CA   . ASP A 1 111 ? 2.799   18.570  -6.444  1.00 1.00 ? 131 ASP A CA   4  
ATOM 7082  C C    . ASP A 1 111 ? 1.745   18.543  -5.312  1.00 1.00 ? 131 ASP A C    4  
ATOM 7083  O O    . ASP A 1 111 ? 1.851   19.265  -4.321  1.00 1.00 ? 131 ASP A O    4  
ATOM 7084  C CB   . ASP A 1 111 ? 2.173   19.009  -7.798  1.00 1.00 ? 131 ASP A CB   4  
ATOM 7085  C CG   . ASP A 1 111 ? 2.773   18.337  -9.055  1.00 1.00 ? 131 ASP A CG   4  
ATOM 7086  O OD1  . ASP A 1 111 ? 2.554   17.105  -9.178  1.00 1.00 ? 131 ASP A OD1  4  
ATOM 7087  O OD2  . ASP A 1 111 ? 3.517   19.002  -9.803  1.00 1.00 ? 131 ASP A OD2  4  
ATOM 7088  H H    . ASP A 1 111 ? 3.222   16.844  -7.565  1.00 1.00 ? 131 ASP A H    4  
ATOM 7089  H HA   . ASP A 1 111 ? 3.574   19.289  -6.160  1.00 1.00 ? 131 ASP A HA   4  
ATOM 7090  H HB2  . ASP A 1 111 ? 1.111   18.762  -7.775  1.00 0.00 ? 131 ASP A HB2  4  
ATOM 7091  H HB3  . ASP A 1 111 ? 2.131   20.097  -7.887  1.00 1.00 ? 131 ASP A HB3  4  
ATOM 7092  N N    . GLY A 1 112 ? 0.751   17.653  -5.458  1.00 1.00 ? 132 GLY A N    4  
ATOM 7093  C CA   . GLY A 1 112 ? -0.265  17.283  -4.470  1.00 1.00 ? 132 GLY A CA   4  
ATOM 7094  C C    . GLY A 1 112 ? -1.657  17.841  -4.784  1.00 1.00 ? 132 GLY A C    4  
ATOM 7095  O O    . GLY A 1 112 ? -2.475  17.081  -5.298  1.00 1.00 ? 132 GLY A O    4  
ATOM 7096  H H    . GLY A 1 112 ? 0.755   17.170  -6.346  1.00 1.00 ? 132 GLY A H    4  
ATOM 7097  H HA2  . GLY A 1 112 ? -0.326  16.194  -4.451  1.00 1.00 ? 132 GLY A HA2  4  
ATOM 7098  H HA3  . GLY A 1 112 ? 0.041   17.597  -3.474  1.00 1.00 ? 132 GLY A HA3  4  
ATOM 7099  N N    . PRO A 1 113 ? -1.961  19.126  -4.488  1.00 1.00 ? 133 PRO A N    4  
ATOM 7100  C CA   . PRO A 1 113 ? -3.293  19.715  -4.687  1.00 1.00 ? 133 PRO A CA   4  
ATOM 7101  C C    . PRO A 1 113 ? -3.730  20.036  -6.142  1.00 1.00 ? 133 PRO A C    4  
ATOM 7102  O O    . PRO A 1 113 ? -4.924  20.292  -6.303  1.00 1.00 ? 133 PRO A O    4  
ATOM 7103  C CB   . PRO A 1 113 ? -3.336  20.973  -3.814  1.00 1.00 ? 133 PRO A CB   4  
ATOM 7104  C CG   . PRO A 1 113 ? -1.870  21.359  -3.622  1.00 1.00 ? 133 PRO A CG   4  
ATOM 7105  C CD   . PRO A 1 113 ? -1.098  20.049  -3.761  1.00 1.00 ? 133 PRO A CD   4  
ATOM 7106  H HA   . PRO A 1 113 ? -4.029  19.012  -4.294  1.00 1.00 ? 133 PRO A HA   4  
ATOM 7107  H HB2  . PRO A 1 113 ? -3.909  21.693  -4.398  1.00 0.00 ? 133 PRO A HB2  4  
ATOM 7108  H HB3  . PRO A 1 113 ? -3.773  20.725  -2.845  1.00 1.00 ? 133 PRO A HB3  4  
ATOM 7109  H HG2  . PRO A 1 113 ? -1.562  22.088  -4.372  1.00 0.00 ? 133 PRO A HG2  4  
ATOM 7110  H HG3  . PRO A 1 113 ? -1.712  21.799  -2.633  1.00 1.00 ? 133 PRO A HG3  4  
ATOM 7111  H HD2  . PRO A 1 113 ? -0.161  20.170  -4.305  1.00 0.00 ? 133 PRO A HD2  4  
ATOM 7112  H HD3  . PRO A 1 113 ? -0.895  19.646  -2.767  1.00 1.00 ? 133 PRO A HD3  4  
ATOM 7113  N N    . ARG A 1 114 ? -2.844  19.980  -7.169  1.00 1.00 ? 134 ARG A N    4  
ATOM 7114  C CA   . ARG A 1 114 ? -3.021  20.186  -8.652  1.00 1.00 ? 134 ARG A CA   4  
ATOM 7115  C C    . ARG A 1 114 ? -2.004  21.121  -9.357  1.00 1.00 ? 134 ARG A C    4  
ATOM 7116  O O    . ARG A 1 114 ? -1.856  21.026  -10.573 1.00 1.00 ? 134 ARG A O    4  
ATOM 7117  C CB   . ARG A 1 114 ? -4.450  20.653  -9.027  1.00 1.00 ? 134 ARG A CB   4  
ATOM 7118  C CG   . ARG A 1 114 ? -4.852  20.407  -10.485 1.00 1.00 ? 134 ARG A CG   4  
ATOM 7119  C CD   . ARG A 1 114 ? -6.351  20.643  -10.696 1.00 1.00 ? 134 ARG A CD   4  
ATOM 7120  N NE   . ARG A 1 114 ? -6.843  19.966  -11.912 1.00 1.00 ? 134 ARG A NE   4  
ATOM 7121  C CZ   . ARG A 1 114 ? -8.036  20.060  -12.469 1.00 1.00 ? 134 ARG A CZ   4  
ATOM 7122  N NH1  . ARG A 1 114 ? -8.976  20.828  -11.992 1.00 1.00 ? 134 ARG A NH1  4  
ATOM 7123  N NH2  . ARG A 1 114 ? -8.306  19.354  -13.529 1.00 1.00 ? 134 ARG A NH2  4  
ATOM 7124  H H    . ARG A 1 114 ? -1.921  19.703  -6.866  1.00 1.00 ? 134 ARG A H    4  
ATOM 7125  H HA   . ARG A 1 114 ? -2.863  19.216  -9.123  1.00 1.00 ? 134 ARG A HA   4  
ATOM 7126  H HB2  . ARG A 1 114 ? -5.200  20.062  -8.501  1.00 0.00 ? 134 ARG A HB2  4  
ATOM 7127  H HB3  . ARG A 1 114 ? -4.597  21.700  -8.761  1.00 1.00 ? 134 ARG A HB3  4  
ATOM 7128  H HG2  . ARG A 1 114 ? -4.326  21.106  -11.135 1.00 0.00 ? 134 ARG A HG2  4  
ATOM 7129  H HG3  . ARG A 1 114 ? -4.592  19.387  -10.772 1.00 1.00 ? 134 ARG A HG3  4  
ATOM 7130  H HD2  . ARG A 1 114 ? -6.912  20.192  -9.877  1.00 0.00 ? 134 ARG A HD2  4  
ATOM 7131  H HD3  . ARG A 1 114 ? -6.555  21.716  -10.725 1.00 1.00 ? 134 ARG A HD3  4  
ATOM 7132  H HE   . ARG A 1 114 ? -6.200  19.340  -12.367 1.00 1.00 ? 134 ARG A HE   4  
ATOM 7133  H HH11 . ARG A 1 114 ? -8.802  21.392  -11.148 1.00 0.00 ? 134 ARG A HH11 4  
ATOM 7134  H HH12 . ARG A 1 114 ? -9.893  20.870  -12.460 1.00 0.00 ? 134 ARG A HH12 4  
ATOM 7135  H HH21 . ARG A 1 114 ? -7.592  18.729  -13.928 1.00 0.00 ? 134 ARG A HH21 4  
ATOM 7136  H HH22 . ARG A 1 114 ? -9.235  19.423  -13.969 1.00 0.00 ? 134 ARG A HH22 4  
ATOM 7137  N N    . GLU A 1 115 ? -1.332  21.997  -8.606  1.00 1.00 ? 135 GLU A N    4  
ATOM 7138  C CA   . GLU A 1 115 ? -0.336  23.022  -8.993  1.00 1.00 ? 135 GLU A CA   4  
ATOM 7139  C C    . GLU A 1 115 ? 0.763   23.129  -7.905  1.00 1.00 ? 135 GLU A C    4  
ATOM 7140  O O    . GLU A 1 115 ? 0.392   23.103  -6.707  1.00 1.00 ? 135 GLU A O    4  
ATOM 7141  C CB   . GLU A 1 115 ? -1.065  24.372  -9.201  1.00 1.00 ? 135 GLU A CB   4  
ATOM 7142  C CG   . GLU A 1 115 ? -1.027  25.013  -10.603 1.00 1.00 ? 135 GLU A CG   4  
ATOM 7143  C CD   . GLU A 1 115 ? -0.516  26.465  -10.634 1.00 1.00 ? 135 GLU A CD   4  
ATOM 7144  O OE1  . GLU A 1 115 ? -1.274  27.366  -10.215 1.00 1.00 ? 135 GLU A OE1  4  
ATOM 7145  O OE2  . GLU A 1 115 ? 0.615   26.664  -11.136 1.00 1.00 ? 135 GLU A OE2  4  
ATOM 7146  O OXT  . GLU A 1 115 ? 1.948   23.178  -8.299  1.00 1.00 ? 135 GLU A OXT  4  
ATOM 7147  H H    . GLU A 1 115 ? -1.478  21.951  -7.608  1.00 1.00 ? 135 GLU A H    4  
ATOM 7148  H HA   . GLU A 1 115 ? 0.163   22.726  -9.918  1.00 1.00 ? 135 GLU A HA   4  
ATOM 7149  H HB2  . GLU A 1 115 ? -2.148  24.277  -9.276  1.00 0.00 ? 135 GLU A HB2  4  
ATOM 7150  H HB3  . GLU A 1 115 ? -0.899  25.088  -8.395  1.00 1.00 ? 135 GLU A HB3  4  
ATOM 7151  H HG2  . GLU A 1 115 ? -0.320  24.468  -11.229 1.00 0.00 ? 135 GLU A HG2  4  
ATOM 7152  H HG3  . GLU A 1 115 ? -2.026  24.965  -11.048 1.00 1.00 ? 135 GLU A HG3  4  
ATOM 7153  N N    . GLU A 1 1   ? -6.981  -9.221  -10.641 1.00 1.00 ? 21  GLU A N    5  
ATOM 7154  C CA   . GLU A 1 1   ? -6.240  -8.279  -9.758  1.00 1.00 ? 21  GLU A CA   5  
ATOM 7155  C C    . GLU A 1 1   ? -6.827  -6.871  -9.929  1.00 1.00 ? 21  GLU A C    5  
ATOM 7156  O O    . GLU A 1 1   ? -7.376  -6.591  -10.992 1.00 1.00 ? 21  GLU A O    5  
ATOM 7157  C CB   . GLU A 1 1   ? -4.724  -8.361  -10.009 1.00 1.00 ? 21  GLU A CB   5  
ATOM 7158  C CG   . GLU A 1 1   ? -3.817  -7.417  -9.197  1.00 1.00 ? 21  GLU A CG   5  
ATOM 7159  C CD   . GLU A 1 1   ? -3.345  -6.158  -9.940  1.00 1.00 ? 21  GLU A CD   5  
ATOM 7160  O OE1  . GLU A 1 1   ? -3.375  -6.146  -11.189 1.00 1.00 ? 21  GLU A OE1  5  
ATOM 7161  O OE2  . GLU A 1 1   ? -2.941  -5.224  -9.221  1.00 1.00 ? 21  GLU A OE2  5  
ATOM 7162  H H1   . GLU A 1 1   ? -6.666  -10.184 -10.458 1.00 0.00 ? 21  GLU A H1   5  
ATOM 7163  H H2   . GLU A 1 1   ? -7.991  -9.149  -10.449 1.00 0.00 ? 21  GLU A H2   5  
ATOM 7164  H HA   . GLU A 1 1   ? -6.405  -8.571  -8.723  1.00 1.00 ? 21  GLU A HA   5  
ATOM 7165  H HB2  . GLU A 1 1   ? -4.257  -9.233  -9.548  1.00 0.00 ? 21  GLU A HB2  5  
ATOM 7166  H HB3  . GLU A 1 1   ? -4.463  -8.418  -11.068 1.00 1.00 ? 21  GLU A HB3  5  
ATOM 7167  H HG2  . GLU A 1 1   ? -4.375  -7.015  -8.352  1.00 0.00 ? 21  GLU A HG2  5  
ATOM 7168  H HG3  . GLU A 1 1   ? -2.952  -7.970  -8.832  1.00 1.00 ? 21  GLU A HG3  5  
ATOM 7169  N N    . LEU A 1 2   ? -6.829  -6.059  -8.861  1.00 1.00 ? 22  LEU A N    5  
ATOM 7170  C CA   . LEU A 1 2   ? -7.529  -4.780  -8.697  1.00 1.00 ? 22  LEU A CA   5  
ATOM 7171  C C    . LEU A 1 2   ? -6.755  -4.032  -7.588  1.00 1.00 ? 22  LEU A C    5  
ATOM 7172  O O    . LEU A 1 2   ? -5.672  -4.504  -7.202  1.00 1.00 ? 22  LEU A O    5  
ATOM 7173  C CB   . LEU A 1 2   ? -9.022  -5.072  -8.388  1.00 1.00 ? 22  LEU A CB   5  
ATOM 7174  C CG   . LEU A 1 2   ? -9.961  -5.101  -9.622  1.00 1.00 ? 22  LEU A CG   5  
ATOM 7175  C CD1  . LEU A 1 2   ? -11.097 -6.113  -9.428  1.00 1.00 ? 22  LEU A CD1  5  
ATOM 7176  C CD2  . LEU A 1 2   ? -10.561 -3.725  -9.908  1.00 1.00 ? 22  LEU A CD2  5  
ATOM 7177  H H    . LEU A 1 2   ? -6.234  -6.157  -8.014  1.00 1.00 ? 22  LEU A H    5  
ATOM 7178  H HA   . LEU A 1 2   ? -7.441  -4.194  -9.616  1.00 1.00 ? 22  LEU A HA   5  
ATOM 7179  H HB2  . LEU A 1 2   ? -9.194  -6.093  -8.047  1.00 0.00 ? 22  LEU A HB2  5  
ATOM 7180  H HB3  . LEU A 1 2   ? -9.432  -4.427  -7.608  1.00 1.00 ? 22  LEU A HB3  5  
ATOM 7181  H HG   . LEU A 1 2   ? -9.405  -5.402  -10.504 1.00 1.00 ? 22  LEU A HG   5  
ATOM 7182  H HD11 . LEU A 1 2   ? -10.681 -7.107  -9.273  1.00 1.00 ? 22  LEU A HD11 5  
ATOM 7183  H HD12 . LEU A 1 2   ? -11.716 -5.836  -8.575  1.00 1.00 ? 22  LEU A HD12 5  
ATOM 7184  H HD13 . LEU A 1 2   ? -11.718 -6.143  -10.323 1.00 1.00 ? 22  LEU A HD13 5  
ATOM 7185  H HD21 . LEU A 1 2   ? -9.770  -2.980  -9.994  1.00 1.00 ? 22  LEU A HD21 5  
ATOM 7186  H HD22 . LEU A 1 2   ? -11.121 -3.750  -10.844 1.00 1.00 ? 22  LEU A HD22 5  
ATOM 7187  H HD23 . LEU A 1 2   ? -11.237 -3.454  -9.098  1.00 1.00 ? 22  LEU A HD23 5  
ATOM 7188  N N    . VAL A 1 3   ? -7.179  -2.851  -7.106  1.00 1.00 ? 23  VAL A N    5  
ATOM 7189  C CA   . VAL A 1 3   ? -6.499  -2.273  -5.920  1.00 1.00 ? 23  VAL A CA   5  
ATOM 7190  C C    . VAL A 1 3   ? -6.800  -3.142  -4.670  1.00 1.00 ? 23  VAL A C    5  
ATOM 7191  O O    . VAL A 1 3   ? -7.589  -2.765  -3.796  1.00 1.00 ? 23  VAL A O    5  
ATOM 7192  C CB   . VAL A 1 3   ? -6.759  -0.755  -5.730  1.00 1.00 ? 23  VAL A CB   5  
ATOM 7193  C CG1  . VAL A 1 3   ? -5.946  -0.166  -4.556  1.00 1.00 ? 23  VAL A CG1  5  
ATOM 7194  C CG2  . VAL A 1 3   ? -6.364  0.034   -6.995  1.00 1.00 ? 23  VAL A CG2  5  
ATOM 7195  H H    . VAL A 1 3   ? -8.065  -2.450  -7.405  1.00 1.00 ? 23  VAL A H    5  
ATOM 7196  H HA   . VAL A 1 3   ? -5.425  -2.343  -6.085  1.00 1.00 ? 23  VAL A HA   5  
ATOM 7197  H HB   . VAL A 1 3   ? -7.817  -0.592  -5.538  1.00 1.00 ? 23  VAL A HB   5  
ATOM 7198  H HG11 . VAL A 1 3   ? -4.877  -0.296  -4.728  1.00 1.00 ? 23  VAL A HG11 5  
ATOM 7199  H HG12 . VAL A 1 3   ? -6.162  0.898   -4.452  1.00 1.00 ? 23  VAL A HG12 5  
ATOM 7200  H HG13 . VAL A 1 3   ? -6.214  -0.653  -3.618  1.00 1.00 ? 23  VAL A HG13 5  
ATOM 7201  H HG21 . VAL A 1 3   ? -5.327  -0.174  -7.268  1.00 1.00 ? 23  VAL A HG21 5  
ATOM 7202  H HG22 . VAL A 1 3   ? -7.014  -0.249  -7.826  1.00 1.00 ? 23  VAL A HG22 5  
ATOM 7203  H HG23 . VAL A 1 3   ? -6.481  1.107   -6.827  1.00 1.00 ? 23  VAL A HG23 5  
ATOM 7204  N N    . ARG A 1 4   ? -6.182  -4.343  -4.615  1.00 1.00 ? 24  ARG A N    5  
ATOM 7205  C CA   . ARG A 1 4   ? -6.143  -5.235  -3.440  1.00 1.00 ? 24  ARG A CA   5  
ATOM 7206  C C    . ARG A 1 4   ? -5.034  -4.774  -2.460  1.00 1.00 ? 24  ARG A C    5  
ATOM 7207  O O    . ARG A 1 4   ? -3.948  -4.371  -2.876  1.00 1.00 ? 24  ARG A O    5  
ATOM 7208  C CB   . ARG A 1 4   ? -5.845  -6.689  -3.847  1.00 1.00 ? 24  ARG A CB   5  
ATOM 7209  C CG   . ARG A 1 4   ? -6.707  -7.301  -4.957  1.00 1.00 ? 24  ARG A CG   5  
ATOM 7210  C CD   . ARG A 1 4   ? -6.271  -8.744  -5.231  1.00 1.00 ? 24  ARG A CD   5  
ATOM 7211  N NE   . ARG A 1 4   ? -7.098  -9.718  -4.496  1.00 1.00 ? 24  ARG A NE   5  
ATOM 7212  C CZ   . ARG A 1 4   ? -6.877  -11.020 -4.379  1.00 1.00 ? 24  ARG A CZ   5  
ATOM 7213  N NH1  . ARG A 1 4   ? -5.793  -11.597 -4.817  1.00 1.00 ? 24  ARG A NH1  5  
ATOM 7214  N NH2  . ARG A 1 4   ? -7.757  -11.792 -3.811  1.00 1.00 ? 24  ARG A NH2  5  
ATOM 7215  H H    . ARG A 1 4   ? -5.845  -4.713  -5.534  1.00 1.00 ? 24  ARG A H    5  
ATOM 7216  H HA   . ARG A 1 4   ? -7.107  -5.205  -2.923  1.00 1.00 ? 24  ARG A HA   5  
ATOM 7217  H HB2  . ARG A 1 4   ? -4.843  -6.737  -4.274  1.00 0.00 ? 24  ARG A HB2  5  
ATOM 7218  H HB3  . ARG A 1 4   ? -5.906  -7.322  -2.962  1.00 1.00 ? 24  ARG A HB3  5  
ATOM 7219  H HG2  . ARG A 1 4   ? -7.756  -7.289  -4.661  1.00 0.00 ? 24  ARG A HG2  5  
ATOM 7220  H HG3  . ARG A 1 4   ? -6.589  -6.730  -5.874  1.00 1.00 ? 24  ARG A HG3  5  
ATOM 7221  H HD2  . ARG A 1 4   ? -6.430  -8.992  -6.281  1.00 0.00 ? 24  ARG A HD2  5  
ATOM 7222  H HD3  . ARG A 1 4   ? -5.210  -8.869  -4.997  1.00 1.00 ? 24  ARG A HD3  5  
ATOM 7223  H HE   . ARG A 1 4   ? -7.895  -9.349  -3.993  1.00 1.00 ? 24  ARG A HE   5  
ATOM 7224  H HH11 . ARG A 1 4   ? -5.062  -11.037 -5.278  1.00 0.00 ? 24  ARG A HH11 5  
ATOM 7225  H HH12 . ARG A 1 4   ? -5.668  -12.613 -4.702  1.00 0.00 ? 24  ARG A HH12 5  
ATOM 7226  H HH21 . ARG A 1 4   ? -8.634  -11.393 -3.447  1.00 0.00 ? 24  ARG A HH21 5  
ATOM 7227  H HH22 . ARG A 1 4   ? -7.575  -12.803 -3.725  1.00 0.00 ? 24  ARG A HH22 5  
ATOM 7228  N N    . THR A 1 5   ? -5.309  -4.859  -1.153  1.00 1.00 ? 25  THR A N    5  
ATOM 7229  C CA   . THR A 1 5   ? -4.369  -4.633  -0.021  1.00 1.00 ? 25  THR A CA   5  
ATOM 7230  C C    . THR A 1 5   ? -3.534  -5.922  0.221   1.00 1.00 ? 25  THR A C    5  
ATOM 7231  O O    . THR A 1 5   ? -3.090  -6.547  -0.752  1.00 1.00 ? 25  THR A O    5  
ATOM 7232  C CB   . THR A 1 5   ? -5.148  -4.150  1.234   1.00 1.00 ? 25  THR A CB   5  
ATOM 7233  O OG1  . THR A 1 5   ? -6.159  -5.062  1.604   1.00 1.00 ? 25  THR A OG1  5  
ATOM 7234  C CG2  . THR A 1 5   ? -5.797  -2.776  1.075   1.00 1.00 ? 25  THR A CG2  5  
ATOM 7235  H H    . THR A 1 5   ? -6.221  -5.221  -0.910  1.00 1.00 ? 25  THR A H    5  
ATOM 7236  H HA   . THR A 1 5   ? -3.661  -3.851  -0.296  1.00 1.00 ? 25  THR A HA   5  
ATOM 7237  H HB   . THR A 1 5   ? -4.450  -4.073  2.061   1.00 1.00 ? 25  THR A HB   5  
ATOM 7238  H HG1  . THR A 1 5   ? -6.634  -4.668  2.345   1.00 1.00 ? 25  THR A HG1  5  
ATOM 7239  H HG21 . THR A 1 5   ? -5.041  -2.044  0.797   1.00 1.00 ? 25  THR A HG21 5  
ATOM 7240  H HG22 . THR A 1 5   ? -6.571  -2.802  0.307   1.00 1.00 ? 25  THR A HG22 5  
ATOM 7241  H HG23 . THR A 1 5   ? -6.246  -2.459  2.017   1.00 1.00 ? 25  THR A HG23 5  
ATOM 7242  N N    . ASP A 1 6   ? -3.325  -6.375  1.477   1.00 1.00 ? 26  ASP A N    5  
ATOM 7243  C CA   . ASP A 1 6   ? -2.730  -7.690  1.809   1.00 1.00 ? 26  ASP A CA   5  
ATOM 7244  C C    . ASP A 1 6   ? -3.368  -8.872  1.038   1.00 1.00 ? 26  ASP A C    5  
ATOM 7245  O O    . ASP A 1 6   ? -2.765  -9.939  0.946   1.00 1.00 ? 26  ASP A O    5  
ATOM 7246  C CB   . ASP A 1 6   ? -2.829  -7.921  3.328   1.00 1.00 ? 26  ASP A CB   5  
ATOM 7247  C CG   . ASP A 1 6   ? -1.728  -7.159  4.058   1.00 1.00 ? 26  ASP A CG   5  
ATOM 7248  O OD1  . ASP A 1 6   ? -0.545  -7.526  3.865   1.00 1.00 ? 26  ASP A OD1  5  
ATOM 7249  O OD2  . ASP A 1 6   ? -2.085  -6.179  4.746   1.00 1.00 ? 26  ASP A OD2  5  
ATOM 7250  H H    . ASP A 1 6   ? -3.583  -5.781  2.251   1.00 1.00 ? 26  ASP A H    5  
ATOM 7251  H HA   . ASP A 1 6   ? -1.677  -7.674  1.514   1.00 1.00 ? 26  ASP A HA   5  
ATOM 7252  H HB2  . ASP A 1 6   ? -3.792  -7.579  3.706   1.00 0.00 ? 26  ASP A HB2  5  
ATOM 7253  H HB3  . ASP A 1 6   ? -2.750  -8.984  3.581   1.00 1.00 ? 26  ASP A HB3  5  
ATOM 7254  N N    . SER A 1 7   ? -4.567  -8.671  0.457   1.00 1.00 ? 27  SER A N    5  
ATOM 7255  C CA   . SER A 1 7   ? -5.262  -9.571  -0.468  1.00 1.00 ? 27  SER A CA   5  
ATOM 7256  C C    . SER A 1 7   ? -5.936  -10.826 0.150   1.00 1.00 ? 27  SER A C    5  
ATOM 7257  O O    . SER A 1 7   ? -6.351  -11.670 -0.652  1.00 1.00 ? 27  SER A O    5  
ATOM 7258  C CB   . SER A 1 7   ? -4.313  -9.910  -1.646  1.00 1.00 ? 27  SER A CB   5  
ATOM 7259  O OG   . SER A 1 7   ? -3.847  -8.757  -2.347  1.00 1.00 ? 27  SER A OG   5  
ATOM 7260  H H    . SER A 1 7   ? -5.004  -7.781  0.654   1.00 1.00 ? 27  SER A H    5  
ATOM 7261  H HA   . SER A 1 7   ? -6.079  -8.995  -0.907  1.00 1.00 ? 27  SER A HA   5  
ATOM 7262  H HB2  . SER A 1 7   ? -3.401  -10.381 -1.279  1.00 0.00 ? 27  SER A HB2  5  
ATOM 7263  H HB3  . SER A 1 7   ? -4.799  -10.597 -2.342  1.00 1.00 ? 27  SER A HB3  5  
ATOM 7264  H HG   . SER A 1 7   ? -3.458  -8.121  -1.719  1.00 1.00 ? 27  SER A HG   5  
ATOM 7265  N N    . PRO A 1 8   ? -6.174  -10.986 1.491   1.00 1.00 ? 28  PRO A N    5  
ATOM 7266  C CA   . PRO A 1 8   ? -6.837  -12.164 2.096   1.00 1.00 ? 28  PRO A CA   5  
ATOM 7267  C C    . PRO A 1 8   ? -8.359  -12.310 1.809   1.00 1.00 ? 28  PRO A C    5  
ATOM 7268  O O    . PRO A 1 8   ? -9.066  -12.831 2.664   1.00 1.00 ? 28  PRO A O    5  
ATOM 7269  C CB   . PRO A 1 8   ? -6.592  -12.046 3.609   1.00 1.00 ? 28  PRO A CB   5  
ATOM 7270  C CG   . PRO A 1 8   ? -6.597  -10.539 3.821   1.00 1.00 ? 28  PRO A CG   5  
ATOM 7271  C CD   . PRO A 1 8   ? -5.893  -10.035 2.566   1.00 1.00 ? 28  PRO A CD   5  
ATOM 7272  H HA   . PRO A 1 8   ? -6.347  -13.074 1.744   1.00 1.00 ? 28  PRO A HA   5  
ATOM 7273  H HB2  . PRO A 1 8   ? -7.379  -12.544 4.177   1.00 0.00 ? 28  PRO A HB2  5  
ATOM 7274  H HB3  . PRO A 1 8   ? -5.620  -12.462 3.875   1.00 1.00 ? 28  PRO A HB3  5  
ATOM 7275  H HG2  . PRO A 1 8   ? -7.614  -10.160 3.929   1.00 0.00 ? 28  PRO A HG2  5  
ATOM 7276  H HG3  . PRO A 1 8   ? -6.045  -10.265 4.720   1.00 1.00 ? 28  PRO A HG3  5  
ATOM 7277  H HD2  . PRO A 1 8   ? -6.200  -9.043  2.239   1.00 0.00 ? 28  PRO A HD2  5  
ATOM 7278  H HD3  . PRO A 1 8   ? -4.824  -10.054 2.772   1.00 1.00 ? 28  PRO A HD3  5  
ATOM 7279  N N    . ASN A 1 9   ? -8.836  -11.825 0.645   1.00 1.00 ? 29  ASN A N    5  
ATOM 7280  C CA   . ASN A 1 9   ? -10.200 -11.723 0.064   1.00 1.00 ? 29  ASN A CA   5  
ATOM 7281  C C    . ASN A 1 9   ? -10.521 -10.315 -0.535  1.00 1.00 ? 29  ASN A C    5  
ATOM 7282  O O    . ASN A 1 9   ? -11.388 -10.226 -1.406  1.00 1.00 ? 29  ASN A O    5  
ATOM 7283  C CB   . ASN A 1 9   ? -11.331 -12.169 1.039   1.00 1.00 ? 29  ASN A CB   5  
ATOM 7284  C CG   . ASN A 1 9   ? -11.399 -13.658 1.401   1.00 1.00 ? 29  ASN A CG   5  
ATOM 7285  O OD1  . ASN A 1 9   ? -10.917 -14.549 0.716   1.00 1.00 ? 29  ASN A OD1  5  
ATOM 7286  N ND2  . ASN A 1 9   ? -12.050 -13.981 2.500   1.00 1.00 ? 29  ASN A ND2  5  
ATOM 7287  H H    . ASN A 1 9   ? -8.080  -11.574 0.019   1.00 1.00 ? 29  ASN A H    5  
ATOM 7288  H HA   . ASN A 1 9   ? -10.240 -12.413 -0.782  1.00 1.00 ? 29  ASN A HA   5  
ATOM 7289  H HB2  . ASN A 1 9   ? -11.210 -11.677 2.004   1.00 0.00 ? 29  ASN A HB2  5  
ATOM 7290  H HB3  . ASN A 1 9   ? -12.304 -11.906 0.630   1.00 1.00 ? 29  ASN A HB3  5  
ATOM 7291  H HD21 . ASN A 1 9   ? -12.485 -13.245 3.076   1.00 0.00 ? 29  ASN A HD21 5  
ATOM 7292  H HD22 . ASN A 1 9   ? -12.122 -14.968 2.784   1.00 0.00 ? 29  ASN A HD22 5  
ATOM 7293  N N    . PHE A 1 10  ? -9.814  -9.227  -0.156  1.00 1.00 ? 30  PHE A N    5  
ATOM 7294  C CA   . PHE A 1 10  ? -10.152 -7.835  -0.525  1.00 1.00 ? 30  PHE A CA   5  
ATOM 7295  C C    . PHE A 1 10  ? -9.614  -7.369  -1.895  1.00 1.00 ? 30  PHE A C    5  
ATOM 7296  O O    . PHE A 1 10  ? -8.475  -7.661  -2.273  1.00 1.00 ? 30  PHE A O    5  
ATOM 7297  C CB   . PHE A 1 10  ? -9.623  -6.876  0.562   1.00 1.00 ? 30  PHE A CB   5  
ATOM 7298  C CG   . PHE A 1 10  ? -10.220 -7.050  1.945   1.00 1.00 ? 30  PHE A CG   5  
ATOM 7299  C CD1  . PHE A 1 10  ? -11.569 -6.696  2.192   1.00 1.00 ? 30  PHE A CD1  5  
ATOM 7300  C CD2  . PHE A 1 10  ? -9.431  -7.596  2.981   1.00 1.00 ? 30  PHE A CD2  5  
ATOM 7301  C CE1  . PHE A 1 10  ? -12.137 -6.934  3.462   1.00 1.00 ? 30  PHE A CE1  5  
ATOM 7302  C CE2  . PHE A 1 10  ? -10.002 -7.832  4.250   1.00 1.00 ? 30  PHE A CE2  5  
ATOM 7303  C CZ   . PHE A 1 10  ? -11.357 -7.517  4.482   1.00 1.00 ? 30  PHE A CZ   5  
ATOM 7304  H H    . PHE A 1 10  ? -9.061  -9.358  0.504   1.00 1.00 ? 30  PHE A H    5  
ATOM 7305  H HA   . PHE A 1 10  ? -11.238 -7.739  -0.543  1.00 1.00 ? 30  PHE A HA   5  
ATOM 7306  H HB2  . PHE A 1 10  ? -8.563  -7.050  0.747   1.00 0.00 ? 30  PHE A HB2  5  
ATOM 7307  H HB3  . PHE A 1 10  ? -9.749  -5.835  0.254   1.00 1.00 ? 30  PHE A HB3  5  
ATOM 7308  H HD1  . PHE A 1 10  ? -12.173 -6.265  1.405   1.00 1.00 ? 30  PHE A HD1  5  
ATOM 7309  H HD2  . PHE A 1 10  ? -8.398  -7.852  2.803   1.00 1.00 ? 30  PHE A HD2  5  
ATOM 7310  H HE1  . PHE A 1 10  ? -13.174 -6.694  3.650   1.00 1.00 ? 30  PHE A HE1  5  
ATOM 7311  H HE2  . PHE A 1 10  ? -9.410  -8.272  5.043   1.00 1.00 ? 30  PHE A HE2  5  
ATOM 7312  H HZ   . PHE A 1 10  ? -11.797 -7.735  5.441   1.00 1.00 ? 30  PHE A HZ   5  
ATOM 7313  N N    . LEU A 1 11  ? -10.444 -6.593  -2.611  1.00 1.00 ? 31  LEU A N    5  
ATOM 7314  C CA   . LEU A 1 11  ? -10.148 -5.858  -3.852  1.00 1.00 ? 31  LEU A CA   5  
ATOM 7315  C C    . LEU A 1 11  ? -10.966 -4.546  -3.959  1.00 1.00 ? 31  LEU A C    5  
ATOM 7316  O O    . LEU A 1 11  ? -12.101 -4.459  -3.477  1.00 1.00 ? 31  LEU A O    5  
ATOM 7317  C CB   . LEU A 1 11  ? -10.326 -6.788  -5.074  1.00 1.00 ? 31  LEU A CB   5  
ATOM 7318  C CG   . LEU A 1 11  ? -11.655 -7.559  -5.278  1.00 1.00 ? 31  LEU A CG   5  
ATOM 7319  C CD1  . LEU A 1 11  ? -12.799 -6.644  -5.736  1.00 1.00 ? 31  LEU A CD1  5  
ATOM 7320  C CD2  . LEU A 1 11  ? -11.459 -8.660  -6.331  1.00 1.00 ? 31  LEU A CD2  5  
ATOM 7321  H H    . LEU A 1 11  ? -11.409 -6.530  -2.287  1.00 1.00 ? 31  LEU A H    5  
ATOM 7322  H HA   . LEU A 1 11  ? -9.097  -5.566  -3.821  1.00 1.00 ? 31  LEU A HA   5  
ATOM 7323  H HB2  . LEU A 1 11  ? -10.319 -6.169  -5.969  1.00 0.00 ? 31  LEU A HB2  5  
ATOM 7324  H HB3  . LEU A 1 11  ? -9.496  -7.495  -5.080  1.00 1.00 ? 31  LEU A HB3  5  
ATOM 7325  H HG   . LEU A 1 11  ? -11.942 -8.050  -4.350  1.00 1.00 ? 31  LEU A HG   5  
ATOM 7326  H HD11 . LEU A 1 11  ? -12.451 -5.935  -6.483  1.00 1.00 ? 31  LEU A HD11 5  
ATOM 7327  H HD12 . LEU A 1 11  ? -13.619 -7.230  -6.153  1.00 1.00 ? 31  LEU A HD12 5  
ATOM 7328  H HD13 . LEU A 1 11  ? -13.192 -6.098  -4.885  1.00 1.00 ? 31  LEU A HD13 5  
ATOM 7329  H HD21 . LEU A 1 11  ? -10.680 -9.352  -6.009  1.00 1.00 ? 31  LEU A HD21 5  
ATOM 7330  H HD22 . LEU A 1 11  ? -12.384 -9.226  -6.456  1.00 1.00 ? 31  LEU A HD22 5  
ATOM 7331  H HD23 . LEU A 1 11  ? -11.184 -8.224  -7.288  1.00 1.00 ? 31  LEU A HD23 5  
ATOM 7332  N N    . CYS A 1 12  ? -10.397 -3.531  -4.627  1.00 1.00 ? 32  CYS A N    5  
ATOM 7333  C CA   . CYS A 1 12  ? -11.042 -2.244  -4.914  1.00 1.00 ? 32  CYS A CA   5  
ATOM 7334  C C    . CYS A 1 12  ? -10.944 -1.829  -6.405  1.00 1.00 ? 32  CYS A C    5  
ATOM 7335  O O    . CYS A 1 12  ? -9.857  -1.733  -6.982  1.00 1.00 ? 32  CYS A O    5  
ATOM 7336  C CB   . CYS A 1 12  ? -10.491 -1.200  -3.932  1.00 1.00 ? 32  CYS A CB   5  
ATOM 7337  S SG   . CYS A 1 12  ? -11.599 0.226   -3.784  1.00 1.00 ? 32  CYS A SG   5  
ATOM 7338  H H    . CYS A 1 12  ? -9.407  -3.590  -4.825  1.00 1.00 ? 32  CYS A H    5  
ATOM 7339  H HA   . CYS A 1 12  ? -12.101 -2.351  -4.678  1.00 1.00 ? 32  CYS A HA   5  
ATOM 7340  H HB2  . CYS A 1 12  ? -10.443 -1.594  -2.917  1.00 0.00 ? 32  CYS A HB2  5  
ATOM 7341  H HB3  . CYS A 1 12  ? -9.484  -0.886  -4.207  1.00 1.00 ? 32  CYS A HB3  5  
ATOM 7342  H HG   . CYS A 1 12  ? -12.674 -0.448  -3.365  1.00 1.00 ? 32  CYS A HG   5  
ATOM 7343  N N    . SER A 1 13  ? -12.116 -1.620  -7.021  1.00 1.00 ? 33  SER A N    5  
ATOM 7344  C CA   . SER A 1 13  ? -12.387 -1.086  -8.360  1.00 1.00 ? 33  SER A CA   5  
ATOM 7345  C C    . SER A 1 13  ? -12.499 0.445   -8.264  1.00 1.00 ? 33  SER A C    5  
ATOM 7346  O O    . SER A 1 13  ? -13.533 0.992   -7.861  1.00 1.00 ? 33  SER A O    5  
ATOM 7347  C CB   . SER A 1 13  ? -13.649 -1.744  -8.933  1.00 1.00 ? 33  SER A CB   5  
ATOM 7348  O OG   . SER A 1 13  ? -13.686 -1.704  -10.346 1.00 1.00 ? 33  SER A OG   5  
ATOM 7349  H H    . SER A 1 13  ? -12.945 -1.705  -6.434  1.00 1.00 ? 33  SER A H    5  
ATOM 7350  H HA   . SER A 1 13  ? -11.556 -1.334  -9.015  1.00 1.00 ? 33  SER A HA   5  
ATOM 7351  H HB2  . SER A 1 13  ? -13.670 -2.817  -8.741  1.00 0.00 ? 33  SER A HB2  5  
ATOM 7352  H HB3  . SER A 1 13  ? -14.558 -1.326  -8.500  1.00 1.00 ? 33  SER A HB3  5  
ATOM 7353  H HG   . SER A 1 13  ? -13.894 -0.808  -10.634 1.00 1.00 ? 33  SER A HG   5  
ATOM 7354  N N    . VAL A 1 14  ? -11.373 1.102   -8.570  1.00 1.00 ? 34  VAL A N    5  
ATOM 7355  C CA   . VAL A 1 14  ? -11.059 2.548   -8.479  1.00 1.00 ? 34  VAL A CA   5  
ATOM 7356  C C    . VAL A 1 14  ? -9.994  2.953   -9.521  1.00 1.00 ? 34  VAL A C    5  
ATOM 7357  O O    . VAL A 1 14  ? -9.235  2.103   -9.996  1.00 1.00 ? 34  VAL A O    5  
ATOM 7358  C CB   . VAL A 1 14  ? -10.510 2.918   -7.068  1.00 1.00 ? 34  VAL A CB   5  
ATOM 7359  C CG1  . VAL A 1 14  ? -11.607 2.963   -6.005  1.00 1.00 ? 34  VAL A CG1  5  
ATOM 7360  C CG2  . VAL A 1 14  ? -9.360  2.012   -6.576  1.00 1.00 ? 34  VAL A CG2  5  
ATOM 7361  H H    . VAL A 1 14  ? -10.604 0.527   -8.881  1.00 1.00 ? 34  VAL A H    5  
ATOM 7362  H HA   . VAL A 1 14  ? -11.967 3.126   -8.670  1.00 1.00 ? 34  VAL A HA   5  
ATOM 7363  H HB   . VAL A 1 14  ? -10.112 3.932   -7.117  1.00 1.00 ? 34  VAL A HB   5  
ATOM 7364  H HG11 . VAL A 1 14  ? -12.133 2.012   -5.940  1.00 1.00 ? 34  VAL A HG11 5  
ATOM 7365  H HG12 . VAL A 1 14  ? -11.154 3.175   -5.038  1.00 1.00 ? 34  VAL A HG12 5  
ATOM 7366  H HG13 . VAL A 1 14  ? -12.316 3.756   -6.248  1.00 1.00 ? 34  VAL A HG13 5  
ATOM 7367  H HG21 . VAL A 1 14  ? -8.588  1.943   -7.340  1.00 1.00 ? 34  VAL A HG21 5  
ATOM 7368  H HG22 . VAL A 1 14  ? -8.919  2.424   -5.669  1.00 1.00 ? 34  VAL A HG22 5  
ATOM 7369  H HG23 . VAL A 1 14  ? -9.731  1.007   -6.362  1.00 1.00 ? 34  VAL A HG23 5  
ATOM 7370  N N    . LEU A 1 15  ? -9.873  4.263   -9.801  1.00 1.00 ? 35  LEU A N    5  
ATOM 7371  C CA   . LEU A 1 15  ? -8.829  4.858   -10.657 1.00 1.00 ? 35  LEU A CA   5  
ATOM 7372  C C    . LEU A 1 15  ? -8.055  6.005   -9.939  1.00 1.00 ? 35  LEU A C    5  
ATOM 7373  O O    . LEU A 1 15  ? -8.293  7.180   -10.227 1.00 1.00 ? 35  LEU A O    5  
ATOM 7374  C CB   . LEU A 1 15  ? -9.461  5.224   -12.021 1.00 1.00 ? 35  LEU A CB   5  
ATOM 7375  C CG   . LEU A 1 15  ? -8.561  5.468   -13.253 1.00 1.00 ? 35  LEU A CG   5  
ATOM 7376  C CD1  . LEU A 1 15  ? -7.852  6.832   -13.249 1.00 1.00 ? 35  LEU A CD1  5  
ATOM 7377  C CD2  . LEU A 1 15  ? -7.532  4.340   -13.422 1.00 1.00 ? 35  LEU A CD2  5  
ATOM 7378  H H    . LEU A 1 15  ? -10.558 4.882   -9.400  1.00 1.00 ? 35  LEU A H    5  
ATOM 7379  H HA   . LEU A 1 15  ? -8.094  4.081   -10.858 1.00 1.00 ? 35  LEU A HA   5  
ATOM 7380  H HB2  . LEU A 1 15  ? -9.954  4.370   -12.486 1.00 0.00 ? 35  LEU A HB2  5  
ATOM 7381  H HB3  . LEU A 1 15  ? -10.211 6.008   -11.927 1.00 1.00 ? 35  LEU A HB3  5  
ATOM 7382  H HG   . LEU A 1 15  ? -9.215  5.449   -14.125 1.00 1.00 ? 35  LEU A HG   5  
ATOM 7383  H HD11 . LEU A 1 15  ? -8.567  7.631   -13.052 1.00 1.00 ? 35  LEU A HD11 5  
ATOM 7384  H HD12 . LEU A 1 15  ? -7.078  6.860   -12.483 1.00 1.00 ? 35  LEU A HD12 5  
ATOM 7385  H HD13 . LEU A 1 15  ? -7.391  7.013   -14.219 1.00 1.00 ? 35  LEU A HD13 5  
ATOM 7386  H HD21 . LEU A 1 15  ? -8.036  3.374   -13.405 1.00 1.00 ? 35  LEU A HD21 5  
ATOM 7387  H HD22 . LEU A 1 15  ? -7.011  4.449   -14.372 1.00 1.00 ? 35  LEU A HD22 5  
ATOM 7388  H HD23 . LEU A 1 15  ? -6.795  4.367   -12.618 1.00 1.00 ? 35  LEU A HD23 5  
ATOM 7389  N N    . PRO A 1 16  ? -7.132  5.687   -8.992  1.00 1.00 ? 36  PRO A N    5  
ATOM 7390  C CA   . PRO A 1 16  ? -6.302  6.672   -8.278  1.00 1.00 ? 36  PRO A CA   5  
ATOM 7391  C C    . PRO A 1 16  ? -5.127  7.223   -9.117  1.00 1.00 ? 36  PRO A C    5  
ATOM 7392  O O    . PRO A 1 16  ? -4.794  8.401   -9.022  1.00 1.00 ? 36  PRO A O    5  
ATOM 7393  C CB   . PRO A 1 16  ? -5.756  5.934   -7.047  1.00 1.00 ? 36  PRO A CB   5  
ATOM 7394  C CG   . PRO A 1 16  ? -5.709  4.473   -7.496  1.00 1.00 ? 36  PRO A CG   5  
ATOM 7395  C CD   . PRO A 1 16  ? -6.851  4.344   -8.501  1.00 1.00 ? 36  PRO A CD   5  
ATOM 7396  H HA   . PRO A 1 16  ? -6.921  7.510   -7.951  1.00 1.00 ? 36  PRO A HA   5  
ATOM 7397  H HB2  . PRO A 1 16  ? -4.767  6.305   -6.777  1.00 0.00 ? 36  PRO A HB2  5  
ATOM 7398  H HB3  . PRO A 1 16  ? -6.458  6.037   -6.218  1.00 1.00 ? 36  PRO A HB3  5  
ATOM 7399  H HG2  . PRO A 1 16  ? -4.755  4.228   -7.965  1.00 0.00 ? 36  PRO A HG2  5  
ATOM 7400  H HG3  . PRO A 1 16  ? -5.842  3.790   -6.654  1.00 1.00 ? 36  PRO A HG3  5  
ATOM 7401  H HD2  . PRO A 1 16  ? -6.608  3.705   -9.350  1.00 0.00 ? 36  PRO A HD2  5  
ATOM 7402  H HD3  . PRO A 1 16  ? -7.733  3.968   -7.986  1.00 1.00 ? 36  PRO A HD3  5  
ATOM 7403  N N    . THR A 1 17  ? -4.460  6.349   -9.889  1.00 1.00 ? 37  THR A N    5  
ATOM 7404  C CA   . THR A 1 17  ? -3.255  6.544   -10.733 1.00 1.00 ? 37  THR A CA   5  
ATOM 7405  C C    . THR A 1 17  ? -2.220  7.481   -10.081 1.00 1.00 ? 37  THR A C    5  
ATOM 7406  O O    . THR A 1 17  ? -1.646  8.352   -10.731 1.00 1.00 ? 37  THR A O    5  
ATOM 7407  C CB   . THR A 1 17  ? -3.596  6.883   -12.209 1.00 1.00 ? 37  THR A CB   5  
ATOM 7408  O OG1  . THR A 1 17  ? -4.563  5.972   -12.681 1.00 1.00 ? 37  THR A OG1  5  
ATOM 7409  C CG2  . THR A 1 17  ? -2.436  6.695   -13.200 1.00 1.00 ? 37  THR A CG2  5  
ATOM 7410  H H    . THR A 1 17  ? -4.835  5.420   -9.870  1.00 1.00 ? 37  THR A H    5  
ATOM 7411  H HA   . THR A 1 17  ? -2.771  5.571   -10.773 1.00 1.00 ? 37  THR A HA   5  
ATOM 7412  H HB   . THR A 1 17  ? -3.987  7.895   -12.285 1.00 1.00 ? 37  THR A HB   5  
ATOM 7413  H HG1  . THR A 1 17  ? -4.716  6.173   -13.606 1.00 1.00 ? 37  THR A HG1  5  
ATOM 7414  H HG21 . THR A 1 17  ? -2.028  5.686   -13.129 1.00 1.00 ? 37  THR A HG21 5  
ATOM 7415  H HG22 . THR A 1 17  ? -2.774  6.868   -14.224 1.00 1.00 ? 37  THR A HG22 5  
ATOM 7416  H HG23 . THR A 1 17  ? -1.641  7.414   -13.000 1.00 1.00 ? 37  THR A HG23 5  
ATOM 7417  N N    . HIS A 1 18  ? -1.972  7.244   -8.778  1.00 1.00 ? 38  HIS A N    5  
ATOM 7418  C CA   . HIS A 1 18  ? -0.943  7.863   -7.906  1.00 1.00 ? 38  HIS A CA   5  
ATOM 7419  C C    . HIS A 1 18  ? -0.827  9.399   -8.060  1.00 1.00 ? 38  HIS A C    5  
ATOM 7420  O O    . HIS A 1 18  ? -0.088  9.895   -8.917  1.00 1.00 ? 38  HIS A O    5  
ATOM 7421  C CB   . HIS A 1 18  ? 0.404   7.138   -8.125  1.00 1.00 ? 38  HIS A CB   5  
ATOM 7422  C CG   . HIS A 1 18  ? 0.798   6.837   -9.551  1.00 1.00 ? 38  HIS A CG   5  
ATOM 7423  N ND1  . HIS A 1 18  ? 1.122   7.778   -10.507 1.00 1.00 ? 38  HIS A ND1  5  
ATOM 7424  C CD2  . HIS A 1 18  ? 0.671   5.625   -10.168 1.00 1.00 ? 38  HIS A CD2  5  
ATOM 7425  C CE1  . HIS A 1 18  ? 1.237   7.137   -11.689 1.00 1.00 ? 38  HIS A CE1  5  
ATOM 7426  N NE2  . HIS A 1 18  ? 0.973   5.819   -11.505 1.00 1.00 ? 38  HIS A NE2  5  
ATOM 7427  H H    . HIS A 1 18  ? -2.599  6.537   -8.413  1.00 1.00 ? 38  HIS A H    5  
ATOM 7428  H HA   . HIS A 1 18  ? -1.235  7.665   -6.874  1.00 1.00 ? 38  HIS A HA   5  
ATOM 7429  H HB2  . HIS A 1 18  ? 1.229   7.782   -7.821  1.00 0.00 ? 38  HIS A HB2  5  
ATOM 7430  H HB3  . HIS A 1 18  ? 0.436   6.223   -7.535  1.00 1.00 ? 38  HIS A HB3  5  
ATOM 7431  H HD1  . HIS A 1 18  ? 0.985   8.780   -10.351 1.00 1.00 ? 38  HIS A HD1  5  
ATOM 7432  H HD2  . HIS A 1 18  ? 0.308   4.720   -9.702  1.00 1.00 ? 38  HIS A HD2  5  
ATOM 7433  H HE1  . HIS A 1 18  ? 1.425   7.626   -12.643 1.00 1.00 ? 38  HIS A HE1  5  
ATOM 7434  H HE2  . HIS A 1 18  ? 0.903   5.102   -12.214 1.00 1.00 ? 38  HIS A HE2  5  
ATOM 7435  N N    . TRP A 1 19  ? -1.532  10.155  -7.206  1.00 1.00 ? 39  TRP A N    5  
ATOM 7436  C CA   . TRP A 1 19  ? -1.734  11.615  -7.210  1.00 1.00 ? 39  TRP A CA   5  
ATOM 7437  C C    . TRP A 1 19  ? -2.401  12.032  -5.869  1.00 1.00 ? 39  TRP A C    5  
ATOM 7438  O O    . TRP A 1 19  ? -2.673  11.170  -5.027  1.00 1.00 ? 39  TRP A O    5  
ATOM 7439  C CB   . TRP A 1 19  ? -2.495  12.064  -8.483  1.00 1.00 ? 39  TRP A CB   5  
ATOM 7440  C CG   . TRP A 1 19  ? -3.906  12.568  -8.452  1.00 1.00 ? 39  TRP A CG   5  
ATOM 7441  C CD1  . TRP A 1 19  ? -4.967  11.945  -7.890  1.00 1.00 ? 39  TRP A CD1  5  
ATOM 7442  C CD2  . TRP A 1 19  ? -4.422  13.809  -9.026  1.00 1.00 ? 39  TRP A CD2  5  
ATOM 7443  N NE1  . TRP A 1 19  ? -6.095  12.733  -8.032  1.00 1.00 ? 39  TRP A NE1  5  
ATOM 7444  C CE2  . TRP A 1 19  ? -5.819  13.895  -8.723  1.00 1.00 ? 39  TRP A CE2  5  
ATOM 7445  C CE3  . TRP A 1 19  ? -3.849  14.873  -9.772  1.00 1.00 ? 39  TRP A CE3  5  
ATOM 7446  C CZ2  . TRP A 1 19  ? -6.608  14.993  -9.121  1.00 1.00 ? 39  TRP A CZ2  5  
ATOM 7447  C CZ3  . TRP A 1 19  ? -4.630  15.982  -10.172 1.00 1.00 ? 39  TRP A CZ3  5  
ATOM 7448  C CH2  . TRP A 1 19  ? -6.002  16.046  -9.841  1.00 1.00 ? 39  TRP A CH2  5  
ATOM 7449  H H    . TRP A 1 19  ? -1.852  9.765   -6.316  1.00 1.00 ? 39  TRP A H    5  
ATOM 7450  H HA   . TRP A 1 19  ? -0.761  12.100  -7.241  1.00 1.00 ? 39  TRP A HA   5  
ATOM 7451  H HB2  . TRP A 1 19  ? -2.194  13.085  -8.718  1.00 0.00 ? 39  TRP A HB2  5  
ATOM 7452  H HB3  . TRP A 1 19  ? -2.298  11.448  -9.363  1.00 1.00 ? 39  TRP A HB3  5  
ATOM 7453  H HD1  . TRP A 1 19  ? -4.923  10.986  -7.392  1.00 1.00 ? 39  TRP A HD1  5  
ATOM 7454  H HE1  . TRP A 1 19  ? -7.008  12.487  -7.675  1.00 1.00 ? 39  TRP A HE1  5  
ATOM 7455  H HE3  . TRP A 1 19  ? -2.806  14.829  -10.041 1.00 1.00 ? 39  TRP A HE3  5  
ATOM 7456  H HZ2  . TRP A 1 19  ? -7.658  15.035  -8.874  1.00 1.00 ? 39  TRP A HZ2  5  
ATOM 7457  H HZ3  . TRP A 1 19  ? -4.180  16.788  -10.737 1.00 1.00 ? 39  TRP A HZ3  5  
ATOM 7458  H HH2  . TRP A 1 19  ? -6.591  16.900  -10.148 1.00 1.00 ? 39  TRP A HH2  5  
ATOM 7459  N N    . ARG A 1 20  ? -2.616  13.332  -5.637  1.00 1.00 ? 40  ARG A N    5  
ATOM 7460  C CA   . ARG A 1 20  ? -3.263  13.867  -4.419  1.00 1.00 ? 40  ARG A CA   5  
ATOM 7461  C C    . ARG A 1 20  ? -4.556  14.647  -4.697  1.00 1.00 ? 40  ARG A C    5  
ATOM 7462  O O    . ARG A 1 20  ? -4.871  14.990  -5.835  1.00 1.00 ? 40  ARG A O    5  
ATOM 7463  C CB   . ARG A 1 20  ? -2.243  14.652  -3.566  1.00 1.00 ? 40  ARG A CB   5  
ATOM 7464  C CG   . ARG A 1 20  ? -2.009  16.118  -3.953  1.00 1.00 ? 40  ARG A CG   5  
ATOM 7465  C CD   . ARG A 1 20  ? -0.997  16.832  -3.052  1.00 1.00 ? 40  ARG A CD   5  
ATOM 7466  N NE   . ARG A 1 20  ? 0.265   17.084  -3.771  1.00 1.00 ? 40  ARG A NE   5  
ATOM 7467  C CZ   . ARG A 1 20  ? 1.171   18.018  -3.529  1.00 1.00 ? 40  ARG A CZ   5  
ATOM 7468  N NH1  . ARG A 1 20  ? 1.139   18.812  -2.501  1.00 1.00 ? 40  ARG A NH1  5  
ATOM 7469  N NH2  . ARG A 1 20  ? 2.180   18.215  -4.322  1.00 1.00 ? 40  ARG A NH2  5  
ATOM 7470  H H    . ARG A 1 20  ? -2.416  13.975  -6.390  1.00 1.00 ? 40  ARG A H    5  
ATOM 7471  H HA   . ARG A 1 20  ? -3.592  13.017  -3.812  1.00 1.00 ? 40  ARG A HA   5  
ATOM 7472  H HB2  . ARG A 1 20  ? -2.626  14.827  -2.561  1.00 0.00 ? 40  ARG A HB2  5  
ATOM 7473  H HB3  . ARG A 1 20  ? -1.303  14.102  -3.475  1.00 1.00 ? 40  ARG A HB3  5  
ATOM 7474  H HG2  . ARG A 1 20  ? -1.595  16.183  -4.960  1.00 0.00 ? 40  ARG A HG2  5  
ATOM 7475  H HG3  . ARG A 1 20  ? -2.946  16.671  -3.927  1.00 1.00 ? 40  ARG A HG3  5  
ATOM 7476  H HD2  . ARG A 1 20  ? -1.341  17.832  -2.790  1.00 0.00 ? 40  ARG A HD2  5  
ATOM 7477  H HD3  . ARG A 1 20  ? -0.837  16.280  -2.124  1.00 1.00 ? 40  ARG A HD3  5  
ATOM 7478  H HE   . ARG A 1 20  ? 0.342   16.651  -4.681  1.00 1.00 ? 40  ARG A HE   5  
ATOM 7479  H HH11 . ARG A 1 20  ? 0.374   18.736  -1.815  1.00 0.00 ? 40  ARG A HH11 5  
ATOM 7480  H HH12 . ARG A 1 20  ? 1.878   19.519  -2.371  1.00 0.00 ? 40  ARG A HH12 5  
ATOM 7481  H HH21 . ARG A 1 20  ? 2.291   17.636  -5.167  1.00 0.00 ? 40  ARG A HH21 5  
ATOM 7482  H HH22 . ARG A 1 20  ? 2.869   18.949  -4.106  1.00 0.00 ? 40  ARG A HH22 5  
ATOM 7483  N N    . CYS A 1 21  ? -5.302  14.904  -3.616  1.00 1.00 ? 41  CYS A N    5  
ATOM 7484  C CA   . CYS A 1 21  ? -6.502  15.754  -3.570  1.00 1.00 ? 41  CYS A CA   5  
ATOM 7485  C C    . CYS A 1 21  ? -7.818  15.182  -4.150  1.00 1.00 ? 41  CYS A C    5  
ATOM 7486  O O    . CYS A 1 21  ? -8.780  15.940  -4.226  1.00 1.00 ? 41  CYS A O    5  
ATOM 7487  C CB   . CYS A 1 21  ? -6.152  17.146  -4.135  1.00 1.00 ? 41  CYS A CB   5  
ATOM 7488  S SG   . CYS A 1 21  ? -5.769  18.286  -2.783  1.00 1.00 ? 41  CYS A SG   5  
ATOM 7489  H H    . CYS A 1 21  ? -4.884  14.595  -2.744  1.00 1.00 ? 41  CYS A H    5  
ATOM 7490  H HA   . CYS A 1 21  ? -6.713  15.893  -2.512  1.00 1.00 ? 41  CYS A HA   5  
ATOM 7491  H HB2  . CYS A 1 21  ? -5.265  17.127  -4.769  1.00 0.00 ? 41  CYS A HB2  5  
ATOM 7492  H HB3  . CYS A 1 21  ? -6.960  17.563  -4.746  1.00 1.00 ? 41  CYS A HB3  5  
ATOM 7493  H HG   . CYS A 1 21  ? -5.208  19.222  -3.573  1.00 1.00 ? 41  CYS A HG   5  
ATOM 7494  N N    . ASN A 1 22  ? -7.922  13.870  -4.439  1.00 1.00 ? 42  ASN A N    5  
ATOM 7495  C CA   . ASN A 1 22  ? -9.018  13.107  -5.073  1.00 1.00 ? 42  ASN A CA   5  
ATOM 7496  C C    . ASN A 1 22  ? -10.444 13.728  -5.049  1.00 1.00 ? 42  ASN A C    5  
ATOM 7497  O O    . ASN A 1 22  ? -11.118 13.745  -6.077  1.00 1.00 ? 42  ASN A O    5  
ATOM 7498  C CB   . ASN A 1 22  ? -8.980  11.711  -4.430  1.00 1.00 ? 42  ASN A CB   5  
ATOM 7499  C CG   . ASN A 1 22  ? -9.659  10.613  -5.237  1.00 1.00 ? 42  ASN A CG   5  
ATOM 7500  O OD1  . ASN A 1 22  ? -9.247  10.298  -6.337  1.00 1.00 ? 42  ASN A OD1  5  
ATOM 7501  N ND2  . ASN A 1 22  ? -10.708 9.991   -4.743  1.00 1.00 ? 42  ASN A ND2  5  
ATOM 7502  H H    . ASN A 1 22  ? -7.099  13.334  -4.225  1.00 1.00 ? 42  ASN A H    5  
ATOM 7503  H HA   . ASN A 1 22  ? -8.756  13.008  -6.127  1.00 1.00 ? 42  ASN A HA   5  
ATOM 7504  H HB2  . ASN A 1 22  ? -7.948  11.363  -4.372  1.00 0.00 ? 42  ASN A HB2  5  
ATOM 7505  H HB3  . ASN A 1 22  ? -9.396  11.759  -3.437  1.00 1.00 ? 42  ASN A HB3  5  
ATOM 7506  H HD21 . ASN A 1 22  ? -11.067 10.247  -3.812  1.00 0.00 ? 42  ASN A HD21 5  
ATOM 7507  H HD22 . ASN A 1 22  ? -11.169 9.247   -5.286  1.00 0.00 ? 42  ASN A HD22 5  
ATOM 7508  N N    . LYS A 1 23  ? -10.872 14.220  -3.873  1.00 1.00 ? 43  LYS A N    5  
ATOM 7509  C CA   . LYS A 1 23  ? -12.073 15.018  -3.490  1.00 1.00 ? 43  LYS A CA   5  
ATOM 7510  C C    . LYS A 1 23  ? -13.480 14.504  -3.867  1.00 1.00 ? 43  LYS A C    5  
ATOM 7511  O O    . LYS A 1 23  ? -14.418 14.780  -3.119  1.00 1.00 ? 43  LYS A O    5  
ATOM 7512  C CB   . LYS A 1 23  ? -11.841 16.474  -3.952  1.00 1.00 ? 43  LYS A CB   5  
ATOM 7513  C CG   . LYS A 1 23  ? -12.793 17.524  -3.360  1.00 1.00 ? 43  LYS A CG   5  
ATOM 7514  C CD   . LYS A 1 23  ? -13.768 18.114  -4.391  1.00 1.00 ? 43  LYS A CD   5  
ATOM 7515  C CE   . LYS A 1 23  ? -13.359 19.495  -4.913  1.00 1.00 ? 43  LYS A CE   5  
ATOM 7516  N NZ   . LYS A 1 23  ? -14.178 19.895  -6.075  1.00 1.00 ? 43  LYS A NZ   5  
ATOM 7517  H H    . LYS A 1 23  ? -10.101 14.186  -3.222  1.00 1.00 ? 43  LYS A H    5  
ATOM 7518  H HA   . LYS A 1 23  ? -12.101 15.045  -2.399  1.00 1.00 ? 43  LYS A HA   5  
ATOM 7519  H HB2  . LYS A 1 23  ? -10.919 16.884  -3.538  1.00 0.00 ? 43  LYS A HB2  5  
ATOM 7520  H HB3  . LYS A 1 23  ? -11.768 16.545  -5.038  1.00 1.00 ? 43  LYS A HB3  5  
ATOM 7521  H HG2  . LYS A 1 23  ? -13.471 17.064  -2.641  1.00 0.00 ? 43  LYS A HG2  5  
ATOM 7522  H HG3  . LYS A 1 23  ? -12.231 18.308  -2.850  1.00 1.00 ? 43  LYS A HG3  5  
ATOM 7523  H HD2  . LYS A 1 23  ? -13.776 17.485  -5.282  1.00 0.00 ? 43  LYS A HD2  5  
ATOM 7524  H HD3  . LYS A 1 23  ? -14.770 18.151  -3.961  1.00 1.00 ? 43  LYS A HD3  5  
ATOM 7525  H HE2  . LYS A 1 23  ? -13.551 20.259  -4.158  1.00 0.00 ? 43  LYS A HE2  5  
ATOM 7526  H HE3  . LYS A 1 23  ? -12.296 19.511  -5.159  1.00 1.00 ? 43  LYS A HE3  5  
ATOM 7527  H HZ1  . LYS A 1 23  ? -14.725 19.087  -6.405  1.00 0.00 ? 43  LYS A HZ1  5  
ATOM 7528  H HZ2  . LYS A 1 23  ? -14.818 20.653  -5.799  1.00 0.00 ? 43  LYS A HZ2  5  
ATOM 7529  N N    . THR A 1 24  ? -13.624 13.761  -4.972  1.00 1.00 ? 44  THR A N    5  
ATOM 7530  C CA   . THR A 1 24  ? -14.807 13.174  -5.663  1.00 1.00 ? 44  THR A CA   5  
ATOM 7531  C C    . THR A 1 24  ? -14.577 13.305  -7.177  1.00 1.00 ? 44  THR A C    5  
ATOM 7532  O O    . THR A 1 24  ? -15.030 14.265  -7.801  1.00 1.00 ? 44  THR A O    5  
ATOM 7533  C CB   . THR A 1 24  ? -16.196 13.756  -5.262  1.00 1.00 ? 44  THR A CB   5  
ATOM 7534  O OG1  . THR A 1 24  ? -16.445 13.508  -3.904  1.00 1.00 ? 44  THR A OG1  5  
ATOM 7535  C CG2  . THR A 1 24  ? -17.392 13.152  -6.012  1.00 1.00 ? 44  THR A CG2  5  
ATOM 7536  H H    . THR A 1 24  ? -12.739 13.676  -5.464  1.00 1.00 ? 44  THR A H    5  
ATOM 7537  H HA   . THR A 1 24  ? -14.835 12.111  -5.414  1.00 1.00 ? 44  THR A HA   5  
ATOM 7538  H HB   . THR A 1 24  ? -16.190 14.835  -5.421  1.00 1.00 ? 44  THR A HB   5  
ATOM 7539  H HG1  . THR A 1 24  ? -15.740 14.003  -3.423  1.00 1.00 ? 44  THR A HG1  5  
ATOM 7540  H HG21 . THR A 1 24  ? -17.428 12.073  -5.854  1.00 1.00 ? 44  THR A HG21 5  
ATOM 7541  H HG22 . THR A 1 24  ? -18.314 13.601  -5.640  1.00 1.00 ? 44  THR A HG22 5  
ATOM 7542  H HG23 . THR A 1 24  ? -17.325 13.364  -7.078  1.00 1.00 ? 44  THR A HG23 5  
ATOM 7543  N N    . LEU A 1 25  ? -13.827 12.361  -7.764  1.00 1.00 ? 45  LEU A N    5  
ATOM 7544  C CA   . LEU A 1 25  ? -13.587 12.271  -9.207  1.00 1.00 ? 45  LEU A CA   5  
ATOM 7545  C C    . LEU A 1 25  ? -14.745 11.546  -9.952  1.00 1.00 ? 45  LEU A C    5  
ATOM 7546  O O    . LEU A 1 25  ? -15.412 10.697  -9.347  1.00 1.00 ? 45  LEU A O    5  
ATOM 7547  C CB   . LEU A 1 25  ? -12.228 11.564  -9.348  1.00 1.00 ? 45  LEU A CB   5  
ATOM 7548  C CG   . LEU A 1 25  ? -11.036 12.377  -9.890  1.00 1.00 ? 45  LEU A CG   5  
ATOM 7549  C CD1  . LEU A 1 25  ? -9.805  12.104  -9.023  1.00 1.00 ? 45  LEU A CD1  5  
ATOM 7550  C CD2  . LEU A 1 25  ? -10.737 12.020  -11.350 1.00 1.00 ? 45  LEU A CD2  5  
ATOM 7551  H H    . LEU A 1 25  ? -13.455 11.606  -7.207  1.00 1.00 ? 45  LEU A H    5  
ATOM 7552  H HA   . LEU A 1 25  ? -13.507 13.287  -9.599  1.00 1.00 ? 45  LEU A HA   5  
ATOM 7553  H HB2  . LEU A 1 25  ? -11.778 11.482  -8.359  1.00 0.00 ? 45  LEU A HB2  5  
ATOM 7554  H HB3  . LEU A 1 25  ? -12.293 10.565  -9.767  1.00 1.00 ? 45  LEU A HB3  5  
ATOM 7555  H HG   . LEU A 1 25  ? -11.259 13.442  -9.829  1.00 1.00 ? 45  LEU A HG   5  
ATOM 7556  H HD11 . LEU A 1 25  ? -10.020 12.376  -7.992  1.00 1.00 ? 45  LEU A HD11 5  
ATOM 7557  H HD12 . LEU A 1 25  ? -9.539  11.046  -9.057  1.00 1.00 ? 45  LEU A HD12 5  
ATOM 7558  H HD13 . LEU A 1 25  ? -8.962  12.697  -9.377  1.00 1.00 ? 45  LEU A HD13 5  
ATOM 7559  H HD21 . LEU A 1 25  ? -11.604 12.221  -11.973 1.00 1.00 ? 45  LEU A HD21 5  
ATOM 7560  H HD22 . LEU A 1 25  ? -9.905  12.621  -11.714 1.00 1.00 ? 45  LEU A HD22 5  
ATOM 7561  H HD23 . LEU A 1 25  ? -10.476 10.963  -11.435 1.00 1.00 ? 45  LEU A HD23 5  
ATOM 7562  N N    . PRO A 1 26  ? -14.976 11.809  -11.266 1.00 1.00 ? 46  PRO A N    5  
ATOM 7563  C CA   . PRO A 1 26  ? -16.074 11.232  -12.081 1.00 1.00 ? 46  PRO A CA   5  
ATOM 7564  C C    . PRO A 1 26  ? -15.958 9.710   -12.392 1.00 1.00 ? 46  PRO A C    5  
ATOM 7565  O O    . PRO A 1 26  ? -16.309 9.257   -13.480 1.00 1.00 ? 46  PRO A O    5  
ATOM 7566  C CB   . PRO A 1 26  ? -16.130 12.086  -13.359 1.00 1.00 ? 46  PRO A CB   5  
ATOM 7567  C CG   . PRO A 1 26  ? -14.708 12.613  -13.504 1.00 1.00 ? 46  PRO A CG   5  
ATOM 7568  C CD   . PRO A 1 26  ? -14.220 12.766  -12.066 1.00 1.00 ? 46  PRO A CD   5  
ATOM 7569  H HA   . PRO A 1 26  ? -17.014 11.372  -11.544 1.00 1.00 ? 46  PRO A HA   5  
ATOM 7570  H HB2  . PRO A 1 26  ? -16.425 11.483  -14.218 1.00 0.00 ? 46  PRO A HB2  5  
ATOM 7571  H HB3  . PRO A 1 26  ? -16.811 12.926  -13.208 1.00 1.00 ? 46  PRO A HB3  5  
ATOM 7572  H HG2  . PRO A 1 26  ? -14.086 11.914  -14.064 1.00 0.00 ? 46  PRO A HG2  5  
ATOM 7573  H HG3  . PRO A 1 26  ? -14.695 13.568  -14.030 1.00 1.00 ? 46  PRO A HG3  5  
ATOM 7574  H HD2  . PRO A 1 26  ? -13.154 12.561  -11.969 1.00 0.00 ? 46  PRO A HD2  5  
ATOM 7575  H HD3  . PRO A 1 26  ? -14.426 13.780  -11.716 1.00 1.00 ? 46  PRO A HD3  5  
ATOM 7576  N N    . ILE A 1 27  ? -15.469 8.926   -11.421 1.00 1.00 ? 47  ILE A N    5  
ATOM 7577  C CA   . ILE A 1 27  ? -15.129 7.486   -11.461 1.00 1.00 ? 47  ILE A CA   5  
ATOM 7578  C C    . ILE A 1 27  ? -15.761 6.647   -10.325 1.00 1.00 ? 47  ILE A C    5  
ATOM 7579  O O    . ILE A 1 27  ? -16.048 5.471   -10.549 1.00 1.00 ? 47  ILE A O    5  
ATOM 7580  C CB   . ILE A 1 27  ? -13.581 7.300   -11.473 1.00 1.00 ? 47  ILE A CB   5  
ATOM 7581  C CG1  . ILE A 1 27  ? -12.927 7.977   -10.236 1.00 1.00 ? 47  ILE A CG1  5  
ATOM 7582  C CG2  . ILE A 1 27  ? -12.992 7.828   -12.802 1.00 1.00 ? 47  ILE A CG2  5  
ATOM 7583  C CD1  . ILE A 1 27  ? -11.404 7.901   -10.083 1.00 1.00 ? 47  ILE A CD1  5  
ATOM 7584  H H    . ILE A 1 27  ? -15.261 9.436   -10.571 1.00 1.00 ? 47  ILE A H    5  
ATOM 7585  H HA   . ILE A 1 27  ? -15.520 7.068   -12.390 1.00 1.00 ? 47  ILE A HA   5  
ATOM 7586  H HB   . ILE A 1 27  ? -13.365 6.229   -11.428 1.00 1.00 ? 47  ILE A HB   5  
ATOM 7587  H HG12 . ILE A 1 27  ? -13.069 9.056   -10.276 1.00 0.00 ? 47  ILE A HG12 5  
ATOM 7588  H HG13 . ILE A 1 27  ? -13.376 7.600   -9.317  1.00 1.00 ? 47  ILE A HG13 5  
ATOM 7589  H HG21 . ILE A 1 27  ? -13.515 7.380   -13.649 1.00 1.00 ? 47  ILE A HG21 5  
ATOM 7590  H HG22 . ILE A 1 27  ? -13.095 8.912   -12.859 1.00 1.00 ? 47  ILE A HG22 5  
ATOM 7591  H HG23 . ILE A 1 27  ? -11.938 7.569   -12.882 1.00 1.00 ? 47  ILE A HG23 5  
ATOM 7592  H HD11 . ILE A 1 27  ? -10.908 8.367   -10.935 1.00 1.00 ? 47  ILE A HD11 5  
ATOM 7593  H HD12 . ILE A 1 27  ? -11.103 8.433   -9.180  1.00 1.00 ? 47  ILE A HD12 5  
ATOM 7594  H HD13 . ILE A 1 27  ? -11.099 6.861   -9.991  1.00 1.00 ? 47  ILE A HD13 5  
ATOM 7595  N N    . ALA A 1 28  ? -16.005 7.242   -9.139  1.00 1.00 ? 48  ALA A N    5  
ATOM 7596  C CA   . ALA A 1 28  ? -16.473 6.602   -7.894  1.00 1.00 ? 48  ALA A CA   5  
ATOM 7597  C C    . ALA A 1 28  ? -15.607 5.404   -7.387  1.00 1.00 ? 48  ALA A C    5  
ATOM 7598  O O    . ALA A 1 28  ? -14.516 5.136   -7.899  1.00 1.00 ? 48  ALA A O    5  
ATOM 7599  C CB   . ALA A 1 28  ? -17.976 6.291   -8.047  1.00 1.00 ? 48  ALA A CB   5  
ATOM 7600  H H    . ALA A 1 28  ? -15.770 8.221   -9.081  1.00 1.00 ? 48  ALA A H    5  
ATOM 7601  H HA   . ALA A 1 28  ? -16.394 7.359   -7.112  1.00 1.00 ? 48  ALA A HA   5  
ATOM 7602  H HB1  . ALA A 1 28  ? -18.512 7.176   -8.396  1.00 1.00 ? 48  ALA A HB1  5  
ATOM 7603  H HB2  . ALA A 1 28  ? -18.126 5.480   -8.763  1.00 1.00 ? 48  ALA A HB2  5  
ATOM 7604  H HB3  . ALA A 1 28  ? -18.396 6.000   -7.086  1.00 1.00 ? 48  ALA A HB3  5  
ATOM 7605  N N    . PHE A 1 29  ? -16.071 4.719   -6.327  1.00 1.00 ? 49  PHE A N    5  
ATOM 7606  C CA   . PHE A 1 29  ? -15.403 3.605   -5.638  1.00 1.00 ? 49  PHE A CA   5  
ATOM 7607  C C    . PHE A 1 29  ? -16.295 2.348   -5.525  1.00 1.00 ? 49  PHE A C    5  
ATOM 7608  O O    . PHE A 1 29  ? -17.453 2.424   -5.098  1.00 1.00 ? 49  PHE A O    5  
ATOM 7609  C CB   . PHE A 1 29  ? -15.016 4.075   -4.221  1.00 1.00 ? 49  PHE A CB   5  
ATOM 7610  C CG   . PHE A 1 29  ? -13.855 5.042   -4.061  1.00 1.00 ? 49  PHE A CG   5  
ATOM 7611  C CD1  . PHE A 1 29  ? -14.008 6.411   -4.382  1.00 1.00 ? 49  PHE A CD1  5  
ATOM 7612  C CD2  . PHE A 1 29  ? -12.649 4.601   -3.468  1.00 1.00 ? 49  PHE A CD2  5  
ATOM 7613  C CE1  . PHE A 1 29  ? -12.952 7.319   -4.140  1.00 1.00 ? 49  PHE A CE1  5  
ATOM 7614  C CE2  . PHE A 1 29  ? -11.589 5.503   -3.238  1.00 1.00 ? 49  PHE A CE2  5  
ATOM 7615  C CZ   . PHE A 1 29  ? -11.739 6.864   -3.578  1.00 1.00 ? 49  PHE A CZ   5  
ATOM 7616  H H    . PHE A 1 29  ? -16.901 5.070   -5.853  1.00 1.00 ? 49  PHE A H    5  
ATOM 7617  H HA   . PHE A 1 29  ? -14.495 3.333   -6.176  1.00 1.00 ? 49  PHE A HA   5  
ATOM 7618  H HB2  . PHE A 1 29  ? -15.790 4.716   -3.799  1.00 0.00 ? 49  PHE A HB2  5  
ATOM 7619  H HB3  . PHE A 1 29  ? -14.881 3.223   -3.551  1.00 1.00 ? 49  PHE A HB3  5  
ATOM 7620  H HD1  . PHE A 1 29  ? -14.948 6.779   -4.772  1.00 1.00 ? 49  PHE A HD1  5  
ATOM 7621  H HD2  . PHE A 1 29  ? -12.538 3.566   -3.173  1.00 1.00 ? 49  PHE A HD2  5  
ATOM 7622  H HE1  . PHE A 1 29  ? -13.090 8.369   -4.352  1.00 1.00 ? 49  PHE A HE1  5  
ATOM 7623  H HE2  . PHE A 1 29  ? -10.672 5.153   -2.784  1.00 1.00 ? 49  PHE A HE2  5  
ATOM 7624  H HZ   . PHE A 1 29  ? -10.938 7.562   -3.377  1.00 1.00 ? 49  PHE A HZ   5  
ATOM 7625  N N    . LYS A 1 30  ? -15.724 1.168   -5.837  1.00 1.00 ? 50  LYS A N    5  
ATOM 7626  C CA   . LYS A 1 30  ? -16.329 -0.160  -5.628  1.00 1.00 ? 50  LYS A CA   5  
ATOM 7627  C C    . LYS A 1 30  ? -15.327 -1.077  -4.909  1.00 1.00 ? 50  LYS A C    5  
ATOM 7628  O O    . LYS A 1 30  ? -14.346 -1.503  -5.505  1.00 1.00 ? 50  LYS A O    5  
ATOM 7629  C CB   . LYS A 1 30  ? -16.765 -0.754  -6.981  1.00 1.00 ? 50  LYS A CB   5  
ATOM 7630  C CG   . LYS A 1 30  ? -18.016 -0.097  -7.583  1.00 1.00 ? 50  LYS A CG   5  
ATOM 7631  C CD   . LYS A 1 30  ? -18.474 -0.807  -8.864  1.00 1.00 ? 50  LYS A CD   5  
ATOM 7632  C CE   . LYS A 1 30  ? -19.944 -0.497  -9.137  1.00 1.00 ? 50  LYS A CE   5  
ATOM 7633  N NZ   . LYS A 1 30  ? -20.533 -1.447  -10.104 1.00 1.00 ? 50  LYS A NZ   5  
ATOM 7634  H H    . LYS A 1 30  ? -14.819 1.181   -6.311  1.00 1.00 ? 50  LYS A H    5  
ATOM 7635  H HA   . LYS A 1 30  ? -17.220 -0.070  -5.003  1.00 1.00 ? 50  LYS A HA   5  
ATOM 7636  H HB2  . LYS A 1 30  ? -15.971 -0.596  -7.713  1.00 0.00 ? 50  LYS A HB2  5  
ATOM 7637  H HB3  . LYS A 1 30  ? -16.948 -1.823  -6.861  1.00 1.00 ? 50  LYS A HB3  5  
ATOM 7638  H HG2  . LYS A 1 30  ? -18.851 -0.167  -6.887  1.00 0.00 ? 50  LYS A HG2  5  
ATOM 7639  H HG3  . LYS A 1 30  ? -17.826 0.958   -7.795  1.00 1.00 ? 50  LYS A HG3  5  
ATOM 7640  H HD2  . LYS A 1 30  ? -17.880 -0.456  -9.707  1.00 0.00 ? 50  LYS A HD2  5  
ATOM 7641  H HD3  . LYS A 1 30  ? -18.343 -1.885  -8.752  1.00 1.00 ? 50  LYS A HD3  5  
ATOM 7642  H HE2  . LYS A 1 30  ? -20.520 -0.639  -8.223  1.00 0.00 ? 50  LYS A HE2  5  
ATOM 7643  H HE3  . LYS A 1 30  ? -20.043 0.539   -9.472  1.00 1.00 ? 50  LYS A HE3  5  
ATOM 7644  H HZ1  . LYS A 1 30  ? -20.136 -2.385  -9.950  1.00 0.00 ? 50  LYS A HZ1  5  
ATOM 7645  H HZ2  . LYS A 1 30  ? -21.554 -1.481  -9.975  1.00 0.00 ? 50  LYS A HZ2  5  
ATOM 7646  N N    . VAL A 1 31  ? -15.578 -1.406  -3.637  1.00 1.00 ? 51  VAL A N    5  
ATOM 7647  C CA   . VAL A 1 31  ? -14.804 -2.384  -2.836  1.00 1.00 ? 51  VAL A CA   5  
ATOM 7648  C C    . VAL A 1 31  ? -15.626 -3.666  -2.684  1.00 1.00 ? 51  VAL A C    5  
ATOM 7649  O O    . VAL A 1 31  ? -16.837 -3.591  -2.455  1.00 1.00 ? 51  VAL A O    5  
ATOM 7650  C CB   . VAL A 1 31  ? -14.345 -1.812  -1.460  1.00 1.00 ? 51  VAL A CB   5  
ATOM 7651  C CG1  . VAL A 1 31  ? -15.323 -2.062  -0.292  1.00 1.00 ? 51  VAL A CG1  5  
ATOM 7652  C CG2  . VAL A 1 31  ? -12.971 -2.379  -1.057  1.00 1.00 ? 51  VAL A CG2  5  
ATOM 7653  H H    . VAL A 1 31  ? -16.443 -1.065  -3.254  1.00 1.00 ? 51  VAL A H    5  
ATOM 7654  H HA   . VAL A 1 31  ? -13.905 -2.636  -3.397  1.00 1.00 ? 51  VAL A HA   5  
ATOM 7655  H HB   . VAL A 1 31  ? -14.220 -0.734  -1.566  1.00 1.00 ? 51  VAL A HB   5  
ATOM 7656  H HG11 . VAL A 1 31  ? -16.348 -1.923  -0.614  1.00 1.00 ? 51  VAL A HG11 5  
ATOM 7657  H HG12 . VAL A 1 31  ? -15.234 -3.082  0.088   1.00 1.00 ? 51  VAL A HG12 5  
ATOM 7658  H HG13 . VAL A 1 31  ? -15.131 -1.363  0.516   1.00 1.00 ? 51  VAL A HG13 5  
ATOM 7659  H HG21 . VAL A 1 31  ? -12.229 -2.154  -1.822  1.00 1.00 ? 51  VAL A HG21 5  
ATOM 7660  H HG22 . VAL A 1 31  ? -12.635 -1.934  -0.121  1.00 1.00 ? 51  VAL A HG22 5  
ATOM 7661  H HG23 . VAL A 1 31  ? -13.025 -3.464  -0.934  1.00 1.00 ? 51  VAL A HG23 5  
ATOM 7662  N N    . VAL A 1 32  ? -14.977 -4.824  -2.862  1.00 1.00 ? 52  VAL A N    5  
ATOM 7663  C CA   . VAL A 1 32  ? -15.559 -6.154  -2.601  1.00 1.00 ? 52  VAL A CA   5  
ATOM 7664  C C    . VAL A 1 32  ? -14.549 -7.066  -1.890  1.00 1.00 ? 52  VAL A C    5  
ATOM 7665  O O    . VAL A 1 32  ? -13.360 -7.073  -2.229  1.00 1.00 ? 52  VAL A O    5  
ATOM 7666  C CB   . VAL A 1 32  ? -16.127 -6.838  -3.882  1.00 1.00 ? 52  VAL A CB   5  
ATOM 7667  C CG1  . VAL A 1 32  ? -16.909 -8.128  -3.545  1.00 1.00 ? 52  VAL A CG1  5  
ATOM 7668  C CG2  . VAL A 1 32  ? -17.069 -5.924  -4.694  1.00 1.00 ? 52  VAL A CG2  5  
ATOM 7669  H H    . VAL A 1 32  ? -13.980 -4.775  -3.076  1.00 1.00 ? 52  VAL A H    5  
ATOM 7670  H HA   . VAL A 1 32  ? -16.406 -6.013  -1.934  1.00 1.00 ? 52  VAL A HA   5  
ATOM 7671  H HB   . VAL A 1 32  ? -15.301 -7.121  -4.532  1.00 1.00 ? 52  VAL A HB   5  
ATOM 7672  H HG11 . VAL A 1 32  ? -17.713 -7.912  -2.841  1.00 1.00 ? 52  VAL A HG11 5  
ATOM 7673  H HG12 . VAL A 1 32  ? -17.345 -8.556  -4.449  1.00 1.00 ? 52  VAL A HG12 5  
ATOM 7674  H HG13 . VAL A 1 32  ? -16.247 -8.879  -3.118  1.00 1.00 ? 52  VAL A HG13 5  
ATOM 7675  H HG21 . VAL A 1 32  ? -17.894 -5.585  -4.070  1.00 1.00 ? 52  VAL A HG21 5  
ATOM 7676  H HG22 . VAL A 1 32  ? -16.525 -5.055  -5.061  1.00 1.00 ? 52  VAL A HG22 5  
ATOM 7677  H HG23 . VAL A 1 32  ? -17.466 -6.457  -5.559  1.00 1.00 ? 52  VAL A HG23 5  
ATOM 7678  N N    . ALA A 1 33  ? -15.031 -7.854  -0.919  1.00 1.00 ? 53  ALA A N    5  
ATOM 7679  C CA   . ALA A 1 33  ? -14.263 -8.943  -0.316  1.00 1.00 ? 53  ALA A CA   5  
ATOM 7680  C C    . ALA A 1 33  ? -14.838 -10.244 -0.916  1.00 1.00 ? 53  ALA A C    5  
ATOM 7681  O O    . ALA A 1 33  ? -15.923 -10.693 -0.529  1.00 1.00 ? 53  ALA A O    5  
ATOM 7682  C CB   . ALA A 1 33  ? -14.355 -8.869  1.215   1.00 1.00 ? 53  ALA A CB   5  
ATOM 7683  H H    . ALA A 1 33  ? -15.997 -7.735  -0.647  1.00 1.00 ? 53  ALA A H    5  
ATOM 7684  H HA   . ALA A 1 33  ? -13.212 -8.854  -0.582  1.00 1.00 ? 53  ALA A HA   5  
ATOM 7685  H HB1  . ALA A 1 33  ? -14.052 -7.885  1.566   1.00 1.00 ? 53  ALA A HB1  5  
ATOM 7686  H HB2  . ALA A 1 33  ? -15.376 -9.057  1.550   1.00 1.00 ? 53  ALA A HB2  5  
ATOM 7687  H HB3  . ALA A 1 33  ? -13.699 -9.618  1.661   1.00 1.00 ? 53  ALA A HB3  5  
ATOM 7688  N N    . LEU A 1 34  ? -14.101 -10.873 -1.837  1.00 1.00 ? 54  LEU A N    5  
ATOM 7689  C CA   . LEU A 1 34  ? -14.507 -12.124 -2.495  1.00 1.00 ? 54  LEU A CA   5  
ATOM 7690  C C    . LEU A 1 34  ? -13.962 -13.288 -1.655  1.00 1.00 ? 54  LEU A C    5  
ATOM 7691  O O    . LEU A 1 34  ? -12.749 -13.451 -1.535  1.00 1.00 ? 54  LEU A O    5  
ATOM 7692  C CB   . LEU A 1 34  ? -14.069 -12.129 -3.973  1.00 1.00 ? 54  LEU A CB   5  
ATOM 7693  C CG   . LEU A 1 34  ? -14.429 -13.370 -4.828  1.00 1.00 ? 54  LEU A CG   5  
ATOM 7694  C CD1  . LEU A 1 34  ? -15.905 -13.802 -4.742  1.00 1.00 ? 54  LEU A CD1  5  
ATOM 7695  C CD2  . LEU A 1 34  ? -14.099 -13.066 -6.296  1.00 1.00 ? 54  LEU A CD2  5  
ATOM 7696  H H    . LEU A 1 34  ? -13.157 -10.523 -2.004  1.00 1.00 ? 54  LEU A H    5  
ATOM 7697  H HA   . LEU A 1 34  ? -15.598 -12.164 -2.495  1.00 1.00 ? 54  LEU A HA   5  
ATOM 7698  H HB2  . LEU A 1 34  ? -14.614 -11.361 -4.524  1.00 0.00 ? 54  LEU A HB2  5  
ATOM 7699  H HB3  . LEU A 1 34  ? -12.999 -11.926 -4.046  1.00 1.00 ? 54  LEU A HB3  5  
ATOM 7700  H HG   . LEU A 1 34  ? -13.814 -14.210 -4.506  1.00 1.00 ? 54  LEU A HG   5  
ATOM 7701  H HD11 . LEU A 1 34  ? -16.565 -12.980 -5.024  1.00 1.00 ? 54  LEU A HD11 5  
ATOM 7702  H HD12 . LEU A 1 34  ? -16.090 -14.642 -5.415  1.00 1.00 ? 54  LEU A HD12 5  
ATOM 7703  H HD13 . LEU A 1 34  ? -16.149 -14.134 -3.735  1.00 1.00 ? 54  LEU A HD13 5  
ATOM 7704  H HD21 . LEU A 1 34  ? -13.051 -12.785 -6.399  1.00 1.00 ? 54  LEU A HD21 5  
ATOM 7705  H HD22 . LEU A 1 34  ? -14.279 -13.952 -6.910  1.00 1.00 ? 54  LEU A HD22 5  
ATOM 7706  H HD23 . LEU A 1 34  ? -14.724 -12.249 -6.664  1.00 1.00 ? 54  LEU A HD23 5  
ATOM 7707  N N    . GLY A 1 35  ? -14.880 -14.060 -1.060  1.00 1.00 ? 55  GLY A N    5  
ATOM 7708  C CA   . GLY A 1 35  ? -14.605 -15.131 -0.088  1.00 1.00 ? 55  GLY A CA   5  
ATOM 7709  C C    . GLY A 1 35  ? -14.930 -14.805 1.385   1.00 1.00 ? 55  GLY A C    5  
ATOM 7710  O O    . GLY A 1 35  ? -14.682 -15.656 2.235   1.00 1.00 ? 55  GLY A O    5  
ATOM 7711  H H    . GLY A 1 35  ? -15.845 -13.842 -1.257  1.00 1.00 ? 55  GLY A H    5  
ATOM 7712  H HA2  . GLY A 1 35  ? -15.187 -16.010 -0.360  1.00 1.00 ? 55  GLY A HA2  5  
ATOM 7713  H HA3  . GLY A 1 35  ? -13.552 -15.408 -0.139  1.00 1.00 ? 55  GLY A HA3  5  
ATOM 7714  N N    . ASP A 1 36  ? -15.487 -13.618 1.690   1.00 1.00 ? 56  ASP A N    5  
ATOM 7715  C CA   . ASP A 1 36  ? -15.909 -13.160 3.024   1.00 1.00 ? 56  ASP A CA   5  
ATOM 7716  C C    . ASP A 1 36  ? -17.318 -12.512 3.044   1.00 1.00 ? 56  ASP A C    5  
ATOM 7717  O O    . ASP A 1 36  ? -17.824 -12.091 1.996   1.00 1.00 ? 56  ASP A O    5  
ATOM 7718  C CB   . ASP A 1 36  ? -14.833 -12.182 3.517   1.00 1.00 ? 56  ASP A CB   5  
ATOM 7719  C CG   . ASP A 1 36  ? -14.583 -12.256 5.017   1.00 1.00 ? 56  ASP A CG   5  
ATOM 7720  O OD1  . ASP A 1 36  ? -15.586 -12.249 5.770   1.00 1.00 ? 56  ASP A OD1  5  
ATOM 7721  O OD2  . ASP A 1 36  ? -13.387 -12.359 5.352   1.00 1.00 ? 56  ASP A OD2  5  
ATOM 7722  H H    . ASP A 1 36  ? -15.642 -12.968 0.935   1.00 1.00 ? 56  ASP A H    5  
ATOM 7723  H HA   . ASP A 1 36  ? -15.932 -14.027 3.692   1.00 1.00 ? 56  ASP A HA   5  
ATOM 7724  H HB2  . ASP A 1 36  ? -13.856 -12.339 3.060   1.00 0.00 ? 56  ASP A HB2  5  
ATOM 7725  H HB3  . ASP A 1 36  ? -15.026 -11.153 3.202   1.00 1.00 ? 56  ASP A HB3  5  
ATOM 7726  N N    . VAL A 1 37  ? -17.933 -12.406 4.239   1.00 1.00 ? 57  VAL A N    5  
ATOM 7727  C CA   . VAL A 1 37  ? -19.261 -11.775 4.485   1.00 1.00 ? 57  VAL A CA   5  
ATOM 7728  C C    . VAL A 1 37  ? -19.277 -10.970 5.819   1.00 1.00 ? 57  VAL A C    5  
ATOM 7729  O O    . VAL A 1 37  ? -19.884 -11.421 6.795   1.00 1.00 ? 57  VAL A O    5  
ATOM 7730  C CB   . VAL A 1 37  ? -20.463 -12.768 4.369   1.00 1.00 ? 57  VAL A CB   5  
ATOM 7731  C CG1  . VAL A 1 37  ? -21.815 -12.017 4.349   1.00 1.00 ? 57  VAL A CG1  5  
ATOM 7732  C CG2  . VAL A 1 37  ? -20.434 -13.649 3.104   1.00 1.00 ? 57  VAL A CG2  5  
ATOM 7733  H H    . VAL A 1 37  ? -17.323 -12.606 5.037   1.00 1.00 ? 57  VAL A H    5  
ATOM 7734  H HA   . VAL A 1 37  ? -19.400 -11.053 3.687   1.00 1.00 ? 57  VAL A HA   5  
ATOM 7735  H HB   . VAL A 1 37  ? -20.455 -13.438 5.232   1.00 1.00 ? 57  VAL A HB   5  
ATOM 7736  H HG11 . VAL A 1 37  ? -21.944 -11.430 5.257   1.00 1.00 ? 57  VAL A HG11 5  
ATOM 7737  H HG12 . VAL A 1 37  ? -21.863 -11.349 3.487   1.00 1.00 ? 57  VAL A HG12 5  
ATOM 7738  H HG13 . VAL A 1 37  ? -22.643 -12.725 4.295   1.00 1.00 ? 57  VAL A HG13 5  
ATOM 7739  H HG21 . VAL A 1 37  ? -20.412 -13.025 2.212   1.00 1.00 ? 57  VAL A HG21 5  
ATOM 7740  H HG22 . VAL A 1 37  ? -19.552 -14.288 3.112   1.00 1.00 ? 57  VAL A HG22 5  
ATOM 7741  H HG23 . VAL A 1 37  ? -21.313 -14.293 3.069   1.00 1.00 ? 57  VAL A HG23 5  
ATOM 7742  N N    . PRO A 1 38  ? -18.598 -9.799  5.894   1.00 1.00 ? 58  PRO A N    5  
ATOM 7743  C CA   . PRO A 1 38  ? -18.620 -8.887  7.048   1.00 1.00 ? 58  PRO A CA   5  
ATOM 7744  C C    . PRO A 1 38  ? -19.877 -7.983  7.122   1.00 1.00 ? 58  PRO A C    5  
ATOM 7745  O O    . PRO A 1 38  ? -20.786 -8.079  6.297   1.00 1.00 ? 58  PRO A O    5  
ATOM 7746  C CB   . PRO A 1 38  ? -17.342 -8.052  6.896   1.00 1.00 ? 58  PRO A CB   5  
ATOM 7747  C CG   . PRO A 1 38  ? -17.196 -7.935  5.380   1.00 1.00 ? 58  PRO A CG   5  
ATOM 7748  C CD   . PRO A 1 38  ? -17.741 -9.256  4.850   1.00 1.00 ? 58  PRO A CD   5  
ATOM 7749  H HA   . PRO A 1 38  ? -18.574 -9.462  7.972   1.00 1.00 ? 58  PRO A HA   5  
ATOM 7750  H HB2  . PRO A 1 38  ? -17.450 -7.076  7.374   1.00 0.00 ? 58  PRO A HB2  5  
ATOM 7751  H HB3  . PRO A 1 38  ? -16.495 -8.613  7.295   1.00 1.00 ? 58  PRO A HB3  5  
ATOM 7752  H HG2  . PRO A 1 38  ? -17.759 -7.084  4.996   1.00 0.00 ? 58  PRO A HG2  5  
ATOM 7753  H HG3  . PRO A 1 38  ? -16.152 -7.802  5.097   1.00 1.00 ? 58  PRO A HG3  5  
ATOM 7754  H HD2  . PRO A 1 38  ? -18.308 -9.124  3.929   1.00 0.00 ? 58  PRO A HD2  5  
ATOM 7755  H HD3  . PRO A 1 38  ? -16.909 -9.936  4.658   1.00 1.00 ? 58  PRO A HD3  5  
ATOM 7756  N N    . ASP A 1 39  ? -19.925 -7.102  8.134   1.00 1.00 ? 59  ASP A N    5  
ATOM 7757  C CA   . ASP A 1 39  ? -20.974 -6.099  8.389   1.00 1.00 ? 59  ASP A CA   5  
ATOM 7758  C C    . ASP A 1 39  ? -20.394 -4.834  9.076   1.00 1.00 ? 59  ASP A C    5  
ATOM 7759  O O    . ASP A 1 39  ? -20.210 -4.806  10.292  1.00 1.00 ? 59  ASP A O    5  
ATOM 7760  C CB   . ASP A 1 39  ? -22.156 -6.733  9.163   1.00 1.00 ? 59  ASP A CB   5  
ATOM 7761  C CG   . ASP A 1 39  ? -21.821 -7.423  10.494  1.00 1.00 ? 59  ASP A CG   5  
ATOM 7762  O OD1  . ASP A 1 39  ? -20.956 -8.325  10.504  1.00 1.00 ? 59  ASP A OD1  5  
ATOM 7763  O OD2  . ASP A 1 39  ? -22.492 -7.062  11.484  1.00 1.00 ? 59  ASP A OD2  5  
ATOM 7764  H H    . ASP A 1 39  ? -19.239 -7.222  8.869   1.00 1.00 ? 59  ASP A H    5  
ATOM 7765  H HA   . ASP A 1 39  ? -21.381 -5.778  7.433   1.00 1.00 ? 59  ASP A HA   5  
ATOM 7766  H HB2  . ASP A 1 39  ? -22.866 -5.939  9.392   1.00 0.00 ? 59  ASP A HB2  5  
ATOM 7767  H HB3  . ASP A 1 39  ? -22.686 -7.433  8.518   1.00 1.00 ? 59  ASP A HB3  5  
ATOM 7768  N N    . GLY A 1 40  ? -20.060 -3.781  8.300   1.00 1.00 ? 60  GLY A N    5  
ATOM 7769  C CA   . GLY A 1 40  ? -19.496 -2.501  8.769   1.00 1.00 ? 60  GLY A CA   5  
ATOM 7770  C C    . GLY A 1 40  ? -18.027 -2.207  8.400   1.00 1.00 ? 60  GLY A C    5  
ATOM 7771  O O    . GLY A 1 40  ? -17.426 -1.328  9.011   1.00 1.00 ? 60  GLY A O    5  
ATOM 7772  H H    . GLY A 1 40  ? -20.171 -3.811  7.285   1.00 1.00 ? 60  GLY A H    5  
ATOM 7773  H HA2  . GLY A 1 40  ? -20.094 -1.699  8.339   1.00 1.00 ? 60  GLY A HA2  5  
ATOM 7774  H HA3  . GLY A 1 40  ? -19.595 -2.420  9.846   1.00 1.00 ? 60  GLY A HA3  5  
ATOM 7775  N N    . THR A 1 41  ? -17.441 -2.908  7.415   1.00 1.00 ? 61  THR A N    5  
ATOM 7776  C CA   . THR A 1 41  ? -16.025 -2.840  6.970   1.00 1.00 ? 61  THR A CA   5  
ATOM 7777  C C    . THR A 1 41  ? -15.553 -1.411  6.662   1.00 1.00 ? 61  THR A C    5  
ATOM 7778  O O    . THR A 1 41  ? -15.840 -0.905  5.578   1.00 1.00 ? 61  THR A O    5  
ATOM 7779  C CB   . THR A 1 41  ? -15.783 -3.776  5.764   1.00 1.00 ? 61  THR A CB   5  
ATOM 7780  O OG1  . THR A 1 41  ? -16.028 -5.097  6.185   1.00 1.00 ? 61  THR A OG1  5  
ATOM 7781  C CG2  . THR A 1 41  ? -14.352 -3.737  5.199   1.00 1.00 ? 61  THR A CG2  5  
ATOM 7782  H H    . THR A 1 41  ? -18.041 -3.589  6.964   1.00 1.00 ? 61  THR A H    5  
ATOM 7783  H HA   . THR A 1 41  ? -15.421 -3.220  7.785   1.00 1.00 ? 61  THR A HA   5  
ATOM 7784  H HB   . THR A 1 41  ? -16.481 -3.526  4.963   1.00 1.00 ? 61  THR A HB   5  
ATOM 7785  H HG1  . THR A 1 41  ? -15.709 -5.688  5.501   1.00 1.00 ? 61  THR A HG1  5  
ATOM 7786  H HG21 . THR A 1 41  ? -13.617 -3.805  6.000   1.00 1.00 ? 61  THR A HG21 5  
ATOM 7787  H HG22 . THR A 1 41  ? -14.202 -4.549  4.488   1.00 1.00 ? 61  THR A HG22 5  
ATOM 7788  H HG23 . THR A 1 41  ? -14.193 -2.799  4.673   1.00 1.00 ? 61  THR A HG23 5  
ATOM 7789  N N    . LEU A 1 42  ? -14.835 -0.769  7.599   1.00 1.00 ? 62  LEU A N    5  
ATOM 7790  C CA   . LEU A 1 42  ? -14.282 0.580   7.462   1.00 1.00 ? 62  LEU A CA   5  
ATOM 7791  C C    . LEU A 1 42  ? -13.017 0.571   6.580   1.00 1.00 ? 62  LEU A C    5  
ATOM 7792  O O    . LEU A 1 42  ? -11.904 0.258   7.013   1.00 1.00 ? 62  LEU A O    5  
ATOM 7793  C CB   . LEU A 1 42  ? -14.087 1.177   8.870   1.00 1.00 ? 62  LEU A CB   5  
ATOM 7794  C CG   . LEU A 1 42  ? -13.626 2.646   8.970   1.00 1.00 ? 62  LEU A CG   5  
ATOM 7795  C CD1  . LEU A 1 42  ? -14.589 3.589   8.237   1.00 1.00 ? 62  LEU A CD1  5  
ATOM 7796  C CD2  . LEU A 1 42  ? -13.540 3.065   10.445  1.00 1.00 ? 62  LEU A CD2  5  
ATOM 7797  H H    . LEU A 1 42  ? -14.589 -1.250  8.457   1.00 1.00 ? 62  LEU A H    5  
ATOM 7798  H HA   . LEU A 1 42  ? -15.030 1.202   6.978   1.00 1.00 ? 62  LEU A HA   5  
ATOM 7799  H HB2  . LEU A 1 42  ? -15.041 1.272   9.388   1.00 0.00 ? 62  LEU A HB2  5  
ATOM 7800  H HB3  . LEU A 1 42  ? -13.440 0.544   9.473   1.00 1.00 ? 62  LEU A HB3  5  
ATOM 7801  H HG   . LEU A 1 42  ? -12.631 2.742   8.531   1.00 1.00 ? 62  LEU A HG   5  
ATOM 7802  H HD11 . LEU A 1 42  ? -15.621 3.387   8.519   1.00 1.00 ? 62  LEU A HD11 5  
ATOM 7803  H HD12 . LEU A 1 42  ? -14.371 4.628   8.475   1.00 1.00 ? 62  LEU A HD12 5  
ATOM 7804  H HD13 . LEU A 1 42  ? -14.461 3.457   7.166   1.00 1.00 ? 62  LEU A HD13 5  
ATOM 7805  H HD21 . LEU A 1 42  ? -12.851 2.411   10.981  1.00 1.00 ? 62  LEU A HD21 5  
ATOM 7806  H HD22 . LEU A 1 42  ? -13.171 4.089   10.516  1.00 1.00 ? 62  LEU A HD22 5  
ATOM 7807  H HD23 . LEU A 1 42  ? -14.528 3.002   10.905  1.00 1.00 ? 62  LEU A HD23 5  
ATOM 7808  N N    . VAL A 1 43  ? -13.181 1.016   5.331   1.00 1.00 ? 63  VAL A N    5  
ATOM 7809  C CA   . VAL A 1 43  ? -12.123 1.097   4.314   1.00 1.00 ? 63  VAL A CA   5  
ATOM 7810  C C    . VAL A 1 43  ? -11.538 2.499   4.419   1.00 1.00 ? 63  VAL A C    5  
ATOM 7811  O O    . VAL A 1 43  ? -12.214 3.476   4.075   1.00 1.00 ? 63  VAL A O    5  
ATOM 7812  C CB   . VAL A 1 43  ? -12.671 0.816   2.893   1.00 1.00 ? 63  VAL A CB   5  
ATOM 7813  C CG1  . VAL A 1 43  ? -11.606 1.030   1.794   1.00 1.00 ? 63  VAL A CG1  5  
ATOM 7814  C CG2  . VAL A 1 43  ? -13.181 -0.630  2.789   1.00 1.00 ? 63  VAL A CG2  5  
ATOM 7815  H H    . VAL A 1 43  ? -14.113 1.346   5.076   1.00 1.00 ? 63  VAL A H    5  
ATOM 7816  H HA   . VAL A 1 43  ? -11.349 0.357   4.521   1.00 1.00 ? 63  VAL A HA   5  
ATOM 7817  H HB   . VAL A 1 43  ? -13.507 1.486   2.684   1.00 1.00 ? 63  VAL A HB   5  
ATOM 7818  H HG11 . VAL A 1 43  ? -10.738 0.396   1.970   1.00 1.00 ? 63  VAL A HG11 5  
ATOM 7819  H HG12 . VAL A 1 43  ? -12.028 0.794   0.813   1.00 1.00 ? 63  VAL A HG12 5  
ATOM 7820  H HG13 . VAL A 1 43  ? -11.291 2.075   1.774   1.00 1.00 ? 63  VAL A HG13 5  
ATOM 7821  H HG21 . VAL A 1 43  ? -12.392 -1.338  3.038   1.00 1.00 ? 63  VAL A HG21 5  
ATOM 7822  H HG22 . VAL A 1 43  ? -14.030 -0.775  3.460   1.00 1.00 ? 63  VAL A HG22 5  
ATOM 7823  H HG23 . VAL A 1 43  ? -13.517 -0.829  1.775   1.00 1.00 ? 63  VAL A HG23 5  
ATOM 7824  N N    . THR A 1 44  ? -10.299 2.587   4.933   1.00 1.00 ? 64  THR A N    5  
ATOM 7825  C CA   . THR A 1 44  ? -9.599  3.892   5.062   1.00 1.00 ? 64  THR A CA   5  
ATOM 7826  C C    . THR A 1 44  ? -8.380  4.007   4.124   1.00 1.00 ? 64  THR A C    5  
ATOM 7827  O O    . THR A 1 44  ? -7.357  3.345   4.324   1.00 1.00 ? 64  THR A O    5  
ATOM 7828  C CB   . THR A 1 44  ? -9.243  4.167   6.538   1.00 1.00 ? 64  THR A CB   5  
ATOM 7829  O OG1  . THR A 1 44  ? -10.434 4.230   7.302   1.00 1.00 ? 64  THR A OG1  5  
ATOM 7830  C CG2  . THR A 1 44  ? -8.512  5.498   6.739   1.00 1.00 ? 64  THR A CG2  5  
ATOM 7831  H H    . THR A 1 44  ? -9.877  1.735   5.343   1.00 1.00 ? 64  THR A H    5  
ATOM 7832  H HA   . THR A 1 44  ? -10.286 4.687   4.784   1.00 1.00 ? 64  THR A HA   5  
ATOM 7833  H HB   . THR A 1 44  ? -8.619  3.361   6.932   1.00 1.00 ? 64  THR A HB   5  
ATOM 7834  H HG1  . THR A 1 44  ? -10.743 3.321   7.390   1.00 1.00 ? 64  THR A HG1  5  
ATOM 7835  H HG21 . THR A 1 44  ? -9.086  6.320   6.316   1.00 1.00 ? 64  THR A HG21 5  
ATOM 7836  H HG22 . THR A 1 44  ? -8.354  5.682   7.803   1.00 1.00 ? 64  THR A HG22 5  
ATOM 7837  H HG23 . THR A 1 44  ? -7.536  5.450   6.255   1.00 1.00 ? 64  THR A HG23 5  
ATOM 7838  N N    . VAL A 1 45  ? -8.424  4.944   3.162   1.00 1.00 ? 65  VAL A N    5  
ATOM 7839  C CA   . VAL A 1 45  ? -7.311  5.203   2.218   1.00 1.00 ? 65  VAL A CA   5  
ATOM 7840  C C    . VAL A 1 45  ? -6.479  6.399   2.694   1.00 1.00 ? 65  VAL A C    5  
ATOM 7841  O O    . VAL A 1 45  ? -6.933  7.535   2.588   1.00 1.00 ? 65  VAL A O    5  
ATOM 7842  C CB   . VAL A 1 45  ? -7.764  5.339   0.733   1.00 1.00 ? 65  VAL A CB   5  
ATOM 7843  C CG1  . VAL A 1 45  ? -8.820  6.409   0.403   1.00 1.00 ? 65  VAL A CG1  5  
ATOM 7844  C CG2  . VAL A 1 45  ? -6.542  5.641   -0.154  1.00 1.00 ? 65  VAL A CG2  5  
ATOM 7845  H H    . VAL A 1 45  ? -9.284  5.486   3.095   1.00 1.00 ? 65  VAL A H    5  
ATOM 7846  H HA   . VAL A 1 45  ? -6.662  4.333   2.227   1.00 1.00 ? 65  VAL A HA   5  
ATOM 7847  H HB   . VAL A 1 45  ? -8.175  4.377   0.421   1.00 1.00 ? 65  VAL A HB   5  
ATOM 7848  H HG11 . VAL A 1 45  ? -9.665  6.321   1.081   1.00 1.00 ? 65  VAL A HG11 5  
ATOM 7849  H HG12 . VAL A 1 45  ? -8.356  7.390   0.468   1.00 1.00 ? 65  VAL A HG12 5  
ATOM 7850  H HG13 . VAL A 1 45  ? -9.182  6.273   -0.619  1.00 1.00 ? 65  VAL A HG13 5  
ATOM 7851  H HG21 . VAL A 1 45  ? -5.755  4.901   0.004   1.00 1.00 ? 65  VAL A HG21 5  
ATOM 7852  H HG22 . VAL A 1 45  ? -6.818  5.630   -1.209  1.00 1.00 ? 65  VAL A HG22 5  
ATOM 7853  H HG23 . VAL A 1 45  ? -6.125  6.620   0.071   1.00 1.00 ? 65  VAL A HG23 5  
ATOM 7854  N N    . MET A 1 46  ? -5.227  6.170   3.120   1.00 1.00 ? 66  MET A N    5  
ATOM 7855  C CA   . MET A 1 46  ? -4.321  7.242   3.578   1.00 1.00 ? 66  MET A CA   5  
ATOM 7856  C C    . MET A 1 46  ? -2.935  7.220   2.907   1.00 1.00 ? 66  MET A C    5  
ATOM 7857  O O    . MET A 1 46  ? -2.525  6.239   2.286   1.00 1.00 ? 66  MET A O    5  
ATOM 7858  C CB   . MET A 1 46  ? -4.164  7.142   5.113   1.00 1.00 ? 66  MET A CB   5  
ATOM 7859  C CG   . MET A 1 46  ? -5.342  7.738   5.892   1.00 1.00 ? 66  MET A CG   5  
ATOM 7860  S SD   . MET A 1 46  ? -5.036  8.324   7.580   1.00 1.00 ? 66  MET A SD   5  
ATOM 7861  C CE   . MET A 1 46  ? -5.150  6.787   8.538   1.00 1.00 ? 66  MET A CE   5  
ATOM 7862  H H    . MET A 1 46  ? -4.889  5.208   3.204   1.00 1.00 ? 66  MET A H    5  
ATOM 7863  H HA   . MET A 1 46  ? -4.759  8.210   3.339   1.00 1.00 ? 66  MET A HA   5  
ATOM 7864  H HB2  . MET A 1 46  ? -4.074  6.120   5.480   1.00 0.00 ? 66  MET A HB2  5  
ATOM 7865  H HB3  . MET A 1 46  ? -3.258  7.658   5.433   1.00 1.00 ? 66  MET A HB3  5  
ATOM 7866  H HG2  . MET A 1 46  ? -5.701  8.600   5.329   1.00 0.00 ? 66  MET A HG2  5  
ATOM 7867  H HG3  . MET A 1 46  ? -6.223  7.101   5.847   1.00 1.00 ? 66  MET A HG3  5  
ATOM 7868  H HE1  . MET A 1 46  ? -4.404  6.072   8.196   1.00 1.00 ? 66  MET A HE1  5  
ATOM 7869  H HE2  . MET A 1 46  ? -4.968  7.006   9.592   1.00 1.00 ? 66  MET A HE2  5  
ATOM 7870  H HE3  . MET A 1 46  ? -6.143  6.355   8.427   1.00 1.00 ? 66  MET A HE3  5  
ATOM 7871  N N    . ALA A 1 47  ? -2.182  8.316   3.046   1.00 1.00 ? 67  ALA A N    5  
ATOM 7872  C CA   . ALA A 1 47  ? -0.767  8.400   2.672   1.00 1.00 ? 67  ALA A CA   5  
ATOM 7873  C C    . ALA A 1 47  ? 0.100   8.270   3.940   1.00 1.00 ? 67  ALA A C    5  
ATOM 7874  O O    . ALA A 1 47  ? -0.139  8.980   4.915   1.00 1.00 ? 67  ALA A O    5  
ATOM 7875  C CB   . ALA A 1 47  ? -0.511  9.738   1.964   1.00 1.00 ? 67  ALA A CB   5  
ATOM 7876  H H    . ALA A 1 47  ? -2.605  9.172   3.397   1.00 1.00 ? 67  ALA A H    5  
ATOM 7877  H HA   . ALA A 1 47  ? -0.511  7.602   1.975   1.00 1.00 ? 67  ALA A HA   5  
ATOM 7878  H HB1  . ALA A 1 47  ? -1.228  9.876   1.163   1.00 1.00 ? 67  ALA A HB1  5  
ATOM 7879  H HB2  . ALA A 1 47  ? -0.603  10.568  2.662   1.00 1.00 ? 67  ALA A HB2  5  
ATOM 7880  H HB3  . ALA A 1 47  ? 0.494   9.752   1.544   1.00 1.00 ? 67  ALA A HB3  5  
ATOM 7881  N N    . GLY A 1 48  ? 1.078   7.347   3.955   1.00 1.00 ? 68  GLY A N    5  
ATOM 7882  C CA   . GLY A 1 48  ? 2.127   7.220   4.994   1.00 1.00 ? 68  GLY A CA   5  
ATOM 7883  C C    . GLY A 1 48  ? 2.596   8.578   5.552   1.00 1.00 ? 68  GLY A C    5  
ATOM 7884  O O    . GLY A 1 48  ? 2.466   8.802   6.751   1.00 1.00 ? 68  GLY A O    5  
ATOM 7885  H H    . GLY A 1 48  ? 1.046   6.642   3.232   1.00 1.00 ? 68  GLY A H    5  
ATOM 7886  H HA2  . GLY A 1 48  ? 1.759   6.615   5.817   1.00 1.00 ? 68  GLY A HA2  5  
ATOM 7887  H HA3  . GLY A 1 48  ? 2.992   6.709   4.570   1.00 1.00 ? 68  GLY A HA3  5  
ATOM 7888  N N    . ASN A 1 49  ? 3.075   9.453   4.653   1.00 1.00 ? 69  ASN A N    5  
ATOM 7889  C CA   . ASN A 1 49  ? 3.478   10.856  4.809   1.00 1.00 ? 69  ASN A CA   5  
ATOM 7890  C C    . ASN A 1 49  ? 4.815   10.941  5.573   1.00 1.00 ? 69  ASN A C    5  
ATOM 7891  O O    . ASN A 1 49  ? 4.894   10.598  6.751   1.00 1.00 ? 69  ASN A O    5  
ATOM 7892  C CB   . ASN A 1 49  ? 2.309   11.719  5.331   1.00 1.00 ? 69  ASN A CB   5  
ATOM 7893  C CG   . ASN A 1 49  ? 2.347   13.190  4.905   1.00 1.00 ? 69  ASN A CG   5  
ATOM 7894  O OD1  . ASN A 1 49  ? 3.258   13.677  4.248   1.00 1.00 ? 69  ASN A OD1  5  
ATOM 7895  N ND2  . ASN A 1 49  ? 1.312   13.934  5.201   1.00 1.00 ? 69  ASN A ND2  5  
ATOM 7896  H H    . ASN A 1 49  ? 3.356   9.027   3.779   1.00 1.00 ? 69  ASN A H    5  
ATOM 7897  H HA   . ASN A 1 49  ? 3.667   11.204  3.793   1.00 1.00 ? 69  ASN A HA   5  
ATOM 7898  H HB2  . ASN A 1 49  ? 1.359   11.436  4.877   1.00 0.00 ? 69  ASN A HB2  5  
ATOM 7899  H HB3  . ASN A 1 49  ? 2.185   11.627  6.412   1.00 1.00 ? 69  ASN A HB3  5  
ATOM 7900  H HD21 . ASN A 1 49  ? 0.511   13.526  5.702   1.00 0.00 ? 69  ASN A HD21 5  
ATOM 7901  H HD22 . ASN A 1 49  ? 1.300   14.928  4.931   1.00 0.00 ? 69  ASN A HD22 5  
ATOM 7902  N N    . ASP A 1 50  ? 5.883   11.320  4.848   1.00 1.00 ? 70  ASP A N    5  
ATOM 7903  C CA   . ASP A 1 50  ? 7.288   11.249  5.300   1.00 1.00 ? 70  ASP A CA   5  
ATOM 7904  C C    . ASP A 1 50  ? 7.695   9.822   5.781   1.00 1.00 ? 70  ASP A C    5  
ATOM 7905  O O    . ASP A 1 50  ? 8.521   9.646   6.673   1.00 1.00 ? 70  ASP A O    5  
ATOM 7906  C CB   . ASP A 1 50  ? 7.578   12.425  6.260   1.00 1.00 ? 70  ASP A CB   5  
ATOM 7907  C CG   . ASP A 1 50  ? 8.375   13.574  5.628   1.00 1.00 ? 70  ASP A CG   5  
ATOM 7908  O OD1  . ASP A 1 50  ? 9.307   13.291  4.837   1.00 1.00 ? 70  ASP A OD1  5  
ATOM 7909  O OD2  . ASP A 1 50  ? 7.994   14.731  5.895   1.00 1.00 ? 70  ASP A OD2  5  
ATOM 7910  H H    . ASP A 1 50  ? 5.691   11.690  3.933   1.00 1.00 ? 70  ASP A H    5  
ATOM 7911  H HA   . ASP A 1 50  ? 7.906   11.388  4.415   1.00 1.00 ? 70  ASP A HA   5  
ATOM 7912  H HB2  . ASP A 1 50  ? 6.626   12.832  6.600   1.00 0.00 ? 70  ASP A HB2  5  
ATOM 7913  H HB3  . ASP A 1 50  ? 8.020   12.115  7.207   1.00 1.00 ? 70  ASP A HB3  5  
ATOM 7914  N N    . GLU A 1 51  ? 7.096   8.798   5.140   1.00 1.00 ? 71  GLU A N    5  
ATOM 7915  C CA   . GLU A 1 51  ? 7.162   7.351   5.428   1.00 1.00 ? 71  GLU A CA   5  
ATOM 7916  C C    . GLU A 1 51  ? 6.791   6.978   6.888   1.00 1.00 ? 71  GLU A C    5  
ATOM 7917  O O    . GLU A 1 51  ? 7.556   6.291   7.567   1.00 1.00 ? 71  GLU A O    5  
ATOM 7918  C CB   . GLU A 1 51  ? 8.493   6.743   4.914   1.00 1.00 ? 71  GLU A CB   5  
ATOM 7919  C CG   . GLU A 1 51  ? 8.653   6.883   3.389   1.00 1.00 ? 71  GLU A CG   5  
ATOM 7920  C CD   . GLU A 1 51  ? 9.610   5.876   2.743   1.00 1.00 ? 71  GLU A CD   5  
ATOM 7921  O OE1  . GLU A 1 51  ? 10.835  6.012   2.939   1.00 1.00 ? 71  GLU A OE1  5  
ATOM 7922  O OE2  . GLU A 1 51  ? 9.087   5.000   2.020   1.00 1.00 ? 71  GLU A OE2  5  
ATOM 7923  H H    . GLU A 1 51  ? 6.459   9.098   4.418   1.00 1.00 ? 71  GLU A H    5  
ATOM 7924  H HA   . GLU A 1 51  ? 6.385   6.880   4.827   1.00 1.00 ? 71  GLU A HA   5  
ATOM 7925  H HB2  . GLU A 1 51  ? 9.366   7.219   5.361   1.00 0.00 ? 71  GLU A HB2  5  
ATOM 7926  H HB3  . GLU A 1 51  ? 8.525   5.684   5.182   1.00 1.00 ? 71  GLU A HB3  5  
ATOM 7927  H HG2  . GLU A 1 51  ? 7.674   6.744   2.931   1.00 0.00 ? 71  GLU A HG2  5  
ATOM 7928  H HG3  . GLU A 1 51  ? 8.928   7.901   3.112   1.00 1.00 ? 71  GLU A HG3  5  
ATOM 7929  N N    . ASN A 1 52  ? 5.592   7.398   7.358   1.00 1.00 ? 72  ASN A N    5  
ATOM 7930  C CA   . ASN A 1 52  ? 5.043   6.994   8.670   1.00 1.00 ? 72  ASN A CA   5  
ATOM 7931  C C    . ASN A 1 52  ? 4.350   5.592   8.581   1.00 1.00 ? 72  ASN A C    5  
ATOM 7932  O O    . ASN A 1 52  ? 5.050   4.594   8.441   1.00 1.00 ? 72  ASN A O    5  
ATOM 7933  C CB   . ASN A 1 52  ? 4.327   8.201   9.353   1.00 1.00 ? 72  ASN A CB   5  
ATOM 7934  C CG   . ASN A 1 52  ? 2.989   8.010   10.052  1.00 1.00 ? 72  ASN A CG   5  
ATOM 7935  O OD1  . ASN A 1 52  ? 2.890   7.734   11.230  1.00 1.00 ? 72  ASN A OD1  5  
ATOM 7936  N ND2  . ASN A 1 52  ? 1.910   8.046   9.303   1.00 1.00 ? 72  ASN A ND2  5  
ATOM 7937  H H    . ASN A 1 52  ? 5.060   8.051   6.789   1.00 1.00 ? 72  ASN A H    5  
ATOM 7938  H HA   . ASN A 1 52  ? 5.903   6.817   9.319   1.00 1.00 ? 72  ASN A HA   5  
ATOM 7939  H HB2  . ASN A 1 52  ? 4.813   8.386   10.311  1.00 0.00 ? 72  ASN A HB2  5  
ATOM 7940  H HB3  . ASN A 1 52  ? 4.356   9.129   8.787   1.00 1.00 ? 72  ASN A HB3  5  
ATOM 7941  H HD21 . ASN A 1 52  ? 1.993   8.198   8.287   1.00 0.00 ? 72  ASN A HD21 5  
ATOM 7942  H HD22 . ASN A 1 52  ? 0.981   7.921   9.730   1.00 0.00 ? 72  ASN A HD22 5  
ATOM 7943  N N    . TYR A 1 53  ? 3.007   5.497   8.648   1.00 1.00 ? 73  TYR A N    5  
ATOM 7944  C CA   . TYR A 1 53  ? 2.125   4.313   8.638   1.00 1.00 ? 73  TYR A CA   5  
ATOM 7945  C C    . TYR A 1 53  ? 0.632   4.749   8.551   1.00 1.00 ? 73  TYR A C    5  
ATOM 7946  O O    . TYR A 1 53  ? -0.142  4.601   9.501   1.00 1.00 ? 73  TYR A O    5  
ATOM 7947  C CB   . TYR A 1 53  ? 2.405   3.418   9.880   1.00 1.00 ? 73  TYR A CB   5  
ATOM 7948  C CG   . TYR A 1 53  ? 3.544   2.418   9.779   1.00 1.00 ? 73  TYR A CG   5  
ATOM 7949  C CD1  . TYR A 1 53  ? 3.510   1.406   8.791   1.00 1.00 ? 73  TYR A CD1  5  
ATOM 7950  C CD2  . TYR A 1 53  ? 4.627   2.478   10.692  1.00 1.00 ? 73  TYR A CD2  5  
ATOM 7951  C CE1  . TYR A 1 53  ? 4.571   0.476   8.690   1.00 1.00 ? 73  TYR A CE1  5  
ATOM 7952  C CE2  . TYR A 1 53  ? 5.682   1.538   10.605  1.00 1.00 ? 73  TYR A CE2  5  
ATOM 7953  C CZ   . TYR A 1 53  ? 5.657   0.536   9.595   1.00 1.00 ? 73  TYR A CZ   5  
ATOM 7954  O OH   . TYR A 1 53  ? 6.668   -0.365  9.500   1.00 1.00 ? 73  TYR A OH   5  
ATOM 7955  H H    . TYR A 1 53  ? 2.544   6.388   8.753   1.00 1.00 ? 73  TYR A H    5  
ATOM 7956  H HA   . TYR A 1 53  ? 2.340   3.730   7.743   1.00 1.00 ? 73  TYR A HA   5  
ATOM 7957  H HB2  . TYR A 1 53  ? 2.695   4.030   10.735  1.00 0.00 ? 73  TYR A HB2  5  
ATOM 7958  H HB3  . TYR A 1 53  ? 1.513   2.849   10.151  1.00 1.00 ? 73  TYR A HB3  5  
ATOM 7959  H HD1  . TYR A 1 53  ? 2.680   1.346   8.109   1.00 1.00 ? 73  TYR A HD1  5  
ATOM 7960  H HD2  . TYR A 1 53  ? 4.654   3.253   11.441  1.00 1.00 ? 73  TYR A HD2  5  
ATOM 7961  H HE1  . TYR A 1 53  ? 4.568   -0.286  7.929   1.00 1.00 ? 73  TYR A HE1  5  
ATOM 7962  H HE2  . TYR A 1 53  ? 6.504   1.585   11.305  1.00 1.00 ? 73  TYR A HE2  5  
ATOM 7963  H HH   . TYR A 1 53  ? 7.363   -0.176  10.125  1.00 1.00 ? 73  TYR A HH   5  
ATOM 7964  N N    . SER A 1 54  ? 0.193   5.269   7.389   1.00 1.00 ? 74  SER A N    5  
ATOM 7965  C CA   . SER A 1 54  ? -1.158  5.822   7.115   1.00 1.00 ? 74  SER A CA   5  
ATOM 7966  C C    . SER A 1 54  ? -1.521  7.072   7.952   1.00 1.00 ? 74  SER A C    5  
ATOM 7967  O O    . SER A 1 54  ? -2.083  6.949   9.038   1.00 1.00 ? 74  SER A O    5  
ATOM 7968  C CB   . SER A 1 54  ? -2.260  4.731   7.152   1.00 1.00 ? 74  SER A CB   5  
ATOM 7969  O OG   . SER A 1 54  ? -2.343  4.004   8.367   1.00 1.00 ? 74  SER A OG   5  
ATOM 7970  H H    . SER A 1 54  ? 0.870   5.324   6.643   1.00 1.00 ? 74  SER A H    5  
ATOM 7971  H HA   . SER A 1 54  ? -1.149  6.153   6.078   1.00 1.00 ? 74  SER A HA   5  
ATOM 7972  H HB2  . SER A 1 54  ? -3.249  5.179   7.058   1.00 0.00 ? 74  SER A HB2  5  
ATOM 7973  H HB3  . SER A 1 54  ? -2.129  4.024   6.337   1.00 1.00 ? 74  SER A HB3  5  
ATOM 7974  H HG   . SER A 1 54  ? -1.543  4.224   8.911   1.00 1.00 ? 74  SER A HG   5  
ATOM 7975  N N    . ALA A 1 55  ? -1.206  8.284   7.449   1.00 1.00 ? 75  ALA A N    5  
ATOM 7976  C CA   . ALA A 1 55  ? -1.605  9.566   8.069   1.00 1.00 ? 75  ALA A CA   5  
ATOM 7977  C C    . ALA A 1 55  ? -1.866  10.703  7.047   1.00 1.00 ? 75  ALA A C    5  
ATOM 7978  O O    . ALA A 1 55  ? -1.076  11.645  6.940   1.00 1.00 ? 75  ALA A O    5  
ATOM 7979  C CB   . ALA A 1 55  ? -0.602  9.973   9.166   1.00 1.00 ? 75  ALA A CB   5  
ATOM 7980  H H    . ALA A 1 55  ? -0.729  8.340   6.548   1.00 1.00 ? 75  ALA A H    5  
ATOM 7981  H HA   . ALA A 1 55  ? -2.554  9.409   8.582   1.00 1.00 ? 75  ALA A HA   5  
ATOM 7982  H HB1  . ALA A 1 55  ? -0.521  9.190   9.918   1.00 1.00 ? 75  ALA A HB1  5  
ATOM 7983  H HB2  . ALA A 1 55  ? 0.372   10.178  8.725   1.00 1.00 ? 75  ALA A HB2  5  
ATOM 7984  H HB3  . ALA A 1 55  ? -0.953  10.878  9.663   1.00 1.00 ? 75  ALA A HB3  5  
ATOM 7985  N N    . GLU A 1 56  ? -3.010  10.626  6.337   1.00 1.00 ? 76  GLU A N    5  
ATOM 7986  C CA   . GLU A 1 56  ? -3.561  11.649  5.419   1.00 1.00 ? 76  GLU A CA   5  
ATOM 7987  C C    . GLU A 1 56  ? -4.615  11.142  4.408   1.00 1.00 ? 76  GLU A C    5  
ATOM 7988  O O    . GLU A 1 56  ? -4.282  10.655  3.321   1.00 1.00 ? 76  GLU A O    5  
ATOM 7989  C CB   . GLU A 1 56  ? -2.468  12.470  4.700   1.00 1.00 ? 76  GLU A CB   5  
ATOM 7990  C CG   . GLU A 1 56  ? -3.016  13.741  4.051   1.00 1.00 ? 76  GLU A CG   5  
ATOM 7991  C CD   . GLU A 1 56  ? -1.928  14.712  3.587   1.00 1.00 ? 76  GLU A CD   5  
ATOM 7992  O OE1  . GLU A 1 56  ? -1.094  15.149  4.409   1.00 1.00 ? 76  GLU A OE1  5  
ATOM 7993  O OE2  . GLU A 1 56  ? -2.008  15.073  2.390   1.00 1.00 ? 76  GLU A OE2  5  
ATOM 7994  H H    . GLU A 1 56  ? -3.583  9.819   6.550   1.00 1.00 ? 76  GLU A H    5  
ATOM 7995  H HA   . GLU A 1 56  ? -4.070  12.362  6.069   1.00 1.00 ? 76  GLU A HA   5  
ATOM 7996  H HB2  . GLU A 1 56  ? -1.674  12.794  5.374   1.00 0.00 ? 76  GLU A HB2  5  
ATOM 7997  H HB3  . GLU A 1 56  ? -1.936  11.863  3.967   1.00 1.00 ? 76  GLU A HB3  5  
ATOM 7998  H HG2  . GLU A 1 56  ? -3.622  13.552  3.163   1.00 0.00 ? 76  GLU A HG2  5  
ATOM 7999  H HG3  . GLU A 1 56  ? -3.729  14.241  4.709   1.00 1.00 ? 76  GLU A HG3  5  
ATOM 8000  N N    . LEU A 1 57  ? -5.894  11.321  4.765   1.00 1.00 ? 77  LEU A N    5  
ATOM 8001  C CA   . LEU A 1 57  ? -7.109  11.154  4.012   1.00 1.00 ? 77  LEU A CA   5  
ATOM 8002  C C    . LEU A 1 57  ? -7.994  12.409  4.250   1.00 1.00 ? 77  LEU A C    5  
ATOM 8003  O O    . LEU A 1 57  ? -7.742  13.194  5.175   1.00 1.00 ? 77  LEU A O    5  
ATOM 8004  C CB   . LEU A 1 57  ? -7.749  9.831   4.485   1.00 1.00 ? 77  LEU A CB   5  
ATOM 8005  C CG   . LEU A 1 57  ? -8.612  9.689   5.753   1.00 1.00 ? 77  LEU A CG   5  
ATOM 8006  C CD1  . LEU A 1 57  ? -8.207  10.567  6.922   1.00 1.00 ? 77  LEU A CD1  5  
ATOM 8007  C CD2  . LEU A 1 57  ? -10.088 9.950   5.460   1.00 1.00 ? 77  LEU A CD2  5  
ATOM 8008  H H    . LEU A 1 57  ? -6.236  11.618  5.665   1.00 1.00 ? 77  LEU A H    5  
ATOM 8009  H HA   . LEU A 1 57  ? -6.845  11.075  2.964   1.00 1.00 ? 77  LEU A HA   5  
ATOM 8010  H HB2  . LEU A 1 57  ? -8.576  9.570   3.823   1.00 0.00 ? 77  LEU A HB2  5  
ATOM 8011  H HB3  . LEU A 1 57  ? -7.007  9.042   4.461   1.00 1.00 ? 77  LEU A HB3  5  
ATOM 8012  H HG   . LEU A 1 57  ? -8.530  8.656   6.089   1.00 1.00 ? 77  LEU A HG   5  
ATOM 8013  H HD11 . LEU A 1 57  ? -7.134  10.509  7.084   1.00 1.00 ? 77  LEU A HD11 5  
ATOM 8014  H HD12 . LEU A 1 57  ? -8.513  11.599  6.788   1.00 1.00 ? 77  LEU A HD12 5  
ATOM 8015  H HD13 . LEU A 1 57  ? -8.698  10.204  7.824   1.00 1.00 ? 77  LEU A HD13 5  
ATOM 8016  H HD21 . LEU A 1 57  ? -10.203 10.886  4.933   1.00 1.00 ? 77  LEU A HD21 5  
ATOM 8017  H HD22 . LEU A 1 57  ? -10.423 9.103   4.895   1.00 1.00 ? 77  LEU A HD22 5  
ATOM 8018  H HD23 . LEU A 1 57  ? -10.666 9.967   6.388   1.00 1.00 ? 77  LEU A HD23 5  
ATOM 8019  N N    . ARG A 1 58  ? -9.037  12.633  3.440   1.00 1.00 ? 78  ARG A N    5  
ATOM 8020  C CA   . ARG A 1 58  ? -10.065 13.677  3.715   1.00 1.00 ? 78  ARG A CA   5  
ATOM 8021  C C    . ARG A 1 58  ? -11.460 13.212  3.274   1.00 1.00 ? 78  ARG A C    5  
ATOM 8022  O O    . ARG A 1 58  ? -11.910 13.539  2.182   1.00 1.00 ? 78  ARG A O    5  
ATOM 8023  C CB   . ARG A 1 58  ? -9.606  15.022  3.102   1.00 1.00 ? 78  ARG A CB   5  
ATOM 8024  C CG   . ARG A 1 58  ? -9.900  16.269  3.935   1.00 1.00 ? 78  ARG A CG   5  
ATOM 8025  C CD   . ARG A 1 58  ? -11.401 16.530  4.132   1.00 1.00 ? 78  ARG A CD   5  
ATOM 8026  N NE   . ARG A 1 58  ? -11.761 17.942  3.949   1.00 1.00 ? 78  ARG A NE   5  
ATOM 8027  C CZ   . ARG A 1 58  ? -12.926 18.413  3.545   1.00 1.00 ? 78  ARG A CZ   5  
ATOM 8028  N NH1  . ARG A 1 58  ? -13.970 17.661  3.294   1.00 1.00 ? 78  ARG A NH1  5  
ATOM 8029  N NH2  . ARG A 1 58  ? -13.061 19.698  3.364   1.00 1.00 ? 78  ARG A NH2  5  
ATOM 8030  H H    . ARG A 1 58  ? -9.050  12.065  2.595   1.00 1.00 ? 78  ARG A H    5  
ATOM 8031  H HA   . ARG A 1 58  ? -10.110 13.827  4.795   1.00 1.00 ? 78  ARG A HA   5  
ATOM 8032  H HB2  . ARG A 1 58  ? -8.523  15.136  3.095   1.00 0.00 ? 78  ARG A HB2  5  
ATOM 8033  H HB3  . ARG A 1 58  ? -9.926  15.145  2.069   1.00 1.00 ? 78  ARG A HB3  5  
ATOM 8034  H HG2  . ARG A 1 58  ? -9.540  16.110  4.951   1.00 0.00 ? 78  ARG A HG2  5  
ATOM 8035  H HG3  . ARG A 1 58  ? -9.388  17.122  3.488   1.00 1.00 ? 78  ARG A HG3  5  
ATOM 8036  H HD2  . ARG A 1 58  ? -11.975 15.986  3.382   1.00 0.00 ? 78  ARG A HD2  5  
ATOM 8037  H HD3  . ARG A 1 58  ? -11.710 16.196  5.127   1.00 1.00 ? 78  ARG A HD3  5  
ATOM 8038  H HE   . ARG A 1 58  ? -11.032 18.621  4.052   1.00 1.00 ? 78  ARG A HE   5  
ATOM 8039  H HH11 . ARG A 1 58  ? -13.909 16.640  3.410   1.00 0.00 ? 78  ARG A HH11 5  
ATOM 8040  H HH12 . ARG A 1 58  ? -14.851 18.093  2.982   1.00 0.00 ? 78  ARG A HH12 5  
ATOM 8041  H HH21 . ARG A 1 58  ? -12.266 20.329  3.536   1.00 0.00 ? 78  ARG A HH21 5  
ATOM 8042  H HH22 . ARG A 1 58  ? -13.964 20.082  3.049   1.00 0.00 ? 78  ARG A HH22 5  
ATOM 8043  N N    . ASN A 1 59  ? -12.129 12.426  4.137   1.00 1.00 ? 79  ASN A N    5  
ATOM 8044  C CA   . ASN A 1 59  ? -13.383 11.706  3.861   1.00 1.00 ? 79  ASN A CA   5  
ATOM 8045  C C    . ASN A 1 59  ? -13.106 10.345  3.165   1.00 1.00 ? 79  ASN A C    5  
ATOM 8046  O O    . ASN A 1 59  ? -14.049 9.617   2.875   1.00 1.00 ? 79  ASN A O    5  
ATOM 8047  C CB   . ASN A 1 59  ? -14.405 12.630  3.152   1.00 1.00 ? 79  ASN A CB   5  
ATOM 8048  C CG   . ASN A 1 59  ? -14.802 13.865  3.963   1.00 1.00 ? 79  ASN A CG   5  
ATOM 8049  O OD1  . ASN A 1 59  ? -14.280 14.964  3.818   1.00 1.00 ? 79  ASN A OD1  5  
ATOM 8050  N ND2  . ASN A 1 59  ? -15.738 13.725  4.876   1.00 1.00 ? 79  ASN A ND2  5  
ATOM 8051  H H    . ASN A 1 59  ? -11.660 12.083  4.961   1.00 1.00 ? 79  ASN A H    5  
ATOM 8052  H HA   . ASN A 1 59  ? -13.822 11.440  4.820   1.00 1.00 ? 79  ASN A HA   5  
ATOM 8053  H HB2  . ASN A 1 59  ? -13.980 13.088  2.259   1.00 0.00 ? 79  ASN A HB2  5  
ATOM 8054  H HB3  . ASN A 1 59  ? -15.293 12.081  2.841   1.00 1.00 ? 79  ASN A HB3  5  
ATOM 8055  H HD21 . ASN A 1 59  ? -16.178 12.805  5.027   1.00 0.00 ? 79  ASN A HD21 5  
ATOM 8056  H HD22 . ASN A 1 59  ? -16.031 14.534  5.443   1.00 0.00 ? 79  ASN A HD22 5  
ATOM 8057  N N    . ALA A 1 60  ? -11.823 9.952   2.979   1.00 1.00 ? 80  ALA A N    5  
ATOM 8058  C CA   . ALA A 1 60  ? -11.293 8.652   2.506   1.00 1.00 ? 80  ALA A CA   5  
ATOM 8059  C C    . ALA A 1 60  ? -11.565 7.423   3.408   1.00 1.00 ? 80  ALA A C    5  
ATOM 8060  O O    . ALA A 1 60  ? -10.993 6.352   3.196   1.00 1.00 ? 80  ALA A O    5  
ATOM 8061  C CB   . ALA A 1 60  ? -9.795  8.866   2.282   1.00 1.00 ? 80  ALA A CB   5  
ATOM 8062  H H    . ALA A 1 60  ? -11.074 10.539  3.367   1.00 1.00 ? 80  ALA A H    5  
ATOM 8063  H HA   . ALA A 1 60  ? -11.724 8.383   1.553   1.00 1.00 ? 80  ALA A HA   5  
ATOM 8064  H HB1  . ALA A 1 60  ? -9.462  9.829   2.654   1.00 1.00 ? 80  ALA A HB1  5  
ATOM 8065  H HB2  . ALA A 1 60  ? -9.219  8.095   2.781   1.00 1.00 ? 80  ALA A HB2  5  
ATOM 8066  H HB3  . ALA A 1 60  ? -9.585  8.842   1.221   1.00 1.00 ? 80  ALA A HB3  5  
ATOM 8067  N N    . THR A 1 61  ? -12.420 7.616   4.414   1.00 1.00 ? 81  THR A N    5  
ATOM 8068  C CA   . THR A 1 61  ? -12.856 6.612   5.398   1.00 1.00 ? 81  THR A CA   5  
ATOM 8069  C C    . THR A 1 61  ? -14.382 6.388   5.315   1.00 1.00 ? 81  THR A C    5  
ATOM 8070  O O    . THR A 1 61  ? -15.154 7.326   5.525   1.00 1.00 ? 81  THR A O    5  
ATOM 8071  C CB   . THR A 1 61  ? -12.312 6.989   6.793   1.00 1.00 ? 81  THR A CB   5  
ATOM 8072  O OG1  . THR A 1 61  ? -12.419 5.889   7.653   1.00 1.00 ? 81  THR A OG1  5  
ATOM 8073  C CG2  . THR A 1 61  ? -12.940 8.205   7.486   1.00 1.00 ? 81  THR A CG2  5  
ATOM 8074  H H    . THR A 1 61  ? -12.734 8.590   4.446   1.00 1.00 ? 81  THR A H    5  
ATOM 8075  H HA   . THR A 1 61  ? -12.375 5.666   5.145   1.00 1.00 ? 81  THR A HA   5  
ATOM 8076  H HB   . THR A 1 61  ? -11.246 7.196   6.692   1.00 1.00 ? 81  THR A HB   5  
ATOM 8077  H HG1  . THR A 1 61  ? -11.637 5.302   7.523   1.00 1.00 ? 81  THR A HG1  5  
ATOM 8078  H HG21 . THR A 1 61  ? -12.965 9.057   6.804   1.00 1.00 ? 81  THR A HG21 5  
ATOM 8079  H HG22 . THR A 1 61  ? -13.951 7.974   7.824   1.00 1.00 ? 81  THR A HG22 5  
ATOM 8080  H HG23 . THR A 1 61  ? -12.338 8.479   8.354   1.00 1.00 ? 81  THR A HG23 5  
ATOM 8081  N N    . ALA A 1 62  ? -14.817 5.174   4.925   1.00 1.00 ? 82  ALA A N    5  
ATOM 8082  C CA   . ALA A 1 62  ? -16.216 4.721   4.865   1.00 1.00 ? 82  ALA A CA   5  
ATOM 8083  C C    . ALA A 1 62  ? -16.369 3.235   5.281   1.00 1.00 ? 82  ALA A C    5  
ATOM 8084  O O    . ALA A 1 62  ? -15.527 2.403   4.947   1.00 1.00 ? 82  ALA A O    5  
ATOM 8085  C CB   . ALA A 1 62  ? -16.767 4.974   3.449   1.00 1.00 ? 82  ALA A CB   5  
ATOM 8086  H H    . ALA A 1 62  ? -14.146 4.430   4.785   1.00 1.00 ? 82  ALA A H    5  
ATOM 8087  H HA   . ALA A 1 62  ? -16.794 5.335   5.562   1.00 1.00 ? 82  ALA A HA   5  
ATOM 8088  H HB1  . ALA A 1 62  ? -16.645 6.023   3.173   1.00 1.00 ? 82  ALA A HB1  5  
ATOM 8089  H HB2  . ALA A 1 62  ? -16.251 4.344   2.721   1.00 1.00 ? 82  ALA A HB2  5  
ATOM 8090  H HB3  . ALA A 1 62  ? -17.832 4.740   3.421   1.00 1.00 ? 82  ALA A HB3  5  
ATOM 8091  N N    . ALA A 1 63  ? -17.483 2.908   5.941   1.00 1.00 ? 83  ALA A N    5  
ATOM 8092  C CA   . ALA A 1 63  ? -17.917 1.560   6.387   1.00 1.00 ? 83  ALA A CA   5  
ATOM 8093  C C    . ALA A 1 63  ? -18.815 0.854   5.320   1.00 1.00 ? 83  ALA A C    5  
ATOM 8094  O O    . ALA A 1 63  ? -19.644 1.508   4.686   1.00 1.00 ? 83  ALA A O    5  
ATOM 8095  C CB   . ALA A 1 63  ? -18.634 1.705   7.744   1.00 1.00 ? 83  ALA A CB   5  
ATOM 8096  H H    . ALA A 1 63  ? -18.036 3.707   6.194   1.00 1.00 ? 83  ALA A H    5  
ATOM 8097  H HA   . ALA A 1 63  ? -17.038 0.945   6.553   1.00 1.00 ? 83  ALA A HA   5  
ATOM 8098  H HB1  . ALA A 1 63  ? -17.954 2.144   8.483   1.00 1.00 ? 83  ALA A HB1  5  
ATOM 8099  H HB2  . ALA A 1 63  ? -19.514 2.338   7.649   1.00 1.00 ? 83  ALA A HB2  5  
ATOM 8100  H HB3  . ALA A 1 63  ? -18.945 0.723   8.115   1.00 1.00 ? 83  ALA A HB3  5  
ATOM 8101  N N    . MET A 1 64  ? -18.694 -0.483  5.154   1.00 1.00 ? 84  MET A N    5  
ATOM 8102  C CA   . MET A 1 64  ? -19.287 -1.326  4.086   1.00 1.00 ? 84  MET A CA   5  
ATOM 8103  C C    . MET A 1 64  ? -20.191 -2.429  4.656   1.00 1.00 ? 84  MET A C    5  
ATOM 8104  O O    . MET A 1 64  ? -19.902 -2.935  5.739   1.00 1.00 ? 84  MET A O    5  
ATOM 8105  C CB   . MET A 1 64  ? -18.143 -1.986  3.284   1.00 1.00 ? 84  MET A CB   5  
ATOM 8106  C CG   . MET A 1 64  ? -17.584 -1.173  2.114   1.00 1.00 ? 84  MET A CG   5  
ATOM 8107  S SD   . MET A 1 64  ? -16.783 0.415   2.455   1.00 1.00 ? 84  MET A SD   5  
ATOM 8108  C CE   . MET A 1 64  ? -18.138 1.538   2.029   1.00 1.00 ? 84  MET A CE   5  
ATOM 8109  H H    . MET A 1 64  ? -18.151 -1.008  5.829   1.00 1.00 ? 84  MET A H    5  
ATOM 8110  H HA   . MET A 1 64  ? -19.890 -0.705  3.423   1.00 1.00 ? 84  MET A HA   5  
ATOM 8111  H HB2  . MET A 1 64  ? -17.315 -2.167  3.969   1.00 0.00 ? 84  MET A HB2  5  
ATOM 8112  H HB3  . MET A 1 64  ? -18.465 -2.949  2.883   1.00 1.00 ? 84  MET A HB3  5  
ATOM 8113  H HG2  . MET A 1 64  ? -16.830 -1.791  1.625   1.00 0.00 ? 84  MET A HG2  5  
ATOM 8114  H HG3  . MET A 1 64  ? -18.352 -1.039  1.362   1.00 1.00 ? 84  MET A HG3  5  
ATOM 8115  H HE1  . MET A 1 64  ? -19.078 1.145   2.409   1.00 1.00 ? 84  MET A HE1  5  
ATOM 8116  H HE2  . MET A 1 64  ? -17.950 2.515   2.467   1.00 1.00 ? 84  MET A HE2  5  
ATOM 8117  H HE3  . MET A 1 64  ? -18.221 1.633   0.951   1.00 1.00 ? 84  MET A HE3  5  
ATOM 8118  N N    . LYS A 1 65  ? -21.241 -2.842  3.916   1.00 1.00 ? 85  LYS A N    5  
ATOM 8119  C CA   . LYS A 1 65  ? -22.295 -3.758  4.410   1.00 1.00 ? 85  LYS A CA   5  
ATOM 8120  C C    . LYS A 1 65  ? -21.816 -5.221  4.378   1.00 1.00 ? 85  LYS A C    5  
ATOM 8121  O O    . LYS A 1 65  ? -20.818 -5.529  5.016   1.00 1.00 ? 85  LYS A O    5  
ATOM 8122  C CB   . LYS A 1 65  ? -23.618 -3.469  3.674   1.00 1.00 ? 85  LYS A CB   5  
ATOM 8123  C CG   . LYS A 1 65  ? -24.215 -2.112  4.081   1.00 1.00 ? 85  LYS A CG   5  
ATOM 8124  C CD   . LYS A 1 65  ? -25.649 -1.902  3.585   1.00 1.00 ? 85  LYS A CD   5  
ATOM 8125  C CE   . LYS A 1 65  ? -26.620 -2.813  4.334   1.00 1.00 ? 85  LYS A CE   5  
ATOM 8126  N NZ   . LYS A 1 65  ? -27.937 -2.897  3.673   1.00 1.00 ? 85  LYS A NZ   5  
ATOM 8127  H H    . LYS A 1 65  ? -21.220 -2.628  2.923   1.00 1.00 ? 85  LYS A H    5  
ATOM 8128  H HA   . LYS A 1 65  ? -22.470 -3.555  5.471   1.00 1.00 ? 85  LYS A HA   5  
ATOM 8129  H HB2  . LYS A 1 65  ? -23.440 -3.435  2.599   1.00 0.00 ? 85  LYS A HB2  5  
ATOM 8130  H HB3  . LYS A 1 65  ? -24.339 -4.257  3.895   1.00 1.00 ? 85  LYS A HB3  5  
ATOM 8131  H HG2  . LYS A 1 65  ? -24.283 -2.048  5.166   1.00 0.00 ? 85  LYS A HG2  5  
ATOM 8132  H HG3  . LYS A 1 65  ? -23.580 -1.304  3.716   1.00 1.00 ? 85  LYS A HG3  5  
ATOM 8133  H HD2  . LYS A 1 65  ? -25.974 -0.885  3.801   1.00 0.00 ? 85  LYS A HD2  5  
ATOM 8134  H HD3  . LYS A 1 65  ? -25.699 -2.069  2.507   1.00 1.00 ? 85  LYS A HD3  5  
ATOM 8135  H HE2  . LYS A 1 65  ? -26.266 -3.844  4.312   1.00 0.00 ? 85  LYS A HE2  5  
ATOM 8136  H HE3  . LYS A 1 65  ? -26.709 -2.498  5.374   1.00 1.00 ? 85  LYS A HE3  5  
ATOM 8137  H HZ1  . LYS A 1 65  ? -28.366 -3.810  3.876   1.00 0.00 ? 85  LYS A HZ1  5  
ATOM 8138  H HZ2  . LYS A 1 65  ? -28.548 -2.145  4.026   1.00 0.00 ? 85  LYS A HZ2  5  
ATOM 8139  N N    . ASN A 1 66  ? -22.451 -6.096  3.589   1.00 1.00 ? 86  ASN A N    5  
ATOM 8140  C CA   . ASN A 1 66  ? -22.170 -7.539  3.467   1.00 1.00 ? 86  ASN A CA   5  
ATOM 8141  C C    . ASN A 1 66  ? -20.727 -7.897  3.023   1.00 1.00 ? 86  ASN A C    5  
ATOM 8142  O O    . ASN A 1 66  ? -20.390 -9.072  3.041   1.00 1.00 ? 86  ASN A O    5  
ATOM 8143  C CB   . ASN A 1 66  ? -23.161 -8.179  2.466   1.00 1.00 ? 86  ASN A CB   5  
ATOM 8144  C CG   . ASN A 1 66  ? -24.607 -7.703  2.416   1.00 1.00 ? 86  ASN A CG   5  
ATOM 8145  O OD1  . ASN A 1 66  ? -25.215 -7.245  3.368   1.00 1.00 ? 86  ASN A OD1  5  
ATOM 8146  N ND2  . ASN A 1 66  ? -25.196 -7.770  1.247   1.00 1.00 ? 86  ASN A ND2  5  
ATOM 8147  H H    . ASN A 1 66  ? -23.242 -5.738  3.081   1.00 1.00 ? 86  ASN A H    5  
ATOM 8148  H HA   . ASN A 1 66  ? -22.336 -8.005  4.441   1.00 1.00 ? 86  ASN A HA   5  
ATOM 8149  H HB2  . ASN A 1 66  ? -22.878 -7.921  1.445   1.00 0.00 ? 86  ASN A HB2  5  
ATOM 8150  H HB3  . ASN A 1 66  ? -23.150 -9.261  2.573   1.00 1.00 ? 86  ASN A HB3  5  
ATOM 8151  H HD21 . ASN A 1 66  ? -24.681 -8.129  0.430   1.00 0.00 ? 86  ASN A HD21 5  
ATOM 8152  H HD22 . ASN A 1 66  ? -26.174 -7.464  1.144   1.00 0.00 ? 86  ASN A HD22 5  
ATOM 8153  N N    . GLN A 1 67  ? -19.912 -6.899  2.628   1.00 1.00 ? 87  GLN A N    5  
ATOM 8154  C CA   . GLN A 1 67  ? -18.571 -6.876  2.000   1.00 1.00 ? 87  GLN A CA   5  
ATOM 8155  C C    . GLN A 1 67  ? -18.461 -5.855  0.831   1.00 1.00 ? 87  GLN A C    5  
ATOM 8156  O O    . GLN A 1 67  ? -17.428 -5.848  0.158   1.00 1.00 ? 87  GLN A O    5  
ATOM 8157  C CB   . GLN A 1 67  ? -18.089 -8.255  1.477   1.00 1.00 ? 87  GLN A CB   5  
ATOM 8158  C CG   . GLN A 1 67  ? -18.655 -8.721  0.127   1.00 1.00 ? 87  GLN A CG   5  
ATOM 8159  C CD   . GLN A 1 67  ? -19.906 -9.584  0.213   1.00 1.00 ? 87  GLN A CD   5  
ATOM 8160  O OE1  . GLN A 1 67  ? -21.014 -9.123  -0.015  1.00 1.00 ? 87  GLN A OE1  5  
ATOM 8161  N NE2  . GLN A 1 67  ? -19.789 -10.863 0.507   1.00 1.00 ? 87  GLN A NE2  5  
ATOM 8162  H H    . GLN A 1 67  ? -20.280 -6.004  2.919   1.00 1.00 ? 87  GLN A H    5  
ATOM 8163  H HA   . GLN A 1 67  ? -17.856 -6.558  2.759   1.00 1.00 ? 87  GLN A HA   5  
ATOM 8164  H HB2  . GLN A 1 67  ? -17.080 -8.132  1.081   1.00 0.00 ? 87  GLN A HB2  5  
ATOM 8165  H HB3  . GLN A 1 67  ? -18.052 -9.043  2.224   1.00 1.00 ? 87  GLN A HB3  5  
ATOM 8166  H HG2  . GLN A 1 67  ? -19.035 -7.878  -0.450  1.00 0.00 ? 87  GLN A HG2  5  
ATOM 8167  H HG3  . GLN A 1 67  ? -17.891 -9.215  -0.466  1.00 1.00 ? 87  GLN A HG3  5  
ATOM 8168  H HE21 . GLN A 1 67  ? -18.857 -11.269 0.675   1.00 0.00 ? 87  GLN A HE21 5  
ATOM 8169  H HE22 . GLN A 1 67  ? -20.628 -11.456 0.567   1.00 0.00 ? 87  GLN A HE22 5  
ATOM 8170  N N    . VAL A 1 68  ? -19.480 -5.001  0.568   1.00 1.00 ? 88  VAL A N    5  
ATOM 8171  C CA   . VAL A 1 68  ? -19.565 -4.147  -0.645  1.00 1.00 ? 88  VAL A CA   5  
ATOM 8172  C C    . VAL A 1 68  ? -19.730 -2.652  -0.307  1.00 1.00 ? 88  VAL A C    5  
ATOM 8173  O O    . VAL A 1 68  ? -20.425 -2.295  0.654   1.00 1.00 ? 88  VAL A O    5  
ATOM 8174  C CB   . VAL A 1 68  ? -20.685 -4.655  -1.606  1.00 1.00 ? 88  VAL A CB   5  
ATOM 8175  C CG1  . VAL A 1 68  ? -20.740 -3.882  -2.944  1.00 1.00 ? 88  VAL A CG1  5  
ATOM 8176  C CG2  . VAL A 1 68  ? -20.517 -6.147  -1.965  1.00 1.00 ? 88  VAL A CG2  5  
ATOM 8177  H H    . VAL A 1 68  ? -20.241 -4.902  1.227   1.00 1.00 ? 88  VAL A H    5  
ATOM 8178  H HA   . VAL A 1 68  ? -18.632 -4.258  -1.190  1.00 1.00 ? 88  VAL A HA   5  
ATOM 8179  H HB   . VAL A 1 68  ? -21.651 -4.536  -1.111  1.00 1.00 ? 88  VAL A HB   5  
ATOM 8180  H HG11 . VAL A 1 68  ? -19.769 -3.918  -3.441  1.00 1.00 ? 88  VAL A HG11 5  
ATOM 8181  H HG12 . VAL A 1 68  ? -21.489 -4.323  -3.603  1.00 1.00 ? 88  VAL A HG12 5  
ATOM 8182  H HG13 . VAL A 1 68  ? -21.025 -2.844  -2.781  1.00 1.00 ? 88  VAL A HG13 5  
ATOM 8183  H HG21 . VAL A 1 68  ? -19.539 -6.322  -2.412  1.00 1.00 ? 88  VAL A HG21 5  
ATOM 8184  H HG22 . VAL A 1 68  ? -20.612 -6.760  -1.071  1.00 1.00 ? 88  VAL A HG22 5  
ATOM 8185  H HG23 . VAL A 1 68  ? -21.291 -6.467  -2.663  1.00 1.00 ? 88  VAL A HG23 5  
ATOM 8186  N N    . ALA A 1 69  ? -19.112 -1.794  -1.140  1.00 1.00 ? 89  ALA A N    5  
ATOM 8187  C CA   . ALA A 1 69  ? -19.207 -0.321  -1.135  1.00 1.00 ? 89  ALA A CA   5  
ATOM 8188  C C    . ALA A 1 69  ? -20.183 0.243   -2.201  1.00 1.00 ? 89  ALA A C    5  
ATOM 8189  O O    . ALA A 1 69  ? -20.292 -0.273  -3.315  1.00 1.00 ? 89  ALA A O    5  
ATOM 8190  C CB   . ALA A 1 69  ? -17.815 0.313   -1.315  1.00 1.00 ? 89  ALA A CB   5  
ATOM 8191  H H    . ALA A 1 69  ? -18.547 -2.249  -1.847  1.00 1.00 ? 89  ALA A H    5  
ATOM 8192  H HA   . ALA A 1 69  ? -19.579 -0.018  -0.156  1.00 1.00 ? 89  ALA A HA   5  
ATOM 8193  H HB1  . ALA A 1 69  ? -17.369 -0.018  -2.250  1.00 1.00 ? 89  ALA A HB1  5  
ATOM 8194  H HB2  . ALA A 1 69  ? -17.892 1.400   -1.345  1.00 1.00 ? 89  ALA A HB2  5  
ATOM 8195  H HB3  . ALA A 1 69  ? -17.165 0.059   -0.483  1.00 1.00 ? 89  ALA A HB3  5  
ATOM 8196  N N    . ARG A 1 70  ? -20.846 1.360   -1.849  1.00 1.00 ? 90  ARG A N    5  
ATOM 8197  C CA   . ARG A 1 70  ? -21.759 2.175   -2.679  1.00 1.00 ? 90  ARG A CA   5  
ATOM 8198  C C    . ARG A 1 70  ? -21.161 3.576   -2.941  1.00 1.00 ? 90  ARG A C    5  
ATOM 8199  O O    . ARG A 1 70  ? -21.096 4.394   -2.028  1.00 1.00 ? 90  ARG A O    5  
ATOM 8200  C CB   . ARG A 1 70  ? -23.119 2.241   -1.956  1.00 1.00 ? 90  ARG A CB   5  
ATOM 8201  C CG   . ARG A 1 70  ? -24.338 2.732   -2.740  1.00 1.00 ? 90  ARG A CG   5  
ATOM 8202  C CD   . ARG A 1 70  ? -25.437 1.669   -2.624  1.00 1.00 ? 90  ARG A CD   5  
ATOM 8203  N NE   . ARG A 1 70  ? -25.105 0.462   -3.408  1.00 1.00 ? 90  ARG A NE   5  
ATOM 8204  C CZ   . ARG A 1 70  ? -25.423 0.195   -4.663  1.00 1.00 ? 90  ARG A CZ   5  
ATOM 8205  N NH1  . ARG A 1 70  ? -26.244 0.923   -5.375  1.00 1.00 ? 90  ARG A NH1  5  
ATOM 8206  N NH2  . ARG A 1 70  ? -24.899 -0.843  -5.247  1.00 1.00 ? 90  ARG A NH2  5  
ATOM 8207  H H    . ARG A 1 70  ? -20.695 1.688   -0.907  1.00 1.00 ? 90  ARG A H    5  
ATOM 8208  H HA   . ARG A 1 70  ? -21.905 1.669   -3.637  1.00 1.00 ? 90  ARG A HA   5  
ATOM 8209  H HB2  . ARG A 1 70  ? -23.512 1.246   -1.742  1.00 0.00 ? 90  ARG A HB2  5  
ATOM 8210  H HB3  . ARG A 1 70  ? -23.046 2.766   -1.005  1.00 1.00 ? 90  ARG A HB3  5  
ATOM 8211  H HG2  . ARG A 1 70  ? -24.722 3.673   -2.345  1.00 0.00 ? 90  ARG A HG2  5  
ATOM 8212  H HG3  . ARG A 1 70  ? -24.103 2.899   -3.791  1.00 1.00 ? 90  ARG A HG3  5  
ATOM 8213  H HD2  . ARG A 1 70  ? -25.500 1.295   -1.602  1.00 0.00 ? 90  ARG A HD2  5  
ATOM 8214  H HD3  . ARG A 1 70  ? -26.405 2.088   -2.897  1.00 1.00 ? 90  ARG A HD3  5  
ATOM 8215  H HE   . ARG A 1 70  ? -24.417 -0.147  -3.002  1.00 1.00 ? 90  ARG A HE   5  
ATOM 8216  H HH11 . ARG A 1 70  ? -26.684 1.758   -4.961  1.00 0.00 ? 90  ARG A HH11 5  
ATOM 8217  H HH12 . ARG A 1 70  ? -26.451 0.661   -6.350  1.00 0.00 ? 90  ARG A HH12 5  
ATOM 8218  H HH21 . ARG A 1 70  ? -24.243 -1.448  -4.733  1.00 0.00 ? 90  ARG A HH21 5  
ATOM 8219  H HH22 . ARG A 1 70  ? -25.141 -1.060  -6.226  1.00 0.00 ? 90  ARG A HH22 5  
ATOM 8220  N N    . PHE A 1 71  ? -20.763 3.840   -4.195  1.00 1.00 ? 91  PHE A N    5  
ATOM 8221  C CA   . PHE A 1 71  ? -20.177 5.077   -4.753  1.00 1.00 ? 91  PHE A CA   5  
ATOM 8222  C C    . PHE A 1 71  ? -19.045 5.747   -3.933  1.00 1.00 ? 91  PHE A C    5  
ATOM 8223  O O    . PHE A 1 71  ? -17.884 5.590   -4.303  1.00 1.00 ? 91  PHE A O    5  
ATOM 8224  C CB   . PHE A 1 71  ? -21.312 6.050   -5.143  1.00 1.00 ? 91  PHE A CB   5  
ATOM 8225  C CG   . PHE A 1 71  ? -20.977 7.168   -6.122  1.00 1.00 ? 91  PHE A CG   5  
ATOM 8226  C CD1  . PHE A 1 71  ? -20.162 8.263   -5.743  1.00 1.00 ? 91  PHE A CD1  5  
ATOM 8227  C CD2  . PHE A 1 71  ? -21.518 7.126   -7.427  1.00 1.00 ? 91  PHE A CD2  5  
ATOM 8228  C CE1  . PHE A 1 71  ? -19.884 9.297   -6.662  1.00 1.00 ? 91  PHE A CE1  5  
ATOM 8229  C CE2  . PHE A 1 71  ? -21.246 8.166   -8.345  1.00 1.00 ? 91  PHE A CE2  5  
ATOM 8230  C CZ   . PHE A 1 71  ? -20.430 9.253   -7.962  1.00 1.00 ? 91  PHE A CZ   5  
ATOM 8231  H H    . PHE A 1 71  ? -20.842 3.067   -4.836  1.00 1.00 ? 91  PHE A H    5  
ATOM 8232  H HA   . PHE A 1 71  ? -19.708 4.779   -5.690  1.00 1.00 ? 91  PHE A HA   5  
ATOM 8233  H HB2  . PHE A 1 71  ? -22.068 5.559   -5.756  1.00 0.00 ? 91  PHE A HB2  5  
ATOM 8234  H HB3  . PHE A 1 71  ? -21.818 6.450   -4.263  1.00 1.00 ? 91  PHE A HB3  5  
ATOM 8235  H HD1  . PHE A 1 71  ? -19.737 8.331   -4.754  1.00 1.00 ? 91  PHE A HD1  5  
ATOM 8236  H HD2  . PHE A 1 71  ? -22.147 6.301   -7.727  1.00 1.00 ? 91  PHE A HD2  5  
ATOM 8237  H HE1  . PHE A 1 71  ? -19.256 10.126  -6.361  1.00 1.00 ? 91  PHE A HE1  5  
ATOM 8238  H HE2  . PHE A 1 71  ? -21.668 8.130   -9.340  1.00 1.00 ? 91  PHE A HE2  5  
ATOM 8239  H HZ   . PHE A 1 71  ? -20.223 10.052  -8.662  1.00 1.00 ? 91  PHE A HZ   5  
ATOM 8240  N N    . ASN A 1 72  ? -19.407 6.486   -2.870  1.00 1.00 ? 92  ASN A N    5  
ATOM 8241  C CA   . ASN A 1 72  ? -18.632 7.358   -1.972  1.00 1.00 ? 92  ASN A CA   5  
ATOM 8242  C C    . ASN A 1 72  ? -17.602 8.353   -2.603  1.00 1.00 ? 92  ASN A C    5  
ATOM 8243  O O    . ASN A 1 72  ? -17.164 8.241   -3.747  1.00 1.00 ? 92  ASN A O    5  
ATOM 8244  C CB   . ASN A 1 72  ? -18.019 6.477   -0.861  1.00 1.00 ? 92  ASN A CB   5  
ATOM 8245  C CG   . ASN A 1 72  ? -19.034 5.844   0.077   1.00 1.00 ? 92  ASN A CG   5  
ATOM 8246  O OD1  . ASN A 1 72  ? -19.931 6.474   0.614   1.00 1.00 ? 92  ASN A OD1  5  
ATOM 8247  N ND2  . ASN A 1 72  ? -18.885 4.574   0.369   1.00 1.00 ? 92  ASN A ND2  5  
ATOM 8248  H H    . ASN A 1 72  ? -20.371 6.338   -2.599  1.00 1.00 ? 92  ASN A H    5  
ATOM 8249  H HA   . ASN A 1 72  ? -19.368 8.003   -1.487  1.00 1.00 ? 92  ASN A HA   5  
ATOM 8250  H HB2  . ASN A 1 72  ? -17.454 5.656   -1.304  1.00 0.00 ? 92  ASN A HB2  5  
ATOM 8251  H HB3  . ASN A 1 72  ? -17.352 7.068   -0.243  1.00 1.00 ? 92  ASN A HB3  5  
ATOM 8252  H HD21 . ASN A 1 72  ? -18.102 4.042   -0.036  1.00 0.00 ? 92  ASN A HD21 5  
ATOM 8253  H HD22 . ASN A 1 72  ? -19.553 4.109   1.001   1.00 0.00 ? 92  ASN A HD22 5  
ATOM 8254  N N    . ASP A 1 73  ? -17.233 9.369   -1.806  1.00 1.00 ? 93  ASP A N    5  
ATOM 8255  C CA   . ASP A 1 73  ? -16.387 10.526  -2.155  1.00 1.00 ? 93  ASP A CA   5  
ATOM 8256  C C    . ASP A 1 73  ? -14.863 10.240  -2.037  1.00 1.00 ? 93  ASP A C    5  
ATOM 8257  O O    . ASP A 1 73  ? -14.139 10.432  -3.011  1.00 1.00 ? 93  ASP A O    5  
ATOM 8258  C CB   . ASP A 1 73  ? -16.790 11.705  -1.243  1.00 1.00 ? 93  ASP A CB   5  
ATOM 8259  C CG   . ASP A 1 73  ? -18.258 12.191  -1.320  1.00 1.00 ? 93  ASP A CG   5  
ATOM 8260  O OD1  . ASP A 1 73  ? -19.160 11.352  -1.549  1.00 1.00 ? 93  ASP A OD1  5  
ATOM 8261  O OD2  . ASP A 1 73  ? -18.469 13.390  -1.033  1.00 1.00 ? 93  ASP A OD2  5  
ATOM 8262  H H    . ASP A 1 73  ? -17.842 9.517   -1.009  1.00 1.00 ? 93  ASP A H    5  
ATOM 8263  H HA   . ASP A 1 73  ? -16.595 10.813  -3.189  1.00 1.00 ? 93  ASP A HA   5  
ATOM 8264  H HB2  . ASP A 1 73  ? -16.618 11.396  -0.212  1.00 0.00 ? 93  ASP A HB2  5  
ATOM 8265  H HB3  . ASP A 1 73  ? -16.102 12.542  -1.391  1.00 1.00 ? 93  ASP A HB3  5  
ATOM 8266  N N    . LEU A 1 74  ? -14.431 9.776   -0.845  1.00 1.00 ? 94  LEU A N    5  
ATOM 8267  C CA   . LEU A 1 74  ? -13.127 9.264   -0.373  1.00 1.00 ? 94  LEU A CA   5  
ATOM 8268  C C    . LEU A 1 74  ? -11.845 10.010  -0.861  1.00 1.00 ? 94  LEU A C    5  
ATOM 8269  O O    . LEU A 1 74  ? -11.582 10.007  -2.074  1.00 1.00 ? 94  LEU A O    5  
ATOM 8270  C CB   . LEU A 1 74  ? -13.113 7.739   -0.645  1.00 1.00 ? 94  LEU A CB   5  
ATOM 8271  C CG   . LEU A 1 74  ? -14.233 6.880   0.000   1.00 1.00 ? 94  LEU A CG   5  
ATOM 8272  C CD1  . LEU A 1 74  ? -14.602 5.694   -0.893  1.00 1.00 ? 94  LEU A CD1  5  
ATOM 8273  C CD2  . LEU A 1 74  ? -13.845 6.344   1.380   1.00 1.00 ? 94  LEU A CD2  5  
ATOM 8274  H H    . LEU A 1 74  ? -15.181 9.664   -0.181  1.00 1.00 ? 94  LEU A H    5  
ATOM 8275  H HA   . LEU A 1 74  ? -13.170 9.400   0.695   1.00 1.00 ? 94  LEU A HA   5  
ATOM 8276  H HB2  . LEU A 1 74  ? -13.392 7.505   -1.673  1.00 0.00 ? 94  LEU A HB2  5  
ATOM 8277  H HB3  . LEU A 1 74  ? -12.126 7.302   -0.478  1.00 1.00 ? 94  LEU A HB3  5  
ATOM 8278  H HG   . LEU A 1 74  ? -15.132 7.481   0.123   1.00 1.00 ? 94  LEU A HG   5  
ATOM 8279  H HD11 . LEU A 1 74  ? -13.726 5.069   -1.066  1.00 1.00 ? 94  LEU A HD11 5  
ATOM 8280  H HD12 . LEU A 1 74  ? -15.381 5.089   -0.435  1.00 1.00 ? 94  LEU A HD12 5  
ATOM 8281  H HD13 . LEU A 1 74  ? -14.989 6.074   -1.838  1.00 1.00 ? 94  LEU A HD13 5  
ATOM 8282  H HD21 . LEU A 1 74  ? -12.875 5.844   1.341   1.00 1.00 ? 94  LEU A HD21 5  
ATOM 8283  H HD22 . LEU A 1 74  ? -13.829 7.171   2.083   1.00 1.00 ? 94  LEU A HD22 5  
ATOM 8284  H HD23 . LEU A 1 74  ? -14.587 5.631   1.732   1.00 1.00 ? 94  LEU A HD23 5  
ATOM 8285  N N    . ARG A 1 75  ? -10.981 10.586  0.039   1.00 1.00 ? 95  ARG A N    5  
ATOM 8286  C CA   . ARG A 1 75  ? -9.880  11.464  -0.467  1.00 1.00 ? 95  ARG A CA   5  
ATOM 8287  C C    . ARG A 1 75  ? -8.485  10.981  -0.055  1.00 1.00 ? 95  ARG A C    5  
ATOM 8288  O O    . ARG A 1 75  ? -8.137  11.085  1.116   1.00 1.00 ? 95  ARG A O    5  
ATOM 8289  C CB   . ARG A 1 75  ? -10.174 12.898  0.005   1.00 1.00 ? 95  ARG A CB   5  
ATOM 8290  C CG   . ARG A 1 75  ? -9.915  14.108  -0.894  1.00 1.00 ? 95  ARG A CG   5  
ATOM 8291  C CD   . ARG A 1 75  ? -8.489  14.639  -0.715  1.00 1.00 ? 95  ARG A CD   5  
ATOM 8292  N NE   . ARG A 1 75  ? -8.341  16.032  -0.240  1.00 1.00 ? 95  ARG A NE   5  
ATOM 8293  C CZ   . ARG A 1 75  ? -8.544  17.215  -0.791  1.00 1.00 ? 95  ARG A CZ   5  
ATOM 8294  N NH1  . ARG A 1 75  ? -9.066  17.437  -1.965  1.00 1.00 ? 95  ARG A NH1  5  
ATOM 8295  N NH2  . ARG A 1 75  ? -8.147  18.256  -0.123  1.00 1.00 ? 95  ARG A NH2  5  
ATOM 8296  H H    . ARG A 1 75  ? -10.937 10.295  1.054   1.00 1.00 ? 95  ARG A H    5  
ATOM 8297  H HA   . ARG A 1 75  ? -9.909  11.499  -1.548  1.00 1.00 ? 95  ARG A HA   5  
ATOM 8298  H HB2  . ARG A 1 75  ? -11.248 13.078  0.041   1.00 0.00 ? 95  ARG A HB2  5  
ATOM 8299  H HB3  . ARG A 1 75  ? -9.768  13.064  0.993   1.00 1.00 ? 95  ARG A HB3  5  
ATOM 8300  H HG2  . ARG A 1 75  ? -10.040 13.795  -1.931  1.00 0.00 ? 95  ARG A HG2  5  
ATOM 8301  H HG3  . ARG A 1 75  ? -10.637 14.884  -0.635  1.00 1.00 ? 95  ARG A HG3  5  
ATOM 8302  H HD2  . ARG A 1 75  ? -8.004  14.267  0.188   1.00 0.00 ? 95  ARG A HD2  5  
ATOM 8303  H HD3  . ARG A 1 75  ? -7.827  14.370  -1.535  1.00 1.00 ? 95  ARG A HD3  5  
ATOM 8304  H HE   . ARG A 1 75  ? -7.881  16.155  0.649   1.00 1.00 ? 95  ARG A HE   5  
ATOM 8305  H HH11 . ARG A 1 75  ? -9.362  16.645  -2.554  1.00 0.00 ? 95  ARG A HH11 5  
ATOM 8306  H HH12 . ARG A 1 75  ? -9.180  18.402  -2.304  1.00 0.00 ? 95  ARG A HH12 5  
ATOM 8307  H HH21 . ARG A 1 75  ? -7.696  18.137  0.796   1.00 0.00 ? 95  ARG A HH21 5  
ATOM 8308  H HH22 . ARG A 1 75  ? -8.283  19.200  -0.512  1.00 0.00 ? 95  ARG A HH22 5  
ATOM 8309  N N    . PHE A 1 76  ? -7.654  10.589  -1.027  1.00 1.00 ? 96  PHE A N    5  
ATOM 8310  C CA   . PHE A 1 76  ? -6.328  9.981   -0.824  1.00 1.00 ? 96  PHE A CA   5  
ATOM 8311  C C    . PHE A 1 76  ? -5.211  11.028  -1.008  1.00 1.00 ? 96  PHE A C    5  
ATOM 8312  O O    . PHE A 1 76  ? -5.287  11.844  -1.930  1.00 1.00 ? 96  PHE A O    5  
ATOM 8313  C CB   . PHE A 1 76  ? -6.188  8.727   -1.707  1.00 1.00 ? 96  PHE A CB   5  
ATOM 8314  C CG   . PHE A 1 76  ? -5.631  8.801   -3.119  1.00 1.00 ? 96  PHE A CG   5  
ATOM 8315  C CD1  . PHE A 1 76  ? -6.436  9.219   -4.204  1.00 1.00 ? 96  PHE A CD1  5  
ATOM 8316  C CD2  . PHE A 1 76  ? -4.327  8.318   -3.367  1.00 1.00 ? 96  PHE A CD2  5  
ATOM 8317  C CE1  . PHE A 1 76  ? -5.931  9.181   -5.524  1.00 1.00 ? 96  PHE A CE1  5  
ATOM 8318  C CE2  . PHE A 1 76  ? -3.818  8.280   -4.680  1.00 1.00 ? 96  PHE A CE2  5  
ATOM 8319  C CZ   . PHE A 1 76  ? -4.616  8.722   -5.754  1.00 1.00 ? 96  PHE A CZ   5  
ATOM 8320  H H    . PHE A 1 76  ? -7.989  10.659  -1.976  1.00 1.00 ? 96  PHE A H    5  
ATOM 8321  H HA   . PHE A 1 76  ? -6.279  9.624   0.207   1.00 1.00 ? 96  PHE A HA   5  
ATOM 8322  H HB2  . PHE A 1 76  ? -5.368  8.093   -1.369  1.00 0.00 ? 96  PHE A HB2  5  
ATOM 8323  H HB3  . PHE A 1 76  ? -7.097  8.126   -1.689  1.00 1.00 ? 96  PHE A HB3  5  
ATOM 8324  H HD1  . PHE A 1 76  ? -7.449  9.540   -4.038  1.00 1.00 ? 96  PHE A HD1  5  
ATOM 8325  H HD2  . PHE A 1 76  ? -3.711  7.967   -2.549  1.00 1.00 ? 96  PHE A HD2  5  
ATOM 8326  H HE1  . PHE A 1 76  ? -6.556  9.487   -6.353  1.00 1.00 ? 96  PHE A HE1  5  
ATOM 8327  H HE2  . PHE A 1 76  ? -2.819  7.917   -4.861  1.00 1.00 ? 96  PHE A HE2  5  
ATOM 8328  H HZ   . PHE A 1 76  ? -4.208  8.700   -6.749  1.00 1.00 ? 96  PHE A HZ   5  
ATOM 8329  N N    . VAL A 1 77  ? -4.205  11.023  -0.104  1.00 1.00 ? 97  VAL A N    5  
ATOM 8330  C CA   . VAL A 1 77  ? -3.145  12.071  -0.024  1.00 1.00 ? 97  VAL A CA   5  
ATOM 8331  C C    . VAL A 1 77  ? -3.853  13.470  -0.002  1.00 1.00 ? 97  VAL A C    5  
ATOM 8332  O O    . VAL A 1 77  ? -3.644  14.319  -0.869  1.00 1.00 ? 97  VAL A O    5  
ATOM 8333  C CB   . VAL A 1 77  ? -2.096  11.892  -1.173  1.00 1.00 ? 97  VAL A CB   5  
ATOM 8334  C CG1  . VAL A 1 77  ? -0.742  12.488  -0.770  1.00 1.00 ? 97  VAL A CG1  5  
ATOM 8335  C CG2  . VAL A 1 77  ? -1.858  10.455  -1.706  1.00 1.00 ? 97  VAL A CG2  5  
ATOM 8336  H H    . VAL A 1 77  ? -4.218  10.322  0.628   1.00 1.00 ? 97  VAL A H    5  
ATOM 8337  H HA   . VAL A 1 77  ? -2.630  11.948  0.928   1.00 1.00 ? 97  VAL A HA   5  
ATOM 8338  H HB   . VAL A 1 77  ? -2.441  12.447  -2.037  1.00 1.00 ? 97  VAL A HB   5  
ATOM 8339  H HG11 . VAL A 1 77  ? -0.866  13.530  -0.466  1.00 1.00 ? 97  VAL A HG11 5  
ATOM 8340  H HG12 . VAL A 1 77  ? -0.308  11.926  0.057   1.00 1.00 ? 97  VAL A HG12 5  
ATOM 8341  H HG13 . VAL A 1 77  ? -0.048  12.458  -1.611  1.00 1.00 ? 97  VAL A HG13 5  
ATOM 8342  H HG21 . VAL A 1 77  ? -1.779  9.734   -0.895  1.00 1.00 ? 97  VAL A HG21 5  
ATOM 8343  H HG22 . VAL A 1 77  ? -2.687  10.177  -2.352  1.00 1.00 ? 97  VAL A HG22 5  
ATOM 8344  H HG23 . VAL A 1 77  ? -0.942  10.427  -2.292  1.00 1.00 ? 97  VAL A HG23 5  
ATOM 8345  N N    . GLY A 1 78  ? -4.750  13.654  0.982   1.00 1.00 ? 98  GLY A N    5  
ATOM 8346  C CA   . GLY A 1 78  ? -5.718  14.769  1.058   1.00 1.00 ? 98  GLY A CA   5  
ATOM 8347  C C    . GLY A 1 78  ? -5.500  16.122  1.750   1.00 1.00 ? 98  GLY A C    5  
ATOM 8348  O O    . GLY A 1 78  ? -6.394  16.967  1.571   1.00 1.00 ? 98  GLY A O    5  
ATOM 8349  H H    . GLY A 1 78  ? -4.863  12.876  1.613   1.00 1.00 ? 98  GLY A H    5  
ATOM 8350  H HA2  . GLY A 1 78  ? -5.971  15.004  0.027   1.00 1.00 ? 98  GLY A HA2  5  
ATOM 8351  H HA3  . GLY A 1 78  ? -6.624  14.352  1.498   1.00 1.00 ? 98  GLY A HA3  5  
ATOM 8352  N N    . ARG A 1 79  ? -4.418  16.388  2.521   1.00 1.00 ? 99  ARG A N    5  
ATOM 8353  C CA   . ARG A 1 79  ? -4.206  17.669  3.253   1.00 1.00 ? 99  ARG A CA   5  
ATOM 8354  C C    . ARG A 1 79  ? -2.746  18.168  3.415   1.00 1.00 ? 99  ARG A C    5  
ATOM 8355  O O    . ARG A 1 79  ? -2.340  18.641  4.476   1.00 1.00 ? 99  ARG A O    5  
ATOM 8356  C CB   . ARG A 1 79  ? -5.029  17.683  4.558   1.00 1.00 ? 99  ARG A CB   5  
ATOM 8357  C CG   . ARG A 1 79  ? -5.437  19.118  4.910   1.00 1.00 ? 99  ARG A CG   5  
ATOM 8358  C CD   . ARG A 1 79  ? -4.690  19.759  6.090   1.00 1.00 ? 99  ARG A CD   5  
ATOM 8359  N NE   . ARG A 1 79  ? -5.479  19.724  7.332   1.00 1.00 ? 99  ARG A NE   5  
ATOM 8360  C CZ   . ARG A 1 79  ? -5.018  19.651  8.566   1.00 1.00 ? 99  ARG A CZ   5  
ATOM 8361  N NH1  . ARG A 1 79  ? -3.749  19.620  8.851   1.00 1.00 ? 99  ARG A NH1  5  
ATOM 8362  N NH2  . ARG A 1 79  ? -5.851  19.602  9.562   1.00 1.00 ? 99  ARG A NH2  5  
ATOM 8363  H H    . ARG A 1 79  ? -3.674  15.683  2.512   1.00 1.00 ? 99  ARG A H    5  
ATOM 8364  H HA   . ARG A 1 79  ? -4.648  18.443  2.621   1.00 1.00 ? 99  ARG A HA   5  
ATOM 8365  H HB2  . ARG A 1 79  ? -5.989  17.179  4.438   1.00 0.00 ? 99  ARG A HB2  5  
ATOM 8366  H HB3  . ARG A 1 79  ? -4.507  17.180  5.372   1.00 1.00 ? 99  ARG A HB3  5  
ATOM 8367  H HG2  . ARG A 1 79  ? -5.091  19.838  4.166   1.00 0.00 ? 99  ARG A HG2  5  
ATOM 8368  H HG3  . ARG A 1 79  ? -6.516  19.233  4.978   1.00 1.00 ? 99  ARG A HG3  5  
ATOM 8369  H HD2  . ARG A 1 79  ? -3.780  19.198  6.302   1.00 0.00 ? 99  ARG A HD2  5  
ATOM 8370  H HD3  . ARG A 1 79  ? -4.424  20.791  5.847   1.00 1.00 ? 99  ARG A HD3  5  
ATOM 8371  H HE   . ARG A 1 79  ? -6.468  19.868  7.247   1.00 1.00 ? 99  ARG A HE   5  
ATOM 8372  H HH11 . ARG A 1 79  ? -3.051  19.654  8.095   1.00 0.00 ? 99  ARG A HH11 5  
ATOM 8373  H HH12 . ARG A 1 79  ? -3.443  19.564  9.833   1.00 0.00 ? 99  ARG A HH12 5  
ATOM 8374  H HH21 . ARG A 1 79  ? -6.866  19.620  9.386   1.00 0.00 ? 99  ARG A HH21 5  
ATOM 8375  H HH22 . ARG A 1 79  ? -5.498  19.545  10.528  1.00 0.00 ? 99  ARG A HH22 5  
ATOM 8376  N N    . SER A 1 80  ? -2.031  18.169  2.287   1.00 1.00 ? 100 SER A N    5  
ATOM 8377  C CA   . SER A 1 80  ? -0.692  18.711  1.960   1.00 1.00 ? 100 SER A CA   5  
ATOM 8378  C C    . SER A 1 80  ? 0.040   17.806  0.963   1.00 1.00 ? 100 SER A C    5  
ATOM 8379  O O    . SER A 1 80  ? -0.023  18.115  -0.226  1.00 1.00 ? 100 SER A O    5  
ATOM 8380  C CB   . SER A 1 80  ? 0.164   19.147  3.159   1.00 1.00 ? 100 SER A CB   5  
ATOM 8381  O OG   . SER A 1 80  ? 1.159   20.093  2.768   1.00 1.00 ? 100 SER A OG   5  
ATOM 8382  H H    . SER A 1 80  ? -2.489  17.634  1.557   1.00 1.00 ? 100 SER A H    5  
ATOM 8383  H HA   . SER A 1 80  ? -0.894  19.627  1.404   1.00 1.00 ? 100 SER A HA   5  
ATOM 8384  H HB2  . SER A 1 80  ? -0.426  19.695  3.893   1.00 0.00 ? 100 SER A HB2  5  
ATOM 8385  H HB3  . SER A 1 80  ? 0.604   18.288  3.670   1.00 1.00 ? 100 SER A HB3  5  
ATOM 8386  H HG   . SER A 1 80  ? 1.953   19.921  3.286   1.00 1.00 ? 100 SER A HG   5  
ATOM 8387  N N    . GLY A 1 81  ? 0.681   16.706  1.397   1.00 1.00 ? 101 GLY A N    5  
ATOM 8388  C CA   . GLY A 1 81  ? 1.345   15.715  0.528   1.00 1.00 ? 101 GLY A CA   5  
ATOM 8389  C C    . GLY A 1 81  ? 2.848   15.963  0.296   1.00 1.00 ? 101 GLY A C    5  
ATOM 8390  O O    . GLY A 1 81  ? 3.224   16.551  -0.717  1.00 1.00 ? 101 GLY A O    5  
ATOM 8391  H H    . GLY A 1 81  ? 0.539   16.467  2.369   1.00 1.00 ? 101 GLY A H    5  
ATOM 8392  H HA2  . GLY A 1 81  ? 1.205   14.720  0.954   1.00 1.00 ? 101 GLY A HA2  5  
ATOM 8393  H HA3  . GLY A 1 81  ? 0.857   15.712  -0.448  1.00 1.00 ? 101 GLY A HA3  5  
ATOM 8394  N N    . ARG A 1 82  ? 3.697   15.468  1.219   1.00 1.00 ? 102 ARG A N    5  
ATOM 8395  C CA   . ARG A 1 82  ? 5.174   15.605  1.306   1.00 1.00 ? 102 ARG A CA   5  
ATOM 8396  C C    . ARG A 1 82  ? 5.974   15.409  -0.002  1.00 1.00 ? 102 ARG A C    5  
ATOM 8397  O O    . ARG A 1 82  ? 6.734   16.287  -0.398  1.00 1.00 ? 102 ARG A O    5  
ATOM 8398  C CB   . ARG A 1 82  ? 5.668   14.664  2.430   1.00 1.00 ? 102 ARG A CB   5  
ATOM 8399  C CG   . ARG A 1 82  ? 7.178   14.404  2.434   1.00 1.00 ? 102 ARG A CG   5  
ATOM 8400  C CD   . ARG A 1 82  ? 7.552   12.943  2.148   1.00 1.00 ? 102 ARG A CD   5  
ATOM 8401  N NE   . ARG A 1 82  ? 8.886   12.866  1.533   1.00 1.00 ? 102 ARG A NE   5  
ATOM 8402  C CZ   . ARG A 1 82  ? 9.311   12.019  0.609   1.00 1.00 ? 102 ARG A CZ   5  
ATOM 8403  N NH1  . ARG A 1 82  ? 8.624   10.963  0.258   1.00 1.00 ? 102 ARG A NH1  5  
ATOM 8404  N NH2  . ARG A 1 82  ? 10.458  12.210  0.021   1.00 1.00 ? 102 ARG A NH2  5  
ATOM 8405  H H    . ARG A 1 82  ? 3.261   15.001  2.006   1.00 1.00 ? 102 ARG A H    5  
ATOM 8406  H HA   . ARG A 1 82  ? 5.402   16.626  1.625   1.00 1.00 ? 102 ARG A HA   5  
ATOM 8407  H HB2  . ARG A 1 82  ? 5.539   15.118  3.413   1.00 0.00 ? 102 ARG A HB2  5  
ATOM 8408  H HB3  . ARG A 1 82  ? 5.119   13.721  2.429   1.00 1.00 ? 102 ARG A HB3  5  
ATOM 8409  H HG2  . ARG A 1 82  ? 7.664   14.925  1.608   1.00 0.00 ? 102 ARG A HG2  5  
ATOM 8410  H HG3  . ARG A 1 82  ? 7.627   14.747  3.357   1.00 1.00 ? 102 ARG A HG3  5  
ATOM 8411  H HD2  . ARG A 1 82  ? 7.584   12.377  3.079   1.00 0.00 ? 102 ARG A HD2  5  
ATOM 8412  H HD3  . ARG A 1 82  ? 6.813   12.490  1.485   1.00 1.00 ? 102 ARG A HD3  5  
ATOM 8413  H HE   . ARG A 1 82  ? 9.569   13.498  1.928   1.00 1.00 ? 102 ARG A HE   5  
ATOM 8414  H HH11 . ARG A 1 82  ? 7.719   10.765  0.706   1.00 0.00 ? 102 ARG A HH11 5  
ATOM 8415  H HH12 . ARG A 1 82  ? 8.990   10.329  -0.467  1.00 0.00 ? 102 ARG A HH12 5  
ATOM 8416  H HH21 . ARG A 1 82  ? 11.039  13.022  0.276   1.00 0.00 ? 102 ARG A HH21 5  
ATOM 8417  H HH22 . ARG A 1 82  ? 10.784  11.548  -0.698  1.00 0.00 ? 102 ARG A HH22 5  
ATOM 8418  N N    . GLY A 1 83  ? 5.859   14.214  -0.597  1.00 1.00 ? 103 GLY A N    5  
ATOM 8419  C CA   . GLY A 1 83  ? 6.625   13.744  -1.761  1.00 1.00 ? 103 GLY A CA   5  
ATOM 8420  C C    . GLY A 1 83  ? 5.899   12.616  -2.494  1.00 1.00 ? 103 GLY A C    5  
ATOM 8421  O O    . GLY A 1 83  ? 5.276   12.889  -3.510  1.00 1.00 ? 103 GLY A O    5  
ATOM 8422  H H    . GLY A 1 83  ? 5.170   13.619  -0.166  1.00 1.00 ? 103 GLY A H    5  
ATOM 8423  H HA2  . GLY A 1 83  ? 6.771   14.574  -2.458  1.00 1.00 ? 103 GLY A HA2  5  
ATOM 8424  H HA3  . GLY A 1 83  ? 7.610   13.396  -1.443  1.00 1.00 ? 103 GLY A HA3  5  
ATOM 8425  N N    . LYS A 1 84  ? 5.983   11.368  -1.988  1.00 1.00 ? 104 LYS A N    5  
ATOM 8426  C CA   . LYS A 1 84  ? 5.229   10.182  -2.474  1.00 1.00 ? 104 LYS A CA   5  
ATOM 8427  C C    . LYS A 1 84  ? 5.039   9.065   -1.419  1.00 1.00 ? 104 LYS A C    5  
ATOM 8428  O O    . LYS A 1 84  ? 5.946   8.264   -1.190  1.00 1.00 ? 104 LYS A O    5  
ATOM 8429  C CB   . LYS A 1 84  ? 5.815   9.618   -3.786  1.00 1.00 ? 104 LYS A CB   5  
ATOM 8430  C CG   . LYS A 1 84  ? 7.345   9.503   -3.890  1.00 1.00 ? 104 LYS A CG   5  
ATOM 8431  C CD   . LYS A 1 84  ? 7.901   10.284  -5.094  1.00 1.00 ? 104 LYS A CD   5  
ATOM 8432  C CE   . LYS A 1 84  ? 9.429   10.305  -5.146  1.00 1.00 ? 104 LYS A CE   5  
ATOM 8433  N NZ   . LYS A 1 84  ? 9.972   9.196   -5.958  1.00 1.00 ? 104 LYS A NZ   5  
ATOM 8434  H H    . LYS A 1 84  ? 6.595   11.256  -1.195  1.00 1.00 ? 104 LYS A H    5  
ATOM 8435  H HA   . LYS A 1 84  ? 4.225   10.522  -2.722  1.00 1.00 ? 104 LYS A HA   5  
ATOM 8436  H HB2  . LYS A 1 84  ? 5.592   8.554   -3.874  1.00 0.00 ? 104 LYS A HB2  5  
ATOM 8437  H HB3  . LYS A 1 84  ? 5.387   10.133  -4.643  1.00 1.00 ? 104 LYS A HB3  5  
ATOM 8438  H HG2  . LYS A 1 84  ? 7.802   9.939   -3.002  1.00 0.00 ? 104 LYS A HG2  5  
ATOM 8439  H HG3  . LYS A 1 84  ? 7.626   8.453   -3.965  1.00 1.00 ? 104 LYS A HG3  5  
ATOM 8440  H HD2  . LYS A 1 84  ? 7.565   9.812   -6.018  1.00 0.00 ? 104 LYS A HD2  5  
ATOM 8441  H HD3  . LYS A 1 84  ? 7.539   11.315  -5.056  1.00 1.00 ? 104 LYS A HD3  5  
ATOM 8442  H HE2  . LYS A 1 84  ? 9.782   11.184  -5.683  1.00 0.00 ? 104 LYS A HE2  5  
ATOM 8443  H HE3  . LYS A 1 84  ? 9.847   10.327  -4.139  1.00 1.00 ? 104 LYS A HE3  5  
ATOM 8444  H HZ1  . LYS A 1 84  ? 10.902  8.932   -5.601  1.00 0.00 ? 104 LYS A HZ1  5  
ATOM 8445  H HZ2  . LYS A 1 84  ? 9.341   8.385   -5.899  1.00 0.00 ? 104 LYS A HZ2  5  
ATOM 8446  N N    . SER A 1 85  ? 3.867   9.027   -0.762  1.00 1.00 ? 105 SER A N    5  
ATOM 8447  C CA   . SER A 1 85  ? 3.414   7.984   0.181   1.00 1.00 ? 105 SER A CA   5  
ATOM 8448  C C    . SER A 1 85  ? 2.020   7.408   -0.172  1.00 1.00 ? 105 SER A C    5  
ATOM 8449  O O    . SER A 1 85  ? 1.089   8.174   -0.424  1.00 1.00 ? 105 SER A O    5  
ATOM 8450  C CB   . SER A 1 85  ? 3.358   8.583   1.587   1.00 1.00 ? 105 SER A CB   5  
ATOM 8451  O OG   . SER A 1 85  ? 4.517   8.321   2.354   1.00 1.00 ? 105 SER A OG   5  
ATOM 8452  H H    . SER A 1 85  ? 3.220   9.783   -0.926  1.00 1.00 ? 105 SER A H    5  
ATOM 8453  H HA   . SER A 1 85  ? 4.123   7.155   0.167   1.00 1.00 ? 105 SER A HA   5  
ATOM 8454  H HB2  . SER A 1 85  ? 3.306   9.671   1.538   1.00 0.00 ? 105 SER A HB2  5  
ATOM 8455  H HB3  . SER A 1 85  ? 2.487   8.224   2.120   1.00 1.00 ? 105 SER A HB3  5  
ATOM 8456  H HG   . SER A 1 85  ? 5.028   7.626   1.917   1.00 1.00 ? 105 SER A HG   5  
ATOM 8457  N N    . PHE A 1 86  ? 1.861   6.073   -0.102  1.00 1.00 ? 106 PHE A N    5  
ATOM 8458  C CA   . PHE A 1 86  ? 0.594   5.337   -0.273  1.00 1.00 ? 106 PHE A CA   5  
ATOM 8459  C C    . PHE A 1 86  ? 0.411   4.248   0.815   1.00 1.00 ? 106 PHE A C    5  
ATOM 8460  O O    . PHE A 1 86  ? 1.183   3.289   0.860   1.00 1.00 ? 106 PHE A O    5  
ATOM 8461  C CB   . PHE A 1 86  ? 0.552   4.752   -1.702  1.00 1.00 ? 106 PHE A CB   5  
ATOM 8462  C CG   . PHE A 1 86  ? -0.798  4.586   -2.371  1.00 1.00 ? 106 PHE A CG   5  
ATOM 8463  C CD1  . PHE A 1 86  ? -1.817  3.810   -1.769  1.00 1.00 ? 106 PHE A CD1  5  
ATOM 8464  C CD2  . PHE A 1 86  ? -1.029  5.181   -3.632  1.00 1.00 ? 106 PHE A CD2  5  
ATOM 8465  C CE1  . PHE A 1 86  ? -3.057  3.639   -2.420  1.00 1.00 ? 106 PHE A CE1  5  
ATOM 8466  C CE2  . PHE A 1 86  ? -2.274  5.005   -4.283  1.00 1.00 ? 106 PHE A CE2  5  
ATOM 8467  C CZ   . PHE A 1 86  ? -3.289  4.238   -3.676  1.00 1.00 ? 106 PHE A CZ   5  
ATOM 8468  H H    . PHE A 1 86  ? 2.684   5.510   0.030   1.00 1.00 ? 106 PHE A H    5  
ATOM 8469  H HA   . PHE A 1 86  ? -0.235  6.045   -0.188  1.00 1.00 ? 106 PHE A HA   5  
ATOM 8470  H HB2  . PHE A 1 86  ? 0.949   5.443   -2.446  1.00 0.00 ? 106 PHE A HB2  5  
ATOM 8471  H HB3  . PHE A 1 86  ? 1.138   3.835   -1.793  1.00 1.00 ? 106 PHE A HB3  5  
ATOM 8472  H HD1  . PHE A 1 86  ? -1.653  3.335   -0.814  1.00 1.00 ? 106 PHE A HD1  5  
ATOM 8473  H HD2  . PHE A 1 86  ? -0.252  5.763   -4.110  1.00 1.00 ? 106 PHE A HD2  5  
ATOM 8474  H HE1  . PHE A 1 86  ? -3.830  3.042   -1.957  1.00 1.00 ? 106 PHE A HE1  5  
ATOM 8475  H HE2  . PHE A 1 86  ? -2.449  5.454   -5.249  1.00 1.00 ? 106 PHE A HE2  5  
ATOM 8476  H HZ   . PHE A 1 86  ? -4.241  4.103   -4.171  1.00 1.00 ? 106 PHE A HZ   5  
ATOM 8477  N N    . THR A 1 87  ? -0.589  4.391   1.702   1.00 1.00 ? 107 THR A N    5  
ATOM 8478  C CA   . THR A 1 87  ? -0.967  3.413   2.756   1.00 1.00 ? 107 THR A CA   5  
ATOM 8479  C C    . THR A 1 87  ? -2.504  3.289   2.882   1.00 1.00 ? 107 THR A C    5  
ATOM 8480  O O    . THR A 1 87  ? -3.144  3.820   3.799   1.00 1.00 ? 107 THR A O    5  
ATOM 8481  C CB   . THR A 1 87  ? -0.304  3.720   4.126   1.00 1.00 ? 107 THR A CB   5  
ATOM 8482  O OG1  . THR A 1 87  ? 1.052   4.097   3.992   1.00 1.00 ? 107 THR A OG1  5  
ATOM 8483  C CG2  . THR A 1 87  ? -0.312  2.487   5.042   1.00 1.00 ? 107 THR A CG2  5  
ATOM 8484  H H    . THR A 1 87  ? -1.151  5.236   1.675   1.00 1.00 ? 107 THR A H    5  
ATOM 8485  H HA   . THR A 1 87  ? -0.601  2.431   2.445   1.00 1.00 ? 107 THR A HA   5  
ATOM 8486  H HB   . THR A 1 87  ? -0.835  4.543   4.602   1.00 1.00 ? 107 THR A HB   5  
ATOM 8487  H HG1  . THR A 1 87  ? 1.466   3.406   3.461   1.00 1.00 ? 107 THR A HG1  5  
ATOM 8488  H HG21 . THR A 1 87  ? -1.336  2.149   5.202   1.00 1.00 ? 107 THR A HG21 5  
ATOM 8489  H HG22 . THR A 1 87  ? 0.255   1.669   4.601   1.00 1.00 ? 107 THR A HG22 5  
ATOM 8490  H HG23 . THR A 1 87  ? 0.129   2.733   6.006   1.00 1.00 ? 107 THR A HG23 5  
ATOM 8491  N N    . LEU A 1 88  ? -3.111  2.582   1.917   1.00 1.00 ? 108 LEU A N    5  
ATOM 8492  C CA   . LEU A 1 88  ? -4.530  2.211   1.900   1.00 1.00 ? 108 LEU A CA   5  
ATOM 8493  C C    . LEU A 1 88  ? -4.787  1.055   2.892   1.00 1.00 ? 108 LEU A C    5  
ATOM 8494  O O    . LEU A 1 88  ? -4.353  -0.069  2.646   1.00 1.00 ? 108 LEU A O    5  
ATOM 8495  C CB   . LEU A 1 88  ? -4.934  1.893   0.447   1.00 1.00 ? 108 LEU A CB   5  
ATOM 8496  C CG   . LEU A 1 88  ? -6.435  1.752   0.123   1.00 1.00 ? 108 LEU A CG   5  
ATOM 8497  C CD1  . LEU A 1 88  ? -6.643  2.124   -1.351  1.00 1.00 ? 108 LEU A CD1  5  
ATOM 8498  C CD2  . LEU A 1 88  ? -6.967  0.334   0.356   1.00 1.00 ? 108 LEU A CD2  5  
ATOM 8499  H H    . LEU A 1 88  ? -2.521  2.185   1.206   1.00 1.00 ? 108 LEU A H    5  
ATOM 8500  H HA   . LEU A 1 88  ? -5.101  3.073   2.227   1.00 1.00 ? 108 LEU A HA   5  
ATOM 8501  H HB2  . LEU A 1 88  ? -4.772  2.737   -0.224  1.00 0.00 ? 108 LEU A HB2  5  
ATOM 8502  H HB3  . LEU A 1 88  ? -4.371  1.059   0.034   1.00 1.00 ? 108 LEU A HB3  5  
ATOM 8503  H HG   . LEU A 1 88  ? -7.004  2.442   0.744   1.00 1.00 ? 108 LEU A HG   5  
ATOM 8504  H HD11 . LEU A 1 88  ? -6.306  3.143   -1.534  1.00 1.00 ? 108 LEU A HD11 5  
ATOM 8505  H HD12 . LEU A 1 88  ? -6.079  1.446   -1.994  1.00 1.00 ? 108 LEU A HD12 5  
ATOM 8506  H HD13 . LEU A 1 88  ? -7.702  2.059   -1.605  1.00 1.00 ? 108 LEU A HD13 5  
ATOM 8507  H HD21 . LEU A 1 88  ? -6.420  -0.373  -0.270  1.00 1.00 ? 108 LEU A HD21 5  
ATOM 8508  H HD22 . LEU A 1 88  ? -6.852  0.055   1.404   1.00 1.00 ? 108 LEU A HD22 5  
ATOM 8509  H HD23 . LEU A 1 88  ? -8.026  0.285   0.100   1.00 1.00 ? 108 LEU A HD23 5  
ATOM 8510  N N    . THR A 1 89  ? -5.468  1.337   4.012   1.00 1.00 ? 109 THR A N    5  
ATOM 8511  C CA   . THR A 1 89  ? -5.716  0.385   5.127   1.00 1.00 ? 109 THR A CA   5  
ATOM 8512  C C    . THR A 1 89  ? -7.217  0.111   5.333   1.00 1.00 ? 109 THR A C    5  
ATOM 8513  O O    . THR A 1 89  ? -7.992  0.973   5.752   1.00 1.00 ? 109 THR A O    5  
ATOM 8514  C CB   . THR A 1 89  ? -5.022  0.838   6.433   1.00 1.00 ? 109 THR A CB   5  
ATOM 8515  O OG1  . THR A 1 89  ? -3.611  0.825   6.268   1.00 1.00 ? 109 THR A OG1  5  
ATOM 8516  C CG2  . THR A 1 89  ? -5.305  -0.072  7.640   1.00 1.00 ? 109 THR A CG2  5  
ATOM 8517  H H    . THR A 1 89  ? -5.810  2.297   4.117   1.00 1.00 ? 109 THR A H    5  
ATOM 8518  H HA   . THR A 1 89  ? -5.250  -0.566  4.871   1.00 1.00 ? 109 THR A HA   5  
ATOM 8519  H HB   . THR A 1 89  ? -5.336  1.855   6.680   1.00 1.00 ? 109 THR A HB   5  
ATOM 8520  H HG1  . THR A 1 89  ? -3.252  1.365   6.984   1.00 1.00 ? 109 THR A HG1  5  
ATOM 8521  H HG21 . THR A 1 89  ? -5.038  -1.105  7.409   1.00 1.00 ? 109 THR A HG21 5  
ATOM 8522  H HG22 . THR A 1 89  ? -4.729  0.256   8.505   1.00 1.00 ? 109 THR A HG22 5  
ATOM 8523  H HG23 . THR A 1 89  ? -6.361  -0.024  7.905   1.00 1.00 ? 109 THR A HG23 5  
ATOM 8524  N N    . ILE A 1 90  ? -7.628  -1.143  5.102   1.00 1.00 ? 110 ILE A N    5  
ATOM 8525  C CA   . ILE A 1 90  ? -8.996  -1.646  5.311   1.00 1.00 ? 110 ILE A CA   5  
ATOM 8526  C C    . ILE A 1 90  ? -9.055  -2.222  6.729   1.00 1.00 ? 110 ILE A C    5  
ATOM 8527  O O    . ILE A 1 90  ? -8.361  -3.198  7.028   1.00 1.00 ? 110 ILE A O    5  
ATOM 8528  C CB   . ILE A 1 90  ? -9.391  -2.706  4.245   1.00 1.00 ? 110 ILE A CB   5  
ATOM 8529  C CG1  . ILE A 1 90  ? -9.464  -2.059  2.839   1.00 1.00 ? 110 ILE A CG1  5  
ATOM 8530  C CG2  . ILE A 1 90  ? -10.746 -3.365  4.607   1.00 1.00 ? 110 ILE A CG2  5  
ATOM 8531  C CD1  . ILE A 1 90  ? -9.619  -3.044  1.671   1.00 1.00 ? 110 ILE A CD1  5  
ATOM 8532  H H    . ILE A 1 90  ? -6.927  -1.852  4.889   1.00 1.00 ? 110 ILE A H    5  
ATOM 8533  H HA   . ILE A 1 90  ? -9.701  -0.818  5.231   1.00 1.00 ? 110 ILE A HA   5  
ATOM 8534  H HB   . ILE A 1 90  ? -8.629  -3.486  4.232   1.00 1.00 ? 110 ILE A HB   5  
ATOM 8535  H HG12 . ILE A 1 90  ? -10.346 -1.421  2.762   1.00 0.00 ? 110 ILE A HG12 5  
ATOM 8536  H HG13 . ILE A 1 90  ? -8.578  -1.454  2.655   1.00 1.00 ? 110 ILE A HG13 5  
ATOM 8537  H HG21 . ILE A 1 90  ? -11.525 -2.608  4.719   1.00 1.00 ? 110 ILE A HG21 5  
ATOM 8538  H HG22 . ILE A 1 90  ? -11.045 -4.083  3.845   1.00 1.00 ? 110 ILE A HG22 5  
ATOM 8539  H HG23 . ILE A 1 90  ? -10.665 -3.920  5.543   1.00 1.00 ? 110 ILE A HG23 5  
ATOM 8540  H HD11 . ILE A 1 90  ? -8.846  -3.811  1.724   1.00 1.00 ? 110 ILE A HD11 5  
ATOM 8541  H HD12 . ILE A 1 90  ? -10.601 -3.514  1.701   1.00 1.00 ? 110 ILE A HD12 5  
ATOM 8542  H HD13 . ILE A 1 90  ? -9.523  -2.505  0.728   1.00 1.00 ? 110 ILE A HD13 5  
ATOM 8543  N N    . THR A 1 91  ? -9.886  -1.599  7.580   1.00 1.00 ? 111 THR A N    5  
ATOM 8544  C CA   . THR A 1 91  ? -10.146 -2.048  8.974   1.00 1.00 ? 111 THR A CA   5  
ATOM 8545  C C    . THR A 1 91  ? -11.600 -2.532  9.199   1.00 1.00 ? 111 THR A C    5  
ATOM 8546  O O    . THR A 1 91  ? -12.552 -1.752  9.189   1.00 1.00 ? 111 THR A O    5  
ATOM 8547  C CB   . THR A 1 91  ? -9.629  -1.022  10.002  1.00 1.00 ? 111 THR A CB   5  
ATOM 8548  O OG1  . THR A 1 91  ? -9.732  -1.544  11.308  1.00 1.00 ? 111 THR A OG1  5  
ATOM 8549  C CG2  . THR A 1 91  ? -10.283 0.359   10.007  1.00 1.00 ? 111 THR A CG2  5  
ATOM 8550  H H    . THR A 1 91  ? -10.341 -0.744  7.213   1.00 1.00 ? 111 THR A H    5  
ATOM 8551  H HA   . THR A 1 91  ? -9.523  -2.924  9.145   1.00 1.00 ? 111 THR A HA   5  
ATOM 8552  H HB   . THR A 1 91  ? -8.566  -0.874  9.809   1.00 1.00 ? 111 THR A HB   5  
ATOM 8553  H HG1  . THR A 1 91  ? -9.477  -0.844  11.916  1.00 1.00 ? 111 THR A HG1  5  
ATOM 8554  H HG21 . THR A 1 91  ? -10.162 0.825   9.023   1.00 1.00 ? 111 THR A HG21 5  
ATOM 8555  H HG22 . THR A 1 91  ? -11.344 0.280   10.238  1.00 1.00 ? 111 THR A HG22 5  
ATOM 8556  H HG23 . THR A 1 91  ? -9.808  1.004   10.748  1.00 1.00 ? 111 THR A HG23 5  
ATOM 8557  N N    . VAL A 1 92  ? -11.795 -3.856  9.346   1.00 1.00 ? 112 VAL A N    5  
ATOM 8558  C CA   . VAL A 1 92  ? -13.106 -4.516  9.538   1.00 1.00 ? 112 VAL A CA   5  
ATOM 8559  C C    . VAL A 1 92  ? -13.622 -4.358  10.983  1.00 1.00 ? 112 VAL A C    5  
ATOM 8560  O O    . VAL A 1 92  ? -12.871 -4.406  11.957  1.00 1.00 ? 112 VAL A O    5  
ATOM 8561  C CB   . VAL A 1 92  ? -13.050 -6.000  9.098   1.00 1.00 ? 112 VAL A CB   5  
ATOM 8562  C CG1  . VAL A 1 92  ? -14.273 -6.854  9.477   1.00 1.00 ? 112 VAL A CG1  5  
ATOM 8563  C CG2  . VAL A 1 92  ? -12.847 -6.140  7.583   1.00 1.00 ? 112 VAL A CG2  5  
ATOM 8564  H H    . VAL A 1 92  ? -10.978 -4.470  9.333   1.00 1.00 ? 112 VAL A H    5  
ATOM 8565  H HA   . VAL A 1 92  ? -13.813 -4.017  8.879   1.00 1.00 ? 112 VAL A HA   5  
ATOM 8566  H HB   . VAL A 1 92  ? -12.204 -6.444  9.591   1.00 1.00 ? 112 VAL A HB   5  
ATOM 8567  H HG11 . VAL A 1 92  ? -15.191 -6.413  9.085   1.00 1.00 ? 112 VAL A HG11 5  
ATOM 8568  H HG12 . VAL A 1 92  ? -14.167 -7.864  9.075   1.00 1.00 ? 112 VAL A HG12 5  
ATOM 8569  H HG13 . VAL A 1 92  ? -14.325 -6.963  10.559  1.00 1.00 ? 112 VAL A HG13 5  
ATOM 8570  H HG21 . VAL A 1 92  ? -11.938 -5.625  7.269   1.00 1.00 ? 112 VAL A HG21 5  
ATOM 8571  H HG22 . VAL A 1 92  ? -12.754 -7.194  7.328   1.00 1.00 ? 112 VAL A HG22 5  
ATOM 8572  H HG23 . VAL A 1 92  ? -13.701 -5.733  7.053   1.00 1.00 ? 112 VAL A HG23 5  
ATOM 8573  N N    . PHE A 1 93  ? -14.947 -4.242  11.084  1.00 1.00 ? 113 PHE A N    5  
ATOM 8574  C CA   . PHE A 1 93  ? -15.773 -3.946  12.273  1.00 1.00 ? 113 PHE A CA   5  
ATOM 8575  C C    . PHE A 1 93  ? -16.516 -5.174  12.867  1.00 1.00 ? 113 PHE A C    5  
ATOM 8576  O O    . PHE A 1 93  ? -17.111 -5.062  13.939  1.00 1.00 ? 113 PHE A O    5  
ATOM 8577  C CB   . PHE A 1 93  ? -16.745 -2.840  11.816  1.00 1.00 ? 113 PHE A CB   5  
ATOM 8578  C CG   . PHE A 1 93  ? -17.675 -2.181  12.827  1.00 1.00 ? 113 PHE A CG   5  
ATOM 8579  C CD1  . PHE A 1 93  ? -17.187 -1.221  13.748  1.00 1.00 ? 113 PHE A CD1  5  
ATOM 8580  C CD2  . PHE A 1 93  ? -19.058 -2.479  12.804  1.00 1.00 ? 113 PHE A CD2  5  
ATOM 8581  C CE1  . PHE A 1 93  ? -18.076 -0.593  14.654  1.00 1.00 ? 113 PHE A CE1  5  
ATOM 8582  C CE2  . PHE A 1 93  ? -19.943 -1.850  13.705  1.00 1.00 ? 113 PHE A CE2  5  
ATOM 8583  C CZ   . PHE A 1 93  ? -19.450 -0.914  14.639  1.00 1.00 ? 113 PHE A CZ   5  
ATOM 8584  H H    . PHE A 1 93  ? -15.423 -4.369  10.209  1.00 1.00 ? 113 PHE A H    5  
ATOM 8585  H HA   . PHE A 1 93  ? -15.141 -3.534  13.060  1.00 1.00 ? 113 PHE A HA   5  
ATOM 8586  H HB2  . PHE A 1 93  ? -16.182 -1.950  11.534  1.00 0.00 ? 113 PHE A HB2  5  
ATOM 8587  H HB3  . PHE A 1 93  ? -17.321 -3.189  10.956  1.00 1.00 ? 113 PHE A HB3  5  
ATOM 8588  H HD1  . PHE A 1 93  ? -16.136 -0.967  13.756  1.00 1.00 ? 113 PHE A HD1  5  
ATOM 8589  H HD2  . PHE A 1 93  ? -19.449 -3.192  12.092  1.00 1.00 ? 113 PHE A HD2  5  
ATOM 8590  H HE1  . PHE A 1 93  ? -17.712 0.133   15.368  1.00 1.00 ? 113 PHE A HE1  5  
ATOM 8591  H HE2  . PHE A 1 93  ? -20.997 -2.093  13.675  1.00 1.00 ? 113 PHE A HE2  5  
ATOM 8592  H HZ   . PHE A 1 93  ? -20.125 -0.439  15.340  1.00 1.00 ? 113 PHE A HZ   5  
ATOM 8593  N N    . THR A 1 94  ? -16.463 -6.331  12.184  1.00 1.00 ? 114 THR A N    5  
ATOM 8594  C CA   . THR A 1 94  ? -17.164 -7.616  12.465  1.00 1.00 ? 114 THR A CA   5  
ATOM 8595  C C    . THR A 1 94  ? -16.566 -8.338  13.697  1.00 1.00 ? 114 THR A C    5  
ATOM 8596  O O    . THR A 1 94  ? -15.501 -7.952  14.185  1.00 1.00 ? 114 THR A O    5  
ATOM 8597  C CB   . THR A 1 94  ? -17.059 -8.546  11.217  1.00 1.00 ? 114 THR A CB   5  
ATOM 8598  O OG1  . THR A 1 94  ? -17.353 -7.849  10.021  1.00 1.00 ? 114 THR A OG1  5  
ATOM 8599  C CG2  . THR A 1 94  ? -17.995 -9.768  11.189  1.00 1.00 ? 114 THR A CG2  5  
ATOM 8600  H H    . THR A 1 94  ? -15.795 -6.344  11.420  1.00 1.00 ? 114 THR A H    5  
ATOM 8601  H HA   . THR A 1 94  ? -18.218 -7.403  12.658  1.00 1.00 ? 114 THR A HA   5  
ATOM 8602  H HB   . THR A 1 94  ? -16.029 -8.897  11.141  1.00 1.00 ? 114 THR A HB   5  
ATOM 8603  H HG1  . THR A 1 94  ? -17.208 -8.477  9.310   1.00 1.00 ? 114 THR A HG1  5  
ATOM 8604  H HG21 . THR A 1 94  ? -19.025 -9.468  11.373  1.00 1.00 ? 114 THR A HG21 5  
ATOM 8605  H HG22 . THR A 1 94  ? -17.940 -10.270 10.222  1.00 1.00 ? 114 THR A HG22 5  
ATOM 8606  H HG23 . THR A 1 94  ? -17.725 -10.504 11.937  1.00 1.00 ? 114 THR A HG23 5  
ATOM 8607  N N    . ASN A 1 95  ? -17.199 -9.425  14.186  1.00 1.00 ? 115 ASN A N    5  
ATOM 8608  C CA   . ASN A 1 95  ? -16.653 -10.309 15.236  1.00 1.00 ? 115 ASN A CA   5  
ATOM 8609  C C    . ASN A 1 95  ? -15.137 -10.595 15.020  1.00 1.00 ? 115 ASN A C    5  
ATOM 8610  O O    . ASN A 1 95  ? -14.380 -10.383 15.967  1.00 1.00 ? 115 ASN A O    5  
ATOM 8611  C CB   . ASN A 1 95  ? -17.532 -11.575 15.352  1.00 1.00 ? 115 ASN A CB   5  
ATOM 8612  C CG   . ASN A 1 95  ? -18.482 -11.576 16.545  1.00 1.00 ? 115 ASN A CG   5  
ATOM 8613  O OD1  . ASN A 1 95  ? -19.690 -11.662 16.424  1.00 1.00 ? 115 ASN A OD1  5  
ATOM 8614  N ND2  . ASN A 1 95  ? -17.972 -11.486 17.756  1.00 1.00 ? 115 ASN A ND2  5  
ATOM 8615  H H    . ASN A 1 95  ? -18.084 -9.685  13.774  1.00 1.00 ? 115 ASN A H    5  
ATOM 8616  H HA   . ASN A 1 95  ? -16.716 -9.747  16.172  1.00 1.00 ? 115 ASN A HA   5  
ATOM 8617  H HB2  . ASN A 1 95  ? -18.205 -11.680 14.501  1.00 0.00 ? 115 ASN A HB2  5  
ATOM 8618  H HB3  . ASN A 1 95  ? -16.930 -12.484 15.398  1.00 1.00 ? 115 ASN A HB3  5  
ATOM 8619  H HD21 . ASN A 1 95  ? -16.951 -11.418 17.880  1.00 0.00 ? 115 ASN A HD21 5  
ATOM 8620  H HD22 . ASN A 1 95  ? -18.594 -11.485 18.577  1.00 0.00 ? 115 ASN A HD22 5  
ATOM 8621  N N    . PRO A 1 96  ? -14.688 -11.058 13.825  1.00 1.00 ? 116 PRO A N    5  
ATOM 8622  C CA   . PRO A 1 96  ? -13.275 -11.143 13.442  1.00 1.00 ? 116 PRO A CA   5  
ATOM 8623  C C    . PRO A 1 96  ? -12.760 -9.729  13.031  1.00 1.00 ? 116 PRO A C    5  
ATOM 8624  O O    . PRO A 1 96  ? -13.179 -9.213  11.990  1.00 1.00 ? 116 PRO A O    5  
ATOM 8625  C CB   . PRO A 1 96  ? -13.209 -12.117 12.258  1.00 1.00 ? 116 PRO A CB   5  
ATOM 8626  C CG   . PRO A 1 96  ? -14.594 -12.007 11.620  1.00 1.00 ? 116 PRO A CG   5  
ATOM 8627  C CD   . PRO A 1 96  ? -15.517 -11.662 12.787  1.00 1.00 ? 116 PRO A CD   5  
ATOM 8628  H HA   . PRO A 1 96  ? -12.681 -11.548 14.262  1.00 1.00 ? 116 PRO A HA   5  
ATOM 8629  H HB2  . PRO A 1 96  ? -12.422 -11.830 11.560  1.00 0.00 ? 116 PRO A HB2  5  
ATOM 8630  H HB3  . PRO A 1 96  ? -13.047 -13.134 12.620  1.00 1.00 ? 116 PRO A HB3  5  
ATOM 8631  H HG2  . PRO A 1 96  ? -14.621 -11.226 10.860  1.00 0.00 ? 116 PRO A HG2  5  
ATOM 8632  H HG3  . PRO A 1 96  ? -14.886 -12.942 11.140  1.00 1.00 ? 116 PRO A HG3  5  
ATOM 8633  H HD2  . PRO A 1 96  ? -16.311 -10.967 12.513  1.00 0.00 ? 116 PRO A HD2  5  
ATOM 8634  H HD3  . PRO A 1 96  ? -15.951 -12.586 13.167  1.00 1.00 ? 116 PRO A HD3  5  
ATOM 8635  N N    . PRO A 1 97  ? -11.867 -9.074  13.811  1.00 1.00 ? 117 PRO A N    5  
ATOM 8636  C CA   . PRO A 1 97  ? -11.258 -7.792  13.428  1.00 1.00 ? 117 PRO A CA   5  
ATOM 8637  C C    . PRO A 1 97  ? -10.255 -8.018  12.273  1.00 1.00 ? 117 PRO A C    5  
ATOM 8638  O O    . PRO A 1 97  ? -9.176  -8.582  12.475  1.00 1.00 ? 117 PRO A O    5  
ATOM 8639  C CB   . PRO A 1 97  ? -10.599 -7.239  14.698  1.00 1.00 ? 117 PRO A CB   5  
ATOM 8640  C CG   . PRO A 1 97  ? -10.290 -8.483  15.528  1.00 1.00 ? 117 PRO A CG   5  
ATOM 8641  C CD   . PRO A 1 97  ? -11.258 -9.563  15.044  1.00 1.00 ? 117 PRO A CD   5  
ATOM 8642  H HA   . PRO A 1 97  ? -12.036 -7.092  13.106  1.00 1.00 ? 117 PRO A HA   5  
ATOM 8643  H HB2  . PRO A 1 97  ? -9.717  -6.714  14.333  1.00 0.00 ? 117 PRO A HB2  5  
ATOM 8644  H HB3  . PRO A 1 97  ? -11.321 -6.619  15.234  1.00 1.00 ? 117 PRO A HB3  5  
ATOM 8645  H HG2  . PRO A 1 97  ? -9.262  -8.813  15.372  1.00 0.00 ? 117 PRO A HG2  5  
ATOM 8646  H HG3  . PRO A 1 97  ? -10.418 -8.286  16.593  1.00 1.00 ? 117 PRO A HG3  5  
ATOM 8647  H HD2  . PRO A 1 97  ? -10.726 -10.498 14.870  1.00 0.00 ? 117 PRO A HD2  5  
ATOM 8648  H HD3  . PRO A 1 97  ? -12.014 -9.742  15.806  1.00 1.00 ? 117 PRO A HD3  5  
ATOM 8649  N N    . GLN A 1 98  ? -10.619 -7.610  11.046  1.00 1.00 ? 118 GLN A N    5  
ATOM 8650  C CA   . GLN A 1 98  ? -9.826  -7.851  9.825   1.00 1.00 ? 118 GLN A CA   5  
ATOM 8651  C C    . GLN A 1 98  ? -9.147  -6.557  9.339   1.00 1.00 ? 118 GLN A C    5  
ATOM 8652  O O    . GLN A 1 98  ? -9.771  -5.700  8.713   1.00 1.00 ? 118 GLN A O    5  
ATOM 8653  C CB   . GLN A 1 98  ? -10.679 -8.538  8.731   1.00 1.00 ? 118 GLN A CB   5  
ATOM 8654  C CG   . GLN A 1 98  ? -10.413 -10.035 8.474   1.00 1.00 ? 118 GLN A CG   5  
ATOM 8655  C CD   . GLN A 1 98  ? -11.288 -10.950 9.327   1.00 1.00 ? 118 GLN A CD   5  
ATOM 8656  O OE1  . GLN A 1 98  ? -12.502 -10.898 9.310   1.00 1.00 ? 118 GLN A OE1  5  
ATOM 8657  N NE2  . GLN A 1 98  ? -10.733 -11.834 10.121  1.00 1.00 ? 118 GLN A NE2  5  
ATOM 8658  H H    . GLN A 1 98  ? -11.494 -7.088  10.958  1.00 1.00 ? 118 GLN A H    5  
ATOM 8659  H HA   . GLN A 1 98  ? -9.021  -8.547  10.065  1.00 1.00 ? 118 GLN A HA   5  
ATOM 8660  H HB2  . GLN A 1 98  ? -11.733 -8.531  9.005   1.00 0.00 ? 118 GLN A HB2  5  
ATOM 8661  H HB3  . GLN A 1 98  ? -10.568 -8.020  7.774   1.00 1.00 ? 118 GLN A HB3  5  
ATOM 8662  H HG2  . GLN A 1 98  ? -10.731 -10.335 7.475   1.00 0.00 ? 118 GLN A HG2  5  
ATOM 8663  H HG3  . GLN A 1 98  ? -9.354  -10.277 8.561   1.00 1.00 ? 118 GLN A HG3  5  
ATOM 8664  H HE21 . GLN A 1 98  ? -9.706  -11.911 10.170  1.00 0.00 ? 118 GLN A HE21 5  
ATOM 8665  H HE22 . GLN A 1 98  ? -11.323 -12.452 10.698  1.00 0.00 ? 118 GLN A HE22 5  
ATOM 8666  N N    . VAL A 1 99  ? -7.848  -6.432  9.633   1.00 1.00 ? 119 VAL A N    5  
ATOM 8667  C CA   . VAL A 1 99  ? -6.951  -5.329  9.220   1.00 1.00 ? 119 VAL A CA   5  
ATOM 8668  C C    . VAL A 1 99  ? -6.018  -5.762  8.066   1.00 1.00 ? 119 VAL A C    5  
ATOM 8669  O O    . VAL A 1 99  ? -5.168  -6.635  8.237   1.00 1.00 ? 119 VAL A O    5  
ATOM 8670  C CB   . VAL A 1 99  ? -6.169  -4.728  10.424  1.00 1.00 ? 119 VAL A CB   5  
ATOM 8671  C CG1  . VAL A 1 99  ? -7.131  -3.990  11.379  1.00 1.00 ? 119 VAL A CG1  5  
ATOM 8672  C CG2  . VAL A 1 99  ? -5.348  -5.745  11.246  1.00 1.00 ? 119 VAL A CG2  5  
ATOM 8673  H H    . VAL A 1 99  ? -7.497  -7.137  10.261  1.00 1.00 ? 119 VAL A H    5  
ATOM 8674  H HA   . VAL A 1 99  ? -7.573  -4.518  8.842   1.00 1.00 ? 119 VAL A HA   5  
ATOM 8675  H HB   . VAL A 1 99  ? -5.474  -3.982  10.029  1.00 1.00 ? 119 VAL A HB   5  
ATOM 8676  H HG11 . VAL A 1 99  ? -7.694  -3.241  10.825  1.00 1.00 ? 119 VAL A HG11 5  
ATOM 8677  H HG12 . VAL A 1 99  ? -7.827  -4.692  11.841  1.00 1.00 ? 119 VAL A HG12 5  
ATOM 8678  H HG13 . VAL A 1 99  ? -6.570  -3.481  12.164  1.00 1.00 ? 119 VAL A HG13 5  
ATOM 8679  H HG21 . VAL A 1 99  ? -5.998  -6.511  11.671  1.00 1.00 ? 119 VAL A HG21 5  
ATOM 8680  H HG22 . VAL A 1 99  ? -4.597  -6.223  10.621  1.00 1.00 ? 119 VAL A HG22 5  
ATOM 8681  H HG23 . VAL A 1 99  ? -4.827  -5.239  12.059  1.00 1.00 ? 119 VAL A HG23 5  
ATOM 8682  N N    . ALA A 1 100 ? -6.186  -5.152  6.880   1.00 1.00 ? 120 ALA A N    5  
ATOM 8683  C CA   . ALA A 1 100 ? -5.405  -5.412  5.654   1.00 1.00 ? 120 ALA A CA   5  
ATOM 8684  C C    . ALA A 1 100 ? -4.971  -4.089  4.984   1.00 1.00 ? 120 ALA A C    5  
ATOM 8685  O O    . ALA A 1 100 ? -5.806  -3.225  4.703   1.00 1.00 ? 120 ALA A O    5  
ATOM 8686  C CB   . ALA A 1 100 ? -6.231  -6.305  4.710   1.00 1.00 ? 120 ALA A CB   5  
ATOM 8687  H H    . ALA A 1 100 ? -6.933  -4.459  6.817   1.00 1.00 ? 120 ALA A H    5  
ATOM 8688  H HA   . ALA A 1 100 ? -4.501  -5.968  5.923   1.00 1.00 ? 120 ALA A HA   5  
ATOM 8689  H HB1  . ALA A 1 100 ? -6.487  -7.242  5.213   1.00 1.00 ? 120 ALA A HB1  5  
ATOM 8690  H HB2  . ALA A 1 100 ? -7.150  -5.796  4.411   1.00 1.00 ? 120 ALA A HB2  5  
ATOM 8691  H HB3  . ALA A 1 100 ? -5.643  -6.545  3.822   1.00 1.00 ? 120 ALA A HB3  5  
ATOM 8692  N N    . THR A 1 101 ? -3.671  -3.934  4.695   1.00 1.00 ? 121 THR A N    5  
ATOM 8693  C CA   . THR A 1 101 ? -3.023  -2.691  4.216   1.00 1.00 ? 121 THR A CA   5  
ATOM 8694  C C    . THR A 1 101 ? -2.260  -2.834  2.885   1.00 1.00 ? 121 THR A C    5  
ATOM 8695  O O    . THR A 1 101 ? -1.718  -3.891  2.557   1.00 1.00 ? 121 THR A O    5  
ATOM 8696  C CB   . THR A 1 101 ? -2.162  -2.042  5.325   1.00 1.00 ? 121 THR A CB   5  
ATOM 8697  O OG1  . THR A 1 101 ? -1.892  -0.700  4.982   1.00 1.00 ? 121 THR A OG1  5  
ATOM 8698  C CG2  . THR A 1 101 ? -0.835  -2.757  5.604   1.00 1.00 ? 121 THR A CG2  5  
ATOM 8699  H H    . THR A 1 101 ? -3.052  -4.741  4.853   1.00 1.00 ? 121 THR A H    5  
ATOM 8700  H HA   . THR A 1 101 ? -3.823  -1.982  4.020   1.00 1.00 ? 121 THR A HA   5  
ATOM 8701  H HB   . THR A 1 101 ? -2.742  -2.031  6.250   1.00 1.00 ? 121 THR A HB   5  
ATOM 8702  H HG1  . THR A 1 101 ? -2.569  -0.132  5.421   1.00 1.00 ? 121 THR A HG1  5  
ATOM 8703  H HG21 . THR A 1 101 ? -1.021  -3.797  5.874   1.00 1.00 ? 121 THR A HG21 5  
ATOM 8704  H HG22 . THR A 1 101 ? -0.189  -2.724  4.726   1.00 1.00 ? 121 THR A HG22 5  
ATOM 8705  H HG23 . THR A 1 101 ? -0.322  -2.269  6.434   1.00 1.00 ? 121 THR A HG23 5  
ATOM 8706  N N    . TYR A 1 102 ? -2.220  -1.753  2.096   1.00 1.00 ? 122 TYR A N    5  
ATOM 8707  C CA   . TYR A 1 102 ? -1.516  -1.668  0.812   1.00 1.00 ? 122 TYR A CA   5  
ATOM 8708  C C    . TYR A 1 102 ? -0.052  -1.245  1.066   1.00 1.00 ? 122 TYR A C    5  
ATOM 8709  O O    . TYR A 1 102 ? 0.247   -0.119  1.464   1.00 1.00 ? 122 TYR A O    5  
ATOM 8710  C CB   . TYR A 1 102 ? -2.257  -0.632  -0.050  1.00 1.00 ? 122 TYR A CB   5  
ATOM 8711  C CG   . TYR A 1 102 ? -1.962  -0.594  -1.540  1.00 1.00 ? 122 TYR A CG   5  
ATOM 8712  C CD1  . TYR A 1 102 ? -2.645  -1.498  -2.378  1.00 1.00 ? 122 TYR A CD1  5  
ATOM 8713  C CD2  . TYR A 1 102 ? -1.080  0.362   -2.097  1.00 1.00 ? 122 TYR A CD2  5  
ATOM 8714  C CE1  . TYR A 1 102 ? -2.439  -1.478  -3.774  1.00 1.00 ? 122 TYR A CE1  5  
ATOM 8715  C CE2  . TYR A 1 102 ? -0.869  0.397   -3.499  1.00 1.00 ? 122 TYR A CE2  5  
ATOM 8716  C CZ   . TYR A 1 102 ? -1.561  -0.515  -4.337  1.00 1.00 ? 122 TYR A CZ   5  
ATOM 8717  O OH   . TYR A 1 102 ? -1.439  -0.443  -5.685  1.00 1.00 ? 122 TYR A OH   5  
ATOM 8718  H H    . TYR A 1 102 ? -2.754  -0.949  2.412   1.00 1.00 ? 122 TYR A H    5  
ATOM 8719  H HA   . TYR A 1 102 ? -1.556  -2.630  0.305   1.00 1.00 ? 122 TYR A HA   5  
ATOM 8720  H HB2  . TYR A 1 102 ? -3.311  -0.885  -0.158  1.00 0.00 ? 122 TYR A HB2  5  
ATOM 8721  H HB3  . TYR A 1 102 ? -2.201  0.364   0.391   1.00 1.00 ? 122 TYR A HB3  5  
ATOM 8722  H HD1  . TYR A 1 102 ? -3.352  -2.199  -1.955  1.00 1.00 ? 122 TYR A HD1  5  
ATOM 8723  H HD2  . TYR A 1 102 ? -0.591  1.094   -1.470  1.00 1.00 ? 122 TYR A HD2  5  
ATOM 8724  H HE1  . TYR A 1 102 ? -2.958  -2.194  -4.400  1.00 1.00 ? 122 TYR A HE1  5  
ATOM 8725  H HE2  . TYR A 1 102 ? -0.225  1.132   -3.956  1.00 1.00 ? 122 TYR A HE2  5  
ATOM 8726  H HH   . TYR A 1 102 ? -2.306  -0.546  -6.071  1.00 1.00 ? 122 TYR A HH   5  
ATOM 8727  N N    . HIS A 1 103 ? 0.862   -2.190  0.787   1.00 1.00 ? 123 HIS A N    5  
ATOM 8728  C CA   . HIS A 1 103 ? 2.321   -2.138  1.010   1.00 1.00 ? 123 HIS A CA   5  
ATOM 8729  C C    . HIS A 1 103 ? 3.119   -2.571  -0.247  1.00 1.00 ? 123 HIS A C    5  
ATOM 8730  O O    . HIS A 1 103 ? 3.981   -3.458  -0.197  1.00 1.00 ? 123 HIS A O    5  
ATOM 8731  C CB   . HIS A 1 103 ? 2.649   -2.946  2.283   1.00 1.00 ? 123 HIS A CB   5  
ATOM 8732  C CG   . HIS A 1 103 ? 2.340   -4.422  2.235   1.00 1.00 ? 123 HIS A CG   5  
ATOM 8733  N ND1  . HIS A 1 103 ? 3.093   -5.368  1.574   1.00 1.00 ? 123 HIS A ND1  5  
ATOM 8734  C CD2  . HIS A 1 103 ? 1.295   -5.053  2.842   1.00 1.00 ? 123 HIS A CD2  5  
ATOM 8735  C CE1  . HIS A 1 103 ? 2.540   -6.579  1.812   1.00 1.00 ? 123 HIS A CE1  5  
ATOM 8736  N NE2  . HIS A 1 103 ? 1.438   -6.396  2.579   1.00 1.00 ? 123 HIS A NE2  5  
ATOM 8737  H H    . HIS A 1 103 ? 0.477   -3.094  0.549   1.00 1.00 ? 123 HIS A H    5  
ATOM 8738  H HA   . HIS A 1 103 ? 2.614   -1.105  1.205   1.00 1.00 ? 123 HIS A HA   5  
ATOM 8739  H HB2  . HIS A 1 103 ? 3.723   -3.000  2.451   1.00 0.00 ? 123 HIS A HB2  5  
ATOM 8740  H HB3  . HIS A 1 103 ? 2.197   -2.491  3.169   1.00 1.00 ? 123 HIS A HB3  5  
ATOM 8741  H HD1  . HIS A 1 103 ? 3.858   -5.087  0.957   1.00 1.00 ? 123 HIS A HD1  5  
ATOM 8742  H HD2  . HIS A 1 103 ? 0.499   -4.617  3.430   1.00 1.00 ? 123 HIS A HD2  5  
ATOM 8743  H HE1  . HIS A 1 103 ? 2.917   -7.535  1.452   1.00 1.00 ? 123 HIS A HE1  5  
ATOM 8744  H HE2  . HIS A 1 103 ? 0.759   -7.069  2.983   1.00 1.00 ? 123 HIS A HE2  5  
ATOM 8745  N N    . ARG A 1 104 ? 2.756   -1.967  -1.393  1.00 1.00 ? 124 ARG A N    5  
ATOM 8746  C CA   . ARG A 1 104 ? 3.254   -2.259  -2.755  1.00 1.00 ? 124 ARG A CA   5  
ATOM 8747  C C    . ARG A 1 104 ? 3.569   -1.001  -3.599  1.00 1.00 ? 124 ARG A C    5  
ATOM 8748  O O    . ARG A 1 104 ? 4.638   -0.425  -3.417  1.00 1.00 ? 124 ARG A O    5  
ATOM 8749  C CB   . ARG A 1 104 ? 2.340   -3.296  -3.451  1.00 1.00 ? 124 ARG A CB   5  
ATOM 8750  C CG   . ARG A 1 104 ? 0.823   -3.089  -3.306  1.00 1.00 ? 124 ARG A CG   5  
ATOM 8751  C CD   . ARG A 1 104 ? 0.028   -3.984  -4.257  1.00 1.00 ? 124 ARG A CD   5  
ATOM 8752  N NE   . ARG A 1 104 ? 0.270   -3.636  -5.670  1.00 1.00 ? 124 ARG A NE   5  
ATOM 8753  C CZ   . ARG A 1 104 ? 0.990   -4.340  -6.530  1.00 1.00 ? 124 ARG A CZ   5  
ATOM 8754  N NH1  . ARG A 1 104 ? 1.568   -5.471  -6.215  1.00 1.00 ? 124 ARG A NH1  5  
ATOM 8755  N NH2  . ARG A 1 104 ? 1.149   -3.912  -7.751  1.00 1.00 ? 124 ARG A NH2  5  
ATOM 8756  H H    . ARG A 1 104 ? 2.011   -1.295  -1.276  1.00 1.00 ? 124 ARG A H    5  
ATOM 8757  H HA   . ARG A 1 104 ? 4.230   -2.746  -2.656  1.00 1.00 ? 124 ARG A HA   5  
ATOM 8758  H HB2  . ARG A 1 104 ? 2.438   -3.226  -4.534  1.00 0.00 ? 124 ARG A HB2  5  
ATOM 8759  H HB3  . ARG A 1 104 ? 2.609   -4.309  -3.147  1.00 1.00 ? 124 ARG A HB3  5  
ATOM 8760  H HG2  . ARG A 1 104 ? 0.518   -3.334  -2.289  1.00 0.00 ? 124 ARG A HG2  5  
ATOM 8761  H HG3  . ARG A 1 104 ? 0.576   -2.051  -3.517  1.00 1.00 ? 124 ARG A HG3  5  
ATOM 8762  H HD2  . ARG A 1 104 ? 0.353   -5.020  -4.160  1.00 0.00 ? 124 ARG A HD2  5  
ATOM 8763  H HD3  . ARG A 1 104 ? -1.036  -3.929  -4.025  1.00 1.00 ? 124 ARG A HD3  5  
ATOM 8764  H HE   . ARG A 1 104 ? -0.148  -2.785  -6.014  1.00 1.00 ? 124 ARG A HE   5  
ATOM 8765  H HH11 . ARG A 1 104 ? 1.473   -5.851  -5.262  1.00 0.00 ? 124 ARG A HH11 5  
ATOM 8766  H HH12 . ARG A 1 104 ? 2.119   -5.982  -6.920  1.00 0.00 ? 124 ARG A HH12 5  
ATOM 8767  H HH21 . ARG A 1 104 ? 0.715   -3.027  -8.047  1.00 0.00 ? 124 ARG A HH21 5  
ATOM 8768  H HH22 . ARG A 1 104 ? 1.709   -4.462  -8.419  1.00 0.00 ? 124 ARG A HH22 5  
ATOM 8769  N N    . ALA A 1 105 ? 2.686   -0.566  -4.514  1.00 1.00 ? 125 ALA A N    5  
ATOM 8770  C CA   . ALA A 1 105 ? 2.911   0.510   -5.508  1.00 1.00 ? 125 ALA A CA   5  
ATOM 8771  C C    . ALA A 1 105 ? 2.971   1.965   -4.946  1.00 1.00 ? 125 ALA A C    5  
ATOM 8772  O O    . ALA A 1 105 ? 2.213   2.851   -5.351  1.00 1.00 ? 125 ALA A O    5  
ATOM 8773  C CB   . ALA A 1 105 ? 1.898   0.332   -6.657  1.00 1.00 ? 125 ALA A CB   5  
ATOM 8774  H H    . ALA A 1 105 ? 1.819   -1.073  -4.575  1.00 1.00 ? 125 ALA A H    5  
ATOM 8775  H HA   . ALA A 1 105 ? 3.892   0.335   -5.952  1.00 1.00 ? 125 ALA A HA   5  
ATOM 8776  H HB1  . ALA A 1 105 ? 1.887   -0.703  -7.008  1.00 1.00 ? 125 ALA A HB1  5  
ATOM 8777  H HB2  . ALA A 1 105 ? 0.901   0.613   -6.323  1.00 1.00 ? 125 ALA A HB2  5  
ATOM 8778  H HB3  . ALA A 1 105 ? 2.178   0.973   -7.496  1.00 1.00 ? 125 ALA A HB3  5  
ATOM 8779  N N    . ILE A 1 106 ? 3.911   2.223   -4.025  1.00 1.00 ? 126 ILE A N    5  
ATOM 8780  C CA   . ILE A 1 106 ? 4.179   3.515   -3.353  1.00 1.00 ? 126 ILE A CA   5  
ATOM 8781  C C    . ILE A 1 106 ? 4.796   4.597   -4.276  1.00 1.00 ? 126 ILE A C    5  
ATOM 8782  O O    . ILE A 1 106 ? 5.962   4.976   -4.148  1.00 1.00 ? 126 ILE A O    5  
ATOM 8783  C CB   . ILE A 1 106 ? 4.986   3.314   -2.039  1.00 1.00 ? 126 ILE A CB   5  
ATOM 8784  C CG1  . ILE A 1 106 ? 6.284   2.481   -2.204  1.00 1.00 ? 126 ILE A CG1  5  
ATOM 8785  C CG2  . ILE A 1 106 ? 4.106   2.675   -0.947  1.00 1.00 ? 126 ILE A CG2  5  
ATOM 8786  C CD1  . ILE A 1 106 ? 7.561   3.177   -1.725  1.00 1.00 ? 126 ILE A CD1  5  
ATOM 8787  H H    . ILE A 1 106 ? 4.466   1.419   -3.735  1.00 1.00 ? 126 ILE A H    5  
ATOM 8788  H HA   . ILE A 1 106 ? 3.215   3.928   -3.049  1.00 1.00 ? 126 ILE A HA   5  
ATOM 8789  H HB   . ILE A 1 106 ? 5.247   4.308   -1.667  1.00 1.00 ? 126 ILE A HB   5  
ATOM 8790  H HG12 . ILE A 1 106 ? 6.283   1.585   -1.584  1.00 0.00 ? 126 ILE A HG12 5  
ATOM 8791  H HG13 . ILE A 1 106 ? 6.434   2.145   -3.230  1.00 1.00 ? 126 ILE A HG13 5  
ATOM 8792  H HG21 . ILE A 1 106 ? 3.218   3.284   -0.781  1.00 1.00 ? 126 ILE A HG21 5  
ATOM 8793  H HG22 . ILE A 1 106 ? 3.793   1.670   -1.234  1.00 1.00 ? 126 ILE A HG22 5  
ATOM 8794  H HG23 . ILE A 1 106 ? 4.655   2.621   -0.004  1.00 1.00 ? 126 ILE A HG23 5  
ATOM 8795  H HD11 . ILE A 1 106 ? 7.429   3.536   -0.704  1.00 1.00 ? 126 ILE A HD11 5  
ATOM 8796  H HD12 . ILE A 1 106 ? 8.389   2.466   -1.750  1.00 1.00 ? 126 ILE A HD12 5  
ATOM 8797  H HD13 . ILE A 1 106 ? 7.792   4.018   -2.381  1.00 1.00 ? 126 ILE A HD13 5  
ATOM 8798  N N    . LYS A 1 107 ? 3.971   5.136   -5.187  1.00 1.00 ? 127 LYS A N    5  
ATOM 8799  C CA   . LYS A 1 107 ? 4.246   6.286   -6.075  1.00 1.00 ? 127 LYS A CA   5  
ATOM 8800  C C    . LYS A 1 107 ? 3.129   7.344   -6.002  1.00 1.00 ? 127 LYS A C    5  
ATOM 8801  O O    . LYS A 1 107 ? 2.004   7.041   -5.608  1.00 1.00 ? 127 LYS A O    5  
ATOM 8802  C CB   . LYS A 1 107 ? 4.462   5.769   -7.509  1.00 1.00 ? 127 LYS A CB   5  
ATOM 8803  C CG   . LYS A 1 107 ? 5.228   6.740   -8.419  1.00 1.00 ? 127 LYS A CG   5  
ATOM 8804  C CD   . LYS A 1 107 ? 5.556   6.084   -9.769  1.00 1.00 ? 127 LYS A CD   5  
ATOM 8805  C CE   . LYS A 1 107 ? 6.695   6.758   -10.548 1.00 1.00 ? 127 LYS A CE   5  
ATOM 8806  N NZ   . LYS A 1 107 ? 6.364   8.128   -11.000 1.00 1.00 ? 127 LYS A NZ   5  
ATOM 8807  H H    . LYS A 1 107 ? 3.058   4.691   -5.247  1.00 1.00 ? 127 LYS A H    5  
ATOM 8808  H HA   . LYS A 1 107 ? 5.167   6.763   -5.731  1.00 1.00 ? 127 LYS A HA   5  
ATOM 8809  H HB2  . LYS A 1 107 ? 5.118   4.900   -7.506  1.00 0.00 ? 127 LYS A HB2  5  
ATOM 8810  H HB3  . LYS A 1 107 ? 3.509   5.483   -7.958  1.00 1.00 ? 127 LYS A HB3  5  
ATOM 8811  H HG2  . LYS A 1 107 ? 4.608   7.617   -8.602  1.00 0.00 ? 127 LYS A HG2  5  
ATOM 8812  H HG3  . LYS A 1 107 ? 6.154   7.034   -7.924  1.00 1.00 ? 127 LYS A HG3  5  
ATOM 8813  H HD2  . LYS A 1 107 ? 5.974   5.087   -9.631  1.00 0.00 ? 127 LYS A HD2  5  
ATOM 8814  H HD3  . LYS A 1 107 ? 4.660   5.986   -10.389 1.00 1.00 ? 127 LYS A HD3  5  
ATOM 8815  H HE2  . LYS A 1 107 ? 7.550   6.912   -9.889  1.00 0.00 ? 127 LYS A HE2  5  
ATOM 8816  H HE3  . LYS A 1 107 ? 6.995   6.122   -11.387 1.00 1.00 ? 127 LYS A HE3  5  
ATOM 8817  H HZ1  . LYS A 1 107 ? 5.392   8.351   -10.740 1.00 0.00 ? 127 LYS A HZ1  5  
ATOM 8818  H HZ2  . LYS A 1 107 ? 7.003   8.801   -10.554 1.00 0.00 ? 127 LYS A HZ2  5  
ATOM 8819  N N    . ILE A 1 108 ? 3.448   8.580   -6.412  1.00 1.00 ? 128 ILE A N    5  
ATOM 8820  C CA   . ILE A 1 108 ? 2.533   9.734   -6.549  1.00 1.00 ? 128 ILE A CA   5  
ATOM 8821  C C    . ILE A 1 108 ? 2.999   10.689  -7.677  1.00 1.00 ? 128 ILE A C    5  
ATOM 8822  O O    . ILE A 1 108 ? 4.161   10.670  -8.095  1.00 1.00 ? 128 ILE A O    5  
ATOM 8823  C CB   . ILE A 1 108 ? 2.329   10.439  -5.162  1.00 1.00 ? 128 ILE A CB   5  
ATOM 8824  C CG1  . ILE A 1 108 ? 0.851   10.551  -4.743  1.00 1.00 ? 128 ILE A CG1  5  
ATOM 8825  C CG2  . ILE A 1 108 ? 2.917   11.858  -5.053  1.00 1.00 ? 128 ILE A CG2  5  
ATOM 8826  C CD1  . ILE A 1 108 ? 0.132   9.224   -4.477  1.00 1.00 ? 128 ILE A CD1  5  
ATOM 8827  H H    . ILE A 1 108 ? 4.394   8.724   -6.733  1.00 1.00 ? 128 ILE A H    5  
ATOM 8828  H HA   . ILE A 1 108 ? 1.574   9.336   -6.874  1.00 1.00 ? 128 ILE A HA   5  
ATOM 8829  H HB   . ILE A 1 108 ? 2.812   9.846   -4.385  1.00 1.00 ? 128 ILE A HB   5  
ATOM 8830  H HG12 . ILE A 1 108 ? 0.766   11.010  -3.758  1.00 0.00 ? 128 ILE A HG12 5  
ATOM 8831  H HG13 . ILE A 1 108 ? 0.297   11.159  -5.452  1.00 1.00 ? 128 ILE A HG13 5  
ATOM 8832  H HG21 . ILE A 1 108 ? 3.959   11.858  -5.370  1.00 1.00 ? 128 ILE A HG21 5  
ATOM 8833  H HG22 . ILE A 1 108 ? 2.370   12.571  -5.672  1.00 1.00 ? 128 ILE A HG22 5  
ATOM 8834  H HG23 . ILE A 1 108 ? 2.865   12.205  -4.021  1.00 1.00 ? 128 ILE A HG23 5  
ATOM 8835  H HD11 . ILE A 1 108 ? 0.636   8.679   -3.679  1.00 1.00 ? 128 ILE A HD11 5  
ATOM 8836  H HD12 . ILE A 1 108 ? -0.899  9.409   -4.190  1.00 1.00 ? 128 ILE A HD12 5  
ATOM 8837  H HD13 . ILE A 1 108 ? 0.112   8.620   -5.376  1.00 1.00 ? 128 ILE A HD13 5  
ATOM 8838  N N    . THR A 1 109 ? 2.075   11.533  -8.152  1.00 1.00 ? 129 THR A N    5  
ATOM 8839  C CA   . THR A 1 109 ? 2.285   12.583  -9.176  1.00 1.00 ? 129 THR A CA   5  
ATOM 8840  C C    . THR A 1 109 ? 2.469   13.959  -8.503  1.00 1.00 ? 129 THR A C    5  
ATOM 8841  O O    . THR A 1 109 ? 1.589   14.400  -7.765  1.00 1.00 ? 129 THR A O    5  
ATOM 8842  C CB   . THR A 1 109 ? 1.092   12.633  -10.167 1.00 1.00 ? 129 THR A CB   5  
ATOM 8843  O OG1  . THR A 1 109 ? 0.879   11.361  -10.750 1.00 1.00 ? 129 THR A OG1  5  
ATOM 8844  C CG2  . THR A 1 109 ? 1.311   13.627  -11.313 1.00 1.00 ? 129 THR A CG2  5  
ATOM 8845  H H    . THR A 1 109 ? 1.131   11.392  -7.812  1.00 1.00 ? 129 THR A H    5  
ATOM 8846  H HA   . THR A 1 109 ? 3.179   12.341  -9.750  1.00 1.00 ? 129 THR A HA   5  
ATOM 8847  H HB   . THR A 1 109 ? 0.184   12.916  -9.632  1.00 1.00 ? 129 THR A HB   5  
ATOM 8848  H HG1  . THR A 1 109 ? 0.429   10.814  -10.063 1.00 1.00 ? 129 THR A HG1  5  
ATOM 8849  H HG21 . THR A 1 109 ? 2.240   13.407  -11.845 1.00 1.00 ? 129 THR A HG21 5  
ATOM 8850  H HG22 . THR A 1 109 ? 0.480   13.570  -12.017 1.00 1.00 ? 129 THR A HG22 5  
ATOM 8851  H HG23 . THR A 1 109 ? 1.353   14.645  -10.923 1.00 1.00 ? 129 THR A HG23 5  
ATOM 8852  N N    . VAL A 1 110 ? 3.591   14.648  -8.787  1.00 1.00 ? 130 VAL A N    5  
ATOM 8853  C CA   . VAL A 1 110 ? 3.991   15.940  -8.165  1.00 1.00 ? 130 VAL A CA   5  
ATOM 8854  C C    . VAL A 1 110 ? 3.183   17.178  -8.612  1.00 1.00 ? 130 VAL A C    5  
ATOM 8855  O O    . VAL A 1 110 ? 2.985   18.072  -7.791  1.00 1.00 ? 130 VAL A O    5  
ATOM 8856  C CB   . VAL A 1 110 ? 5.526   16.167  -8.284  1.00 1.00 ? 130 VAL A CB   5  
ATOM 8857  C CG1  . VAL A 1 110 ? 6.035   16.395  -9.722  1.00 1.00 ? 130 VAL A CG1  5  
ATOM 8858  C CG2  . VAL A 1 110 ? 6.046   17.317  -7.398  1.00 1.00 ? 130 VAL A CG2  5  
ATOM 8859  H H    . VAL A 1 110 ? 4.264   14.190  -9.383  1.00 1.00 ? 130 VAL A H    5  
ATOM 8860  H HA   . VAL A 1 110 ? 3.786   15.834  -7.096  1.00 1.00 ? 130 VAL A HA   5  
ATOM 8861  H HB   . VAL A 1 110 ? 6.010   15.260  -7.913  1.00 1.00 ? 130 VAL A HB   5  
ATOM 8862  H HG11 . VAL A 1 110 ? 5.745   15.577  -10.375 1.00 1.00 ? 130 VAL A HG11 5  
ATOM 8863  H HG12 . VAL A 1 110 ? 5.640   17.330  -10.124 1.00 1.00 ? 130 VAL A HG12 5  
ATOM 8864  H HG13 . VAL A 1 110 ? 7.124   16.453  -9.718  1.00 1.00 ? 130 VAL A HG13 5  
ATOM 8865  H HG21 . VAL A 1 110 ? 5.705   17.189  -6.371  1.00 1.00 ? 130 VAL A HG21 5  
ATOM 8866  H HG22 . VAL A 1 110 ? 7.138   17.322  -7.397  1.00 1.00 ? 130 VAL A HG22 5  
ATOM 8867  H HG23 . VAL A 1 110 ? 5.696   18.283  -7.772  1.00 1.00 ? 130 VAL A HG23 5  
ATOM 8868  N N    . ASP A 1 111 ? 2.679   17.212  -9.861  1.00 1.00 ? 131 ASP A N    5  
ATOM 8869  C CA   . ASP A 1 111 ? 1.844   18.277  -10.460 1.00 1.00 ? 131 ASP A CA   5  
ATOM 8870  C C    . ASP A 1 111 ? 0.512   18.486  -9.701  1.00 1.00 ? 131 ASP A C    5  
ATOM 8871  O O    . ASP A 1 111 ? 0.221   19.616  -9.318  1.00 1.00 ? 131 ASP A O    5  
ATOM 8872  C CB   . ASP A 1 111 ? 1.645   17.941  -11.953 1.00 1.00 ? 131 ASP A CB   5  
ATOM 8873  C CG   . ASP A 1 111 ? 0.920   19.013  -12.772 1.00 1.00 ? 131 ASP A CG   5  
ATOM 8874  O OD1  . ASP A 1 111 ? 1.619   19.911  -13.283 1.00 1.00 ? 131 ASP A OD1  5  
ATOM 8875  O OD2  . ASP A 1 111 ? -0.318  18.891  -12.885 1.00 1.00 ? 131 ASP A OD2  5  
ATOM 8876  H H    . ASP A 1 111 ? 2.868   16.410  -10.435 1.00 1.00 ? 131 ASP A H    5  
ATOM 8877  H HA   . ASP A 1 111 ? 2.396   19.218  -10.396 1.00 1.00 ? 131 ASP A HA   5  
ATOM 8878  H HB2  . ASP A 1 111 ? 2.629   17.800  -12.401 1.00 0.00 ? 131 ASP A HB2  5  
ATOM 8879  H HB3  . ASP A 1 111 ? 1.164   16.968  -12.083 1.00 1.00 ? 131 ASP A HB3  5  
ATOM 8880  N N    . GLY A 1 112 ? -0.231  17.391  -9.440  1.00 1.00 ? 132 GLY A N    5  
ATOM 8881  C CA   . GLY A 1 112 ? -1.439  17.262  -8.605  1.00 1.00 ? 132 GLY A CA   5  
ATOM 8882  C C    . GLY A 1 112 ? -1.343  18.067  -7.295  1.00 1.00 ? 132 GLY A C    5  
ATOM 8883  O O    . GLY A 1 112 ? -0.729  17.548  -6.356  1.00 1.00 ? 132 GLY A O    5  
ATOM 8884  H H    . GLY A 1 112 ? 0.141   16.548  -9.841  1.00 1.00 ? 132 GLY A H    5  
ATOM 8885  H HA2  . GLY A 1 112 ? -2.322  17.557  -9.172  1.00 1.00 ? 132 GLY A HA2  5  
ATOM 8886  H HA3  . GLY A 1 112 ? -1.551  16.210  -8.340  1.00 1.00 ? 132 GLY A HA3  5  
ATOM 8887  N N    . PRO A 1 113 ? -1.875  19.310  -7.231  1.00 1.00 ? 133 PRO A N    5  
ATOM 8888  C CA   . PRO A 1 113 ? -1.675  20.218  -6.102  1.00 1.00 ? 133 PRO A CA   5  
ATOM 8889  C C    . PRO A 1 113 ? -2.643  20.017  -4.915  1.00 1.00 ? 133 PRO A C    5  
ATOM 8890  O O    . PRO A 1 113 ? -3.681  19.359  -5.001  1.00 1.00 ? 133 PRO A O    5  
ATOM 8891  C CB   . PRO A 1 113 ? -1.835  21.620  -6.704  1.00 1.00 ? 133 PRO A CB   5  
ATOM 8892  C CG   . PRO A 1 113 ? -2.822  21.428  -7.858  1.00 1.00 ? 133 PRO A CG   5  
ATOM 8893  C CD   . PRO A 1 113 ? -2.675  19.963  -8.266  1.00 1.00 ? 133 PRO A CD   5  
ATOM 8894  H HA   . PRO A 1 113 ? -0.654  20.111  -5.733  1.00 1.00 ? 133 PRO A HA   5  
ATOM 8895  H HB2  . PRO A 1 113 ? -2.223  22.224  -5.883  1.00 0.00 ? 133 PRO A HB2  5  
ATOM 8896  H HB3  . PRO A 1 113 ? -0.874  21.951  -7.111  1.00 1.00 ? 133 PRO A HB3  5  
ATOM 8897  H HG2  . PRO A 1 113 ? -3.838  21.655  -7.536  1.00 0.00 ? 133 PRO A HG2  5  
ATOM 8898  H HG3  . PRO A 1 113 ? -2.571  22.086  -8.693  1.00 1.00 ? 133 PRO A HG3  5  
ATOM 8899  H HD2  . PRO A 1 113 ? -3.662  19.507  -8.356  1.00 0.00 ? 133 PRO A HD2  5  
ATOM 8900  H HD3  . PRO A 1 113 ? -2.196  19.897  -9.242  1.00 1.00 ? 133 PRO A HD3  5  
ATOM 8901  N N    . ARG A 1 114 ? -2.286  20.647  -3.782  1.00 1.00 ? 134 ARG A N    5  
ATOM 8902  C CA   . ARG A 1 114 ? -3.099  20.773  -2.553  1.00 1.00 ? 134 ARG A CA   5  
ATOM 8903  C C    . ARG A 1 114 ? -4.338  21.685  -2.729  1.00 1.00 ? 134 ARG A C    5  
ATOM 8904  O O    . ARG A 1 114 ? -5.404  21.349  -2.218  1.00 1.00 ? 134 ARG A O    5  
ATOM 8905  C CB   . ARG A 1 114 ? -2.194  21.300  -1.423  1.00 1.00 ? 134 ARG A CB   5  
ATOM 8906  C CG   . ARG A 1 114 ? -2.975  21.516  -0.118  1.00 1.00 ? 134 ARG A CG   5  
ATOM 8907  C CD   . ARG A 1 114 ? -2.540  22.761  0.663   1.00 1.00 ? 134 ARG A CD   5  
ATOM 8908  N NE   . ARG A 1 114 ? -1.349  22.508  1.495   1.00 1.00 ? 134 ARG A NE   5  
ATOM 8909  C CZ   . ARG A 1 114 ? -0.417  23.379  1.827   1.00 1.00 ? 134 ARG A CZ   5  
ATOM 8910  N NH1  . ARG A 1 114 ? -0.446  24.618  1.423   1.00 1.00 ? 134 ARG A NH1  5  
ATOM 8911  N NH2  . ARG A 1 114 ? 0.573   22.993  2.577   1.00 1.00 ? 134 ARG A NH2  5  
ATOM 8912  H H    . ARG A 1 114 ? -1.396  21.119  -3.810  1.00 1.00 ? 134 ARG A H    5  
ATOM 8913  H HA   . ARG A 1 114 ? -3.469  19.789  -2.263  1.00 1.00 ? 134 ARG A HA   5  
ATOM 8914  H HB2  . ARG A 1 114 ? -1.427  20.562  -1.189  1.00 0.00 ? 134 ARG A HB2  5  
ATOM 8915  H HB3  . ARG A 1 114 ? -1.712  22.229  -1.737  1.00 1.00 ? 134 ARG A HB3  5  
ATOM 8916  H HG2  . ARG A 1 114 ? -4.017  21.764  -0.314  1.00 0.00 ? 134 ARG A HG2  5  
ATOM 8917  H HG3  . ARG A 1 114 ? -2.962  20.624  0.505   1.00 1.00 ? 134 ARG A HG3  5  
ATOM 8918  H HD2  . ARG A 1 114 ? -2.222  23.547  -0.019  1.00 0.00 ? 134 ARG A HD2  5  
ATOM 8919  H HD3  . ARG A 1 114 ? -3.366  23.141  1.266   1.00 1.00 ? 134 ARG A HD3  5  
ATOM 8920  H HE   . ARG A 1 114 ? -1.215  21.581  1.857   1.00 1.00 ? 134 ARG A HE   5  
ATOM 8921  H HH11 . ARG A 1 114 ? -1.216  24.947  0.824   1.00 0.00 ? 134 ARG A HH11 5  
ATOM 8922  H HH12 . ARG A 1 114 ? 0.302   25.268  1.705   1.00 0.00 ? 134 ARG A HH12 5  
ATOM 8923  H HH21 . ARG A 1 114 ? 0.621   22.017  2.904   1.00 0.00 ? 134 ARG A HH21 5  
ATOM 8924  H HH22 . ARG A 1 114 ? 1.309   23.663  2.844   1.00 0.00 ? 134 ARG A HH22 5  
ATOM 8925  N N    . GLU A 1 115 ? -4.163  22.794  -3.466  1.00 1.00 ? 135 GLU A N    5  
ATOM 8926  C CA   . GLU A 1 115 ? -5.109  23.919  -3.677  1.00 1.00 ? 135 GLU A CA   5  
ATOM 8927  C C    . GLU A 1 115 ? -5.626  24.596  -2.369  1.00 1.00 ? 135 GLU A C    5  
ATOM 8928  O O    . GLU A 1 115 ? -6.545  25.437  -2.486  1.00 1.00 ? 135 GLU A O    5  
ATOM 8929  C CB   . GLU A 1 115 ? -6.215  23.476  -4.670  1.00 1.00 ? 135 GLU A CB   5  
ATOM 8930  C CG   . GLU A 1 115 ? -5.689  23.267  -6.104  1.00 1.00 ? 135 GLU A CG   5  
ATOM 8931  C CD   . GLU A 1 115 ? -6.774  22.818  -7.101  1.00 1.00 ? 135 GLU A CD   5  
ATOM 8932  O OE1  . GLU A 1 115 ? -7.632  23.666  -7.436  1.00 1.00 ? 135 GLU A OE1  5  
ATOM 8933  O OE2  . GLU A 1 115 ? -6.723  21.648  -7.543  1.00 1.00 ? 135 GLU A OE2  5  
ATOM 8934  O OXT  . GLU A 1 115 ? -5.031  24.366  -1.289  1.00 1.00 ? 135 GLU A OXT  5  
ATOM 8935  H H    . GLU A 1 115 ? -3.231  22.889  -3.824  1.00 1.00 ? 135 GLU A H    5  
ATOM 8936  H HA   . GLU A 1 115 ? -4.566  24.729  -4.158  1.00 1.00 ? 135 GLU A HA   5  
ATOM 8937  H HB2  . GLU A 1 115 ? -6.641  22.524  -4.352  1.00 0.00 ? 135 GLU A HB2  5  
ATOM 8938  H HB3  . GLU A 1 115 ? -7.007  24.224  -4.706  1.00 1.00 ? 135 GLU A HB3  5  
ATOM 8939  H HG2  . GLU A 1 115 ? -5.361  24.210  -6.541  1.00 0.00 ? 135 GLU A HG2  5  
ATOM 8940  H HG3  . GLU A 1 115 ? -4.837  22.579  -6.114  1.00 1.00 ? 135 GLU A HG3  5  
ATOM 8941  N N    . GLU A 1 1   ? -5.274  -9.900  -10.570 1.00 1.00 ? 21  GLU A N    6  
ATOM 8942  C CA   . GLU A 1 1   ? -5.112  -8.963  -9.428  1.00 1.00 ? 21  GLU A CA   6  
ATOM 8943  C C    . GLU A 1 1   ? -6.335  -8.049  -9.281  1.00 1.00 ? 21  GLU A C    6  
ATOM 8944  O O    . GLU A 1 1   ? -7.048  -7.829  -10.253 1.00 1.00 ? 21  GLU A O    6  
ATOM 8945  C CB   . GLU A 1 1   ? -3.866  -8.085  -9.653  1.00 1.00 ? 21  GLU A CB   6  
ATOM 8946  C CG   . GLU A 1 1   ? -3.344  -7.422  -8.370  1.00 1.00 ? 21  GLU A CG   6  
ATOM 8947  C CD   . GLU A 1 1   ? -2.628  -6.094  -8.645  1.00 1.00 ? 21  GLU A CD   6  
ATOM 8948  O OE1  . GLU A 1 1   ? -3.300  -5.087  -8.958  1.00 1.00 ? 21  GLU A OE1  6  
ATOM 8949  O OE2  . GLU A 1 1   ? -1.382  -6.068  -8.628  1.00 1.00 ? 21  GLU A OE2  6  
ATOM 8950  H H1   . GLU A 1 1   ? -6.252  -9.881  -10.896 1.00 0.00 ? 21  GLU A H1   6  
ATOM 8951  H H2   . GLU A 1 1   ? -4.650  -9.617  -11.339 1.00 0.00 ? 21  GLU A H2   6  
ATOM 8952  H HA   . GLU A 1 1   ? -4.994  -9.525  -8.500  1.00 1.00 ? 21  GLU A HA   6  
ATOM 8953  H HB2  . GLU A 1 1   ? -3.031  -8.711  -9.969  1.00 0.00 ? 21  GLU A HB2  6  
ATOM 8954  H HB3  . GLU A 1 1   ? -4.075  -7.343  -10.427 1.00 1.00 ? 21  GLU A HB3  6  
ATOM 8955  H HG2  . GLU A 1 1   ? -4.193  -7.164  -7.737  1.00 0.00 ? 21  GLU A HG2  6  
ATOM 8956  H HG3  . GLU A 1 1   ? -2.688  -8.125  -7.851  1.00 1.00 ? 21  GLU A HG3  6  
ATOM 8957  N N    . LEU A 1 2   ? -6.494  -7.459  -8.088  1.00 1.00 ? 22  LEU A N    6  
ATOM 8958  C CA   . LEU A 1 2   ? -7.125  -6.172  -7.805  1.00 1.00 ? 22  LEU A CA   6  
ATOM 8959  C C    . LEU A 1 2   ? -6.398  -5.596  -6.576  1.00 1.00 ? 22  LEU A C    6  
ATOM 8960  O O    . LEU A 1 2   ? -5.332  -6.120  -6.217  1.00 1.00 ? 22  LEU A O    6  
ATOM 8961  C CB   . LEU A 1 2   ? -8.641  -6.380  -7.621  1.00 1.00 ? 22  LEU A CB   6  
ATOM 8962  C CG   . LEU A 1 2   ? -9.494  -5.973  -8.844  1.00 1.00 ? 22  LEU A CG   6  
ATOM 8963  C CD1  . LEU A 1 2   ? -10.908 -6.527  -8.674  1.00 1.00 ? 22  LEU A CD1  6  
ATOM 8964  C CD2  . LEU A 1 2   ? -9.527  -4.453  -9.045  1.00 1.00 ? 22  LEU A CD2  6  
ATOM 8965  H H    . LEU A 1 2   ? -5.893  -7.637  -7.269  1.00 1.00 ? 22  LEU A H    6  
ATOM 8966  H HA   . LEU A 1 2   ? -6.910  -5.498  -8.638  1.00 1.00 ? 22  LEU A HA   6  
ATOM 8967  H HB2  . LEU A 1 2   ? -8.900  -7.437  -7.552  1.00 0.00 ? 22  LEU A HB2  6  
ATOM 8968  H HB3  . LEU A 1 2   ? -9.008  -5.902  -6.713  1.00 1.00 ? 22  LEU A HB3  6  
ATOM 8969  H HG   . LEU A 1 2   ? -9.076  -6.425  -9.744  1.00 1.00 ? 22  LEU A HG   6  
ATOM 8970  H HD11 . LEU A 1 2   ? -10.864 -7.611  -8.552  1.00 1.00 ? 22  LEU A HD11 6  
ATOM 8971  H HD12 . LEU A 1 2   ? -11.377 -6.078  -7.802  1.00 1.00 ? 22  LEU A HD12 6  
ATOM 8972  H HD13 . LEU A 1 2   ? -11.505 -6.302  -9.556  1.00 1.00 ? 22  LEU A HD13 6  
ATOM 8973  H HD21 . LEU A 1 2   ? -8.515  -4.052  -9.110  1.00 1.00 ? 22  LEU A HD21 6  
ATOM 8974  H HD22 . LEU A 1 2   ? -10.051 -4.214  -9.968  1.00 1.00 ? 22  LEU A HD22 6  
ATOM 8975  H HD23 . LEU A 1 2   ? -10.042 -3.983  -8.213  1.00 1.00 ? 22  LEU A HD23 6  
ATOM 8976  N N    . VAL A 1 3   ? -6.826  -4.466  -5.986  1.00 1.00 ? 23  VAL A N    6  
ATOM 8977  C CA   . VAL A 1 3   ? -6.262  -4.059  -4.676  1.00 1.00 ? 23  VAL A CA   6  
ATOM 8978  C C    . VAL A 1 3   ? -6.762  -5.099  -3.632  1.00 1.00 ? 23  VAL A C    6  
ATOM 8979  O O    . VAL A 1 3   ? -7.630  -4.830  -2.805  1.00 1.00 ? 23  VAL A O    6  
ATOM 8980  C CB   . VAL A 1 3   ? -6.611  -2.588  -4.300  1.00 1.00 ? 23  VAL A CB   6  
ATOM 8981  C CG1  . VAL A 1 3   ? -5.870  -2.137  -3.031  1.00 1.00 ? 23  VAL A CG1  6  
ATOM 8982  C CG2  . VAL A 1 3   ? -6.316  -1.583  -5.432  1.00 1.00 ? 23  VAL A CG2  6  
ATOM 8983  H H    . VAL A 1 3   ? -7.710  -4.040  -6.263  1.00 1.00 ? 23  VAL A H    6  
ATOM 8984  H HA   . VAL A 1 3   ? -5.176  -4.120  -4.716  1.00 1.00 ? 23  VAL A HA   6  
ATOM 8985  H HB   . VAL A 1 3   ? -7.671  -2.521  -4.093  1.00 1.00 ? 23  VAL A HB   6  
ATOM 8986  H HG11 . VAL A 1 3   ? -4.795  -2.222  -3.163  1.00 1.00 ? 23  VAL A HG11 6  
ATOM 8987  H HG12 . VAL A 1 3   ? -6.124  -1.102  -2.791  1.00 1.00 ? 23  VAL A HG12 6  
ATOM 8988  H HG13 . VAL A 1 3   ? -6.165  -2.749  -2.182  1.00 1.00 ? 23  VAL A HG13 6  
ATOM 8989  H HG21 . VAL A 1 3   ? -5.302  -1.724  -5.797  1.00 1.00 ? 23  VAL A HG21 6  
ATOM 8990  H HG22 . VAL A 1 3   ? -7.006  -1.739  -6.261  1.00 1.00 ? 23  VAL A HG22 6  
ATOM 8991  H HG23 . VAL A 1 3   ? -6.444  -0.553  -5.084  1.00 1.00 ? 23  VAL A HG23 6  
ATOM 8992  N N    . ARG A 1 4   ? -6.196  -6.324  -3.716  1.00 1.00 ? 24  ARG A N    6  
ATOM 8993  C CA   . ARG A 1 4   ? -6.323  -7.496  -2.829  1.00 1.00 ? 24  ARG A CA   6  
ATOM 8994  C C    . ARG A 1 4   ? -4.911  -7.968  -2.452  1.00 1.00 ? 24  ARG A C    6  
ATOM 8995  O O    . ARG A 1 4   ? -4.339  -8.859  -3.081  1.00 1.00 ? 24  ARG A O    6  
ATOM 8996  C CB   . ARG A 1 4   ? -7.169  -8.608  -3.489  1.00 1.00 ? 24  ARG A CB   6  
ATOM 8997  C CG   . ARG A 1 4   ? -6.848  -8.937  -4.957  1.00 1.00 ? 24  ARG A CG   6  
ATOM 8998  C CD   . ARG A 1 4   ? -7.105  -10.402 -5.290  1.00 1.00 ? 24  ARG A CD   6  
ATOM 8999  N NE   . ARG A 1 4   ? -8.546  -10.738 -5.358  1.00 1.00 ? 24  ARG A NE   6  
ATOM 9000  C CZ   . ARG A 1 4   ? -9.144  -11.826 -4.892  1.00 1.00 ? 24  ARG A CZ   6  
ATOM 9001  N NH1  . ARG A 1 4   ? -8.548  -12.709 -4.145  1.00 1.00 ? 24  ARG A NH1  6  
ATOM 9002  N NH2  . ARG A 1 4   ? -10.389 -12.070 -5.181  1.00 1.00 ? 24  ARG A NH2  6  
ATOM 9003  H H    . ARG A 1 4   ? -5.747  -6.517  -4.631  1.00 1.00 ? 24  ARG A H    6  
ATOM 9004  H HA   . ARG A 1 4   ? -6.842  -7.211  -1.911  1.00 1.00 ? 24  ARG A HA   6  
ATOM 9005  H HB2  . ARG A 1 4   ? -6.962  -9.574  -3.028  1.00 0.00 ? 24  ARG A HB2  6  
ATOM 9006  H HB3  . ARG A 1 4   ? -8.231  -8.399  -3.379  1.00 1.00 ? 24  ARG A HB3  6  
ATOM 9007  H HG2  . ARG A 1 4   ? -7.458  -8.321  -5.618  1.00 0.00 ? 24  ARG A HG2  6  
ATOM 9008  H HG3  . ARG A 1 4   ? -5.798  -8.741  -5.159  1.00 1.00 ? 24  ARG A HG3  6  
ATOM 9009  H HD2  . ARG A 1 4   ? -6.760  -10.622 -6.300  1.00 0.00 ? 24  ARG A HD2  6  
ATOM 9010  H HD3  . ARG A 1 4   ? -6.572  -11.046 -4.586  1.00 1.00 ? 24  ARG A HD3  6  
ATOM 9011  H HE   . ARG A 1 4   ? -9.126  -10.138 -5.917  1.00 1.00 ? 24  ARG A HE   6  
ATOM 9012  H HH11 . ARG A 1 4   ? -7.559  -12.583 -3.886  1.00 0.00 ? 24  ARG A HH11 6  
ATOM 9013  H HH12 . ARG A 1 4   ? -9.065  -13.537 -3.811  1.00 0.00 ? 24  ARG A HH12 6  
ATOM 9014  H HH21 . ARG A 1 4   ? -10.918 -11.416 -5.777  1.00 0.00 ? 24  ARG A HH21 6  
ATOM 9015  H HH22 . ARG A 1 4   ? -10.847 -12.917 -4.814  1.00 0.00 ? 24  ARG A HH22 6  
ATOM 9016  N N    . THR A 1 5   ? -4.336  -7.298  -1.453  1.00 1.00 ? 25  THR A N    6  
ATOM 9017  C CA   . THR A 1 5   ? -2.940  -7.427  -1.003  1.00 1.00 ? 25  THR A CA   6  
ATOM 9018  C C    . THR A 1 5   ? -2.871  -8.308  0.252   1.00 1.00 ? 25  THR A C    6  
ATOM 9019  O O    . THR A 1 5   ? -2.483  -9.465  0.132   1.00 1.00 ? 25  THR A O    6  
ATOM 9020  C CB   . THR A 1 5   ? -2.281  -6.038  -0.840  1.00 1.00 ? 25  THR A CB   6  
ATOM 9021  O OG1  . THR A 1 5   ? -3.038  -5.250  0.059   1.00 1.00 ? 25  THR A OG1  6  
ATOM 9022  C CG2  . THR A 1 5   ? -2.165  -5.280  -2.180  1.00 1.00 ? 25  THR A CG2  6  
ATOM 9023  H H    . THR A 1 5   ? -4.881  -6.578  -1.006  1.00 1.00 ? 25  THR A H    6  
ATOM 9024  H HA   . THR A 1 5   ? -2.374  -7.955  -1.773  1.00 1.00 ? 25  THR A HA   6  
ATOM 9025  H HB   . THR A 1 5   ? -1.274  -6.159  -0.437  1.00 1.00 ? 25  THR A HB   6  
ATOM 9026  H HG1  . THR A 1 5   ? -2.700  -4.316  -0.020  1.00 1.00 ? 25  THR A HG1  6  
ATOM 9027  H HG21 . THR A 1 5   ? -1.592  -5.873  -2.895  1.00 1.00 ? 25  THR A HG21 6  
ATOM 9028  H HG22 . THR A 1 5   ? -3.150  -5.083  -2.601  1.00 1.00 ? 25  THR A HG22 6  
ATOM 9029  H HG23 . THR A 1 5   ? -1.649  -4.333  -2.035  1.00 1.00 ? 25  THR A HG23 6  
ATOM 9030  N N    . ASP A 1 6   ? -3.298  -7.793  1.418   1.00 1.00 ? 26  ASP A N    6  
ATOM 9031  C CA   . ASP A 1 6   ? -3.404  -8.529  2.697   1.00 1.00 ? 26  ASP A CA   6  
ATOM 9032  C C    . ASP A 1 6   ? -4.350  -9.757  2.642   1.00 1.00 ? 26  ASP A C    6  
ATOM 9033  O O    . ASP A 1 6   ? -4.019  -10.798 3.204   1.00 1.00 ? 26  ASP A O    6  
ATOM 9034  C CB   . ASP A 1 6   ? -3.831  -7.525  3.778   1.00 1.00 ? 26  ASP A CB   6  
ATOM 9035  C CG   . ASP A 1 6   ? -3.588  -8.006  5.214   1.00 1.00 ? 26  ASP A CG   6  
ATOM 9036  O OD1  . ASP A 1 6   ? -2.408  -7.984  5.613   1.00 1.00 ? 26  ASP A OD1  6  
ATOM 9037  O OD2  . ASP A 1 6   ? -4.585  -8.400  5.862   1.00 1.00 ? 26  ASP A OD2  6  
ATOM 9038  H H    . ASP A 1 6   ? -3.517  -6.806  1.389   1.00 1.00 ? 26  ASP A H    6  
ATOM 9039  H HA   . ASP A 1 6   ? -2.407  -8.892  2.957   1.00 1.00 ? 26  ASP A HA   6  
ATOM 9040  H HB2  . ASP A 1 6   ? -3.263  -6.606  3.636   1.00 0.00 ? 26  ASP A HB2  6  
ATOM 9041  H HB3  . ASP A 1 6   ? -4.861  -7.202  3.631   1.00 1.00 ? 26  ASP A HB3  6  
ATOM 9042  N N    . SER A 1 7   ? -5.487  -9.667  1.920   1.00 1.00 ? 27  SER A N    6  
ATOM 9043  C CA   . SER A 1 7   ? -6.462  -10.752 1.698   1.00 1.00 ? 27  SER A CA   6  
ATOM 9044  C C    . SER A 1 7   ? -7.404  -11.119 2.889   1.00 1.00 ? 27  SER A C    6  
ATOM 9045  O O    . SER A 1 7   ? -7.774  -12.292 2.990   1.00 1.00 ? 27  SER A O    6  
ATOM 9046  C CB   . SER A 1 7   ? -5.756  -11.974 1.052   1.00 1.00 ? 27  SER A CB   6  
ATOM 9047  O OG   . SER A 1 7   ? -5.532  -11.800 -0.334  1.00 1.00 ? 27  SER A OG   6  
ATOM 9048  H H    . SER A 1 7   ? -5.744  -8.772  1.521   1.00 1.00 ? 27  SER A H    6  
ATOM 9049  H HA   . SER A 1 7   ? -7.138  -10.372 0.933   1.00 1.00 ? 27  SER A HA   6  
ATOM 9050  H HB2  . SER A 1 7   ? -4.763  -12.129 1.474   1.00 0.00 ? 27  SER A HB2  6  
ATOM 9051  H HB3  . SER A 1 7   ? -6.326  -12.893 1.207   1.00 1.00 ? 27  SER A HB3  6  
ATOM 9052  H HG   . SER A 1 7   ? -4.603  -11.560 -0.457  1.00 1.00 ? 27  SER A HG   6  
ATOM 9053  N N    . PRO A 1 8   ? -7.904  -10.186 3.748   1.00 1.00 ? 28  PRO A N    6  
ATOM 9054  C CA   . PRO A 1 8   ? -8.957  -10.456 4.767   1.00 1.00 ? 28  PRO A CA   6  
ATOM 9055  C C    . PRO A 1 8   ? -10.358 -10.723 4.138   1.00 1.00 ? 28  PRO A C    6  
ATOM 9056  O O    . PRO A 1 8   ? -11.390 -10.294 4.653   1.00 1.00 ? 28  PRO A O    6  
ATOM 9057  C CB   . PRO A 1 8   ? -8.979  -9.225  5.691   1.00 1.00 ? 28  PRO A CB   6  
ATOM 9058  C CG   . PRO A 1 8   ? -8.450  -8.096  4.812   1.00 1.00 ? 28  PRO A CG   6  
ATOM 9059  C CD   . PRO A 1 8   ? -7.514  -8.784  3.821   1.00 1.00 ? 28  PRO A CD   6  
ATOM 9060  H HA   . PRO A 1 8   ? -8.675  -11.325 5.361   1.00 1.00 ? 28  PRO A HA   6  
ATOM 9061  H HB2  . PRO A 1 8   ? -9.991  -9.020  6.040   1.00 0.00 ? 28  PRO A HB2  6  
ATOM 9062  H HB3  . PRO A 1 8   ? -8.309  -9.376  6.534   1.00 1.00 ? 28  PRO A HB3  6  
ATOM 9063  H HG2  . PRO A 1 8   ? -9.261  -7.581  4.295   1.00 0.00 ? 28  PRO A HG2  6  
ATOM 9064  H HG3  . PRO A 1 8   ? -7.915  -7.353  5.400   1.00 1.00 ? 28  PRO A HG3  6  
ATOM 9065  H HD2  . PRO A 1 8   ? -7.558  -8.365  2.817   1.00 0.00 ? 28  PRO A HD2  6  
ATOM 9066  H HD3  . PRO A 1 8   ? -6.499  -8.731  4.215   1.00 1.00 ? 28  PRO A HD3  6  
ATOM 9067  N N    . ASN A 1 9   ? -10.366 -11.421 2.990   1.00 1.00 ? 29  ASN A N    6  
ATOM 9068  C CA   . ASN A 1 9   ? -11.425 -11.713 2.020   1.00 1.00 ? 29  ASN A CA   6  
ATOM 9069  C C    . ASN A 1 9   ? -11.831 -10.494 1.136   1.00 1.00 ? 29  ASN A C    6  
ATOM 9070  O O    . ASN A 1 9   ? -12.859 -10.572 0.455   1.00 1.00 ? 29  ASN A O    6  
ATOM 9071  C CB   . ASN A 1 9   ? -12.582 -12.493 2.683   1.00 1.00 ? 29  ASN A CB   6  
ATOM 9072  C CG   . ASN A 1 9   ? -12.218 -13.891 3.175   1.00 1.00 ? 29  ASN A CG   6  
ATOM 9073  O OD1  . ASN A 1 9   ? -11.599 -14.704 2.509   1.00 1.00 ? 29  ASN A OD1  6  
ATOM 9074  N ND2  . ASN A 1 9   ? -12.649 -14.219 4.372   1.00 1.00 ? 29  ASN A ND2  6  
ATOM 9075  H H    . ASN A 1 9   ? -9.469  -11.843 2.784   1.00 1.00 ? 29  ASN A H    6  
ATOM 9076  H HA   . ASN A 1 9   ? -10.991 -12.416 1.310   1.00 1.00 ? 29  ASN A HA   6  
ATOM 9077  H HB2  . ASN A 1 9   ? -12.936 -11.958 3.565   1.00 0.00 ? 29  ASN A HB2  6  
ATOM 9078  H HB3  . ASN A 1 9   ? -13.405 -12.602 1.983   1.00 1.00 ? 29  ASN A HB3  6  
ATOM 9079  H HD21 . ASN A 1 9   ? -13.200 -13.547 4.923   1.00 0.00 ? 29  ASN A HD21 6  
ATOM 9080  H HD22 . ASN A 1 9   ? -12.435 -15.150 4.758   1.00 0.00 ? 29  ASN A HD22 6  
ATOM 9081  N N    . PHE A 1 10  ? -11.023 -9.408  1.065   1.00 1.00 ? 30  PHE A N    6  
ATOM 9082  C CA   . PHE A 1 10  ? -11.377 -8.154  0.359   1.00 1.00 ? 30  PHE A CA   6  
ATOM 9083  C C    . PHE A 1 10  ? -10.607 -7.889  -0.947  1.00 1.00 ? 30  PHE A C    6  
ATOM 9084  O O    . PHE A 1 10  ? -9.381  -8.010  -0.997  1.00 1.00 ? 30  PHE A O    6  
ATOM 9085  C CB   . PHE A 1 10  ? -11.184 -6.945  1.289   1.00 1.00 ? 30  PHE A CB   6  
ATOM 9086  C CG   . PHE A 1 10  ? -12.200 -6.805  2.401   1.00 1.00 ? 30  PHE A CG   6  
ATOM 9087  C CD1  . PHE A 1 10  ? -13.417 -6.109  2.199   1.00 1.00 ? 30  PHE A CD1  6  
ATOM 9088  C CD2  . PHE A 1 10  ? -11.906 -7.359  3.660   1.00 1.00 ? 30  PHE A CD2  6  
ATOM 9089  C CE1  . PHE A 1 10  ? -14.343 -5.996  3.261   1.00 1.00 ? 30  PHE A CE1  6  
ATOM 9090  C CE2  . PHE A 1 10  ? -12.837 -7.270  4.713   1.00 1.00 ? 30  PHE A CE2  6  
ATOM 9091  C CZ   . PHE A 1 10  ? -14.060 -6.602  4.507   1.00 1.00 ? 30  PHE A CZ   6  
ATOM 9092  H H    . PHE A 1 10  ? -10.122 -9.446  1.538   1.00 1.00 ? 30  PHE A H    6  
ATOM 9093  H HA   . PHE A 1 10  ? -12.434 -8.192  0.112   1.00 1.00 ? 30  PHE A HA   6  
ATOM 9094  H HB2  . PHE A 1 10  ? -10.247 -7.026  1.840   1.00 0.00 ? 30  PHE A HB2  6  
ATOM 9095  H HB3  . PHE A 1 10  ? -11.165 -6.012  0.716   1.00 1.00 ? 30  PHE A HB3  6  
ATOM 9096  H HD1  . PHE A 1 10  ? -13.646 -5.681  1.233   1.00 1.00 ? 30  PHE A HD1  6  
ATOM 9097  H HD2  . PHE A 1 10  ? -10.973 -7.872  3.817   1.00 1.00 ? 30  PHE A HD2  6  
ATOM 9098  H HE1  . PHE A 1 10  ? -15.285 -5.486  3.117   1.00 1.00 ? 30  PHE A HE1  6  
ATOM 9099  H HE2  . PHE A 1 10  ? -12.610 -7.726  5.666   1.00 1.00 ? 30  PHE A HE2  6  
ATOM 9100  H HZ   . PHE A 1 10  ? -14.778 -6.565  5.309   1.00 1.00 ? 30  PHE A HZ   6  
ATOM 9101  N N    . LEU A 1 11  ? -11.351 -7.432  -1.969  1.00 1.00 ? 31  LEU A N    6  
ATOM 9102  C CA   . LEU A 1 11  ? -10.876 -6.922  -3.270  1.00 1.00 ? 31  LEU A CA   6  
ATOM 9103  C C    . LEU A 1 11  ? -11.361 -5.470  -3.536  1.00 1.00 ? 31  LEU A C    6  
ATOM 9104  O O    . LEU A 1 11  ? -12.561 -5.184  -3.543  1.00 1.00 ? 31  LEU A O    6  
ATOM 9105  C CB   . LEU A 1 11  ? -11.224 -7.936  -4.384  1.00 1.00 ? 31  LEU A CB   6  
ATOM 9106  C CG   . LEU A 1 11  ? -12.717 -8.197  -4.704  1.00 1.00 ? 31  LEU A CG   6  
ATOM 9107  C CD1  . LEU A 1 11  ? -13.133 -7.447  -5.973  1.00 1.00 ? 31  LEU A CD1  6  
ATOM 9108  C CD2  . LEU A 1 11  ? -13.022 -9.689  -4.909  1.00 1.00 ? 31  LEU A CD2  6  
ATOM 9109  H H    . LEU A 1 11  ? -12.366 -7.469  -1.822  1.00 1.00 ? 31  LEU A H    6  
ATOM 9110  H HA   . LEU A 1 11  ? -9.787  -6.882  -3.222  1.00 1.00 ? 31  LEU A HA   6  
ATOM 9111  H HB2  . LEU A 1 11  ? -10.909 -7.527  -5.343  1.00 0.00 ? 31  LEU A HB2  6  
ATOM 9112  H HB3  . LEU A 1 11  ? -10.699 -8.873  -4.185  1.00 1.00 ? 31  LEU A HB3  6  
ATOM 9113  H HG   . LEU A 1 11  ? -13.335 -7.847  -3.886  1.00 1.00 ? 31  LEU A HG   6  
ATOM 9114  H HD11 . LEU A 1 11  ? -12.938 -6.380  -5.864  1.00 1.00 ? 31  LEU A HD11 6  
ATOM 9115  H HD12 . LEU A 1 11  ? -12.591 -7.832  -6.834  1.00 1.00 ? 31  LEU A HD12 6  
ATOM 9116  H HD13 . LEU A 1 11  ? -14.203 -7.579  -6.147  1.00 1.00 ? 31  LEU A HD13 6  
ATOM 9117  H HD21 . LEU A 1 11  ? -12.761 -10.248 -4.010  1.00 1.00 ? 31  LEU A HD21 6  
ATOM 9118  H HD22 . LEU A 1 11  ? -14.092 -9.813  -5.089  1.00 1.00 ? 31  LEU A HD22 6  
ATOM 9119  H HD23 . LEU A 1 11  ? -12.478 -10.072 -5.769  1.00 1.00 ? 31  LEU A HD23 6  
ATOM 9120  N N    . CYS A 1 12  ? -10.416 -4.538  -3.755  1.00 1.00 ? 32  CYS A N    6  
ATOM 9121  C CA   . CYS A 1 12  ? -10.644 -3.099  -3.981  1.00 1.00 ? 32  CYS A CA   6  
ATOM 9122  C C    . CYS A 1 12  ? -10.218 -2.642  -5.403  1.00 1.00 ? 32  CYS A C    6  
ATOM 9123  O O    . CYS A 1 12  ? -9.267  -3.160  -5.989  1.00 1.00 ? 32  CYS A O    6  
ATOM 9124  C CB   . CYS A 1 12  ? -9.985  -2.339  -2.804  1.00 1.00 ? 32  CYS A CB   6  
ATOM 9125  S SG   . CYS A 1 12  ? -9.617  -0.583  -3.107  1.00 1.00 ? 32  CYS A SG   6  
ATOM 9126  H H    . CYS A 1 12  ? -9.442  -4.815  -3.673  1.00 1.00 ? 32  CYS A H    6  
ATOM 9127  H HA   . CYS A 1 12  ? -11.713 -2.902  -3.908  1.00 1.00 ? 32  CYS A HA   6  
ATOM 9128  H HB2  . CYS A 1 12  ? -10.657 -2.226  -1.955  1.00 0.00 ? 32  CYS A HB2  6  
ATOM 9129  H HB3  . CYS A 1 12  ? -9.095  -2.847  -2.428  1.00 1.00 ? 32  CYS A HB3  6  
ATOM 9130  H HG   . CYS A 1 12  ? -8.542  -0.777  -3.879  1.00 1.00 ? 32  CYS A HG   6  
ATOM 9131  N N    . SER A 1 13  ? -10.936 -1.655  -5.956  1.00 1.00 ? 33  SER A N    6  
ATOM 9132  C CA   . SER A 1 13  ? -10.838 -1.085  -7.311  1.00 1.00 ? 33  SER A CA   6  
ATOM 9133  C C    . SER A 1 13  ? -10.758 0.461   -7.250  1.00 1.00 ? 33  SER A C    6  
ATOM 9134  O O    . SER A 1 13  ? -11.791 1.141   -7.199  1.00 1.00 ? 33  SER A O    6  
ATOM 9135  C CB   . SER A 1 13  ? -12.011 -1.609  -8.171  1.00 1.00 ? 33  SER A CB   6  
ATOM 9136  O OG   . SER A 1 13  ? -12.328 -0.752  -9.246  1.00 1.00 ? 33  SER A OG   6  
ATOM 9137  H H    . SER A 1 13  ? -11.752 -1.350  -5.427  1.00 1.00 ? 33  SER A H    6  
ATOM 9138  H HA   . SER A 1 13  ? -9.927  -1.446  -7.791  1.00 1.00 ? 33  SER A HA   6  
ATOM 9139  H HB2  . SER A 1 13  ? -11.769 -2.566  -8.635  1.00 0.00 ? 33  SER A HB2  6  
ATOM 9140  H HB3  . SER A 1 13  ? -12.913 -1.755  -7.571  1.00 1.00 ? 33  SER A HB3  6  
ATOM 9141  H HG   . SER A 1 13  ? -12.555 0.103   -8.852  1.00 1.00 ? 33  SER A HG   6  
ATOM 9142  N N    . VAL A 1 14  ? -9.516  0.989   -7.276  1.00 1.00 ? 34  VAL A N    6  
ATOM 9143  C CA   . VAL A 1 14  ? -9.116  2.423   -7.299  1.00 1.00 ? 34  VAL A CA   6  
ATOM 9144  C C    . VAL A 1 14  ? -7.842  2.628   -8.161  1.00 1.00 ? 34  VAL A C    6  
ATOM 9145  O O    . VAL A 1 14  ? -6.903  1.828   -8.092  1.00 1.00 ? 34  VAL A O    6  
ATOM 9146  C CB   . VAL A 1 14  ? -8.867  2.983   -5.865  1.00 1.00 ? 34  VAL A CB   6  
ATOM 9147  C CG1  . VAL A 1 14  ? -8.570  4.500   -5.888  1.00 1.00 ? 34  VAL A CG1  6  
ATOM 9148  C CG2  . VAL A 1 14  ? -10.056 2.757   -4.911  1.00 1.00 ? 34  VAL A CG2  6  
ATOM 9149  H H    . VAL A 1 14  ? -8.756  0.325   -7.329  1.00 1.00 ? 34  VAL A H    6  
ATOM 9150  H HA   . VAL A 1 14  ? -9.936  2.993   -7.743  1.00 1.00 ? 34  VAL A HA   6  
ATOM 9151  H HB   . VAL A 1 14  ? -7.999  2.479   -5.434  1.00 1.00 ? 34  VAL A HB   6  
ATOM 9152  H HG11 . VAL A 1 14  ? -9.379  5.039   -6.381  1.00 1.00 ? 34  VAL A HG11 6  
ATOM 9153  H HG12 . VAL A 1 14  ? -8.456  4.881   -4.872  1.00 1.00 ? 34  VAL A HG12 6  
ATOM 9154  H HG13 . VAL A 1 14  ? -7.634  4.698   -6.409  1.00 1.00 ? 34  VAL A HG13 6  
ATOM 9155  H HG21 . VAL A 1 14  ? -10.963 3.182   -5.338  1.00 1.00 ? 34  VAL A HG21 6  
ATOM 9156  H HG22 . VAL A 1 14  ? -10.215 1.691   -4.754  1.00 1.00 ? 34  VAL A HG22 6  
ATOM 9157  H HG23 . VAL A 1 14  ? -9.860  3.210   -3.938  1.00 1.00 ? 34  VAL A HG23 6  
ATOM 9158  N N    . LEU A 1 15  ? -7.801  3.715   -8.952  1.00 1.00 ? 35  LEU A N    6  
ATOM 9159  C CA   . LEU A 1 15  ? -6.669  4.132   -9.807  1.00 1.00 ? 35  LEU A CA   6  
ATOM 9160  C C    . LEU A 1 15  ? -5.472  4.778   -9.028  1.00 1.00 ? 35  LEU A C    6  
ATOM 9161  O O    . LEU A 1 15  ? -5.701  5.491   -8.045  1.00 1.00 ? 35  LEU A O    6  
ATOM 9162  C CB   . LEU A 1 15  ? -7.194  5.060   -10.928 1.00 1.00 ? 35  LEU A CB   6  
ATOM 9163  C CG   . LEU A 1 15  ? -7.473  6.550   -10.624 1.00 1.00 ? 35  LEU A CG   6  
ATOM 9164  C CD1  . LEU A 1 15  ? -7.659  7.317   -11.938 1.00 1.00 ? 35  LEU A CD1  6  
ATOM 9165  C CD2  . LEU A 1 15  ? -8.706  6.767   -9.740  1.00 1.00 ? 35  LEU A CD2  6  
ATOM 9166  H H    . LEU A 1 15  ? -8.603  4.325   -8.933  1.00 1.00 ? 35  LEU A H    6  
ATOM 9167  H HA   . LEU A 1 15  ? -6.313  3.228   -10.303 1.00 1.00 ? 35  LEU A HA   6  
ATOM 9168  H HB2  . LEU A 1 15  ? -6.414  5.287   -11.656 1.00 0.00 ? 35  LEU A HB2  6  
ATOM 9169  H HB3  . LEU A 1 15  ? -8.024  4.602   -11.471 1.00 1.00 ? 35  LEU A HB3  6  
ATOM 9170  H HG   . LEU A 1 15  ? -6.608  6.977   -10.117 1.00 1.00 ? 35  LEU A HG   6  
ATOM 9171  H HD11 . LEU A 1 15  ? -6.770  7.202   -12.559 1.00 1.00 ? 35  LEU A HD11 6  
ATOM 9172  H HD12 . LEU A 1 15  ? -8.529  6.942   -12.482 1.00 1.00 ? 35  LEU A HD12 6  
ATOM 9173  H HD13 . LEU A 1 15  ? -7.799  8.379   -11.731 1.00 1.00 ? 35  LEU A HD13 6  
ATOM 9174  H HD21 . LEU A 1 15  ? -9.598  6.342   -10.205 1.00 1.00 ? 35  LEU A HD21 6  
ATOM 9175  H HD22 . LEU A 1 15  ? -8.551  6.327   -8.757  1.00 1.00 ? 35  LEU A HD22 6  
ATOM 9176  H HD23 . LEU A 1 15  ? -8.844  7.838   -9.608  1.00 1.00 ? 35  LEU A HD23 6  
ATOM 9177  N N    . PRO A 1 16  ? -4.201  4.594   -9.467  1.00 1.00 ? 36  PRO A N    6  
ATOM 9178  C CA   . PRO A 1 16  ? -3.001  5.141   -8.810  1.00 1.00 ? 36  PRO A CA   6  
ATOM 9179  C C    . PRO A 1 16  ? -2.690  6.611   -9.180  1.00 1.00 ? 36  PRO A C    6  
ATOM 9180  O O    . PRO A 1 16  ? -2.055  6.881   -10.203 1.00 1.00 ? 36  PRO A O    6  
ATOM 9181  C CB   . PRO A 1 16  ? -1.838  4.229   -9.223  1.00 1.00 ? 36  PRO A CB   6  
ATOM 9182  C CG   . PRO A 1 16  ? -2.276  3.692   -10.587 1.00 1.00 ? 36  PRO A CG   6  
ATOM 9183  C CD   . PRO A 1 16  ? -3.805  3.696   -10.548 1.00 1.00 ? 36  PRO A CD   6  
ATOM 9184  H HA   . PRO A 1 16  ? -3.120  5.079   -7.728  1.00 1.00 ? 36  PRO A HA   6  
ATOM 9185  H HB2  . PRO A 1 16  ? -0.906  4.790   -9.290  1.00 0.00 ? 36  PRO A HB2  6  
ATOM 9186  H HB3  . PRO A 1 16  ? -1.742  3.407   -8.515  1.00 1.00 ? 36  PRO A HB3  6  
ATOM 9187  H HG2  . PRO A 1 16  ? -1.905  4.323   -11.394 1.00 0.00 ? 36  PRO A HG2  6  
ATOM 9188  H HG3  . PRO A 1 16  ? -1.898  2.681   -10.750 1.00 1.00 ? 36  PRO A HG3  6  
ATOM 9189  H HD2  . PRO A 1 16  ? -4.236  4.039   -11.489 1.00 0.00 ? 36  PRO A HD2  6  
ATOM 9190  H HD3  . PRO A 1 16  ? -4.161  2.686   -10.336 1.00 1.00 ? 36  PRO A HD3  6  
ATOM 9191  N N    . THR A 1 17  ? -3.063  7.573   -8.317  1.00 1.00 ? 37  THR A N    6  
ATOM 9192  C CA   . THR A 1 17  ? -2.747  9.017   -8.495  1.00 1.00 ? 37  THR A CA   6  
ATOM 9193  C C    . THR A 1 17  ? -1.463  9.526   -7.798  1.00 1.00 ? 37  THR A C    6  
ATOM 9194  O O    . THR A 1 17  ? -1.086  10.669  -8.058  1.00 1.00 ? 37  THR A O    6  
ATOM 9195  C CB   . THR A 1 17  ? -3.962  9.916   -8.192  1.00 1.00 ? 37  THR A CB   6  
ATOM 9196  O OG1  . THR A 1 17  ? -3.683  11.231  -8.621  1.00 1.00 ? 37  THR A OG1  6  
ATOM 9197  C CG2  . THR A 1 17  ? -4.366  9.966   -6.717  1.00 1.00 ? 37  THR A CG2  6  
ATOM 9198  H H    . THR A 1 17  ? -3.642  7.283   -7.543  1.00 1.00 ? 37  THR A H    6  
ATOM 9199  H HA   . THR A 1 17  ? -2.554  9.170   -9.559  1.00 1.00 ? 37  THR A HA   6  
ATOM 9200  H HB   . THR A 1 17  ? -4.816  9.556   -8.770  1.00 1.00 ? 37  THR A HB   6  
ATOM 9201  H HG1  . THR A 1 17  ? -2.718  11.349  -8.600  1.00 1.00 ? 37  THR A HG1  6  
ATOM 9202  H HG21 . THR A 1 17  ? -3.535  10.311  -6.105  1.00 1.00 ? 37  THR A HG21 6  
ATOM 9203  H HG22 . THR A 1 17  ? -5.207  10.653  -6.596  1.00 1.00 ? 37  THR A HG22 6  
ATOM 9204  H HG23 . THR A 1 17  ? -4.685  8.975   -6.385  1.00 1.00 ? 37  THR A HG23 6  
ATOM 9205  N N    . HIS A 1 18  ? -0.798  8.714   -6.949  1.00 1.00 ? 38  HIS A N    6  
ATOM 9206  C CA   . HIS A 1 18  ? 0.519   8.932   -6.287  1.00 1.00 ? 38  HIS A CA   6  
ATOM 9207  C C    . HIS A 1 18  ? 0.874   10.405  -5.955  1.00 1.00 ? 38  HIS A C    6  
ATOM 9208  O O    . HIS A 1 18  ? 1.936   10.925  -6.330  1.00 1.00 ? 38  HIS A O    6  
ATOM 9209  C CB   . HIS A 1 18  ? 1.609   8.226   -7.122  1.00 1.00 ? 38  HIS A CB   6  
ATOM 9210  C CG   . HIS A 1 18  ? 1.689   8.681   -8.561  1.00 1.00 ? 38  HIS A CG   6  
ATOM 9211  N ND1  . HIS A 1 18  ? 2.407   9.771   -8.997  1.00 1.00 ? 38  HIS A ND1  6  
ATOM 9212  C CD2  . HIS A 1 18  ? 0.986   8.182   -9.622  1.00 1.00 ? 38  HIS A CD2  6  
ATOM 9213  C CE1  . HIS A 1 18  ? 2.166   9.918   -10.317 1.00 1.00 ? 38  HIS A CE1  6  
ATOM 9214  N NE2  . HIS A 1 18  ? 1.297   8.963   -10.718 1.00 1.00 ? 38  HIS A NE2  6  
ATOM 9215  H H    . HIS A 1 18  ? -1.213  7.797   -6.853  1.00 1.00 ? 38  HIS A H    6  
ATOM 9216  H HA   . HIS A 1 18  ? 0.495   8.431   -5.317  1.00 1.00 ? 38  HIS A HA   6  
ATOM 9217  H HB2  . HIS A 1 18  ? 2.613   8.498   -6.796  1.00 0.00 ? 38  HIS A HB2  6  
ATOM 9218  H HB3  . HIS A 1 18  ? 1.538   7.143   -7.052  1.00 1.00 ? 38  HIS A HB3  6  
ATOM 9219  H HD1  . HIS A 1 18  ? 2.945   10.364  -8.377  1.00 1.00 ? 38  HIS A HD1  6  
ATOM 9220  H HD2  . HIS A 1 18  ? 0.286   7.354   -9.588  1.00 1.00 ? 38  HIS A HD2  6  
ATOM 9221  H HE1  . HIS A 1 18  ? 2.602   10.687  -10.954 1.00 1.00 ? 38  HIS A HE1  6  
ATOM 9222  H HE2  . HIS A 1 18  ? 0.918   8.837   -11.649 1.00 1.00 ? 38  HIS A HE2  6  
ATOM 9223  N N    . TRP A 1 19  ? -0.005  11.067  -5.192  1.00 1.00 ? 39  TRP A N    6  
ATOM 9224  C CA   . TRP A 1 19  ? 0.106   12.451  -4.718  1.00 1.00 ? 39  TRP A CA   6  
ATOM 9225  C C    . TRP A 1 19  ? -0.867  12.795  -3.574  1.00 1.00 ? 39  TRP A C    6  
ATOM 9226  O O    . TRP A 1 19  ? -1.696  11.974  -3.171  1.00 1.00 ? 39  TRP A O    6  
ATOM 9227  C CB   . TRP A 1 19  ? 0.006   13.451  -5.892  1.00 1.00 ? 39  TRP A CB   6  
ATOM 9228  C CG   . TRP A 1 19  ? -1.304  14.102  -6.213  1.00 1.00 ? 39  TRP A CG   6  
ATOM 9229  C CD1  . TRP A 1 19  ? -2.449  13.458  -6.519  1.00 1.00 ? 39  TRP A CD1  6  
ATOM 9230  C CD2  . TRP A 1 19  ? -1.623  15.524  -6.215  1.00 1.00 ? 39  TRP A CD2  6  
ATOM 9231  N NE1  . TRP A 1 19  ? -3.445  14.384  -6.752  1.00 1.00 ? 39  TRP A NE1  6  
ATOM 9232  C CE2  . TRP A 1 19  ? -2.977  15.674  -6.652  1.00 1.00 ? 39  TRP A CE2  6  
ATOM 9233  C CE3  . TRP A 1 19  ? -0.920  16.706  -5.883  1.00 1.00 ? 39  TRP A CE3  6  
ATOM 9234  C CZ2  . TRP A 1 19  ? -3.570  16.938  -6.852  1.00 1.00 ? 39  TRP A CZ2  6  
ATOM 9235  C CZ3  . TRP A 1 19  ? -1.525  17.976  -6.014  1.00 1.00 ? 39  TRP A CZ3  6  
ATOM 9236  C CH2  . TRP A 1 19  ? -2.837  18.096  -6.519  1.00 1.00 ? 39  TRP A CH2  6  
ATOM 9237  H H    . TRP A 1 19  ? -0.770  10.544  -4.800  1.00 1.00 ? 39  TRP A H    6  
ATOM 9238  H HA   . TRP A 1 19  ? 1.099   12.545  -4.294  1.00 1.00 ? 39  TRP A HA   6  
ATOM 9239  H HB2  . TRP A 1 19  ? 0.442   14.424  -5.669  1.00 0.00 ? 39  TRP A HB2  6  
ATOM 9240  H HB3  . TRP A 1 19  ? 0.509   13.109  -6.794  1.00 1.00 ? 39  TRP A HB3  6  
ATOM 9241  H HD1  . TRP A 1 19  ? -2.553  12.383  -6.556  1.00 1.00 ? 39  TRP A HD1  6  
ATOM 9242  H HE1  . TRP A 1 19  ? -4.401  14.137  -6.904  1.00 1.00 ? 39  TRP A HE1  6  
ATOM 9243  H HE3  . TRP A 1 19  ? 0.099   16.640  -5.531  1.00 1.00 ? 39  TRP A HE3  6  
ATOM 9244  H HZ2  . TRP A 1 19  ? -4.568  17.013  -7.247  1.00 1.00 ? 39  TRP A HZ2  6  
ATOM 9245  H HZ3  . TRP A 1 19  ? -0.957  18.860  -5.752  1.00 1.00 ? 39  TRP A HZ3  6  
ATOM 9246  H HH2  . TRP A 1 19  ? -3.278  19.072  -6.645  1.00 1.00 ? 39  TRP A HH2  6  
ATOM 9247  N N    . ARG A 1 20  ? -0.740  14.028  -3.059  1.00 1.00 ? 40  ARG A N    6  
ATOM 9248  C CA   . ARG A 1 20  ? -1.576  14.651  -2.025  1.00 1.00 ? 40  ARG A CA   6  
ATOM 9249  C C    . ARG A 1 20  ? -2.966  14.951  -2.600  1.00 1.00 ? 40  ARG A C    6  
ATOM 9250  O O    . ARG A 1 20  ? -3.157  15.974  -3.258  1.00 1.00 ? 40  ARG A O    6  
ATOM 9251  C CB   . ARG A 1 20  ? -0.813  15.900  -1.530  1.00 1.00 ? 40  ARG A CB   6  
ATOM 9252  C CG   . ARG A 1 20  ? -1.379  16.582  -0.278  1.00 1.00 ? 40  ARG A CG   6  
ATOM 9253  C CD   . ARG A 1 20  ? -1.875  18.014  -0.502  1.00 1.00 ? 40  ARG A CD   6  
ATOM 9254  N NE   . ARG A 1 20  ? -3.074  18.025  -1.360  1.00 1.00 ? 40  ARG A NE   6  
ATOM 9255  C CZ   . ARG A 1 20  ? -3.652  19.017  -1.998  1.00 1.00 ? 40  ARG A CZ   6  
ATOM 9256  N NH1  . ARG A 1 20  ? -3.180  20.227  -1.999  1.00 1.00 ? 40  ARG A NH1  6  
ATOM 9257  N NH2  . ARG A 1 20  ? -4.742  18.788  -2.667  1.00 1.00 ? 40  ARG A NH2  6  
ATOM 9258  H H    . ARG A 1 20  ? -0.099  14.616  -3.579  1.00 1.00 ? 40  ARG A H    6  
ATOM 9259  H HA   . ARG A 1 20  ? -1.691  13.987  -1.184  1.00 1.00 ? 40  ARG A HA   6  
ATOM 9260  H HB2  . ARG A 1 20  ? 0.159   15.643  -1.112  1.00 0.00 ? 40  ARG A HB2  6  
ATOM 9261  H HB3  . ARG A 1 20  ? -0.634  16.615  -2.339  1.00 1.00 ? 40  ARG A HB3  6  
ATOM 9262  H HG2  . ARG A 1 20  ? -2.262  16.039  0.057   1.00 0.00 ? 40  ARG A HG2  6  
ATOM 9263  H HG3  . ARG A 1 20  ? -0.620  16.574  0.508   1.00 1.00 ? 40  ARG A HG3  6  
ATOM 9264  H HD2  . ARG A 1 20  ? -2.171  18.447  0.455   1.00 0.00 ? 40  ARG A HD2  6  
ATOM 9265  H HD3  . ARG A 1 20  ? -1.072  18.610  -0.942  1.00 1.00 ? 40  ARG A HD3  6  
ATOM 9266  H HE   . ARG A 1 20  ? -3.394  17.139  -1.718  1.00 1.00 ? 40  ARG A HE   6  
ATOM 9267  H HH11 . ARG A 1 20  ? -2.316  20.443  -1.482  1.00 0.00 ? 40  ARG A HH11 6  
ATOM 9268  H HH12 . ARG A 1 20  ? -3.671  20.971  -2.516  1.00 0.00 ? 40  ARG A HH12 6  
ATOM 9269  H HH21 . ARG A 1 20  ? -5.143  17.840  -2.692  1.00 0.00 ? 40  ARG A HH21 6  
ATOM 9270  H HH22 . ARG A 1 20  ? -5.207  19.556  -3.173  1.00 0.00 ? 40  ARG A HH22 6  
ATOM 9271  N N    . CYS A 1 21  ? -3.976  14.121  -2.294  1.00 1.00 ? 41  CYS A N    6  
ATOM 9272  C CA   . CYS A 1 21  ? -5.337  14.332  -2.816  1.00 1.00 ? 41  CYS A CA   6  
ATOM 9273  C C    . CYS A 1 21  ? -6.075  15.343  -1.934  1.00 1.00 ? 41  CYS A C    6  
ATOM 9274  O O    . CYS A 1 21  ? -6.360  16.455  -2.393  1.00 1.00 ? 41  CYS A O    6  
ATOM 9275  C CB   . CYS A 1 21  ? -6.096  13.008  -3.000  1.00 1.00 ? 41  CYS A CB   6  
ATOM 9276  S SG   . CYS A 1 21  ? -7.663  13.331  -3.864  1.00 1.00 ? 41  CYS A SG   6  
ATOM 9277  H H    . CYS A 1 21  ? -3.809  13.382  -1.614  1.00 1.00 ? 41  CYS A H    6  
ATOM 9278  H HA   . CYS A 1 21  ? -5.257  14.780  -3.809  1.00 1.00 ? 41  CYS A HA   6  
ATOM 9279  H HB2  . CYS A 1 21  ? -5.506  12.305  -3.588  1.00 0.00 ? 41  CYS A HB2  6  
ATOM 9280  H HB3  . CYS A 1 21  ? -6.312  12.552  -2.038  1.00 1.00 ? 41  CYS A HB3  6  
ATOM 9281  H HG   . CYS A 1 21  ? -7.164  13.335  -5.106  1.00 1.00 ? 41  CYS A HG   6  
ATOM 9282  N N    . ASN A 1 22  ? -6.340  14.972  -0.670  1.00 1.00 ? 42  ASN A N    6  
ATOM 9283  C CA   . ASN A 1 22  ? -7.023  15.800  0.329   1.00 1.00 ? 42  ASN A CA   6  
ATOM 9284  C C    . ASN A 1 22  ? -8.287  16.510  -0.232  1.00 1.00 ? 42  ASN A C    6  
ATOM 9285  O O    . ASN A 1 22  ? -8.403  17.735  -0.209  1.00 1.00 ? 42  ASN A O    6  
ATOM 9286  C CB   . ASN A 1 22  ? -5.966  16.742  0.945   1.00 1.00 ? 42  ASN A CB   6  
ATOM 9287  C CG   . ASN A 1 22  ? -6.332  17.301  2.316   1.00 1.00 ? 42  ASN A CG   6  
ATOM 9288  O OD1  . ASN A 1 22  ? -7.100  16.735  3.074   1.00 1.00 ? 42  ASN A OD1  6  
ATOM 9289  N ND2  . ASN A 1 22  ? -5.759  18.410  2.715   1.00 1.00 ? 42  ASN A ND2  6  
ATOM 9290  H H    . ASN A 1 22  ? -5.979  14.061  -0.389  1.00 1.00 ? 42  ASN A H    6  
ATOM 9291  H HA   . ASN A 1 22  ? -7.364  15.130  1.122   1.00 1.00 ? 42  ASN A HA   6  
ATOM 9292  H HB2  . ASN A 1 22  ? -5.047  16.191  1.140   1.00 0.00 ? 42  ASN A HB2  6  
ATOM 9293  H HB3  . ASN A 1 22  ? -5.752  17.558  0.256   1.00 1.00 ? 42  ASN A HB3  6  
ATOM 9294  H HD21 . ASN A 1 22  ? -5.078  18.884  2.107   1.00 0.00 ? 42  ASN A HD21 6  
ATOM 9295  H HD22 . ASN A 1 22  ? -5.991  18.806  3.637   1.00 0.00 ? 42  ASN A HD22 6  
ATOM 9296  N N    . LYS A 1 23  ? -9.230  15.714  -0.769  1.00 1.00 ? 43  LYS A N    6  
ATOM 9297  C CA   . LYS A 1 23  ? -10.502 16.137  -1.406  1.00 1.00 ? 43  LYS A CA   6  
ATOM 9298  C C    . LYS A 1 23  ? -10.423 16.880  -2.761  1.00 1.00 ? 43  LYS A C    6  
ATOM 9299  O O    . LYS A 1 23  ? -11.479 17.232  -3.285  1.00 1.00 ? 43  LYS A O    6  
ATOM 9300  C CB   . LYS A 1 23  ? -11.353 16.922  -0.377  1.00 1.00 ? 43  LYS A CB   6  
ATOM 9301  C CG   . LYS A 1 23  ? -12.857 16.678  -0.536  1.00 1.00 ? 43  LYS A CG   6  
ATOM 9302  C CD   . LYS A 1 23  ? -13.776 17.868  -0.259  1.00 1.00 ? 43  LYS A CD   6  
ATOM 9303  C CE   . LYS A 1 23  ? -13.998 18.717  -1.518  1.00 1.00 ? 43  LYS A CE   6  
ATOM 9304  N NZ   . LYS A 1 23  ? -13.241 19.984  -1.524  1.00 1.00 ? 43  LYS A NZ   6  
ATOM 9305  H H    . LYS A 1 23  ? -9.001  14.726  -0.735  1.00 1.00 ? 43  LYS A H    6  
ATOM 9306  H HA   . LYS A 1 23  ? -11.044 15.237  -1.657  1.00 1.00 ? 43  LYS A HA   6  
ATOM 9307  H HB2  . LYS A 1 23  ? -11.161 16.560  0.634   1.00 0.00 ? 43  LYS A HB2  6  
ATOM 9308  H HB3  . LYS A 1 23  ? -11.113 17.987  -0.412  1.00 1.00 ? 43  LYS A HB3  6  
ATOM 9309  H HG2  . LYS A 1 23  ? -13.069 16.448  -1.579  1.00 0.00 ? 43  LYS A HG2  6  
ATOM 9310  H HG3  . LYS A 1 23  ? -13.147 15.843  0.096   1.00 1.00 ? 43  LYS A HG3  6  
ATOM 9311  H HD2  . LYS A 1 23  ? -14.801 17.554  -0.061  1.00 0.00 ? 43  LYS A HD2  6  
ATOM 9312  H HD3  . LYS A 1 23  ? -13.446 18.445  0.608   1.00 1.00 ? 43  LYS A HD3  6  
ATOM 9313  H HE2  . LYS A 1 23  ? -13.597 18.198  -2.389  1.00 0.00 ? 43  LYS A HE2  6  
ATOM 9314  H HE3  . LYS A 1 23  ? -15.067 18.888  -1.665  1.00 1.00 ? 43  LYS A HE3  6  
ATOM 9315  H HZ1  . LYS A 1 23  ? -13.601 20.598  -2.268  1.00 0.00 ? 43  LYS A HZ1  6  
ATOM 9316  H HZ2  . LYS A 1 23  ? -13.347 20.453  -0.612  1.00 0.00 ? 43  LYS A HZ2  6  
ATOM 9317  N N    . THR A 1 24  ? -9.235  17.099  -3.349  1.00 1.00 ? 44  THR A N    6  
ATOM 9318  C CA   . THR A 1 24  ? -9.057  17.934  -4.570  1.00 1.00 ? 44  THR A CA   6  
ATOM 9319  C C    . THR A 1 24  ? -9.498  17.305  -5.917  1.00 1.00 ? 44  THR A C    6  
ATOM 9320  O O    . THR A 1 24  ? -9.820  18.062  -6.830  1.00 1.00 ? 44  THR A O    6  
ATOM 9321  C CB   . THR A 1 24  ? -7.628  18.518  -4.631  1.00 1.00 ? 44  THR A CB   6  
ATOM 9322  O OG1  . THR A 1 24  ? -7.626  19.781  -5.246  1.00 1.00 ? 44  THR A OG1  6  
ATOM 9323  C CG2  . THR A 1 24  ? -6.597  17.648  -5.352  1.00 1.00 ? 44  THR A CG2  6  
ATOM 9324  H H    . THR A 1 24  ? -8.417  16.771  -2.843  1.00 1.00 ? 44  THR A H    6  
ATOM 9325  H HA   . THR A 1 24  ? -9.706  18.794  -4.437  1.00 1.00 ? 44  THR A HA   6  
ATOM 9326  H HB   . THR A 1 24  ? -7.283  18.680  -3.608  1.00 1.00 ? 44  THR A HB   6  
ATOM 9327  H HG1  . THR A 1 24  ? -6.878  19.820  -5.857  1.00 1.00 ? 44  THR A HG1  6  
ATOM 9328  H HG21 . THR A 1 24  ? -6.686  16.614  -5.015  1.00 1.00 ? 44  THR A HG21 6  
ATOM 9329  H HG22 . THR A 1 24  ? -6.765  17.689  -6.422  1.00 1.00 ? 44  THR A HG22 6  
ATOM 9330  H HG23 . THR A 1 24  ? -5.589  18.001  -5.144  1.00 1.00 ? 44  THR A HG23 6  
ATOM 9331  N N    . LEU A 1 25  ? -9.565  15.963  -6.059  1.00 1.00 ? 45  LEU A N    6  
ATOM 9332  C CA   . LEU A 1 25  ? -10.033 15.256  -7.261  1.00 1.00 ? 45  LEU A CA   6  
ATOM 9333  C C    . LEU A 1 25  ? -10.982 14.100  -6.855  1.00 1.00 ? 45  LEU A C    6  
ATOM 9334  O O    . LEU A 1 25  ? -10.511 13.155  -6.217  1.00 1.00 ? 45  LEU A O    6  
ATOM 9335  C CB   . LEU A 1 25  ? -8.817  14.730  -8.073  1.00 1.00 ? 45  LEU A CB   6  
ATOM 9336  C CG   . LEU A 1 25  ? -8.253  15.524  -9.279  1.00 1.00 ? 45  LEU A CG   6  
ATOM 9337  C CD1  . LEU A 1 25  ? -9.335  16.059  -10.227 1.00 1.00 ? 45  LEU A CD1  6  
ATOM 9338  C CD2  . LEU A 1 25  ? -7.309  16.651  -8.859  1.00 1.00 ? 45  LEU A CD2  6  
ATOM 9339  H H    . LEU A 1 25  ? -9.321  15.341  -5.300  1.00 1.00 ? 45  LEU A H    6  
ATOM 9340  H HA   . LEU A 1 25  ? -10.589 15.947  -7.893  1.00 1.00 ? 45  LEU A HA   6  
ATOM 9341  H HB2  . LEU A 1 25  ? -7.921  14.731  -7.452  1.00 0.00 ? 45  LEU A HB2  6  
ATOM 9342  H HB3  . LEU A 1 25  ? -9.005  13.711  -8.416  1.00 1.00 ? 45  LEU A HB3  6  
ATOM 9343  H HG   . LEU A 1 25  ? -7.644  14.821  -9.854  1.00 1.00 ? 45  LEU A HG   6  
ATOM 9344  H HD11 . LEU A 1 25  ? -10.006 15.250  -10.519 1.00 1.00 ? 45  LEU A HD11 6  
ATOM 9345  H HD12 . LEU A 1 25  ? -9.905  16.855  -9.749  1.00 1.00 ? 45  LEU A HD12 6  
ATOM 9346  H HD13 . LEU A 1 25  ? -8.863  16.463  -11.124 1.00 1.00 ? 45  LEU A HD13 6  
ATOM 9347  H HD21 . LEU A 1 25  ? -6.534  16.251  -8.208  1.00 1.00 ? 45  LEU A HD21 6  
ATOM 9348  H HD22 . LEU A 1 25  ? -6.832  17.082  -9.742  1.00 1.00 ? 45  LEU A HD22 6  
ATOM 9349  H HD23 . LEU A 1 25  ? -7.868  17.436  -8.350  1.00 1.00 ? 45  LEU A HD23 6  
ATOM 9350  N N    . PRO A 1 26  ? -12.307 14.181  -7.122  1.00 1.00 ? 46  PRO A N    6  
ATOM 9351  C CA   . PRO A 1 26  ? -13.244 13.058  -6.969  1.00 1.00 ? 46  PRO A CA   6  
ATOM 9352  C C    . PRO A 1 26  ? -13.217 12.145  -8.224  1.00 1.00 ? 46  PRO A C    6  
ATOM 9353  O O    . PRO A 1 26  ? -13.069 12.628  -9.349  1.00 1.00 ? 46  PRO A O    6  
ATOM 9354  C CB   . PRO A 1 26  ? -14.622 13.704  -6.794  1.00 1.00 ? 46  PRO A CB   6  
ATOM 9355  C CG   . PRO A 1 26  ? -14.507 15.003  -7.594  1.00 1.00 ? 46  PRO A CG   6  
ATOM 9356  C CD   . PRO A 1 26  ? -13.023 15.371  -7.572  1.00 1.00 ? 46  PRO A CD   6  
ATOM 9357  H HA   . PRO A 1 26  ? -12.996 12.474  -6.081  1.00 1.00 ? 46  PRO A HA   6  
ATOM 9358  H HB2  . PRO A 1 26  ? -15.409 13.056  -7.183  1.00 0.00 ? 46  PRO A HB2  6  
ATOM 9359  H HB3  . PRO A 1 26  ? -14.777 13.946  -5.739  1.00 1.00 ? 46  PRO A HB3  6  
ATOM 9360  H HG2  . PRO A 1 26  ? -14.849 14.863  -8.619  1.00 0.00 ? 46  PRO A HG2  6  
ATOM 9361  H HG3  . PRO A 1 26  ? -15.111 15.792  -7.146  1.00 1.00 ? 46  PRO A HG3  6  
ATOM 9362  H HD2  . PRO A 1 26  ? -12.682 15.664  -8.565  1.00 0.00 ? 46  PRO A HD2  6  
ATOM 9363  H HD3  . PRO A 1 26  ? -12.847 16.200  -6.882  1.00 1.00 ? 46  PRO A HD3  6  
ATOM 9364  N N    . ILE A 1 27  ? -13.367 10.823  -8.038  1.00 1.00 ? 47  ILE A N    6  
ATOM 9365  C CA   . ILE A 1 27  ? -13.315 9.789   -9.104  1.00 1.00 ? 47  ILE A CA   6  
ATOM 9366  C C    . ILE A 1 27  ? -14.370 8.683   -8.854  1.00 1.00 ? 47  ILE A C    6  
ATOM 9367  O O    . ILE A 1 27  ? -15.561 8.975   -8.932  1.00 1.00 ? 47  ILE A O    6  
ATOM 9368  C CB   . ILE A 1 27  ? -11.858 9.277   -9.380  1.00 1.00 ? 47  ILE A CB   6  
ATOM 9369  C CG1  . ILE A 1 27  ? -11.041 9.034   -8.082  1.00 1.00 ? 47  ILE A CG1  6  
ATOM 9370  C CG2  . ILE A 1 27  ? -11.116 10.138  -10.426 1.00 1.00 ? 47  ILE A CG2  6  
ATOM 9371  C CD1  . ILE A 1 27  ? -10.184 10.187  -7.524  1.00 1.00 ? 47  ILE A CD1  6  
ATOM 9372  H H    . ILE A 1 27  ? -13.514 10.514  -7.093  1.00 1.00 ? 47  ILE A H    6  
ATOM 9373  H HA   . ILE A 1 27  ? -13.658 10.260  -10.030 1.00 1.00 ? 47  ILE A HA   6  
ATOM 9374  H HB   . ILE A 1 27  ? -11.944 8.307   -9.872  1.00 1.00 ? 47  ILE A HB   6  
ATOM 9375  H HG12 . ILE A 1 27  ? -11.692 8.945   -7.212  1.00 0.00 ? 47  ILE A HG12 6  
ATOM 9376  H HG13 . ILE A 1 27  ? -10.456 8.118   -8.146  1.00 1.00 ? 47  ILE A HG13 6  
ATOM 9377  H HG21 . ILE A 1 27  ? -11.671 10.153  -11.366 1.00 1.00 ? 47  ILE A HG21 6  
ATOM 9378  H HG22 . ILE A 1 27  ? -11.008 11.161  -10.069 1.00 1.00 ? 47  ILE A HG22 6  
ATOM 9379  H HG23 . ILE A 1 27  ? -10.127 9.724   -10.625 1.00 1.00 ? 47  ILE A HG23 6  
ATOM 9380  H HD11 . ILE A 1 27  ? -10.833 11.025  -7.300  1.00 1.00 ? 47  ILE A HD11 6  
ATOM 9381  H HD12 . ILE A 1 27  ? -9.683  9.887   -6.603  1.00 1.00 ? 47  ILE A HD12 6  
ATOM 9382  H HD13 . ILE A 1 27  ? -9.428  10.508  -8.244  1.00 1.00 ? 47  ILE A HD13 6  
ATOM 9383  N N    . ALA A 1 28  ? -13.973 7.430   -8.587  1.00 1.00 ? 48  ALA A N    6  
ATOM 9384  C CA   . ALA A 1 28  ? -14.838 6.258   -8.404  1.00 1.00 ? 48  ALA A CA   6  
ATOM 9385  C C    . ALA A 1 28  ? -14.085 5.174   -7.606  1.00 1.00 ? 48  ALA A C    6  
ATOM 9386  O O    . ALA A 1 28  ? -13.043 4.685   -8.048  1.00 1.00 ? 48  ALA A O    6  
ATOM 9387  C CB   . ALA A 1 28  ? -15.293 5.743   -9.783  1.00 1.00 ? 48  ALA A CB   6  
ATOM 9388  H H    . ALA A 1 28  ? -12.979 7.253   -8.542  1.00 1.00 ? 48  ALA A H    6  
ATOM 9389  H HA   . ALA A 1 28  ? -15.727 6.561   -7.845  1.00 1.00 ? 48  ALA A HA   6  
ATOM 9390  H HB1  . ALA A 1 28  ? -15.847 6.528   -10.304 1.00 1.00 ? 48  ALA A HB1  6  
ATOM 9391  H HB2  . ALA A 1 28  ? -14.426 5.458   -10.385 1.00 1.00 ? 48  ALA A HB2  6  
ATOM 9392  H HB3  . ALA A 1 28  ? -15.951 4.884   -9.663  1.00 1.00 ? 48  ALA A HB3  6  
ATOM 9393  N N    . PHE A 1 29  ? -14.620 4.804   -6.439  1.00 1.00 ? 49  PHE A N    6  
ATOM 9394  C CA   . PHE A 1 29  ? -14.009 3.903   -5.453  1.00 1.00 ? 49  PHE A CA   6  
ATOM 9395  C C    . PHE A 1 29  ? -14.959 2.724   -5.192  1.00 1.00 ? 49  PHE A C    6  
ATOM 9396  O O    . PHE A 1 29  ? -16.074 2.903   -4.691  1.00 1.00 ? 49  PHE A O    6  
ATOM 9397  C CB   . PHE A 1 29  ? -13.658 4.687   -4.173  1.00 1.00 ? 49  PHE A CB   6  
ATOM 9398  C CG   . PHE A 1 29  ? -13.051 6.068   -4.376  1.00 1.00 ? 49  PHE A CG   6  
ATOM 9399  C CD1  . PHE A 1 29  ? -11.670 6.228   -4.635  1.00 1.00 ? 49  PHE A CD1  6  
ATOM 9400  C CD2  . PHE A 1 29  ? -13.898 7.197   -4.383  1.00 1.00 ? 49  PHE A CD2  6  
ATOM 9401  C CE1  . PHE A 1 29  ? -11.142 7.509   -4.904  1.00 1.00 ? 49  PHE A CE1  6  
ATOM 9402  C CE2  . PHE A 1 29  ? -13.374 8.478   -4.668  1.00 1.00 ? 49  PHE A CE2  6  
ATOM 9403  C CZ   . PHE A 1 29  ? -11.997 8.632   -4.926  1.00 1.00 ? 49  PHE A CZ   6  
ATOM 9404  H H    . PHE A 1 29  ? -15.487 5.245   -6.133  1.00 1.00 ? 49  PHE A H    6  
ATOM 9405  H HA   . PHE A 1 29  ? -13.077 3.514   -5.864  1.00 1.00 ? 49  PHE A HA   6  
ATOM 9406  H HB2  . PHE A 1 29  ? -14.563 4.961   -3.630  1.00 0.00 ? 49  PHE A HB2  6  
ATOM 9407  H HB3  . PHE A 1 29  ? -13.033 4.085   -3.513  1.00 1.00 ? 49  PHE A HB3  6  
ATOM 9408  H HD1  . PHE A 1 29  ? -11.015 5.375   -4.623  1.00 1.00 ? 49  PHE A HD1  6  
ATOM 9409  H HD2  . PHE A 1 29  ? -14.950 7.066   -4.173  1.00 1.00 ? 49  PHE A HD2  6  
ATOM 9410  H HE1  . PHE A 1 29  ? -10.085 7.634   -5.084  1.00 1.00 ? 49  PHE A HE1  6  
ATOM 9411  H HE2  . PHE A 1 29  ? -14.014 9.343   -4.675  1.00 1.00 ? 49  PHE A HE2  6  
ATOM 9412  H HZ   . PHE A 1 29  ? -11.587 9.618   -5.100  1.00 1.00 ? 49  PHE A HZ   6  
ATOM 9413  N N    . LYS A 1 30  ? -14.534 1.516   -5.596  1.00 1.00 ? 50  LYS A N    6  
ATOM 9414  C CA   . LYS A 1 30  ? -15.351 0.290   -5.585  1.00 1.00 ? 50  LYS A CA   6  
ATOM 9415  C C    . LYS A 1 30  ? -14.617 -0.821  -4.827  1.00 1.00 ? 50  LYS A C    6  
ATOM 9416  O O    . LYS A 1 30  ? -13.507 -1.190  -5.203  1.00 1.00 ? 50  LYS A O    6  
ATOM 9417  C CB   . LYS A 1 30  ? -15.735 -0.120  -7.022  1.00 1.00 ? 50  LYS A CB   6  
ATOM 9418  C CG   . LYS A 1 30  ? -16.469 0.984   -7.804  1.00 1.00 ? 50  LYS A CG   6  
ATOM 9419  C CD   . LYS A 1 30  ? -16.903 0.512   -9.193  1.00 1.00 ? 50  LYS A CD   6  
ATOM 9420  C CE   . LYS A 1 30  ? -17.266 1.674   -10.121 1.00 1.00 ? 50  LYS A CE   6  
ATOM 9421  N NZ   . LYS A 1 30  ? -16.091 2.151   -10.879 1.00 1.00 ? 50  LYS A NZ   6  
ATOM 9422  H H    . LYS A 1 30  ? -13.595 1.438   -5.984  1.00 1.00 ? 50  LYS A H    6  
ATOM 9423  H HA   . LYS A 1 30  ? -16.281 0.497   -5.055  1.00 1.00 ? 50  LYS A HA   6  
ATOM 9424  H HB2  . LYS A 1 30  ? -14.823 -0.330  -7.581  1.00 0.00 ? 50  LYS A HB2  6  
ATOM 9425  H HB3  . LYS A 1 30  ? -16.362 -1.009  -6.977  1.00 1.00 ? 50  LYS A HB3  6  
ATOM 9426  H HG2  . LYS A 1 30  ? -17.370 1.268   -7.260  1.00 0.00 ? 50  LYS A HG2  6  
ATOM 9427  H HG3  . LYS A 1 30  ? -15.813 1.848   -7.906  1.00 1.00 ? 50  LYS A HG3  6  
ATOM 9428  H HD2  . LYS A 1 30  ? -16.082 -0.026  -9.663  1.00 0.00 ? 50  LYS A HD2  6  
ATOM 9429  H HD3  . LYS A 1 30  ? -17.768 -0.149  -9.095  1.00 1.00 ? 50  LYS A HD3  6  
ATOM 9430  H HE2  . LYS A 1 30  ? -17.959 1.340   -10.893 1.00 0.00 ? 50  LYS A HE2  6  
ATOM 9431  H HE3  . LYS A 1 30  ? -17.740 2.480   -9.552  1.00 1.00 ? 50  LYS A HE3  6  
ATOM 9432  H HZ1  . LYS A 1 30  ? -16.400 2.536   -11.783 1.00 0.00 ? 50  LYS A HZ1  6  
ATOM 9433  H HZ2  . LYS A 1 30  ? -15.609 2.885   -10.340 1.00 0.00 ? 50  LYS A HZ2  6  
ATOM 9434  N N    . VAL A 1 31  ? -15.207 -1.317  -3.734  1.00 1.00 ? 51  VAL A N    6  
ATOM 9435  C CA   . VAL A 1 31  ? -14.617 -2.347  -2.844  1.00 1.00 ? 51  VAL A CA   6  
ATOM 9436  C C    . VAL A 1 31  ? -15.657 -3.419  -2.509  1.00 1.00 ? 51  VAL A C    6  
ATOM 9437  O O    . VAL A 1 31  ? -16.810 -3.106  -2.201  1.00 1.00 ? 51  VAL A O    6  
ATOM 9438  C CB   . VAL A 1 31  ? -13.962 -1.756  -1.562  1.00 1.00 ? 51  VAL A CB   6  
ATOM 9439  C CG1  . VAL A 1 31  ? -13.105 -2.819  -0.843  1.00 1.00 ? 51  VAL A CG1  6  
ATOM 9440  C CG2  . VAL A 1 31  ? -13.075 -0.527  -1.850  1.00 1.00 ? 51  VAL A CG2  6  
ATOM 9441  H H    . VAL A 1 31  ? -16.162 -1.007  -3.558  1.00 1.00 ? 51  VAL A H    6  
ATOM 9442  H HA   . VAL A 1 31  ? -13.823 -2.840  -3.401  1.00 1.00 ? 51  VAL A HA   6  
ATOM 9443  H HB   . VAL A 1 31  ? -14.739 -1.446  -0.867  1.00 1.00 ? 51  VAL A HB   6  
ATOM 9444  H HG11 . VAL A 1 31  ? -12.361 -3.236  -1.520  1.00 1.00 ? 51  VAL A HG11 6  
ATOM 9445  H HG12 . VAL A 1 31  ? -12.584 -2.379  0.008   1.00 1.00 ? 51  VAL A HG12 6  
ATOM 9446  H HG13 . VAL A 1 31  ? -13.736 -3.621  -0.462  1.00 1.00 ? 51  VAL A HG13 6  
ATOM 9447  H HG21 . VAL A 1 31  ? -12.387 -0.746  -2.664  1.00 1.00 ? 51  VAL A HG21 6  
ATOM 9448  H HG22 . VAL A 1 31  ? -13.694 0.324   -2.137  1.00 1.00 ? 51  VAL A HG22 6  
ATOM 9449  H HG23 . VAL A 1 31  ? -12.499 -0.241  -0.969  1.00 1.00 ? 51  VAL A HG23 6  
ATOM 9450  N N    . VAL A 1 32  ? -15.242 -4.688  -2.590  1.00 1.00 ? 52  VAL A N    6  
ATOM 9451  C CA   . VAL A 1 32  ? -16.074 -5.883  -2.361  1.00 1.00 ? 52  VAL A CA   6  
ATOM 9452  C C    . VAL A 1 32  ? -15.323 -6.911  -1.494  1.00 1.00 ? 52  VAL A C    6  
ATOM 9453  O O    . VAL A 1 32  ? -14.119 -7.116  -1.653  1.00 1.00 ? 52  VAL A O    6  
ATOM 9454  C CB   . VAL A 1 32  ? -16.541 -6.508  -3.709  1.00 1.00 ? 52  VAL A CB   6  
ATOM 9455  C CG1  . VAL A 1 32  ? -17.429 -7.756  -3.521  1.00 1.00 ? 52  VAL A CG1  6  
ATOM 9456  C CG2  . VAL A 1 32  ? -17.331 -5.501  -4.578  1.00 1.00 ? 52  VAL A CG2  6  
ATOM 9457  H H    . VAL A 1 32  ? -14.264 -4.856  -2.826  1.00 1.00 ? 52  VAL A H    6  
ATOM 9458  H HA   . VAL A 1 32  ? -16.967 -5.574  -1.827  1.00 1.00 ? 52  VAL A HA   6  
ATOM 9459  H HB   . VAL A 1 32  ? -15.661 -6.809  -4.277  1.00 1.00 ? 52  VAL A HB   6  
ATOM 9460  H HG11 . VAL A 1 32  ? -18.287 -7.520  -2.888  1.00 1.00 ? 52  VAL A HG11 6  
ATOM 9461  H HG12 . VAL A 1 32  ? -17.788 -8.119  -4.484  1.00 1.00 ? 52  VAL A HG12 6  
ATOM 9462  H HG13 . VAL A 1 32  ? -16.860 -8.565  -3.063  1.00 1.00 ? 52  VAL A HG13 6  
ATOM 9463  H HG21 . VAL A 1 32  ? -18.195 -5.116  -4.034  1.00 1.00 ? 52  VAL A HG21 6  
ATOM 9464  H HG22 . VAL A 1 32  ? -16.697 -4.659  -4.856  1.00 1.00 ? 52  VAL A HG22 6  
ATOM 9465  H HG23 . VAL A 1 32  ? -17.675 -5.971  -5.497  1.00 1.00 ? 52  VAL A HG23 6  
ATOM 9466  N N    . ALA A 1 33  ? -16.040 -7.584  -0.592  1.00 1.00 ? 53  ALA A N    6  
ATOM 9467  C CA   . ALA A 1 33  ? -15.556 -8.728  0.188   1.00 1.00 ? 53  ALA A CA   6  
ATOM 9468  C C    . ALA A 1 33  ? -16.268 -10.027 -0.235  1.00 1.00 ? 53  ALA A C    6  
ATOM 9469  O O    . ALA A 1 33  ? -17.453 -10.019 -0.578  1.00 1.00 ? 53  ALA A O    6  
ATOM 9470  C CB   . ALA A 1 33  ? -15.677 -8.465  1.702   1.00 1.00 ? 53  ALA A CB   6  
ATOM 9471  H H    . ALA A 1 33  ? -17.001 -7.286  -0.447  1.00 1.00 ? 53  ALA A H    6  
ATOM 9472  H HA   . ALA A 1 33  ? -14.498 -8.861  -0.024  1.00 1.00 ? 53  ALA A HA   6  
ATOM 9473  H HB1  . ALA A 1 33  ? -16.213 -7.538  1.910   1.00 1.00 ? 53  ALA A HB1  6  
ATOM 9474  H HB2  . ALA A 1 33  ? -16.192 -9.285  2.203   1.00 1.00 ? 53  ALA A HB2  6  
ATOM 9475  H HB3  . ALA A 1 33  ? -14.682 -8.415  2.142   1.00 1.00 ? 53  ALA A HB3  6  
ATOM 9476  N N    . LEU A 1 34  ? -15.542 -11.151 -0.180  1.00 1.00 ? 54  LEU A N    6  
ATOM 9477  C CA   . LEU A 1 34  ? -16.116 -12.493 -0.367  1.00 1.00 ? 54  LEU A CA   6  
ATOM 9478  C C    . LEU A 1 34  ? -16.919 -12.915 0.894   1.00 1.00 ? 54  LEU A C    6  
ATOM 9479  O O    . LEU A 1 34  ? -16.485 -12.694 2.026   1.00 1.00 ? 54  LEU A O    6  
ATOM 9480  C CB   . LEU A 1 34  ? -14.999 -13.493 -0.713  1.00 1.00 ? 54  LEU A CB   6  
ATOM 9481  C CG   . LEU A 1 34  ? -15.493 -14.908 -1.091  1.00 1.00 ? 54  LEU A CG   6  
ATOM 9482  C CD1  . LEU A 1 34  ? -14.768 -15.372 -2.357  1.00 1.00 ? 54  LEU A CD1  6  
ATOM 9483  C CD2  . LEU A 1 34  ? -15.282 -15.920 0.043   1.00 1.00 ? 54  LEU A CD2  6  
ATOM 9484  H H    . LEU A 1 34  ? -14.546 -11.020 0.008   1.00 1.00 ? 54  LEU A H    6  
ATOM 9485  H HA   . LEU A 1 34  ? -16.799 -12.444 -1.216  1.00 1.00 ? 54  LEU A HA   6  
ATOM 9486  H HB2  . LEU A 1 34  ? -14.495 -13.222 -1.640  1.00 0.00 ? 54  LEU A HB2  6  
ATOM 9487  H HB3  . LEU A 1 34  ? -14.242 -13.532 0.071   1.00 1.00 ? 54  LEU A HB3  6  
ATOM 9488  H HG   . LEU A 1 34  ? -16.560 -14.879 -1.321  1.00 1.00 ? 54  LEU A HG   6  
ATOM 9489  H HD11 . LEU A 1 34  ? -14.956 -14.661 -3.163  1.00 1.00 ? 54  LEU A HD11 6  
ATOM 9490  H HD12 . LEU A 1 34  ? -13.694 -15.436 -2.178  1.00 1.00 ? 54  LEU A HD12 6  
ATOM 9491  H HD13 . LEU A 1 34  ? -15.142 -16.349 -2.663  1.00 1.00 ? 54  LEU A HD13 6  
ATOM 9492  H HD21 . LEU A 1 34  ? -15.784 -15.583 0.951   1.00 1.00 ? 54  LEU A HD21 6  
ATOM 9493  H HD22 . LEU A 1 34  ? -15.695 -16.889 -0.240  1.00 1.00 ? 54  LEU A HD22 6  
ATOM 9494  H HD23 . LEU A 1 34  ? -14.219 -16.033 0.257   1.00 1.00 ? 54  LEU A HD23 6  
ATOM 9495  N N    . GLY A 1 35  ? -18.075 -13.556 0.674   1.00 1.00 ? 55  GLY A N    6  
ATOM 9496  C CA   . GLY A 1 35  ? -19.096 -13.909 1.680   1.00 1.00 ? 55  GLY A CA   6  
ATOM 9497  C C    . GLY A 1 35  ? -20.396 -13.092 1.505   1.00 1.00 ? 55  GLY A C    6  
ATOM 9498  O O    . GLY A 1 35  ? -20.524 -12.333 0.542   1.00 1.00 ? 55  GLY A O    6  
ATOM 9499  H H    . GLY A 1 35  ? -18.350 -13.670 -0.289  1.00 1.00 ? 55  GLY A H    6  
ATOM 9500  H HA2  . GLY A 1 35  ? -19.330 -14.970 1.585   1.00 1.00 ? 55  GLY A HA2  6  
ATOM 9501  H HA3  . GLY A 1 35  ? -18.707 -13.715 2.680   1.00 1.00 ? 55  GLY A HA3  6  
ATOM 9502  N N    . ASP A 1 36  ? -21.379 -13.288 2.401   1.00 1.00 ? 56  ASP A N    6  
ATOM 9503  C CA   . ASP A 1 36  ? -22.678 -12.577 2.384   1.00 1.00 ? 56  ASP A CA   6  
ATOM 9504  C C    . ASP A 1 36  ? -23.348 -12.534 3.782   1.00 1.00 ? 56  ASP A C    6  
ATOM 9505  O O    . ASP A 1 36  ? -23.994 -13.501 4.196   1.00 1.00 ? 56  ASP A O    6  
ATOM 9506  C CB   . ASP A 1 36  ? -23.571 -13.234 1.309   1.00 1.00 ? 56  ASP A CB   6  
ATOM 9507  C CG   . ASP A 1 36  ? -24.498 -12.276 0.543   1.00 1.00 ? 56  ASP A CG   6  
ATOM 9508  O OD1  . ASP A 1 36  ? -24.022 -11.732 -0.478  1.00 1.00 ? 56  ASP A OD1  6  
ATOM 9509  O OD2  . ASP A 1 36  ? -25.669 -12.119 0.952   1.00 1.00 ? 56  ASP A OD2  6  
ATOM 9510  H H    . ASP A 1 36  ? -21.217 -13.943 3.150   1.00 1.00 ? 56  ASP A H    6  
ATOM 9511  H HA   . ASP A 1 36  ? -22.492 -11.545 2.070   1.00 1.00 ? 56  ASP A HA   6  
ATOM 9512  H HB2  . ASP A 1 36  ? -22.922 -13.710 0.576   1.00 0.00 ? 56  ASP A HB2  6  
ATOM 9513  H HB3  . ASP A 1 36  ? -24.090 -14.129 1.660   1.00 1.00 ? 56  ASP A HB3  6  
ATOM 9514  N N    . VAL A 1 37  ? -23.135 -11.444 4.544   1.00 1.00 ? 57  VAL A N    6  
ATOM 9515  C CA   . VAL A 1 37  ? -23.666 -11.187 5.910   1.00 1.00 ? 57  VAL A CA   6  
ATOM 9516  C C    . VAL A 1 37  ? -23.730 -9.674  6.245   1.00 1.00 ? 57  VAL A C    6  
ATOM 9517  O O    . VAL A 1 37  ? -22.848 -8.939  5.802   1.00 1.00 ? 57  VAL A O    6  
ATOM 9518  C CB   . VAL A 1 37  ? -22.812 -11.944 6.975   1.00 1.00 ? 57  VAL A CB   6  
ATOM 9519  C CG1  . VAL A 1 37  ? -21.377 -11.412 7.180   1.00 1.00 ? 57  VAL A CG1  6  
ATOM 9520  C CG2  . VAL A 1 37  ? -23.506 -11.995 8.346   1.00 1.00 ? 57  VAL A CG2  6  
ATOM 9521  H H    . VAL A 1 37  ? -22.574 -10.703 4.114   1.00 1.00 ? 57  VAL A H    6  
ATOM 9522  H HA   . VAL A 1 37  ? -24.678 -11.591 5.938   1.00 1.00 ? 57  VAL A HA   6  
ATOM 9523  H HB   . VAL A 1 37  ? -22.720 -12.979 6.643   1.00 1.00 ? 57  VAL A HB   6  
ATOM 9524  H HG11 . VAL A 1 37  ? -20.830 -11.439 6.238   1.00 1.00 ? 57  VAL A HG11 6  
ATOM 9525  H HG12 . VAL A 1 37  ? -21.392 -10.388 7.559   1.00 1.00 ? 57  VAL A HG12 6  
ATOM 9526  H HG13 . VAL A 1 37  ? -20.843 -12.035 7.901   1.00 1.00 ? 57  VAL A HG13 6  
ATOM 9527  H HG21 . VAL A 1 37  ? -24.519 -12.382 8.238   1.00 1.00 ? 57  VAL A HG21 6  
ATOM 9528  H HG22 . VAL A 1 37  ? -22.958 -12.655 9.018   1.00 1.00 ? 57  VAL A HG22 6  
ATOM 9529  H HG23 . VAL A 1 37  ? -23.542 -11.004 8.801   1.00 1.00 ? 57  VAL A HG23 6  
ATOM 9530  N N    . PRO A 1 38  ? -24.700 -9.172  7.052   1.00 1.00 ? 58  PRO A N    6  
ATOM 9531  C CA   . PRO A 1 38  ? -24.692 -7.781  7.540   1.00 1.00 ? 58  PRO A CA   6  
ATOM 9532  C C    . PRO A 1 38  ? -23.413 -7.444  8.345   1.00 1.00 ? 58  PRO A C    6  
ATOM 9533  O O    . PRO A 1 38  ? -22.830 -8.312  8.994   1.00 1.00 ? 58  PRO A O    6  
ATOM 9534  C CB   . PRO A 1 38  ? -25.963 -7.598  8.378   1.00 1.00 ? 58  PRO A CB   6  
ATOM 9535  C CG   . PRO A 1 38  ? -26.449 -9.017  8.668   1.00 1.00 ? 58  PRO A CG   6  
ATOM 9536  C CD   . PRO A 1 38  ? -25.863 -9.885  7.556   1.00 1.00 ? 58  PRO A CD   6  
ATOM 9537  H HA   . PRO A 1 38  ? -24.744 -7.111  6.681   1.00 1.00 ? 58  PRO A HA   6  
ATOM 9538  H HB2  . PRO A 1 38  ? -25.638 -7.057  9.266   1.00 0.00 ? 58  PRO A HB2  6  
ATOM 9539  H HB3  . PRO A 1 38  ? -26.715 -7.070  7.784   1.00 1.00 ? 58  PRO A HB3  6  
ATOM 9540  H HG2  . PRO A 1 38  ? -26.097 -9.368  9.638   1.00 0.00 ? 58  PRO A HG2  6  
ATOM 9541  H HG3  . PRO A 1 38  ? -27.539 -9.072  8.677   1.00 1.00 ? 58  PRO A HG3  6  
ATOM 9542  H HD2  . PRO A 1 38  ? -25.557 -10.869 7.911   1.00 0.00 ? 58  PRO A HD2  6  
ATOM 9543  H HD3  . PRO A 1 38  ? -26.596 -9.998  6.753   1.00 1.00 ? 58  PRO A HD3  6  
ATOM 9544  N N    . ASP A 1 39  ? -23.008 -6.165  8.316   1.00 1.00 ? 59  ASP A N    6  
ATOM 9545  C CA   . ASP A 1 39  ? -21.749 -5.605  8.852   1.00 1.00 ? 59  ASP A CA   6  
ATOM 9546  C C    . ASP A 1 39  ? -20.501 -6.048  8.043   1.00 1.00 ? 59  ASP A C    6  
ATOM 9547  O O    . ASP A 1 39  ? -19.945 -7.130  8.232   1.00 1.00 ? 59  ASP A O    6  
ATOM 9548  C CB   . ASP A 1 39  ? -21.658 -5.820  10.378  1.00 1.00 ? 59  ASP A CB   6  
ATOM 9549  C CG   . ASP A 1 39  ? -22.780 -5.125  11.177  1.00 1.00 ? 59  ASP A CG   6  
ATOM 9550  O OD1  . ASP A 1 39  ? -23.285 -4.088  10.695  1.00 1.00 ? 59  ASP A OD1  6  
ATOM 9551  O OD2  . ASP A 1 39  ? -23.126 -5.662  12.256  1.00 1.00 ? 59  ASP A OD2  6  
ATOM 9552  H H    . ASP A 1 39  ? -23.641 -5.516  7.882   1.00 1.00 ? 59  ASP A H    6  
ATOM 9553  H HA   . ASP A 1 39  ? -21.819 -4.523  8.727   1.00 1.00 ? 59  ASP A HA   6  
ATOM 9554  H HB2  . ASP A 1 39  ? -21.720 -6.890  10.579  1.00 0.00 ? 59  ASP A HB2  6  
ATOM 9555  H HB3  . ASP A 1 39  ? -20.685 -5.486  10.747  1.00 1.00 ? 59  ASP A HB3  6  
ATOM 9556  N N    . GLY A 1 40  ? -20.054 -5.186  7.112   1.00 1.00 ? 60  GLY A N    6  
ATOM 9557  C CA   . GLY A 1 40  ? -19.014 -5.437  6.109   1.00 1.00 ? 60  GLY A CA   6  
ATOM 9558  C C    . GLY A 1 40  ? -17.655 -4.815  6.416   1.00 1.00 ? 60  GLY A C    6  
ATOM 9559  O O    . GLY A 1 40  ? -16.695 -5.209  5.763   1.00 1.00 ? 60  GLY A O    6  
ATOM 9560  H H    . GLY A 1 40  ? -20.412 -4.228  7.076   1.00 1.00 ? 60  GLY A H    6  
ATOM 9561  H HA2  . GLY A 1 40  ? -18.876 -6.510  5.989   1.00 1.00 ? 60  GLY A HA2  6  
ATOM 9562  H HA3  . GLY A 1 40  ? -19.351 -5.053  5.145   1.00 1.00 ? 60  GLY A HA3  6  
ATOM 9563  N N    . THR A 1 41  ? -17.577 -3.868  7.369   1.00 1.00 ? 61  THR A N    6  
ATOM 9564  C CA   . THR A 1 41  ? -16.341 -3.260  7.958   1.00 1.00 ? 61  THR A CA   6  
ATOM 9565  C C    . THR A 1 41  ? -15.909 -1.937  7.295   1.00 1.00 ? 61  THR A C    6  
ATOM 9566  O O    . THR A 1 41  ? -16.694 -1.390  6.525   1.00 1.00 ? 61  THR A O    6  
ATOM 9567  C CB   . THR A 1 41  ? -15.194 -4.304  8.111   1.00 1.00 ? 61  THR A CB   6  
ATOM 9568  O OG1  . THR A 1 41  ? -14.629 -4.139  9.386   1.00 1.00 ? 61  THR A OG1  6  
ATOM 9569  C CG2  . THR A 1 41  ? -14.063 -4.285  7.067   1.00 1.00 ? 61  THR A CG2  6  
ATOM 9570  H H    . THR A 1 41  ? -18.491 -3.478  7.607   1.00 1.00 ? 61  THR A H    6  
ATOM 9571  H HA   . THR A 1 41  ? -16.643 -2.955  8.965   1.00 1.00 ? 61  THR A HA   6  
ATOM 9572  H HB   . THR A 1 41  ? -15.625 -5.307  8.105   1.00 1.00 ? 61  THR A HB   6  
ATOM 9573  H HG1  . THR A 1 41  ? -15.168 -4.646  10.004  1.00 1.00 ? 61  THR A HG1  6  
ATOM 9574  H HG21 . THR A 1 41  ? -14.462 -4.132  6.066   1.00 1.00 ? 61  THR A HG21 6  
ATOM 9575  H HG22 . THR A 1 41  ? -13.335 -3.502  7.272   1.00 1.00 ? 61  THR A HG22 6  
ATOM 9576  H HG23 . THR A 1 41  ? -13.547 -5.237  7.078   1.00 1.00 ? 61  THR A HG23 6  
ATOM 9577  N N    . LEU A 1 42  ? -14.732 -1.369  7.621   1.00 1.00 ? 62  LEU A N    6  
ATOM 9578  C CA   . LEU A 1 42  ? -14.268 -0.051  7.160   1.00 1.00 ? 62  LEU A CA   6  
ATOM 9579  C C    . LEU A 1 42  ? -13.195 -0.089  6.042   1.00 1.00 ? 62  LEU A C    6  
ATOM 9580  O O    . LEU A 1 42  ? -12.140 -0.704  6.176   1.00 1.00 ? 62  LEU A O    6  
ATOM 9581  C CB   . LEU A 1 42  ? -13.736 0.705   8.400   1.00 1.00 ? 62  LEU A CB   6  
ATOM 9582  C CG   . LEU A 1 42  ? -14.728 1.635   9.131   1.00 1.00 ? 62  LEU A CG   6  
ATOM 9583  C CD1  . LEU A 1 42  ? -15.809 0.843   9.878   1.00 1.00 ? 62  LEU A CD1  6  
ATOM 9584  C CD2  . LEU A 1 42  ? -13.973 2.516   10.139  1.00 1.00 ? 62  LEU A CD2  6  
ATOM 9585  H H    . LEU A 1 42  ? -14.069 -1.846  8.230   1.00 1.00 ? 62  LEU A H    6  
ATOM 9586  H HA   . LEU A 1 42  ? -15.119 0.511   6.775   1.00 1.00 ? 62  LEU A HA   6  
ATOM 9587  H HB2  . LEU A 1 42  ? -13.498 0.005   9.201   1.00 0.00 ? 62  LEU A HB2  6  
ATOM 9588  H HB3  . LEU A 1 42  ? -12.830 1.262   8.148   1.00 1.00 ? 62  LEU A HB3  6  
ATOM 9589  H HG   . LEU A 1 42  ? -15.207 2.289   8.399   1.00 1.00 ? 62  LEU A HG   6  
ATOM 9590  H HD11 . LEU A 1 42  ? -15.346 0.168   10.595  1.00 1.00 ? 62  LEU A HD11 6  
ATOM 9591  H HD12 . LEU A 1 42  ? -16.475 1.525   10.410  1.00 1.00 ? 62  LEU A HD12 6  
ATOM 9592  H HD13 . LEU A 1 42  ? -16.402 0.264   9.173   1.00 1.00 ? 62  LEU A HD13 6  
ATOM 9593  H HD21 . LEU A 1 42  ? -13.461 1.894   10.874  1.00 1.00 ? 62  LEU A HD21 6  
ATOM 9594  H HD22 . LEU A 1 42  ? -13.236 3.128   9.616   1.00 1.00 ? 62  LEU A HD22 6  
ATOM 9595  H HD23 . LEU A 1 42  ? -14.667 3.181   10.653  1.00 1.00 ? 62  LEU A HD23 6  
ATOM 9596  N N    . VAL A 1 43  ? -13.434 0.661   4.960   1.00 1.00 ? 63  VAL A N    6  
ATOM 9597  C CA   . VAL A 1 43  ? -12.498 0.984   3.865   1.00 1.00 ? 63  VAL A CA   6  
ATOM 9598  C C    . VAL A 1 43  ? -11.868 2.317   4.252   1.00 1.00 ? 63  VAL A C    6  
ATOM 9599  O O    . VAL A 1 43  ? -12.578 3.311   4.407   1.00 1.00 ? 63  VAL A O    6  
ATOM 9600  C CB   . VAL A 1 43  ? -13.176 1.063   2.471   1.00 1.00 ? 63  VAL A CB   6  
ATOM 9601  C CG1  . VAL A 1 43  ? -12.378 1.857   1.412   1.00 1.00 ? 63  VAL A CG1  6  
ATOM 9602  C CG2  . VAL A 1 43  ? -13.362 -0.354  1.909   1.00 1.00 ? 63  VAL A CG2  6  
ATOM 9603  H H    . VAL A 1 43  ? -14.342 1.119   4.913   1.00 1.00 ? 63  VAL A H    6  
ATOM 9604  H HA   . VAL A 1 43  ? -11.711 0.240   3.813   1.00 1.00 ? 63  VAL A HA   6  
ATOM 9605  H HB   . VAL A 1 43  ? -14.157 1.533   2.567   1.00 1.00 ? 63  VAL A HB   6  
ATOM 9606  H HG11 . VAL A 1 43  ? -11.383 1.429   1.281   1.00 1.00 ? 63  VAL A HG11 6  
ATOM 9607  H HG12 . VAL A 1 43  ? -12.903 1.843   0.455   1.00 1.00 ? 63  VAL A HG12 6  
ATOM 9608  H HG13 . VAL A 1 43  ? -12.277 2.897   1.716   1.00 1.00 ? 63  VAL A HG13 6  
ATOM 9609  H HG21 . VAL A 1 43  ? -13.798 -1.003  2.664   1.00 1.00 ? 63  VAL A HG21 6  
ATOM 9610  H HG22 . VAL A 1 43  ? -14.029 -0.326  1.047   1.00 1.00 ? 63  VAL A HG22 6  
ATOM 9611  H HG23 . VAL A 1 43  ? -12.398 -0.773  1.616   1.00 1.00 ? 63  VAL A HG23 6  
ATOM 9612  N N    . THR A 1 44  ? -10.546 2.287   4.466   1.00 1.00 ? 64  THR A N    6  
ATOM 9613  C CA   . THR A 1 44  ? -9.695  3.396   4.938   1.00 1.00 ? 64  THR A CA   6  
ATOM 9614  C C    . THR A 1 44  ? -8.473  3.580   4.023   1.00 1.00 ? 64  THR A C    6  
ATOM 9615  O O    . THR A 1 44  ? -7.611  2.703   3.953   1.00 1.00 ? 64  THR A O    6  
ATOM 9616  C CB   . THR A 1 44  ? -9.204  3.133   6.386   1.00 1.00 ? 64  THR A CB   6  
ATOM 9617  O OG1  . THR A 1 44  ? -8.667  1.830   6.493   1.00 1.00 ? 64  THR A OG1  6  
ATOM 9618  C CG2  . THR A 1 44  ? -10.313 3.281   7.430   1.00 1.00 ? 64  THR A CG2  6  
ATOM 9619  H H    . THR A 1 44  ? -10.094 1.377   4.395   1.00 1.00 ? 64  THR A H    6  
ATOM 9620  H HA   . THR A 1 44  ? -10.264 4.325   4.949   1.00 1.00 ? 64  THR A HA   6  
ATOM 9621  H HB   . THR A 1 44  ? -8.419  3.851   6.632   1.00 1.00 ? 64  THR A HB   6  
ATOM 9622  H HG1  . THR A 1 44  ? -8.560  1.564   7.437   1.00 1.00 ? 64  THR A HG1  6  
ATOM 9623  H HG21 . THR A 1 44  ? -11.123 2.581   7.230   1.00 1.00 ? 64  THR A HG21 6  
ATOM 9624  H HG22 . THR A 1 44  ? -9.916  3.092   8.428   1.00 1.00 ? 64  THR A HG22 6  
ATOM 9625  H HG23 . THR A 1 44  ? -10.711 4.298   7.404   1.00 1.00 ? 64  THR A HG23 6  
ATOM 9626  N N    . VAL A 1 45  ? -8.336  4.747   3.357   1.00 1.00 ? 65  VAL A N    6  
ATOM 9627  C CA   . VAL A 1 45  ? -7.101  5.074   2.598   1.00 1.00 ? 65  VAL A CA   6  
ATOM 9628  C C    . VAL A 1 45  ? -6.316  6.196   3.302   1.00 1.00 ? 65  VAL A C    6  
ATOM 9629  O O    . VAL A 1 45  ? -6.716  7.357   3.304   1.00 1.00 ? 65  VAL A O    6  
ATOM 9630  C CB   . VAL A 1 45  ? -7.279  5.251   1.056   1.00 1.00 ? 65  VAL A CB   6  
ATOM 9631  C CG1  . VAL A 1 45  ? -8.002  4.047   0.429   1.00 1.00 ? 65  VAL A CG1  6  
ATOM 9632  C CG2  . VAL A 1 45  ? -7.964  6.500   0.466   1.00 1.00 ? 65  VAL A CG2  6  
ATOM 9633  H H    . VAL A 1 45  ? -9.098  5.411   3.413   1.00 1.00 ? 65  VAL A H    6  
ATOM 9634  H HA   . VAL A 1 45  ? -6.465  4.201   2.648   1.00 1.00 ? 65  VAL A HA   6  
ATOM 9635  H HB   . VAL A 1 45  ? -6.264  5.250   0.650   1.00 1.00 ? 65  VAL A HB   6  
ATOM 9636  H HG11 . VAL A 1 45  ? -7.503  3.124   0.713   1.00 1.00 ? 65  VAL A HG11 6  
ATOM 9637  H HG12 . VAL A 1 45  ? -9.037  3.999   0.764   1.00 1.00 ? 65  VAL A HG12 6  
ATOM 9638  H HG13 . VAL A 1 45  ? -7.999  4.123   -0.660  1.00 1.00 ? 65  VAL A HG13 6  
ATOM 9639  H HG21 . VAL A 1 45  ? -7.726  7.383   1.047   1.00 1.00 ? 65  VAL A HG21 6  
ATOM 9640  H HG22 . VAL A 1 45  ? -7.616  6.656   -0.558  1.00 1.00 ? 65  VAL A HG22 6  
ATOM 9641  H HG23 . VAL A 1 45  ? -9.043  6.354   0.423   1.00 1.00 ? 65  VAL A HG23 6  
ATOM 9642  N N    . MET A 1 46  ? -5.153  5.823   3.861   1.00 1.00 ? 66  MET A N    6  
ATOM 9643  C CA   . MET A 1 46  ? -4.173  6.682   4.554   1.00 1.00 ? 66  MET A CA   6  
ATOM 9644  C C    . MET A 1 46  ? -2.732  6.200   4.273   1.00 1.00 ? 66  MET A C    6  
ATOM 9645  O O    . MET A 1 46  ? -2.301  5.164   4.787   1.00 1.00 ? 66  MET A O    6  
ATOM 9646  C CB   . MET A 1 46  ? -4.420  6.657   6.071   1.00 1.00 ? 66  MET A CB   6  
ATOM 9647  C CG   . MET A 1 46  ? -5.642  7.409   6.594   1.00 1.00 ? 66  MET A CG   6  
ATOM 9648  S SD   . MET A 1 46  ? -5.690  7.379   8.410   1.00 1.00 ? 66  MET A SD   6  
ATOM 9649  C CE   . MET A 1 46  ? -7.054  8.517   8.749   1.00 1.00 ? 66  MET A CE   6  
ATOM 9650  H H    . MET A 1 46  ? -5.029  4.813   3.964   1.00 1.00 ? 66  MET A H    6  
ATOM 9651  H HA   . MET A 1 46  ? -4.282  7.709   4.209   1.00 1.00 ? 66  MET A HA   6  
ATOM 9652  H HB2  . MET A 1 46  ? -4.545  5.615   6.367   1.00 0.00 ? 66  MET A HB2  6  
ATOM 9653  H HB3  . MET A 1 46  ? -3.546  7.041   6.597   1.00 1.00 ? 66  MET A HB3  6  
ATOM 9654  H HG2  . MET A 1 46  ? -5.622  8.450   6.273   1.00 0.00 ? 66  MET A HG2  6  
ATOM 9655  H HG3  . MET A 1 46  ? -6.553  6.955   6.199   1.00 1.00 ? 66  MET A HG3  6  
ATOM 9656  H HE1  . MET A 1 46  ? -6.847  9.487   8.298   1.00 1.00 ? 66  MET A HE1  6  
ATOM 9657  H HE2  . MET A 1 46  ? -7.980  8.108   8.351   1.00 1.00 ? 66  MET A HE2  6  
ATOM 9658  H HE3  . MET A 1 46  ? -7.154  8.637   9.828   1.00 1.00 ? 66  MET A HE3  6  
ATOM 9659  N N    . ALA A 1 47  ? -1.965  6.950   3.455   1.00 1.00 ? 67  ALA A N    6  
ATOM 9660  C CA   . ALA A 1 47  ? -0.604  6.558   3.069   1.00 1.00 ? 67  ALA A CA   6  
ATOM 9661  C C    . ALA A 1 47  ? 0.454   7.360   3.846   1.00 1.00 ? 67  ALA A C    6  
ATOM 9662  O O    . ALA A 1 47  ? 0.729   8.524   3.553   1.00 1.00 ? 67  ALA A O    6  
ATOM 9663  C CB   . ALA A 1 47  ? -0.438  6.700   1.544   1.00 1.00 ? 67  ALA A CB   6  
ATOM 9664  H H    . ALA A 1 47  ? -2.316  7.825   3.098   1.00 1.00 ? 67  ALA A H    6  
ATOM 9665  H HA   . ALA A 1 47  ? -0.461  5.506   3.293   1.00 1.00 ? 67  ALA A HA   6  
ATOM 9666  H HB1  . ALA A 1 47  ? -1.206  6.140   1.014   1.00 1.00 ? 67  ALA A HB1  6  
ATOM 9667  H HB2  . ALA A 1 47  ? -0.505  7.745   1.249   1.00 1.00 ? 67  ALA A HB2  6  
ATOM 9668  H HB3  . ALA A 1 47  ? 0.541   6.323   1.252   1.00 1.00 ? 67  ALA A HB3  6  
ATOM 9669  N N    . GLY A 1 48  ? 1.089   6.680   4.805   1.00 1.00 ? 68  GLY A N    6  
ATOM 9670  C CA   . GLY A 1 48  ? 2.241   7.133   5.590   1.00 1.00 ? 68  GLY A CA   6  
ATOM 9671  C C    . GLY A 1 48  ? 3.196   5.979   5.944   1.00 1.00 ? 68  GLY A C    6  
ATOM 9672  O O    . GLY A 1 48  ? 2.881   4.800   5.779   1.00 1.00 ? 68  GLY A O    6  
ATOM 9673  H H    . GLY A 1 48  ? 0.660   5.807   5.114   1.00 1.00 ? 68  GLY A H    6  
ATOM 9674  H HA2  . GLY A 1 48  ? 2.794   7.879   5.023   1.00 1.00 ? 68  GLY A HA2  6  
ATOM 9675  H HA3  . GLY A 1 48  ? 1.885   7.596   6.508   1.00 1.00 ? 68  GLY A HA3  6  
ATOM 9676  N N    . ASN A 1 49  ? 4.386   6.344   6.430   1.00 1.00 ? 69  ASN A N    6  
ATOM 9677  C CA   . ASN A 1 49  ? 5.533   5.487   6.772   1.00 1.00 ? 69  ASN A CA   6  
ATOM 9678  C C    . ASN A 1 49  ? 6.112   4.584   5.639   1.00 1.00 ? 69  ASN A C    6  
ATOM 9679  O O    . ASN A 1 49  ? 7.322   4.376   5.637   1.00 1.00 ? 69  ASN A O    6  
ATOM 9680  C CB   . ASN A 1 49  ? 5.256   4.778   8.110   1.00 1.00 ? 69  ASN A CB   6  
ATOM 9681  C CG   . ASN A 1 49  ? 6.468   4.668   9.042   1.00 1.00 ? 69  ASN A CG   6  
ATOM 9682  O OD1  . ASN A 1 49  ? 6.424   5.024   10.207  1.00 1.00 ? 69  ASN A OD1  6  
ATOM 9683  N ND2  . ASN A 1 49  ? 7.591   4.190   8.547   1.00 1.00 ? 69  ASN A ND2  6  
ATOM 9684  H H    . ASN A 1 49  ? 4.565   7.335   6.466   1.00 1.00 ? 69  ASN A H    6  
ATOM 9685  H HA   . ASN A 1 49  ? 6.343   6.179   6.977   1.00 1.00 ? 69  ASN A HA   6  
ATOM 9686  H HB2  . ASN A 1 49  ? 4.582   5.367   8.732   1.00 0.00 ? 69  ASN A HB2  6  
ATOM 9687  H HB3  . ASN A 1 49  ? 4.798   3.805   7.950   1.00 1.00 ? 69  ASN A HB3  6  
ATOM 9688  H HD21 . ASN A 1 49  ? 7.637   3.904   7.559   1.00 0.00 ? 69  ASN A HD21 6  
ATOM 9689  H HD22 . ASN A 1 49  ? 8.422   4.103   9.149   1.00 0.00 ? 69  ASN A HD22 6  
ATOM 9690  N N    . ASP A 1 50  ? 5.294   4.078   4.698   1.00 1.00 ? 70  ASP A N    6  
ATOM 9691  C CA   . ASP A 1 50  ? 5.635   3.371   3.433   1.00 1.00 ? 70  ASP A CA   6  
ATOM 9692  C C    . ASP A 1 50  ? 6.391   4.264   2.407   1.00 1.00 ? 70  ASP A C    6  
ATOM 9693  O O    . ASP A 1 50  ? 7.100   3.768   1.532   1.00 1.00 ? 70  ASP A O    6  
ATOM 9694  C CB   . ASP A 1 50  ? 4.308   2.890   2.806   1.00 1.00 ? 70  ASP A CB   6  
ATOM 9695  C CG   . ASP A 1 50  ? 4.395   2.025   1.532   1.00 1.00 ? 70  ASP A CG   6  
ATOM 9696  O OD1  . ASP A 1 50  ? 4.978   0.920   1.608   1.00 1.00 ? 70  ASP A OD1  6  
ATOM 9697  O OD2  . ASP A 1 50  ? 3.796   2.430   0.509   1.00 1.00 ? 70  ASP A OD2  6  
ATOM 9698  H H    . ASP A 1 50  ? 4.307   4.160   4.921   1.00 1.00 ? 70  ASP A H    6  
ATOM 9699  H HA   . ASP A 1 50  ? 6.254   2.506   3.657   1.00 1.00 ? 70  ASP A HA   6  
ATOM 9700  H HB2  . ASP A 1 50  ? 3.791   2.290   3.554   1.00 0.00 ? 70  ASP A HB2  6  
ATOM 9701  H HB3  . ASP A 1 50  ? 3.628   3.732   2.651   1.00 1.00 ? 70  ASP A HB3  6  
ATOM 9702  N N    . GLU A 1 51  ? 6.243   5.589   2.544   1.00 1.00 ? 71  GLU A N    6  
ATOM 9703  C CA   . GLU A 1 51  ? 6.853   6.665   1.756   1.00 1.00 ? 71  GLU A CA   6  
ATOM 9704  C C    . GLU A 1 51  ? 7.686   7.578   2.682   1.00 1.00 ? 71  GLU A C    6  
ATOM 9705  O O    . GLU A 1 51  ? 8.911   7.607   2.579   1.00 1.00 ? 71  GLU A O    6  
ATOM 9706  C CB   . GLU A 1 51  ? 5.719   7.396   1.014   1.00 1.00 ? 71  GLU A CB   6  
ATOM 9707  C CG   . GLU A 1 51  ? 6.151   8.566   0.124   1.00 1.00 ? 71  GLU A CG   6  
ATOM 9708  C CD   . GLU A 1 51  ? 6.407   9.878   0.879   1.00 1.00 ? 71  GLU A CD   6  
ATOM 9709  O OE1  . GLU A 1 51  ? 5.600   10.249  1.759   1.00 1.00 ? 71  GLU A OE1  6  
ATOM 9710  O OE2  . GLU A 1 51  ? 7.467   10.487  0.573   1.00 1.00 ? 71  GLU A OE2  6  
ATOM 9711  H H    . GLU A 1 51  ? 5.646   5.845   3.316   1.00 1.00 ? 71  GLU A H    6  
ATOM 9712  H HA   . GLU A 1 51  ? 7.522   6.233   1.007   1.00 1.00 ? 71  GLU A HA   6  
ATOM 9713  H HB2  . GLU A 1 51  ? 5.217   6.672   0.373   1.00 0.00 ? 71  GLU A HB2  6  
ATOM 9714  H HB3  . GLU A 1 51  ? 4.933   7.711   1.705   1.00 1.00 ? 71  GLU A HB3  6  
ATOM 9715  H HG2  . GLU A 1 51  ? 7.077   8.288   -0.379  1.00 0.00 ? 71  GLU A HG2  6  
ATOM 9716  H HG3  . GLU A 1 51  ? 5.399   8.715   -0.647  1.00 1.00 ? 71  GLU A HG3  6  
ATOM 9717  N N    . ASN A 1 52  ? 7.008   8.302   3.586   1.00 1.00 ? 72  ASN A N    6  
ATOM 9718  C CA   . ASN A 1 52  ? 7.571   9.166   4.615   1.00 1.00 ? 72  ASN A CA   6  
ATOM 9719  C C    . ASN A 1 52  ? 6.709   9.138   5.900   1.00 1.00 ? 72  ASN A C    6  
ATOM 9720  O O    . ASN A 1 52  ? 6.981   8.370   6.816   1.00 1.00 ? 72  ASN A O    6  
ATOM 9721  C CB   . ASN A 1 52  ? 7.714   10.571  3.984   1.00 1.00 ? 72  ASN A CB   6  
ATOM 9722  C CG   . ASN A 1 52  ? 9.128   10.963  3.629   1.00 1.00 ? 72  ASN A CG   6  
ATOM 9723  O OD1  . ASN A 1 52  ? 9.988   11.140  4.475   1.00 1.00 ? 72  ASN A OD1  6  
ATOM 9724  N ND2  . ASN A 1 52  ? 9.374   11.158  2.360   1.00 1.00 ? 72  ASN A ND2  6  
ATOM 9725  H H    . ASN A 1 52  ? 6.013   8.359   3.438   1.00 1.00 ? 72  ASN A H    6  
ATOM 9726  H HA   . ASN A 1 52  ? 8.562   8.792   4.893   1.00 1.00 ? 72  ASN A HA   6  
ATOM 9727  H HB2  . ASN A 1 52  ? 7.212   10.561  3.016   1.00 0.00 ? 72  ASN A HB2  6  
ATOM 9728  H HB3  . ASN A 1 52  ? 7.284   11.379  4.564   1.00 1.00 ? 72  ASN A HB3  6  
ATOM 9729  H HD21 . ASN A 1 52  ? 8.622   11.043  1.666   1.00 0.00 ? 72  ASN A HD21 6  
ATOM 9730  H HD22 . ASN A 1 52  ? 10.320  11.427  2.055   1.00 0.00 ? 72  ASN A HD22 6  
ATOM 9731  N N    . TYR A 1 53  ? 5.660   9.968   5.965   1.00 1.00 ? 73  TYR A N    6  
ATOM 9732  C CA   . TYR A 1 53  ? 4.821   10.234  7.153   1.00 1.00 ? 73  TYR A CA   6  
ATOM 9733  C C    . TYR A 1 53  ? 3.512   11.015  6.869   1.00 1.00 ? 73  TYR A C    6  
ATOM 9734  O O    . TYR A 1 53  ? 2.894   11.491  7.819   1.00 1.00 ? 73  TYR A O    6  
ATOM 9735  C CB   . TYR A 1 53  ? 5.674   11.035  8.168   1.00 1.00 ? 73  TYR A CB   6  
ATOM 9736  C CG   . TYR A 1 53  ? 6.240   12.350  7.652   1.00 1.00 ? 73  TYR A CG   6  
ATOM 9737  C CD1  . TYR A 1 53  ? 5.422   13.506  7.639   1.00 1.00 ? 73  TYR A CD1  6  
ATOM 9738  C CD2  . TYR A 1 53  ? 7.541   12.396  7.096   1.00 1.00 ? 73  TYR A CD2  6  
ATOM 9739  C CE1  . TYR A 1 53  ? 5.888   14.698  7.041   1.00 1.00 ? 73  TYR A CE1  6  
ATOM 9740  C CE2  . TYR A 1 53  ? 8.009   13.582  6.489   1.00 1.00 ? 73  TYR A CE2  6  
ATOM 9741  C CZ   . TYR A 1 53  ? 7.183   14.734  6.458   1.00 1.00 ? 73  TYR A CZ   6  
ATOM 9742  O OH   . TYR A 1 53  ? 7.625   15.870  5.856   1.00 1.00 ? 73  TYR A OH   6  
ATOM 9743  H H    . TYR A 1 53  ? 5.609   10.608  5.184   1.00 1.00 ? 73  TYR A H    6  
ATOM 9744  H HA   . TYR A 1 53  ? 4.539   9.290   7.621   1.00 1.00 ? 73  TYR A HA   6  
ATOM 9745  H HB2  . TYR A 1 53  ? 5.063   11.408  8.990   1.00 0.00 ? 73  TYR A HB2  6  
ATOM 9746  H HB3  . TYR A 1 53  ? 6.465   10.415  8.598   1.00 1.00 ? 73  TYR A HB3  6  
ATOM 9747  H HD1  . TYR A 1 53  ? 4.430   13.469  8.063   1.00 1.00 ? 73  TYR A HD1  6  
ATOM 9748  H HD2  . TYR A 1 53  ? 8.172   11.516  7.107   1.00 1.00 ? 73  TYR A HD2  6  
ATOM 9749  H HE1  . TYR A 1 53  ? 5.245   15.566  7.020   1.00 1.00 ? 73  TYR A HE1  6  
ATOM 9750  H HE2  . TYR A 1 53  ? 8.987   13.622  6.031   1.00 1.00 ? 73  TYR A HE2  6  
ATOM 9751  H HH   . TYR A 1 53  ? 6.989   16.577  5.950   1.00 1.00 ? 73  TYR A HH   6  
ATOM 9752  N N    . SER A 1 54  ? 3.109   11.206  5.598   1.00 1.00 ? 74  SER A N    6  
ATOM 9753  C CA   . SER A 1 54  ? 1.980   12.056  5.165   1.00 1.00 ? 74  SER A CA   6  
ATOM 9754  C C    . SER A 1 54  ? 0.621   11.641  5.757   1.00 1.00 ? 74  SER A C    6  
ATOM 9755  O O    . SER A 1 54  ? 0.118   12.362  6.614   1.00 1.00 ? 74  SER A O    6  
ATOM 9756  C CB   . SER A 1 54  ? 1.925   12.162  3.632   1.00 1.00 ? 74  SER A CB   6  
ATOM 9757  O OG   . SER A 1 54  ? 2.977   12.964  3.145   1.00 1.00 ? 74  SER A OG   6  
ATOM 9758  H H    . SER A 1 54  ? 3.652   10.781  4.862   1.00 1.00 ? 74  SER A H    6  
ATOM 9759  H HA   . SER A 1 54  ? 2.184   13.061  5.540   1.00 1.00 ? 74  SER A HA   6  
ATOM 9760  H HB2  . SER A 1 54  ? 2.002   11.162  3.206   1.00 0.00 ? 74  SER A HB2  6  
ATOM 9761  H HB3  . SER A 1 54  ? 0.974   12.622  3.340   1.00 1.00 ? 74  SER A HB3  6  
ATOM 9762  H HG   . SER A 1 54  ? 3.627   12.394  2.708   1.00 1.00 ? 74  SER A HG   6  
ATOM 9763  N N    . ALA A 1 55  ? 0.020   10.524  5.311   1.00 1.00 ? 75  ALA A N    6  
ATOM 9764  C CA   . ALA A 1 55  ? -1.314  10.052  5.714   1.00 1.00 ? 75  ALA A CA   6  
ATOM 9765  C C    . ALA A 1 55  ? -2.428  11.143  5.707   1.00 1.00 ? 75  ALA A C    6  
ATOM 9766  O O    . ALA A 1 55  ? -2.358  12.124  4.960   1.00 1.00 ? 75  ALA A O    6  
ATOM 9767  C CB   . ALA A 1 55  ? -1.149  9.242   7.020   1.00 1.00 ? 75  ALA A CB   6  
ATOM 9768  H H    . ALA A 1 55  ? 0.473   9.913   4.630   1.00 1.00 ? 75  ALA A H    6  
ATOM 9769  H HA   . ALA A 1 55  ? -1.629  9.339   4.951   1.00 1.00 ? 75  ALA A HA   6  
ATOM 9770  H HB1  . ALA A 1 55  ? -0.362  8.496   6.897   1.00 1.00 ? 75  ALA A HB1  6  
ATOM 9771  H HB2  . ALA A 1 55  ? -0.883  9.912   7.838   1.00 1.00 ? 75  ALA A HB2  6  
ATOM 9772  H HB3  . ALA A 1 55  ? -2.066  8.714   7.274   1.00 1.00 ? 75  ALA A HB3  6  
ATOM 9773  N N    . GLU A 1 56  ? -3.490  10.913  6.494   1.00 1.00 ? 76  GLU A N    6  
ATOM 9774  C CA   . GLU A 1 56  ? -4.755  11.662  6.601   1.00 1.00 ? 76  GLU A CA   6  
ATOM 9775  C C    . GLU A 1 56  ? -5.641  11.641  5.337   1.00 1.00 ? 76  GLU A C    6  
ATOM 9776  O O    . GLU A 1 56  ? -5.135  11.603  4.209   1.00 1.00 ? 76  GLU A O    6  
ATOM 9777  C CB   . GLU A 1 56  ? -4.497  13.101  7.092   1.00 1.00 ? 76  GLU A CB   6  
ATOM 9778  C CG   . GLU A 1 56  ? -5.754  13.824  7.590   1.00 1.00 ? 76  GLU A CG   6  
ATOM 9779  C CD   . GLU A 1 56  ? -6.424  13.044  8.719   1.00 1.00 ? 76  GLU A CD   6  
ATOM 9780  O OE1  . GLU A 1 56  ? -7.210  12.115  8.406   1.00 1.00 ? 76  GLU A OE1  6  
ATOM 9781  O OE2  . GLU A 1 56  ? -6.033  13.335  9.866   1.00 1.00 ? 76  GLU A OE2  6  
ATOM 9782  H H    . GLU A 1 56  ? -3.406  10.111  7.098   1.00 1.00 ? 76  GLU A H    6  
ATOM 9783  H HA   . GLU A 1 56  ? -5.312  11.135  7.380   1.00 1.00 ? 76  GLU A HA   6  
ATOM 9784  H HB2  . GLU A 1 56  ? -3.788  13.061  7.918   1.00 0.00 ? 76  GLU A HB2  6  
ATOM 9785  H HB3  . GLU A 1 56  ? -4.030  13.695  6.307   1.00 1.00 ? 76  GLU A HB3  6  
ATOM 9786  H HG2  . GLU A 1 56  ? -5.510  14.817  7.966   1.00 0.00 ? 76  GLU A HG2  6  
ATOM 9787  H HG3  . GLU A 1 56  ? -6.445  14.026  6.770   1.00 1.00 ? 76  GLU A HG3  6  
ATOM 9788  N N    . LEU A 1 57  ? -6.974  11.697  5.527   1.00 1.00 ? 77  LEU A N    6  
ATOM 9789  C CA   . LEU A 1 57  ? -7.951  11.538  4.464   1.00 1.00 ? 77  LEU A CA   6  
ATOM 9790  C C    . LEU A 1 57  ? -9.100  12.572  4.449   1.00 1.00 ? 77  LEU A C    6  
ATOM 9791  O O    . LEU A 1 57  ? -9.358  13.273  5.424   1.00 1.00 ? 77  LEU A O    6  
ATOM 9792  C CB   . LEU A 1 57  ? -8.386  10.069  4.563   1.00 1.00 ? 77  LEU A CB   6  
ATOM 9793  C CG   . LEU A 1 57  ? -9.604  9.587   5.369   1.00 1.00 ? 77  LEU A CG   6  
ATOM 9794  C CD1  . LEU A 1 57  ? -9.501  8.073   5.592   1.00 1.00 ? 77  LEU A CD1  6  
ATOM 9795  C CD2  . LEU A 1 57  ? -9.845  10.249  6.724   1.00 1.00 ? 77  LEU A CD2  6  
ATOM 9796  H H    . LEU A 1 57  ? -7.380  11.689  6.459   1.00 1.00 ? 77  LEU A H    6  
ATOM 9797  H HA   . LEU A 1 57  ? -7.433  11.663  3.515   1.00 1.00 ? 77  LEU A HA   6  
ATOM 9798  H HB2  . LEU A 1 57  ? -8.957  9.760   3.688   1.00 0.00 ? 77  LEU A HB2  6  
ATOM 9799  H HB3  . LEU A 1 57  ? -7.525  9.399   4.642   1.00 1.00 ? 77  LEU A HB3  6  
ATOM 9800  H HG   . LEU A 1 57  ? -10.484 9.788   4.763   1.00 1.00 ? 77  LEU A HG   6  
ATOM 9801  H HD11 . LEU A 1 57  ? -9.297  7.523   4.679   1.00 1.00 ? 77  LEU A HD11 6  
ATOM 9802  H HD12 . LEU A 1 57  ? -8.690  7.858   6.285   1.00 1.00 ? 77  LEU A HD12 6  
ATOM 9803  H HD13 . LEU A 1 57  ? -10.427 7.709   6.023   1.00 1.00 ? 77  LEU A HD13 6  
ATOM 9804  H HD21 . LEU A 1 57  ? -8.932  10.238  7.319   1.00 1.00 ? 77  LEU A HD21 6  
ATOM 9805  H HD22 . LEU A 1 57  ? -10.177 11.276  6.612   1.00 1.00 ? 77  LEU A HD22 6  
ATOM 9806  H HD23 . LEU A 1 57  ? -10.622 9.715   7.273   1.00 1.00 ? 77  LEU A HD23 6  
ATOM 9807  N N    . ARG A 1 58  ? -9.830  12.630  3.322   1.00 1.00 ? 78  ARG A N    6  
ATOM 9808  C CA   . ARG A 1 58  ? -11.067 13.421  3.154   1.00 1.00 ? 78  ARG A CA   6  
ATOM 9809  C C    . ARG A 1 58  ? -12.218 12.495  2.746   1.00 1.00 ? 78  ARG A C    6  
ATOM 9810  O O    . ARG A 1 58  ? -12.533 12.351  1.568   1.00 1.00 ? 78  ARG A O    6  
ATOM 9811  C CB   . ARG A 1 58  ? -10.792 14.572  2.171   1.00 1.00 ? 78  ARG A CB   6  
ATOM 9812  C CG   . ARG A 1 58  ? -10.177 15.817  2.828   1.00 1.00 ? 78  ARG A CG   6  
ATOM 9813  C CD   . ARG A 1 58  ? -11.185 16.924  3.107   1.00 1.00 ? 78  ARG A CD   6  
ATOM 9814  N NE   . ARG A 1 58  ? -11.795 16.770  4.435   1.00 1.00 ? 78  ARG A NE   6  
ATOM 9815  C CZ   . ARG A 1 58  ? -12.963 17.246  4.837   1.00 1.00 ? 78  ARG A CZ   6  
ATOM 9816  N NH1  . ARG A 1 58  ? -13.816 17.863  4.057   1.00 1.00 ? 78  ARG A NH1  6  
ATOM 9817  N NH2  . ARG A 1 58  ? -13.318 17.123  6.082   1.00 1.00 ? 78  ARG A NH2  6  
ATOM 9818  H H    . ARG A 1 58  ? -9.481  12.049  2.556   1.00 1.00 ? 78  ARG A H    6  
ATOM 9819  H HA   . ARG A 1 58  ? -11.359 13.862  4.110   1.00 1.00 ? 78  ARG A HA   6  
ATOM 9820  H HB2  . ARG A 1 58  ? -10.013 14.311  1.456   1.00 0.00 ? 78  ARG A HB2  6  
ATOM 9821  H HB3  . ARG A 1 58  ? -11.683 14.833  1.598   1.00 1.00 ? 78  ARG A HB3  6  
ATOM 9822  H HG2  . ARG A 1 58  ? -9.734  15.531  3.782   1.00 0.00 ? 78  ARG A HG2  6  
ATOM 9823  H HG3  . ARG A 1 58  ? -9.414  16.220  2.172   1.00 1.00 ? 78  ARG A HG3  6  
ATOM 9824  H HD2  . ARG A 1 58  ? -10.692 17.893  3.176   1.00 0.00 ? 78  ARG A HD2  6  
ATOM 9825  H HD3  . ARG A 1 58  ? -11.934 16.983  2.312   1.00 1.00 ? 78  ARG A HD3  6  
ATOM 9826  H HE   . ARG A 1 58  ? -11.210 16.348  5.140   1.00 1.00 ? 78  ARG A HE   6  
ATOM 9827  H HH11 . ARG A 1 58  ? -13.594 18.004  3.061   1.00 0.00 ? 78  ARG A HH11 6  
ATOM 9828  H HH12 . ARG A 1 58  ? -14.708 18.207  4.440   1.00 0.00 ? 78  ARG A HH12 6  
ATOM 9829  H HH21 . ARG A 1 58  ? -12.691 16.656  6.752   1.00 0.00 ? 78  ARG A HH21 6  
ATOM 9830  H HH22 . ARG A 1 58  ? -14.225 17.492  6.398   1.00 0.00 ? 78  ARG A HH22 6  
ATOM 9831  N N    . ASN A 1 59  ? -12.861 11.853  3.729   1.00 1.00 ? 79  ASN A N    6  
ATOM 9832  C CA   . ASN A 1 59  ? -13.925 10.874  3.504   1.00 1.00 ? 79  ASN A CA   6  
ATOM 9833  C C    . ASN A 1 59  ? -13.410 9.545   2.905   1.00 1.00 ? 79  ASN A C    6  
ATOM 9834  O O    . ASN A 1 59  ? -14.223 8.689   2.585   1.00 1.00 ? 79  ASN A O    6  
ATOM 9835  C CB   . ASN A 1 59  ? -15.116 11.548  2.764   1.00 1.00 ? 79  ASN A CB   6  
ATOM 9836  C CG   . ASN A 1 59  ? -16.173 12.156  3.687   1.00 1.00 ? 79  ASN A CG   6  
ATOM 9837  O OD1  . ASN A 1 59  ? -15.902 12.625  4.786   1.00 1.00 ? 79  ASN A OD1  6  
ATOM 9838  N ND2  . ASN A 1 59  ? -17.417 12.188  3.262   1.00 1.00 ? 79  ASN A ND2  6  
ATOM 9839  H H    . ASN A 1 59  ? -12.501 11.886  4.670   1.00 1.00 ? 79  ASN A H    6  
ATOM 9840  H HA   . ASN A 1 59  ? -14.282 10.568  4.488   1.00 1.00 ? 79  ASN A HA   6  
ATOM 9841  H HB2  . ASN A 1 59  ? -14.779 12.410  2.188   1.00 0.00 ? 79  ASN A HB2  6  
ATOM 9842  H HB3  . ASN A 1 59  ? -15.594 10.849  2.076   1.00 1.00 ? 79  ASN A HB3  6  
ATOM 9843  H HD21 . ASN A 1 59  ? -17.653 11.810  2.334   1.00 0.00 ? 79  ASN A HD21 6  
ATOM 9844  H HD22 . ASN A 1 59  ? -18.154 12.591  3.857   1.00 0.00 ? 79  ASN A HD22 6  
ATOM 9845  N N    . ALA A 1 60  ? -12.076 9.293   2.841   1.00 1.00 ? 80  ALA A N    6  
ATOM 9846  C CA   . ALA A 1 60  ? -11.547 7.954   2.492   1.00 1.00 ? 80  ALA A CA   6  
ATOM 9847  C C    . ALA A 1 60  ? -11.879 6.870   3.543   1.00 1.00 ? 80  ALA A C    6  
ATOM 9848  O O    . ALA A 1 60  ? -11.430 5.738   3.392   1.00 1.00 ? 80  ALA A O    6  
ATOM 9849  C CB   . ALA A 1 60  ? -10.050 8.013   2.214   1.00 1.00 ? 80  ALA A CB   6  
ATOM 9850  H H    . ALA A 1 60  ? -11.408 9.955   3.243   1.00 1.00 ? 80  ALA A H    6  
ATOM 9851  H HA   . ALA A 1 60  ? -12.026 7.610   1.578   1.00 1.00 ? 80  ALA A HA   6  
ATOM 9852  H HB1  . ALA A 1 60  ? -9.564  8.763   2.812   1.00 1.00 ? 80  ALA A HB1  6  
ATOM 9853  H HB2  . ALA A 1 60  ? -9.584  7.060   2.447   1.00 1.00 ? 80  ALA A HB2  6  
ATOM 9854  H HB3  . ALA A 1 60  ? -9.870  8.214   1.168   1.00 1.00 ? 80  ALA A HB3  6  
ATOM 9855  N N    . THR A 1 61  ? -12.634 7.246   4.591   1.00 1.00 ? 81  THR A N    6  
ATOM 9856  C CA   . THR A 1 61  ? -13.215 6.301   5.579   1.00 1.00 ? 81  THR A CA   6  
ATOM 9857  C C    . THR A 1 61  ? -14.696 6.046   5.245   1.00 1.00 ? 81  THR A C    6  
ATOM 9858  O O    . THR A 1 61  ? -15.541 6.932   5.368   1.00 1.00 ? 81  THR A O    6  
ATOM 9859  C CB   . THR A 1 61  ? -12.979 6.669   7.060   1.00 1.00 ? 81  THR A CB   6  
ATOM 9860  O OG1  . THR A 1 61  ? -13.227 5.518   7.833   1.00 1.00 ? 81  THR A OG1  6  
ATOM 9861  C CG2  . THR A 1 61  ? -13.812 7.788   7.691   1.00 1.00 ? 81  THR A CG2  6  
ATOM 9862  H H    . THR A 1 61  ? -12.849 8.241   4.475   1.00 1.00 ? 81  THR A H    6  
ATOM 9863  H HA   . THR A 1 61  ? -12.679 5.370   5.462   1.00 1.00 ? 81  THR A HA   6  
ATOM 9864  H HB   . THR A 1 61  ? -11.930 6.918   7.197   1.00 1.00 ? 81  THR A HB   6  
ATOM 9865  H HG1  . THR A 1 61  ? -14.163 5.496   8.045   1.00 1.00 ? 81  THR A HG1  6  
ATOM 9866  H HG21 . THR A 1 61  ? -13.774 8.691   7.087   1.00 1.00 ? 81  THR A HG21 6  
ATOM 9867  H HG22 . THR A 1 61  ? -14.852 7.482   7.801   1.00 1.00 ? 81  THR A HG22 6  
ATOM 9868  H HG23 . THR A 1 61  ? -13.414 8.015   8.681   1.00 1.00 ? 81  THR A HG23 6  
ATOM 9869  N N    . ALA A 1 62  ? -15.004 4.808   4.834   1.00 1.00 ? 82  ALA A N    6  
ATOM 9870  C CA   . ALA A 1 62  ? -16.311 4.349   4.369   1.00 1.00 ? 82  ALA A CA   6  
ATOM 9871  C C    . ALA A 1 62  ? -16.573 2.925   4.884   1.00 1.00 ? 82  ALA A C    6  
ATOM 9872  O O    . ALA A 1 62  ? -15.800 2.011   4.616   1.00 1.00 ? 82  ALA A O    6  
ATOM 9873  C CB   . ALA A 1 62  ? -16.362 4.450   2.834   1.00 1.00 ? 82  ALA A CB   6  
ATOM 9874  H H    . ALA A 1 62  ? -14.247 4.136   4.754   1.00 1.00 ? 82  ALA A H    6  
ATOM 9875  H HA   . ALA A 1 62  ? -17.079 5.011   4.771   1.00 1.00 ? 82  ALA A HA   6  
ATOM 9876  H HB1  . ALA A 1 62  ? -16.125 5.469   2.521   1.00 1.00 ? 82  ALA A HB1  6  
ATOM 9877  H HB2  . ALA A 1 62  ? -15.647 3.759   2.385   1.00 1.00 ? 82  ALA A HB2  6  
ATOM 9878  H HB3  . ALA A 1 62  ? -17.364 4.196   2.485   1.00 1.00 ? 82  ALA A HB3  6  
ATOM 9879  N N    . ALA A 1 63  ? -17.671 2.745   5.619   1.00 1.00 ? 83  ALA A N    6  
ATOM 9880  C CA   . ALA A 1 63  ? -18.096 1.447   6.166   1.00 1.00 ? 83  ALA A CA   6  
ATOM 9881  C C    . ALA A 1 63  ? -19.078 0.699   5.227   1.00 1.00 ? 83  ALA A C    6  
ATOM 9882  O O    . ALA A 1 63  ? -19.829 1.320   4.467   1.00 1.00 ? 83  ALA A O    6  
ATOM 9883  C CB   . ALA A 1 63  ? -18.661 1.657   7.583   1.00 1.00 ? 83  ALA A CB   6  
ATOM 9884  H H    . ALA A 1 63  ? -18.226 3.565   5.788   1.00 1.00 ? 83  ALA A H    6  
ATOM 9885  H HA   . ALA A 1 63  ? -17.208 0.829   6.272   1.00 1.00 ? 83  ALA A HA   6  
ATOM 9886  H HB1  . ALA A 1 63  ? -17.937 2.191   8.200   1.00 1.00 ? 83  ALA A HB1  6  
ATOM 9887  H HB2  . ALA A 1 63  ? -19.590 2.224   7.550   1.00 1.00 ? 83  ALA A HB2  6  
ATOM 9888  H HB3  . ALA A 1 63  ? -18.855 0.691   8.052   1.00 1.00 ? 83  ALA A HB3  6  
ATOM 9889  N N    . MET A 1 64  ? -19.111 -0.641  5.309   1.00 1.00 ? 84  MET A N    6  
ATOM 9890  C CA   . MET A 1 64  ? -19.926 -1.544  4.487   1.00 1.00 ? 84  MET A CA   6  
ATOM 9891  C C    . MET A 1 64  ? -20.756 -2.468  5.385   1.00 1.00 ? 84  MET A C    6  
ATOM 9892  O O    . MET A 1 64  ? -20.488 -2.592  6.588   1.00 1.00 ? 84  MET A O    6  
ATOM 9893  C CB   . MET A 1 64  ? -19.032 -2.381  3.550   1.00 1.00 ? 84  MET A CB   6  
ATOM 9894  C CG   . MET A 1 64  ? -18.206 -1.600  2.527   1.00 1.00 ? 84  MET A CG   6  
ATOM 9895  S SD   . MET A 1 64  ? -16.611 -0.966  3.113   1.00 1.00 ? 84  MET A SD   6  
ATOM 9896  C CE   . MET A 1 64  ? -15.823 -2.518  3.627   1.00 1.00 ? 84  MET A CE   6  
ATOM 9897  H H    . MET A 1 64  ? -18.546 -1.132  6.006   1.00 1.00 ? 84  MET A H    6  
ATOM 9898  H HA   . MET A 1 64  ? -20.616 -0.958  3.881   1.00 1.00 ? 84  MET A HA   6  
ATOM 9899  H HB2  . MET A 1 64  ? -18.328 -2.936  4.170   1.00 0.00 ? 84  MET A HB2  6  
ATOM 9900  H HB3  . MET A 1 64  ? -19.637 -3.101  3.002   1.00 1.00 ? 84  MET A HB3  6  
ATOM 9901  H HG2  . MET A 1 64  ? -17.997 -2.264  1.688   1.00 0.00 ? 84  MET A HG2  6  
ATOM 9902  H HG3  . MET A 1 64  ? -18.800 -0.787  2.105   1.00 1.00 ? 84  MET A HG3  6  
ATOM 9903  H HE1  . MET A 1 64  ? -16.478 -3.057  4.308   1.00 1.00 ? 84  MET A HE1  6  
ATOM 9904  H HE2  . MET A 1 64  ? -15.616 -3.133  2.752   1.00 1.00 ? 84  MET A HE2  6  
ATOM 9905  H HE3  . MET A 1 64  ? -14.890 -2.296  4.147   1.00 1.00 ? 84  MET A HE3  6  
ATOM 9906  N N    . LYS A 1 65  ? -21.730 -3.159  4.764   1.00 1.00 ? 85  LYS A N    6  
ATOM 9907  C CA   . LYS A 1 65  ? -22.698 -4.063  5.420   1.00 1.00 ? 85  LYS A CA   6  
ATOM 9908  C C    . LYS A 1 65  ? -22.688 -5.436  4.744   1.00 1.00 ? 85  LYS A C    6  
ATOM 9909  O O    . LYS A 1 65  ? -21.944 -6.300  5.177   1.00 1.00 ? 85  LYS A O    6  
ATOM 9910  C CB   . LYS A 1 65  ? -24.082 -3.408  5.602   1.00 1.00 ? 85  LYS A CB   6  
ATOM 9911  C CG   . LYS A 1 65  ? -24.818 -2.975  4.323   1.00 1.00 ? 85  LYS A CG   6  
ATOM 9912  C CD   . LYS A 1 65  ? -25.542 -1.629  4.437   1.00 1.00 ? 85  LYS A CD   6  
ATOM 9913  C CE   . LYS A 1 65  ? -24.590 -0.428  4.413   1.00 1.00 ? 85  LYS A CE   6  
ATOM 9914  N NZ   . LYS A 1 65  ? -24.237 -0.021  3.034   1.00 1.00 ? 85  LYS A NZ   6  
ATOM 9915  H H    . LYS A 1 65  ? -21.701 -3.130  3.748   1.00 1.00 ? 85  LYS A H    6  
ATOM 9916  H HA   . LYS A 1 65  ? -22.357 -4.251  6.437   1.00 1.00 ? 85  LYS A HA   6  
ATOM 9917  H HB2  . LYS A 1 65  ? -24.786 -4.150  5.977   1.00 0.00 ? 85  LYS A HB2  6  
ATOM 9918  H HB3  . LYS A 1 65  ? -24.003 -2.584  6.316   1.00 1.00 ? 85  LYS A HB3  6  
ATOM 9919  H HG2  . LYS A 1 65  ? -24.085 -2.844  3.525   1.00 0.00 ? 85  LYS A HG2  6  
ATOM 9920  H HG3  . LYS A 1 65  ? -25.534 -3.747  4.053   1.00 1.00 ? 85  LYS A HG3  6  
ATOM 9921  H HD2  . LYS A 1 65  ? -26.193 -1.486  3.574   1.00 0.00 ? 85  LYS A HD2  6  
ATOM 9922  H HD3  . LYS A 1 65  ? -26.144 -1.608  5.346   1.00 1.00 ? 85  LYS A HD3  6  
ATOM 9923  H HE2  . LYS A 1 65  ? -25.085 0.459   4.810   1.00 0.00 ? 85  LYS A HE2  6  
ATOM 9924  H HE3  . LYS A 1 65  ? -23.703 -0.630  5.019   1.00 1.00 ? 85  LYS A HE3  6  
ATOM 9925  H HZ1  . LYS A 1 65  ? -25.082 -0.036  2.445   1.00 0.00 ? 85  LYS A HZ1  6  
ATOM 9926  H HZ2  . LYS A 1 65  ? -23.845 0.931   3.046   1.00 0.00 ? 85  LYS A HZ2  6  
ATOM 9927  N N    . ASN A 1 66  ? -23.366 -5.597  3.603   1.00 1.00 ? 86  ASN A N    6  
ATOM 9928  C CA   . ASN A 1 66  ? -23.359 -6.808  2.780   1.00 1.00 ? 86  ASN A CA   6  
ATOM 9929  C C    . ASN A 1 66  ? -22.102 -6.890  1.874   1.00 1.00 ? 86  ASN A C    6  
ATOM 9930  O O    . ASN A 1 66  ? -22.182 -7.123  0.670   1.00 1.00 ? 86  ASN A O    6  
ATOM 9931  C CB   . ASN A 1 66  ? -24.722 -6.921  2.060   1.00 1.00 ? 86  ASN A CB   6  
ATOM 9932  C CG   . ASN A 1 66  ? -25.190 -8.373  1.895   1.00 1.00 ? 86  ASN A CG   6  
ATOM 9933  O OD1  . ASN A 1 66  ? -24.588 -9.323  2.358   1.00 1.00 ? 86  ASN A OD1  6  
ATOM 9934  N ND2  . ASN A 1 66  ? -26.323 -8.620  1.288   1.00 1.00 ? 86  ASN A ND2  6  
ATOM 9935  H H    . ASN A 1 66  ? -23.778 -4.780  3.209   1.00 1.00 ? 86  ASN A H    6  
ATOM 9936  H HA   . ASN A 1 66  ? -23.281 -7.657  3.463   1.00 1.00 ? 86  ASN A HA   6  
ATOM 9937  H HB2  . ASN A 1 66  ? -25.528 -6.499  2.659   1.00 0.00 ? 86  ASN A HB2  6  
ATOM 9938  H HB3  . ASN A 1 66  ? -24.717 -6.392  1.104   1.00 1.00 ? 86  ASN A HB3  6  
ATOM 9939  H HD21 . ASN A 1 66  ? -26.893 -7.843  0.924   1.00 0.00 ? 86  ASN A HD21 6  
ATOM 9940  H HD22 . ASN A 1 66  ? -26.645 -9.592  1.174   1.00 0.00 ? 86  ASN A HD22 6  
ATOM 9941  N N    . GLN A 1 67  ? -20.938 -6.605  2.486   1.00 1.00 ? 87  GLN A N    6  
ATOM 9942  C CA   . GLN A 1 67  ? -19.571 -6.691  1.945   1.00 1.00 ? 87  GLN A CA   6  
ATOM 9943  C C    . GLN A 1 67  ? -19.297 -5.774  0.718   1.00 1.00 ? 87  GLN A C    6  
ATOM 9944  O O    . GLN A 1 67  ? -18.351 -6.043  -0.024  1.00 1.00 ? 87  GLN A O    6  
ATOM 9945  C CB   . GLN A 1 67  ? -19.262 -8.191  1.688   1.00 1.00 ? 87  GLN A CB   6  
ATOM 9946  C CG   . GLN A 1 67  ? -18.999 -9.071  2.927   1.00 1.00 ? 87  GLN A CG   6  
ATOM 9947  C CD   . GLN A 1 67  ? -20.229 -9.285  3.804   1.00 1.00 ? 87  GLN A CD   6  
ATOM 9948  O OE1  . GLN A 1 67  ? -21.257 -9.758  3.358   1.00 1.00 ? 87  GLN A OE1  6  
ATOM 9949  N NE2  . GLN A 1 67  ? -20.213 -8.918  5.068   1.00 1.00 ? 87  GLN A NE2  6  
ATOM 9950  H H    . GLN A 1 67  ? -21.081 -6.404  3.469   1.00 1.00 ? 87  GLN A H    6  
ATOM 9951  H HA   . GLN A 1 67  ? -18.876 -6.356  2.713   1.00 1.00 ? 87  GLN A HA   6  
ATOM 9952  H HB2  . GLN A 1 67  ? -20.121 -8.695  1.245   1.00 0.00 ? 87  GLN A HB2  6  
ATOM 9953  H HB3  . GLN A 1 67  ? -18.420 -8.302  1.008   1.00 1.00 ? 87  GLN A HB3  6  
ATOM 9954  H HG2  . GLN A 1 67  ? -18.788 -10.103 2.647   1.00 0.00 ? 87  GLN A HG2  6  
ATOM 9955  H HG3  . GLN A 1 67  ? -18.147 -8.710  3.500   1.00 1.00 ? 87  GLN A HG3  6  
ATOM 9956  H HE21 . GLN A 1 67  ? -19.368 -8.486  5.468   1.00 0.00 ? 87  GLN A HE21 6  
ATOM 9957  H HE22 . GLN A 1 67  ? -21.046 -9.064  5.657   1.00 0.00 ? 87  GLN A HE22 6  
ATOM 9958  N N    . VAL A 1 68  ? -20.073 -4.687  0.499   1.00 1.00 ? 88  VAL A N    6  
ATOM 9959  C CA   . VAL A 1 68  ? -20.015 -3.851  -0.737  1.00 1.00 ? 88  VAL A CA   6  
ATOM 9960  C C    . VAL A 1 68  ? -19.914 -2.323  -0.498  1.00 1.00 ? 88  VAL A C    6  
ATOM 9961  O O    . VAL A 1 68  ? -20.717 -1.747  0.238   1.00 1.00 ? 88  VAL A O    6  
ATOM 9962  C CB   . VAL A 1 68  ? -21.209 -4.201  -1.677  1.00 1.00 ? 88  VAL A CB   6  
ATOM 9963  C CG1  . VAL A 1 68  ? -21.370 -3.254  -2.886  1.00 1.00 ? 88  VAL A CG1  6  
ATOM 9964  C CG2  . VAL A 1 68  ? -21.101 -5.634  -2.246  1.00 1.00 ? 88  VAL A CG2  6  
ATOM 9965  H H    . VAL A 1 68  ? -20.784 -4.479  1.196   1.00 1.00 ? 88  VAL A H    6  
ATOM 9966  H HA   . VAL A 1 68  ? -19.112 -4.135  -1.280  1.00 1.00 ? 88  VAL A HA   6  
ATOM 9967  H HB   . VAL A 1 68  ? -22.128 -4.138  -1.092  1.00 1.00 ? 88  VAL A HB   6  
ATOM 9968  H HG11 . VAL A 1 68  ? -20.469 -3.263  -3.500  1.00 1.00 ? 88  VAL A HG11 6  
ATOM 9969  H HG12 . VAL A 1 68  ? -22.220 -3.569  -3.491  1.00 1.00 ? 88  VAL A HG12 6  
ATOM 9970  H HG13 . VAL A 1 68  ? -21.567 -2.238  -2.550  1.00 1.00 ? 88  VAL A HG13 6  
ATOM 9971  H HG21 . VAL A 1 68  ? -21.002 -6.361  -1.443  1.00 1.00 ? 88  VAL A HG21 6  
ATOM 9972  H HG22 . VAL A 1 68  ? -21.997 -5.886  -2.811  1.00 1.00 ? 88  VAL A HG22 6  
ATOM 9973  H HG23 . VAL A 1 68  ? -20.230 -5.726  -2.898  1.00 1.00 ? 88  VAL A HG23 6  
ATOM 9974  N N    . ALA A 1 69  ? -18.984 -1.684  -1.229  1.00 1.00 ? 89  ALA A N    6  
ATOM 9975  C CA   . ALA A 1 69  ? -18.720 -0.242  -1.390  1.00 1.00 ? 89  ALA A CA   6  
ATOM 9976  C C    . ALA A 1 69  ? -18.694 0.166   -2.891  1.00 1.00 ? 89  ALA A C    6  
ATOM 9977  O O    . ALA A 1 69  ? -17.995 -0.444  -3.707  1.00 1.00 ? 89  ALA A O    6  
ATOM 9978  C CB   . ALA A 1 69  ? -17.387 0.120   -0.713  1.00 1.00 ? 89  ALA A CB   6  
ATOM 9979  H H    . ALA A 1 69  ? -18.329 -2.290  -1.721  1.00 1.00 ? 89  ALA A H    6  
ATOM 9980  H HA   . ALA A 1 69  ? -19.509 0.324   -0.893  1.00 1.00 ? 89  ALA A HA   6  
ATOM 9981  H HB1  . ALA A 1 69  ? -17.391 -0.193  0.327   1.00 1.00 ? 89  ALA A HB1  6  
ATOM 9982  H HB2  . ALA A 1 69  ? -16.568 -0.370  -1.235  1.00 1.00 ? 89  ALA A HB2  6  
ATOM 9983  H HB3  . ALA A 1 69  ? -17.223 1.198   -0.750  1.00 1.00 ? 89  ALA A HB3  6  
ATOM 9984  N N    . ARG A 1 70  ? -19.452 1.224   -3.221  1.00 1.00 ? 90  ARG A N    6  
ATOM 9985  C CA   . ARG A 1 70  ? -19.638 1.953   -4.501  1.00 1.00 ? 90  ARG A CA   6  
ATOM 9986  C C    . ARG A 1 70  ? -19.623 3.479   -4.257  1.00 1.00 ? 90  ARG A C    6  
ATOM 9987  O O    . ARG A 1 70  ? -19.946 3.874   -3.138  1.00 1.00 ? 90  ARG A O    6  
ATOM 9988  C CB   . ARG A 1 70  ? -21.005 1.552   -5.112  1.00 1.00 ? 90  ARG A CB   6  
ATOM 9989  C CG   . ARG A 1 70  ? -22.254 1.944   -4.286  1.00 1.00 ? 90  ARG A CG   6  
ATOM 9990  C CD   . ARG A 1 70  ? -22.867 3.303   -4.641  1.00 1.00 ? 90  ARG A CD   6  
ATOM 9991  N NE   . ARG A 1 70  ? -23.895 3.194   -5.689  1.00 1.00 ? 90  ARG A NE   6  
ATOM 9992  C CZ   . ARG A 1 70  ? -24.880 4.036   -5.948  1.00 1.00 ? 90  ARG A CZ   6  
ATOM 9993  N NH1  . ARG A 1 70  ? -25.079 5.153   -5.309  1.00 1.00 ? 90  ARG A NH1  6  
ATOM 9994  N NH2  . ARG A 1 70  ? -25.732 3.758   -6.888  1.00 1.00 ? 90  ARG A NH2  6  
ATOM 9995  H H    . ARG A 1 70  ? -19.904 1.692   -2.450  1.00 1.00 ? 90  ARG A H    6  
ATOM 9996  H HA   . ARG A 1 70  ? -18.833 1.701   -5.195  1.00 1.00 ? 90  ARG A HA   6  
ATOM 9997  H HB2  . ARG A 1 70  ? -21.178 2.098   -6.039  1.00 0.00 ? 90  ARG A HB2  6  
ATOM 9998  H HB3  . ARG A 1 70  ? -21.023 0.483   -5.328  1.00 1.00 ? 90  ARG A HB3  6  
ATOM 9999  H HG2  . ARG A 1 70  ? -23.079 1.256   -4.471  1.00 0.00 ? 90  ARG A HG2  6  
ATOM 10000 H HG3  . ARG A 1 70  ? -22.039 1.926   -3.214  1.00 1.00 ? 90  ARG A HG3  6  
ATOM 10001 H HD2  . ARG A 1 70  ? -23.409 3.723   -3.793  1.00 0.00 ? 90  ARG A HD2  6  
ATOM 10002 H HD3  . ARG A 1 70  ? -22.095 4.020   -4.930  1.00 1.00 ? 90  ARG A HD3  6  
ATOM 10003 H HE   . ARG A 1 70  ? -23.887 2.356   -6.242  1.00 1.00 ? 90  ARG A HE   6  
ATOM 10004 H HH11 . ARG A 1 70  ? -24.445 5.430   -4.547  1.00 0.00 ? 90  ARG A HH11 6  
ATOM 10005 H HH12 . ARG A 1 70  ? -25.870 5.761   -5.568  1.00 0.00 ? 90  ARG A HH12 6  
ATOM 10006 H HH21 . ARG A 1 70  ? -25.636 2.885   -7.425  1.00 0.00 ? 90  ARG A HH21 6  
ATOM 10007 H HH22 . ARG A 1 70  ? -26.502 4.409   -7.094  1.00 0.00 ? 90  ARG A HH22 6  
ATOM 10008 N N    . PHE A 1 71  ? -19.368 4.292   -5.308  1.00 1.00 ? 91  PHE A N    6  
ATOM 10009 C CA   . PHE A 1 71  ? -19.461 5.785   -5.403  1.00 1.00 ? 91  PHE A CA   6  
ATOM 10010 C C    . PHE A 1 71  ? -18.095 6.517   -5.470  1.00 1.00 ? 91  PHE A C    6  
ATOM 10011 O O    . PHE A 1 71  ? -17.027 5.902   -5.490  1.00 1.00 ? 91  PHE A O    6  
ATOM 10012 C CB   . PHE A 1 71  ? -20.292 6.348   -4.219  1.00 1.00 ? 91  PHE A CB   6  
ATOM 10013 C CG   . PHE A 1 71  ? -21.134 7.602   -4.348  1.00 1.00 ? 91  PHE A CG   6  
ATOM 10014 C CD1  . PHE A 1 71  ? -22.310 7.588   -5.129  1.00 1.00 ? 91  PHE A CD1  6  
ATOM 10015 C CD2  . PHE A 1 71  ? -20.831 8.729   -3.551  1.00 1.00 ? 91  PHE A CD2  6  
ATOM 10016 C CE1  . PHE A 1 71  ? -23.193 8.692   -5.095  1.00 1.00 ? 91  PHE A CE1  6  
ATOM 10017 C CE2  . PHE A 1 71  ? -21.710 9.832   -3.520  1.00 1.00 ? 91  PHE A CE2  6  
ATOM 10018 C CZ   . PHE A 1 71  ? -22.898 9.811   -4.285  1.00 1.00 ? 91  PHE A CZ   6  
ATOM 10019 H H    . PHE A 1 71  ? -19.008 3.811   -6.115  1.00 1.00 ? 91  PHE A H    6  
ATOM 10020 H HA   . PHE A 1 71  ? -20.007 6.024   -6.319  1.00 1.00 ? 91  PHE A HA   6  
ATOM 10021 H HB2  . PHE A 1 71  ? -21.176 5.737   -4.038  1.00 0.00 ? 91  PHE A HB2  6  
ATOM 10022 H HB3  . PHE A 1 71  ? -19.698 6.366   -3.301  1.00 1.00 ? 91  PHE A HB3  6  
ATOM 10023 H HD1  . PHE A 1 71  ? -22.549 6.728   -5.736  1.00 1.00 ? 91  PHE A HD1  6  
ATOM 10024 H HD2  . PHE A 1 71  ? -19.941 8.737   -2.935  1.00 1.00 ? 91  PHE A HD2  6  
ATOM 10025 H HE1  . PHE A 1 71  ? -24.104 8.682   -5.679  1.00 1.00 ? 91  PHE A HE1  6  
ATOM 10026 H HE2  . PHE A 1 71  ? -21.481 10.683  -2.889  1.00 1.00 ? 91  PHE A HE2  6  
ATOM 10027 H HZ   . PHE A 1 71  ? -23.586 10.646  -4.238  1.00 1.00 ? 91  PHE A HZ   6  
ATOM 10028 N N    . ASN A 1 72  ? -18.154 7.851   -5.577  1.00 1.00 ? 92  ASN A N    6  
ATOM 10029 C CA   . ASN A 1 72  ? -17.057 8.815   -5.419  1.00 1.00 ? 92  ASN A CA   6  
ATOM 10030 C C    . ASN A 1 72  ? -16.862 9.090   -3.889  1.00 1.00 ? 92  ASN A C    6  
ATOM 10031 O O    . ASN A 1 72  ? -17.229 8.261   -3.054  1.00 1.00 ? 92  ASN A O    6  
ATOM 10032 C CB   . ASN A 1 72  ? -17.374 10.077  -6.264  1.00 1.00 ? 92  ASN A CB   6  
ATOM 10033 C CG   . ASN A 1 72  ? -18.777 10.650  -6.092  1.00 1.00 ? 92  ASN A CG   6  
ATOM 10034 O OD1  . ASN A 1 72  ? -19.784 10.016  -6.358  1.00 1.00 ? 92  ASN A OD1  6  
ATOM 10035 N ND2  . ASN A 1 72  ? -18.880 11.882  -5.657  1.00 1.00 ? 92  ASN A ND2  6  
ATOM 10036 H H    . ASN A 1 72  ? -19.075 8.272   -5.662  1.00 1.00 ? 92  ASN A H    6  
ATOM 10037 H HA   . ASN A 1 72  ? -16.134 8.378   -5.802  1.00 1.00 ? 92  ASN A HA   6  
ATOM 10038 H HB2  . ASN A 1 72  ? -16.710 10.896  -5.986  1.00 0.00 ? 92  ASN A HB2  6  
ATOM 10039 H HB3  . ASN A 1 72  ? -17.240 9.867   -7.322  1.00 1.00 ? 92  ASN A HB3  6  
ATOM 10040 H HD21 . ASN A 1 72  ? -18.029 12.426  -5.446  1.00 0.00 ? 92  ASN A HD21 6  
ATOM 10041 H HD22 . ASN A 1 72  ? -19.808 12.307  -5.525  1.00 0.00 ? 92  ASN A HD22 6  
ATOM 10042 N N    . ASP A 1 73  ? -16.275 10.232  -3.486  1.00 1.00 ? 93  ASP A N    6  
ATOM 10043 C CA   . ASP A 1 73  ? -16.192 10.684  -2.075  1.00 1.00 ? 93  ASP A CA   6  
ATOM 10044 C C    . ASP A 1 73  ? -15.312 9.848   -1.096  1.00 1.00 ? 93  ASP A C    6  
ATOM 10045 O O    . ASP A 1 73  ? -15.728 9.554   0.019   1.00 1.00 ? 93  ASP A O    6  
ATOM 10046 C CB   . ASP A 1 73  ? -17.622 10.986  -1.542  1.00 1.00 ? 93  ASP A CB   6  
ATOM 10047 C CG   . ASP A 1 73  ? -17.667 11.966  -0.354  1.00 1.00 ? 93  ASP A CG   6  
ATOM 10048 O OD1  . ASP A 1 73  ? -17.161 13.104  -0.535  1.00 1.00 ? 93  ASP A OD1  6  
ATOM 10049 O OD2  . ASP A 1 73  ? -18.175 11.607  0.729   1.00 1.00 ? 93  ASP A OD2  6  
ATOM 10050 H H    . ASP A 1 73  ? -15.953 10.862  -4.202  1.00 1.00 ? 93  ASP A H    6  
ATOM 10051 H HA   . ASP A 1 73  ? -15.696 11.644  -2.128  1.00 1.00 ? 93  ASP A HA   6  
ATOM 10052 H HB2  . ASP A 1 73  ? -18.203 11.425  -2.352  1.00 0.00 ? 93  ASP A HB2  6  
ATOM 10053 H HB3  . ASP A 1 73  ? -18.147 10.059  -1.302  1.00 1.00 ? 93  ASP A HB3  6  
ATOM 10054 N N    . LEU A 1 74  ? -14.077 9.503   -1.492  1.00 1.00 ? 94  LEU A N    6  
ATOM 10055 C CA   . LEU A 1 74  ? -13.019 8.858   -0.679  1.00 1.00 ? 94  LEU A CA   6  
ATOM 10056 C C    . LEU A 1 74  ? -11.648 9.503   -1.011  1.00 1.00 ? 94  LEU A C    6  
ATOM 10057 O O    . LEU A 1 74  ? -11.339 9.546   -2.203  1.00 1.00 ? 94  LEU A O    6  
ATOM 10058 C CB   . LEU A 1 74  ? -13.010 7.333   -0.962  1.00 1.00 ? 94  LEU A CB   6  
ATOM 10059 C CG   . LEU A 1 74  ? -14.024 6.463   -0.179  1.00 1.00 ? 94  LEU A CG   6  
ATOM 10060 C CD1  . LEU A 1 74  ? -15.282 6.188   -1.008  1.00 1.00 ? 94  LEU A CD1  6  
ATOM 10061 C CD2  . LEU A 1 74  ? -13.405 5.119   0.237   1.00 1.00 ? 94  LEU A CD2  6  
ATOM 10062 H H    . LEU A 1 74  ? -13.847 9.698   -2.454  1.00 1.00 ? 94  LEU A H    6  
ATOM 10063 H HA   . LEU A 1 74  ? -13.234 9.030   0.370   1.00 1.00 ? 94  LEU A HA   6  
ATOM 10064 H HB2  . LEU A 1 74  ? -13.335 7.151   -1.986  1.00 0.00 ? 94  LEU A HB2  6  
ATOM 10065 H HB3  . LEU A 1 74  ? -11.999 6.943   -0.827  1.00 1.00 ? 94  LEU A HB3  6  
ATOM 10066 H HG   . LEU A 1 74  ? -14.321 6.978   0.730   1.00 1.00 ? 94  LEU A HG   6  
ATOM 10067 H HD11 . LEU A 1 74  ? -15.762 7.128   -1.274  1.00 1.00 ? 94  LEU A HD11 6  
ATOM 10068 H HD12 . LEU A 1 74  ? -15.037 5.643   -1.921  1.00 1.00 ? 94  LEU A HD12 6  
ATOM 10069 H HD13 . LEU A 1 74  ? -15.992 5.603   -0.422  1.00 1.00 ? 94  LEU A HD13 6  
ATOM 10070 H HD21 . LEU A 1 74  ? -13.072 4.560   -0.638  1.00 1.00 ? 94  LEU A HD21 6  
ATOM 10071 H HD22 . LEU A 1 74  ? -12.556 5.289   0.901   1.00 1.00 ? 94  LEU A HD22 6  
ATOM 10072 H HD23 . LEU A 1 74  ? -14.140 4.526   0.781   1.00 1.00 ? 94  LEU A HD23 6  
ATOM 10073 N N    . ARG A 1 75  ? -10.845 10.066  -0.056  1.00 1.00 ? 95  ARG A N    6  
ATOM 10074 C CA   . ARG A 1 75  ? -9.523  10.675  -0.476  1.00 1.00 ? 95  ARG A CA   6  
ATOM 10075 C C    . ARG A 1 75  ? -8.382  10.514  0.524   1.00 1.00 ? 95  ARG A C    6  
ATOM 10076 O O    . ARG A 1 75  ? -8.634  10.644  1.713   1.00 1.00 ? 95  ARG A O    6  
ATOM 10077 C CB   . ARG A 1 75  ? -9.611  12.176  -0.838  1.00 1.00 ? 95  ARG A CB   6  
ATOM 10078 C CG   . ARG A 1 75  ? -10.617 12.645  -1.897  1.00 1.00 ? 95  ARG A CG   6  
ATOM 10079 C CD   . ARG A 1 75  ? -11.887 12.893  -1.103  1.00 1.00 ? 95  ARG A CD   6  
ATOM 10080 N NE   . ARG A 1 75  ? -13.015 13.476  -1.838  1.00 1.00 ? 95  ARG A NE   6  
ATOM 10081 C CZ   . ARG A 1 75  ? -14.221 13.618  -1.317  1.00 1.00 ? 95  ARG A CZ   6  
ATOM 10082 N NH1  . ARG A 1 75  ? -14.545 13.221  -0.119  1.00 1.00 ? 95  ARG A NH1  6  
ATOM 10083 N NH2  . ARG A 1 75  ? -15.199 14.143  -1.992  1.00 1.00 ? 95  ARG A NH2  6  
ATOM 10084 H H    . ARG A 1 75  ? -10.961 9.779   0.952   1.00 1.00 ? 95  ARG A H    6  
ATOM 10085 H HA   . ARG A 1 75  ? -9.200  10.153  -1.380  1.00 1.00 ? 95  ARG A HA   6  
ATOM 10086 H HB2  . ARG A 1 75  ? -9.976  12.744  0.017   1.00 0.00 ? 95  ARG A HB2  6  
ATOM 10087 H HB3  . ARG A 1 75  ? -8.625  12.549  -1.118  1.00 1.00 ? 95  ARG A HB3  6  
ATOM 10088 H HG2  . ARG A 1 75  ? -10.305 13.570  -2.383  1.00 0.00 ? 95  ARG A HG2  6  
ATOM 10089 H HG3  . ARG A 1 75  ? -10.756 11.909  -2.690  1.00 1.00 ? 95  ARG A HG3  6  
ATOM 10090 H HD2  . ARG A 1 75  ? -12.245 11.934  -0.728  1.00 0.00 ? 95  ARG A HD2  6  
ATOM 10091 H HD3  . ARG A 1 75  ? -11.647 13.565  -0.280  1.00 1.00 ? 95  ARG A HD3  6  
ATOM 10092 H HE   . ARG A 1 75  ? -12.881 13.765  -2.793  1.00 1.00 ? 95  ARG A HE   6  
ATOM 10093 H HH11 . ARG A 1 75  ? -13.841 12.765  0.480   1.00 0.00 ? 95  ARG A HH11 6  
ATOM 10094 H HH12 . ARG A 1 75  ? -15.504 13.362  0.229   1.00 0.00 ? 95  ARG A HH12 6  
ATOM 10095 H HH21 . ARG A 1 75  ? -15.044 14.460  -2.959  1.00 0.00 ? 95  ARG A HH21 6  
ATOM 10096 H HH22 . ARG A 1 75  ? -16.128 14.241  -1.559  1.00 0.00 ? 95  ARG A HH22 6  
ATOM 10097 N N    . PHE A 1 76  ? -7.138  10.435  0.043   1.00 1.00 ? 96  PHE A N    6  
ATOM 10098 C CA   . PHE A 1 76  ? -5.896  10.236  0.820   1.00 1.00 ? 96  PHE A CA   6  
ATOM 10099 C C    . PHE A 1 76  ? -4.863  11.372  0.731   1.00 1.00 ? 96  PHE A C    6  
ATOM 10100 O O    . PHE A 1 76  ? -4.966  12.286  -0.098  1.00 1.00 ? 96  PHE A O    6  
ATOM 10101 C CB   . PHE A 1 76  ? -5.224  8.887   0.487   1.00 1.00 ? 96  PHE A CB   6  
ATOM 10102 C CG   . PHE A 1 76  ? -4.608  8.555   -0.870  1.00 1.00 ? 96  PHE A CG   6  
ATOM 10103 C CD1  . PHE A 1 76  ? -4.470  9.511   -1.908  1.00 1.00 ? 96  PHE A CD1  6  
ATOM 10104 C CD2  . PHE A 1 76  ? -4.087  7.253   -1.065  1.00 1.00 ? 96  PHE A CD2  6  
ATOM 10105 C CE1  . PHE A 1 76  ? -3.807  9.173   -3.106  1.00 1.00 ? 96  PHE A CE1  6  
ATOM 10106 C CE2  . PHE A 1 76  ? -3.442  6.908   -2.273  1.00 1.00 ? 96  PHE A CE2  6  
ATOM 10107 C CZ   . PHE A 1 76  ? -3.298  7.870   -3.294  1.00 1.00 ? 96  PHE A CZ   6  
ATOM 10108 H H    . PHE A 1 76  ? -7.063  10.593  -0.950  1.00 1.00 ? 96  PHE A H    6  
ATOM 10109 H HA   . PHE A 1 76  ? -6.171  10.178  1.878   1.00 1.00 ? 96  PHE A HA   6  
ATOM 10110 H HB2  . PHE A 1 76  ? -4.195  8.824   0.844   1.00 0.00 ? 96  PHE A HB2  6  
ATOM 10111 H HB3  . PHE A 1 76  ? -5.738  8.040   0.922   1.00 1.00 ? 96  PHE A HB3  6  
ATOM 10112 H HD1  . PHE A 1 76  ? -4.838  10.516  -1.812  1.00 1.00 ? 96  PHE A HD1  6  
ATOM 10113 H HD2  . PHE A 1 76  ? -4.172  6.515   -0.279  1.00 1.00 ? 96  PHE A HD2  6  
ATOM 10114 H HE1  . PHE A 1 76  ? -3.679  9.927   -3.868  1.00 1.00 ? 96  PHE A HE1  6  
ATOM 10115 H HE2  . PHE A 1 76  ? -3.046  5.912   -2.408  1.00 1.00 ? 96  PHE A HE2  6  
ATOM 10116 H HZ   . PHE A 1 76  ? -2.790  7.612   -4.212  1.00 1.00 ? 96  PHE A HZ   6  
ATOM 10117 N N    . VAL A 1 77  ? -3.856  11.285  1.610   1.00 1.00 ? 97  VAL A N    6  
ATOM 10118 C CA   . VAL A 1 77  ? -2.642  12.118  1.654   1.00 1.00 ? 97  VAL A CA   6  
ATOM 10119 C C    . VAL A 1 77  ? -3.027  13.598  1.853   1.00 1.00 ? 97  VAL A C    6  
ATOM 10120 O O    . VAL A 1 77  ? -2.931  14.425  0.948   1.00 1.00 ? 97  VAL A O    6  
ATOM 10121 C CB   . VAL A 1 77  ? -1.715  11.815  0.439   1.00 1.00 ? 97  VAL A CB   6  
ATOM 10122 C CG1  . VAL A 1 77  ? -0.366  12.566  0.505   1.00 1.00 ? 97  VAL A CG1  6  
ATOM 10123 C CG2  . VAL A 1 77  ? -1.376  10.316  0.289   1.00 1.00 ? 97  VAL A CG2  6  
ATOM 10124 H H    . VAL A 1 77  ? -3.983  10.625  2.365   1.00 1.00 ? 97  VAL A H    6  
ATOM 10125 H HA   . VAL A 1 77  ? -2.072  11.822  2.535   1.00 1.00 ? 97  VAL A HA   6  
ATOM 10126 H HB   . VAL A 1 77  ? -2.241  12.116  -0.465  1.00 1.00 ? 97  VAL A HB   6  
ATOM 10127 H HG11 . VAL A 1 77  ? -0.505  13.617  0.751   1.00 1.00 ? 97  VAL A HG11 6  
ATOM 10128 H HG12 . VAL A 1 77  ? 0.289   12.121  1.253   1.00 1.00 ? 97  VAL A HG12 6  
ATOM 10129 H HG13 . VAL A 1 77  ? 0.129   12.518  -0.466  1.00 1.00 ? 97  VAL A HG13 6  
ATOM 10130 H HG21 . VAL A 1 77  ? -2.283  9.718   0.214   1.00 1.00 ? 97  VAL A HG21 6  
ATOM 10131 H HG22 . VAL A 1 77  ? -0.807  10.145  -0.625  1.00 1.00 ? 97  VAL A HG22 6  
ATOM 10132 H HG23 . VAL A 1 77  ? -0.797  9.975   1.148   1.00 1.00 ? 97  VAL A HG23 6  
ATOM 10133 N N    . GLY A 1 78  ? -3.502  13.898  3.068   1.00 1.00 ? 98  GLY A N    6  
ATOM 10134 C CA   . GLY A 1 78  ? -3.839  15.232  3.594   1.00 1.00 ? 98  GLY A CA   6  
ATOM 10135 C C    . GLY A 1 78  ? -2.797  15.867  4.541   1.00 1.00 ? 98  GLY A C    6  
ATOM 10136 O O    . GLY A 1 78  ? -2.898  17.056  4.831   1.00 1.00 ? 98  GLY A O    6  
ATOM 10137 H H    . GLY A 1 78  ? -3.631  13.080  3.662   1.00 1.00 ? 98  GLY A H    6  
ATOM 10138 H HA2  . GLY A 1 78  ? -3.987  15.919  2.760   1.00 1.00 ? 98  GLY A HA2  6  
ATOM 10139 H HA3  . GLY A 1 78  ? -4.783  15.177  4.137   1.00 1.00 ? 98  GLY A HA3  6  
ATOM 10140 N N    . ARG A 1 79  ? -1.791  15.096  5.009   1.00 1.00 ? 99  ARG A N    6  
ATOM 10141 C CA   . ARG A 1 79  ? -0.598  15.479  5.814   1.00 1.00 ? 99  ARG A CA   6  
ATOM 10142 C C    . ARG A 1 79  ? -0.796  15.836  7.307   1.00 1.00 ? 99  ARG A C    6  
ATOM 10143 O O    . ARG A 1 79  ? 0.197   15.835  8.034   1.00 1.00 ? 99  ARG A O    6  
ATOM 10144 C CB   . ARG A 1 79  ? 0.233   16.526  5.044   1.00 1.00 ? 99  ARG A CB   6  
ATOM 10145 C CG   . ARG A 1 79  ? 1.699   16.670  5.490   1.00 1.00 ? 99  ARG A CG   6  
ATOM 10146 C CD   . ARG A 1 79  ? 2.654   16.897  4.322   1.00 1.00 ? 99  ARG A CD   6  
ATOM 10147 N NE   . ARG A 1 79  ? 2.403   18.161  3.604   1.00 1.00 ? 99  ARG A NE   6  
ATOM 10148 C CZ   . ARG A 1 79  ? 3.318   19.045  3.253   1.00 1.00 ? 99  ARG A CZ   6  
ATOM 10149 N NH1  . ARG A 1 79  ? 4.571   18.939  3.604   1.00 1.00 ? 99  ARG A NH1  6  
ATOM 10150 N NH2  . ARG A 1 79  ? 2.992   20.073  2.525   1.00 1.00 ? 99  ARG A NH2  6  
ATOM 10151 H H    . ARG A 1 79  ? -1.895  14.107  4.795   1.00 1.00 ? 99  ARG A H    6  
ATOM 10152 H HA   . ARG A 1 79  ? 0.024   14.587  5.847   1.00 1.00 ? 99  ARG A HA   6  
ATOM 10153 H HB2  . ARG A 1 79  ? 0.372   16.227  4.005   1.00 0.00 ? 99  ARG A HB2  6  
ATOM 10154 H HB3  . ARG A 1 79  ? -0.260  17.501  5.050   1.00 1.00 ? 99  ARG A HB3  6  
ATOM 10155 H HG2  . ARG A 1 79  ? 1.828   17.528  6.149   1.00 0.00 ? 99  ARG A HG2  6  
ATOM 10156 H HG3  . ARG A 1 79  ? 2.036   15.783  6.031   1.00 1.00 ? 99  ARG A HG3  6  
ATOM 10157 H HD2  . ARG A 1 79  ? 3.679   17.034  4.666   1.00 0.00 ? 99  ARG A HD2  6  
ATOM 10158 H HD3  . ARG A 1 79  ? 2.652   16.050  3.634   1.00 1.00 ? 99  ARG A HD3  6  
ATOM 10159 H HE   . ARG A 1 79  ? 1.452   18.401  3.383   1.00 1.00 ? 99  ARG A HE   6  
ATOM 10160 H HH11 . ARG A 1 79  ? 4.879   18.142  4.179   1.00 0.00 ? 99  ARG A HH11 6  
ATOM 10161 H HH12 . ARG A 1 79  ? 5.251   19.653  3.306   1.00 0.00 ? 99  ARG A HH12 6  
ATOM 10162 H HH21 . ARG A 1 79  ? 2.016   20.200  2.220   1.00 0.00 ? 99  ARG A HH21 6  
ATOM 10163 H HH22 . ARG A 1 79  ? 3.710   20.760  2.253   1.00 0.00 ? 99  ARG A HH22 6  
ATOM 10164 N N    . SER A 1 80  ? -2.038  16.119  7.736   1.00 1.00 ? 100 SER A N    6  
ATOM 10165 C CA   . SER A 1 80  ? -2.663  16.358  9.076   1.00 1.00 ? 100 SER A CA   6  
ATOM 10166 C C    . SER A 1 80  ? -1.877  16.995  10.268  1.00 1.00 ? 100 SER A C    6  
ATOM 10167 O O    . SER A 1 80  ? -2.482  17.311  11.290  1.00 1.00 ? 100 SER A O    6  
ATOM 10168 C CB   . SER A 1 80  ? -3.311  15.028  9.515   1.00 1.00 ? 100 SER A CB   6  
ATOM 10169 O OG   . SER A 1 80  ? -4.523  15.200  10.225  1.00 1.00 ? 100 SER A OG   6  
ATOM 10170 H H    . SER A 1 80  ? -2.679  16.106  6.954   1.00 1.00 ? 100 SER A H    6  
ATOM 10171 H HA   . SER A 1 80  ? -3.488  17.042  8.892   1.00 1.00 ? 100 SER A HA   6  
ATOM 10172 H HB2  . SER A 1 80  ? -3.667  14.455  8.658   1.00 0.00 ? 100 SER A HB2  6  
ATOM 10173 H HB3  . SER A 1 80  ? -2.601  14.395  10.058  1.00 1.00 ? 100 SER A HB3  6  
ATOM 10174 H HG   . SER A 1 80  ? -5.139  14.385  10.117  1.00 1.00 ? 100 SER A HG   6  
ATOM 10175 N N    . GLY A 1 81  ? -0.567  17.251  10.157  1.00 1.00 ? 101 GLY A N    6  
ATOM 10176 C CA   . GLY A 1 81  ? 0.381   17.672  11.203  1.00 1.00 ? 101 GLY A CA   6  
ATOM 10177 C C    . GLY A 1 81  ? 1.202   16.469  11.709  1.00 1.00 ? 101 GLY A C    6  
ATOM 10178 O O    . GLY A 1 81  ? 1.294   16.254  12.917  1.00 1.00 ? 101 GLY A O    6  
ATOM 10179 H H    . GLY A 1 81  ? -0.178  16.941  9.282   1.00 1.00 ? 101 GLY A H    6  
ATOM 10180 H HA2  . GLY A 1 81  ? 1.076   18.403  10.798  1.00 1.00 ? 101 GLY A HA2  6  
ATOM 10181 H HA3  . GLY A 1 81  ? -0.144  18.130  12.044  1.00 1.00 ? 101 GLY A HA3  6  
ATOM 10182 N N    . ARG A 1 82  ? 1.771   15.693  10.756  1.00 1.00 ? 102 ARG A N    6  
ATOM 10183 C CA   . ARG A 1 82  ? 2.453   14.380  10.880  1.00 1.00 ? 102 ARG A CA   6  
ATOM 10184 C C    . ARG A 1 82  ? 1.411   13.245  10.698  1.00 1.00 ? 102 ARG A C    6  
ATOM 10185 O O    . ARG A 1 82  ? 0.199   13.481  10.637  1.00 1.00 ? 102 ARG A O    6  
ATOM 10186 C CB   . ARG A 1 82  ? 3.231   14.224  12.211  1.00 1.00 ? 102 ARG A CB   6  
ATOM 10187 C CG   . ARG A 1 82  ? 4.361   15.232  12.462  1.00 1.00 ? 102 ARG A CG   6  
ATOM 10188 C CD   . ARG A 1 82  ? 4.937   15.050  13.870  1.00 1.00 ? 102 ARG A CD   6  
ATOM 10189 N NE   . ARG A 1 82  ? 6.133   15.886  14.101  1.00 1.00 ? 102 ARG A NE   6  
ATOM 10190 C CZ   . ARG A 1 82  ? 6.361   16.654  15.154  1.00 1.00 ? 102 ARG A CZ   6  
ATOM 10191 N NH1  . ARG A 1 82  ? 5.518   16.783  16.143  1.00 1.00 ? 102 ARG A NH1  6  
ATOM 10192 N NH2  . ARG A 1 82  ? 7.472   17.333  15.251  1.00 1.00 ? 102 ARG A NH2  6  
ATOM 10193 H H    . ARG A 1 82  ? 1.512   15.953  9.811   1.00 1.00 ? 102 ARG A H    6  
ATOM 10194 H HA   . ARG A 1 82  ? 3.169   14.293  10.062  1.00 1.00 ? 102 ARG A HA   6  
ATOM 10195 H HB2  . ARG A 1 82  ? 2.559   14.391  13.053  1.00 0.00 ? 102 ARG A HB2  6  
ATOM 10196 H HB3  . ARG A 1 82  ? 3.647   13.220  12.278  1.00 1.00 ? 102 ARG A HB3  6  
ATOM 10197 H HG2  . ARG A 1 82  ? 5.146   15.095  11.718  1.00 0.00 ? 102 ARG A HG2  6  
ATOM 10198 H HG3  . ARG A 1 82  ? 3.968   16.246  12.390  1.00 1.00 ? 102 ARG A HG3  6  
ATOM 10199 H HD2  . ARG A 1 82  ? 4.238   15.389  14.635  1.00 0.00 ? 102 ARG A HD2  6  
ATOM 10200 H HD3  . ARG A 1 82  ? 5.164   14.002  14.076  1.00 1.00 ? 102 ARG A HD3  6  
ATOM 10201 H HE   . ARG A 1 82  ? 6.843   15.890  13.388  1.00 1.00 ? 102 ARG A HE   6  
ATOM 10202 H HH11 . ARG A 1 82  ? 4.623   16.271  16.127  1.00 0.00 ? 102 ARG A HH11 6  
ATOM 10203 H HH12 . ARG A 1 82  ? 5.746   17.395  16.939  1.00 0.00 ? 102 ARG A HH12 6  
ATOM 10204 H HH21 . ARG A 1 82  ? 8.178   17.274  14.505  1.00 0.00 ? 102 ARG A HH21 6  
ATOM 10205 H HH22 . ARG A 1 82  ? 7.641   17.928  16.075  1.00 0.00 ? 102 ARG A HH22 6  
ATOM 10206 N N    . GLY A 1 83  ? 1.899   12.002  10.625  1.00 1.00 ? 103 GLY A N    6  
ATOM 10207 C CA   . GLY A 1 83  ? 1.063   10.809  10.462  1.00 1.00 ? 103 GLY A CA   6  
ATOM 10208 C C    . GLY A 1 83  ? 1.778   9.601   9.863   1.00 1.00 ? 103 GLY A C    6  
ATOM 10209 O O    . GLY A 1 83  ? 1.384   9.119   8.800   1.00 1.00 ? 103 GLY A O    6  
ATOM 10210 H H    . GLY A 1 83  ? 2.902   11.918  10.625  1.00 1.00 ? 103 GLY A H    6  
ATOM 10211 H HA2  . GLY A 1 83  ? 0.666   10.523  11.431  1.00 1.00 ? 103 GLY A HA2  6  
ATOM 10212 H HA3  . GLY A 1 83  ? 0.213   11.051  9.818   1.00 1.00 ? 103 GLY A HA3  6  
ATOM 10213 N N    . LYS A 1 84  ? 2.814   9.072   10.551  1.00 1.00 ? 104 LYS A N    6  
ATOM 10214 C CA   . LYS A 1 84  ? 3.456   7.805   10.132  1.00 1.00 ? 104 LYS A CA   6  
ATOM 10215 C C    . LYS A 1 84  ? 2.467   6.651   10.435  1.00 1.00 ? 104 LYS A C    6  
ATOM 10216 O O    . LYS A 1 84  ? 2.511   5.980   11.466  1.00 1.00 ? 104 LYS A O    6  
ATOM 10217 C CB   . LYS A 1 84  ? 4.816   7.653   10.865  1.00 1.00 ? 104 LYS A CB   6  
ATOM 10218 C CG   . LYS A 1 84  ? 4.825   7.938   12.381  1.00 1.00 ? 104 LYS A CG   6  
ATOM 10219 C CD   . LYS A 1 84  ? 6.161   7.703   13.097  1.00 1.00 ? 104 LYS A CD   6  
ATOM 10220 C CE   . LYS A 1 84  ? 6.758   8.956   13.743  1.00 1.00 ? 104 LYS A CE   6  
ATOM 10221 N NZ   . LYS A 1 84  ? 5.879   9.563   14.766  1.00 1.00 ? 104 LYS A NZ   6  
ATOM 10222 H H    . LYS A 1 84  ? 3.088   9.513   11.407  1.00 1.00 ? 104 LYS A H    6  
ATOM 10223 H HA   . LYS A 1 84  ? 3.660   7.810   9.066   1.00 1.00 ? 104 LYS A HA   6  
ATOM 10224 H HB2  . LYS A 1 84  ? 5.129   6.608   10.864  1.00 0.00 ? 104 LYS A HB2  6  
ATOM 10225 H HB3  . LYS A 1 84  ? 5.580   8.248   10.366  1.00 1.00 ? 104 LYS A HB3  6  
ATOM 10226 H HG2  . LYS A 1 84  ? 4.630   8.992   12.573  1.00 0.00 ? 104 LYS A HG2  6  
ATOM 10227 H HG3  . LYS A 1 84  ? 4.064   7.352   12.884  1.00 1.00 ? 104 LYS A HG3  6  
ATOM 10228 H HD2  . LYS A 1 84  ? 6.044   7.059   13.968  1.00 0.00 ? 104 LYS A HD2  6  
ATOM 10229 H HD3  . LYS A 1 84  ? 6.894   7.228   12.442  1.00 1.00 ? 104 LYS A HD3  6  
ATOM 10230 H HE2  . LYS A 1 84  ? 7.635   8.703   14.340  1.00 0.00 ? 104 LYS A HE2  6  
ATOM 10231 H HE3  . LYS A 1 84  ? 7.064   9.679   12.980  1.00 1.00 ? 104 LYS A HE3  6  
ATOM 10232 H HZ1  . LYS A 1 84  ? 5.122   10.086  14.303  1.00 0.00 ? 104 LYS A HZ1  6  
ATOM 10233 H HZ2  . LYS A 1 84  ? 5.473   8.821   15.354  1.00 0.00 ? 104 LYS A HZ2  6  
ATOM 10234 N N    . SER A 1 85  ? 1.562   6.436   9.470   1.00 1.00 ? 105 SER A N    6  
ATOM 10235 C CA   . SER A 1 85  ? 0.557   5.371   9.396   1.00 1.00 ? 105 SER A CA   6  
ATOM 10236 C C    . SER A 1 85  ? 0.544   4.647   8.046   1.00 1.00 ? 105 SER A C    6  
ATOM 10237 O O    . SER A 1 85  ? 0.137   5.224   7.038   1.00 1.00 ? 105 SER A O    6  
ATOM 10238 C CB   . SER A 1 85  ? -0.830  5.923   9.736   1.00 1.00 ? 105 SER A CB   6  
ATOM 10239 O OG   . SER A 1 85  ? -1.733  4.859   9.926   1.00 1.00 ? 105 SER A OG   6  
ATOM 10240 H H    . SER A 1 85  ? 1.534   7.171   8.769   1.00 1.00 ? 105 SER A H    6  
ATOM 10241 H HA   . SER A 1 85  ? 0.792   4.632   10.165  1.00 1.00 ? 105 SER A HA   6  
ATOM 10242 H HB2  . SER A 1 85  ? -0.805  6.496   10.662  1.00 0.00 ? 105 SER A HB2  6  
ATOM 10243 H HB3  . SER A 1 85  ? -1.193  6.581   8.941   1.00 1.00 ? 105 SER A HB3  6  
ATOM 10244 H HG   . SER A 1 85  ? -1.666  4.531   10.831  1.00 1.00 ? 105 SER A HG   6  
ATOM 10245 N N    . PHE A 1 86  ? 0.924   3.368   8.038   1.00 1.00 ? 106 PHE A N    6  
ATOM 10246 C CA   . PHE A 1 86  ? 0.859   2.499   6.858   1.00 1.00 ? 106 PHE A CA   6  
ATOM 10247 C C    . PHE A 1 86  ? -0.536  1.848   6.791   1.00 1.00 ? 106 PHE A C    6  
ATOM 10248 O O    . PHE A 1 86  ? -0.728  0.728   7.272   1.00 1.00 ? 106 PHE A O    6  
ATOM 10249 C CB   . PHE A 1 86  ? 2.018   1.491   6.963   1.00 1.00 ? 106 PHE A CB   6  
ATOM 10250 C CG   . PHE A 1 86  ? 2.215   0.486   5.837   1.00 1.00 ? 106 PHE A CG   6  
ATOM 10251 C CD1  . PHE A 1 86  ? 2.224   0.893   4.481   1.00 1.00 ? 106 PHE A CD1  6  
ATOM 10252 C CD2  . PHE A 1 86  ? 2.469   -0.868  6.154   1.00 1.00 ? 106 PHE A CD2  6  
ATOM 10253 C CE1  . PHE A 1 86  ? 2.508   -0.042  3.460   1.00 1.00 ? 106 PHE A CE1  6  
ATOM 10254 C CE2  . PHE A 1 86  ? 2.759   -1.802  5.135   1.00 1.00 ? 106 PHE A CE2  6  
ATOM 10255 C CZ   . PHE A 1 86  ? 2.797   -1.383  3.788   1.00 1.00 ? 106 PHE A CZ   6  
ATOM 10256 H H    . PHE A 1 86  ? 1.207   2.959   8.915   1.00 1.00 ? 106 PHE A H    6  
ATOM 10257 H HA   . PHE A 1 86  ? 1.011   3.090   5.954   1.00 1.00 ? 106 PHE A HA   6  
ATOM 10258 H HB2  . PHE A 1 86  ? 2.974   2.007   6.869   1.00 0.00 ? 106 PHE A HB2  6  
ATOM 10259 H HB3  . PHE A 1 86  ? 1.988   0.981   7.929   1.00 1.00 ? 106 PHE A HB3  6  
ATOM 10260 H HD1  . PHE A 1 86  ? 2.051   1.928   4.219   1.00 1.00 ? 106 PHE A HD1  6  
ATOM 10261 H HD2  . PHE A 1 86  ? 2.469   -1.191  7.186   1.00 1.00 ? 106 PHE A HD2  6  
ATOM 10262 H HE1  . PHE A 1 86  ? 2.552   0.274   2.427   1.00 1.00 ? 106 PHE A HE1  6  
ATOM 10263 H HE2  . PHE A 1 86  ? 2.978   -2.828  5.391   1.00 1.00 ? 106 PHE A HE2  6  
ATOM 10264 H HZ   . PHE A 1 86  ? 3.060   -2.087  3.015   1.00 1.00 ? 106 PHE A HZ   6  
ATOM 10265 N N    . THR A 1 87  ? -1.524  2.572   6.230   1.00 1.00 ? 107 THR A N    6  
ATOM 10266 C CA   . THR A 1 87  ? -2.935  2.101   6.191   1.00 1.00 ? 107 THR A CA   6  
ATOM 10267 C C    . THR A 1 87  ? -3.735  2.576   4.964   1.00 1.00 ? 107 THR A C    6  
ATOM 10268 O O    . THR A 1 87  ? -4.843  3.110   5.056   1.00 1.00 ? 107 THR A O    6  
ATOM 10269 C CB   . THR A 1 87  ? -3.645  2.345   7.539   1.00 1.00 ? 107 THR A CB   6  
ATOM 10270 O OG1  . THR A 1 87  ? -4.789  1.518   7.549   1.00 1.00 ? 107 THR A OG1  6  
ATOM 10271 C CG2  . THR A 1 87  ? -4.044  3.797   7.863   1.00 1.00 ? 107 THR A CG2  6  
ATOM 10272 H H    . THR A 1 87  ? -1.297  3.523   5.911   1.00 1.00 ? 107 THR A H    6  
ATOM 10273 H HA   . THR A 1 87  ? -2.900  1.015   6.084   1.00 1.00 ? 107 THR A HA   6  
ATOM 10274 H HB   . THR A 1 87  ? -2.975  2.021   8.340   1.00 1.00 ? 107 THR A HB   6  
ATOM 10275 H HG1  . THR A 1 87  ? -5.325  1.754   6.772   1.00 1.00 ? 107 THR A HG1  6  
ATOM 10276 H HG21 . THR A 1 87  ? -3.216  4.468   7.616   1.00 1.00 ? 107 THR A HG21 6  
ATOM 10277 H HG22 . THR A 1 87  ? -4.929  4.104   7.317   1.00 1.00 ? 107 THR A HG22 6  
ATOM 10278 H HG23 . THR A 1 87  ? -4.250  3.895   8.927   1.00 1.00 ? 107 THR A HG23 6  
ATOM 10279 N N    . LEU A 1 88  ? -3.177  2.347   3.774   1.00 1.00 ? 108 LEU A N    6  
ATOM 10280 C CA   . LEU A 1 88  ? -3.702  2.806   2.489   1.00 1.00 ? 108 LEU A CA   6  
ATOM 10281 C C    . LEU A 1 88  ? -4.546  1.733   1.768   1.00 1.00 ? 108 LEU A C    6  
ATOM 10282 O O    . LEU A 1 88  ? -4.114  1.253   0.728   1.00 1.00 ? 108 LEU A O    6  
ATOM 10283 C CB   . LEU A 1 88  ? -2.547  3.421   1.658   1.00 1.00 ? 108 LEU A CB   6  
ATOM 10284 C CG   . LEU A 1 88  ? -1.301  2.578   1.296   1.00 1.00 ? 108 LEU A CG   6  
ATOM 10285 C CD1  . LEU A 1 88  ? -0.691  3.123   -0.002  1.00 1.00 ? 108 LEU A CD1  6  
ATOM 10286 C CD2  . LEU A 1 88  ? -0.211  2.569   2.381   1.00 1.00 ? 108 LEU A CD2  6  
ATOM 10287 H H    . LEU A 1 88  ? -2.281  1.886   3.791   1.00 1.00 ? 108 LEU A H    6  
ATOM 10288 H HA   . LEU A 1 88  ? -4.385  3.631   2.669   1.00 1.00 ? 108 LEU A HA   6  
ATOM 10289 H HB2  . LEU A 1 88  ? -2.869  3.579   0.630   1.00 0.00 ? 108 LEU A HB2  6  
ATOM 10290 H HB3  . LEU A 1 88  ? -2.248  4.375   2.083   1.00 1.00 ? 108 LEU A HB3  6  
ATOM 10291 H HG   . LEU A 1 88  ? -1.608  1.551   1.117   1.00 1.00 ? 108 LEU A HG   6  
ATOM 10292 H HD11 . LEU A 1 88  ? -1.442  3.142   -0.790  1.00 1.00 ? 108 LEU A HD11 6  
ATOM 10293 H HD12 . LEU A 1 88  ? -0.294  4.125   0.144   1.00 1.00 ? 108 LEU A HD12 6  
ATOM 10294 H HD13 . LEU A 1 88  ? 0.126   2.473   -0.321  1.00 1.00 ? 108 LEU A HD13 6  
ATOM 10295 H HD21 . LEU A 1 88  ? 0.139   3.577   2.592   1.00 1.00 ? 108 LEU A HD21 6  
ATOM 10296 H HD22 . LEU A 1 88  ? -0.573  2.108   3.296   1.00 1.00 ? 108 LEU A HD22 6  
ATOM 10297 H HD23 . LEU A 1 88  ? 0.638   1.983   2.030   1.00 1.00 ? 108 LEU A HD23 6  
ATOM 10298 N N    . THR A 1 89  ? -5.740  1.366   2.285   1.00 1.00 ? 109 THR A N    6  
ATOM 10299 C CA   . THR A 1 89  ? -6.786  0.450   1.699   1.00 1.00 ? 109 THR A CA   6  
ATOM 10300 C C    . THR A 1 89  ? -7.944  0.122   2.675   1.00 1.00 ? 109 THR A C    6  
ATOM 10301 O O    . THR A 1 89  ? -9.057  0.617   2.469   1.00 1.00 ? 109 THR A O    6  
ATOM 10302 C CB   . THR A 1 89  ? -6.266  -0.860  1.027   1.00 1.00 ? 109 THR A CB   6  
ATOM 10303 O OG1  . THR A 1 89  ? -5.508  -0.587  -0.122  1.00 1.00 ? 109 THR A OG1  6  
ATOM 10304 C CG2  . THR A 1 89  ? -7.359  -1.803  0.499   1.00 1.00 ? 109 THR A CG2  6  
ATOM 10305 H H    . THR A 1 89  ? -6.018  1.906   3.112   1.00 1.00 ? 109 THR A H    6  
ATOM 10306 H HA   . THR A 1 89  ? -7.254  1.007   0.890   1.00 1.00 ? 109 THR A HA   6  
ATOM 10307 H HB   . THR A 1 89  ? -5.642  -1.405  1.727   1.00 1.00 ? 109 THR A HB   6  
ATOM 10308 H HG1  . THR A 1 89  ? -4.892  0.148   0.134   1.00 1.00 ? 109 THR A HG1  6  
ATOM 10309 H HG21 . THR A 1 89  ? -8.014  -2.125  1.300   1.00 1.00 ? 109 THR A HG21 6  
ATOM 10310 H HG22 . THR A 1 89  ? -7.956  -1.304  -0.267  1.00 1.00 ? 109 THR A HG22 6  
ATOM 10311 H HG23 . THR A 1 89  ? -6.904  -2.698  0.074   1.00 1.00 ? 109 THR A HG23 6  
ATOM 10312 N N    . ILE A 1 90  ? -7.748  -0.787  3.655   1.00 1.00 ? 110 ILE A N    6  
ATOM 10313 C CA   . ILE A 1 90  ? -8.824  -1.269  4.561   1.00 1.00 ? 110 ILE A CA   6  
ATOM 10314 C C    . ILE A 1 90  ? -8.464  -1.299  6.054   1.00 1.00 ? 110 ILE A C    6  
ATOM 10315 O O    . ILE A 1 90  ? -7.303  -1.481  6.422   1.00 1.00 ? 110 ILE A O    6  
ATOM 10316 C CB   . ILE A 1 90  ? -9.441  -2.625  4.071   1.00 1.00 ? 110 ILE A CB   6  
ATOM 10317 C CG1  . ILE A 1 90  ? -10.976 -2.547  4.211   1.00 1.00 ? 110 ILE A CG1  6  
ATOM 10318 C CG2  . ILE A 1 90  ? -8.894  -3.883  4.783   1.00 1.00 ? 110 ILE A CG2  6  
ATOM 10319 C CD1  . ILE A 1 90  ? -11.793 -3.809  3.952   1.00 1.00 ? 110 ILE A CD1  6  
ATOM 10320 H H    . ILE A 1 90  ? -6.800  -1.101  3.829   1.00 1.00 ? 110 ILE A H    6  
ATOM 10321 H HA   . ILE A 1 90  ? -9.615  -0.520  4.497   1.00 1.00 ? 110 ILE A HA   6  
ATOM 10322 H HB   . ILE A 1 90  ? -9.240  -2.747  3.007   1.00 1.00 ? 110 ILE A HB   6  
ATOM 10323 H HG12 . ILE A 1 90  ? -11.217 -2.296  5.245   1.00 0.00 ? 110 ILE A HG12 6  
ATOM 10324 H HG13 . ILE A 1 90  ? -11.343 -1.777  3.539   1.00 1.00 ? 110 ILE A HG13 6  
ATOM 10325 H HG21 . ILE A 1 90  ? -7.816  -3.843  4.840   1.00 1.00 ? 110 ILE A HG21 6  
ATOM 10326 H HG22 . ILE A 1 90  ? -9.282  -3.958  5.802   1.00 1.00 ? 110 ILE A HG22 6  
ATOM 10327 H HG23 . ILE A 1 90  ? -9.178  -4.781  4.233   1.00 1.00 ? 110 ILE A HG23 6  
ATOM 10328 H HD11 . ILE A 1 90  ? -11.561 -4.189  2.959   1.00 1.00 ? 110 ILE A HD11 6  
ATOM 10329 H HD12 . ILE A 1 90  ? -11.566 -4.562  4.706   1.00 1.00 ? 110 ILE A HD12 6  
ATOM 10330 H HD13 . ILE A 1 90  ? -12.853 -3.567  4.009   1.00 1.00 ? 110 ILE A HD13 6  
ATOM 10331 N N    . THR A 1 91  ? -9.507  -1.215  6.893   1.00 1.00 ? 111 THR A N    6  
ATOM 10332 C CA   . THR A 1 91  ? -9.493  -1.418  8.357   1.00 1.00 ? 111 THR A CA   6  
ATOM 10333 C C    . THR A 1 91  ? -10.678 -2.301  8.822   1.00 1.00 ? 111 THR A C    6  
ATOM 10334 O O    . THR A 1 91  ? -11.825 -1.848  8.903   1.00 1.00 ? 111 THR A O    6  
ATOM 10335 C CB   . THR A 1 91  ? -9.446  -0.088  9.149   1.00 1.00 ? 111 THR A CB   6  
ATOM 10336 O OG1  . THR A 1 91  ? -8.324  0.699   8.785   1.00 1.00 ? 111 THR A OG1  6  
ATOM 10337 C CG2  . THR A 1 91  ? -9.327  -0.318  10.664  1.00 1.00 ? 111 THR A CG2  6  
ATOM 10338 H H    . THR A 1 91  ? -10.382 -0.903  6.460   1.00 1.00 ? 111 THR A H    6  
ATOM 10339 H HA   . THR A 1 91  ? -8.586  -1.962  8.602   1.00 1.00 ? 111 THR A HA   6  
ATOM 10340 H HB   . THR A 1 91  ? -10.351 0.487   8.945   1.00 1.00 ? 111 THR A HB   6  
ATOM 10341 H HG1  . THR A 1 91  ? -7.527  0.165   8.877   1.00 1.00 ? 111 THR A HG1  6  
ATOM 10342 H HG21 . THR A 1 91  ? -8.452  -0.926  10.901  1.00 1.00 ? 111 THR A HG21 6  
ATOM 10343 H HG22 . THR A 1 91  ? -9.239  0.641   11.181  1.00 1.00 ? 111 THR A HG22 6  
ATOM 10344 H HG23 . THR A 1 91  ? -10.217 -0.820  11.038  1.00 1.00 ? 111 THR A HG23 6  
ATOM 10345 N N    . VAL A 1 92  ? -10.390 -3.565  9.187   1.00 1.00 ? 112 VAL A N    6  
ATOM 10346 C CA   . VAL A 1 92  ? -11.359 -4.498  9.801   1.00 1.00 ? 112 VAL A CA   6  
ATOM 10347 C C    . VAL A 1 92  ? -11.608 -4.098  11.264  1.00 1.00 ? 112 VAL A C    6  
ATOM 10348 O O    . VAL A 1 92  ? -10.820 -4.343  12.176  1.00 1.00 ? 112 VAL A O    6  
ATOM 10349 C CB   . VAL A 1 92  ? -10.987 -5.994  9.686   1.00 1.00 ? 112 VAL A CB   6  
ATOM 10350 C CG1  . VAL A 1 92  ? -11.918 -6.918  10.503  1.00 1.00 ? 112 VAL A CG1  6  
ATOM 10351 C CG2  . VAL A 1 92  ? -11.008 -6.512  8.233   1.00 1.00 ? 112 VAL A CG2  6  
ATOM 10352 H H    . VAL A 1 92  ? -9.455  -3.923  9.016   1.00 1.00 ? 112 VAL A H    6  
ATOM 10353 H HA   . VAL A 1 92  ? -12.279 -4.401  9.238   1.00 1.00 ? 112 VAL A HA   6  
ATOM 10354 H HB   . VAL A 1 92  ? -9.996  -6.093  10.099  1.00 1.00 ? 112 VAL A HB   6  
ATOM 10355 H HG11 . VAL A 1 92  ? -12.957 -6.782  10.204  1.00 1.00 ? 112 VAL A HG11 6  
ATOM 10356 H HG12 . VAL A 1 92  ? -11.642 -7.964  10.361  1.00 1.00 ? 112 VAL A HG12 6  
ATOM 10357 H HG13 . VAL A 1 92  ? -11.821 -6.706  11.564  1.00 1.00 ? 112 VAL A HG13 6  
ATOM 10358 H HG21 . VAL A 1 92  ? -10.449 -5.849  7.576   1.00 1.00 ? 112 VAL A HG21 6  
ATOM 10359 H HG22 . VAL A 1 92  ? -10.563 -7.506  8.176   1.00 1.00 ? 112 VAL A HG22 6  
ATOM 10360 H HG23 . VAL A 1 92  ? -12.031 -6.586  7.869   1.00 1.00 ? 112 VAL A HG23 6  
ATOM 10361 N N    . PHE A 1 93  ? -12.770 -3.483  11.422  1.00 1.00 ? 113 PHE A N    6  
ATOM 10362 C CA   . PHE A 1 93  ? -13.522 -3.058  12.595  1.00 1.00 ? 113 PHE A CA   6  
ATOM 10363 C C    . PHE A 1 93  ? -14.073 -4.295  13.339  1.00 1.00 ? 113 PHE A C    6  
ATOM 10364 O O    . PHE A 1 93  ? -15.235 -4.689  13.235  1.00 1.00 ? 113 PHE A O    6  
ATOM 10365 C CB   . PHE A 1 93  ? -14.610 -2.087  12.111  1.00 1.00 ? 113 PHE A CB   6  
ATOM 10366 C CG   . PHE A 1 93  ? -15.379 -1.327  13.172  1.00 1.00 ? 113 PHE A CG   6  
ATOM 10367 C CD1  . PHE A 1 93  ? -16.559 -1.869  13.733  1.00 1.00 ? 113 PHE A CD1  6  
ATOM 10368 C CD2  . PHE A 1 93  ? -14.938 -0.045  13.568  1.00 1.00 ? 113 PHE A CD2  6  
ATOM 10369 C CE1  . PHE A 1 93  ? -17.291 -1.134  14.688  1.00 1.00 ? 113 PHE A CE1  6  
ATOM 10370 C CE2  . PHE A 1 93  ? -15.677 0.695   14.517  1.00 1.00 ? 113 PHE A CE2  6  
ATOM 10371 C CZ   . PHE A 1 93  ? -16.856 0.153   15.076  1.00 1.00 ? 113 PHE A CZ   6  
ATOM 10372 H H    . PHE A 1 93  ? -13.205 -3.442  10.521  1.00 1.00 ? 113 PHE A H    6  
ATOM 10373 H HA   . PHE A 1 93  ? -12.862 -2.515  13.271  1.00 1.00 ? 113 PHE A HA   6  
ATOM 10374 H HB2  . PHE A 1 93  ? -14.181 -1.231  11.591  1.00 0.00 ? 113 PHE A HB2  6  
ATOM 10375 H HB3  . PHE A 1 93  ? -15.303 -2.570  11.423  1.00 1.00 ? 113 PHE A HB3  6  
ATOM 10376 H HD1  . PHE A 1 93  ? -16.912 -2.845  13.429  1.00 1.00 ? 113 PHE A HD1  6  
ATOM 10377 H HD2  . PHE A 1 93  ? -14.042 0.376   13.134  1.00 1.00 ? 113 PHE A HD2  6  
ATOM 10378 H HE1  . PHE A 1 93  ? -18.190 -1.554  15.117  1.00 1.00 ? 113 PHE A HE1  6  
ATOM 10379 H HE2  . PHE A 1 93  ? -15.342 1.681   14.807  1.00 1.00 ? 113 PHE A HE2  6  
ATOM 10380 H HZ   . PHE A 1 93  ? -17.422 0.718   15.804  1.00 1.00 ? 113 PHE A HZ   6  
ATOM 10381 N N    . THR A 1 94  ? -13.166 -4.998  14.011  1.00 1.00 ? 114 THR A N    6  
ATOM 10382 C CA   . THR A 1 94  ? -13.406 -6.169  14.898  1.00 1.00 ? 114 THR A CA   6  
ATOM 10383 C C    . THR A 1 94  ? -12.291 -6.241  15.967  1.00 1.00 ? 114 THR A C    6  
ATOM 10384 O O    . THR A 1 94  ? -11.257 -5.585  15.826  1.00 1.00 ? 114 THR A O    6  
ATOM 10385 C CB   . THR A 1 94  ? -13.552 -7.451  14.036  1.00 1.00 ? 114 THR A CB   6  
ATOM 10386 O OG1  . THR A 1 94  ? -14.676 -7.303  13.184  1.00 1.00 ? 114 THR A OG1  6  
ATOM 10387 C CG2  . THR A 1 94  ? -13.801 -8.761  14.797  1.00 1.00 ? 114 THR A CG2  6  
ATOM 10388 H H    . THR A 1 94  ? -12.211 -4.687  13.844  1.00 1.00 ? 114 THR A H    6  
ATOM 10389 H HA   . THR A 1 94  ? -14.345 -6.023  15.438  1.00 1.00 ? 114 THR A HA   6  
ATOM 10390 H HB   . THR A 1 94  ? -12.661 -7.577  13.423  1.00 1.00 ? 114 THR A HB   6  
ATOM 10391 H HG1  . THR A 1 94  ? -14.941 -6.360  13.186  1.00 1.00 ? 114 THR A HG1  6  
ATOM 10392 H HG21 . THR A 1 94  ? -14.690 -8.678  15.424  1.00 1.00 ? 114 THR A HG21 6  
ATOM 10393 H HG22 . THR A 1 94  ? -13.955 -9.572  14.081  1.00 1.00 ? 114 THR A HG22 6  
ATOM 10394 H HG23 . THR A 1 94  ? -12.939 -9.024  15.403  1.00 1.00 ? 114 THR A HG23 6  
ATOM 10395 N N    . ASN A 1 95  ? -12.494 -6.998  17.061  1.00 1.00 ? 115 ASN A N    6  
ATOM 10396 C CA   . ASN A 1 95  ? -11.588 -7.051  18.222  1.00 1.00 ? 115 ASN A CA   6  
ATOM 10397 C C    . ASN A 1 95  ? -10.088 -7.216  17.848  1.00 1.00 ? 115 ASN A C    6  
ATOM 10398 O O    . ASN A 1 95  ? -9.264  -6.578  18.509  1.00 1.00 ? 115 ASN A O    6  
ATOM 10399 C CB   . ASN A 1 95  ? -12.129 -8.084  19.230  1.00 1.00 ? 115 ASN A CB   6  
ATOM 10400 C CG   . ASN A 1 95  ? -12.133 -7.585  20.666  1.00 1.00 ? 115 ASN A CG   6  
ATOM 10401 O OD1  . ASN A 1 95  ? -13.155 -7.471  21.315  1.00 1.00 ? 115 ASN A OD1  6  
ATOM 10402 N ND2  . ASN A 1 95  ? -10.976 -7.259  21.204  1.00 1.00 ? 115 ASN A ND2  6  
ATOM 10403 H H    . ASN A 1 95  ? -13.334 -7.559  17.100  1.00 1.00 ? 115 ASN A H    6  
ATOM 10404 H HA   . ASN A 1 95  ? -11.660 -6.057  18.672  1.00 1.00 ? 115 ASN A HA   6  
ATOM 10405 H HB2  . ASN A 1 95  ? -13.186 -8.307  19.088  1.00 0.00 ? 115 ASN A HB2  6  
ATOM 10406 H HB3  . ASN A 1 95  ? -11.617 -9.040  19.177  1.00 1.00 ? 115 ASN A HB3  6  
ATOM 10407 H HD21 . ASN A 1 95  ? -10.111 -7.345  20.654  1.00 0.00 ? 115 ASN A HD21 6  
ATOM 10408 H HD22 . ASN A 1 95  ? -10.939 -6.917  22.176  1.00 0.00 ? 115 ASN A HD22 6  
ATOM 10409 N N    . PRO A 1 96  ? -9.725  -8.076  16.862  1.00 1.00 ? 116 PRO A N    6  
ATOM 10410 C CA   . PRO A 1 96  ? -8.407  -8.151  16.232  1.00 1.00 ? 116 PRO A CA   6  
ATOM 10411 C C    . PRO A 1 96  ? -8.434  -7.225  14.975  1.00 1.00 ? 116 PRO A C    6  
ATOM 10412 O O    . PRO A 1 96  ? -9.016  -7.610  13.952  1.00 1.00 ? 116 PRO A O    6  
ATOM 10413 C CB   . PRO A 1 96  ? -8.199  -9.620  15.844  1.00 1.00 ? 116 PRO A CB   6  
ATOM 10414 C CG   . PRO A 1 96  ? -9.627  -10.108 15.578  1.00 1.00 ? 116 PRO A CG   6  
ATOM 10415 C CD   . PRO A 1 96  ? -10.497 -9.262  16.505  1.00 1.00 ? 116 PRO A CD   6  
ATOM 10416 H HA   . PRO A 1 96  ? -7.617  -7.851  16.919  1.00 1.00 ? 116 PRO A HA   6  
ATOM 10417 H HB2  . PRO A 1 96  ? -7.567  -9.708  14.961  1.00 0.00 ? 116 PRO A HB2  6  
ATOM 10418 H HB3  . PRO A 1 96  ? -7.780  -10.168 16.692  1.00 1.00 ? 116 PRO A HB3  6  
ATOM 10419 H HG2  . PRO A 1 96  ? -9.907  -9.966  14.534  1.00 0.00 ? 116 PRO A HG2  6  
ATOM 10420 H HG3  . PRO A 1 96  ? -9.734  -11.172 15.807  1.00 1.00 ? 116 PRO A HG3  6  
ATOM 10421 H HD2  . PRO A 1 96  ? -11.438 -8.950  16.053  1.00 0.00 ? 116 PRO A HD2  6  
ATOM 10422 H HD3  . PRO A 1 96  ? -10.690 -9.841  17.406  1.00 1.00 ? 116 PRO A HD3  6  
ATOM 10423 N N    . PRO A 1 97  ? -7.864  -5.991  15.020  1.00 1.00 ? 117 PRO A N    6  
ATOM 10424 C CA   . PRO A 1 97  ? -7.924  -5.012  13.921  1.00 1.00 ? 117 PRO A CA   6  
ATOM 10425 C C    . PRO A 1 97  ? -7.168  -5.523  12.680  1.00 1.00 ? 117 PRO A C    6  
ATOM 10426 O O    . PRO A 1 97  ? -5.960  -5.760  12.770  1.00 1.00 ? 117 PRO A O    6  
ATOM 10427 C CB   . PRO A 1 97  ? -7.309  -3.719  14.468  1.00 1.00 ? 117 PRO A CB   6  
ATOM 10428 C CG   . PRO A 1 97  ? -6.380  -4.210  15.581  1.00 1.00 ? 117 PRO A CG   6  
ATOM 10429 C CD   . PRO A 1 97  ? -7.048  -5.479  16.112  1.00 1.00 ? 117 PRO A CD   6  
ATOM 10430 H HA   . PRO A 1 97  ? -8.966  -4.829  13.668  1.00 1.00 ? 117 PRO A HA   6  
ATOM 10431 H HB2  . PRO A 1 97  ? -6.762  -3.187  13.690  1.00 0.00 ? 117 PRO A HB2  6  
ATOM 10432 H HB3  . PRO A 1 97  ? -8.099  -3.108  14.910  1.00 1.00 ? 117 PRO A HB3  6  
ATOM 10433 H HG2  . PRO A 1 97  ? -5.382  -4.438  15.204  1.00 0.00 ? 117 PRO A HG2  6  
ATOM 10434 H HG3  . PRO A 1 97  ? -6.262  -3.465  16.370  1.00 1.00 ? 117 PRO A HG3  6  
ATOM 10435 H HD2  . PRO A 1 97  ? -6.330  -6.241  16.415  1.00 0.00 ? 117 PRO A HD2  6  
ATOM 10436 H HD3  . PRO A 1 97  ? -7.690  -5.225  16.957  1.00 1.00 ? 117 PRO A HD3  6  
ATOM 10437 N N    . GLN A 1 98  ? -7.840  -5.691  11.521  1.00 1.00 ? 118 GLN A N    6  
ATOM 10438 C CA   . GLN A 1 98  ? -7.216  -6.325  10.332  1.00 1.00 ? 118 GLN A CA   6  
ATOM 10439 C C    . GLN A 1 98  ? -7.176  -5.357  9.140   1.00 1.00 ? 118 GLN A C    6  
ATOM 10440 O O    . GLN A 1 98  ? -8.182  -5.065  8.497   1.00 1.00 ? 118 GLN A O    6  
ATOM 10441 C CB   . GLN A 1 98  ? -7.807  -7.725  10.078  1.00 1.00 ? 118 GLN A CB   6  
ATOM 10442 C CG   . GLN A 1 98  ? -6.909  -8.677  9.277   1.00 1.00 ? 118 GLN A CG   6  
ATOM 10443 C CD   . GLN A 1 98  ? -7.248  -10.129 9.602   1.00 1.00 ? 118 GLN A CD   6  
ATOM 10444 O OE1  . GLN A 1 98  ? -8.037  -10.781 8.949   1.00 1.00 ? 118 GLN A OE1  6  
ATOM 10445 N NE2  . GLN A 1 98  ? -6.688  -10.697 10.652  1.00 1.00 ? 118 GLN A NE2  6  
ATOM 10446 H H    . GLN A 1 98  ? -8.812  -5.377  11.444  1.00 1.00 ? 118 GLN A H    6  
ATOM 10447 H HA   . GLN A 1 98  ? -6.179  -6.534  10.585  1.00 1.00 ? 118 GLN A HA   6  
ATOM 10448 H HB2  . GLN A 1 98  ? -7.927  -8.318  10.984  1.00 0.00 ? 118 GLN A HB2  6  
ATOM 10449 H HB3  . GLN A 1 98  ? -8.791  -7.704  9.620   1.00 1.00 ? 118 GLN A HB3  6  
ATOM 10450 H HG2  . GLN A 1 98  ? -7.067  -8.555  8.205   1.00 0.00 ? 118 GLN A HG2  6  
ATOM 10451 H HG3  . GLN A 1 98  ? -5.853  -8.487  9.484   1.00 1.00 ? 118 GLN A HG3  6  
ATOM 10452 H HE21 . GLN A 1 98  ? -6.032  -10.163 11.238  1.00 0.00 ? 118 GLN A HE21 6  
ATOM 10453 H HE22 . GLN A 1 98  ? -6.905  -11.677 10.884  1.00 0.00 ? 118 GLN A HE22 6  
ATOM 10454 N N    . VAL A 1 99  ? -5.986  -4.798  8.907   1.00 1.00 ? 119 VAL A N    6  
ATOM 10455 C CA   . VAL A 1 99  ? -5.681  -3.723  7.946   1.00 1.00 ? 119 VAL A CA   6  
ATOM 10456 C C    . VAL A 1 99  ? -4.992  -4.231  6.669   1.00 1.00 ? 119 VAL A C    6  
ATOM 10457 O O    . VAL A 1 99  ? -4.145  -5.119  6.709   1.00 1.00 ? 119 VAL A O    6  
ATOM 10458 C CB   . VAL A 1 99  ? -4.863  -2.565  8.592   1.00 1.00 ? 119 VAL A CB   6  
ATOM 10459 C CG1  . VAL A 1 99  ? -5.615  -1.925  9.774   1.00 1.00 ? 119 VAL A CG1  6  
ATOM 10460 C CG2  . VAL A 1 99  ? -3.447  -2.965  9.054   1.00 1.00 ? 119 VAL A CG2  6  
ATOM 10461 H H    . VAL A 1 99  ? -5.258  -5.102  9.523   1.00 1.00 ? 119 VAL A H    6  
ATOM 10462 H HA   . VAL A 1 99  ? -6.637  -3.305  7.650   1.00 1.00 ? 119 VAL A HA   6  
ATOM 10463 H HB   . VAL A 1 99  ? -4.748  -1.786  7.834   1.00 1.00 ? 119 VAL A HB   6  
ATOM 10464 H HG11 . VAL A 1 99  ? -6.609  -1.627  9.458   1.00 1.00 ? 119 VAL A HG11 6  
ATOM 10465 H HG12 . VAL A 1 99  ? -5.699  -2.636  10.596  1.00 1.00 ? 119 VAL A HG12 6  
ATOM 10466 H HG13 . VAL A 1 99  ? -5.082  -1.040  10.123  1.00 1.00 ? 119 VAL A HG13 6  
ATOM 10467 H HG21 . VAL A 1 99  ? -2.868  -3.344  8.211   1.00 1.00 ? 119 VAL A HG21 6  
ATOM 10468 H HG22 . VAL A 1 99  ? -2.929  -2.094  9.456   1.00 1.00 ? 119 VAL A HG22 6  
ATOM 10469 H HG23 . VAL A 1 99  ? -3.501  -3.736  9.824   1.00 1.00 ? 119 VAL A HG23 6  
ATOM 10470 N N    . ALA A 1 100 ? -5.334  -3.600  5.539   1.00 1.00 ? 120 ALA A N    6  
ATOM 10471 C CA   . ALA A 1 100 ? -4.749  -3.838  4.208   1.00 1.00 ? 120 ALA A CA   6  
ATOM 10472 C C    . ALA A 1 100 ? -4.142  -2.560  3.596   1.00 1.00 ? 120 ALA A C    6  
ATOM 10473 O O    . ALA A 1 100 ? -4.550  -1.436  3.901   1.00 1.00 ? 120 ALA A O    6  
ATOM 10474 C CB   . ALA A 1 100 ? -5.777  -4.511  3.276   1.00 1.00 ? 120 ALA A CB   6  
ATOM 10475 H H    . ALA A 1 100 ? -6.008  -2.856  5.689   1.00 1.00 ? 120 ALA A H    6  
ATOM 10476 H HA   . ALA A 1 100 ? -3.932  -4.553  4.329   1.00 1.00 ? 120 ALA A HA   6  
ATOM 10477 H HB1  . ALA A 1 100 ? -6.254  -5.353  3.785   1.00 1.00 ? 120 ALA A HB1  6  
ATOM 10478 H HB2  . ALA A 1 100 ? -6.542  -3.797  2.967   1.00 1.00 ? 120 ALA A HB2  6  
ATOM 10479 H HB3  . ALA A 1 100 ? -5.282  -4.893  2.380   1.00 1.00 ? 120 ALA A HB3  6  
ATOM 10480 N N    . THR A 1 101 ? -3.173  -2.758  2.690   1.00 1.00 ? 121 THR A N    6  
ATOM 10481 C CA   . THR A 1 101 ? -2.339  -1.718  2.051   1.00 1.00 ? 121 THR A CA   6  
ATOM 10482 C C    . THR A 1 101 ? -2.333  -1.801  0.515   1.00 1.00 ? 121 THR A C    6  
ATOM 10483 O O    . THR A 1 101 ? -2.217  -2.902  -0.039  1.00 1.00 ? 121 THR A O    6  
ATOM 10484 C CB   . THR A 1 101 ? -0.907  -1.775  2.627   1.00 1.00 ? 121 THR A CB   6  
ATOM 10485 O OG1  . THR A 1 101 ? -0.203  -0.633  2.216   1.00 1.00 ? 121 THR A OG1  6  
ATOM 10486 C CG2  . THR A 1 101 ? -0.077  -3.009  2.230   1.00 1.00 ? 121 THR A CG2  6  
ATOM 10487 H H    . THR A 1 101 ? -2.982  -3.721  2.439   1.00 1.00 ? 121 THR A H    6  
ATOM 10488 H HA   . THR A 1 101 ? -2.744  -0.738  2.324   1.00 1.00 ? 121 THR A HA   6  
ATOM 10489 H HB   . THR A 1 101 ? -0.976  -1.747  3.714   1.00 1.00 ? 121 THR A HB   6  
ATOM 10490 H HG1  . THR A 1 101 ? 0.599   -0.584  2.751   1.00 1.00 ? 121 THR A HG1  6  
ATOM 10491 H HG21 . THR A 1 101 ? -0.617  -3.920  2.475   1.00 1.00 ? 121 THR A HG21 6  
ATOM 10492 H HG22 . THR A 1 101 ? 0.144   -3.002  1.161   1.00 1.00 ? 121 THR A HG22 6  
ATOM 10493 H HG23 . THR A 1 101 ? 0.860   -3.015  2.781   1.00 1.00 ? 121 THR A HG23 6  
ATOM 10494 N N    . TYR A 1 102 ? -2.389  -0.673  -0.198  1.00 1.00 ? 122 TYR A N    6  
ATOM 10495 C CA   . TYR A 1 102 ? -2.340  -0.621  -1.663  1.00 1.00 ? 122 TYR A CA   6  
ATOM 10496 C C    . TYR A 1 102 ? -0.870  -0.521  -2.106  1.00 1.00 ? 122 TYR A C    6  
ATOM 10497 O O    . TYR A 1 102 ? -0.239  0.542   -2.033  1.00 1.00 ? 122 TYR A O    6  
ATOM 10498 C CB   . TYR A 1 102 ? -3.171  0.592   -2.123  1.00 1.00 ? 122 TYR A CB   6  
ATOM 10499 C CG   . TYR A 1 102 ? -3.253  0.939   -3.604  1.00 1.00 ? 122 TYR A CG   6  
ATOM 10500 C CD1  . TYR A 1 102 ? -3.294  -0.071  -4.594  1.00 1.00 ? 122 TYR A CD1  6  
ATOM 10501 C CD2  . TYR A 1 102 ? -3.349  2.298   -3.995  1.00 1.00 ? 122 TYR A CD2  6  
ATOM 10502 C CE1  . TYR A 1 102 ? -3.472  0.269   -5.955  1.00 1.00 ? 122 TYR A CE1  6  
ATOM 10503 C CE2  . TYR A 1 102 ? -3.506  2.645   -5.356  1.00 1.00 ? 122 TYR A CE2  6  
ATOM 10504 C CZ   . TYR A 1 102 ? -3.602  1.625   -6.331  1.00 1.00 ? 122 TYR A CZ   6  
ATOM 10505 O OH   . TYR A 1 102 ? -3.846  1.939   -7.632  1.00 1.00 ? 122 TYR A OH   6  
ATOM 10506 H H    . TYR A 1 102 ? -2.570  0.200   0.296   1.00 1.00 ? 122 TYR A H    6  
ATOM 10507 H HA   . TYR A 1 102 ? -2.800  -1.519  -2.075  1.00 1.00 ? 122 TYR A HA   6  
ATOM 10508 H HB2  . TYR A 1 102 ? -4.232  0.404   -1.961  1.00 0.00 ? 122 TYR A HB2  6  
ATOM 10509 H HB3  . TYR A 1 102 ? -2.882  1.484   -1.558  1.00 1.00 ? 122 TYR A HB3  6  
ATOM 10510 H HD1  . TYR A 1 102 ? -3.229  -1.113  -4.316  1.00 1.00 ? 122 TYR A HD1  6  
ATOM 10511 H HD2  . TYR A 1 102 ? -3.338  3.075   -3.240  1.00 1.00 ? 122 TYR A HD2  6  
ATOM 10512 H HE1  . TYR A 1 102 ? -3.513  -0.501  -6.712  1.00 1.00 ? 122 TYR A HE1  6  
ATOM 10513 H HE2  . TYR A 1 102 ? -3.601  3.680   -5.657  1.00 1.00 ? 122 TYR A HE2  6  
ATOM 10514 H HH   . TYR A 1 102 ? -4.626  1.468   -7.949  1.00 1.00 ? 122 TYR A HH   6  
ATOM 10515 N N    . HIS A 1 103 ? -0.353  -1.600  -2.704  1.00 1.00 ? 123 HIS A N    6  
ATOM 10516 C CA   . HIS A 1 103 ? 1.069   -1.735  -3.062  1.00 1.00 ? 123 HIS A CA   6  
ATOM 10517 C C    . HIS A 1 103 ? 1.360   -1.376  -4.532  1.00 1.00 ? 123 HIS A C    6  
ATOM 10518 O O    . HIS A 1 103 ? 1.895   -2.172  -5.304  1.00 1.00 ? 123 HIS A O    6  
ATOM 10519 C CB   . HIS A 1 103 ? 1.606   -3.090  -2.578  1.00 1.00 ? 123 HIS A CB   6  
ATOM 10520 C CG   . HIS A 1 103 ? 3.090   -3.052  -2.307  1.00 1.00 ? 123 HIS A CG   6  
ATOM 10521 N ND1  . HIS A 1 103 ? 3.685   -2.460  -1.211  1.00 1.00 ? 123 HIS A ND1  6  
ATOM 10522 C CD2  . HIS A 1 103 ? 4.076   -3.453  -3.165  1.00 1.00 ? 123 HIS A CD2  6  
ATOM 10523 C CE1  . HIS A 1 103 ? 5.020   -2.503  -1.398  1.00 1.00 ? 123 HIS A CE1  6  
ATOM 10524 N NE2  . HIS A 1 103 ? 5.283   -3.115  -2.576  1.00 1.00 ? 123 HIS A NE2  6  
ATOM 10525 H H    . HIS A 1 103 ? -0.937  -2.422  -2.736  1.00 1.00 ? 123 HIS A H    6  
ATOM 10526 H HA   . HIS A 1 103 ? 1.608   -0.988  -2.475  1.00 1.00 ? 123 HIS A HA   6  
ATOM 10527 H HB2  . HIS A 1 103 ? 1.202   -3.351  -1.600  1.00 0.00 ? 123 HIS A HB2  6  
ATOM 10528 H HB3  . HIS A 1 103 ? 1.340   -3.894  -3.271  1.00 1.00 ? 123 HIS A HB3  6  
ATOM 10529 H HD1  . HIS A 1 103 ? 3.196   -2.003  -0.449  1.00 1.00 ? 123 HIS A HD1  6  
ATOM 10530 H HD2  . HIS A 1 103 ? 3.911   -3.894  -4.144  1.00 1.00 ? 123 HIS A HD2  6  
ATOM 10531 H HE1  . HIS A 1 103 ? 5.757   -2.065  -0.726  1.00 1.00 ? 123 HIS A HE1  6  
ATOM 10532 H HE2  . HIS A 1 103 ? 6.201   -3.267  -2.981  1.00 1.00 ? 123 HIS A HE2  6  
ATOM 10533 N N    . ARG A 1 104 ? 0.983   -0.135  -4.886  1.00 1.00 ? 124 ARG A N    6  
ATOM 10534 C CA   . ARG A 1 104 ? 1.024   0.485   -6.224  1.00 1.00 ? 124 ARG A CA   6  
ATOM 10535 C C    . ARG A 1 104 ? 1.632   1.900   -6.193  1.00 1.00 ? 124 ARG A C    6  
ATOM 10536 O O    . ARG A 1 104 ? 2.661   2.132   -6.817  1.00 1.00 ? 124 ARG A O    6  
ATOM 10537 C CB   . ARG A 1 104 ? -0.417  0.468   -6.789  1.00 1.00 ? 124 ARG A CB   6  
ATOM 10538 C CG   . ARG A 1 104 ? -0.751  -0.546  -7.895  1.00 1.00 ? 124 ARG A CG   6  
ATOM 10539 C CD   . ARG A 1 104 ? -0.707  -2.033  -7.496  1.00 1.00 ? 124 ARG A CD   6  
ATOM 10540 N NE   . ARG A 1 104 ? -1.289  -2.922  -8.530  1.00 1.00 ? 124 ARG A NE   6  
ATOM 10541 C CZ   . ARG A 1 104 ? -0.868  -3.136  -9.763  1.00 1.00 ? 124 ARG A CZ   6  
ATOM 10542 N NH1  . ARG A 1 104 ? 0.235   -2.642  -10.237 1.00 1.00 ? 124 ARG A NH1  6  
ATOM 10543 N NH2  . ARG A 1 104 ? -1.573  -3.862  -10.569 1.00 1.00 ? 124 ARG A NH2  6  
ATOM 10544 H H    . ARG A 1 104 ? 0.559   0.369   -4.115  1.00 1.00 ? 124 ARG A H    6  
ATOM 10545 H HA   . ARG A 1 104 ? 1.679   -0.104  -6.875  1.00 1.00 ? 124 ARG A HA   6  
ATOM 10546 H HB2  . ARG A 1 104 ? -1.138  0.133   -6.043  1.00 0.00 ? 124 ARG A HB2  6  
ATOM 10547 H HB3  . ARG A 1 104 ? -0.731  1.458   -7.120  1.00 1.00 ? 124 ARG A HB3  6  
ATOM 10548 H HG2  . ARG A 1 104 ? -1.802  -0.466  -8.171  1.00 0.00 ? 124 ARG A HG2  6  
ATOM 10549 H HG3  . ARG A 1 104 ? -0.142  -0.353  -8.774  1.00 1.00 ? 124 ARG A HG3  6  
ATOM 10550 H HD2  . ARG A 1 104 ? 0.328   -2.363  -7.394  1.00 0.00 ? 124 ARG A HD2  6  
ATOM 10551 H HD3  . ARG A 1 104 ? -1.219  -2.181  -6.545  1.00 1.00 ? 124 ARG A HD3  6  
ATOM 10552 H HE   . ARG A 1 104 ? -2.060  -3.548  -8.309  1.00 1.00 ? 124 ARG A HE   6  
ATOM 10553 H HH11 . ARG A 1 104 ? 0.830   -2.048  -9.642  1.00 0.00 ? 124 ARG A HH11 6  
ATOM 10554 H HH12 . ARG A 1 104 ? 0.513   -2.843  -11.207 1.00 0.00 ? 124 ARG A HH12 6  
ATOM 10555 H HH21 . ARG A 1 104 ? -2.462  -4.272  -10.248 1.00 0.00 ? 124 ARG A HH21 6  
ATOM 10556 H HH22 . ARG A 1 104 ? -1.247  -4.029  -11.531 1.00 0.00 ? 124 ARG A HH22 6  
ATOM 10557 N N    . ALA A 1 105 ? 1.000   2.835   -5.465  1.00 1.00 ? 125 ALA A N    6  
ATOM 10558 C CA   . ALA A 1 105 ? 1.354   4.265   -5.399  1.00 1.00 ? 125 ALA A CA   6  
ATOM 10559 C C    . ALA A 1 105 ? 2.625   4.628   -4.581  1.00 1.00 ? 125 ALA A C    6  
ATOM 10560 O O    . ALA A 1 105 ? 3.114   5.742   -4.743  1.00 1.00 ? 125 ALA A O    6  
ATOM 10561 C CB   . ALA A 1 105 ? 0.120   5.029   -4.883  1.00 1.00 ? 125 ALA A CB   6  
ATOM 10562 H H    . ALA A 1 105 ? 0.161   2.538   -4.991  1.00 1.00 ? 125 ALA A H    6  
ATOM 10563 H HA   . ALA A 1 105 ? 1.547   4.609   -6.417  1.00 1.00 ? 125 ALA A HA   6  
ATOM 10564 H HB1  . ALA A 1 105 ? -0.739  4.847   -5.532  1.00 1.00 ? 125 ALA A HB1  6  
ATOM 10565 H HB2  . ALA A 1 105 ? -0.126  4.721   -3.863  1.00 1.00 ? 125 ALA A HB2  6  
ATOM 10566 H HB3  . ALA A 1 105 ? 0.325   6.101   -4.880  1.00 1.00 ? 125 ALA A HB3  6  
ATOM 10567 N N    . ILE A 1 106 ? 3.142   3.710   -3.741  1.00 1.00 ? 126 ILE A N    6  
ATOM 10568 C CA   . ILE A 1 106 ? 4.291   3.764   -2.796  1.00 1.00 ? 126 ILE A CA   6  
ATOM 10569 C C    . ILE A 1 106 ? 4.855   5.186   -2.544  1.00 1.00 ? 126 ILE A C    6  
ATOM 10570 O O    . ILE A 1 106 ? 4.436   5.865   -1.604  1.00 1.00 ? 126 ILE A O    6  
ATOM 10571 C CB   . ILE A 1 106 ? 5.396   2.731   -3.185  1.00 1.00 ? 126 ILE A CB   6  
ATOM 10572 C CG1  . ILE A 1 106 ? 4.857   1.346   -3.615  1.00 1.00 ? 126 ILE A CG1  6  
ATOM 10573 C CG2  . ILE A 1 106 ? 6.442   2.572   -2.059  1.00 1.00 ? 126 ILE A CG2  6  
ATOM 10574 C CD1  . ILE A 1 106 ? 3.939   0.610   -2.635  1.00 1.00 ? 126 ILE A CD1  6  
ATOM 10575 H H    . ILE A 1 106 ? 2.644   2.836   -3.738  1.00 1.00 ? 126 ILE A H    6  
ATOM 10576 H HA   . ILE A 1 106 ? 3.898   3.441   -1.831  1.00 1.00 ? 126 ILE A HA   6  
ATOM 10577 H HB   . ILE A 1 106 ? 5.920   3.113   -4.063  1.00 1.00 ? 126 ILE A HB   6  
ATOM 10578 H HG12 . ILE A 1 106 ? 4.168   1.446   -4.453  1.00 0.00 ? 126 ILE A HG12 6  
ATOM 10579 H HG13 . ILE A 1 106 ? 5.677   0.693   -3.921  1.00 1.00 ? 126 ILE A HG13 6  
ATOM 10580 H HG21 . ILE A 1 106 ? 6.930   3.525   -1.840  1.00 1.00 ? 126 ILE A HG21 6  
ATOM 10581 H HG22 . ILE A 1 106 ? 5.971   2.218   -1.138  1.00 1.00 ? 126 ILE A HG22 6  
ATOM 10582 H HG23 . ILE A 1 106 ? 7.214   1.859   -2.353  1.00 1.00 ? 126 ILE A HG23 6  
ATOM 10583 H HD11 . ILE A 1 106 ? 4.460   0.416   -1.697  1.00 1.00 ? 126 ILE A HD11 6  
ATOM 10584 H HD12 . ILE A 1 106 ? 3.041   1.197   -2.438  1.00 1.00 ? 126 ILE A HD12 6  
ATOM 10585 H HD13 . ILE A 1 106 ? 3.649   -0.335  -3.089  1.00 1.00 ? 126 ILE A HD13 6  
ATOM 10586 N N    . LYS A 1 107 ? 5.791   5.654   -3.395  1.00 1.00 ? 127 LYS A N    6  
ATOM 10587 C CA   . LYS A 1 107 ? 6.391   6.996   -3.383  1.00 1.00 ? 127 LYS A CA   6  
ATOM 10588 C C    . LYS A 1 107 ? 5.445   8.018   -4.043  1.00 1.00 ? 127 LYS A C    6  
ATOM 10589 O O    . LYS A 1 107 ? 5.407   8.164   -5.265  1.00 1.00 ? 127 LYS A O    6  
ATOM 10590 C CB   . LYS A 1 107 ? 7.788   6.945   -4.036  1.00 1.00 ? 127 LYS A CB   6  
ATOM 10591 C CG   . LYS A 1 107 ? 8.552   8.278   -4.001  1.00 1.00 ? 127 LYS A CG   6  
ATOM 10592 C CD   . LYS A 1 107 ? 8.835   8.736   -2.568  1.00 1.00 ? 127 LYS A CD   6  
ATOM 10593 C CE   . LYS A 1 107 ? 9.340   10.181  -2.527  1.00 1.00 ? 127 LYS A CE   6  
ATOM 10594 N NZ   . LYS A 1 107 ? 9.496   10.647  -1.135  1.00 1.00 ? 127 LYS A NZ   6  
ATOM 10595 H H    . LYS A 1 107 ? 6.048   5.035   -4.147  1.00 1.00 ? 127 LYS A H    6  
ATOM 10596 H HA   . LYS A 1 107 ? 6.537   7.285   -2.342  1.00 1.00 ? 127 LYS A HA   6  
ATOM 10597 H HB2  . LYS A 1 107 ? 8.452   6.279   -3.484  1.00 0.00 ? 127 LYS A HB2  6  
ATOM 10598 H HB3  . LYS A 1 107 ? 7.726   6.583   -5.064  1.00 1.00 ? 127 LYS A HB3  6  
ATOM 10599 H HG2  . LYS A 1 107 ? 9.535   8.158   -4.455  1.00 0.00 ? 127 LYS A HG2  6  
ATOM 10600 H HG3  . LYS A 1 107 ? 8.000   9.042   -4.552  1.00 1.00 ? 127 LYS A HG3  6  
ATOM 10601 H HD2  . LYS A 1 107 ? 7.910   8.717   -1.992  1.00 0.00 ? 127 LYS A HD2  6  
ATOM 10602 H HD3  . LYS A 1 107 ? 9.562   8.064   -2.110  1.00 1.00 ? 127 LYS A HD3  6  
ATOM 10603 H HE2  . LYS A 1 107 ? 10.327  10.230  -2.989  1.00 0.00 ? 127 LYS A HE2  6  
ATOM 10604 H HE3  . LYS A 1 107 ? 8.645   10.821  -3.076  1.00 1.00 ? 127 LYS A HE3  6  
ATOM 10605 H HZ1  . LYS A 1 107 ? 9.447   11.675  -1.110  1.00 0.00 ? 127 LYS A HZ1  6  
ATOM 10606 H HZ2  . LYS A 1 107 ? 8.741   10.254  -0.555  1.00 0.00 ? 127 LYS A HZ2  6  
ATOM 10607 N N    . ILE A 1 108 ? 4.689   8.727   -3.192  1.00 1.00 ? 128 ILE A N    6  
ATOM 10608 C CA   . ILE A 1 108 ? 3.690   9.740   -3.569  1.00 1.00 ? 128 ILE A CA   6  
ATOM 10609 C C    . ILE A 1 108 ? 4.293   11.163  -3.622  1.00 1.00 ? 128 ILE A C    6  
ATOM 10610 O O    . ILE A 1 108 ? 5.343   11.466  -3.052  1.00 1.00 ? 128 ILE A O    6  
ATOM 10611 C CB   . ILE A 1 108 ? 2.395   9.669   -2.698  1.00 1.00 ? 128 ILE A CB   6  
ATOM 10612 C CG1  . ILE A 1 108 ? 2.308   10.690  -1.538  1.00 1.00 ? 128 ILE A CG1  6  
ATOM 10613 C CG2  . ILE A 1 108 ? 1.982   8.252   -2.241  1.00 1.00 ? 128 ILE A CG2  6  
ATOM 10614 C CD1  . ILE A 1 108 ? 3.343   10.631  -0.414  1.00 1.00 ? 128 ILE A CD1  6  
ATOM 10615 H H    . ILE A 1 108 ? 4.776   8.477   -2.220  1.00 1.00 ? 128 ILE A H    6  
ATOM 10616 H HA   . ILE A 1 108 ? 3.388   9.500   -4.584  1.00 1.00 ? 128 ILE A HA   6  
ATOM 10617 H HB   . ILE A 1 108 ? 1.594   9.981   -3.364  1.00 1.00 ? 128 ILE A HB   6  
ATOM 10618 H HG12 . ILE A 1 108 ? 2.531   11.693  -1.902  1.00 0.00 ? 128 ILE A HG12 6  
ATOM 10619 H HG13 . ILE A 1 108 ? 1.309   10.688  -1.112  1.00 1.00 ? 128 ILE A HG13 6  
ATOM 10620 H HG21 . ILE A 1 108 ? 1.974   7.572   -3.091  1.00 1.00 ? 128 ILE A HG21 6  
ATOM 10621 H HG22 . ILE A 1 108 ? 2.687   7.873   -1.500  1.00 1.00 ? 128 ILE A HG22 6  
ATOM 10622 H HG23 . ILE A 1 108 ? 0.986   8.267   -1.796  1.00 1.00 ? 128 ILE A HG23 6  
ATOM 10623 H HD11 . ILE A 1 108 ? 4.342   10.774  -0.818  1.00 1.00 ? 128 ILE A HD11 6  
ATOM 10624 H HD12 . ILE A 1 108 ? 3.150   11.433  0.297   1.00 1.00 ? 128 ILE A HD12 6  
ATOM 10625 H HD13 . ILE A 1 108 ? 3.287   9.673   0.102   1.00 1.00 ? 128 ILE A HD13 6  
ATOM 10626 N N    . THR A 1 109 ? 3.571   12.051  -4.310  1.00 1.00 ? 129 THR A N    6  
ATOM 10627 C CA   . THR A 1 109 ? 3.999   13.424  -4.644  1.00 1.00 ? 129 THR A CA   6  
ATOM 10628 C C    . THR A 1 109 ? 3.335   14.490  -3.752  1.00 1.00 ? 129 THR A C    6  
ATOM 10629 O O    . THR A 1 109 ? 2.109   14.571  -3.678  1.00 1.00 ? 129 THR A O    6  
ATOM 10630 C CB   . THR A 1 109 ? 3.727   13.746  -6.137  1.00 1.00 ? 129 THR A CB   6  
ATOM 10631 O OG1  . THR A 1 109 ? 3.795   12.622  -7.001  1.00 1.00 ? 129 THR A OG1  6  
ATOM 10632 C CG2  . THR A 1 109 ? 4.758   14.754  -6.638  1.00 1.00 ? 129 THR A CG2  6  
ATOM 10633 H H    . THR A 1 109 ? 2.763   11.668  -4.791  1.00 1.00 ? 129 THR A H    6  
ATOM 10634 H HA   . THR A 1 109 ? 5.079   13.467  -4.484  1.00 1.00 ? 129 THR A HA   6  
ATOM 10635 H HB   . THR A 1 109 ? 2.730   14.174  -6.243  1.00 1.00 ? 129 THR A HB   6  
ATOM 10636 H HG1  . THR A 1 109 ? 3.083   12.003  -6.728  1.00 1.00 ? 129 THR A HG1  6  
ATOM 10637 H HG21 . THR A 1 109 ? 5.769   14.372  -6.486  1.00 1.00 ? 129 THR A HG21 6  
ATOM 10638 H HG22 . THR A 1 109 ? 4.612   14.899  -7.699  1.00 1.00 ? 129 THR A HG22 6  
ATOM 10639 H HG23 . THR A 1 109 ? 4.644   15.707  -6.123  1.00 1.00 ? 129 THR A HG23 6  
ATOM 10640 N N    . VAL A 1 110 ? 4.148   15.340  -3.103  1.00 1.00 ? 130 VAL A N    6  
ATOM 10641 C CA   . VAL A 1 110 ? 3.697   16.399  -2.164  1.00 1.00 ? 130 VAL A CA   6  
ATOM 10642 C C    . VAL A 1 110 ? 2.987   17.558  -2.896  1.00 1.00 ? 130 VAL A C    6  
ATOM 10643 O O    . VAL A 1 110 ? 1.836   17.845  -2.570  1.00 1.00 ? 130 VAL A O    6  
ATOM 10644 C CB   . VAL A 1 110 ? 4.851   16.887  -1.243  1.00 1.00 ? 130 VAL A CB   6  
ATOM 10645 C CG1  . VAL A 1 110 ? 4.379   17.929  -0.209  1.00 1.00 ? 130 VAL A CG1  6  
ATOM 10646 C CG2  . VAL A 1 110 ? 5.475   15.709  -0.459  1.00 1.00 ? 130 VAL A CG2  6  
ATOM 10647 H H    . VAL A 1 110 ? 5.141   15.201  -3.211  1.00 1.00 ? 130 VAL A H    6  
ATOM 10648 H HA   . VAL A 1 110 ? 2.945   15.955  -1.508  1.00 1.00 ? 130 VAL A HA   6  
ATOM 10649 H HB   . VAL A 1 110 ? 5.636   17.342  -1.853  1.00 1.00 ? 130 VAL A HB   6  
ATOM 10650 H HG11 . VAL A 1 110 ? 3.584   17.511  0.410   1.00 1.00 ? 130 VAL A HG11 6  
ATOM 10651 H HG12 . VAL A 1 110 ? 5.212   18.228  0.429   1.00 1.00 ? 130 VAL A HG12 6  
ATOM 10652 H HG13 . VAL A 1 110 ? 4.003   18.822  -0.710  1.00 1.00 ? 130 VAL A HG13 6  
ATOM 10653 H HG21 . VAL A 1 110 ? 4.720   15.215  0.156   1.00 1.00 ? 130 VAL A HG21 6  
ATOM 10654 H HG22 . VAL A 1 110 ? 5.895   14.970  -1.142  1.00 1.00 ? 130 VAL A HG22 6  
ATOM 10655 H HG23 . VAL A 1 110 ? 6.283   16.058  0.188   1.00 1.00 ? 130 VAL A HG23 6  
ATOM 10656 N N    . ASP A 1 111 ? 3.654   18.204  -3.870  1.00 1.00 ? 131 ASP A N    6  
ATOM 10657 C CA   . ASP A 1 111 ? 3.109   19.245  -4.761  1.00 1.00 ? 131 ASP A CA   6  
ATOM 10658 C C    . ASP A 1 111 ? 2.700   18.693  -6.152  1.00 1.00 ? 131 ASP A C    6  
ATOM 10659 O O    . ASP A 1 111 ? 1.512   18.566  -6.423  1.00 1.00 ? 131 ASP A O    6  
ATOM 10660 C CB   . ASP A 1 111 ? 4.137   20.388  -4.833  1.00 1.00 ? 131 ASP A CB   6  
ATOM 10661 C CG   . ASP A 1 111 ? 3.633   21.698  -5.458  1.00 1.00 ? 131 ASP A CG   6  
ATOM 10662 O OD1  . ASP A 1 111 ? 2.432   21.999  -5.292  1.00 1.00 ? 131 ASP A OD1  6  
ATOM 10663 O OD2  . ASP A 1 111 ? 4.482   22.397  -6.050  1.00 1.00 ? 131 ASP A OD2  6  
ATOM 10664 H H    . ASP A 1 111 ? 4.618   17.949  -3.999  1.00 1.00 ? 131 ASP A H    6  
ATOM 10665 H HA   . ASP A 1 111 ? 2.206   19.651  -4.300  1.00 1.00 ? 131 ASP A HA   6  
ATOM 10666 H HB2  . ASP A 1 111 ? 4.455   20.619  -3.817  1.00 0.00 ? 131 ASP A HB2  6  
ATOM 10667 H HB3  . ASP A 1 111 ? 5.053   20.047  -5.319  1.00 1.00 ? 131 ASP A HB3  6  
ATOM 10668 N N    . GLY A 1 112 ? 3.661   18.310  -7.009  1.00 1.00 ? 132 GLY A N    6  
ATOM 10669 C CA   . GLY A 1 112 ? 3.457   17.677  -8.327  1.00 1.00 ? 132 GLY A CA   6  
ATOM 10670 C C    . GLY A 1 112 ? 4.771   17.206  -9.013  1.00 1.00 ? 132 GLY A C    6  
ATOM 10671 O O    . GLY A 1 112 ? 5.836   17.730  -8.672  1.00 1.00 ? 132 GLY A O    6  
ATOM 10672 H H    . GLY A 1 112 ? 4.615   18.516  -6.757  1.00 1.00 ? 132 GLY A H    6  
ATOM 10673 H HA2  . GLY A 1 112 ? 2.784   16.834  -8.183  1.00 1.00 ? 132 GLY A HA2  6  
ATOM 10674 H HA3  . GLY A 1 112 ? 2.967   18.388  -8.994  1.00 1.00 ? 132 GLY A HA3  6  
ATOM 10675 N N    . PRO A 1 113 ? 4.733   16.223  -9.952  1.00 1.00 ? 133 PRO A N    6  
ATOM 10676 C CA   . PRO A 1 113 ? 5.917   15.771  -10.708 1.00 1.00 ? 133 PRO A CA   6  
ATOM 10677 C C    . PRO A 1 113 ? 6.468   16.794  -11.730 1.00 1.00 ? 133 PRO A C    6  
ATOM 10678 O O    . PRO A 1 113 ? 5.754   17.689  -12.185 1.00 1.00 ? 133 PRO A O    6  
ATOM 10679 C CB   . PRO A 1 113 ? 5.493   14.491  -11.436 1.00 1.00 ? 133 PRO A CB   6  
ATOM 10680 C CG   . PRO A 1 113 ? 4.137   14.083  -10.859 1.00 1.00 ? 133 PRO A CG   6  
ATOM 10681 C CD   . PRO A 1 113 ? 3.583   15.386  -10.281 1.00 1.00 ? 133 PRO A CD   6  
ATOM 10682 H HA   . PRO A 1 113 ? 6.704   15.525  -9.992  1.00 1.00 ? 133 PRO A HA   6  
ATOM 10683 H HB2  . PRO A 1 113 ? 5.426   14.736  -12.495 1.00 0.00 ? 133 PRO A HB2  6  
ATOM 10684 H HB3  . PRO A 1 113 ? 6.229   13.698  -11.305 1.00 1.00 ? 133 PRO A HB3  6  
ATOM 10685 H HG2  . PRO A 1 113 ? 3.531   13.631  -11.643 1.00 0.00 ? 133 PRO A HG2  6  
ATOM 10686 H HG3  . PRO A 1 113 ? 4.287   13.361  -10.052 1.00 1.00 ? 133 PRO A HG3  6  
ATOM 10687 H HD2  . PRO A 1 113 ? 2.916   15.867  -10.996 1.00 0.00 ? 133 PRO A HD2  6  
ATOM 10688 H HD3  . PRO A 1 113 ? 2.983   15.148  -9.401  1.00 1.00 ? 133 PRO A HD3  6  
ATOM 10689 N N    . ARG A 1 114 ? 7.745   16.616  -12.125 1.00 1.00 ? 134 ARG A N    6  
ATOM 10690 C CA   . ARG A 1 114 ? 8.527   17.488  -13.038 1.00 1.00 ? 134 ARG A CA   6  
ATOM 10691 C C    . ARG A 1 114 ? 9.452   16.754  -14.035 1.00 1.00 ? 134 ARG A C    6  
ATOM 10692 O O    . ARG A 1 114 ? 9.497   17.129  -15.207 1.00 1.00 ? 134 ARG A O    6  
ATOM 10693 C CB   . ARG A 1 114 ? 9.324   18.495  -12.190 1.00 1.00 ? 134 ARG A CB   6  
ATOM 10694 C CG   . ARG A 1 114 ? 10.086  19.538  -13.025 1.00 1.00 ? 134 ARG A CG   6  
ATOM 10695 C CD   . ARG A 1 114 ? 11.518  19.131  -13.401 1.00 1.00 ? 134 ARG A CD   6  
ATOM 10696 N NE   . ARG A 1 114 ? 11.718  19.087  -14.858 1.00 1.00 ? 134 ARG A NE   6  
ATOM 10697 C CZ   . ARG A 1 114 ? 12.831  19.381  -15.508 1.00 1.00 ? 134 ARG A CZ   6  
ATOM 10698 N NH1  . ARG A 1 114 ? 13.928  19.774  -14.928 1.00 1.00 ? 134 ARG A NH1  6  
ATOM 10699 N NH2  . ARG A 1 114 ? 12.866  19.301  -16.803 1.00 1.00 ? 134 ARG A NH2  6  
ATOM 10700 H H    . ARG A 1 114 ? 8.214   15.837  -11.692 1.00 1.00 ? 134 ARG A H    6  
ATOM 10701 H HA   . ARG A 1 114 ? 7.821   18.062  -13.644 1.00 1.00 ? 134 ARG A HA   6  
ATOM 10702 H HB2  . ARG A 1 114 ? 8.665   19.149  -11.618 1.00 0.00 ? 134 ARG A HB2  6  
ATOM 10703 H HB3  . ARG A 1 114 ? 9.979   17.991  -11.476 1.00 1.00 ? 134 ARG A HB3  6  
ATOM 10704 H HG2  . ARG A 1 114 ? 9.587   19.675  -13.984 1.00 0.00 ? 134 ARG A HG2  6  
ATOM 10705 H HG3  . ARG A 1 114 ? 10.109  20.487  -12.494 1.00 1.00 ? 134 ARG A HG3  6  
ATOM 10706 H HD2  . ARG A 1 114 ? 12.244  19.862  -13.045 1.00 0.00 ? 134 ARG A HD2  6  
ATOM 10707 H HD3  . ARG A 1 114 ? 11.783  18.164  -12.965 1.00 1.00 ? 134 ARG A HD3  6  
ATOM 10708 H HE   . ARG A 1 114 ? 10.981  18.655  -15.402 1.00 1.00 ? 134 ARG A HE   6  
ATOM 10709 H HH11 . ARG A 1 114 ? 13.963  19.874  -13.903 1.00 0.00 ? 134 ARG A HH11 6  
ATOM 10710 H HH12 . ARG A 1 114 ? 14.762  19.987  -15.495 1.00 0.00 ? 134 ARG A HH12 6  
ATOM 10711 H HH21 . ARG A 1 114 ? 12.027  19.010  -17.324 1.00 0.00 ? 134 ARG A HH21 6  
ATOM 10712 H HH22 . ARG A 1 114 ? 13.734  19.529  -17.310 1.00 0.00 ? 134 ARG A HH22 6  
ATOM 10713 N N    . GLU A 1 115 ? 10.229  15.784  -13.541 1.00 1.00 ? 135 GLU A N    6  
ATOM 10714 C CA   . GLU A 1 115 ? 11.109  14.808  -14.223 1.00 1.00 ? 135 GLU A CA   6  
ATOM 10715 C C    . GLU A 1 115 ? 11.321  13.543  -13.353 1.00 1.00 ? 135 GLU A C    6  
ATOM 10716 O O    . GLU A 1 115 ? 11.415  12.458  -13.966 1.00 1.00 ? 135 GLU A O    6  
ATOM 10717 C CB   . GLU A 1 115 ? 12.441  15.425  -14.702 1.00 1.00 ? 135 GLU A CB   6  
ATOM 10718 C CG   . GLU A 1 115 ? 13.419  16.010  -13.670 1.00 1.00 ? 135 GLU A CG   6  
ATOM 10719 C CD   . GLU A 1 115 ? 14.830  16.249  -14.252 1.00 1.00 ? 135 GLU A CD   6  
ATOM 10720 O OE1  . GLU A 1 115 ? 15.056  17.360  -14.784 1.00 1.00 ? 135 GLU A OE1  6  
ATOM 10721 O OE2  . GLU A 1 115 ? 15.671  15.331  -14.157 1.00 1.00 ? 135 GLU A OE2  6  
ATOM 10722 O OXT  . GLU A 1 115 ? 11.284  13.674  -12.109 1.00 1.00 ? 135 GLU A OXT  6  
ATOM 10723 H H    . GLU A 1 115 ? 10.161  15.583  -12.555 1.00 1.00 ? 135 GLU A H    6  
ATOM 10724 H HA   . GLU A 1 115 ? 10.594  14.438  -15.106 1.00 1.00 ? 135 GLU A HA   6  
ATOM 10725 H HB2  . GLU A 1 115 ? 13.097  14.640  -15.080 1.00 0.00 ? 135 GLU A HB2  6  
ATOM 10726 H HB3  . GLU A 1 115 ? 12.249  16.147  -15.500 1.00 1.00 ? 135 GLU A HB3  6  
ATOM 10727 H HG2  . GLU A 1 115 ? 13.146  17.020  -13.366 1.00 0.00 ? 135 GLU A HG2  6  
ATOM 10728 H HG3  . GLU A 1 115 ? 13.464  15.415  -12.756 1.00 1.00 ? 135 GLU A HG3  6  
ATOM 10729 N N    . GLU A 1 1   ? -5.913  -10.433 -11.681 1.00 1.00 ? 21  GLU A N    7  
ATOM 10730 C CA   . GLU A 1 1   ? -5.557  -9.629  -10.480 1.00 1.00 ? 21  GLU A CA   7  
ATOM 10731 C C    . GLU A 1 1   ? -6.200  -8.238  -10.525 1.00 1.00 ? 21  GLU A C    7  
ATOM 10732 O O    . GLU A 1 1   ? -6.339  -7.696  -11.618 1.00 1.00 ? 21  GLU A O    7  
ATOM 10733 C CB   . GLU A 1 1   ? -4.042  -9.526  -10.337 1.00 1.00 ? 21  GLU A CB   7  
ATOM 10734 C CG   . GLU A 1 1   ? -3.660  -9.105  -8.927  1.00 1.00 ? 21  GLU A CG   7  
ATOM 10735 C CD   . GLU A 1 1   ? -2.150  -9.178  -8.815  1.00 1.00 ? 21  GLU A CD   7  
ATOM 10736 O OE1  . GLU A 1 1   ? -1.663  -10.318 -8.666  1.00 1.00 ? 21  GLU A OE1  7  
ATOM 10737 O OE2  . GLU A 1 1   ? -1.525  -8.101  -8.808  1.00 1.00 ? 21  GLU A OE2  7  
ATOM 10738 H H1   . GLU A 1 1   ? -6.274  -9.810  -12.418 1.00 0.00 ? 21  GLU A H1   7  
ATOM 10739 H H2   . GLU A 1 1   ? -5.077  -10.925 -12.027 1.00 0.00 ? 21  GLU A H2   7  
ATOM 10740 H HA   . GLU A 1 1   ? -5.926  -10.147 -9.595  1.00 1.00 ? 21  GLU A HA   7  
ATOM 10741 H HB2  . GLU A 1 1   ? -3.562  -10.488 -10.514 1.00 0.00 ? 21  GLU A HB2  7  
ATOM 10742 H HB3  . GLU A 1 1   ? -3.623  -8.813  -11.049 1.00 1.00 ? 21  GLU A HB3  7  
ATOM 10743 H HG2  . GLU A 1 1   ? -4.003  -8.086  -8.752  1.00 0.00 ? 21  GLU A HG2  7  
ATOM 10744 H HG3  . GLU A 1 1   ? -4.132  -9.780  -8.211  1.00 1.00 ? 21  GLU A HG3  7  
ATOM 10745 N N    . LEU A 1 2   ? -6.630  -7.707  -9.368  1.00 1.00 ? 22  LEU A N    7  
ATOM 10746 C CA   . LEU A 1 2   ? -7.596  -6.620  -9.168  1.00 1.00 ? 22  LEU A CA   7  
ATOM 10747 C C    . LEU A 1 2   ? -7.188  -5.906  -7.858  1.00 1.00 ? 22  LEU A C    7  
ATOM 10748 O O    . LEU A 1 2   ? -6.084  -6.188  -7.358  1.00 1.00 ? 22  LEU A O    7  
ATOM 10749 C CB   . LEU A 1 2   ? -9.004  -7.255  -9.145  1.00 1.00 ? 22  LEU A CB   7  
ATOM 10750 C CG   . LEU A 1 2   ? -9.941  -7.070  -10.366 1.00 1.00 ? 22  LEU A CG   7  
ATOM 10751 C CD1  . LEU A 1 2   ? -10.515 -5.654  -10.379 1.00 1.00 ? 22  LEU A CD1  7  
ATOM 10752 C CD2  . LEU A 1 2   ? -9.319  -7.373  -11.730 1.00 1.00 ? 22  LEU A CD2  7  
ATOM 10753 H H    . LEU A 1 2   ? -6.268  -7.944  -8.425  1.00 1.00 ? 22  LEU A H    7  
ATOM 10754 H HA   . LEU A 1 2   ? -7.528  -5.890  -9.980  1.00 1.00 ? 22  LEU A HA   7  
ATOM 10755 H HB2  . LEU A 1 2   ? -8.941  -8.343  -9.189  1.00 0.00 ? 22  LEU A HB2  7  
ATOM 10756 H HB3  . LEU A 1 2   ? -9.536  -6.985  -8.234  1.00 1.00 ? 22  LEU A HB3  7  
ATOM 10757 H HG   . LEU A 1 2   ? -10.768 -7.773  -10.245 1.00 1.00 ? 22  LEU A HG   7  
ATOM 10758 H HD11 . LEU A 1 2   ? -11.036 -5.481  -9.439  1.00 1.00 ? 22  LEU A HD11 7  
ATOM 10759 H HD12 . LEU A 1 2   ? -9.719  -4.917  -10.501 1.00 1.00 ? 22  LEU A HD12 7  
ATOM 10760 H HD13 . LEU A 1 2   ? -11.233 -5.547  -11.191 1.00 1.00 ? 22  LEU A HD13 7  
ATOM 10761 H HD21 . LEU A 1 2   ? -8.876  -8.367  -11.725 1.00 1.00 ? 22  LEU A HD21 7  
ATOM 10762 H HD22 . LEU A 1 2   ? -10.090 -7.340  -12.500 1.00 1.00 ? 22  LEU A HD22 7  
ATOM 10763 H HD23 . LEU A 1 2   ? -8.560  -6.626  -11.967 1.00 1.00 ? 22  LEU A HD23 7  
ATOM 10764 N N    . VAL A 1 3   ? -7.937  -4.929  -7.311  1.00 1.00 ? 23  VAL A N    7  
ATOM 10765 C CA   . VAL A 1 3   ? -7.567  -4.431  -5.957  1.00 1.00 ? 23  VAL A CA   7  
ATOM 10766 C C    . VAL A 1 3   ? -7.958  -5.525  -4.922  1.00 1.00 ? 23  VAL A C    7  
ATOM 10767 O O    . VAL A 1 3   ? -8.891  -5.370  -4.128  1.00 1.00 ? 23  VAL A O    7  
ATOM 10768 C CB   . VAL A 1 3   ? -8.116  -3.008  -5.681  1.00 1.00 ? 23  VAL A CB   7  
ATOM 10769 C CG1  . VAL A 1 3   ? -7.667  -2.461  -4.314  1.00 1.00 ? 23  VAL A CG1  7  
ATOM 10770 C CG2  . VAL A 1 3   ? -7.696  -1.997  -6.770  1.00 1.00 ? 23  VAL A CG2  7  
ATOM 10771 H H    . VAL A 1 3   ? -8.877  -4.722  -7.641  1.00 1.00 ? 23  VAL A H    7  
ATOM 10772 H HA   . VAL A 1 3   ? -6.482  -4.323  -5.897  1.00 1.00 ? 23  VAL A HA   7  
ATOM 10773 H HB   . VAL A 1 3   ? -9.193  -3.045  -5.687  1.00 1.00 ? 23  VAL A HB   7  
ATOM 10774 H HG11 . VAL A 1 3   ? -6.585  -2.510  -4.227  1.00 1.00 ? 23  VAL A HG11 7  
ATOM 10775 H HG12 . VAL A 1 3   ? -7.992  -1.424  -4.189  1.00 1.00 ? 23  VAL A HG12 7  
ATOM 10776 H HG13 . VAL A 1 3   ? -8.113  -3.041  -3.508  1.00 1.00 ? 23  VAL A HG13 7  
ATOM 10777 H HG21 . VAL A 1 3   ? -6.611  -1.967  -6.864  1.00 1.00 ? 23  VAL A HG21 7  
ATOM 10778 H HG22 . VAL A 1 3   ? -8.126  -2.281  -7.734  1.00 1.00 ? 23  VAL A HG22 7  
ATOM 10779 H HG23 . VAL A 1 3   ? -8.069  -0.998  -6.528  1.00 1.00 ? 23  VAL A HG23 7  
ATOM 10780 N N    . ARG A 1 4   ? -7.189  -6.635  -4.946  1.00 1.00 ? 24  ARG A N    7  
ATOM 10781 C CA   . ARG A 1 4   ? -7.175  -7.762  -3.984  1.00 1.00 ? 24  ARG A CA   7  
ATOM 10782 C C    . ARG A 1 4   ? -5.843  -7.714  -3.212  1.00 1.00 ? 24  ARG A C    7  
ATOM 10783 O O    . ARG A 1 4   ? -4.781  -7.701  -3.839  1.00 1.00 ? 24  ARG A O    7  
ATOM 10784 C CB   . ARG A 1 4   ? -7.428  -9.108  -4.709  1.00 1.00 ? 24  ARG A CB   7  
ATOM 10785 C CG   . ARG A 1 4   ? -6.347  -9.652  -5.660  1.00 1.00 ? 24  ARG A CG   7  
ATOM 10786 C CD   . ARG A 1 4   ? -5.280  -10.447 -4.892  1.00 1.00 ? 24  ARG A CD   7  
ATOM 10787 N NE   . ARG A 1 4   ? -4.037  -10.702 -5.652  1.00 1.00 ? 24  ARG A NE   7  
ATOM 10788 C CZ   . ARG A 1 4   ? -2.860  -10.136 -5.414  1.00 1.00 ? 24  ARG A CZ   7  
ATOM 10789 N NH1  . ARG A 1 4   ? -2.652  -9.183  -4.562  1.00 1.00 ? 24  ARG A NH1  7  
ATOM 10790 N NH2  . ARG A 1 4   ? -1.785  -10.459 -6.049  1.00 1.00 ? 24  ARG A NH2  7  
ATOM 10791 H H    . ARG A 1 4   ? -6.635  -6.768  -5.823  1.00 1.00 ? 24  ARG A H    7  
ATOM 10792 H HA   . ARG A 1 4   ? -7.991  -7.621  -3.267  1.00 1.00 ? 24  ARG A HA   7  
ATOM 10793 H HB2  . ARG A 1 4   ? -7.444  -9.917  -3.980  1.00 0.00 ? 24  ARG A HB2  7  
ATOM 10794 H HB3  . ARG A 1 4   ? -8.386  -9.069  -5.228  1.00 1.00 ? 24  ARG A HB3  7  
ATOM 10795 H HG2  . ARG A 1 4   ? -6.800  -10.347 -6.367  1.00 0.00 ? 24  ARG A HG2  7  
ATOM 10796 H HG3  . ARG A 1 4   ? -5.893  -8.829  -6.204  1.00 1.00 ? 24  ARG A HG3  7  
ATOM 10797 H HD2  . ARG A 1 4   ? -4.887  -9.877  -4.051  1.00 0.00 ? 24  ARG A HD2  7  
ATOM 10798 H HD3  . ARG A 1 4   ? -5.685  -11.378 -4.495  1.00 1.00 ? 24  ARG A HD3  7  
ATOM 10799 H HE   . ARG A 1 4   ? -4.014  -11.461 -6.316  1.00 1.00 ? 24  ARG A HE   7  
ATOM 10800 H HH11 . ARG A 1 4   ? -3.434  -8.807  -4.009  1.00 0.00 ? 24  ARG A HH11 7  
ATOM 10801 H HH12 . ARG A 1 4   ? -1.703  -8.800  -4.439  1.00 0.00 ? 24  ARG A HH12 7  
ATOM 10802 H HH21 . ARG A 1 4   ? -1.817  -11.186 -6.779  1.00 0.00 ? 24  ARG A HH21 7  
ATOM 10803 H HH22 . ARG A 1 4   ? -0.895  -9.991  -5.827  1.00 0.00 ? 24  ARG A HH22 7  
ATOM 10804 N N    . THR A 1 5   ? -5.865  -7.642  -1.873  1.00 1.00 ? 25  THR A N    7  
ATOM 10805 C CA   . THR A 1 5   ? -4.642  -7.438  -1.054  1.00 1.00 ? 25  THR A CA   7  
ATOM 10806 C C    . THR A 1 5   ? -4.493  -8.455  0.094   1.00 1.00 ? 25  THR A C    7  
ATOM 10807 O O    . THR A 1 5   ? -4.098  -9.586  -0.175  1.00 1.00 ? 25  THR A O    7  
ATOM 10808 C CB   . THR A 1 5   ? -4.449  -5.942  -0.708  1.00 1.00 ? 25  THR A CB   7  
ATOM 10809 O OG1  . THR A 1 5   ? -3.275  -5.811  0.052   1.00 1.00 ? 25  THR A OG1  7  
ATOM 10810 C CG2  . THR A 1 5   ? -5.603  -5.225  0.012   1.00 1.00 ? 25  THR A CG2  7  
ATOM 10811 H H    . THR A 1 5   ? -6.764  -7.650  -1.412  1.00 1.00 ? 25  THR A H    7  
ATOM 10812 H HA   . THR A 1 5   ? -3.776  -7.663  -1.678  1.00 1.00 ? 25  THR A HA   7  
ATOM 10813 H HB   . THR A 1 5   ? -4.297  -5.416  -1.651  1.00 1.00 ? 25  THR A HB   7  
ATOM 10814 H HG1  . THR A 1 5   ? -3.235  -4.896  0.431   1.00 1.00 ? 25  THR A HG1  7  
ATOM 10815 H HG21 . THR A 1 5   ? -6.556  -5.455  -0.466  1.00 1.00 ? 25  THR A HG21 7  
ATOM 10816 H HG22 . THR A 1 5   ? -5.656  -5.490  1.066   1.00 1.00 ? 25  THR A HG22 7  
ATOM 10817 H HG23 . THR A 1 5   ? -5.451  -4.147  -0.065  1.00 1.00 ? 25  THR A HG23 7  
ATOM 10818 N N    . ASP A 1 6   ? -4.820  -8.090  1.342   1.00 1.00 ? 26  ASP A N    7  
ATOM 10819 C CA   . ASP A 1 6   ? -4.686  -8.881  2.577   1.00 1.00 ? 26  ASP A CA   7  
ATOM 10820 C C    . ASP A 1 6   ? -5.416  -10.252 2.587   1.00 1.00 ? 26  ASP A C    7  
ATOM 10821 O O    . ASP A 1 6   ? -4.932  -11.235 3.151   1.00 1.00 ? 26  ASP A O    7  
ATOM 10822 C CB   . ASP A 1 6   ? -5.232  -7.965  3.676   1.00 1.00 ? 26  ASP A CB   7  
ATOM 10823 C CG   . ASP A 1 6   ? -4.850  -8.395  5.086   1.00 1.00 ? 26  ASP A CG   7  
ATOM 10824 O OD1  . ASP A 1 6   ? -3.728  -8.030  5.477   1.00 1.00 ? 26  ASP A OD1  7  
ATOM 10825 O OD2  . ASP A 1 6   ? -5.696  -9.071  5.723   1.00 1.00 ? 26  ASP A OD2  7  
ATOM 10826 H H    . ASP A 1 6   ? -5.046  -7.118  1.477   1.00 1.00 ? 26  ASP A H    7  
ATOM 10827 H HA   . ASP A 1 6   ? -3.624  -9.070  2.747   1.00 1.00 ? 26  ASP A HA   7  
ATOM 10828 H HB2  . ASP A 1 6   ? -4.837  -6.963  3.515   1.00 0.00 ? 26  ASP A HB2  7  
ATOM 10829 H HB3  . ASP A 1 6   ? -6.312  -7.825  3.578   1.00 1.00 ? 26  ASP A HB3  7  
ATOM 10830 N N    . SER A 1 7   ? -6.582  -10.319 1.933   1.00 1.00 ? 27  SER A N    7  
ATOM 10831 C CA   . SER A 1 7   ? -7.369  -11.531 1.695   1.00 1.00 ? 27  SER A CA   7  
ATOM 10832 C C    . SER A 1 7   ? -7.911  -11.459 0.259   1.00 1.00 ? 27  SER A C    7  
ATOM 10833 O O    . SER A 1 7   ? -8.794  -10.629 0.007   1.00 1.00 ? 27  SER A O    7  
ATOM 10834 C CB   . SER A 1 7   ? -8.495  -11.693 2.725   1.00 1.00 ? 27  SER A CB   7  
ATOM 10835 O OG   . SER A 1 7   ? -7.938  -11.953 3.997   1.00 1.00 ? 27  SER A OG   7  
ATOM 10836 H H    . SER A 1 7   ? -6.906  -9.458  1.516   1.00 1.00 ? 27  SER A H    7  
ATOM 10837 H HA   . SER A 1 7   ? -6.729  -12.409 1.803   1.00 1.00 ? 27  SER A HA   7  
ATOM 10838 H HB2  . SER A 1 7   ? -9.093  -10.783 2.765   1.00 0.00 ? 27  SER A HB2  7  
ATOM 10839 H HB3  . SER A 1 7   ? -9.138  -12.531 2.443   1.00 1.00 ? 27  SER A HB3  7  
ATOM 10840 H HG   . SER A 1 7   ? -6.980  -11.843 3.924   1.00 1.00 ? 27  SER A HG   7  
ATOM 10841 N N    . PRO A 1 8   ? -7.405  -12.291 -0.690  1.00 1.00 ? 28  PRO A N    7  
ATOM 10842 C CA   . PRO A 1 8   ? -7.928  -12.415 -2.063  1.00 1.00 ? 28  PRO A CA   7  
ATOM 10843 C C    . PRO A 1 8   ? -9.469  -12.538 -2.183  1.00 1.00 ? 28  PRO A C    7  
ATOM 10844 O O    . PRO A 1 8   ? -10.022 -12.233 -3.238  1.00 1.00 ? 28  PRO A O    7  
ATOM 10845 C CB   . PRO A 1 8   ? -7.201  -13.623 -2.664  1.00 1.00 ? 28  PRO A CB   7  
ATOM 10846 C CG   . PRO A 1 8   ? -5.895  -13.750 -1.875  1.00 1.00 ? 28  PRO A CG   7  
ATOM 10847 C CD   . PRO A 1 8   ? -6.254  -13.171 -0.508  1.00 1.00 ? 28  PRO A CD   7  
ATOM 10848 H HA   . PRO A 1 8   ? -7.623  -11.524 -2.615  1.00 1.00 ? 28  PRO A HA   7  
ATOM 10849 H HB2  . PRO A 1 8   ? -7.872  -14.470 -2.518  1.00 0.00 ? 28  PRO A HB2  7  
ATOM 10850 H HB3  . PRO A 1 8   ? -7.001  -13.484 -3.728  1.00 1.00 ? 28  PRO A HB3  7  
ATOM 10851 H HG2  . PRO A 1 8   ? -5.562  -14.788 -1.862  1.00 0.00 ? 28  PRO A HG2  7  
ATOM 10852 H HG3  . PRO A 1 8   ? -5.119  -13.139 -2.333  1.00 1.00 ? 28  PRO A HG3  7  
ATOM 10853 H HD2  . PRO A 1 8   ? -6.489  -13.981 0.182   1.00 0.00 ? 28  PRO A HD2  7  
ATOM 10854 H HD3  . PRO A 1 8   ? -5.403  -12.620 -0.103  1.00 1.00 ? 28  PRO A HD3  7  
ATOM 10855 N N    . ASN A 1 9   ? -10.158 -12.921 -1.093  1.00 1.00 ? 29  ASN A N    7  
ATOM 10856 C CA   . ASN A 1 9   ? -11.605 -12.933 -0.888  1.00 1.00 ? 29  ASN A CA   7  
ATOM 10857 C C    . ASN A 1 9   ? -12.265 -11.551 -1.092  1.00 1.00 ? 29  ASN A C    7  
ATOM 10858 O O    . ASN A 1 9   ? -13.376 -11.506 -1.615  1.00 1.00 ? 29  ASN A O    7  
ATOM 10859 C CB   . ASN A 1 9   ? -11.847 -13.447 0.544   1.00 1.00 ? 29  ASN A CB   7  
ATOM 10860 C CG   . ASN A 1 9   ? -11.708 -14.955 0.655   1.00 1.00 ? 29  ASN A CG   7  
ATOM 10861 O OD1  . ASN A 1 9   ? -10.623 -15.512 0.650   1.00 1.00 ? 29  ASN A OD1  7  
ATOM 10862 N ND2  . ASN A 1 9   ? -12.812 -15.664 0.693   1.00 1.00 ? 29  ASN A ND2  7  
ATOM 10863 H H    . ASN A 1 9   ? -9.615  -13.172 -0.286  1.00 1.00 ? 29  ASN A H    7  
ATOM 10864 H HA   . ASN A 1 9   ? -12.070 -13.616 -1.601  1.00 1.00 ? 29  ASN A HA   7  
ATOM 10865 H HB2  . ASN A 1 9   ? -11.098 -13.062 1.236   1.00 0.00 ? 29  ASN A HB2  7  
ATOM 10866 H HB3  . ASN A 1 9   ? -12.823 -13.143 0.917   1.00 1.00 ? 29  ASN A HB3  7  
ATOM 10867 H HD21 . ASN A 1 9   ? -13.728 -15.196 0.647   1.00 0.00 ? 29  ASN A HD21 7  
ATOM 10868 H HD22 . ASN A 1 9   ? -12.762 -16.691 0.768   1.00 0.00 ? 29  ASN A HD22 7  
ATOM 10869 N N    . PHE A 1 10  ? -11.604 -10.447 -0.697  1.00 1.00 ? 30  PHE A N    7  
ATOM 10870 C CA   . PHE A 1 10  ? -12.124 -9.069  -0.806  1.00 1.00 ? 30  PHE A CA   7  
ATOM 10871 C C    . PHE A 1 10  ? -11.476 -8.359  -2.015  1.00 1.00 ? 30  PHE A C    7  
ATOM 10872 O O    . PHE A 1 10  ? -10.281 -8.041  -1.991  1.00 1.00 ? 30  PHE A O    7  
ATOM 10873 C CB   . PHE A 1 10  ? -11.916 -8.270  0.500   1.00 1.00 ? 30  PHE A CB   7  
ATOM 10874 C CG   . PHE A 1 10  ? -11.835 -8.987  1.845   1.00 1.00 ? 30  PHE A CG   7  
ATOM 10875 C CD1  . PHE A 1 10  ? -12.923 -9.742  2.349   1.00 1.00 ? 30  PHE A CD1  7  
ATOM 10876 C CD2  . PHE A 1 10  ? -10.654 -8.869  2.613   1.00 1.00 ? 30  PHE A CD2  7  
ATOM 10877 C CE1  . PHE A 1 10  ? -12.808 -10.407 3.591   1.00 1.00 ? 30  PHE A CE1  7  
ATOM 10878 C CE2  . PHE A 1 10  ? -10.550 -9.514  3.864   1.00 1.00 ? 30  PHE A CE2  7  
ATOM 10879 C CZ   . PHE A 1 10  ? -11.618 -10.299 4.346   1.00 1.00 ? 30  PHE A CZ   7  
ATOM 10880 H H    . PHE A 1 10  ? -10.654 -10.586 -0.346  1.00 1.00 ? 30  PHE A H    7  
ATOM 10881 H HA   . PHE A 1 10  ? -13.201 -9.112  -0.977  1.00 1.00 ? 30  PHE A HA   7  
ATOM 10882 H HB2  . PHE A 1 10  ? -10.908 -7.854  0.523   1.00 0.00 ? 30  PHE A HB2  7  
ATOM 10883 H HB3  . PHE A 1 10  ? -12.642 -7.453  0.557   1.00 1.00 ? 30  PHE A HB3  7  
ATOM 10884 H HD1  . PHE A 1 10  ? -13.846 -9.821  1.791   1.00 1.00 ? 30  PHE A HD1  7  
ATOM 10885 H HD2  . PHE A 1 10  ? -9.819  -8.290  2.249   1.00 1.00 ? 30  PHE A HD2  7  
ATOM 10886 H HE1  . PHE A 1 10  ? -13.636 -10.990 3.970   1.00 1.00 ? 30  PHE A HE1  7  
ATOM 10887 H HE2  . PHE A 1 10  ? -9.645  -9.421  4.450   1.00 1.00 ? 30  PHE A HE2  7  
ATOM 10888 H HZ   . PHE A 1 10  ? -11.526 -10.803 5.297   1.00 1.00 ? 30  PHE A HZ   7  
ATOM 10889 N N    . LEU A 1 11  ? -12.272 -8.098  -3.069  1.00 1.00 ? 31  LEU A N    7  
ATOM 10890 C CA   . LEU A 1 11  ? -11.834 -7.599  -4.381  1.00 1.00 ? 31  LEU A CA   7  
ATOM 10891 C C    . LEU A 1 11  ? -12.426 -6.217  -4.739  1.00 1.00 ? 31  LEU A C    7  
ATOM 10892 O O    . LEU A 1 11  ? -13.643 -6.041  -4.846  1.00 1.00 ? 31  LEU A O    7  
ATOM 10893 C CB   . LEU A 1 11  ? -12.185 -8.702  -5.395  1.00 1.00 ? 31  LEU A CB   7  
ATOM 10894 C CG   . LEU A 1 11  ? -11.664 -8.515  -6.826  1.00 1.00 ? 31  LEU A CG   7  
ATOM 10895 C CD1  . LEU A 1 11  ? -11.548 -9.888  -7.497  1.00 1.00 ? 31  LEU A CD1  7  
ATOM 10896 C CD2  . LEU A 1 11  ? -12.568 -7.590  -7.659  1.00 1.00 ? 31  LEU A CD2  7  
ATOM 10897 H H    . LEU A 1 11  ? -13.261 -8.346  -3.011  1.00 1.00 ? 31  LEU A H    7  
ATOM 10898 H HA   . LEU A 1 11  ? -10.744 -7.515  -4.367  1.00 1.00 ? 31  LEU A HA   7  
ATOM 10899 H HB2  . LEU A 1 11  ? -11.653 -9.631  -5.191  1.00 0.00 ? 31  LEU A HB2  7  
ATOM 10900 H HB3  . LEU A 1 11  ? -13.251 -8.942  -5.388  1.00 1.00 ? 31  LEU A HB3  7  
ATOM 10901 H HG   . LEU A 1 11  ? -10.664 -8.091  -6.769  1.00 1.00 ? 31  LEU A HG   7  
ATOM 10902 H HD11 . LEU A 1 11  ? -10.891 -10.531 -6.910  1.00 1.00 ? 31  LEU A HD11 7  
ATOM 10903 H HD12 . LEU A 1 11  ? -12.531 -10.355 -7.568  1.00 1.00 ? 31  LEU A HD12 7  
ATOM 10904 H HD13 . LEU A 1 11  ? -11.127 -9.778  -8.496  1.00 1.00 ? 31  LEU A HD13 7  
ATOM 10905 H HD21 . LEU A 1 11  ? -13.612 -7.879  -7.544  1.00 1.00 ? 31  LEU A HD21 7  
ATOM 10906 H HD22 . LEU A 1 11  ? -12.450 -6.555  -7.343  1.00 1.00 ? 31  LEU A HD22 7  
ATOM 10907 H HD23 . LEU A 1 11  ? -12.319 -7.643  -8.712  1.00 1.00 ? 31  LEU A HD23 7  
ATOM 10908 N N    . CYS A 1 12  ? -11.546 -5.240  -4.998  1.00 1.00 ? 32  CYS A N    7  
ATOM 10909 C CA   . CYS A 1 12  ? -11.887 -3.825  -5.198  1.00 1.00 ? 32  CYS A CA   7  
ATOM 10910 C C    . CYS A 1 12  ? -11.590 -3.304  -6.629  1.00 1.00 ? 32  CYS A C    7  
ATOM 10911 O O    . CYS A 1 12  ? -10.864 -3.926  -7.416  1.00 1.00 ? 32  CYS A O    7  
ATOM 10912 C CB   . CYS A 1 12  ? -11.176 -2.993  -4.100  1.00 1.00 ? 32  CYS A CB   7  
ATOM 10913 S SG   . CYS A 1 12  ? -11.315 -3.649  -2.403  1.00 1.00 ? 32  CYS A SG   7  
ATOM 10914 H H    . CYS A 1 12  ? -10.551 -5.436  -4.915  1.00 1.00 ? 32  CYS A H    7  
ATOM 10915 H HA   . CYS A 1 12  ? -12.956 -3.710  -5.062  1.00 1.00 ? 32  CYS A HA   7  
ATOM 10916 H HB2  . CYS A 1 12  ? -10.092 -3.013  -4.216  1.00 0.00 ? 32  CYS A HB2  7  
ATOM 10917 H HB3  . CYS A 1 12  ? -11.480 -1.948  -4.123  1.00 1.00 ? 32  CYS A HB3  7  
ATOM 10918 H HG   . CYS A 1 12  ? -10.616 -4.772  -2.630  1.00 1.00 ? 32  CYS A HG   7  
ATOM 10919 N N    . SER A 1 13  ? -12.166 -2.144  -6.986  1.00 1.00 ? 33  SER A N    7  
ATOM 10920 C CA   . SER A 1 13  ? -11.976 -1.446  -8.272  1.00 1.00 ? 33  SER A CA   7  
ATOM 10921 C C    . SER A 1 13  ? -12.163 0.082   -8.167  1.00 1.00 ? 33  SER A C    7  
ATOM 10922 O O    . SER A 1 13  ? -13.180 0.586   -7.676  1.00 1.00 ? 33  SER A O    7  
ATOM 10923 C CB   . SER A 1 13  ? -12.931 -2.025  -9.321  1.00 1.00 ? 33  SER A CB   7  
ATOM 10924 O OG   . SER A 1 13  ? -12.470 -3.303  -9.696  1.00 1.00 ? 33  SER A OG   7  
ATOM 10925 H H    . SER A 1 13  ? -12.921 -1.788  -6.412  1.00 1.00 ? 33  SER A H    7  
ATOM 10926 H HA   . SER A 1 13  ? -10.955 -1.640  -8.615  1.00 1.00 ? 33  SER A HA   7  
ATOM 10927 H HB2  . SER A 1 13  ? -13.943 -2.095  -8.921  1.00 0.00 ? 33  SER A HB2  7  
ATOM 10928 H HB3  . SER A 1 13  ? -12.958 -1.390  -10.209 1.00 1.00 ? 33  SER A HB3  7  
ATOM 10929 H HG   . SER A 1 13  ? -11.950 -3.656  -8.953  1.00 1.00 ? 33  SER A HG   7  
ATOM 10930 N N    . VAL A 1 14  ? -11.134 0.794   -8.653  1.00 1.00 ? 34  VAL A N    7  
ATOM 10931 C CA   . VAL A 1 14  ? -10.971 2.254   -8.826  1.00 1.00 ? 34  VAL A CA   7  
ATOM 10932 C C    . VAL A 1 14  ? -9.958  2.526   -9.962  1.00 1.00 ? 34  VAL A C    7  
ATOM 10933 O O    . VAL A 1 14  ? -9.063  1.711   -10.201 1.00 1.00 ? 34  VAL A O    7  
ATOM 10934 C CB   . VAL A 1 14  ? -10.491 2.915   -7.500  1.00 1.00 ? 34  VAL A CB   7  
ATOM 10935 C CG1  . VAL A 1 14  ? -9.051  2.538   -7.091  1.00 1.00 ? 34  VAL A CG1  7  
ATOM 10936 C CG2  . VAL A 1 14  ? -10.601 4.449   -7.558  1.00 1.00 ? 34  VAL A CG2  7  
ATOM 10937 H H    . VAL A 1 14  ? -10.376 0.260   -9.055  1.00 1.00 ? 34  VAL A H    7  
ATOM 10938 H HA   . VAL A 1 14  ? -11.938 2.682   -9.102  1.00 1.00 ? 34  VAL A HA   7  
ATOM 10939 H HB   . VAL A 1 14  ? -11.157 2.583   -6.701  1.00 1.00 ? 34  VAL A HB   7  
ATOM 10940 H HG11 . VAL A 1 14  ? -8.955  1.454   -7.016  1.00 1.00 ? 34  VAL A HG11 7  
ATOM 10941 H HG12 . VAL A 1 14  ? -8.335  2.904   -7.829  1.00 1.00 ? 34  VAL A HG12 7  
ATOM 10942 H HG13 . VAL A 1 14  ? -8.802  2.976   -6.125  1.00 1.00 ? 34  VAL A HG13 7  
ATOM 10943 H HG21 . VAL A 1 14  ? -11.609 4.749   -7.850  1.00 1.00 ? 34  VAL A HG21 7  
ATOM 10944 H HG22 . VAL A 1 14  ? -10.384 4.868   -6.579  1.00 1.00 ? 34  VAL A HG22 7  
ATOM 10945 H HG23 . VAL A 1 14  ? -9.877  4.864   -8.255  1.00 1.00 ? 34  VAL A HG23 7  
ATOM 10946 N N    . LEU A 1 15  ? -10.067 3.676   -10.645 1.00 1.00 ? 35  LEU A N    7  
ATOM 10947 C CA   . LEU A 1 15  ? -9.067  4.127   -11.627 1.00 1.00 ? 35  LEU A CA   7  
ATOM 10948 C C    . LEU A 1 15  ? -7.727  4.564   -10.958 1.00 1.00 ? 35  LEU A C    7  
ATOM 10949 O O    . LEU A 1 15  ? -7.739  5.055   -9.822  1.00 1.00 ? 35  LEU A O    7  
ATOM 10950 C CB   . LEU A 1 15  ? -9.672  5.219   -12.534 1.00 1.00 ? 35  LEU A CB   7  
ATOM 10951 C CG   . LEU A 1 15  ? -9.786  6.671   -12.024 1.00 1.00 ? 35  LEU A CG   7  
ATOM 10952 C CD1  . LEU A 1 15  ? -10.197 7.586   -13.184 1.00 1.00 ? 35  LEU A CD1  7  
ATOM 10953 C CD2  . LEU A 1 15  ? -10.784 6.822   -10.868 1.00 1.00 ? 35  LEU A CD2  7  
ATOM 10954 H H    . LEU A 1 15  ? -10.817 4.305   -10.410 1.00 1.00 ? 35  LEU A H    7  
ATOM 10955 H HA   . LEU A 1 15  ? -8.853  3.273   -12.270 1.00 1.00 ? 35  LEU A HA   7  
ATOM 10956 H HB2  . LEU A 1 15  ? -8.987  5.469   -13.345 1.00 0.00 ? 35  LEU A HB2  7  
ATOM 10957 H HB3  . LEU A 1 15  ? -10.611 4.877   -12.974 1.00 1.00 ? 35  LEU A HB3  7  
ATOM 10958 H HG   . LEU A 1 15  ? -8.802  6.996   -11.688 1.00 1.00 ? 35  LEU A HG   7  
ATOM 10959 H HD11 . LEU A 1 15  ? -9.477  7.494   -13.999 1.00 1.00 ? 35  LEU A HD11 7  
ATOM 10960 H HD12 . LEU A 1 15  ? -11.191 7.321   -13.550 1.00 1.00 ? 35  LEU A HD12 7  
ATOM 10961 H HD13 . LEU A 1 15  ? -10.207 8.625   -12.851 1.00 1.00 ? 35  LEU A HD13 7  
ATOM 10962 H HD21 . LEU A 1 15  ? -11.746 6.380   -11.133 1.00 1.00 ? 35  LEU A HD21 7  
ATOM 10963 H HD22 . LEU A 1 15  ? -10.392 6.336   -9.977  1.00 1.00 ? 35  LEU A HD22 7  
ATOM 10964 H HD23 . LEU A 1 15  ? -10.927 7.877   -10.635 1.00 1.00 ? 35  LEU A HD23 7  
ATOM 10965 N N    . PRO A 1 16  ? -6.565  4.434   -11.645 1.00 1.00 ? 36  PRO A N    7  
ATOM 10966 C CA   . PRO A 1 16  ? -5.251  4.849   -11.133 1.00 1.00 ? 36  PRO A CA   7  
ATOM 10967 C C    . PRO A 1 16  ? -5.107  6.387   -11.056 1.00 1.00 ? 36  PRO A C    7  
ATOM 10968 O O    . PRO A 1 16  ? -4.490  7.001   -11.926 1.00 1.00 ? 36  PRO A O    7  
ATOM 10969 C CB   . PRO A 1 16  ? -4.210  4.200   -12.057 1.00 1.00 ? 36  PRO A CB   7  
ATOM 10970 C CG   . PRO A 1 16  ? -4.965  3.978   -13.367 1.00 1.00 ? 36  PRO A CG   7  
ATOM 10971 C CD   . PRO A 1 16  ? -6.425  3.810   -12.955 1.00 1.00 ? 36  PRO A CD   7  
ATOM 10972 H HA   . PRO A 1 16  ? -5.114  4.447   -10.129 1.00 1.00 ? 36  PRO A HA   7  
ATOM 10973 H HB2  . PRO A 1 16  ? -3.414  4.941   -12.118 1.00 0.00 ? 36  PRO A HB2  7  
ATOM 10974 H HB3  . PRO A 1 16  ? -3.904  3.236   -11.648 1.00 1.00 ? 36  PRO A HB3  7  
ATOM 10975 H HG2  . PRO A 1 16  ? -4.844  4.827   -14.040 1.00 0.00 ? 36  PRO A HG2  7  
ATOM 10976 H HG3  . PRO A 1 16  ? -4.602  3.089   -13.885 1.00 1.00 ? 36  PRO A HG3  7  
ATOM 10977 H HD2  . PRO A 1 16  ? -7.117  4.284   -13.652 1.00 0.00 ? 36  PRO A HD2  7  
ATOM 10978 H HD3  . PRO A 1 16  ? -6.654  2.745   -12.869 1.00 1.00 ? 36  PRO A HD3  7  
ATOM 10979 N N    . THR A 1 17  ? -5.663  7.015   -10.003 1.00 1.00 ? 37  THR A N    7  
ATOM 10980 C CA   . THR A 1 17  ? -5.554  8.462   -9.740  1.00 1.00 ? 37  THR A CA   7  
ATOM 10981 C C    . THR A 1 17  ? -4.173  8.793   -9.148  1.00 1.00 ? 37  THR A C    7  
ATOM 10982 O O    . THR A 1 17  ? -3.272  9.199   -9.874  1.00 1.00 ? 37  THR A O    7  
ATOM 10983 C CB   . THR A 1 17  ? -6.714  9.022   -8.873  1.00 1.00 ? 37  THR A CB   7  
ATOM 10984 O OG1  . THR A 1 17  ? -6.777  8.387   -7.610  1.00 1.00 ? 37  THR A OG1  7  
ATOM 10985 C CG2  . THR A 1 17  ? -8.103  8.847   -9.491  1.00 1.00 ? 37  THR A CG2  7  
ATOM 10986 H H    . THR A 1 17  ? -6.196  6.469   -9.335  1.00 1.00 ? 37  THR A H    7  
ATOM 10987 H HA   . THR A 1 17  ? -5.605  8.975   -10.701 1.00 1.00 ? 37  THR A HA   7  
ATOM 10988 H HB   . THR A 1 17  ? -6.546  10.090  -8.718  1.00 1.00 ? 37  THR A HB   7  
ATOM 10989 H HG1  . THR A 1 17  ? -7.705  8.390   -7.357  1.00 1.00 ? 37  THR A HG1  7  
ATOM 10990 H HG21 . THR A 1 17  ? -8.118  9.280   -10.490 1.00 1.00 ? 37  THR A HG21 7  
ATOM 10991 H HG22 . THR A 1 17  ? -8.355  7.788   -9.557  1.00 1.00 ? 37  THR A HG22 7  
ATOM 10992 H HG23 . THR A 1 17  ? -8.852  9.354   -8.882  1.00 1.00 ? 37  THR A HG23 7  
ATOM 10993 N N    . HIS A 1 18  ? -3.999  8.575   -7.835  1.00 1.00 ? 38  HIS A N    7  
ATOM 10994 C CA   . HIS A 1 18  ? -2.824  8.930   -7.001  1.00 1.00 ? 38  HIS A CA   7  
ATOM 10995 C C    . HIS A 1 18  ? -2.319  10.366  -7.300  1.00 1.00 ? 38  HIS A C    7  
ATOM 10996 O O    . HIS A 1 18  ? -1.321  10.583  -7.994  1.00 1.00 ? 38  HIS A O    7  
ATOM 10997 C CB   . HIS A 1 18  ? -1.705  7.864   -7.103  1.00 1.00 ? 38  HIS A CB   7  
ATOM 10998 C CG   . HIS A 1 18  ? -2.033  6.511   -7.685  1.00 1.00 ? 38  HIS A CG   7  
ATOM 10999 N ND1  . HIS A 1 18  ? -1.702  6.123   -8.964  1.00 1.00 ? 38  HIS A ND1  7  
ATOM 11000 C CD2  . HIS A 1 18  ? -2.742  5.502   -7.091  1.00 1.00 ? 38  HIS A CD2  7  
ATOM 11001 C CE1  . HIS A 1 18  ? -2.193  4.879   -9.145  1.00 1.00 ? 38  HIS A CE1  7  
ATOM 11002 N NE2  . HIS A 1 18  ? -2.837  4.482   -8.023  1.00 1.00 ? 38  HIS A NE2  7  
ATOM 11003 H H    . HIS A 1 18  ? -4.847  8.180   -7.428  1.00 1.00 ? 38  HIS A H    7  
ATOM 11004 H HA   . HIS A 1 18  ? -3.156  8.925   -5.965  1.00 1.00 ? 38  HIS A HA   7  
ATOM 11005 H HB2  . HIS A 1 18  ? -0.969  8.117   -7.866  1.00 0.00 ? 38  HIS A HB2  7  
ATOM 11006 H HB3  . HIS A 1 18  ? -1.160  7.751   -6.165  1.00 1.00 ? 38  HIS A HB3  7  
ATOM 11007 H HD1  . HIS A 1 18  ? -1.200  6.716   -9.617  1.00 1.00 ? 38  HIS A HD1  7  
ATOM 11008 H HD2  . HIS A 1 18  ? -3.161  5.518   -6.091  1.00 1.00 ? 38  HIS A HD2  7  
ATOM 11009 H HE1  . HIS A 1 18  ? -2.087  4.288   -10.050 1.00 1.00 ? 38  HIS A HE1  7  
ATOM 11010 H HE2  . HIS A 1 18  ? -3.315  3.601   -7.885  1.00 1.00 ? 38  HIS A HE2  7  
ATOM 11011 N N    . TRP A 1 19  ? -3.019  11.372  -6.753  1.00 1.00 ? 39  TRP A N    7  
ATOM 11012 C CA   . TRP A 1 19  ? -2.808  12.819  -6.943  1.00 1.00 ? 39  TRP A CA   7  
ATOM 11013 C C    . TRP A 1 19  ? -3.586  13.650  -5.893  1.00 1.00 ? 39  TRP A C    7  
ATOM 11014 O O    . TRP A 1 19  ? -4.379  13.102  -5.124  1.00 1.00 ? 39  TRP A O    7  
ATOM 11015 C CB   . TRP A 1 19  ? -3.103  13.248  -8.407  1.00 1.00 ? 39  TRP A CB   7  
ATOM 11016 C CG   . TRP A 1 19  ? -4.501  13.495  -8.906  1.00 1.00 ? 39  TRP A CG   7  
ATOM 11017 C CD1  . TRP A 1 19  ? -5.259  14.559  -8.568  1.00 1.00 ? 39  TRP A CD1  7  
ATOM 11018 C CD2  . TRP A 1 19  ? -5.264  12.792  -9.939  1.00 1.00 ? 39  TRP A CD2  7  
ATOM 11019 N NE1  . TRP A 1 19  ? -6.499  14.471  -9.165  1.00 1.00 ? 39  TRP A NE1  7  
ATOM 11020 C CE2  . TRP A 1 19  ? -6.548  13.418  -10.047 1.00 1.00 ? 39  TRP A CE2  7  
ATOM 11021 C CE3  . TRP A 1 19  ? -4.991  11.737  -10.848 1.00 1.00 ? 39  TRP A CE3  7  
ATOM 11022 C CZ2  . TRP A 1 19  ? -7.536  12.975  -10.948 1.00 1.00 ? 39  TRP A CZ2  7  
ATOM 11023 C CZ3  . TRP A 1 19  ? -5.968  11.289  -11.767 1.00 1.00 ? 39  TRP A CZ3  7  
ATOM 11024 C CH2  . TRP A 1 19  ? -7.244  11.894  -11.805 1.00 1.00 ? 39  TRP A CH2  7  
ATOM 11025 H H    . TRP A 1 19  ? -3.637  11.165  -5.980  1.00 1.00 ? 39  TRP A H    7  
ATOM 11026 H HA   . TRP A 1 19  ? -1.755  12.996  -6.762  1.00 1.00 ? 39  TRP A HA   7  
ATOM 11027 H HB2  . TRP A 1 19  ? -2.822  14.285  -8.589  1.00 0.00 ? 39  TRP A HB2  7  
ATOM 11028 H HB3  . TRP A 1 19  ? -2.557  12.636  -9.127  1.00 1.00 ? 39  TRP A HB3  7  
ATOM 11029 H HD1  . TRP A 1 19  ? -4.933  15.352  -7.919  1.00 1.00 ? 39  TRP A HD1  7  
ATOM 11030 H HE1  . TRP A 1 19  ? -7.242  15.139  -9.022  1.00 1.00 ? 39  TRP A HE1  7  
ATOM 11031 H HE3  . TRP A 1 19  ? -4.003  11.301  -10.864 1.00 1.00 ? 39  TRP A HE3  7  
ATOM 11032 H HZ2  . TRP A 1 19  ? -8.490  13.477  -11.005 1.00 1.00 ? 39  TRP A HZ2  7  
ATOM 11033 H HZ3  . TRP A 1 19  ? -5.731  10.496  -12.465 1.00 1.00 ? 39  TRP A HZ3  7  
ATOM 11034 H HH2  . TRP A 1 19  ? -7.983  11.555  -12.517 1.00 1.00 ? 39  TRP A HH2  7  
ATOM 11035 N N    . ARG A 1 20  ? -3.381  14.986  -5.863  1.00 1.00 ? 40  ARG A N    7  
ATOM 11036 C CA   . ARG A 1 20  ? -4.125  15.935  -5.006  1.00 1.00 ? 40  ARG A CA   7  
ATOM 11037 C C    . ARG A 1 20  ? -5.613  16.011  -5.428  1.00 1.00 ? 40  ARG A C    7  
ATOM 11038 O O    . ARG A 1 20  ? -5.992  16.738  -6.350  1.00 1.00 ? 40  ARG A O    7  
ATOM 11039 C CB   . ARG A 1 20  ? -3.383  17.281  -5.098  1.00 1.00 ? 40  ARG A CB   7  
ATOM 11040 C CG   . ARG A 1 20  ? -4.075  18.475  -4.425  1.00 1.00 ? 40  ARG A CG   7  
ATOM 11041 C CD   . ARG A 1 20  ? -4.240  19.690  -5.354  1.00 1.00 ? 40  ARG A CD   7  
ATOM 11042 N NE   . ARG A 1 20  ? -5.084  19.369  -6.516  1.00 1.00 ? 40  ARG A NE   7  
ATOM 11043 C CZ   . ARG A 1 20  ? -5.277  20.043  -7.636  1.00 1.00 ? 40  ARG A CZ   7  
ATOM 11044 N NH1  . ARG A 1 20  ? -4.695  21.163  -7.949  1.00 1.00 ? 40  ARG A NH1  7  
ATOM 11045 N NH2  . ARG A 1 20  ? -6.101  19.565  -8.517  1.00 1.00 ? 40  ARG A NH2  7  
ATOM 11046 H H    . ARG A 1 20  ? -2.674  15.350  -6.485  1.00 1.00 ? 40  ARG A H    7  
ATOM 11047 H HA   . ARG A 1 20  ? -4.073  15.630  -3.966  1.00 1.00 ? 40  ARG A HA   7  
ATOM 11048 H HB2  . ARG A 1 20  ? -2.450  17.226  -4.537  1.00 0.00 ? 40  ARG A HB2  7  
ATOM 11049 H HB3  . ARG A 1 20  ? -3.162  17.508  -6.139  1.00 1.00 ? 40  ARG A HB3  7  
ATOM 11050 H HG2  . ARG A 1 20  ? -5.088  18.193  -4.136  1.00 0.00 ? 40  ARG A HG2  7  
ATOM 11051 H HG3  . ARG A 1 20  ? -3.512  18.768  -3.538  1.00 1.00 ? 40  ARG A HG3  7  
ATOM 11052 H HD2  . ARG A 1 20  ? -4.719  20.493  -4.793  1.00 0.00 ? 40  ARG A HD2  7  
ATOM 11053 H HD3  . ARG A 1 20  ? -3.257  20.000  -5.694  1.00 1.00 ? 40  ARG A HD3  7  
ATOM 11054 H HE   . ARG A 1 20  ? -5.537  18.466  -6.500  1.00 1.00 ? 40  ARG A HE   7  
ATOM 11055 H HH11 . ARG A 1 20  ? -4.021  21.593  -7.298  1.00 0.00 ? 40  ARG A HH11 7  
ATOM 11056 H HH12 . ARG A 1 20  ? -4.907  21.619  -8.847  1.00 0.00 ? 40  ARG A HH12 7  
ATOM 11057 H HH21 . ARG A 1 20  ? -6.590  18.677  -8.337  1.00 0.00 ? 40  ARG A HH21 7  
ATOM 11058 H HH22 . ARG A 1 20  ? -6.267  20.074  -9.397  1.00 0.00 ? 40  ARG A HH22 7  
ATOM 11059 N N    . CYS A 1 21  ? -6.470  15.312  -4.672  1.00 1.00 ? 41  CYS A N    7  
ATOM 11060 C CA   . CYS A 1 21  ? -7.904  15.119  -4.944  1.00 1.00 ? 41  CYS A CA   7  
ATOM 11061 C C    . CYS A 1 21  ? -8.794  16.243  -4.373  1.00 1.00 ? 41  CYS A C    7  
ATOM 11062 O O    . CYS A 1 21  ? -9.650  16.765  -5.100  1.00 1.00 ? 41  CYS A O    7  
ATOM 11063 C CB   . CYS A 1 21  ? -8.286  13.719  -4.434  1.00 1.00 ? 41  CYS A CB   7  
ATOM 11064 S SG   . CYS A 1 21  ? -10.063 13.370  -4.539  1.00 1.00 ? 41  CYS A SG   7  
ATOM 11065 H H    . CYS A 1 21  ? -6.040  14.697  -3.992  1.00 1.00 ? 41  CYS A H    7  
ATOM 11066 H HA   . CYS A 1 21  ? -8.058  15.118  -6.024  1.00 1.00 ? 41  CYS A HA   7  
ATOM 11067 H HB2  . CYS A 1 21  ? -7.850  12.930  -5.048  1.00 0.00 ? 41  CYS A HB2  7  
ATOM 11068 H HB3  . CYS A 1 21  ? -7.945  13.552  -3.414  1.00 1.00 ? 41  CYS A HB3  7  
ATOM 11069 H HG   . CYS A 1 21  ? -10.156 13.411  -5.869  1.00 1.00 ? 41  CYS A HG   7  
ATOM 11070 N N    . ASN A 1 22  ? -8.641  16.587  -3.076  1.00 1.00 ? 42  ASN A N    7  
ATOM 11071 C CA   . ASN A 1 22  ? -9.454  17.584  -2.339  1.00 1.00 ? 42  ASN A CA   7  
ATOM 11072 C C    . ASN A 1 22  ? -10.993 17.305  -2.353  1.00 1.00 ? 42  ASN A C    7  
ATOM 11073 O O    . ASN A 1 22  ? -11.769 18.128  -1.865  1.00 1.00 ? 42  ASN A O    7  
ATOM 11074 C CB   . ASN A 1 22  ? -9.062  18.969  -2.917  1.00 1.00 ? 42  ASN A CB   7  
ATOM 11075 C CG   . ASN A 1 22  ? -8.846  20.160  -1.983  1.00 1.00 ? 42  ASN A CG   7  
ATOM 11076 O OD1  . ASN A 1 22  ? -8.948  20.120  -0.766  1.00 1.00 ? 42  ASN A OD1  7  
ATOM 11077 N ND2  . ASN A 1 22  ? -8.517  21.294  -2.548  1.00 1.00 ? 42  ASN A ND2  7  
ATOM 11078 H H    . ASN A 1 22  ? -7.923  16.083  -2.571  1.00 1.00 ? 42  ASN A H    7  
ATOM 11079 H HA   . ASN A 1 22  ? -9.153  17.549  -1.290  1.00 1.00 ? 42  ASN A HA   7  
ATOM 11080 H HB2  . ASN A 1 22  ? -8.032  18.977  -3.276  1.00 0.00 ? 42  ASN A HB2  7  
ATOM 11081 H HB3  . ASN A 1 22  ? -9.700  19.248  -3.755  1.00 1.00 ? 42  ASN A HB3  7  
ATOM 11082 H HD21 . ASN A 1 22  ? -8.418  21.350  -3.573  1.00 0.00 ? 42  ASN A HD21 7  
ATOM 11083 H HD22 . ASN A 1 22  ? -8.359  22.131  -1.970  1.00 0.00 ? 42  ASN A HD22 7  
ATOM 11084 N N    . LYS A 1 23  ? -11.418 16.127  -2.858  1.00 1.00 ? 43  LYS A N    7  
ATOM 11085 C CA   . LYS A 1 23  ? -12.781 15.648  -3.180  1.00 1.00 ? 43  LYS A CA   7  
ATOM 11086 C C    . LYS A 1 23  ? -13.487 16.416  -4.330  1.00 1.00 ? 43  LYS A C    7  
ATOM 11087 O O    . LYS A 1 23  ? -14.711 16.463  -4.409  1.00 1.00 ? 43  LYS A O    7  
ATOM 11088 C CB   . LYS A 1 23  ? -13.608 15.450  -1.892  1.00 1.00 ? 43  LYS A CB   7  
ATOM 11089 C CG   . LYS A 1 23  ? -14.412 14.139  -1.963  1.00 1.00 ? 43  LYS A CG   7  
ATOM 11090 C CD   . LYS A 1 23  ? -15.540 13.952  -0.949  1.00 1.00 ? 43  LYS A CD   7  
ATOM 11091 C CE   . LYS A 1 23  ? -16.819 14.604  -1.467  1.00 1.00 ? 43  LYS A CE   7  
ATOM 11092 N NZ   . LYS A 1 23  ? -18.001 14.207  -0.670  1.00 1.00 ? 43  LYS A NZ   7  
ATOM 11093 H H    . LYS A 1 23  ? -10.663 15.533  -3.172  1.00 1.00 ? 43  LYS A H    7  
ATOM 11094 H HA   . LYS A 1 23  ? -12.636 14.656  -3.604  1.00 1.00 ? 43  LYS A HA   7  
ATOM 11095 H HB2  . LYS A 1 23  ? -12.964 15.313  -1.024  1.00 0.00 ? 43  LYS A HB2  7  
ATOM 11096 H HB3  . LYS A 1 23  ? -14.250 16.314  -1.692  1.00 1.00 ? 43  LYS A HB3  7  
ATOM 11097 H HG2  . LYS A 1 23  ? -14.934 14.100  -2.919  1.00 0.00 ? 43  LYS A HG2  7  
ATOM 11098 H HG3  . LYS A 1 23  ? -13.724 13.304  -1.876  1.00 1.00 ? 43  LYS A HG3  7  
ATOM 11099 H HD2  . LYS A 1 23  ? -15.812 12.903  -0.841  1.00 0.00 ? 43  LYS A HD2  7  
ATOM 11100 H HD3  . LYS A 1 23  ? -15.255 14.318  0.039   1.00 1.00 ? 43  LYS A HD3  7  
ATOM 11101 H HE2  . LYS A 1 23  ? -16.760 15.686  -1.352  1.00 0.00 ? 43  LYS A HE2  7  
ATOM 11102 H HE3  . LYS A 1 23  ? -16.957 14.366  -2.527  1.00 1.00 ? 43  LYS A HE3  7  
ATOM 11103 H HZ1  . LYS A 1 23  ? -18.848 14.287  -1.249  1.00 0.00 ? 43  LYS A HZ1  7  
ATOM 11104 H HZ2  . LYS A 1 23  ? -17.891 13.231  -0.355  1.00 0.00 ? 43  LYS A HZ2  7  
ATOM 11105 N N    . THR A 1 24  ? -12.673 16.977  -5.241  1.00 1.00 ? 44  THR A N    7  
ATOM 11106 C CA   . THR A 1 24  ? -12.991 17.859  -6.390  1.00 1.00 ? 44  THR A CA   7  
ATOM 11107 C C    . THR A 1 24  ? -13.984 17.254  -7.404  1.00 1.00 ? 44  THR A C    7  
ATOM 11108 O O    . THR A 1 24  ? -14.981 17.895  -7.729  1.00 1.00 ? 44  THR A O    7  
ATOM 11109 C CB   . THR A 1 24  ? -11.699 18.268  -7.144  1.00 1.00 ? 44  THR A CB   7  
ATOM 11110 O OG1  . THR A 1 24  ? -10.741 18.827  -6.268  1.00 1.00 ? 44  THR A OG1  7  
ATOM 11111 C CG2  . THR A 1 24  ? -11.946 19.280  -8.271  1.00 1.00 ? 44  THR A CG2  7  
ATOM 11112 H H    . THR A 1 24  ? -11.688 16.837  -5.042  1.00 1.00 ? 44  THR A H    7  
ATOM 11113 H HA   . THR A 1 24  ? -13.440 18.773  -5.996  1.00 1.00 ? 44  THR A HA   7  
ATOM 11114 H HB   . THR A 1 24  ? -11.255 17.374  -7.583  1.00 1.00 ? 44  THR A HB   7  
ATOM 11115 H HG1  . THR A 1 24  ? -10.263 18.088  -5.833  1.00 1.00 ? 44  THR A HG1  7  
ATOM 11116 H HG21 . THR A 1 24  ? -12.633 18.867  -9.013  1.00 1.00 ? 44  THR A HG21 7  
ATOM 11117 H HG22 . THR A 1 24  ? -12.375 20.198  -7.869  1.00 1.00 ? 44  THR A HG22 7  
ATOM 11118 H HG23 . THR A 1 24  ? -11.010 19.510  -8.782  1.00 1.00 ? 44  THR A HG23 7  
ATOM 11119 N N    . LEU A 1 25  ? -13.677 16.061  -7.944  1.00 1.00 ? 45  LEU A N    7  
ATOM 11120 C CA   . LEU A 1 25  ? -14.412 15.358  -9.004  1.00 1.00 ? 45  LEU A CA   7  
ATOM 11121 C C    . LEU A 1 25  ? -14.698 13.898  -8.564  1.00 1.00 ? 45  LEU A C    7  
ATOM 11122 O O    . LEU A 1 25  ? -13.749 13.118  -8.462  1.00 1.00 ? 45  LEU A O    7  
ATOM 11123 C CB   . LEU A 1 25  ? -13.677 15.510  -10.363 1.00 1.00 ? 45  LEU A CB   7  
ATOM 11124 C CG   . LEU A 1 25  ? -12.365 14.752  -10.693 1.00 1.00 ? 45  LEU A CG   7  
ATOM 11125 C CD1  . LEU A 1 25  ? -11.940 15.066  -12.138 1.00 1.00 ? 45  LEU A CD1  7  
ATOM 11126 C CD2  . LEU A 1 25  ? -11.210 15.097  -9.742  1.00 1.00 ? 45  LEU A CD2  7  
ATOM 11127 H H    . LEU A 1 25  ? -12.841 15.596  -7.623  1.00 1.00 ? 45  LEU A H    7  
ATOM 11128 H HA   . LEU A 1 25  ? -15.369 15.863  -9.147  1.00 1.00 ? 45  LEU A HA   7  
ATOM 11129 H HB2  . LEU A 1 25  ? -14.248 15.013  -11.146 1.00 0.00 ? 45  LEU A HB2  7  
ATOM 11130 H HB3  . LEU A 1 25  ? -13.574 16.569  -10.608 1.00 1.00 ? 45  LEU A HB3  7  
ATOM 11131 H HG   . LEU A 1 25  ? -12.548 13.678  -10.643 1.00 1.00 ? 45  LEU A HG   7  
ATOM 11132 H HD11 . LEU A 1 25  ? -12.736 14.784  -12.828 1.00 1.00 ? 45  LEU A HD11 7  
ATOM 11133 H HD12 . LEU A 1 25  ? -11.729 16.130  -12.254 1.00 1.00 ? 45  LEU A HD12 7  
ATOM 11134 H HD13 . LEU A 1 25  ? -11.047 14.496  -12.397 1.00 1.00 ? 45  LEU A HD13 7  
ATOM 11135 H HD21 . LEU A 1 25  ? -11.065 16.178  -9.701  1.00 1.00 ? 45  LEU A HD21 7  
ATOM 11136 H HD22 . LEU A 1 25  ? -11.428 14.711  -8.748  1.00 1.00 ? 45  LEU A HD22 7  
ATOM 11137 H HD23 . LEU A 1 25  ? -10.289 14.628  -10.083 1.00 1.00 ? 45  LEU A HD23 7  
ATOM 11138 N N    . PRO A 1 26  ? -15.951 13.529  -8.203  1.00 1.00 ? 46  PRO A N    7  
ATOM 11139 C CA   . PRO A 1 26  ? -16.322 12.168  -7.787  1.00 1.00 ? 46  PRO A CA   7  
ATOM 11140 C C    . PRO A 1 26  ? -16.424 11.176  -8.965  1.00 1.00 ? 46  PRO A C    7  
ATOM 11141 O O    . PRO A 1 26  ? -17.050 11.466  -9.984  1.00 1.00 ? 46  PRO A O    7  
ATOM 11142 C CB   . PRO A 1 26  ? -17.677 12.299  -7.089  1.00 1.00 ? 46  PRO A CB   7  
ATOM 11143 C CG   . PRO A 1 26  ? -18.291 13.559  -7.702  1.00 1.00 ? 46  PRO A CG   7  
ATOM 11144 C CD   . PRO A 1 26  ? -17.098 14.423  -8.095  1.00 1.00 ? 46  PRO A CD   7  
ATOM 11145 H HA   . PRO A 1 26  ? -15.592 11.799  -7.063  1.00 1.00 ? 46  PRO A HA   7  
ATOM 11146 H HB2  . PRO A 1 26  ? -18.198 11.376  -7.345  1.00 0.00 ? 46  PRO A HB2  7  
ATOM 11147 H HB3  . PRO A 1 26  ? -17.519 12.459  -6.021  1.00 1.00 ? 46  PRO A HB3  7  
ATOM 11148 H HG2  . PRO A 1 26  ? -18.901 13.315  -8.572  1.00 0.00 ? 46  PRO A HG2  7  
ATOM 11149 H HG3  . PRO A 1 26  ? -18.929 14.075  -6.982  1.00 1.00 ? 46  PRO A HG3  7  
ATOM 11150 H HD2  . PRO A 1 26  ? -17.253 14.926  -9.048  1.00 0.00 ? 46  PRO A HD2  7  
ATOM 11151 H HD3  . PRO A 1 26  ? -16.905 15.165  -7.317  1.00 1.00 ? 46  PRO A HD3  7  
ATOM 11152 N N    . ILE A 1 27  ? -15.841 9.975   -8.790  1.00 1.00 ? 47  ILE A N    7  
ATOM 11153 C CA   . ILE A 1 27  ? -15.788 8.877   -9.795  1.00 1.00 ? 47  ILE A CA   7  
ATOM 11154 C C    . ILE A 1 27  ? -16.396 7.532   -9.314  1.00 1.00 ? 47  ILE A C    7  
ATOM 11155 O O    . ILE A 1 27  ? -16.668 6.655   -10.135 1.00 1.00 ? 47  ILE A O    7  
ATOM 11156 C CB   . ILE A 1 27  ? -14.337 8.678   -10.337 1.00 1.00 ? 47  ILE A CB   7  
ATOM 11157 C CG1  . ILE A 1 27  ? -13.555 9.984   -10.628 1.00 1.00 ? 47  ILE A CG1  7  
ATOM 11158 C CG2  . ILE A 1 27  ? -14.335 7.900   -11.670 1.00 1.00 ? 47  ILE A CG2  7  
ATOM 11159 C CD1  . ILE A 1 27  ? -12.639 10.478  -9.499  1.00 1.00 ? 47  ILE A CD1  7  
ATOM 11160 H H    . ILE A 1 27  ? -15.263 9.898   -7.967  1.00 1.00 ? 47  ILE A H    7  
ATOM 11161 H HA   . ILE A 1 27  ? -16.405 9.183   -10.641 1.00 1.00 ? 47  ILE A HA   7  
ATOM 11162 H HB   . ILE A 1 27  ? -13.772 8.093   -9.609  1.00 1.00 ? 47  ILE A HB   7  
ATOM 11163 H HG12 . ILE A 1 27  ? -12.789 9.830   -11.390 1.00 0.00 ? 47  ILE A HG12 7  
ATOM 11164 H HG13 . ILE A 1 27  ? -14.215 10.777  -10.984 1.00 1.00 ? 47  ILE A HG13 7  
ATOM 11165 H HG21 . ILE A 1 27  ? -15.004 8.375   -12.390 1.00 1.00 ? 47  ILE A HG21 7  
ATOM 11166 H HG22 . ILE A 1 27  ? -13.332 7.865   -12.094 1.00 1.00 ? 47  ILE A HG22 7  
ATOM 11167 H HG23 . ILE A 1 27  ? -14.656 6.871   -11.511 1.00 1.00 ? 47  ILE A HG23 7  
ATOM 11168 H HD11 . ILE A 1 27  ? -13.215 10.659  -8.594  1.00 1.00 ? 47  ILE A HD11 7  
ATOM 11169 H HD12 . ILE A 1 27  ? -11.873 9.736   -9.280  1.00 1.00 ? 47  ILE A HD12 7  
ATOM 11170 H HD13 . ILE A 1 27  ? -12.149 11.402  -9.806  1.00 1.00 ? 47  ILE A HD13 7  
ATOM 11171 N N    . ALA A 1 28  ? -16.683 7.398   -8.008  1.00 1.00 ? 48  ALA A N    7  
ATOM 11172 C CA   . ALA A 1 28  ? -17.164 6.199   -7.301  1.00 1.00 ? 48  ALA A CA   7  
ATOM 11173 C C    . ALA A 1 28  ? -16.146 5.033   -7.184  1.00 1.00 ? 48  ALA A C    7  
ATOM 11174 O O    . ALA A 1 28  ? -15.150 4.949   -7.906  1.00 1.00 ? 48  ALA A O    7  
ATOM 11175 C CB   . ALA A 1 28  ? -18.532 5.772   -7.884  1.00 1.00 ? 48  ALA A CB   7  
ATOM 11176 H H    . ALA A 1 28  ? -16.501 8.216   -7.451  1.00 1.00 ? 48  ALA A H    7  
ATOM 11177 H HA   . ALA A 1 28  ? -17.342 6.519   -6.276  1.00 1.00 ? 48  ALA A HA   7  
ATOM 11178 H HB1  . ALA A 1 28  ? -19.232 6.609   -7.855  1.00 1.00 ? 48  ALA A HB1  7  
ATOM 11179 H HB2  . ALA A 1 28  ? -18.421 5.441   -8.916  1.00 1.00 ? 48  ALA A HB2  7  
ATOM 11180 H HB3  . ALA A 1 28  ? -18.950 4.939   -7.320  1.00 1.00 ? 48  ALA A HB3  7  
ATOM 11181 N N    . PHE A 1 29  ? -16.435 4.122   -6.244  1.00 1.00 ? 49  PHE A N    7  
ATOM 11182 C CA   . PHE A 1 29  ? -15.631 2.942   -5.870  1.00 1.00 ? 49  PHE A CA   7  
ATOM 11183 C C    . PHE A 1 29  ? -16.516 1.687   -5.903  1.00 1.00 ? 49  PHE A C    7  
ATOM 11184 O O    . PHE A 1 29  ? -17.605 1.675   -5.324  1.00 1.00 ? 49  PHE A O    7  
ATOM 11185 C CB   . PHE A 1 29  ? -14.991 3.153   -4.485  1.00 1.00 ? 49  PHE A CB   7  
ATOM 11186 C CG   . PHE A 1 29  ? -14.268 4.480   -4.315  1.00 1.00 ? 49  PHE A CG   7  
ATOM 11187 C CD1  . PHE A 1 29  ? -15.005 5.614   -3.904  1.00 1.00 ? 49  PHE A CD1  7  
ATOM 11188 C CD2  . PHE A 1 29  ? -12.907 4.615   -4.670  1.00 1.00 ? 49  PHE A CD2  7  
ATOM 11189 C CE1  . PHE A 1 29  ? -14.402 6.889   -3.906  1.00 1.00 ? 49  PHE A CE1  7  
ATOM 11190 C CE2  . PHE A 1 29  ? -12.295 5.888   -4.638  1.00 1.00 ? 49  PHE A CE2  7  
ATOM 11191 C CZ   . PHE A 1 29  ? -13.047 7.026   -4.280  1.00 1.00 ? 49  PHE A CZ   7  
ATOM 11192 H H    . PHE A 1 29  ? -17.260 4.312   -5.674  1.00 1.00 ? 49  PHE A H    7  
ATOM 11193 H HA   . PHE A 1 29  ? -14.820 2.820   -6.593  1.00 1.00 ? 49  PHE A HA   7  
ATOM 11194 H HB2  . PHE A 1 29  ? -15.761 3.223   -3.717  1.00 0.00 ? 49  PHE A HB2  7  
ATOM 11195 H HB3  . PHE A 1 29  ? -14.333 2.317   -4.238  1.00 1.00 ? 49  PHE A HB3  7  
ATOM 11196 H HD1  . PHE A 1 29  ? -16.041 5.504   -3.617  1.00 1.00 ? 49  PHE A HD1  7  
ATOM 11197 H HD2  . PHE A 1 29  ? -12.338 3.749   -4.976  1.00 1.00 ? 49  PHE A HD2  7  
ATOM 11198 H HE1  . PHE A 1 29  ? -14.965 7.760   -3.607  1.00 1.00 ? 49  PHE A HE1  7  
ATOM 11199 H HE2  . PHE A 1 29  ? -11.250 6.000   -4.889  1.00 1.00 ? 49  PHE A HE2  7  
ATOM 11200 H HZ   . PHE A 1 29  ? -12.575 7.999   -4.266  1.00 1.00 ? 49  PHE A HZ   7  
ATOM 11201 N N    . LYS A 1 30  ? -16.049 0.639   -6.603  1.00 1.00 ? 50  LYS A N    7  
ATOM 11202 C CA   . LYS A 1 30  ? -16.815 -0.587  -6.906  1.00 1.00 ? 50  LYS A CA   7  
ATOM 11203 C C    . LYS A 1 30  ? -16.050 -1.820  -6.416  1.00 1.00 ? 50  LYS A C    7  
ATOM 11204 O O    . LYS A 1 30  ? -14.994 -2.157  -6.949  1.00 1.00 ? 50  LYS A O    7  
ATOM 11205 C CB   . LYS A 1 30  ? -17.125 -0.599  -8.419  1.00 1.00 ? 50  LYS A CB   7  
ATOM 11206 C CG   . LYS A 1 30  ? -18.149 0.478   -8.843  1.00 1.00 ? 50  LYS A CG   7  
ATOM 11207 C CD   . LYS A 1 30  ? -17.839 1.046   -10.234 1.00 1.00 ? 50  LYS A CD   7  
ATOM 11208 C CE   . LYS A 1 30  ? -18.507 2.411   -10.438 1.00 1.00 ? 50  LYS A CE   7  
ATOM 11209 N NZ   . LYS A 1 30  ? -18.285 2.956   -11.792 1.00 1.00 ? 50  LYS A NZ   7  
ATOM 11210 H H    . LYS A 1 30  ? -15.115 0.712   -7.008  1.00 1.00 ? 50  LYS A H    7  
ATOM 11211 H HA   . LYS A 1 30  ? -17.776 -0.563  -6.384  1.00 1.00 ? 50  LYS A HA   7  
ATOM 11212 H HB2  . LYS A 1 30  ? -16.231 -0.368  -9.001  1.00 0.00 ? 50  LYS A HB2  7  
ATOM 11213 H HB3  . LYS A 1 30  ? -17.490 -1.577  -8.733  1.00 1.00 ? 50  LYS A HB3  7  
ATOM 11214 H HG2  . LYS A 1 30  ? -19.150 0.056   -8.919  1.00 0.00 ? 50  LYS A HG2  7  
ATOM 11215 H HG3  . LYS A 1 30  ? -18.181 1.292   -8.119  1.00 1.00 ? 50  LYS A HG3  7  
ATOM 11216 H HD2  . LYS A 1 30  ? -16.764 1.202   -10.320 1.00 0.00 ? 50  LYS A HD2  7  
ATOM 11217 H HD3  . LYS A 1 30  ? -18.175 0.334   -10.989 1.00 1.00 ? 50  LYS A HD3  7  
ATOM 11218 H HE2  . LYS A 1 30  ? -19.588 2.299   -10.348 1.00 0.00 ? 50  LYS A HE2  7  
ATOM 11219 H HE3  . LYS A 1 30  ? -18.145 3.107   -9.677  1.00 1.00 ? 50  LYS A HE3  7  
ATOM 11220 H HZ1  . LYS A 1 30  ? -18.342 3.984   -11.763 1.00 0.00 ? 50  LYS A HZ1  7  
ATOM 11221 H HZ2  . LYS A 1 30  ? -17.354 2.674   -12.127 1.00 0.00 ? 50  LYS A HZ2  7  
ATOM 11222 N N    . VAL A 1 31  ? -16.559 -2.458  -5.352  1.00 1.00 ? 51  VAL A N    7  
ATOM 11223 C CA   . VAL A 1 31  ? -15.949 -3.626  -4.676  1.00 1.00 ? 51  VAL A CA   7  
ATOM 11224 C C    . VAL A 1 31  ? -16.993 -4.715  -4.384  1.00 1.00 ? 51  VAL A C    7  
ATOM 11225 O O    . VAL A 1 31  ? -18.153 -4.424  -4.067  1.00 1.00 ? 51  VAL A O    7  
ATOM 11226 C CB   . VAL A 1 31  ? -15.070 -3.279  -3.431  1.00 1.00 ? 51  VAL A CB   7  
ATOM 11227 C CG1  . VAL A 1 31  ? -14.338 -1.915  -3.494  1.00 1.00 ? 51  VAL A CG1  7  
ATOM 11228 C CG2  . VAL A 1 31  ? -15.743 -3.467  -2.064  1.00 1.00 ? 51  VAL A CG2  7  
ATOM 11229 H H    . VAL A 1 31  ? -17.456 -2.129  -5.018  1.00 1.00 ? 51  VAL A H    7  
ATOM 11230 H HA   . VAL A 1 31  ? -15.257 -4.059  -5.403  1.00 1.00 ? 51  VAL A HA   7  
ATOM 11231 H HB   . VAL A 1 31  ? -14.278 -4.021  -3.420  1.00 1.00 ? 51  VAL A HB   7  
ATOM 11232 H HG11 . VAL A 1 31  ? -13.823 -1.801  -4.444  1.00 1.00 ? 51  VAL A HG11 7  
ATOM 11233 H HG12 . VAL A 1 31  ? -15.016 -1.077  -3.391  1.00 1.00 ? 51  VAL A HG12 7  
ATOM 11234 H HG13 . VAL A 1 31  ? -13.609 -1.844  -2.687  1.00 1.00 ? 51  VAL A HG13 7  
ATOM 11235 H HG21 . VAL A 1 31  ? -16.724 -3.009  -2.041  1.00 1.00 ? 51  VAL A HG21 7  
ATOM 11236 H HG22 . VAL A 1 31  ? -15.870 -4.531  -1.859  1.00 1.00 ? 51  VAL A HG22 7  
ATOM 11237 H HG23 . VAL A 1 31  ? -15.117 -3.046  -1.279  1.00 1.00 ? 51  VAL A HG23 7  
ATOM 11238 N N    . VAL A 1 32  ? -16.538 -5.966  -4.503  1.00 1.00 ? 52  VAL A N    7  
ATOM 11239 C CA   . VAL A 1 32  ? -17.249 -7.247  -4.308  1.00 1.00 ? 52  VAL A CA   7  
ATOM 11240 C C    . VAL A 1 32  ? -16.375 -8.237  -3.517  1.00 1.00 ? 52  VAL A C    7  
ATOM 11241 O O    . VAL A 1 32  ? -15.147 -8.224  -3.662  1.00 1.00 ? 52  VAL A O    7  
ATOM 11242 C CB   . VAL A 1 32  ? -17.707 -7.880  -5.653  1.00 1.00 ? 52  VAL A CB   7  
ATOM 11243 C CG1  . VAL A 1 32  ? -18.888 -7.115  -6.277  1.00 1.00 ? 52  VAL A CG1  7  
ATOM 11244 C CG2  . VAL A 1 32  ? -16.587 -8.024  -6.704  1.00 1.00 ? 52  VAL A CG2  7  
ATOM 11245 H H    . VAL A 1 32  ? -15.538 -6.061  -4.689  1.00 1.00 ? 52  VAL A H    7  
ATOM 11246 H HA   . VAL A 1 32  ? -18.143 -7.056  -3.709  1.00 1.00 ? 52  VAL A HA   7  
ATOM 11247 H HB   . VAL A 1 32  ? -18.074 -8.882  -5.435  1.00 1.00 ? 52  VAL A HB   7  
ATOM 11248 H HG11 . VAL A 1 32  ? -19.717 -7.071  -5.570  1.00 1.00 ? 52  VAL A HG11 7  
ATOM 11249 H HG12 . VAL A 1 32  ? -18.588 -6.098  -6.532  1.00 1.00 ? 52  VAL A HG12 7  
ATOM 11250 H HG13 . VAL A 1 32  ? -19.220 -7.624  -7.182  1.00 1.00 ? 52  VAL A HG13 7  
ATOM 11251 H HG21 . VAL A 1 32  ? -15.758 -8.606  -6.299  1.00 1.00 ? 52  VAL A HG21 7  
ATOM 11252 H HG22 . VAL A 1 32  ? -16.970 -8.533  -7.590  1.00 1.00 ? 52  VAL A HG22 7  
ATOM 11253 H HG23 . VAL A 1 32  ? -16.217 -7.040  -6.995  1.00 1.00 ? 52  VAL A HG23 7  
ATOM 11254 N N    . ALA A 1 33  ? -16.974 -9.114  -2.696  1.00 1.00 ? 53  ALA A N    7  
ATOM 11255 C CA   . ALA A 1 33  ? -16.206 -10.151 -1.984  1.00 1.00 ? 53  ALA A CA   7  
ATOM 11256 C C    . ALA A 1 33  ? -16.821 -11.566 -1.992  1.00 1.00 ? 53  ALA A C    7  
ATOM 11257 O O    . ALA A 1 33  ? -18.028 -11.756 -2.166  1.00 1.00 ? 53  ALA A O    7  
ATOM 11258 C CB   . ALA A 1 33  ? -15.908 -9.664  -0.557  1.00 1.00 ? 53  ALA A CB   7  
ATOM 11259 H H    . ALA A 1 33  ? -17.980 -9.094  -2.582  1.00 1.00 ? 53  ALA A H    7  
ATOM 11260 H HA   . ALA A 1 33  ? -15.245 -10.249 -2.493  1.00 1.00 ? 53  ALA A HA   7  
ATOM 11261 H HB1  . ALA A 1 33  ? -15.582 -8.622  -0.554  1.00 1.00 ? 53  ALA A HB1  7  
ATOM 11262 H HB2  . ALA A 1 33  ? -16.791 -9.780  0.067   1.00 1.00 ? 53  ALA A HB2  7  
ATOM 11263 H HB3  . ALA A 1 33  ? -15.119 -10.271 -0.118  1.00 1.00 ? 53  ALA A HB3  7  
ATOM 11264 N N    . LEU A 1 34  ? -15.952 -12.560 -1.751  1.00 1.00 ? 54  LEU A N    7  
ATOM 11265 C CA   . LEU A 1 34  ? -16.272 -13.980 -1.553  1.00 1.00 ? 54  LEU A CA   7  
ATOM 11266 C C    . LEU A 1 34  ? -16.252 -14.272 -0.037  1.00 1.00 ? 54  LEU A C    7  
ATOM 11267 O O    . LEU A 1 34  ? -15.193 -14.297 0.595   1.00 1.00 ? 54  LEU A O    7  
ATOM 11268 C CB   . LEU A 1 34  ? -15.259 -14.846 -2.332  1.00 1.00 ? 54  LEU A CB   7  
ATOM 11269 C CG   . LEU A 1 34  ? -14.994 -14.489 -3.815  1.00 1.00 ? 54  LEU A CG   7  
ATOM 11270 C CD1  . LEU A 1 34  ? -13.893 -15.392 -4.384  1.00 1.00 ? 54  LEU A CD1  7  
ATOM 11271 C CD2  . LEU A 1 34  ? -16.257 -14.610 -4.681  1.00 1.00 ? 54  LEU A CD2  7  
ATOM 11272 H H    . LEU A 1 34  ? -14.982 -12.259 -1.653  1.00 1.00 ? 54  LEU A H    7  
ATOM 11273 H HA   . LEU A 1 34  ? -17.269 -14.182 -1.946  1.00 1.00 ? 54  LEU A HA   7  
ATOM 11274 H HB2  . LEU A 1 34  ? -14.261 -14.690 -1.923  1.00 0.00 ? 54  LEU A HB2  7  
ATOM 11275 H HB3  . LEU A 1 34  ? -15.531 -15.897 -2.235  1.00 1.00 ? 54  LEU A HB3  7  
ATOM 11276 H HG   . LEU A 1 34  ? -14.635 -13.460 -3.872  1.00 1.00 ? 54  LEU A HG   7  
ATOM 11277 H HD11 . LEU A 1 34  ? -12.982 -15.277 -3.799  1.00 1.00 ? 54  LEU A HD11 7  
ATOM 11278 H HD12 . LEU A 1 34  ? -14.206 -16.435 -4.360  1.00 1.00 ? 54  LEU A HD12 7  
ATOM 11279 H HD13 . LEU A 1 34  ? -13.677 -15.108 -5.415  1.00 1.00 ? 54  LEU A HD13 7  
ATOM 11280 H HD21 . LEU A 1 34  ? -16.666 -15.619 -4.620  1.00 1.00 ? 54  LEU A HD21 7  
ATOM 11281 H HD22 . LEU A 1 34  ? -17.007 -13.894 -4.344  1.00 1.00 ? 54  LEU A HD22 7  
ATOM 11282 H HD23 . LEU A 1 34  ? -16.017 -14.380 -5.720  1.00 1.00 ? 54  LEU A HD23 7  
ATOM 11283 N N    . GLY A 1 35  ? -17.432 -14.570 0.519   1.00 1.00 ? 55  GLY A N    7  
ATOM 11284 C CA   . GLY A 1 35  ? -17.695 -14.672 1.966   1.00 1.00 ? 55  GLY A CA   7  
ATOM 11285 C C    . GLY A 1 35  ? -18.279 -13.355 2.524   1.00 1.00 ? 55  GLY A C    7  
ATOM 11286 O O    . GLY A 1 35  ? -18.252 -12.320 1.851   1.00 1.00 ? 55  GLY A O    7  
ATOM 11287 H H    . GLY A 1 35  ? -18.234 -14.502 -0.086  1.00 1.00 ? 55  GLY A H    7  
ATOM 11288 H HA2  . GLY A 1 35  ? -18.394 -15.487 2.151   1.00 1.00 ? 55  GLY A HA2  7  
ATOM 11289 H HA3  . GLY A 1 35  ? -16.771 -14.894 2.502   1.00 1.00 ? 55  GLY A HA3  7  
ATOM 11290 N N    . ASP A 1 36  ? -18.780 -13.380 3.770   1.00 1.00 ? 56  ASP A N    7  
ATOM 11291 C CA   . ASP A 1 36  ? -19.516 -12.269 4.420   1.00 1.00 ? 56  ASP A CA   7  
ATOM 11292 C C    . ASP A 1 36  ? -20.787 -11.765 3.660   1.00 1.00 ? 56  ASP A C    7  
ATOM 11293 O O    . ASP A 1 36  ? -21.052 -12.161 2.519   1.00 1.00 ? 56  ASP A O    7  
ATOM 11294 C CB   . ASP A 1 36  ? -18.491 -11.147 4.714   1.00 1.00 ? 56  ASP A CB   7  
ATOM 11295 C CG   . ASP A 1 36  ? -18.763 -10.267 5.937   1.00 1.00 ? 56  ASP A CG   7  
ATOM 11296 O OD1  . ASP A 1 36  ? -19.918 -10.282 6.412   1.00 1.00 ? 56  ASP A OD1  7  
ATOM 11297 O OD2  . ASP A 1 36  ? -17.780 -9.647  6.411   1.00 1.00 ? 56  ASP A OD2  7  
ATOM 11298 H H    . ASP A 1 36  ? -18.696 -14.240 4.289   1.00 1.00 ? 56  ASP A H    7  
ATOM 11299 H HA   . ASP A 1 36  ? -19.876 -12.652 5.375   1.00 1.00 ? 56  ASP A HA   7  
ATOM 11300 H HB2  . ASP A 1 36  ? -17.521 -11.619 4.875   1.00 0.00 ? 56  ASP A HB2  7  
ATOM 11301 H HB3  . ASP A 1 36  ? -18.297 -10.541 3.827   1.00 1.00 ? 56  ASP A HB3  7  
ATOM 11302 N N    . VAL A 1 37  ? -21.609 -10.915 4.308   1.00 1.00 ? 57  VAL A N    7  
ATOM 11303 C CA   . VAL A 1 37  ? -22.765 -10.231 3.665   1.00 1.00 ? 57  VAL A CA   7  
ATOM 11304 C C    . VAL A 1 37  ? -23.127 -8.839  4.237   1.00 1.00 ? 57  VAL A C    7  
ATOM 11305 O O    . VAL A 1 37  ? -23.377 -7.949  3.416   1.00 1.00 ? 57  VAL A O    7  
ATOM 11306 C CB   . VAL A 1 37  ? -23.995 -11.163 3.421   1.00 1.00 ? 57  VAL A CB   7  
ATOM 11307 C CG1  . VAL A 1 37  ? -24.975 -11.324 4.595   1.00 1.00 ? 57  VAL A CG1  7  
ATOM 11308 C CG2  . VAL A 1 37  ? -24.789 -10.708 2.182   1.00 1.00 ? 57  VAL A CG2  7  
ATOM 11309 H H    . VAL A 1 37  ? -21.284 -10.613 5.235   1.00 1.00 ? 57  VAL A H    7  
ATOM 11310 H HA   . VAL A 1 37  ? -22.401 -10.009 2.663   1.00 1.00 ? 57  VAL A HA   7  
ATOM 11311 H HB   . VAL A 1 37  ? -23.632 -12.166 3.188   1.00 1.00 ? 57  VAL A HB   7  
ATOM 11312 H HG11 . VAL A 1 37  ? -25.380 -10.357 4.889   1.00 1.00 ? 57  VAL A HG11 7  
ATOM 11313 H HG12 . VAL A 1 37  ? -25.802 -11.971 4.301   1.00 1.00 ? 57  VAL A HG12 7  
ATOM 11314 H HG13 . VAL A 1 37  ? -24.472 -11.808 5.429   1.00 1.00 ? 57  VAL A HG13 7  
ATOM 11315 H HG21 . VAL A 1 37  ? -24.142 -10.736 1.303   1.00 1.00 ? 57  VAL A HG21 7  
ATOM 11316 H HG22 . VAL A 1 37  ? -25.630 -11.378 2.007   1.00 1.00 ? 57  VAL A HG22 7  
ATOM 11317 H HG23 . VAL A 1 37  ? -25.161 -9.693  2.317   1.00 1.00 ? 57  VAL A HG23 7  
ATOM 11318 N N    . PRO A 1 38  ? -23.169 -8.594  5.574   1.00 1.00 ? 58  PRO A N    7  
ATOM 11319 C CA   . PRO A 1 38  ? -23.338 -7.246  6.144   1.00 1.00 ? 58  PRO A CA   7  
ATOM 11320 C C    . PRO A 1 38  ? -22.000 -6.459  6.177   1.00 1.00 ? 58  PRO A C    7  
ATOM 11321 O O    . PRO A 1 38  ? -20.934 -7.037  5.976   1.00 1.00 ? 58  PRO A O    7  
ATOM 11322 C CB   . PRO A 1 38  ? -23.831 -7.480  7.575   1.00 1.00 ? 58  PRO A CB   7  
ATOM 11323 C CG   . PRO A 1 38  ? -23.075 -8.749  7.972   1.00 1.00 ? 58  PRO A CG   7  
ATOM 11324 C CD   . PRO A 1 38  ? -22.912 -9.532  6.667   1.00 1.00 ? 58  PRO A CD   7  
ATOM 11325 H HA   . PRO A 1 38  ? -24.085 -6.678  5.581   1.00 1.00 ? 58  PRO A HA   7  
ATOM 11326 H HB2  . PRO A 1 38  ? -23.588 -6.636  8.222   1.00 0.00 ? 58  PRO A HB2  7  
ATOM 11327 H HB3  . PRO A 1 38  ? -24.906 -7.680  7.570   1.00 1.00 ? 58  PRO A HB3  7  
ATOM 11328 H HG2  . PRO A 1 38  ? -22.101 -8.510  8.400   1.00 0.00 ? 58  PRO A HG2  7  
ATOM 11329 H HG3  . PRO A 1 38  ? -23.631 -9.324  8.713   1.00 1.00 ? 58  PRO A HG3  7  
ATOM 11330 H HD2  . PRO A 1 38  ? -21.916 -9.967  6.585   1.00 0.00 ? 58  PRO A HD2  7  
ATOM 11331 H HD3  . PRO A 1 38  ? -23.629 -10.346 6.662   1.00 1.00 ? 58  PRO A HD3  7  
ATOM 11332 N N    . ASP A 1 39  ? -22.077 -5.148  6.471   1.00 1.00 ? 59  ASP A N    7  
ATOM 11333 C CA   . ASP A 1 39  ? -20.987 -4.175  6.722   1.00 1.00 ? 59  ASP A CA   7  
ATOM 11334 C C    . ASP A 1 39  ? -19.577 -4.645  6.235   1.00 1.00 ? 59  ASP A C    7  
ATOM 11335 O O    . ASP A 1 39  ? -19.351 -4.849  5.037   1.00 1.00 ? 59  ASP A O    7  
ATOM 11336 C CB   . ASP A 1 39  ? -21.038 -3.815  8.232   1.00 1.00 ? 59  ASP A CB   7  
ATOM 11337 C CG   . ASP A 1 39  ? -22.440 -3.492  8.758   1.00 1.00 ? 59  ASP A CG   7  
ATOM 11338 O OD1  . ASP A 1 39  ? -22.878 -2.342  8.556   1.00 1.00 ? 59  ASP A OD1  7  
ATOM 11339 O OD2  . ASP A 1 39  ? -23.067 -4.428  9.301   1.00 1.00 ? 59  ASP A OD2  7  
ATOM 11340 H H    . ASP A 1 39  ? -23.005 -4.824  6.703   1.00 1.00 ? 59  ASP A H    7  
ATOM 11341 H HA   . ASP A 1 39  ? -21.222 -3.262  6.175   1.00 1.00 ? 59  ASP A HA   7  
ATOM 11342 H HB2  . ASP A 1 39  ? -20.659 -4.663  8.799   1.00 0.00 ? 59  ASP A HB2  7  
ATOM 11343 H HB3  . ASP A 1 39  ? -20.359 -2.984  8.445   1.00 1.00 ? 59  ASP A HB3  7  
ATOM 11344 N N    . GLY A 1 40  ? -18.590 -4.713  7.141   1.00 1.00 ? 60  GLY A N    7  
ATOM 11345 C CA   . GLY A 1 40  ? -17.275 -5.326  6.945   1.00 1.00 ? 60  GLY A CA   7  
ATOM 11346 C C    . GLY A 1 40  ? -16.142 -4.600  7.658   1.00 1.00 ? 60  GLY A C    7  
ATOM 11347 O O    . GLY A 1 40  ? -15.567 -5.084  8.634   1.00 1.00 ? 60  GLY A O    7  
ATOM 11348 H H    . GLY A 1 40  ? -18.755 -4.192  7.987   1.00 1.00 ? 60  GLY A H    7  
ATOM 11349 H HA2  . GLY A 1 40  ? -17.314 -6.355  7.304   1.00 1.00 ? 60  GLY A HA2  7  
ATOM 11350 H HA3  . GLY A 1 40  ? -17.043 -5.371  5.880   1.00 1.00 ? 60  GLY A HA3  7  
ATOM 11351 N N    . THR A 1 41  ? -15.826 -3.412  7.137   1.00 1.00 ? 61  THR A N    7  
ATOM 11352 C CA   . THR A 1 41  ? -14.645 -2.609  7.497   1.00 1.00 ? 61  THR A CA   7  
ATOM 11353 C C    . THR A 1 41  ? -14.880 -1.101  7.609   1.00 1.00 ? 61  THR A C    7  
ATOM 11354 O O    . THR A 1 41  ? -15.872 -0.556  7.126   1.00 1.00 ? 61  THR A O    7  
ATOM 11355 C CB   . THR A 1 41  ? -13.524 -2.810  6.435   1.00 1.00 ? 61  THR A CB   7  
ATOM 11356 O OG1  . THR A 1 41  ? -13.894 -2.325  5.158   1.00 1.00 ? 61  THR A OG1  7  
ATOM 11357 C CG2  . THR A 1 41  ? -13.064 -4.256  6.282   1.00 1.00 ? 61  THR A CG2  7  
ATOM 11358 H H    . THR A 1 41  ? -16.377 -3.110  6.341   1.00 1.00 ? 61  THR A H    7  
ATOM 11359 H HA   . THR A 1 41  ? -14.265 -2.950  8.460   1.00 1.00 ? 61  THR A HA   7  
ATOM 11360 H HB   . THR A 1 41  ? -12.654 -2.237  6.738   1.00 1.00 ? 61  THR A HB   7  
ATOM 11361 H HG1  . THR A 1 41  ? -14.839 -2.529  4.980   1.00 1.00 ? 61  THR A HG1  7  
ATOM 11362 H HG21 . THR A 1 41  ? -12.681 -4.635  7.226   1.00 1.00 ? 61  THR A HG21 7  
ATOM 11363 H HG22 . THR A 1 41  ? -13.906 -4.863  5.969   1.00 1.00 ? 61  THR A HG22 7  
ATOM 11364 H HG23 . THR A 1 41  ? -12.274 -4.318  5.531   1.00 1.00 ? 61  THR A HG23 7  
ATOM 11365 N N    . LEU A 1 42  ? -13.886 -0.461  8.233   1.00 1.00 ? 62  LEU A N    7  
ATOM 11366 C CA   . LEU A 1 42  ? -13.622 0.966   8.337   1.00 1.00 ? 62  LEU A CA   7  
ATOM 11367 C C    . LEU A 1 42  ? -12.385 1.245   7.449   1.00 1.00 ? 62  LEU A C    7  
ATOM 11368 O O    . LEU A 1 42  ? -11.240 0.937   7.801   1.00 1.00 ? 62  LEU A O    7  
ATOM 11369 C CB   . LEU A 1 42  ? -13.430 1.395   9.800   1.00 1.00 ? 62  LEU A CB   7  
ATOM 11370 C CG   . LEU A 1 42  ? -14.720 1.556   10.624  1.00 1.00 ? 62  LEU A CG   7  
ATOM 11371 C CD1  . LEU A 1 42  ? -14.318 1.756   12.091  1.00 1.00 ? 62  LEU A CD1  7  
ATOM 11372 C CD2  . LEU A 1 42  ? -15.591 2.736   10.158  1.00 1.00 ? 62  LEU A CD2  7  
ATOM 11373 H H    . LEU A 1 42  ? -13.180 -1.071  8.649   1.00 1.00 ? 62  LEU A H    7  
ATOM 11374 H HA   . LEU A 1 42  ? -14.467 1.511   7.937   1.00 1.00 ? 62  LEU A HA   7  
ATOM 11375 H HB2  . LEU A 1 42  ? -12.892 0.620   10.346  1.00 0.00 ? 62  LEU A HB2  7  
ATOM 11376 H HB3  . LEU A 1 42  ? -12.857 2.324   9.842   1.00 1.00 ? 62  LEU A HB3  7  
ATOM 11377 H HG   . LEU A 1 42  ? -15.308 0.642   10.543  1.00 1.00 ? 62  LEU A HG   7  
ATOM 11378 H HD11 . LEU A 1 42  ? -13.748 0.893   12.437  1.00 1.00 ? 62  LEU A HD11 7  
ATOM 11379 H HD12 . LEU A 1 42  ? -13.705 2.652   12.195  1.00 1.00 ? 62  LEU A HD12 7  
ATOM 11380 H HD13 . LEU A 1 42  ? -15.208 1.864   12.712  1.00 1.00 ? 62  LEU A HD13 7  
ATOM 11381 H HD21 . LEU A 1 42  ? -15.017 3.663   10.179  1.00 1.00 ? 62  LEU A HD21 7  
ATOM 11382 H HD22 . LEU A 1 42  ? -15.954 2.566   9.145   1.00 1.00 ? 62  LEU A HD22 7  
ATOM 11383 H HD23 . LEU A 1 42  ? -16.458 2.845   10.809  1.00 1.00 ? 62  LEU A HD23 7  
ATOM 11384 N N    . VAL A 1 43  ? -12.610 1.868   6.291   1.00 1.00 ? 63  VAL A N    7  
ATOM 11385 C CA   . VAL A 1 43  ? -11.602 2.115   5.247   1.00 1.00 ? 63  VAL A CA   7  
ATOM 11386 C C    . VAL A 1 43  ? -10.994 3.481   5.561   1.00 1.00 ? 63  VAL A C    7  
ATOM 11387 O O    . VAL A 1 43  ? -11.664 4.503   5.372   1.00 1.00 ? 63  VAL A O    7  
ATOM 11388 C CB   . VAL A 1 43  ? -12.253 2.103   3.830   1.00 1.00 ? 63  VAL A CB   7  
ATOM 11389 C CG1  . VAL A 1 43  ? -11.269 2.529   2.720   1.00 1.00 ? 63  VAL A CG1  7  
ATOM 11390 C CG2  . VAL A 1 43  ? -12.828 0.721   3.457   1.00 1.00 ? 63  VAL A CG2  7  
ATOM 11391 H H    . VAL A 1 43  ? -13.578 2.109   6.098   1.00 1.00 ? 63  VAL A H    7  
ATOM 11392 H HA   . VAL A 1 43  ? -10.826 1.352   5.274   1.00 1.00 ? 63  VAL A HA   7  
ATOM 11393 H HB   . VAL A 1 43  ? -13.084 2.811   3.819   1.00 1.00 ? 63  VAL A HB   7  
ATOM 11394 H HG11 . VAL A 1 43  ? -10.417 1.857   2.686   1.00 1.00 ? 63  VAL A HG11 7  
ATOM 11395 H HG12 . VAL A 1 43  ? -11.767 2.517   1.750   1.00 1.00 ? 63  VAL A HG12 7  
ATOM 11396 H HG13 . VAL A 1 43  ? -10.913 3.546   2.896   1.00 1.00 ? 63  VAL A HG13 7  
ATOM 11397 H HG21 . VAL A 1 43  ? -13.536 0.386   4.216   1.00 1.00 ? 63  VAL A HG21 7  
ATOM 11398 H HG22 . VAL A 1 43  ? -13.360 0.780   2.506   1.00 1.00 ? 63  VAL A HG22 7  
ATOM 11399 H HG23 . VAL A 1 43  ? -12.032 -0.014  3.365   1.00 1.00 ? 63  VAL A HG23 7  
ATOM 11400 N N    . THR A 1 44  ? -9.737  3.490   6.044   1.00 1.00 ? 64  THR A N    7  
ATOM 11401 C CA   . THR A 1 44  ? -8.992  4.718   6.406   1.00 1.00 ? 64  THR A CA   7  
ATOM 11402 C C    . THR A 1 44  ? -7.820  4.962   5.439   1.00 1.00 ? 64  THR A C    7  
ATOM 11403 O O    . THR A 1 44  ? -6.882  4.164   5.347   1.00 1.00 ? 64  THR A O    7  
ATOM 11404 C CB   . THR A 1 44  ? -8.491  4.692   7.868   1.00 1.00 ? 64  THR A CB   7  
ATOM 11405 O OG1  . THR A 1 44  ? -9.561  4.475   8.768   1.00 1.00 ? 64  THR A OG1  7  
ATOM 11406 C CG2  . THR A 1 44  ? -7.858  6.017   8.311   1.00 1.00 ? 64  THR A CG2  7  
ATOM 11407 H H    . THR A 1 44  ? -9.324  2.600   6.352   1.00 1.00 ? 64  THR A H    7  
ATOM 11408 H HA   . THR A 1 44  ? -9.677  5.564   6.337   1.00 1.00 ? 64  THR A HA   7  
ATOM 11409 H HB   . THR A 1 44  ? -7.757  3.896   8.001   1.00 1.00 ? 64  THR A HB   7  
ATOM 11410 H HG1  . THR A 1 44  ? -9.220  4.606   9.654   1.00 1.00 ? 64  THR A HG1  7  
ATOM 11411 H HG21 . THR A 1 44  ? -8.562  6.841   8.214   1.00 1.00 ? 64  THR A HG21 7  
ATOM 11412 H HG22 . THR A 1 44  ? -7.531  5.954   9.348   1.00 1.00 ? 64  THR A HG22 7  
ATOM 11413 H HG23 . THR A 1 44  ? -6.977  6.222   7.697   1.00 1.00 ? 64  THR A HG23 7  
ATOM 11414 N N    . VAL A 1 45  ? -7.826  6.105   4.734   1.00 1.00 ? 65  VAL A N    7  
ATOM 11415 C CA   . VAL A 1 45  ? -6.771  6.460   3.756   1.00 1.00 ? 65  VAL A CA   7  
ATOM 11416 C C    . VAL A 1 45  ? -5.766  7.438   4.395   1.00 1.00 ? 65  VAL A C    7  
ATOM 11417 O O    . VAL A 1 45  ? -6.116  8.570   4.738   1.00 1.00 ? 65  VAL A O    7  
ATOM 11418 C CB   . VAL A 1 45  ? -7.342  6.892   2.369   1.00 1.00 ? 65  VAL A CB   7  
ATOM 11419 C CG1  . VAL A 1 45  ? -8.600  6.088   1.937   1.00 1.00 ? 65  VAL A CG1  7  
ATOM 11420 C CG2  . VAL A 1 45  ? -7.611  8.400   2.240   1.00 1.00 ? 65  VAL A CG2  7  
ATOM 11421 H H    . VAL A 1 45  ? -8.637  6.710   4.845   1.00 1.00 ? 65  VAL A H    7  
ATOM 11422 H HA   . VAL A 1 45  ? -6.209  5.557   3.539   1.00 1.00 ? 65  VAL A HA   7  
ATOM 11423 H HB   . VAL A 1 45  ? -6.579  6.668   1.623   1.00 1.00 ? 65  VAL A HB   7  
ATOM 11424 H HG11 . VAL A 1 45  ? -8.394  5.021   1.925   1.00 1.00 ? 65  VAL A HG11 7  
ATOM 11425 H HG12 . VAL A 1 45  ? -9.421  6.235   2.635   1.00 1.00 ? 65  VAL A HG12 7  
ATOM 11426 H HG13 . VAL A 1 45  ? -8.923  6.384   0.938   1.00 1.00 ? 65  VAL A HG13 7  
ATOM 11427 H HG21 . VAL A 1 45  ? -8.132  8.753   3.129   1.00 1.00 ? 65  VAL A HG21 7  
ATOM 11428 H HG22 . VAL A 1 45  ? -6.665  8.939   2.160   1.00 1.00 ? 65  VAL A HG22 7  
ATOM 11429 H HG23 . VAL A 1 45  ? -8.206  8.607   1.351   1.00 1.00 ? 65  VAL A HG23 7  
ATOM 11430 N N    . MET A 1 46  ? -4.504  7.009   4.575   1.00 1.00 ? 66  MET A N    7  
ATOM 11431 C CA   . MET A 1 46  ? -3.432  7.823   5.172   1.00 1.00 ? 66  MET A CA   7  
ATOM 11432 C C    . MET A 1 46  ? -2.254  7.984   4.197   1.00 1.00 ? 66  MET A C    7  
ATOM 11433 O O    . MET A 1 46  ? -1.194  7.360   4.349   1.00 1.00 ? 66  MET A O    7  
ATOM 11434 C CB   . MET A 1 46  ? -3.043  7.238   6.544   1.00 1.00 ? 66  MET A CB   7  
ATOM 11435 C CG   . MET A 1 46  ? -4.044  7.548   7.661   1.00 1.00 ? 66  MET A CG   7  
ATOM 11436 S SD   . MET A 1 46  ? -4.133  6.265   8.932   1.00 1.00 ? 66  MET A SD   7  
ATOM 11437 C CE   . MET A 1 46  ? -4.900  7.220   10.266  1.00 1.00 ? 66  MET A CE   7  
ATOM 11438 H H    . MET A 1 46  ? -4.270  6.034   4.395   1.00 1.00 ? 66  MET A H    7  
ATOM 11439 H HA   . MET A 1 46  ? -3.803  8.832   5.365   1.00 1.00 ? 66  MET A HA   7  
ATOM 11440 H HB2  . MET A 1 46  ? -2.976  6.154   6.448   1.00 0.00 ? 66  MET A HB2  7  
ATOM 11441 H HB3  . MET A 1 46  ? -2.067  7.605   6.864   1.00 1.00 ? 66  MET A HB3  7  
ATOM 11442 H HG2  . MET A 1 46  ? -3.824  8.467   8.204   1.00 0.00 ? 66  MET A HG2  7  
ATOM 11443 H HG3  . MET A 1 46  ? -5.042  7.732   7.261   1.00 1.00 ? 66  MET A HG3  7  
ATOM 11444 H HE1  . MET A 1 46  ? -5.818  7.687   9.909   1.00 1.00 ? 66  MET A HE1  7  
ATOM 11445 H HE2  . MET A 1 46  ? -5.134  6.557   11.098  1.00 1.00 ? 66  MET A HE2  7  
ATOM 11446 H HE3  . MET A 1 46  ? -4.208  7.993   10.603  1.00 1.00 ? 66  MET A HE3  7  
ATOM 11447 N N    . ALA A 1 47  ? -2.392  8.876   3.205   1.00 1.00 ? 67  ALA A N    7  
ATOM 11448 C CA   . ALA A 1 47  ? -1.306  9.182   2.287   1.00 1.00 ? 67  ALA A CA   7  
ATOM 11449 C C    . ALA A 1 47  ? -0.634  10.472  2.793   1.00 1.00 ? 67  ALA A C    7  
ATOM 11450 O O    . ALA A 1 47  ? -1.219  11.554  2.725   1.00 1.00 ? 67  ALA A O    7  
ATOM 11451 C CB   . ALA A 1 47  ? -1.892  9.246   0.869   1.00 1.00 ? 67  ALA A CB   7  
ATOM 11452 H H    . ALA A 1 47  ? -3.211  9.467   3.089   1.00 1.00 ? 67  ALA A H    7  
ATOM 11453 H HA   . ALA A 1 47  ? -0.570  8.385   2.294   1.00 1.00 ? 67  ALA A HA   7  
ATOM 11454 H HB1  . ALA A 1 47  ? -2.731  9.934   0.829   1.00 1.00 ? 67  ALA A HB1  7  
ATOM 11455 H HB2  . ALA A 1 47  ? -1.126  9.580   0.172   1.00 1.00 ? 67  ALA A HB2  7  
ATOM 11456 H HB3  . ALA A 1 47  ? -2.241  8.260   0.558   1.00 1.00 ? 67  ALA A HB3  7  
ATOM 11457 N N    . GLY A 1 48  ? 0.563   10.326  3.365   1.00 1.00 ? 68  GLY A N    7  
ATOM 11458 C CA   . GLY A 1 48  ? 1.347   11.377  4.044   1.00 1.00 ? 68  GLY A CA   7  
ATOM 11459 C C    . GLY A 1 48  ? 2.078   12.393  3.142   1.00 1.00 ? 68  GLY A C    7  
ATOM 11460 O O    . GLY A 1 48  ? 2.190   12.235  1.927   1.00 1.00 ? 68  GLY A O    7  
ATOM 11461 H H    . GLY A 1 48  ? 0.848   9.354   3.411   1.00 1.00 ? 68  GLY A H    7  
ATOM 11462 H HA2  . GLY A 1 48  ? 0.679   11.928  4.708   1.00 1.00 ? 68  GLY A HA2  7  
ATOM 11463 H HA3  . GLY A 1 48  ? 2.099   10.905  4.666   1.00 1.00 ? 68  GLY A HA3  7  
ATOM 11464 N N    . ASN A 1 49  ? 2.620   13.430  3.792   1.00 1.00 ? 69  ASN A N    7  
ATOM 11465 C CA   . ASN A 1 49  ? 3.282   14.623  3.244   1.00 1.00 ? 69  ASN A CA   7  
ATOM 11466 C C    . ASN A 1 49  ? 4.435   15.068  4.176   1.00 1.00 ? 69  ASN A C    7  
ATOM 11467 O O    . ASN A 1 49  ? 4.212   15.784  5.149   1.00 1.00 ? 69  ASN A O    7  
ATOM 11468 C CB   . ASN A 1 49  ? 2.220   15.726  3.008   1.00 1.00 ? 69  ASN A CB   7  
ATOM 11469 C CG   . ASN A 1 49  ? 1.389   16.135  4.227   1.00 1.00 ? 69  ASN A CG   7  
ATOM 11470 O OD1  . ASN A 1 49  ? 0.884   15.328  4.986   1.00 1.00 ? 69  ASN A OD1  7  
ATOM 11471 N ND2  . ASN A 1 49  ? 1.163   17.409  4.440   1.00 1.00 ? 69  ASN A ND2  7  
ATOM 11472 H H    . ASN A 1 49  ? 2.453   13.502  4.784   1.00 1.00 ? 69  ASN A H    7  
ATOM 11473 H HA   . ASN A 1 49  ? 3.717   14.374  2.273   1.00 1.00 ? 69  ASN A HA   7  
ATOM 11474 H HB2  . ASN A 1 49  ? 2.727   16.646  2.715   1.00 0.00 ? 69  ASN A HB2  7  
ATOM 11475 H HB3  . ASN A 1 49  ? 1.548   15.403  2.217   1.00 1.00 ? 69  ASN A HB3  7  
ATOM 11476 H HD21 . ASN A 1 49  ? 1.542   18.114  3.793   1.00 0.00 ? 69  ASN A HD21 7  
ATOM 11477 H HD22 . ASN A 1 49  ? 0.606   17.703  5.255   1.00 0.00 ? 69  ASN A HD22 7  
ATOM 11478 N N    . ASP A 1 50  ? 5.647   14.563  3.903   1.00 1.00 ? 70  ASP A N    7  
ATOM 11479 C CA   . ASP A 1 50  ? 6.871   14.716  4.727   1.00 1.00 ? 70  ASP A CA   7  
ATOM 11480 C C    . ASP A 1 50  ? 6.795   14.063  6.144   1.00 1.00 ? 70  ASP A C    7  
ATOM 11481 O O    . ASP A 1 50  ? 7.577   14.392  7.039   1.00 1.00 ? 70  ASP A O    7  
ATOM 11482 C CB   . ASP A 1 50  ? 7.315   16.208  4.696   1.00 1.00 ? 70  ASP A CB   7  
ATOM 11483 C CG   . ASP A 1 50  ? 8.354   16.617  3.632   1.00 1.00 ? 70  ASP A CG   7  
ATOM 11484 O OD1  . ASP A 1 50  ? 8.747   15.767  2.800   1.00 1.00 ? 70  ASP A OD1  7  
ATOM 11485 O OD2  . ASP A 1 50  ? 8.746   17.805  3.634   1.00 1.00 ? 70  ASP A OD2  7  
ATOM 11486 H H    . ASP A 1 50  ? 5.677   13.957  3.101   1.00 1.00 ? 70  ASP A H    7  
ATOM 11487 H HA   . ASP A 1 50  ? 7.655   14.142  4.237   1.00 1.00 ? 70  ASP A HA   7  
ATOM 11488 H HB2  . ASP A 1 50  ? 6.426   16.811  4.510   1.00 0.00 ? 70  ASP A HB2  7  
ATOM 11489 H HB3  . ASP A 1 50  ? 7.630   16.563  5.676   1.00 1.00 ? 70  ASP A HB3  7  
ATOM 11490 N N    . GLU A 1 51  ? 5.864   13.102  6.326   1.00 1.00 ? 71  GLU A N    7  
ATOM 11491 C CA   . GLU A 1 51  ? 5.507   12.432  7.598   1.00 1.00 ? 71  GLU A CA   7  
ATOM 11492 C C    . GLU A 1 51  ? 5.035   10.955  7.489   1.00 1.00 ? 71  GLU A C    7  
ATOM 11493 O O    . GLU A 1 51  ? 5.184   10.218  8.458   1.00 1.00 ? 71  GLU A O    7  
ATOM 11494 C CB   . GLU A 1 51  ? 4.410   13.300  8.247   1.00 1.00 ? 71  GLU A CB   7  
ATOM 11495 C CG   . GLU A 1 51  ? 4.148   13.102  9.746   1.00 1.00 ? 71  GLU A CG   7  
ATOM 11496 C CD   . GLU A 1 51  ? 3.860   14.416  10.488  1.00 1.00 ? 71  GLU A CD   7  
ATOM 11497 O OE1  . GLU A 1 51  ? 3.128   15.258  9.929   1.00 1.00 ? 71  GLU A OE1  7  
ATOM 11498 O OE2  . GLU A 1 51  ? 4.348   14.550  11.634  1.00 1.00 ? 71  GLU A OE2  7  
ATOM 11499 H H    . GLU A 1 51  ? 5.337   12.909  5.489   1.00 1.00 ? 71  GLU A H    7  
ATOM 11500 H HA   . GLU A 1 51  ? 6.374   12.457  8.268   1.00 1.00 ? 71  GLU A HA   7  
ATOM 11501 H HB2  . GLU A 1 51  ? 4.696   14.344  8.117   1.00 0.00 ? 71  GLU A HB2  7  
ATOM 11502 H HB3  . GLU A 1 51  ? 3.471   13.241  7.688   1.00 1.00 ? 71  GLU A HB3  7  
ATOM 11503 H HG2  . GLU A 1 51  ? 3.293   12.458  9.951   1.00 0.00 ? 71  GLU A HG2  7  
ATOM 11504 H HG3  . GLU A 1 51  ? 4.962   12.546  10.216  1.00 1.00 ? 71  GLU A HG3  7  
ATOM 11505 N N    . ASN A 1 52  ? 4.469   10.510  6.341   1.00 1.00 ? 72  ASN A N    7  
ATOM 11506 C CA   . ASN A 1 52  ? 3.811   9.196   6.120   1.00 1.00 ? 72  ASN A CA   7  
ATOM 11507 C C    . ASN A 1 52  ? 2.836   8.768   7.257   1.00 1.00 ? 72  ASN A C    7  
ATOM 11508 O O    . ASN A 1 52  ? 2.744   7.596   7.624   1.00 1.00 ? 72  ASN A O    7  
ATOM 11509 C CB   . ASN A 1 52  ? 4.855   8.135   5.711   1.00 1.00 ? 72  ASN A CB   7  
ATOM 11510 C CG   . ASN A 1 52  ? 4.302   6.993   4.856   1.00 1.00 ? 72  ASN A CG   7  
ATOM 11511 O OD1  . ASN A 1 52  ? 3.107   6.767   4.685   1.00 1.00 ? 72  ASN A OD1  7  
ATOM 11512 N ND2  . ASN A 1 52  ? 5.180   6.249   4.223   1.00 1.00 ? 72  ASN A ND2  7  
ATOM 11513 H H    . ASN A 1 52  ? 4.451   11.161  5.576   1.00 1.00 ? 72  ASN A H    7  
ATOM 11514 H HA   . ASN A 1 52  ? 3.169   9.308   5.249   1.00 1.00 ? 72  ASN A HA   7  
ATOM 11515 H HB2  . ASN A 1 52  ? 5.614   8.574   5.063   1.00 0.00 ? 72  ASN A HB2  7  
ATOM 11516 H HB3  . ASN A 1 52  ? 5.350   7.725   6.593   1.00 1.00 ? 72  ASN A HB3  7  
ATOM 11517 H HD21 . ASN A 1 52  ? 6.186   6.446   4.317   1.00 0.00 ? 72  ASN A HD21 7  
ATOM 11518 H HD22 . ASN A 1 52  ? 4.861   5.467   3.633   1.00 0.00 ? 72  ASN A HD22 7  
ATOM 11519 N N    . TYR A 1 53  ? 2.095   9.755   7.787   1.00 1.00 ? 73  TYR A N    7  
ATOM 11520 C CA   . TYR A 1 53  ? 1.250   9.669   8.976   1.00 1.00 ? 73  TYR A CA   7  
ATOM 11521 C C    . TYR A 1 53  ? 0.033   10.631  8.895   1.00 1.00 ? 73  TYR A C    7  
ATOM 11522 O O    . TYR A 1 53  ? -0.065  11.616  9.616   1.00 1.00 ? 73  TYR A O    7  
ATOM 11523 C CB   . TYR A 1 53  ? 2.223   9.889   10.150  1.00 1.00 ? 73  TYR A CB   7  
ATOM 11524 C CG   . TYR A 1 53  ? 1.760   9.667   11.570  1.00 1.00 ? 73  TYR A CG   7  
ATOM 11525 C CD1  . TYR A 1 53  ? 1.641   8.353   12.083  1.00 1.00 ? 73  TYR A CD1  7  
ATOM 11526 C CD2  . TYR A 1 53  ? 1.534   10.787  12.400  1.00 1.00 ? 73  TYR A CD2  7  
ATOM 11527 C CE1  . TYR A 1 53  ? 1.266   8.158   13.434  1.00 1.00 ? 73  TYR A CE1  7  
ATOM 11528 C CE2  . TYR A 1 53  ? 1.163   10.596  13.751  1.00 1.00 ? 73  TYR A CE2  7  
ATOM 11529 C CZ   . TYR A 1 53  ? 1.037   9.285   14.274  1.00 1.00 ? 73  TYR A CZ   7  
ATOM 11530 O OH   . TYR A 1 53  ? 0.735   9.112   15.586  1.00 1.00 ? 73  TYR A OH   7  
ATOM 11531 H H    . TYR A 1 53  ? 2.278   10.681  7.439   1.00 1.00 ? 73  TYR A H    7  
ATOM 11532 H HA   . TYR A 1 53  ? 0.850   8.656   9.077   1.00 1.00 ? 73  TYR A HA   7  
ATOM 11533 H HB2  . TYR A 1 53  ? 2.964   9.093   10.225  1.00 0.00 ? 73  TYR A HB2  7  
ATOM 11534 H HB3  . TYR A 1 53  ? 2.778   10.823  10.055  1.00 1.00 ? 73  TYR A HB3  7  
ATOM 11535 H HD1  . TYR A 1 53  ? 1.853   7.503   11.446  1.00 1.00 ? 73  TYR A HD1  7  
ATOM 11536 H HD2  . TYR A 1 53  ? 1.661   11.785  12.008  1.00 1.00 ? 73  TYR A HD2  7  
ATOM 11537 H HE1  . TYR A 1 53  ? 1.160   7.156   13.823  1.00 1.00 ? 73  TYR A HE1  7  
ATOM 11538 H HE2  . TYR A 1 53  ? 0.994   11.439  14.399  1.00 1.00 ? 73  TYR A HE2  7  
ATOM 11539 H HH   . TYR A 1 53  ? 0.874   8.212   15.865  1.00 1.00 ? 73  TYR A HH   7  
ATOM 11540 N N    . SER A 1 54  ? -0.901  10.317  7.974   1.00 1.00 ? 74  SER A N    7  
ATOM 11541 C CA   . SER A 1 54  ? -2.241  10.931  7.761   1.00 1.00 ? 74  SER A CA   7  
ATOM 11542 C C    . SER A 1 54  ? -2.266  12.428  7.355   1.00 1.00 ? 74  SER A C    7  
ATOM 11543 O O    . SER A 1 54  ? -2.641  13.270  8.174   1.00 1.00 ? 74  SER A O    7  
ATOM 11544 C CB   . SER A 1 54  ? -3.127  10.658  8.997   1.00 1.00 ? 74  SER A CB   7  
ATOM 11545 O OG   . SER A 1 54  ? -4.398  11.266  8.864   1.00 1.00 ? 74  SER A OG   7  
ATOM 11546 H H    . SER A 1 54  ? -0.650  9.511   7.417   1.00 1.00 ? 74  SER A H    7  
ATOM 11547 H HA   . SER A 1 54  ? -2.715  10.391  6.946   1.00 1.00 ? 74  SER A HA   7  
ATOM 11548 H HB2  . SER A 1 54  ? -3.265  9.582   9.107   1.00 0.00 ? 74  SER A HB2  7  
ATOM 11549 H HB3  . SER A 1 54  ? -2.635  11.062  9.886   1.00 1.00 ? 74  SER A HB3  7  
ATOM 11550 H HG   . SER A 1 54  ? -4.226  12.219  8.806   1.00 1.00 ? 74  SER A HG   7  
ATOM 11551 N N    . ALA A 1 55  ? -2.007  12.756  6.070   1.00 1.00 ? 75  ALA A N    7  
ATOM 11552 C CA   . ALA A 1 55  ? -2.098  14.143  5.555   1.00 1.00 ? 75  ALA A CA   7  
ATOM 11553 C C    . ALA A 1 55  ? -3.447  14.878  5.807   1.00 1.00 ? 75  ALA A C    7  
ATOM 11554 O O    . ALA A 1 55  ? -3.473  15.910  6.472   1.00 1.00 ? 75  ALA A O    7  
ATOM 11555 C CB   . ALA A 1 55  ? -1.742  14.142  4.067   1.00 1.00 ? 75  ALA A CB   7  
ATOM 11556 H H    . ALA A 1 55  ? -1.677  12.038  5.431   1.00 1.00 ? 75  ALA A H    7  
ATOM 11557 H HA   . ALA A 1 55  ? -1.333  14.725  6.075   1.00 1.00 ? 75  ALA A HA   7  
ATOM 11558 H HB1  . ALA A 1 55  ? -0.763  13.686  3.918   1.00 1.00 ? 75  ALA A HB1  7  
ATOM 11559 H HB2  . ALA A 1 55  ? -2.498  13.609  3.488   1.00 1.00 ? 75  ALA A HB2  7  
ATOM 11560 H HB3  . ALA A 1 55  ? -1.687  15.170  3.725   1.00 1.00 ? 75  ALA A HB3  7  
ATOM 11561 N N    . GLU A 1 56  ? -4.552  14.364  5.239   1.00 1.00 ? 76  GLU A N    7  
ATOM 11562 C CA   . GLU A 1 56  ? -5.961  14.780  5.406   1.00 1.00 ? 76  GLU A CA   7  
ATOM 11563 C C    . GLU A 1 56  ? -6.907  14.032  4.443   1.00 1.00 ? 76  GLU A C    7  
ATOM 11564 O O    . GLU A 1 56  ? -6.563  13.763  3.284   1.00 1.00 ? 76  GLU A O    7  
ATOM 11565 C CB   . GLU A 1 56  ? -6.175  16.300  5.209   1.00 1.00 ? 76  GLU A CB   7  
ATOM 11566 C CG   . GLU A 1 56  ? -7.607  16.715  5.596   1.00 1.00 ? 76  GLU A CG   7  
ATOM 11567 C CD   . GLU A 1 56  ? -8.409  17.346  4.458   1.00 1.00 ? 76  GLU A CD   7  
ATOM 11568 O OE1  . GLU A 1 56  ? -8.842  16.637  3.523   1.00 1.00 ? 76  GLU A OE1  7  
ATOM 11569 O OE2  . GLU A 1 56  ? -8.595  18.583  4.489   1.00 1.00 ? 76  GLU A OE2  7  
ATOM 11570 H H    . GLU A 1 56  ? -4.399  13.530  4.696   1.00 1.00 ? 76  GLU A H    7  
ATOM 11571 H HA   . GLU A 1 56  ? -6.244  14.539  6.434   1.00 1.00 ? 76  GLU A HA   7  
ATOM 11572 H HB2  . GLU A 1 56  ? -5.484  16.877  5.824   1.00 0.00 ? 76  GLU A HB2  7  
ATOM 11573 H HB3  . GLU A 1 56  ? -5.922  16.625  4.196   1.00 1.00 ? 76  GLU A HB3  7  
ATOM 11574 H HG2  . GLU A 1 56  ? -8.143  15.825  5.925   1.00 0.00 ? 76  GLU A HG2  7  
ATOM 11575 H HG3  . GLU A 1 56  ? -7.599  17.342  6.489   1.00 1.00 ? 76  GLU A HG3  7  
ATOM 11576 N N    . LEU A 1 57  ? -8.112  13.736  4.950   1.00 1.00 ? 77  LEU A N    7  
ATOM 11577 C CA   . LEU A 1 57  ? -9.263  13.225  4.246   1.00 1.00 ? 77  LEU A CA   7  
ATOM 11578 C C    . LEU A 1 57  ? -10.552 13.935  4.715   1.00 1.00 ? 77  LEU A C    7  
ATOM 11579 O O    . LEU A 1 57  ? -10.605 14.535  5.793   1.00 1.00 ? 77  LEU A O    7  
ATOM 11580 C CB   . LEU A 1 57  ? -9.270  11.691  4.379   1.00 1.00 ? 77  LEU A CB   7  
ATOM 11581 C CG   . LEU A 1 57  ? -9.596  10.884  5.643   1.00 1.00 ? 77  LEU A CG   7  
ATOM 11582 C CD1  . LEU A 1 57  ? -8.467  10.963  6.658   1.00 1.00 ? 77  LEU A CD1  7  
ATOM 11583 C CD2  . LEU A 1 57  ? -10.946 11.227  6.279   1.00 1.00 ? 77  LEU A CD2  7  
ATOM 11584 H H    . LEU A 1 57  ? -8.363  13.930  5.905   1.00 1.